2V77A

Crystal structure of human carboxypeptidase a1
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
308
structure length
308
Chain Sequence
ARSTDTFNYATYHTLEEIYDFLDLLVAENPHLVSKIQIGNTYEGRPIYVLKFSTGGSKRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLDIFLEIVTNPDGFAFTHSTNRMWRKTRSHTAGSLCIGVDPNRNWDAGFGLSGASSNPCSETYHGKFANSEVEVKSIVDFVKDHGNIKAFISIHSYSQLLMYPYGYKTEPVPDQDELDQLSKAAVTALASLYGTKFNYGSIIKAIYQASGSTIDWTYSQGIKYSFTFELRDTGRYGFLLPASQIIPTAKETWLALLTIMEHTLNHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBOXYPEPTIDASE A1
publication title Direct interaction between a human digestive protease and the mucoadhesive poly(acrylic acid).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 114
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature ec 3.4.17.1: Carboxypeptidase A.
pdb deposition date 2007-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2v77A00
4FUUA 4K3NA 5LYIA 2JEWA 1ZG7A 2BCOA 3S9NA 4P4FA 4OP4A 2RFHA 5LYLA 4CPAA 2PE3A 4JYWA 1FNOA 4MRIA 2AFZA 3FMCA 3IWWA 3BI1A 2I3CA 3L2NA 2V8VA 4MCPA 2VL1A 3BXMA 2OR4A 5K8NA 4G1PA 4MHYA 2PVVA 1VIXA 1Z2LA 2ZEGA 2PJ4A 2EWBA 4B6ZA 3VH9A 3LWUA 1DTDA 4O23A 3IJ3A 1YW4A 1XBUA 1CX8A 2ZEEA 4ZY0A 5IB9A 4OIDA 1Q7LA 2GREA 4P4IA 2PIYA 2POKA 1NSAA 4NGQA 4P10A 5JM6A 4H2KA 3D67A 1F2PA 3CDXA 3QNVA 5LRGA 3IEHA 1HDQA 2XEIA 2WYRA 5JGFA 2BO9A 2PJ3A 2QVPA 4MCRA 4ZX8A 5K8MA 2PJAA 3V7ZA 1TXRA 1LFWA 2XEGA 3B2YA 4MHZA 3WC5A 4NGPA 3GUXA 1LOKA 2ZELA 3D7HA 3D7DA 3KI9A 4KSIA 3WC7A 4NFRA 2C1CA 5LRKA 4FBEA 1IGBA 2BOAA 7CPAA 1GYTA 2CIJA 4F9VA 3BHXA 4ZY1A 3S9LA 3T8WA 2ZEPA 2HC9A 1AMPA 4Z65A 3FF3A 2ZOFA 1LANA 3KHZA 4FWUA 1VGYA 1CP7A 1AYEA 2HB6A 1IY7A 3KQZA 1TKJA 4AXVA 3VARA 4NJRA 4BD9A 1TF8A 2ZEDA 4MXUA 3MRUA 5J1QA 4P45A 3CPAA 5K8OA 3JRUA 2ZEFA 1Y0YA 2PCUA 3ISXA 4A38A 1TKHA 4PXBA 3FVLA 3PBBA 4MCSA 5THWA 4ZYQA 4NGTA 4MHNA 4OC3A 3PFOA 2PJCA 3SI2A 4P4DA 2QYVA 1PCAA 3K2KA 3KASA 3HLPA 4UIAA 3WABA 2ABZA 4P44A 1CBXA 3IIBA 2AFUA 2PIZA 2XEJA 1M4LA 3HUVA 3KHXA 4UEFA 4ZI6A 2CTCA 4A37A 3ISZA 2J9AA 2AFMA 1RTQA 1OBRA 3D4UA 4P4JA 4EFDA 3KR5A 1PYTB 4NGSA 4W9YA 3KQXA 2NYQA 3B3TA 4ONWA 1ZG8A 3N5FA 5ELYA 4UEEA 2ANPA 1CP6A 3SI1A 2NSMA 2O4HA 1YMEA 3SJGA 2GU2A 3CPXA 3D7GA 4IHMA 4R76A 2ZEOA 2V8DA 3PB7X 3D66A 5DS0A 3CT9A 3KZWA 1R43A 2EK8A 1BAVA 3IO1A 3PRTA 2EK9A 3MN8A 2ZEMA 2Q43A 3PB9X 1ELMP 5LYDA 3SJFA 8CPAA 4OKOA 4YU9A 4WJBA 1ARLA 4RUHA 4NGRA 5I4MA 3RBUA 1HDUA 3FJUA 2XEFA 2FVGA 4F9UA 4UEZA 4OC5A 3K9TA 3NH5A 3RAMA 3SJXA 4PQAA 3DLJA 1XMBA 2C6CA 4OC4A 5D29A 3WC6A 2IMOA 4IK2A 2AFXA 5D8NA 1H8LA 4DUKA 5HVFA 1YLOA 4NJQA 2CTBA 5LYFA 3TC8A 3FEDA 3NH4A 4OC1A 4P4EA 2Q4ZA 4DYOA 2IJZA 2AFWA 3SI0A 3FX6A 3V38A 4Q7AA 4TNUA 2AFOA 1XFOA 1VHEA 2C6GA 1LAMA 3NH8A 3FEEA 5F09A 4PXEA 4X8IA 2PJ1A 2ZENA 4GM5A 3BI0A 3B35A 4IAVA 4UIBA 3D7FA 1ARMA 1KWMA 2F7VA 3PFEA 4MMOA 2WZNA 3VATA 3NA6A 4NGNA 1Z5RA 1QMUA 1LCPA 2GLFA 2PJ2A 1QQ9A 2PJ0A 4UF4A 3TX8A 4OC2A 1F2OA 2AFSA 3FH4A 3IFEA 4R8FA 1ZLHA 4ZX9A 3H8GA 2PJ6A 1ZG9A 5HVGA 1TF9A 1R3NA 2PJBA 1TKFA 1BLLE 1CPSA 2DEAA 3PB8X 2F8HA 4A39A 4PXCA 3KL9A 4X2TA 3NFZA 2IQ6A 1Y0RA 4WWVA 1YSJA 2PVWA 4P6YA 2V8HA 4PPZA 2PJ9A 3B7IA 2C6PA 2JBJA 3B3VA 2PJ7A 3PB4X 4DJLA 3PB6X 1F57A 4P4BA 2ZEHA 5HVHA 2Q51A 3DGVA 4MHPA 1YW6A 4R7MA 3WT4A 1BPNA 1ELLP 3KGQA 4A94A 1BPMA 4MCQA 3SJEA 4EMEA 4F8ZA 3KR4A 1UWYA 2RB7A 2G9DA 3IC1A 3LMSA 5K8PA 1Z8LA 3B3WA 3GLJA 4PXDA 6CPAA 4NGMA 2QJ8A 5HXDA 2JBKA 4OIWA 1VHOA 1CPXA 1HEEA 4FAIA 4YWYA 2ZOGA 1FT7A 3FECA 3S9MA 3H8EA 1Y7EA 5CBMA 3D68A 4TWEA 3H8FA 1XJOA 2CF4A 2PJ8A 3B3CA 4R6TA 1JQGA 2O53A 3PBEA 3B3SA 1EE3P 2PJ5A 3RZAA 1CG2A 3I1UA 4EWTA 1XRYA 2GLJA 2PRQA 2V77A 3PEIA 1DE4C 5CPAA 5LRJA 2V8GA 1ZLIA 3GB0A 4OMEA 5JH9A 4OC0A 4JZ0A 1LAPA 4ZY2A 4LQGA 4X3RA 2OOTA
chains in the Genus database with same CATH superfamily
4FUUA 4K3NA 5LYIA 2JEWA 1ZG7A 2Z3PA 2BCOA 4CYOA 4QBJA 3S9NA 5AG6A 4GXHA 3H5ZA 4HPSA 4P4FA 2R8VA 2RFHA 3EY5A 4OP4A 4OAEA 1Y7RA 3VWDA 5LYLA 1K4JA 4KOYA 2DF5A 4CPAA 2PE3A 2PR8A 2YNCC 4JYWA 1FNOA 4MRIA 2AFZA 3FMCA 3IWWA 3BI1A 4CGMA 2I3CA 4M6GA 4R9MA 2GE3A 3VWEA 3L2NA 1WK4A 2V8VA 4MCPA 2PDOA 3GKRA 2REEA 2VL1A 2OR4A 3BXMA 1B6BA 3W91A 5K8NA 4G1PA 4MHYA 2B3UA 2Q4YA 2PVVA 1VIXA 1Z2LA 2ZEGA 2PJ4A 2AJ6A 1P0HA 3SXNA 2JDCA 1YLEA 2EWBA 3FYNA 1S5KA 3SXOA 3VH9A 3LWUA 1DTDA 3P2FA 4B6ZA 4O23A 3I9SA 2HV2A 3IJ3A 3EFAA 4QC6A 1YW4A 4MY3A 3R9FA 1XBUA 3BLNA 1CX8A 2ZEEA 1UFHA 3D3SA 4KSAA 4ORFA 4ZY0A 5IB9A 3IWEA 5HH1A 1V0CA 2FXFA 4OIDA 1Q7LA 2FT0A 2GREA 1FY7A 3R9GA 3R95A 1ZO0A 2PIYA 4P4IA 2POKA 2J8NA 2ODFA 1NSAA 2VBQA 4NGQA 4P10A 5F46A 5JM6A 2IL4A 1IB1E 4H2KA 4KOWA 3D67A 3JTKA 1F2PA 2FIAA 4KUBA 3CDXA 3IWGA 3G3SA 3QNVA 4E8OA 1KUVA 5LRGA 3IEHA 1HDQA 2XEIA 2WYRA 5JGFA 2BO9A 2FL4A 2PJ3A 2QVPA 3JUWA 4MCRA 4YRHA 3NE8A 5F48A 2QECA 4XNHC 4ZX8A 5K8MA 2PJAA 3V7ZA 1TXRA 1XF8A 4MFZA 1LFWA 2D4PA 3A9LA 2XEGA 3B2YA 4MHZA 3WC5A 1IOFA 3TE4A 4KLVA 4NGPA 1X10A 2A4NA 2H5MA 2Z3LA 3GUXA 4KLWA 4QVTA 2GANA 1LOKA 2ZELA 3D7HA 1IIDA 3D7DA 3KI9A 4KSIA 2F5IA 3WC7A 5DWNA 4NFRA 2C1CA 1PU9A 4JXRA 3TCVA 4FBEA 5LRKA 1I1DA 1IGBA 2ARHA 4PK2A 3F5BA 2BOAA 3EXNA 4JJXA 3F0AA 2J8RA 7CPAA 4XPDB 1GYTA 1M4GA 2CIJA 3BHXA 4F9VA 4ZY1A 1KZFA 4PSWA 3RO0A 3T8WA 2ZEPA 3S9LA 2HC9A 1AMPA 2PR1A 4UCMA 3FF3A 2ZOFA 1LANA 4AG9A 2PRBA 4Z65A 3KHZA 2GIVA 4BBHA 4FWUA 3RNZA 1VGYA 4CAVA 1CP7A 2HB6A 1AYEA 1QSOA 1Z4RA 1IY7A 1XE4A 2EO8A 1TKJA 1JWQA 3KQZA 4AXVA 3VARA 2QIRA 2OB0A 4NJRA 2WSAA 2P6FA 1S60A 2FS5A 2Q4VA 3C26A 4BD9A 1TF8A 2ZEDA 3FIXA 4MXUA 4UFXA 4UFWA 4YFJA 1Y9KA 3BJ7A 3QAHA 4IF5A 3MRUA 5J1QA 4P45A 2EBJA 3B8GA 3CPAA 4NSQA 3TOAA 4BMHA 1MJAA 2B3VA 5K8OA 3JRUA 2ZEFA 3QB8A 3F8KA 4CYQA 1Y0YA 5AGEA 2PCUA 5G21A 4KVOE 3D8PA 3D2MA 3ISXA 3IU1A 1TKHA 3N7ZA 4PXBA 4A38A 1YGHA 3FVLA 3PBBA 4NF1A 4A30A 4MCSA 5THWA 4ZYQA 1SQHA 5G20A 4NGTA 4MHNA 4OC3A 3PFOA 2PJCA 3SI2A 4P4DA 2VEZA 4H89A 2QYVA 3TO7A 1PCAA 3K2KA 3KASA 3HLPA 4UIAA 4R57A 5J8CA 1J4JA 2ABZA 4HNYB 3WABA 5KTCA 1XEBA 2O28A 3BJ8A 4P44A 1CBXA 3IIBA 2AFUA 2PIZA 2XEJA 1M4LA 4FD4A 1Z8XA 2YNEA 3HUVA 3KHXA 4UEFA 2OU2A 4ZI6A 2Z3KA 4XPKA 2Z10A 4MJ8A 2CTCA 3LODA 2DXQA 1YREA 1Q2YA 3ISZA 4A37A 5IB0A 4UBRA 2G3AA 1GHEA 2J9AA 1Z8WA 1RTQA 2AFMA 1OBRA 1ON0A 3D4UA 4LQ6A 4P4JA 2Q44A 5EMIA 4EFDA 3KR5A 2R7HA 1PYTB 2BSWA 4NGSA 4W9YA 3KQXA 1MK4A 1B87A 1NSLA 4HKFA 2NYQA 3B3TA 4ONWA 1ZG8A 4ZBGA 3RYOA 3N5FA 2Q04A 5ELYA 4OADA 5E96A 2Y0MA 2CY2A 4UEEA 2ANPA 3SHPA 1CP6A 4QB9A 2WPXA 3SI1A 2I00A 5F49A 4C68A 2NSMA 2O4HA 1YQEA 3LACA 2P0WA 3PZJA 4CAFA 1YMEA 2HUZA 4JLYA 2PQ8A 2RC4A 2WPWA 4R87A 5H84A 3MGDA 4RS2A 3SJGA 2GU2A 3CPXA 3D7GA 3DNSA 3P2HA 4A95A 4OLLA 4IHMA 4LUAA 2C27A 4R76A 4M85A 2ZEOA 2V8DA 1BOBA 2OZHA 2NMTA 5H86A 4ZGYB 3S6FA 1X12A 4PSXA 3PB7X 3D66A 5DS0A 3CT9A 2YGWA 3KZWA 1R43A 2GFQA 2EK8A 1Z4EA 1BAVA 4A2ZA 3IO1A 3KKWA 3PRTA 3WR7A 2G0BA 3DSBA 1I12A 1IYLA 2EK9A 2ZXVA 3MN8A 2ZEMA 2Q43A 4AVAA 3PB9X 2B5GA 4Q38A 1ELMP 2OZGA 4KOUA 3CXQA 2Z3MA 5LYDA 3SJFA 2ATRA 4CS0B 8CPAA 4QUSA 4OKOA 2X7BA 4YU9A 1YVOA 4CAXA 4WJBA 4C7HA 1ARLA 4RUHA 4MY0A 4Q36A 4NXYA 1I21A 4NGRA 5I4MA 2B4DB 4C2ZA 3RBUA 2YNDA 1YX0A 1RO5A 4B5OA 1AUGA 1HDUA 3FJUA 4MFKA 4R3LA 2XEFA 2FVGA 4HNXB 1YVKA 4XPDC 3V8IA 4F9UA 2ZW7A 2PC1A 2P6GA 2YNCA 4UEZA 4OC5A 2Q7SA 2EVNA 4KORA 4C2XA 1OZPA 2ZW4A 3K9TA 1Q2CA 5DWMA 4AB7A 3NH5A 4PV6A 3RAMA 3SJXA 5IV0A 4PQAA 3DLJA 4KSFA 1XMBA 2C6CA 4OC4A 2DPSA 5D29A 3WC6A 2WUUA 2IMOA 3W6XA 4U9YA 1MJBA 2D4OA 4IK2A 2Z3OA 2AFXA 3T9YA 2Q7BA 1U6MA 4KOSA 5D8NA 1H8LA 2FE7A 4L8AA 3JVNA 4NCZA 1CJWA 4DUKA 5HVFA 1QSNA 1YLOA 4NJQA 5J8FA 4KVXA 2CTBA 4UFVA 5LYFA 3NE7A 1QSTA 4U5YA 5F47A 3TC8A 4MFQA 3FEDA 3NH4A 4J3GA 4B12A 1XIXA 4OC1A 4P4EA 4I49A 2Q4ZA 4DYOA 1RXTA 3GYAA 2IJZA 4UWIA 2AFWA 4KS9A 3OWCA 3SI0A 3FX6A 3V38A 4CGOA 4Q7AA 2G3TA 3FRMA 4TNUA 3I3GA 3TOBA 5G22A 3TTHA 2AFOA 3S6KA 5JQ4A 3S6GA 1XFOA 4FD5A 4CGPA 1QSMA 1VHEA 2P6EA 2BUEA 2C6GA 4CRYB 2VXKA 1LAMA 3NH8A 3FEEA 3TT2A 5F09A 4PXEA 2EUIA 4X8IA 4CYPA 2PJ1A 2AE6A 2ZENA 1TIQA 2ZPAA 4GM5A 3BI0A 3B35A 4IAVA 4UIBA 4K30A 2VQYA 4MI4A 3D7FA 1ARMA 1KWMA 3R1KA 4XPLA 2F7VA 3PFEA 4MMOA 5A27A 3CZXA 2WZNA 1CM0A 2ZW5A 3D2PA 3VATA 5AG4A 4B14A 4MHDA 4AVCA 4AG7A 1N71A 3NA6A 4NGNA 1Z5RA 1QMUA 1M4DA 4A32A 4CYNA 2R98A 5FVJA 1LCPA 2GLFA 2PJ2A 1QQ9A 2HQYA 2PJ0A 4UF4A 3TX8A 4B5PA 4OC2A 4B10A 1F2OA 2AFSA 3FH4A 3IFEA 4R8FA 1ZLHA 2JDDA 4ZX9A 1WWZA 3H8GA 2CNSA 4BINA 3G8WA 2B5GB 4KOVA 4LX9A 5JPHA 1LRZA 2PJ6A 1ZG9A 5HVGA 1TF9A 5KTAA 4KVME 1IU8A 1R3NA 5CNPA 2PJBA 1TKFA 4UCPA 1KUYA 2BL1A 2VZYA 4MBUA 1BLLE 2FSRA 2PSWA 1S7LA 5AG7A 1CPSA 2DEAA 4AVBA 1NE9A 1M1DA 3FXTA 1Z9UA 3PB8X 5HMNA 3GIUA 2B58A 2F8HA 3FB3A 4A39A 2K5TA 3ZJ0A 4YGOA 2J8MA 4GS4A 1KUXA 4DNCA 4PXCA 4F6AA 3KL9A 3T90A 3E0KA 4RN7A 4X2TA 1YR0A 4FD7A 4RI1A 4CAWA 4F0XA 3NFZA 2IQ6A 1L0CA 1Y0RA 4E0AA 4WWVA 5ISVA 1M4IA 1YSJA 2PVWA 4P6YA 3QAYA 2V8HA 3IGRA 4PPZA 3EC4A 5EC4A 2DPTA 3TFYA 2PJ9A 2Z0ZA 2C6PA 2JBJA 3B3VA 2PJ7A 1XOVA 3B7IA 3PB4X 3IU2A 4JWPA 3EO4A 4DJLA 3PB6X 1F57A 1M44A 4P4BA 2BEIA 4JD6A 4B11A 1P4NA 4KZTA 3S6HA 4A33A 4CAEA 2R1IA 5C88A 2ZEHA 2Z3NA 5HVHA 4NEXA 2Q51A 3H4QA 5G1ZA 3DGVA 1R57A 4MHPA 3GY9A 1YW6A 4KOTA 4R7MA 3WT4A 1IYKA 1IICA 3TO6A 2CNMA 2Z11A 1BPNA 3LD2A 5I0CA 5BWAB 2KCWA 1ELLP 3KGQA 4IUSA 4A94A 1BO4A 1BPMA 4F0YA 4MCQA 1VHSA 4X5KA 4Y49C 4U9ZA 2B4BA 3FBUA 4MFJA 3SJEA 4EMEA 4II9A 4F8ZA 3KR4A 4EVYA 2REFA 1S7KA 1UWYA 5A28A 4M6IA 4UA3A 4XNHB 2RB7A 2G9DA 5KTDA 4JXQA 4CRZB 3IC1A 4C7IA 4Y49B 3LMSA 5K8PA 4KOXA 4L89A 1S7NA 4FD6A 1Z8LA 3ZZIA 1IOIA 3B3WA 3GLJA 4PXDA 1MJ9A 3TO9A 6CPAA 2CNTA 3R9EA 1QSRA 4NGMA 2QJ8A 4ONUA 5HXDA 2JBKA 4OIWA 1VHOA 5C82A 1CPXA 1HEEA 4B13A 4FAIA 5AG5A 4YWYA 2OH1A 1FT7A 2ZOGA 3FECA 3PGPA 3S9MA 4MFLA 3UY5A 4PK3A 3H8EA 1Y7EA 5CBMA 3D68A 3K9UA 4TWEA 4B5PB 3CXSA 2VZZA 4HNWB 1YK3A 2ZW6A 3H8FA 1NMTA 2JEVA 2CXAA 3PP9A 1XJOA 2CF4A 2B4DA 3CXPA 2PJ8A 3B3CA 1Q2DA 4R6TA 1JQGA 3FNCA 1Z8TA 4M3SA 2O53A 3PBEA 4H6UA 3B3SA 4C2YA 1EE3P 2PJ5A 2JLMA 3DR8A 4UCNA 3RZAA 1S3ZA 1CG2A 3I1UA 4EWTA 5GCNA 1XRYA 1PUAA 2GLJA 2PRQA 3W6SA 5IX3A 2V77A 3PEIA 4R3KA 1DE4C 5CPAA 4MFPA 5EBVA 4CGNA 5LRJA 2V8GA 3DR6A 2I79A 1ZLIA 3GB0A 4OMEA 4CGLA 5JH9A 4OC0A 1Y9WA 4JZ0A 1LAPA 4M6HA 4ZY2A 4LQGA 4X3RA 1VKCA 2Q0YA 3DDDA 2OZUA 1A2ZA 2VI7A 2QMLA 4UWJA 4E2AA 3R96A 2OOTA 2FIWA 4KUAA 4H6ZA 4A31A 2FCKA 1S7FA 1XMTA
chains in the Genus database with same CATH topology
4FUUA 4K3NA 5LYIA 2JEWA 1ZG7A 2BCOA 3S9NA 4P4FA 4OP4A 2RFHA 5LYLA 4CPAA 2PE3A 4JYWA 1FNOA 4MRIA 2AFZA 3FMCA 3IWWA 3BI1A 2I3CA 3L2NA 2V8VA 4MCPA 2VL1A 3BXMA 2OR4A 5K8NA 4G1PA 4MHYA 2PVVA 1VIXA 1Z2LA 2ZEGA 2PJ4A 2EWBA 4B6ZA 3VH9A 3LWUA 1DTDA 4O23A 3IJ3A 1YW4A 1XBUA 1CX8A 2ZEEA 4ZY0A 5IB9A 4OIDA 1Q7LA 2GREA 4P4IA 2PIYA 2POKA 1NSAA 4NGQA 4P10A 5JM6A 4H2KA 3D67A 1F2PA 3CDXA 3QNVA 5LRGA 3IEHA 1HDQA 2XEIA 2WYRA 5JGFA 2BO9A 2PJ3A 2QVPA 4MCRA 4ZX8A 5K8MA 2PJAA 3V7ZA 1TXRA 1LFWA 2XEGA 3B2YA 4MHZA 3WC5A 4NGPA 3GUXA 1LOKA 2ZELA 3D7HA 3D7DA 3KI9A 4KSIA 3WC7A 4NFRA 2C1CA 5LRKA 4FBEA 1IGBA 2BOAA 7CPAA 1GYTA 2CIJA 4F9VA 3BHXA 4ZY1A 3S9LA 3T8WA 2ZEPA 2HC9A 1AMPA 4Z65A 3FF3A 2ZOFA 1LANA 3KHZA 4FWUA 1VGYA 1CP7A 1AYEA 2HB6A 1IY7A 3KQZA 1TKJA 4AXVA 3VARA 4NJRA 4BD9A 1TF8A 2ZEDA 4MXUA 3MRUA 5J1QA 4P45A 3CPAA 5K8OA 3JRUA 2ZEFA 1Y0YA 2PCUA 3ISXA 4A38A 1TKHA 4PXBA 3FVLA 3PBBA 4MCSA 5THWA 4ZYQA 4NGTA 4MHNA 4OC3A 3PFOA 2PJCA 3SI2A 4P4DA 2QYVA 1PCAA 3K2KA 3KASA 3HLPA 4UIAA 3WABA 2ABZA 4P44A 1CBXA 3IIBA 2AFUA 2PIZA 2XEJA 1M4LA 3HUVA 3KHXA 4UEFA 4ZI6A 2CTCA 4A37A 3ISZA 2J9AA 2AFMA 1RTQA 1OBRA 3D4UA 4P4JA 4EFDA 3KR5A 1PYTB 4NGSA 4W9YA 3KQXA 2NYQA 3B3TA 4ONWA 1ZG8A 3N5FA 5ELYA 4UEEA 2ANPA 1CP6A 3SI1A 2NSMA 2O4HA 1YMEA 3SJGA 2GU2A 3CPXA 3D7GA 4IHMA 4R76A 2ZEOA 2V8DA 3PB7X 3D66A 5DS0A 3CT9A 3KZWA 1R43A 2EK8A 1BAVA 3IO1A 3PRTA 2EK9A 3MN8A 2ZEMA 2Q43A 3PB9X 1ELMP 5LYDA 3SJFA 8CPAA 4OKOA 4YU9A 4WJBA 1ARLA 4RUHA 4NGRA 5I4MA 3RBUA 1HDUA 3FJUA 2XEFA 2FVGA 4F9UA 4UEZA 4OC5A 3K9TA 3NH5A 3RAMA 3SJXA 4PQAA 3DLJA 1XMBA 2C6CA 4OC4A 5D29A 3WC6A 2IMOA 4IK2A 2AFXA 5D8NA 1H8LA 4DUKA 5HVFA 1YLOA 4NJQA 2CTBA 5LYFA 3TC8A 3FEDA 3NH4A 4OC1A 4P4EA 2Q4ZA 4DYOA 2IJZA 2AFWA 3SI0A 3FX6A 3V38A 4Q7AA 4TNUA 2AFOA 1XFOA 1VHEA 2C6GA 1LAMA 3NH8A 3FEEA 5F09A 4PXEA 4X8IA 2PJ1A 2ZENA 4GM5A 3BI0A 3B35A 4IAVA 4UIBA 3D7FA 1ARMA 1KWMA 2F7VA 3PFEA 4MMOA 2WZNA 3VATA 3NA6A 4NGNA 1Z5RA 1QMUA 1LCPA 2GLFA 2PJ2A 1QQ9A 2PJ0A 4UF4A 3TX8A 4OC2A 1F2OA 2AFSA 3FH4A 3IFEA 4R8FA 1ZLHA 4ZX9A 3H8GA 2PJ6A 1ZG9A 5HVGA 1TF9A 1R3NA 2PJBA 1TKFA 1BLLE 1CPSA 2DEAA 3PB8X 2F8HA 4A39A 4PXCA 3KL9A 4X2TA 3NFZA 2IQ6A 1Y0RA 4WWVA 1YSJA 2PVWA 4P6YA 2V8HA 4PPZA 2PJ9A 3B7IA 2C6PA 2JBJA 3B3VA 2PJ7A 3PB4X 4DJLA 3PB6X 1F57A 4P4BA 2ZEHA 5HVHA 2Q51A 3DGVA 4MHPA 1YW6A 4R7MA 3WT4A 1BPNA 1ELLP 3KGQA 4A94A 1BPMA 4MCQA 3SJEA 4EMEA 4F8ZA 3KR4A 1UWYA 2RB7A 2G9DA 3IC1A 3LMSA 5K8PA 1Z8LA 3B3WA 3GLJA 4PXDA 6CPAA 4NGMA 2QJ8A 5HXDA 2JBKA 4OIWA 1VHOA 1CPXA 1HEEA 4FAIA 4YWYA 2ZOGA 1FT7A 3FECA 3S9MA 3H8EA 1Y7EA 5CBMA 3D68A 4TWEA 3H8FA 1XJOA 2CF4A 2PJ8A 3B3CA 4R6TA 1JQGA 2O53A 3PBEA 3B3SA 1EE3P 2PJ5A 3RZAA 1CG2A 3I1UA 4EWTA 1XRYA 2GLJA 2PRQA 2V77A 3PEIA 1DE4C 5CPAA 5LRJA 2V8GA 1ZLIA 3GB0A 4OMEA 5JH9A 4OC0A 4JZ0A 1LAPA 4ZY2A 4LQGA 4X3RA 2OOTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FUU A;  4K3N A;  5LYI A;  2JEW A;  1ZG7 A;  2BCO A;  3S9N A;  4P4F A;  4OP4 A;  2RFH A;  5LYL A;  4CPA A;  2PE3 A;  4JYW A;  1FNO A;  4MRI A;  2AFZ A;  3FMC A;  3IWW A;  3BI1 A;  2I3C A;  3L2N A;  2V8V A;  4MCP A;  2VL1 A;  3BXM A;  2OR4 A;  5K8N A;  4G1P A;  4MHY A;  2PVV A;  1VIX A;  1Z2L A;  2ZEG A;  2PJ4 A;  2EWB A;  4B6Z A;  3VH9 A;  3LWU A;  1DTD A;  4O23 A;  3IJ3 A;  1YW4 A;  1XBU A;  1CX8 A;  2ZEE A;  4ZY0 A;  5IB9 A;  4OID A;  1Q7L A;  2GRE A;  4P4I A;  2PIY A;  2POK A;  1NSA A;  4NGQ A;  4P10 A;  5JM6 A;  4H2K A;  3D67 A;  1F2P A;  3CDX A;  3QNV A;  5LRG A;  3IEH A;  1HDQ A;  2XEI A;  2WYR A;  5JGF A;  2BO9 A;  2PJ3 A;  2QVP A;  4MCR A;  4ZX8 A;  5K8M A;  2PJA A;  3V7Z A;  1TXR A;  1LFW A;  2XEG A;  3B2Y A;  4MHZ A;  3WC5 A;  4NGP A;  3GUX A;  1LOK A;  2ZEL A;  3D7H A;  3D7D A;  3KI9 A;  4KSI A;  3WC7 A;  4NFR A;  2C1C A;  5LRK A;  4FBE A;  1IGB A;  2BOA A;  7CPA A;  1GYT A;  2CIJ A;  4F9V A;  3BHX A;  4ZY1 A;  3S9L A;  3T8W A;  2ZEP A;  2HC9 A;  1AMP A;  4Z65 A;  3FF3 A;  2ZOF A;  1LAN A;  3KHZ A;  4FWU A;  1VGY A;  1CP7 A;  1AYE A;  2HB6 A;  1IY7 A;  3KQZ A;  1TKJ A;  4AXV A;  3VAR A;  4NJR A;  4BD9 A;  1TF8 A;  2ZED A;  4MXU A;  3MRU A;  5J1Q A;  4P45 A;  3CPA A;  5K8O A;  3JRU A;  2ZEF A;  1Y0Y A;  2PCU A;  3ISX A;  4A38 A;  1TKH A;  4PXB A;  3FVL A;  3PBB A;  4MCS A;  5THW A;  4ZYQ A;  4NGT A;  4MHN A;  4OC3 A;  3PFO A;  2PJC A;  3SI2 A;  4P4D A;  2QYV A;  1PCA A;  3K2K A;  3KAS A;  3HLP A;  4UIA A;  3WAB A;  2ABZ A;  4P44 A;  1CBX A;  3IIB A;  2AFU A;  2PIZ A;  2XEJ A;  1M4L A;  3HUV A;  3KHX A;  4UEF A;  4ZI6 A;  2CTC A;  4A37 A;  3ISZ A;  2J9A A;  2AFM A;  1RTQ A;  1OBR A;  3D4U A;  4P4J A;  4EFD A;  3KR5 A;  1PYT B;  4NGS A;  4W9Y A;  3KQX A;  2NYQ A;  3B3T A;  4ONW A;  1ZG8 A;  3N5F A;  5ELY A;  4UEE A;  2ANP A;  1CP6 A;  3SI1 A;  2NSM A;  2O4H A;  1YME A;  3SJG A;  2GU2 A;  3CPX A;  3D7G A;  4IHM A;  4R76 A;  2ZEO A;  2V8D A;  3PB7 X;  3D66 A;  5DS0 A;  3CT9 A;  3KZW A;  1R43 A;  2EK8 A;  1BAV A;  3IO1 A;  3PRT A;  2EK9 A;  3MN8 A;  2ZEM A;  2Q43 A;  3PB9 X;  1ELM P;  5LYD A;  3SJF A;  8CPA A;  4OKO A;  4YU9 A;  4WJB A;  1ARL A;  4RUH A;  4NGR A;  5I4M A;  3RBU A;  1HDU A;  3FJU A;  2XEF A;  2FVG A;  4F9U A;  4UEZ A;  4OC5 A;  3K9T A;  3NH5 A;  3RAM A;  3SJX A;  4PQA A;  3DLJ A;  1XMB A;  2C6C A;  4OC4 A;  5D29 A;  3WC6 A;  2IMO A;  4IK2 A;  2AFX A;  5D8N A;  1H8L A;  4DUK A;  5HVF A;  1YLO A;  4NJQ A;  2CTB A;  5LYF A;  3TC8 A;  3FED A;  3NH4 A;  4OC1 A;  4P4E A;  2Q4Z A;  4DYO A;  2IJZ A;  2AFW A;  3SI0 A;  3FX6 A;  3V38 A;  4Q7A A;  4TNU A;  2AFO A;  1XFO A;  1VHE A;  2C6G A;  1LAM A;  3NH8 A;  3FEE A;  5F09 A;  4PXE A;  4X8I A;  2PJ1 A;  2ZEN A;  4GM5 A;  3BI0 A;  3B35 A;  4IAV A;  4UIB A;  3D7F A;  1ARM A;  1KWM A;  2F7V A;  3PFE A;  4MMO A;  2WZN A;  3VAT A;  3NA6 A;  4NGN A;  1Z5R A;  1QMU A;  1LCP A;  2GLF A;  2PJ2 A;  1QQ9 A;  2PJ0 A;  4UF4 A;  3TX8 A;  4OC2 A;  1F2O A;  2AFS A;  3FH4 A;  3IFE A;  4R8F A;  1ZLH A;  4ZX9 A;  3H8G A;  2PJ6 A;  1ZG9 A;  5HVG A;  1TF9 A;  1R3N A;  2PJB A;  1TKF A;  1BLL E;  1CPS A;  2DEA A;  3PB8 X;  2F8H A;  4A39 A;  4PXC A;  3KL9 A;  4X2T A;  3NFZ A;  2IQ6 A;  1Y0R A;  4WWV A;  1YSJ A;  2PVW A;  4P6Y A;  2V8H A;  4PPZ A;  2PJ9 A;  3B7I A;  2C6P A;  2JBJ A;  3B3V A;  2PJ7 A;  3PB4 X;  4DJL A;  3PB6 X;  1F57 A;  4P4B A;  2ZEH A;  5HVH A;  2Q51 A;  3DGV A;  4MHP A;  1YW6 A;  4R7M A;  3WT4 A;  1BPN A;  1ELL P;  3KGQ A;  4A94 A;  1BPM A;  4MCQ A;  3SJE A;  4EME A;  4F8Z A;  3KR4 A;  1UWY A;  2RB7 A;  2G9D A;  3IC1 A;  3LMS A;  5K8P A;  1Z8L A;  3B3W A;  3GLJ A;  4PXD A;  6CPA A;  4NGM A;  2QJ8 A;  5HXD A;  2JBK A;  4OIW A;  1VHO A;  1CPX A;  1HEE A;  4FAI A;  4YWY A;  2ZOG A;  1FT7 A;  3FEC A;  3S9M A;  3H8E A;  1Y7E A;  5CBM A;  3D68 A;  4TWE A;  3H8F A;  1XJO A;  2CF4 A;  2PJ8 A;  3B3C A;  4R6T A;  1JQG A;  2O53 A;  3PBE A;  3B3S A;  1EE3 P;  2PJ5 A;  3RZA A;  1CG2 A;  3I1U A;  4EWT A;  1XRY A;  2GLJ A;  2PRQ A;  2V77 A;  3PEI A;  1DE4 C;  5CPA A;  5LRJ A;  2V8G A;  1ZLI A;  3GB0 A;  4OME A;  5JH9 A;  4OC0 A;  4JZ0 A;  1LAP A;  4ZY2 A;  4LQG A;  4X3R A;  2OOT A; 
#chains in the Genus database with same CATH topology
 4FUU A;  4K3N A;  5LYI A;  2JEW A;  1ZG7 A;  2Z3P A;  2BCO A;  4CYO A;  4QBJ A;  3S9N A;  5AG6 A;  4GXH A;  3H5Z A;  4HPS A;  4P4F A;  2R8V A;  2RFH A;  3EY5 A;  4OP4 A;  4OAE A;  1Y7R A;  3VWD A;  5LYL A;  1K4J A;  4KOY A;  2DF5 A;  4CPA A;  2PE3 A;  2PR8 A;  2YNC C;  4JYW A;  1FNO A;  4MRI A;  2AFZ A;  3FMC A;  3IWW A;  3BI1 A;  4CGM A;  2I3C A;  4M6G A;  4R9M A;  2GE3 A;  3VWE A;  3L2N A;  1WK4 A;  2V8V A;  4MCP A;  2PDO A;  3GKR A;  2REE A;  2VL1 A;  2OR4 A;  3BXM A;  1B6B A;  3W91 A;  5K8N A;  4G1P A;  4MHY A;  2B3U A;  2Q4Y A;  2PVV A;  1VIX A;  1Z2L A;  2ZEG A;  2PJ4 A;  2AJ6 A;  1P0H A;  3SXN A;  2JDC A;  1YLE A;  2EWB A;  3FYN A;  1S5K A;  3SXO A;  3VH9 A;  3LWU A;  1DTD A;  3P2F A;  4B6Z A;  4O23 A;  3I9S A;  2HV2 A;  3IJ3 A;  3EFA A;  4QC6 A;  1YW4 A;  4MY3 A;  3R9F A;  1XBU A;  3BLN A;  1CX8 A;  2ZEE A;  1UFH A;  3D3S A;  4KSA A;  4ORF A;  4ZY0 A;  5IB9 A;  3IWE A;  5HH1 A;  1V0C A;  2FXF A;  4OID A;  1Q7L A;  2FT0 A;  2GRE A;  1FY7 A;  3R9G A;  3R95 A;  1ZO0 A;  2PIY A;  4P4I A;  2POK A;  2J8N A;  2ODF A;  1NSA A;  2VBQ A;  4NGQ A;  4P10 A;  5F46 A;  5JM6 A;  2IL4 A;  1IB1 E;  4H2K A;  4KOW A;  3D67 A;  3JTK A;  1F2P A;  2FIA A;  4KUB A;  3CDX A;  3IWG A;  3G3S A;  3QNV A;  4E8O A;  1KUV A;  5LRG A;  3IEH A;  1HDQ A;  2XEI A;  2WYR A;  5JGF A;  2BO9 A;  2FL4 A;  2PJ3 A;  2QVP A;  3JUW A;  4MCR A;  4YRH A;  3NE8 A;  5F48 A;  2QEC A;  4XNH C;  4ZX8 A;  5K8M A;  2PJA A;  3V7Z A;  1TXR A;  1XF8 A;  4MFZ A;  1LFW A;  2D4P A;  3A9L A;  2XEG A;  3B2Y A;  4MHZ A;  3WC5 A;  1IOF A;  3TE4 A;  4KLV A;  4NGP A;  1X10 A;  2A4N A;  2H5M A;  2Z3L A;  3GUX A;  4KLW A;  4QVT A;  2GAN A;  1LOK A;  2ZEL A;  3D7H A;  1IID A;  3D7D A;  3KI9 A;  4KSI A;  2F5I A;  3WC7 A;  5DWN A;  4NFR A;  2C1C A;  1PU9 A;  4JXR A;  3TCV A;  4FBE A;  5LRK A;  1I1D A;  1IGB A;  2ARH A;  4PK2 A;  3F5B A;  2BOA A;  3EXN A;  4JJX A;  3F0A A;  2J8R A;  7CPA A;  4XPD B;  1GYT A;  1M4G A;  2CIJ A;  3BHX A;  4F9V A;  4ZY1 A;  1KZF A;  4PSW A;  3RO0 A;  3T8W A;  2ZEP A;  3S9L A;  2HC9 A;  1AMP A;  2PR1 A;  4UCM A;  3FF3 A;  2ZOF A;  1LAN A;  4AG9 A;  2PRB A;  4Z65 A;  3KHZ A;  2GIV A;  4BBH A;  4FWU A;  3RNZ A;  1VGY A;  4CAV A;  1CP7 A;  2HB6 A;  1AYE A;  1QSO A;  1Z4R A;  1IY7 A;  1XE4 A;  2EO8 A;  1TKJ A;  1JWQ A;  3KQZ A;  4AXV A;  3VAR A;  2QIR A;  2OB0 A;  4NJR A;  2WSA A;  2P6F A;  1S60 A;  2FS5 A;  2Q4V A;  3C26 A;  4BD9 A;  1TF8 A;  2ZED A;  3FIX A;  4MXU A;  4UFX A;  4UFW A;  4YFJ A;  1Y9K A;  3BJ7 A;  3QAH A;  4IF5 A;  3MRU A;  5J1Q A;  4P45 A;  2EBJ A;  3B8G A;  3CPA A;  4NSQ A;  3TOA A;  4BMH A;  1MJA A;  2B3V A;  5K8O A;  3JRU A;  2ZEF A;  3QB8 A;  3F8K A;  4CYQ A;  1Y0Y A;  5AGE A;  2PCU A;  5G21 A;  4KVO E;  3D8P A;  3D2M A;  3ISX A;  3IU1 A;  1TKH A;  3N7Z A;  4PXB A;  4A38 A;  1YGH A;  3FVL A;  3PBB A;  4NF1 A;  4A30 A;  4MCS A;  5THW A;  4ZYQ A;  1SQH A;  5G20 A;  4NGT A;  4MHN A;  4OC3 A;  3PFO A;  2PJC A;  3SI2 A;  4P4D A;  2VEZ A;  4H89 A;  2QYV A;  3TO7 A;  1PCA A;  3K2K A;  3KAS A;  3HLP A;  4UIA A;  4R57 A;  5J8C A;  1J4J A;  2ABZ A;  4HNY B;  3WAB A;  5KTC A;  1XEB A;  2O28 A;  3BJ8 A;  4P44 A;  1CBX A;  3IIB A;  2AFU A;  2PIZ A;  2XEJ A;  1M4L A;  4FD4 A;  1Z8X A;  2YNE A;  3HUV A;  3KHX A;  4UEF A;  2OU2 A;  4ZI6 A;  2Z3K A;  4XPK A;  2Z10 A;  4MJ8 A;  2CTC A;  3LOD A;  2DXQ A;  1YRE A;  1Q2Y A;  3ISZ A;  4A37 A;  5IB0 A;  4UBR A;  2G3A A;  1GHE A;  2J9A A;  1Z8W A;  1RTQ A;  2AFM A;  1OBR A;  1ON0 A;  3D4U A;  4LQ6 A;  4P4J A;  2Q44 A;  5EMI A;  4EFD A;  3KR5 A;  2R7H A;  1PYT B;  2BSW A;  4NGS A;  4W9Y A;  3KQX A;  1MK4 A;  1B87 A;  1NSL A;  4HKF A;  2NYQ A;  3B3T A;  4ONW A;  1ZG8 A;  4ZBG A;  3RYO A;  3N5F A;  2Q04 A;  5ELY A;  4OAD A;  5E96 A;  2Y0M A;  2CY2 A;  4UEE A;  2ANP A;  3SHP A;  1CP6 A;  4QB9 A;  2WPX A;  3SI1 A;  2I00 A;  5F49 A;  4C68 A;  2NSM A;  2O4H A;  1YQE A;  3LAC A;  2P0W A;  3PZJ A;  4CAF A;  1YME A;  2HUZ A;  4JLY A;  2PQ8 A;  2RC4 A;  2WPW A;  4R87 A;  5H84 A;  3MGD A;  4RS2 A;  3SJG A;  2GU2 A;  3CPX A;  3D7G A;  3DNS A;  3P2H A;  4A95 A;  4OLL A;  4IHM A;  4LUA A;  2C27 A;  4R76 A;  4M85 A;  2ZEO A;  2V8D A;  1BOB A;  2OZH A;  2NMT A;  5H86 A;  4ZGY B;  3S6F A;  1X12 A;  4PSX A;  3PB7 X;  3D66 A;  5DS0 A;  3CT9 A;  2YGW A;  3KZW A;  1R43 A;  2GFQ A;  2EK8 A;  1Z4E A;  1BAV A;  4A2Z A;  3IO1 A;  3KKW A;  3PRT A;  3WR7 A;  2G0B A;  3DSB A;  1I12 A;  1IYL A;  2EK9 A;  2ZXV A;  3MN8 A;  2ZEM A;  2Q43 A;  4AVA A;  3PB9 X;  2B5G A;  4Q38 A;  1ELM P;  2OZG A;  4KOU A;  3CXQ A;  2Z3M A;  5LYD A;  3SJF A;  2ATR A;  4CS0 B;  8CPA A;  4QUS A;  4OKO A;  2X7B A;  4YU9 A;  1YVO A;  4CAX A;  4WJB A;  4C7H A;  1ARL A;  4RUH A;  4MY0 A;  4Q36 A;  4NXY A;  1I21 A;  4NGR A;  5I4M A;  2B4D B;  4C2Z A;  3RBU A;  2YND A;  1YX0 A;  1RO5 A;  4B5O A;  1AUG A;  1HDU A;  3FJU A;  4MFK A;  4R3L A;  2XEF A;  2FVG A;  4HNX B;  1YVK A;  4XPD C;  3V8I A;  4F9U A;  2ZW7 A;  2PC1 A;  2P6G A;  2YNC A;  4UEZ A;  4OC5 A;  2Q7S A;  2EVN A;  4KOR A;  4C2X A;  1OZP A;  2ZW4 A;  3K9T A;  1Q2C A;  5DWM A;  4AB7 A;  3NH5 A;  4PV6 A;  3RAM A;  3SJX A;  5IV0 A;  4PQA A;  3DLJ A;  4KSF A;  1XMB A;  2C6C A;  4OC4 A;  2DPS A;  5D29 A;  3WC6 A;  2WUU A;  2IMO A;  3W6X A;  4U9Y A;  1MJB A;  2D4O A;  4IK2 A;  2Z3O A;  2AFX A;  3T9Y A;  2Q7B A;  1U6M A;  4KOS A;  5D8N A;  1H8L A;  2FE7 A;  4L8A A;  3JVN A;  4NCZ A;  1CJW A;  4DUK A;  5HVF A;  1QSN A;  1YLO A;  4NJQ A;  5J8F A;  4KVX A;  2CTB A;  4UFV A;  5LYF A;  3NE7 A;  1QST A;  4U5Y A;  5F47 A;  3TC8 A;  4MFQ A;  3FED A;  3NH4 A;  4J3G A;  4B12 A;  1XIX A;  4OC1 A;  4P4E A;  4I49 A;  2Q4Z A;  4DYO A;  1RXT A;  3GYA A;  2IJZ A;  4UWI A;  2AFW A;  4KS9 A;  3OWC A;  3SI0 A;  3FX6 A;  3V38 A;  4CGO A;  4Q7A A;  2G3T A;  3FRM A;  4TNU A;  3I3G A;  3TOB A;  5G22 A;  3TTH A;  2AFO A;  3S6K A;  5JQ4 A;  3S6G A;  1XFO A;  4FD5 A;  4CGP A;  1QSM A;  1VHE A;  2P6E A;  2BUE A;  2C6G A;  4CRY B;  2VXK A;  1LAM A;  3NH8 A;  3FEE A;  3TT2 A;  5F09 A;  4PXE A;  2EUI A;  4X8I A;  4CYP A;  2PJ1 A;  2AE6 A;  2ZEN A;  1TIQ A;  2ZPA A;  4GM5 A;  3BI0 A;  3B35 A;  4IAV A;  4UIB A;  4K30 A;  2VQY A;  4MI4 A;  3D7F A;  1ARM A;  1KWM A;  3R1K A;  4XPL A;  2F7V A;  3PFE A;  4MMO A;  5A27 A;  3CZX A;  2WZN A;  1CM0 A;  2ZW5 A;  3D2P A;  3VAT A;  5AG4 A;  4B14 A;  4MHD A;  4AVC A;  4AG7 A;  1N71 A;  3NA6 A;  4NGN A;  1Z5R A;  1QMU A;  1M4D A;  4A32 A;  4CYN A;  2R98 A;  5FVJ A;  1LCP A;  2GLF A;  2PJ2 A;  1QQ9 A;  2HQY A;  2PJ0 A;  4UF4 A;  3TX8 A;  4B5P A;  4OC2 A;  4B10 A;  1F2O A;  2AFS A;  3FH4 A;  3IFE A;  4R8F A;  1ZLH A;  2JDD A;  4ZX9 A;  1WWZ A;  3H8G A;  2CNS A;  4BIN A;  3G8W A;  2B5G B;  4KOV A;  4LX9 A;  5JPH A;  1LRZ A;  2PJ6 A;  1ZG9 A;  5HVG A;  1TF9 A;  5KTA A;  4KVM E;  1IU8 A;  1R3N A;  5CNP A;  2PJB A;  1TKF A;  4UCP A;  1KUY A;  2BL1 A;  2VZY A;  4MBU A;  1BLL E;  2FSR A;  2PSW A;  1S7L A;  5AG7 A;  1CPS A;  2DEA A;  4AVB A;  1NE9 A;  1M1D A;  3FXT A;  1Z9U A;  3PB8 X;  5HMN A;  3GIU A;  2B58 A;  2F8H A;  3FB3 A;  4A39 A;  2K5T A;  3ZJ0 A;  4YGO A;  2J8M A;  4GS4 A;  1KUX A;  4DNC A;  4PXC A;  4F6A A;  3KL9 A;  3T90 A;  3E0K A;  4RN7 A;  4X2T A;  1YR0 A;  4FD7 A;  4RI1 A;  4CAW A;  4F0X A;  3NFZ A;  2IQ6 A;  1L0C A;  1Y0R A;  4E0A A;  4WWV A;  5ISV A;  1M4I A;  1YSJ A;  2PVW A;  4P6Y A;  3QAY A;  2V8H A;  3IGR A;  4PPZ A;  3EC4 A;  5EC4 A;  2DPT A;  3TFY A;  2PJ9 A;  2Z0Z A;  2C6P A;  2JBJ A;  3B3V A;  2PJ7 A;  1XOV A;  3B7I A;  3PB4 X;  3IU2 A;  4JWP A;  3EO4 A;  4DJL A;  3PB6 X;  1F57 A;  1M44 A;  4P4B A;  2BEI A;  4JD6 A;  4B11 A;  1P4N A;  4KZT A;  3S6H A;  4A33 A;  4CAE A;  2R1I A;  5C88 A;  2ZEH A;  2Z3N A;  5HVH A;  4NEX A;  2Q51 A;  3H4Q A;  5G1Z A;  3DGV A;  1R57 A;  4MHP A;  3GY9 A;  1YW6 A;  4KOT A;  4R7M A;  3WT4 A;  1IYK A;  1IIC A;  3TO6 A;  2CNM A;  2Z11 A;  1BPN A;  3LD2 A;  5I0C A;  5BWA B;  2KCW A;  1ELL P;  3KGQ A;  4IUS A;  4A94 A;  1BO4 A;  1BPM A;  4F0Y A;  4MCQ A;  1VHS A;  4X5K A;  4Y49 C;  4U9Z A;  2B4B A;  3FBU A;  4MFJ A;  3SJE A;  4EME A;  4II9 A;  4F8Z A;  3KR4 A;  4EVY A;  2REF A;  1S7K A;  1UWY A;  5A28 A;  4M6I A;  4UA3 A;  4XNH B;  2RB7 A;  2G9D A;  5KTD A;  4JXQ A;  4CRZ B;  3IC1 A;  4C7I A;  4Y49 B;  3LMS A;  5K8P A;  4KOX A;  4L89 A;  1S7N A;  4FD6 A;  1Z8L A;  3ZZI A;  1IOI A;  3B3W A;  3GLJ A;  4PXD A;  1MJ9 A;  3TO9 A;  6CPA A;  2CNT A;  3R9E A;  1QSR A;  4NGM A;  2QJ8 A;  4ONU A;  5HXD A;  2JBK A;  4OIW A;  1VHO A;  5C82 A;  1CPX A;  1HEE A;  4B13 A;  4FAI A;  5AG5 A;  4YWY A;  2OH1 A;  1FT7 A;  2ZOG A;  3FEC A;  3PGP A;  3S9M A;  4MFL A;  3UY5 A;  4PK3 A;  3H8E A;  1Y7E A;  5CBM A;  3D68 A;  3K9U A;  4TWE A;  4B5P B;  3CXS A;  2VZZ A;  4HNW B;  1YK3 A;  2ZW6 A;  3H8F A;  1NMT A;  2JEV A;  2CXA A;  3PP9 A;  1XJO A;  2CF4 A;  2B4D A;  3CXP A;  2PJ8 A;  3B3C A;  1Q2D A;  4R6T A;  1JQG A;  3FNC A;  1Z8T A;  4M3S A;  2O53 A;  3PBE A;  4H6U A;  3B3S A;  4C2Y A;  1EE3 P;  2PJ5 A;  2JLM A;  3DR8 A;  4UCN A;  3RZA A;  1S3Z A;  1CG2 A;  3I1U A;  4EWT A;  5GCN A;  1XRY A;  1PUA A;  2GLJ A;  2PRQ A;  3W6S A;  5IX3 A;  2V77 A;  3PEI A;  4R3K A;  1DE4 C;  5CPA A;  4MFP A;  5EBV A;  4CGN A;  5LRJ A;  2V8G A;  3DR6 A;  2I79 A;  1ZLI A;  3GB0 A;  4OME A;  4CGL A;  5JH9 A;  4OC0 A;  1Y9W A;  4JZ0 A;  1LAP A;  4M6H A;  4ZY2 A;  4LQG A;  4X3R A;  1VKC A;  2Q0Y A;  3DDD A;  2OZU A;  1A2Z A;  2VI7 A;  2QML A;  4UWJ A;  4E2A A;  3R96 A;  2OOT A;  2FIW A;  4KUA A;  4H6Z A;  4A31 A;  2FCK A;  1S7F A;  1XMT A; 
#chains in the Genus database with same CATH homology
 4FUU A;  4K3N A;  5LYI A;  2JEW A;  1ZG7 A;  2BCO A;  3S9N A;  4P4F A;  4OP4 A;  2RFH A;  5LYL A;  4CPA A;  2PE3 A;  4JYW A;  1FNO A;  4MRI A;  2AFZ A;  3FMC A;  3IWW A;  3BI1 A;  2I3C A;  3L2N A;  2V8V A;  4MCP A;  2VL1 A;  3BXM A;  2OR4 A;  5K8N A;  4G1P A;  4MHY A;  2PVV A;  1VIX A;  1Z2L A;  2ZEG A;  2PJ4 A;  2EWB A;  4B6Z A;  3VH9 A;  3LWU A;  1DTD A;  4O23 A;  3IJ3 A;  1YW4 A;  1XBU A;  1CX8 A;  2ZEE A;  4ZY0 A;  5IB9 A;  4OID A;  1Q7L A;  2GRE A;  4P4I A;  2PIY A;  2POK A;  1NSA A;  4NGQ A;  4P10 A;  5JM6 A;  4H2K A;  3D67 A;  1F2P A;  3CDX A;  3QNV A;  5LRG A;  3IEH A;  1HDQ A;  2XEI A;  2WYR A;  5JGF A;  2BO9 A;  2PJ3 A;  2QVP A;  4MCR A;  4ZX8 A;  5K8M A;  2PJA A;  3V7Z A;  1TXR A;  1LFW A;  2XEG A;  3B2Y A;  4MHZ A;  3WC5 A;  4NGP A;  3GUX A;  1LOK A;  2ZEL A;  3D7H A;  3D7D A;  3KI9 A;  4KSI A;  3WC7 A;  4NFR A;  2C1C A;  5LRK A;  4FBE A;  1IGB A;  2BOA A;  7CPA A;  1GYT A;  2CIJ A;  4F9V A;  3BHX A;  4ZY1 A;  3S9L A;  3T8W A;  2ZEP A;  2HC9 A;  1AMP A;  4Z65 A;  3FF3 A;  2ZOF A;  1LAN A;  3KHZ A;  4FWU A;  1VGY A;  1CP7 A;  1AYE A;  2HB6 A;  1IY7 A;  3KQZ A;  1TKJ A;  4AXV A;  3VAR A;  4NJR A;  4BD9 A;  1TF8 A;  2ZED A;  4MXU A;  3MRU A;  5J1Q A;  4P45 A;  3CPA A;  5K8O A;  3JRU A;  2ZEF A;  1Y0Y A;  2PCU A;  3ISX A;  4A38 A;  1TKH A;  4PXB A;  3FVL A;  3PBB A;  4MCS A;  5THW A;  4ZYQ A;  4NGT A;  4MHN A;  4OC3 A;  3PFO A;  2PJC A;  3SI2 A;  4P4D A;  2QYV A;  1PCA A;  3K2K A;  3KAS A;  3HLP A;  4UIA A;  3WAB A;  2ABZ A;  4P44 A;  1CBX A;  3IIB A;  2AFU A;  2PIZ A;  2XEJ A;  1M4L A;  3HUV A;  3KHX A;  4UEF A;  4ZI6 A;  2CTC A;  4A37 A;  3ISZ A;  2J9A A;  2AFM A;  1RTQ A;  1OBR A;  3D4U A;  4P4J A;  4EFD A;  3KR5 A;  1PYT B;  4NGS A;  4W9Y A;  3KQX A;  2NYQ A;  3B3T A;  4ONW A;  1ZG8 A;  3N5F A;  5ELY A;  4UEE A;  2ANP A;  1CP6 A;  3SI1 A;  2NSM A;  2O4H A;  1YME A;  3SJG A;  2GU2 A;  3CPX A;  3D7G A;  4IHM A;  4R76 A;  2ZEO A;  2V8D A;  3PB7 X;  3D66 A;  5DS0 A;  3CT9 A;  3KZW A;  1R43 A;  2EK8 A;  1BAV A;  3IO1 A;  3PRT A;  2EK9 A;  3MN8 A;  2ZEM A;  2Q43 A;  3PB9 X;  1ELM P;  5LYD A;  3SJF A;  8CPA A;  4OKO A;  4YU9 A;  4WJB A;  1ARL A;  4RUH A;  4NGR A;  5I4M A;  3RBU A;  1HDU A;  3FJU A;  2XEF A;  2FVG A;  4F9U A;  4UEZ A;  4OC5 A;  3K9T A;  3NH5 A;  3RAM A;  3SJX A;  4PQA A;  3DLJ A;  1XMB A;  2C6C A;  4OC4 A;  5D29 A;  3WC6 A;  2IMO A;  4IK2 A;  2AFX A;  5D8N A;  1H8L A;  4DUK A;  5HVF A;  1YLO A;  4NJQ A;  2CTB A;  5LYF A;  3TC8 A;  3FED A;  3NH4 A;  4OC1 A;  4P4E A;  2Q4Z A;  4DYO A;  2IJZ A;  2AFW A;  3SI0 A;  3FX6 A;  3V38 A;  4Q7A A;  4TNU A;  2AFO A;  1XFO A;  1VHE A;  2C6G A;  1LAM A;  3NH8 A;  3FEE A;  5F09 A;  4PXE A;  4X8I A;  2PJ1 A;  2ZEN A;  4GM5 A;  3BI0 A;  3B35 A;  4IAV A;  4UIB A;  3D7F A;  1ARM A;  1KWM A;  2F7V A;  3PFE A;  4MMO A;  2WZN A;  3VAT A;  3NA6 A;  4NGN A;  1Z5R A;  1QMU A;  1LCP A;  2GLF A;  2PJ2 A;  1QQ9 A;  2PJ0 A;  4UF4 A;  3TX8 A;  4OC2 A;  1F2O A;  2AFS A;  3FH4 A;  3IFE A;  4R8F A;  1ZLH A;  4ZX9 A;  3H8G A;  2PJ6 A;  1ZG9 A;  5HVG A;  1TF9 A;  1R3N A;  2PJB A;  1TKF A;  1BLL E;  1CPS A;  2DEA A;  3PB8 X;  2F8H A;  4A39 A;  4PXC A;  3KL9 A;  4X2T A;  3NFZ A;  2IQ6 A;  1Y0R A;  4WWV A;  1YSJ A;  2PVW A;  4P6Y A;  2V8H A;  4PPZ A;  2PJ9 A;  3B7I A;  2C6P A;  2JBJ A;  3B3V A;  2PJ7 A;  3PB4 X;  4DJL A;  3PB6 X;  1F57 A;  4P4B A;  2ZEH A;  5HVH A;  2Q51 A;  3DGV A;  4MHP A;  1YW6 A;  4R7M A;  3WT4 A;  1BPN A;  1ELL P;  3KGQ A;  4A94 A;  1BPM A;  4MCQ A;  3SJE A;  4EME A;  4F8Z A;  3KR4 A;  1UWY A;  2RB7 A;  2G9D A;  3IC1 A;  3LMS A;  5K8P A;  1Z8L A;  3B3W A;  3GLJ A;  4PXD A;  6CPA A;  4NGM A;  2QJ8 A;  5HXD A;  2JBK A;  4OIW A;  1VHO A;  1CPX A;  1HEE A;  4FAI A;  4YWY A;  2ZOG A;  1FT7 A;  3FEC A;  3S9M A;  3H8E A;  1Y7E A;  5CBM A;  3D68 A;  4TWE A;  3H8F A;  1XJO A;  2CF4 A;  2PJ8 A;  3B3C A;  4R6T A;  1JQG A;  2O53 A;  3PBE A;  3B3S A;  1EE3 P;  2PJ5 A;  3RZA A;  1CG2 A;  3I1U A;  4EWT A;  1XRY A;  2GLJ A;  2PRQ A;  2V77 A;  3PEI A;  1DE4 C;  5CPA A;  5LRJ A;  2V8G A;  1ZLI A;  3GB0 A;  4OME A;  5JH9 A;  4OC0 A;  4JZ0 A;  1LAP A;  4ZY2 A;  4LQG A;  4X3R A;  2OOT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...