2V77A

Crystal structure of human carboxypeptidase a1
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
308
structure length
308
Chain Sequence
ARSTDTFNYATYHTLEEIYDFLDLLVAENPHLVSKIQIGNTYEGRPIYVLKFSTGGSKRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLDIFLEIVTNPDGFAFTHSTNRMWRKTRSHTAGSLCIGVDPNRNWDAGFGLSGASSNPCSETYHGKFANSEVEVKSIVDFVKDHGNIKAFISIHSYSQLLMYPYGYKTEPVPDQDELDQLSKAAVTALASLYGTKFNYGSIIKAIYQASGSTIDWTYSQGIKYSFTFELRDTGRYGFLLPASQIIPTAKETWLALLTIMEHTLNHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBOXYPEPTIDASE A1
publication title Direct interaction between a human digestive protease and the mucoadhesive poly(acrylic acid).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 114
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature ec 3.4.17.1: Carboxypeptidase A.
pdb deposition date 2007-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2v77A00
2NSMA 1BPNA 1Y0RA 2O53A 2QYVA 1BAVA 4MXUA 4ZY0A 3WC7A 1M4LA 2BO9A 1TF8A 4MHNA 3S9MA 4NGQA 3I1UA 3TC8A 2J9AA 3H8GA 1TKHA 4ZYQA 1NSAA 4MHZA 4P4IA 3VH9A 3CT9A 4FWUA 3PFEA 4P4FA 2XEIA 3KZWA 3CDXA 4PXBA 3FMCA 1R3NA 1EE3P 2FVGA 3FVLA 2C1CA 2QVPA 1TKJA 1ZLHA 2BCOA 2ZEGA 6CPAA 3BI1A 4PXCA 3KHXA 3FECA 3KL9A 4UEFA 4A39A 2Q43A 3H8FA 2PIZA 3QNVA 4UEZA 2NYQA 8CPAA 1FNOA 1Q7LA 3D67A 3SI2A 1BPMA 1TF9A 4EMEA 2ZEFA 2PJ3A 3H8EA 4KSIA 3SI1A 4TWEA 5LYFA 3WABA 4YWYA 3GB0A 4NGNA 3RBUA 2PJ4A 4TNUA 1YW4A 4OKOA 2IMOA 3VATA 4F9VA 2PCUA 3NH8A 2C6GA 1TXRA 2PJCA 1ZG7A 3PB6X 5HXDA 1PCAA 2PVVA 2XEFA 4MCRA 4NGRA 2WYRA 3D7GA 3MRUA 1CP6A 4P4DA 3ISZA 2JBJA 1VHOA 4A37A 2ANPA 4OC4A 5CPAA 2GLFA 2PIYA 1HDQA 1CPXA 1YW6A 4PQAA 2BOAA 1Z5RA 3DLJA 1VHEA 3RZAA 3JRUA 4ZX9A 3L2NA 3PB4X 3KHZA 3PEIA 4AXVA 4OIDA 1ELMP 4B6ZA 1LAMA 3T8WA 4MMOA 4ONWA 3KGQA 2ZEDA 1YSJA 1CBXA 1VIXA 1RTQA 3D68A 3VARA 3PRTA 2ZEMA 4ZX8A 2GREA 4OC1A 1JQGA 5HVGA 4NGTA 4OP4A 2POKA 2GU2A 4F9UA 3HUVA 1VGYA 3NFZA 4NJQA 3SJGA 3IIBA 1H8LA 1CP7A 2AFXA 1AMPA 2V8VA 2C6CA 2CTBA 2C6PA 5K8PA 2V8DA 3FEDA 1Z2LA 3BHXA 4W9YA 5LRKA 4P6YA 4R76A 2PJAA 3K2KA 4YU9A 3LMSA 1CG2A 3PB9X 2ZEEA 3KASA 2XEGA 3KR5A 4UEEA 3WT4A 4CPAA 3SJFA 1F2PA 4P44A 2PJ5A 1ELLP 4DYOA 1R43A 2VL1A 2G9DA 4FBEA 4FUUA 4R6TA 3WC6A 3KI9A 1XJOA 2CIJA 2PJ1A 4FAIA 4NGSA 2PJBA 2RB7A 5THWA 1HEEA 3B3CA 2OR4A 3B3SA 4IAVA 3PB7X 1Z8LA 4P4BA 3B3WA 2V8HA 5J1QA 3IFEA 4R7MA 4EWTA 4OC3A 3PFOA 1LANA 4NGMA 4NGPA 2EWBA 3CPXA 3NH5A 2ABZA 1Y0YA 4MCQA 4A94A 3CPAA 2ZOGA 2HB6A 1LOKA 3GLJA 2Q4ZA 1DTDA 4JZ0A 4UIAA 2EK8A 4X3RA 2WZNA 3NH4A 4OC5A 5LRGA 2AFUA 2PE3A 4IK2A 1FT7A 3ISXA 2AFMA 1IGBA 2EK9A 1QQ9A 1F2OA 3KQZA 5JH9A 4H2KA 3IO1A 4X2TA 2OOTA 2JBKA 1Y7EA 4RUHA 4DJLA 3FH4A 1YLOA 3B7IA 2V77A 4UF4A 5I4MA 3K9TA 1IY7A 4R8FA 3NA6A 3MN8A 2GLJA 3B3VA 4JYWA 4MCPA 4UIBA 4ZY1A 2PJ9A 3S9NA 1XBUA 3D7DA 4P4JA 1ARMA 1LFWA 4DUKA 2RFHA 3B35A 3D7FA 1KWMA 4IHMA 1ZLIA 1ZG8A 3PB8X 2PJ7A 2DEAA 5ELYA 3LWUA 2ZEOA 4EFDA 2I3CA 2AFZA 5HVFA 5LYLA 3SI0A 2ZOFA 2PRQA 2HC9A 2AFOA 3SJEA 4ZY2A 3B2YA 2IQ6A 4Q7AA 1HDUA 5F09A 2IJZA 5JGFA 4OC0A 4MHYA 1OBRA 1XFOA 7CPAA 4MHPA 1BLLE 4OC2A 3IJ3A 3KR4A 1ARLA 2AFSA 3N5FA 2PJ2A 5LRJA 4P45A 2O4HA 2ZEHA 2QJ8A 2JEWA 2XEJA 1ZG9A 4O23A 5LYDA 3SJXA 3TX8A 1F57A 3FF3A 3B3TA 4GM5A 1QMUA 4F8ZA 2AFWA 2PJ8A 1PYTB 4X8IA 2ZEPA 1AYEA 2CF4A 2Q51A 4K3NA 3IEHA 5K8NA 4PXDA 4BD9A 3FX6A 4NFRA 3PBEA 1LAPA 4MCSA 2ZENA 5HVHA 4PPZA 4OMEA 4WWVA 3GUXA 5JM6A 3HLPA 2PJ0A 1LCPA 5D29A 3D7HA 5K8MA 5LYIA 1UWYA 4MRIA 4A38A 4ZI6A 3BI0A 3D4UA 2PVWA 5D8NA 3S9LA 1CPSA 3IC1A 3DGVA 3WC5A 5CBMA 4Z65A 4PXEA 4WJBA 2F8HA 3FJUA 3BXMA 4G1PA 4LQGA 1TKFA 1DE4C 5DS0A 3PBBA 4P10A 1XRYA 2F7VA 5K8OA 1XMBA 3D66A 4NJRA 3V38A 3RAMA 2V8GA 3IWWA 1GYTA 2ZELA 4P4EA 3V7ZA 1YMEA 3FEEA 5IB9A 2PJ6A 1CX8A 4OIWA 3KQXA 2CTCA
chains in the Genus database with same CATH superfamily
2NSMA 3SHPA 1BPNA 1CM0A 2PR8A 1Y0RA 2O53A 2QYVA 1R57A 3D2MA 1BAVA 2ZPAA 4MXUA 1IYKA 4UWIA 4ZY0A 2FE7A 4PK2A 4A32A 4CYNA 3WC7A 1M4LA 2BO9A 5C88A 1TF8A 4MHNA 3S9MA 4NGQA 2BSWA 2Z3NA 3BJ8A 3I1UA 3TC8A 2J9AA 3QB8A 3H8GA 4UA3A 1Q2YA 1TKHA 1YREA 5H84A 4ZYQA 1NSAA 3JTKA 5IV0A 1XF8A 3G3SA 4MHZA 1BO4A 4P4IA 4R9MA 3VH9A 4CS0B 3CT9A 2I00A 4FWUA 2R98A 4R3KA 2Q04A 2YGWA 5HH1A 3PFEA 4P4FA 2QECA 2XEIA 2YNCA 1WK4A 3KZWA 3CDXA 2PSWA 4HPSA 2B4DA 3FMCA 1QSOA 4PXBA 1R3NA 4RS2A 1EE3P 1TIQA 2FVGA 3FVLA 3LACA 2C1CA 4YRHA 4M6HA 2QVPA 4MFLA 1TKJA 4CYQA 1ZLHA 1X10A 3GKRA 1BOBA 2BCOA 2ZEGA 6CPAA 3BI1A 2CNMA 3KHXA 2R7HA 4PV6A 4PXCA 4GS4A 2PRBA 3FECA 3KL9A 4MFKA 5F46A 2O28A 2Q44A 2B5GA 3R9EA 2B3UA 1Z4EA 3FIXA 2B3VA 2WUUA 4UEFA 4A39A 4KOYA 2JDDA 4FD7A 2Q43A 3H8FA 3QAHA 2DF5A 2PIZA 4NEXA 1I21A 4CGOA 2Q0YA 2Q4VA 3QNVA 4UEZA 4C68A 1ZO0A 1ON0A 1Q2DA 2NYQA 4Y49C 4A2ZA 4CAVA 4KUAA 8CPAA 4KUBA 1M4DA 1LRZA 4KVXA 1FNOA 1Q7LA 4F6AA 4M85A 2EVNA 2PC1A 3D67A 3SI2A 4JXQA 2P0WA 1BPMA 1TF9A 3NE7A 4EMEA 3W91A 2VZYA 2ZEFA 3F5BA 2PJ3A 3H8EA 4KSIA 4MY0A 3IGRA 1V0CA 3SI1A 2Z3KA 4TWEA 1MK4A 5LYFA 3WABA 4YWYA 3GB0A 3FBUA 1NE9A 5IB0A 1AUGA 4NGNA 2GFQA 3RBUA 1XE4A 2QIRA 1QSNA 2PJ4A 4F0YA 1YVOA 2P6FA 1Y9WA 1YW4A 4LUAA 4TNUA 4OKOA 5E96A 3DR8A 2IMOA 3CXQA 4ONUA 3VATA 2PCUA 2OB0A 3NH8A 4RN7A 4F9VA 2C6GA 1TXRA 2YNCC 2ARHA 2PJCA 1ZG7A 3PB6X 4ORFA 5HXDA 1PCAA 2PVVA 2XEFA 4MCRA 4NGRA 1RXTA 1VHSA 2BL1A 2P6GA 2WYRA 4B10A 3D7GA 3MRUA 5C82A 1CP6A 4P4DA 3ISZA 2Q7SA 2JBJA 5AG6A 4CYPA 3E0KA 1VHOA 1P4NA 2B4BA 2RC4A 2OU2A 4E8OA 4A37A 2ANPA 1J4JA 4OC4A 5CPAA 2GLFA 2PIYA 2Z3PA 1HDQA 4PSXA 1CPXA 4QBJA 5F49A 2Y0MA 2CY2A 4IUSA 4KOTA 1S5KA 1YW6A 4PQAA 2BOAA 1Z5RA 3DLJA 1OZPA 3BJ7A 1VHEA 3JVNA 3EFAA 4JXRA 3JRUA 3RZAA 4OADA 3TT2A 4ZX9A 3P2FA 3IU1A 3L2NA 3PB4X 4FD6A 3KHZA 1IYLA 3PEIA 4U9ZA 2K5TA 4AXVA 1QSMA 3CZXA 4OIDA 3TOBA 4R3LA 1ELMP 4CAWA 4B6ZA 3H5ZA 4A33A 4XPKA 1LAMA 4UWJA 3GY9A 4MMOA 4ONWA 3T8WA 3KGQA 4FD5A 5ISVA 2ZEDA 1YK3A 4CAFA 1IB1E 1CBXA 1VIXA 1YSJA 3PP9A 2Q7BA 1RTQA 2CXAA 5EMIA 3D68A 3VARA 5CNPA 3PRTA 2ZEMA 4ZX8A 2GREA 3TE4A 2EBJA 1I1DA 4OC1A 1JQGA 5HVGA 4NGTA 4OP4A 2HV2A 2POKA 5A28A 5J8FA 4CAEA 3G8WA 4C7IA 2GU2A 3I9SA 4F9UA 1B6BA 4HNYB 2Z3MA 3F8KA 3DDDA 1YR0A 3HUVA 4KOXA 1VGYA 2ZXVA 3NFZA 4NJQA 4AVAA 3EY5A 5F48A 4KSAA 3KKWA 3SJGA 4UCNA 1CJWA 2FT0A 3IIBA 2OZUA 1H8LA 4NSQA 4CRYB 1CP7A 4A31A 4HNWB 2AFXA 1AMPA 2ODFA 3S6GA 2V8VA 1K4JA 3ZZIA 1S7NA 4B5OA 4AVBA 2Z3LA 2C6CA 2CTBA 2C6PA 5K8PA 2WSAA 3EO4A 2V8DA 3FEDA 4B11A 1Z2LA 3BHXA 2FSRA 4W9YA 4HKFA 5LRKA 4P6YA 4R76A 2PJAA 3K2KA 3IWGA 4YU9A 3LMSA 3GIUA 1CG2A 2HQYA 5F47A 3PB9X 3T90A 1B87A 2ZEEA 3KASA 4XPDC 1IOFA 3TO9A 2WPWA 1KZFA 2REFA 2XEGA 4LQ6A 3KR5A 4UEEA 3WT4A 4UCMA 2OZGA 1Y9KA 4CPAA 3SJFA 2F5IA 1F2PA 3CXPA 4P44A 5IX3A 2PJ5A 4QUSA 1ELLP 1PUAA 1IIDA 4DYOA 5JPHA 1R43A 1JWQA 3D8PA 2VL1A 3FXTA 4XPDB 3S6FA 4UFXA 5DWMA 2G9DA 4B14A 4FBEA 2B58A 1X12A 4KORA 4KZTA 4BBHA 4FUUA 4UFVA 1QSTA 4R6TA 3GYAA 2R8VA 1RO5A 3WC6A 3KI9A 4DNCA 2FXFA 1XJOA 2CIJA 2PJ1A 1IU8A 4C2YA 4FAIA 4NGSA 2PJBA 4CYOA 4L89A 2RB7A 4OLLA 5THWA 3VWDA 1HEEA 3B3CA 2OR4A 3B3SA 4MI4A 4IAVA 4AG7A 2PDOA 3PB7X 3S6KA 1Z8LA 4P4BA 3B3WA 5AG4A 2V8HA 5J1QA 4XNHB 3IFEA 2Z0ZA 1I12A 4KS9A 4R7MA 5G22A 2JLMA 4AVCA 3N7ZA 4KSFA 3FB3A 4EWTA 1S7FA 4OC3A 1Z8WA 1LANA 1Q2CA 2J8NA 3K9UA 3PFOA 4KVOE 4NGMA 4NGPA 3WR7A 2EWBA 2I79A 1S7KA 1A2ZA 2BUEA 3CPXA 3NH5A 3R95A 4U9YA 2ABZA 5J8CA 5JQ4A 1Y0YA 4MFQA 4MCQA 4A94A 2HUZA 3CPAA 4CGPA 2ZOGA 2HB6A 1LOKA 3W6XA 3GLJA 2Q4ZA 4J3GA 1DTDA 1XMTA 4JZ0A 5EC4A 4K30A 4UIAA 4L8AA 1L0CA 3A9LA 2EK8A 5H86A 4X3RA 4RI1A 1VKCA 2ATRA 4QB9A 4CGLA 2WZNA 3NH4A 4OC5A 5LRGA 2EUIA 2AFUA 2PE3A 4IK2A 1FT7A 3ISXA 2AFMA 1IGBA 2EK9A 2REEA 4IF5A 1M1DA 1QQ9A 3C26A 4MY3A 4A95A 1F2OA 3KQZA 2PQ8A 5JH9A 4H2KA 3IO1A 4R87A 5DWNA 2VZZA 4X2TA 2OOTA 2JBKA 1Y7EA 1FY7A 2IL4A 4RUHA 3D2PA 4DJLA 4PK3A 4AB7A 2G0BA 4NXYA 3V8IA 3FH4A 3ZJ0A 4H89A 1YLOA 3B7IA 3F0AA 3RYOA 4MBUA 4MJ8A 4BINA 1S7LA 1XOVA 1Z4RA 2OZHA 4UFWA 5AG7A 4C2ZA 2V77A 2WPXA 3FNCA 2DPTA 2G3AA 2Z11A 3MGDA 1XEBA 5HMNA 5KTAA 4UF4A 5I4MA 3K9TA 1IY7A 1YGHA 4R8FA 4B5PB 3NA6A 3S6HA 4UCPA 2ZW6A 5G1ZA 3MN8A 1N71A 2GLJA 3B3VA 4QC6A 4JYWA 1WWZA 4EVYA 4C2XA 4MCPA 1GHEA 2Z10A 4UIBA 4ZY1A 4JJXA 2PJ9A 3EC4A 3S9NA 1Z8XA 1XBUA 2BEIA 3D7DA 5GCNA 4P4JA 4MFPA 5AGEA 5EBVA 1ARMA 1LFWA 4JLYA 4DUKA 3SXOA 2RFHA 3B35A 3D7FA 1KWMA 4IHMA 1ZLIA 1ZG8A 1KUVA 2PJ7A 3PB8X 2R1IA 3IU2A 1MJBA 2AJ6A 1SQHA 2DEAA 4R57A 2FIAA 5ELYA 2EO8A 3LWUA 2VBQA 2ZEOA 4H6UA 4EFDA 2D4OA 2I3CA 2AFZA 3DSBA 4FD4A 5HVFA 2FIWA 4E0AA 1S3ZA 2FCKA 5LYLA 4CGNA 1NSLA 2GANA 1M4GA 1QSRA 2VI7A 4ZGYB 3SI0A 2AE6A 2ZOFA 2PRQA 2HC9A 1YVKA 2AFOA 4NF1A 3SJEA 4ZY2A 3B2YA 2IQ6A 4KOUA 1M44A 1HDUA 2H5MA 4Q7AA 5F09A 4Q38A 2IJZA 5JGFA 2VEZA 4OC0A 4B13A 2JDCA 4MHYA 1OBRA 1PU9A 1XFOA 7CPAA 3IWEA 4MHPA 3TCVA 1BLLE 4OC2A 3IJ3A 3KR4A 1ARLA 2AFSA 3RO0A 1KUYA 3QAYA 3N5FA 2PJ2A 3DR6A 5LRJA 4P45A 4UBRA 2O4HA 2X7BA 1MJ9A 2P6EA 4B5PA 3RNZA 4YFJA 2J8MA 4XNHC 2G3TA 1MJAA 2DXQA 2ZEHA 2QJ8A 2JEWA 2XEJA 1ZG9A 3LODA 2PR1A 3BLNA 4O23A 1S60A 2QMLA 3TFYA 5LYDA 3SJXA 3TX8A 1F57A 3FF3A 2D4PA 3B3TA 4GM5A 1IICA 1QMUA 4F8ZA 1XIXA 5KTCA 5A27A 2ZW7A 2AFWA 2J8RA 2PJ8A 4H6ZA 4CRZB 5I0CA 1IOIA 1PYTB 1Z9UA 4X8IA 2ZEPA 1AYEA 4I49A 4YGOA 2CF4A 2CNTA 3R1KA 3T9YA 4F0XA 2Q51A 4K3NA 3IEHA 4MFJA 3UY5A 3PGPA 3P2HA 5K8NA 2A4NA 2VQYA 4PXDA 4C7HA 4BD9A 2JEVA 2C27A 1KUXA 3FX6A 4NFRA 4KOVA 5G21A 4B12A 4CAXA 3PBEA 2NMTA 3B8GA 3TTHA 1Z8TA 1LAPA 3EXNA 2CNSA 4MCSA 2ZENA 5HVHA 3H4QA 4HNXB 4KVME 4PPZA 4OMEA 4WWVA 5AG5A 3CXSA 1M4IA 4Y49B 4BMHA 3GUXA 4CGMA 1NMTA 5JM6A 4E2AA 3HLPA 3OWCA 2PJ0A 1LCPA 5D29A 3D7HA 5K8MA 4M6GA 1U6MA 5LYIA 1UWYA 4MRIA 4Q36A 3TO6A 3BI0A 3R9GA 4A38A 4ZI6A 5BWAB 3PZJA 3D4UA 2GIVA 2PVWA 4ZBGA 5D8NA 5KTDA 3LD2A 2KCWA 1CPSA 4AG9A 3S9LA 3NE8A 3IC1A 3DGVA 3WC5A 5CBMA 4Z65A 4NCZA 1YX0A 4PXEA 4WJBA 4X5KA 2F8HA 5G20A 3FJUA 3BXMA 2FL4A 4G1PA 4LQGA 4OAEA 4PSWA 3DNSA 1TKFA 2Q4YA 3JUWA 1DE4C 2DPSA 3PBBA 4MHDA 5DS0A 4KOWA 2OH1A 4P10A 2Z3OA 1XRYA 4M3SA 2F7VA 5K8OA 3R96A 1UFHA 1XMBA 2B4DB 4LX9A 4KLWA 3D66A 5FVJA 4NJRA 2GE3A 4JWPA 1Y7RA 3V38A 4II9A 2VXKA 3FRMA 4QVTA 3SXNA 4XPLA 3RAMA 3W6SA 2V8GA 3IWWA 2ZW5A 1GYTA 3TO7A 2ZELA 4P4EA 3FYNA 3I3GA 3V7ZA 4JD6A 2B5GB 1YMEA 2YNEA 3FEEA 3R9FA 5IB9A 3D3SA 2FS5A 2PJ6A 4A30A 4MFZA 4M6IA 4KOSA 1P0HA 1YLEA 3VWEA 2ZW4A 2YNDA 1CX8A 4GXHA 4KLVA 4OIWA 1YQEA 3KQXA 4U5YA 2CTCA 3TOAA
chains in the Genus database with same CATH topology
2NSMA 1BPNA 1Y0RA 2O53A 2QYVA 1BAVA 4MXUA 4ZY0A 3WC7A 1M4LA 2BO9A 1TF8A 4MHNA 3S9MA 4NGQA 3I1UA 3TC8A 2J9AA 3H8GA 1TKHA 4ZYQA 1NSAA 4MHZA 4P4IA 3VH9A 3CT9A 4FWUA 3PFEA 4P4FA 2XEIA 3KZWA 3CDXA 4PXBA 3FMCA 1R3NA 1EE3P 2FVGA 3FVLA 2C1CA 2QVPA 1TKJA 1ZLHA 2BCOA 2ZEGA 6CPAA 3BI1A 4PXCA 3KHXA 3FECA 3KL9A 4UEFA 4A39A 2Q43A 3H8FA 2PIZA 3QNVA 4UEZA 2NYQA 8CPAA 1FNOA 1Q7LA 3D67A 3SI2A 1BPMA 1TF9A 4EMEA 2ZEFA 2PJ3A 3H8EA 4KSIA 3SI1A 4TWEA 5LYFA 3WABA 4YWYA 3GB0A 4NGNA 3RBUA 2PJ4A 4TNUA 1YW4A 4OKOA 2IMOA 3VATA 4F9VA 2PCUA 3NH8A 2C6GA 1TXRA 2PJCA 1ZG7A 3PB6X 5HXDA 1PCAA 2PVVA 2XEFA 4MCRA 4NGRA 2WYRA 3D7GA 3MRUA 1CP6A 4P4DA 3ISZA 2JBJA 1VHOA 4A37A 2ANPA 4OC4A 5CPAA 2GLFA 2PIYA 1HDQA 1CPXA 1YW6A 4PQAA 2BOAA 1Z5RA 3DLJA 1VHEA 3RZAA 3JRUA 4ZX9A 3L2NA 3PB4X 3KHZA 3PEIA 4AXVA 4OIDA 1ELMP 4B6ZA 1LAMA 3T8WA 4MMOA 4ONWA 3KGQA 2ZEDA 1YSJA 1CBXA 1VIXA 1RTQA 3D68A 3VARA 3PRTA 2ZEMA 4ZX8A 2GREA 4OC1A 1JQGA 5HVGA 4NGTA 4OP4A 2POKA 2GU2A 4F9UA 3HUVA 1VGYA 3NFZA 4NJQA 3SJGA 3IIBA 1H8LA 1CP7A 2AFXA 1AMPA 2V8VA 2C6CA 2CTBA 2C6PA 5K8PA 2V8DA 3FEDA 1Z2LA 3BHXA 4W9YA 5LRKA 4P6YA 4R76A 2PJAA 3K2KA 4YU9A 3LMSA 1CG2A 3PB9X 2ZEEA 3KASA 2XEGA 3KR5A 4UEEA 3WT4A 4CPAA 3SJFA 1F2PA 4P44A 2PJ5A 1ELLP 4DYOA 1R43A 2VL1A 2G9DA 4FBEA 4FUUA 4R6TA 3WC6A 3KI9A 1XJOA 2CIJA 2PJ1A 4FAIA 4NGSA 2PJBA 2RB7A 5THWA 1HEEA 3B3CA 2OR4A 3B3SA 4IAVA 3PB7X 1Z8LA 4P4BA 3B3WA 2V8HA 5J1QA 3IFEA 4R7MA 4EWTA 4OC3A 3PFOA 1LANA 4NGMA 4NGPA 2EWBA 3CPXA 3NH5A 2ABZA 1Y0YA 4MCQA 4A94A 3CPAA 2ZOGA 2HB6A 1LOKA 3GLJA 2Q4ZA 1DTDA 4JZ0A 4UIAA 2EK8A 4X3RA 2WZNA 3NH4A 4OC5A 5LRGA 2AFUA 2PE3A 4IK2A 1FT7A 3ISXA 2AFMA 1IGBA 2EK9A 1QQ9A 1F2OA 3KQZA 5JH9A 4H2KA 3IO1A 4X2TA 2OOTA 2JBKA 1Y7EA 4RUHA 4DJLA 3FH4A 1YLOA 3B7IA 2V77A 4UF4A 5I4MA 3K9TA 1IY7A 4R8FA 3NA6A 3MN8A 2GLJA 3B3VA 4JYWA 4MCPA 4UIBA 4ZY1A 2PJ9A 3S9NA 1XBUA 3D7DA 4P4JA 1ARMA 1LFWA 4DUKA 2RFHA 3B35A 3D7FA 1KWMA 4IHMA 1ZLIA 1ZG8A 3PB8X 2PJ7A 2DEAA 5ELYA 3LWUA 2ZEOA 4EFDA 2I3CA 2AFZA 5HVFA 5LYLA 3SI0A 2ZOFA 2PRQA 2HC9A 2AFOA 3SJEA 4ZY2A 3B2YA 2IQ6A 4Q7AA 1HDUA 5F09A 2IJZA 5JGFA 4OC0A 4MHYA 1OBRA 1XFOA 7CPAA 4MHPA 1BLLE 4OC2A 3IJ3A 3KR4A 1ARLA 2AFSA 3N5FA 2PJ2A 5LRJA 4P45A 2O4HA 2ZEHA 2QJ8A 2JEWA 2XEJA 1ZG9A 4O23A 5LYDA 3SJXA 3TX8A 1F57A 3FF3A 3B3TA 4GM5A 1QMUA 4F8ZA 2AFWA 2PJ8A 1PYTB 4X8IA 2ZEPA 1AYEA 2CF4A 2Q51A 4K3NA 3IEHA 5K8NA 4PXDA 4BD9A 3FX6A 4NFRA 3PBEA 1LAPA 4MCSA 2ZENA 5HVHA 4PPZA 4OMEA 4WWVA 3GUXA 5JM6A 3HLPA 2PJ0A 1LCPA 5D29A 3D7HA 5K8MA 5LYIA 1UWYA 4MRIA 4A38A 4ZI6A 3BI0A 3D4UA 2PVWA 5D8NA 3S9LA 1CPSA 3IC1A 3DGVA 3WC5A 5CBMA 4Z65A 4PXEA 4WJBA 2F8HA 3FJUA 3BXMA 4G1PA 4LQGA 1TKFA 1DE4C 5DS0A 3PBBA 4P10A 1XRYA 2F7VA 5K8OA 1XMBA 3D66A 4NJRA 3V38A 3RAMA 2V8GA 3IWWA 1GYTA 2ZELA 4P4EA 3V7ZA 1YMEA 3FEEA 5IB9A 2PJ6A 1CX8A 4OIWA 3KQXA 2CTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NSM A;  1BPN A;  1Y0R A;  2O53 A;  2QYV A;  1BAV A;  4MXU A;  4ZY0 A;  3WC7 A;  1M4L A;  2BO9 A;  1TF8 A;  4MHN A;  3S9M A;  4NGQ A;  3I1U A;  3TC8 A;  2J9A A;  3H8G A;  1TKH A;  4ZYQ A;  1NSA A;  4MHZ A;  4P4I A;  3VH9 A;  3CT9 A;  4FWU A;  3PFE A;  4P4F A;  2XEI A;  3KZW A;  3CDX A;  4PXB A;  3FMC A;  1R3N A;  1EE3 P;  2FVG A;  3FVL A;  2C1C A;  2QVP A;  1TKJ A;  1ZLH A;  2BCO A;  2ZEG A;  6CPA A;  3BI1 A;  4PXC A;  3KHX A;  3FEC A;  3KL9 A;  4UEF A;  4A39 A;  2Q43 A;  3H8F A;  2PIZ A;  3QNV A;  4UEZ A;  2NYQ A;  8CPA A;  1FNO A;  1Q7L A;  3D67 A;  3SI2 A;  1BPM A;  1TF9 A;  4EME A;  2ZEF A;  2PJ3 A;  3H8E A;  4KSI A;  3SI1 A;  4TWE A;  5LYF A;  3WAB A;  4YWY A;  3GB0 A;  4NGN A;  3RBU A;  2PJ4 A;  4TNU A;  1YW4 A;  4OKO A;  2IMO A;  3VAT A;  4F9V A;  2PCU A;  3NH8 A;  2C6G A;  1TXR A;  2PJC A;  1ZG7 A;  3PB6 X;  5HXD A;  1PCA A;  2PVV A;  2XEF A;  4MCR A;  4NGR A;  2WYR A;  3D7G A;  3MRU A;  1CP6 A;  4P4D A;  3ISZ A;  2JBJ A;  1VHO A;  4A37 A;  2ANP A;  4OC4 A;  5CPA A;  2GLF A;  2PIY A;  1HDQ A;  1CPX A;  1YW6 A;  4PQA A;  2BOA A;  1Z5R A;  3DLJ A;  1VHE A;  3RZA A;  3JRU A;  4ZX9 A;  3L2N A;  3PB4 X;  3KHZ A;  3PEI A;  4AXV A;  4OID A;  1ELM P;  4B6Z A;  1LAM A;  3T8W A;  4MMO A;  4ONW A;  3KGQ A;  2ZED A;  1YSJ A;  1CBX A;  1VIX A;  1RTQ A;  3D68 A;  3VAR A;  3PRT A;  2ZEM A;  4ZX8 A;  2GRE A;  4OC1 A;  1JQG A;  5HVG A;  4NGT A;  4OP4 A;  2POK A;  2GU2 A;  4F9U A;  3HUV A;  1VGY A;  3NFZ A;  4NJQ A;  3SJG A;  3IIB A;  1H8L A;  1CP7 A;  2AFX A;  1AMP A;  2V8V A;  2C6C A;  2CTB A;  2C6P A;  5K8P A;  2V8D A;  3FED A;  1Z2L A;  3BHX A;  4W9Y A;  5LRK A;  4P6Y A;  4R76 A;  2PJA A;  3K2K A;  4YU9 A;  3LMS A;  1CG2 A;  3PB9 X;  2ZEE A;  3KAS A;  2XEG A;  3KR5 A;  4UEE A;  3WT4 A;  4CPA A;  3SJF A;  1F2P A;  4P44 A;  2PJ5 A;  1ELL P;  4DYO A;  1R43 A;  2VL1 A;  2G9D A;  4FBE A;  4FUU A;  4R6T A;  3WC6 A;  3KI9 A;  1XJO A;  2CIJ A;  2PJ1 A;  4FAI A;  4NGS A;  2PJB A;  2RB7 A;  5THW A;  1HEE A;  3B3C A;  2OR4 A;  3B3S A;  4IAV A;  3PB7 X;  1Z8L A;  4P4B A;  3B3W A;  2V8H A;  5J1Q A;  3IFE A;  4R7M A;  4EWT A;  4OC3 A;  3PFO A;  1LAN A;  4NGM A;  4NGP A;  2EWB A;  3CPX A;  3NH5 A;  2ABZ A;  1Y0Y A;  4MCQ A;  4A94 A;  3CPA A;  2ZOG A;  2HB6 A;  1LOK A;  3GLJ A;  2Q4Z A;  1DTD A;  4JZ0 A;  4UIA A;  2EK8 A;  4X3R A;  2WZN A;  3NH4 A;  4OC5 A;  5LRG A;  2AFU A;  2PE3 A;  4IK2 A;  1FT7 A;  3ISX A;  2AFM A;  1IGB A;  2EK9 A;  1QQ9 A;  1F2O A;  3KQZ A;  5JH9 A;  4H2K A;  3IO1 A;  4X2T A;  2OOT A;  2JBK A;  1Y7E A;  4RUH A;  4DJL A;  3FH4 A;  1YLO A;  3B7I A;  2V77 A;  4UF4 A;  5I4M A;  3K9T A;  1IY7 A;  4R8F A;  3NA6 A;  3MN8 A;  2GLJ A;  3B3V A;  4JYW A;  4MCP A;  4UIB A;  4ZY1 A;  2PJ9 A;  3S9N A;  1XBU A;  3D7D A;  4P4J A;  1ARM A;  1LFW A;  4DUK A;  2RFH A;  3B35 A;  3D7F A;  1KWM A;  4IHM A;  1ZLI A;  1ZG8 A;  3PB8 X;  2PJ7 A;  2DEA A;  5ELY A;  3LWU A;  2ZEO A;  4EFD A;  2I3C A;  2AFZ A;  5HVF A;  5LYL A;  3SI0 A;  2ZOF A;  2PRQ A;  2HC9 A;  2AFO A;  3SJE A;  4ZY2 A;  3B2Y A;  2IQ6 A;  4Q7A A;  1HDU A;  5F09 A;  2IJZ A;  5JGF A;  4OC0 A;  4MHY A;  1OBR A;  1XFO A;  7CPA A;  4MHP A;  1BLL E;  4OC2 A;  3IJ3 A;  3KR4 A;  1ARL A;  2AFS A;  3N5F A;  2PJ2 A;  5LRJ A;  4P45 A;  2O4H A;  2ZEH A;  2QJ8 A;  2JEW A;  2XEJ A;  1ZG9 A;  4O23 A;  5LYD A;  3SJX A;  3TX8 A;  1F57 A;  3FF3 A;  3B3T A;  4GM5 A;  1QMU A;  4F8Z A;  2AFW A;  2PJ8 A;  1PYT B;  4X8I A;  2ZEP A;  1AYE A;  2CF4 A;  2Q51 A;  4K3N A;  3IEH A;  5K8N A;  4PXD A;  4BD9 A;  3FX6 A;  4NFR A;  3PBE A;  1LAP A;  4MCS A;  2ZEN A;  5HVH A;  4PPZ A;  4OME A;  4WWV A;  3GUX A;  5JM6 A;  3HLP A;  2PJ0 A;  1LCP A;  5D29 A;  3D7H A;  5K8M A;  5LYI A;  1UWY A;  4MRI A;  4A38 A;  4ZI6 A;  3BI0 A;  3D4U A;  2PVW A;  5D8N A;  3S9L A;  1CPS A;  3IC1 A;  3DGV A;  3WC5 A;  5CBM A;  4Z65 A;  4PXE A;  4WJB A;  2F8H A;  3FJU A;  3BXM A;  4G1P A;  4LQG A;  1TKF A;  1DE4 C;  5DS0 A;  3PBB A;  4P10 A;  1XRY A;  2F7V A;  5K8O A;  1XMB A;  3D66 A;  4NJR A;  3V38 A;  3RAM A;  2V8G A;  3IWW A;  1GYT A;  2ZEL A;  4P4E A;  3V7Z A;  1YME A;  3FEE A;  5IB9 A;  2PJ6 A;  1CX8 A;  4OIW A;  3KQX A;  2CTC A; 
#chains in the Genus database with same CATH topology
 2NSM A;  3SHP A;  1BPN A;  1CM0 A;  2PR8 A;  1Y0R A;  2O53 A;  2QYV A;  1R57 A;  3D2M A;  1BAV A;  2ZPA A;  4MXU A;  1IYK A;  4UWI A;  4ZY0 A;  2FE7 A;  4PK2 A;  4A32 A;  4CYN A;  3WC7 A;  1M4L A;  2BO9 A;  5C88 A;  1TF8 A;  4MHN A;  3S9M A;  4NGQ A;  2BSW A;  2Z3N A;  3BJ8 A;  3I1U A;  3TC8 A;  2J9A A;  3QB8 A;  3H8G A;  4UA3 A;  1Q2Y A;  1TKH A;  1YRE A;  5H84 A;  4ZYQ A;  1NSA A;  3JTK A;  5IV0 A;  1XF8 A;  3G3S A;  4MHZ A;  1BO4 A;  4P4I A;  4R9M A;  3VH9 A;  4CS0 B;  3CT9 A;  2I00 A;  4FWU A;  2R98 A;  4R3K A;  2Q04 A;  2YGW A;  5HH1 A;  3PFE A;  4P4F A;  2QEC A;  2XEI A;  2YNC A;  1WK4 A;  3KZW A;  3CDX A;  2PSW A;  4HPS A;  2B4D A;  3FMC A;  1QSO A;  4PXB A;  1R3N A;  4RS2 A;  1EE3 P;  1TIQ A;  2FVG A;  3FVL A;  3LAC A;  2C1C A;  4YRH A;  4M6H A;  2QVP A;  4MFL A;  1TKJ A;  4CYQ A;  1ZLH A;  1X10 A;  3GKR A;  1BOB A;  2BCO A;  2ZEG A;  6CPA A;  3BI1 A;  2CNM A;  3KHX A;  2R7H A;  4PV6 A;  4PXC A;  4GS4 A;  2PRB A;  3FEC A;  3KL9 A;  4MFK A;  5F46 A;  2O28 A;  2Q44 A;  2B5G A;  3R9E A;  2B3U A;  1Z4E A;  3FIX A;  2B3V A;  2WUU A;  4UEF A;  4A39 A;  4KOY A;  2JDD A;  4FD7 A;  2Q43 A;  3H8F A;  3QAH A;  2DF5 A;  2PIZ A;  4NEX A;  1I21 A;  4CGO A;  2Q0Y A;  2Q4V A;  3QNV A;  4UEZ A;  4C68 A;  1ZO0 A;  1ON0 A;  1Q2D A;  2NYQ A;  4Y49 C;  4A2Z A;  4CAV A;  4KUA A;  8CPA A;  4KUB A;  1M4D A;  1LRZ A;  4KVX A;  1FNO A;  1Q7L A;  4F6A A;  4M85 A;  2EVN A;  2PC1 A;  3D67 A;  3SI2 A;  4JXQ A;  2P0W A;  1BPM A;  1TF9 A;  3NE7 A;  4EME A;  3W91 A;  2VZY A;  2ZEF A;  3F5B A;  2PJ3 A;  3H8E A;  4KSI A;  4MY0 A;  3IGR A;  1V0C A;  3SI1 A;  2Z3K A;  4TWE A;  1MK4 A;  5LYF A;  3WAB A;  4YWY A;  3GB0 A;  3FBU A;  1NE9 A;  5IB0 A;  1AUG A;  4NGN A;  2GFQ A;  3RBU A;  1XE4 A;  2QIR A;  1QSN A;  2PJ4 A;  4F0Y A;  1YVO A;  2P6F A;  1Y9W A;  1YW4 A;  4LUA A;  4TNU A;  4OKO A;  5E96 A;  3DR8 A;  2IMO A;  3CXQ A;  4ONU A;  3VAT A;  2PCU A;  2OB0 A;  3NH8 A;  4RN7 A;  4F9V A;  2C6G A;  1TXR A;  2YNC C;  2ARH A;  2PJC A;  1ZG7 A;  3PB6 X;  4ORF A;  5HXD A;  1PCA A;  2PVV A;  2XEF A;  4MCR A;  4NGR A;  1RXT A;  1VHS A;  2BL1 A;  2P6G A;  2WYR A;  4B10 A;  3D7G A;  3MRU A;  5C82 A;  1CP6 A;  4P4D A;  3ISZ A;  2Q7S A;  2JBJ A;  5AG6 A;  4CYP A;  3E0K A;  1VHO A;  1P4N A;  2B4B A;  2RC4 A;  2OU2 A;  4E8O A;  4A37 A;  2ANP A;  1J4J A;  4OC4 A;  5CPA A;  2GLF A;  2PIY A;  2Z3P A;  1HDQ A;  4PSX A;  1CPX A;  4QBJ A;  5F49 A;  2Y0M A;  2CY2 A;  4IUS A;  4KOT A;  1S5K A;  1YW6 A;  4PQA A;  2BOA A;  1Z5R A;  3DLJ A;  1OZP A;  3BJ7 A;  1VHE A;  3JVN A;  3EFA A;  4JXR A;  3JRU A;  3RZA A;  4OAD A;  3TT2 A;  4ZX9 A;  3P2F A;  3IU1 A;  3L2N A;  3PB4 X;  4FD6 A;  3KHZ A;  1IYL A;  3PEI A;  4U9Z A;  2K5T A;  4AXV A;  1QSM A;  3CZX A;  4OID A;  3TOB A;  4R3L A;  1ELM P;  4CAW A;  4B6Z A;  3H5Z A;  4A33 A;  4XPK A;  1LAM A;  4UWJ A;  3GY9 A;  4MMO A;  4ONW A;  3T8W A;  3KGQ A;  4FD5 A;  5ISV A;  2ZED A;  1YK3 A;  4CAF A;  1IB1 E;  1CBX A;  1VIX A;  1YSJ A;  3PP9 A;  2Q7B A;  1RTQ A;  2CXA A;  5EMI A;  3D68 A;  3VAR A;  5CNP A;  3PRT A;  2ZEM A;  4ZX8 A;  2GRE A;  3TE4 A;  2EBJ A;  1I1D A;  4OC1 A;  1JQG A;  5HVG A;  4NGT A;  4OP4 A;  2HV2 A;  2POK A;  5A28 A;  5J8F A;  4CAE A;  3G8W A;  4C7I A;  2GU2 A;  3I9S A;  4F9U A;  1B6B A;  4HNY B;  2Z3M A;  3F8K A;  3DDD A;  1YR0 A;  3HUV A;  4KOX A;  1VGY A;  2ZXV A;  3NFZ A;  4NJQ A;  4AVA A;  3EY5 A;  5F48 A;  4KSA A;  3KKW A;  3SJG A;  4UCN A;  1CJW A;  2FT0 A;  3IIB A;  2OZU A;  1H8L A;  4NSQ A;  4CRY B;  1CP7 A;  4A31 A;  4HNW B;  2AFX A;  1AMP A;  2ODF A;  3S6G A;  2V8V A;  1K4J A;  3ZZI A;  1S7N A;  4B5O A;  4AVB A;  2Z3L A;  2C6C A;  2CTB A;  2C6P A;  5K8P A;  2WSA A;  3EO4 A;  2V8D A;  3FED A;  4B11 A;  1Z2L A;  3BHX A;  2FSR A;  4W9Y A;  4HKF A;  5LRK A;  4P6Y A;  4R76 A;  2PJA A;  3K2K A;  3IWG A;  4YU9 A;  3LMS A;  3GIU A;  1CG2 A;  2HQY A;  5F47 A;  3PB9 X;  3T90 A;  1B87 A;  2ZEE A;  3KAS A;  4XPD C;  1IOF A;  3TO9 A;  2WPW A;  1KZF A;  2REF A;  2XEG A;  4LQ6 A;  3KR5 A;  4UEE A;  3WT4 A;  4UCM A;  2OZG A;  1Y9K A;  4CPA A;  3SJF A;  2F5I A;  1F2P A;  3CXP A;  4P44 A;  5IX3 A;  2PJ5 A;  4QUS A;  1ELL P;  1PUA A;  1IID A;  4DYO A;  5JPH A;  1R43 A;  1JWQ A;  3D8P A;  2VL1 A;  3FXT A;  4XPD B;  3S6F A;  4UFX A;  5DWM A;  2G9D A;  4B14 A;  4FBE A;  2B58 A;  1X12 A;  4KOR A;  4KZT A;  4BBH A;  4FUU A;  4UFV A;  1QST A;  4R6T A;  3GYA A;  2R8V A;  1RO5 A;  3WC6 A;  3KI9 A;  4DNC A;  2FXF A;  1XJO A;  2CIJ A;  2PJ1 A;  1IU8 A;  4C2Y A;  4FAI A;  4NGS A;  2PJB A;  4CYO A;  4L89 A;  2RB7 A;  4OLL A;  5THW A;  3VWD A;  1HEE A;  3B3C A;  2OR4 A;  3B3S A;  4MI4 A;  4IAV A;  4AG7 A;  2PDO A;  3PB7 X;  3S6K A;  1Z8L A;  4P4B A;  3B3W A;  5AG4 A;  2V8H A;  5J1Q A;  4XNH B;  3IFE A;  2Z0Z A;  1I12 A;  4KS9 A;  4R7M A;  5G22 A;  2JLM A;  4AVC A;  3N7Z A;  4KSF A;  3FB3 A;  4EWT A;  1S7F A;  4OC3 A;  1Z8W A;  1LAN A;  1Q2C A;  2J8N A;  3K9U A;  3PFO A;  4KVO E;  4NGM A;  4NGP A;  3WR7 A;  2EWB A;  2I79 A;  1S7K A;  1A2Z A;  2BUE A;  3CPX A;  3NH5 A;  3R95 A;  4U9Y A;  2ABZ A;  5J8C A;  5JQ4 A;  1Y0Y A;  4MFQ A;  4MCQ A;  4A94 A;  2HUZ A;  3CPA A;  4CGP A;  2ZOG A;  2HB6 A;  1LOK A;  3W6X A;  3GLJ A;  2Q4Z A;  4J3G A;  1DTD A;  1XMT A;  4JZ0 A;  5EC4 A;  4K30 A;  4UIA A;  4L8A A;  1L0C A;  3A9L A;  2EK8 A;  5H86 A;  4X3R A;  4RI1 A;  1VKC A;  2ATR A;  4QB9 A;  4CGL A;  2WZN A;  3NH4 A;  4OC5 A;  5LRG A;  2EUI A;  2AFU A;  2PE3 A;  4IK2 A;  1FT7 A;  3ISX A;  2AFM A;  1IGB A;  2EK9 A;  2REE A;  4IF5 A;  1M1D A;  1QQ9 A;  3C26 A;  4MY3 A;  4A95 A;  1F2O A;  3KQZ A;  2PQ8 A;  5JH9 A;  4H2K A;  3IO1 A;  4R87 A;  5DWN A;  2VZZ A;  4X2T A;  2OOT A;  2JBK A;  1Y7E A;  1FY7 A;  2IL4 A;  4RUH A;  3D2P A;  4DJL A;  4PK3 A;  4AB7 A;  2G0B A;  4NXY A;  3V8I A;  3FH4 A;  3ZJ0 A;  4H89 A;  1YLO A;  3B7I A;  3F0A A;  3RYO A;  4MBU A;  4MJ8 A;  4BIN A;  1S7L A;  1XOV A;  1Z4R A;  2OZH A;  4UFW A;  5AG7 A;  4C2Z A;  2V77 A;  2WPX A;  3FNC A;  2DPT A;  2G3A A;  2Z11 A;  3MGD A;  1XEB A;  5HMN A;  5KTA A;  4UF4 A;  5I4M A;  3K9T A;  1IY7 A;  1YGH A;  4R8F A;  4B5P B;  3NA6 A;  3S6H A;  4UCP A;  2ZW6 A;  5G1Z A;  3MN8 A;  1N71 A;  2GLJ A;  3B3V A;  4QC6 A;  4JYW A;  1WWZ A;  4EVY A;  4C2X A;  4MCP A;  1GHE A;  2Z10 A;  4UIB A;  4ZY1 A;  4JJX A;  2PJ9 A;  3EC4 A;  3S9N A;  1Z8X A;  1XBU A;  2BEI A;  3D7D A;  5GCN A;  4P4J A;  4MFP A;  5AGE A;  5EBV A;  1ARM A;  1LFW A;  4JLY A;  4DUK A;  3SXO A;  2RFH A;  3B35 A;  3D7F A;  1KWM A;  4IHM A;  1ZLI A;  1ZG8 A;  1KUV A;  2PJ7 A;  3PB8 X;  2R1I A;  3IU2 A;  1MJB A;  2AJ6 A;  1SQH A;  2DEA A;  4R57 A;  2FIA A;  5ELY A;  2EO8 A;  3LWU A;  2VBQ A;  2ZEO A;  4H6U A;  4EFD A;  2D4O A;  2I3C A;  2AFZ A;  3DSB A;  4FD4 A;  5HVF A;  2FIW A;  4E0A A;  1S3Z A;  2FCK A;  5LYL A;  4CGN A;  1NSL A;  2GAN A;  1M4G A;  1QSR A;  2VI7 A;  4ZGY B;  3SI0 A;  2AE6 A;  2ZOF A;  2PRQ A;  2HC9 A;  1YVK A;  2AFO A;  4NF1 A;  3SJE A;  4ZY2 A;  3B2Y A;  2IQ6 A;  4KOU A;  1M44 A;  1HDU A;  2H5M A;  4Q7A A;  5F09 A;  4Q38 A;  2IJZ A;  5JGF A;  2VEZ A;  4OC0 A;  4B13 A;  2JDC A;  4MHY A;  1OBR A;  1PU9 A;  1XFO A;  7CPA A;  3IWE A;  4MHP A;  3TCV A;  1BLL E;  4OC2 A;  3IJ3 A;  3KR4 A;  1ARL A;  2AFS A;  3RO0 A;  1KUY A;  3QAY A;  3N5F A;  2PJ2 A;  3DR6 A;  5LRJ A;  4P45 A;  4UBR A;  2O4H A;  2X7B A;  1MJ9 A;  2P6E A;  4B5P A;  3RNZ A;  4YFJ A;  2J8M A;  4XNH C;  2G3T A;  1MJA A;  2DXQ A;  2ZEH A;  2QJ8 A;  2JEW A;  2XEJ A;  1ZG9 A;  3LOD A;  2PR1 A;  3BLN A;  4O23 A;  1S60 A;  2QML A;  3TFY A;  5LYD A;  3SJX A;  3TX8 A;  1F57 A;  3FF3 A;  2D4P A;  3B3T A;  4GM5 A;  1IIC A;  1QMU A;  4F8Z A;  1XIX A;  5KTC A;  5A27 A;  2ZW7 A;  2AFW A;  2J8R A;  2PJ8 A;  4H6Z A;  4CRZ B;  5I0C A;  1IOI A;  1PYT B;  1Z9U A;  4X8I A;  2ZEP A;  1AYE A;  4I49 A;  4YGO A;  2CF4 A;  2CNT A;  3R1K A;  3T9Y A;  4F0X A;  2Q51 A;  4K3N A;  3IEH A;  4MFJ A;  3UY5 A;  3PGP A;  3P2H A;  5K8N A;  2A4N A;  2VQY A;  4PXD A;  4C7H A;  4BD9 A;  2JEV A;  2C27 A;  1KUX A;  3FX6 A;  4NFR A;  4KOV A;  5G21 A;  4B12 A;  4CAX A;  3PBE A;  2NMT A;  3B8G A;  3TTH A;  1Z8T A;  1LAP A;  3EXN A;  2CNS A;  4MCS A;  2ZEN A;  5HVH A;  3H4Q A;  4HNX B;  4KVM E;  4PPZ A;  4OME A;  4WWV A;  5AG5 A;  3CXS A;  1M4I A;  4Y49 B;  4BMH A;  3GUX A;  4CGM A;  1NMT A;  5JM6 A;  4E2A A;  3HLP A;  3OWC A;  2PJ0 A;  1LCP A;  5D29 A;  3D7H A;  5K8M A;  4M6G A;  1U6M A;  5LYI A;  1UWY A;  4MRI A;  4Q36 A;  3TO6 A;  3BI0 A;  3R9G A;  4A38 A;  4ZI6 A;  5BWA B;  3PZJ A;  3D4U A;  2GIV A;  2PVW A;  4ZBG A;  5D8N A;  5KTD A;  3LD2 A;  2KCW A;  1CPS A;  4AG9 A;  3S9L A;  3NE8 A;  3IC1 A;  3DGV A;  3WC5 A;  5CBM A;  4Z65 A;  4NCZ A;  1YX0 A;  4PXE A;  4WJB A;  4X5K A;  2F8H A;  5G20 A;  3FJU A;  3BXM A;  2FL4 A;  4G1P A;  4LQG A;  4OAE A;  4PSW A;  3DNS A;  1TKF A;  2Q4Y A;  3JUW A;  1DE4 C;  2DPS A;  3PBB A;  4MHD A;  5DS0 A;  4KOW A;  2OH1 A;  4P10 A;  2Z3O A;  1XRY A;  4M3S A;  2F7V A;  5K8O A;  3R96 A;  1UFH A;  1XMB A;  2B4D B;  4LX9 A;  4KLW A;  3D66 A;  5FVJ A;  4NJR A;  2GE3 A;  4JWP A;  1Y7R A;  3V38 A;  4II9 A;  2VXK A;  3FRM A;  4QVT A;  3SXN A;  4XPL A;  3RAM A;  3W6S A;  2V8G A;  3IWW A;  2ZW5 A;  1GYT A;  3TO7 A;  2ZEL A;  4P4E A;  3FYN A;  3I3G A;  3V7Z A;  4JD6 A;  2B5G B;  1YME A;  2YNE A;  3FEE A;  3R9F A;  5IB9 A;  3D3S A;  2FS5 A;  2PJ6 A;  4A30 A;  4MFZ A;  4M6I A;  4KOS A;  1P0H A;  1YLE A;  3VWE A;  2ZW4 A;  2YND A;  1CX8 A;  4GXH A;  4KLV A;  4OIW A;  1YQE A;  3KQX A;  4U5Y A;  2CTC A;  3TOA A; 
#chains in the Genus database with same CATH homology
 2NSM A;  1BPN A;  1Y0R A;  2O53 A;  2QYV A;  1BAV A;  4MXU A;  4ZY0 A;  3WC7 A;  1M4L A;  2BO9 A;  1TF8 A;  4MHN A;  3S9M A;  4NGQ A;  3I1U A;  3TC8 A;  2J9A A;  3H8G A;  1TKH A;  4ZYQ A;  1NSA A;  4MHZ A;  4P4I A;  3VH9 A;  3CT9 A;  4FWU A;  3PFE A;  4P4F A;  2XEI A;  3KZW A;  3CDX A;  4PXB A;  3FMC A;  1R3N A;  1EE3 P;  2FVG A;  3FVL A;  2C1C A;  2QVP A;  1TKJ A;  1ZLH A;  2BCO A;  2ZEG A;  6CPA A;  3BI1 A;  4PXC A;  3KHX A;  3FEC A;  3KL9 A;  4UEF A;  4A39 A;  2Q43 A;  3H8F A;  2PIZ A;  3QNV A;  4UEZ A;  2NYQ A;  8CPA A;  1FNO A;  1Q7L A;  3D67 A;  3SI2 A;  1BPM A;  1TF9 A;  4EME A;  2ZEF A;  2PJ3 A;  3H8E A;  4KSI A;  3SI1 A;  4TWE A;  5LYF A;  3WAB A;  4YWY A;  3GB0 A;  4NGN A;  3RBU A;  2PJ4 A;  4TNU A;  1YW4 A;  4OKO A;  2IMO A;  3VAT A;  4F9V A;  2PCU A;  3NH8 A;  2C6G A;  1TXR A;  2PJC A;  1ZG7 A;  3PB6 X;  5HXD A;  1PCA A;  2PVV A;  2XEF A;  4MCR A;  4NGR A;  2WYR A;  3D7G A;  3MRU A;  1CP6 A;  4P4D A;  3ISZ A;  2JBJ A;  1VHO A;  4A37 A;  2ANP A;  4OC4 A;  5CPA A;  2GLF A;  2PIY A;  1HDQ A;  1CPX A;  1YW6 A;  4PQA A;  2BOA A;  1Z5R A;  3DLJ A;  1VHE A;  3RZA A;  3JRU A;  4ZX9 A;  3L2N A;  3PB4 X;  3KHZ A;  3PEI A;  4AXV A;  4OID A;  1ELM P;  4B6Z A;  1LAM A;  3T8W A;  4MMO A;  4ONW A;  3KGQ A;  2ZED A;  1YSJ A;  1CBX A;  1VIX A;  1RTQ A;  3D68 A;  3VAR A;  3PRT A;  2ZEM A;  4ZX8 A;  2GRE A;  4OC1 A;  1JQG A;  5HVG A;  4NGT A;  4OP4 A;  2POK A;  2GU2 A;  4F9U A;  3HUV A;  1VGY A;  3NFZ A;  4NJQ A;  3SJG A;  3IIB A;  1H8L A;  1CP7 A;  2AFX A;  1AMP A;  2V8V A;  2C6C A;  2CTB A;  2C6P A;  5K8P A;  2V8D A;  3FED A;  1Z2L A;  3BHX A;  4W9Y A;  5LRK A;  4P6Y A;  4R76 A;  2PJA A;  3K2K A;  4YU9 A;  3LMS A;  1CG2 A;  3PB9 X;  2ZEE A;  3KAS A;  2XEG A;  3KR5 A;  4UEE A;  3WT4 A;  4CPA A;  3SJF A;  1F2P A;  4P44 A;  2PJ5 A;  1ELL P;  4DYO A;  1R43 A;  2VL1 A;  2G9D A;  4FBE A;  4FUU A;  4R6T A;  3WC6 A;  3KI9 A;  1XJO A;  2CIJ A;  2PJ1 A;  4FAI A;  4NGS A;  2PJB A;  2RB7 A;  5THW A;  1HEE A;  3B3C A;  2OR4 A;  3B3S A;  4IAV A;  3PB7 X;  1Z8L A;  4P4B A;  3B3W A;  2V8H A;  5J1Q A;  3IFE A;  4R7M A;  4EWT A;  4OC3 A;  3PFO A;  1LAN A;  4NGM A;  4NGP A;  2EWB A;  3CPX A;  3NH5 A;  2ABZ A;  1Y0Y A;  4MCQ A;  4A94 A;  3CPA A;  2ZOG A;  2HB6 A;  1LOK A;  3GLJ A;  2Q4Z A;  1DTD A;  4JZ0 A;  4UIA A;  2EK8 A;  4X3R A;  2WZN A;  3NH4 A;  4OC5 A;  5LRG A;  2AFU A;  2PE3 A;  4IK2 A;  1FT7 A;  3ISX A;  2AFM A;  1IGB A;  2EK9 A;  1QQ9 A;  1F2O A;  3KQZ A;  5JH9 A;  4H2K A;  3IO1 A;  4X2T A;  2OOT A;  2JBK A;  1Y7E A;  4RUH A;  4DJL A;  3FH4 A;  1YLO A;  3B7I A;  2V77 A;  4UF4 A;  5I4M A;  3K9T A;  1IY7 A;  4R8F A;  3NA6 A;  3MN8 A;  2GLJ A;  3B3V A;  4JYW A;  4MCP A;  4UIB A;  4ZY1 A;  2PJ9 A;  3S9N A;  1XBU A;  3D7D A;  4P4J A;  1ARM A;  1LFW A;  4DUK A;  2RFH A;  3B35 A;  3D7F A;  1KWM A;  4IHM A;  1ZLI A;  1ZG8 A;  3PB8 X;  2PJ7 A;  2DEA A;  5ELY A;  3LWU A;  2ZEO A;  4EFD A;  2I3C A;  2AFZ A;  5HVF A;  5LYL A;  3SI0 A;  2ZOF A;  2PRQ A;  2HC9 A;  2AFO A;  3SJE A;  4ZY2 A;  3B2Y A;  2IQ6 A;  4Q7A A;  1HDU A;  5F09 A;  2IJZ A;  5JGF A;  4OC0 A;  4MHY A;  1OBR A;  1XFO A;  7CPA A;  4MHP A;  1BLL E;  4OC2 A;  3IJ3 A;  3KR4 A;  1ARL A;  2AFS A;  3N5F A;  2PJ2 A;  5LRJ A;  4P45 A;  2O4H A;  2ZEH A;  2QJ8 A;  2JEW A;  2XEJ A;  1ZG9 A;  4O23 A;  5LYD A;  3SJX A;  3TX8 A;  1F57 A;  3FF3 A;  3B3T A;  4GM5 A;  1QMU A;  4F8Z A;  2AFW A;  2PJ8 A;  1PYT B;  4X8I A;  2ZEP A;  1AYE A;  2CF4 A;  2Q51 A;  4K3N A;  3IEH A;  5K8N A;  4PXD A;  4BD9 A;  3FX6 A;  4NFR A;  3PBE A;  1LAP A;  4MCS A;  2ZEN A;  5HVH A;  4PPZ A;  4OME A;  4WWV A;  3GUX A;  5JM6 A;  3HLP A;  2PJ0 A;  1LCP A;  5D29 A;  3D7H A;  5K8M A;  5LYI A;  1UWY A;  4MRI A;  4A38 A;  4ZI6 A;  3BI0 A;  3D4U A;  2PVW A;  5D8N A;  3S9L A;  1CPS A;  3IC1 A;  3DGV A;  3WC5 A;  5CBM A;  4Z65 A;  4PXE A;  4WJB A;  2F8H A;  3FJU A;  3BXM A;  4G1P A;  4LQG A;  1TKF A;  1DE4 C;  5DS0 A;  3PBB A;  4P10 A;  1XRY A;  2F7V A;  5K8O A;  1XMB A;  3D66 A;  4NJR A;  3V38 A;  3RAM A;  2V8G A;  3IWW A;  1GYT A;  2ZEL A;  4P4E A;  3V7Z A;  1YME A;  3FEE A;  5IB9 A;  2PJ6 A;  1CX8 A;  4OIW A;  3KQX A;  2CTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...