3FRMA

The crystal structure of a functionally unknown conserved protein from staphylococcus epidermidis atcc 12228.
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
252
structure length
252
Chain Sequence
AMSKITFKDIYIDGNKITEDSRKAIYLLPPQPLKYASNTWIYKTMPTMNQWLKDIEVQKKMHLNQSSYHLSFSFPANEKIDEVLLEKIRELGFQIGVLELYVIEAKALKELSRKRDVDIQLVSSNNINDYLHVYDAFARPFGDSYANMVKQHIYSSYNLDDIERLVAYVNHQPVGIVDIIMTDKTIEIDGFGVLEEFQHQGIGSEIQAYVGRMANERPVILVADGKDTAKDMYLRQGYVYQGFKYHILKENI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized conserved protein
publication title The crystal structure of a functionally unknown conserved protein from Staphylococcus epidermidis ATCC 12228.
rcsb
source organism Staphylococcus epidermidis
molecule tags Structural genomics, unknown function
total genus 70
structure length 252
sequence length 252
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
A PF18467 DUF5613 Domain of unknown function (DUF5613)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3frmA00
5EBVA 3PGPA 4M85A 3TOBA 5E96A 3EC4A 4QBJA 4K30A 2J8RA 3T90A 3H4QA 1S5KA 4PK3A 2FE7A 3V8IA 1J4JA 3S6FA 1YLEA 3PZJA 2P0WA 1XE4A 2BL1A 3DDDA 1KUYA 3SXNA 1N71A 3R96A 5KTDA 1R57A 5HMNA 4UBRA 4IF5A 4PSXA 3EY5A 3BLNA 1Z4RA 1MK4A 2PDOA 2B5GA 4GS4A 4ORFA 2CY2A 2VZZA 4U9ZA 1S7FA 3D3SA 1TIQA 3P2FA 4B5OA 4IUSA 4NCZA 3QAHA 4MY3A 1U6MA 3BJ8A 4XPKA 2RC4A 2ZW7A 4YGOA 3I3GA 2OU2A 2D4OA 4CRZB 2REFA 2FL4A 2J8NA 4JXQA 3B8GA 5H86A 1Z4EA 3D2PA 2K5TA 4JXRA 4E2AA 4H6ZA 1GHEA 2BSWA 3NE7A 4LX9A 4OAEA 2B58A 4R87A 4AVAA 1Y9KA 2DXQA 4CAWA 4KLVA 1VHSA 2PC1A 1KUVA 3F0AA 2VI7A 2FXFA 3FB3A 3JUWA 4F6AA 1IICA 1ON0A 4KUAA 2J8MA 3FIXA 4KOSA 3ZJ0A 1IYKA 2AJ6A 3W91A 4JWPA 5F48A 4AG7A 1KZFA 4KVME 5IB0A 1RXTA 3FBUA 2B3VA 2GIVA 4NSQA 4R57A 4YRHA 2Y0MA 2ZXVA 3TFYA 2Q04A 1BOBA 5KTAA 2Z0ZA 3KKWA 1PU9A 5IV0A 1YGHA 2GANA 1P4NA 2G3AA 4KOYA 2GE3A 2B5GB 5EC4A 3FRMA 4KOTA 3TCVA 2EVNA 4KORA 2ZW5A 1WWZA 4LUAA 2B3UA 3IWGA 4XPLA 1FY7A 3PP9A 1BO4A 2I79A 4I49A 1Y9WA 4KZTA 4H6UA 3MGDA 2WPXA 2ZPAA 1YX0A 3R1KA 3FXTA 2I00A 4FD6A 4B5PB 2CNMA 2B4DB 2PQ8A 3W6XA 2CNTA 4HNXB 1MJBA 3LODA 5JPHA 4MJ8A 3TO6A 3F8KA 2OZHA 2FT0A 2R7HA 3VWDA 3DR6A 4JJXA 3GYAA 3EXNA 4HKFA 1B87A 3FYNA 2Q44A 3G8WA 5ISVA 3BJ7A 4KLWA 2JDDA 4M3SA 4UWJA 2FCKA 2PR1A 3SXOA 3TTHA 1S7LA 1S7KA 2OH1A 3W6SA 4RI1A 4R3KA 1QSTA 2P6EA 4ZBGA 4NXYA 3N7ZA 4MBUA 2VBQA 4OLLA 3TT2A 1Q2DA 2OZGA 1NSLA 3D2MA 3OWCA 2FS5A 2HUZA 5KTCA 2VQYA 3I9SA 1Y7RA 3EO4A 4KOXA 2NMTA 1M44A 1YR0A 1UFHA 4HNYB 2VZYA 5C82A 2ZW4A 5GCNA 1WK4A 3QB8A 2Q4VA 1MJ9A 3R95A 1IB1E 2OZUA 2R8VA 1QSOA 1XMTA 3K9UA 4JLYA 4FD5A 2Q7BA 3ZZIA 1L0CA 4NF1A 5DWMA 5F46A 2FIWA 1QSNA 1QSMA 2P6FA 1QSRA 3CXPA 4ONUA 4F0YA 4XNHB 4AVBA 3CXQA 4JD6A 4Y49B 1P0HA 3S6HA 4AB7A 2R1IA 4RS2A 4J3GA 2JLMA 2QECA 5I0CA 1Z9UA 4R9MA 2H5MA 3R9EA 3TOAA 2ARHA 2Q0YA 2A4NA 4U5YA 2C27A 4AG9A 3E0KA 1YVOA 2CNSA 2BEIA 4FD4A 4H89A 3S6KA 4KVOE 1IIDA 4PSWA 2PSWA 1B6BA 1S7NA 4L8AA 3TO7A 1M4GA 4R3LA 1PUAA 3FNCA 4PV6A 5HH1A 1Q2YA 4KOUA 4AVCA 4XNHC 1M4IA 1I12A 1MJAA 4Y49C 4NEXA 5DWNA 3TO9A 2Z11A 2B4BA 4MI4A 4OADA 3TE4A 1V0CA 4CS0B 4QUSA 2VXKA 3S6GA 3D8PA 4E8OA 2WPWA 4KUBA 1XF8A 3JVNA 4CAVA 4QVTA 4HNWB 4L89A 2Q4YA 1LRZA 5J8FA 3DSBA 4YFJA 2X7BA 3EFAA 4U9YA 5CNPA 1S60A 1XIXA 2P6GA 4DNCA 3UY5A 2ATRA 3R9GA 4KVXA 3R9FA 1NE9A 4XPDB 4B5PA 2HV2A 5JQ4A 3GKRA 4KOWA 2B4DA 2HQYA 3LD2A 2ZW6A 1VKCA 4CRYB 3F5BA 4EVYA 1SQHA 1I21A 4MY0A 3SHPA 4CAXA 1YVKA 1KUXA 1I1DA 4MHDA 3GY9A 2QMLA 3CXSA 3G3SA 3P2HA 3C26A 5IX3A 4UA3A 4FD7A 1S3ZA 1OZPA 2AE6A 2VEZA 4QC6A 1Q2CA 3T9YA 1RO5A 4UWIA 4X5KA 2Z10A 5C88A 1YK3A 4KOVA 4PK2A 1CJWA 2EUIA 2PRBA 4II9A 4E0AA 4QB9A 1M4DA 2IL4A 5FVJA 1M1DA 2REEA 1K4JA 2PR8A 2O28A 2FIAA 2KCWA 2FSRA 2OB0A 2F5IA 4BMHA 5H84A 1XEBA 2R98A 2JEVA 2G3TA 5F49A 1YREA 2G0BA 4XPDC 5F47A 3DR8A 3RYOA 1IYLA 2BUEA 3IGRA 2D4PA 5J8CA 1CM0A 1NMTA 3WR7A 3VWEA 3DNSA 2QIRA 2JDCA
chains in the Genus database with same CATH superfamily
3LMSA 3PGPA 4M85A 2G9DA 5EBVA 3TOBA 5E96A 5G1ZA 5G22A 1TF8A 3EC4A 4DJLA 5HXDA 4PQAA 4UEFA 4QBJA 4K30A 2GFQA 2J8RA 2AFSA 3D66A 3T90A 3H4QA 1S5KA 4JZ0A 4PK3A 4TWEA 4FUUA 3LACA 1Z8WA 4Q7AA 2YNDA 3KZWA 3FEEA 2FE7A 3V8IA 4OKOA 3RZAA 1LOKA 1J4JA 3S6FA 4CGLA 3B7IA 1ZLHA 4P4DA 4FAIA 1YLEA 4P4IA 4F9VA 4NJQA 3KASA 3PZJA 2P0WA 4KSFA 4A32A 1XE4A 2BL1A 3DDDA 1KUYA 3SXNA 4CYPA 1YW4A 3SJFA 1N71A 3BI1A 3R96A 1HEEA 1IOFA 4UCPA 4ZYQA 2GLJA 1R57A 2J9AA 3GLJA 1OBRA 4IF5A 4PSXA 4UBRA 3EY5A 5HMNA 1KWMA 4F0XA 3BLNA 1X10A 1Z4RA 1MK4A 2PDOA 2B5GA 2ZEPA 5DS0A 3FECA 4GS4A 3PB6X 4OIDA 4ORFA 2CY2A 5AGEA 2VZZA 4U9ZA 1TKHA 3KQZA 4CGMA 4UF4A 1S7FA 3D3SA 2Z3PA 1TIQA 1VHEA 3ISXA 2Q43A 3ISZA 3P2FA 4P4BA 4B5OA 4IUSA 4NCZA 2Q4ZA 3QAHA 4MY3A 4MHPA 1U6MA 4P10A 3BJ8A 5J1QA 4XPKA 1HDUA 1TKJA 1XFOA 2RC4A 4MXUA 2AFWA 2ZW7A 3I3GA 1JQGA 2OU2A 2EO8A 4YGOA 5I4MA 2D4OA 3RO0A 4CRZB 2REFA 2FL4A 3BXMA 2OR4A 2EBJA 4IAVA 5HVFA 2J8NA 3V38A 2PJAA 2PRQA 4JXQA 3B8GA 5H86A 1Z4EA 4DUKA 3D67A 1HDQA 3D2PA 2K5TA 3HLPA 4JXRA 4E2AA 4H6ZA 1AMPA 2C1CA 4B13A 1GHEA 3JTKA 4B11A 2BSWA 3NE7A 3B3VA 3KHZA 2AFXA 3SJXA 4LX9A 4OAEA 4PXBA 2B58A 2V8HA 1TKFA 2BOAA 4R87A 4AVAA 3SJEA 1Y9KA 2DXQA 4KS9A 4PPZA 4CAWA 4KLVA 3H8FA 1VHSA 2ODFA 4ZY2A 1DE4C 2PC1A 1KUVA 3F0AA 2VI7A 2FXFA 3N5FA 3FB3A 3JUWA 6CPAA 2QIRA 4F6AA 1IICA 5AG4A 1ON0A 4O23A 3WC7A 4KUAA 2J8MA 3FIXA 4KOSA 3ZJ0A 1Z2LA 1IYKA 3BI0A 2AJ6A 3W91A 2GREA 2O53A 2PE3A 4JWPA 5F48A 5K8NA 4AG7A 1KZFA 4F9UA 4KVME 1TXRA 1RXTA 3FBUA 4CAFA 5IB0A 2B3VA 1XJOA 2EK9A 2GIVA 1BAVA 4NSQA 4R57A 4YRHA 2CXAA 3IO1A 2Y0MA 4NGRA 2ZXVA 3TFYA 2Q04A 2PJ7A 1BOBA 3H5ZA 5K8MA 1NSAA 5K8OA 5KTAA 2Z0ZA 3KKWA 1PU9A 3LWUA 4K3NA 4H2KA 4OC0A 4R7MA 5IV0A 4A94A 4P4JA 2CTCA 1YGHA 2GANA 1P4NA 2G3AA 2ZEEA 3FH4A 3PB7X 4KOYA 4CGNA 2GE3A 4MHZA 1CP7A 2Z3LA 2B5GB 5EC4A 2BO9A 3FRMA 4KOTA 2PJ4A 3B35A 3TCVA 2EVNA 2ZELA 4OP4A 4KORA 2ZW5A 1IY7A 1WWZA 4LUAA 2C6GA 2B3UA 2QJ8A 3IWGA 4PXDA 3PB4X 4XPLA 1FY7A 3PP9A 1BO4A 2I79A 4I49A 1Y9WA 4KZTA 4H6UA 3NFZA 2PJ8A 1Q7LA 4A33A 3K9TA 3MGDA 2WPXA 3IIBA 3I1UA 3PBEA 2ZPAA 1YX0A 4MFKA 3R1KA 3FXTA 2I00A 1Y0YA 1LANA 4FD6A 2CNMA 4B5PB 4YU9A 2RB7A 2F7VA 2WZNA 2ZEMA 2B4DB 5G20A 2PQ8A 2AFZA 2BCOA 3W6XA 2CNTA 4GXHA 4HNXB 4P4FA 4M6HA 1ZLIA 4A38A 1GYTA 4KSAA 2ZEGA 1MJBA 3LODA 4CPAA 5JPHA 1FNOA 1ARLA 3GB0A 3PBBA 4MJ8A 3TO6A 4NGPA 1EE3P 1Y7EA 5BWAB 3F8KA 3PFOA 4NGNA 3PRTA 2OZHA 4YWYA 2FT0A 2R7HA 3WC5A 3FJUA 3VWDA 3DR6A 4JJXA 1LFWA 3FX6A 4MFJA 4AXVA 2PIZA 2XEIA 3V7ZA 1QMUA 2PIYA 1VHOA 3GYAA 3EXNA 4HKFA 1B87A 3FYNA 4MMOA 2Q44A 4R8FA 3G8WA 4UEZA 2ABZA 5ISVA 3BJ7A 4KLWA 1Y0RA 2JDDA 2V77A 2IMOA 5THWA 5HVGA 4M3SA 7CPAA 2YNEA 2FCKA 4UWJA 5D8NA 4ZY0A 2PR1A 3SXOA 4X8IA 3TTHA 1S7LA 1S7KA 2Z3OA 2OH1A 3W6SA 4M6GA 4RI1A 4R3KA 2WSAA 5A28A 1QSTA 2P6EA 1ELLP 4ZBGA 4NXYA 4CYNA 3N7ZA 3PB8X 4MBUA 4ZY1A 4X3RA 2VBQA 2PJ5A 2GLFA 4OLLA 1Z8XA 3TT2A 4B6ZA 1Q2DA 5LRJA 4BD9A 4A37A 2OZGA 1NSLA 1LAMA 1A2ZA 3D2MA 3OWCA 3NE8A 2FS5A 2ZEHA 2HUZA 5KTCA 2VQYA 3D68A 3I9SA 4GM5A 1Y7RA 5AG7A 3IC1A 4NJRA 5K8PA 5G21A 2DF5A 4NGSA 3EO4A 4KOXA 4MFZA 2NMTA 1M44A 4G1PA 4W9YA 2ZENA 4CAEA 1YR0A 4ZI6A 1UFHA 1YLOA 4HNYB 1F2OA 2AFOA 1F2PA 2VZYA 4IHMA 1M4LA 2ZW4A 4UCNA 5GCNA 3RBUA 1WK4A 4A30A 2WYRA 3QB8A 2Q4VA 1MJ9A 4MFQA 4P45A 3R95A 1ZG8A 1IB1E 2OZUA 2R8VA 1QSOA 2WUUA 1XRYA 4MRIA 1R3NA 3RNZA 4BINA 4P44A 4C2ZA 2PCUA 1XMTA 3K9UA 3PFEA 3DLJA 4JLYA 1CPSA 4FD5A 1XBUA 2Q7BA 1L0CA 3ZZIA 5HVHA 4NF1A 4UEEA 3D7DA 5DWMA 1R43A 1X12A 5F46A 2Q51A 4FBEA 2FIWA 1BPNA 2FVGA 4UIAA 2DPSA 4A95A 1QSNA 1YSJA 1QSMA 3H8GA 2P6FA 1QSRA 3PEIA 3WT4A 5IB9A 3CXPA 5CPAA 1Z5RA 4ONUA 2JEWA 4F0YA 4MCRA 3KGQA 4XNHB 4AVBA 5C82A 2C6PA 3CXQA 4JD6A 5AG6A 5ELYA 4Y49B 1P0HA 3B3WA 3S6HA 4AB7A 2R1IA 1ARMA 3MN8A 4RS2A 2YGWA 1YQEA 4J3GA 2JLMA 2QECA 5I0CA 1Z9UA 2ZEOA 4R9MA 2H5MA 3R9EA 1JWQA 1ZG7A 1ZG9A 3IU2A 1LCPA 3TOAA 4MCQA 3VATA 2ARHA 2IJZA 1CX8A 5EMIA 4B10A 3H8EA 3PB9X 3NH5A 1F57A 2Q0YA 2XEJA 3CPAA 3B3SA 2O4HA 2EK8A 2JBKA 1VIXA 2YNCA 2A4NA 4U5YA 2C27A 4AG9A 2RFHA 1QQ9A 4PXEA 2PJ2A 4LQGA 1CP6A 2XEFA 3E0KA 1YVOA 2CNSA 2Z3NA 2BEIA 3GIUA 2HC9A 2IQ6A 4FD4A 2ZOFA 3IWWA 4B14A 2I3CA 4ZX9A 4OIWA 4H89A 2ZEDA 3S6KA 2HB6A 4UCMA 4KVOE 4RUHA 2CF4A 1IIDA 4PSWA 2PSWA 3S9NA 2NYQA 1TF9A 3QAYA 1B6BA 1DTDA 1S7NA 4L8AA 3TO7A 4MCPA 1M4GA 1CG2A 4R3LA 1PUAA 4OC1A 2VL1A 3FNCA 1IU8A 5JH9A 5LYIA 4R6TA 4PV6A 3MRUA 4OMEA 5HH1A 1Q2YA 4PXCA 4NFRA 4KOUA 3IU1A 4AVCA 3GUXA 4C68A 4Q36A 5KTDA 3FEDA 4XNHC 3CT9A 5D29A 1M4IA 1I12A 1IGBA 1ELMP 1MJAA 4UFWA 4Y49C 2C6CA 4NEXA 5DWNA 4P6YA 4OC5A 4MHNA 2PVWA 3D4UA 4NGTA 3TC8A 2Z11A 2B4BA 4FWUA 3TO9A 4CYOA 3FMCA 4DYOA 5F09A 2AFMA 1VGYA 4WJBA 4X2TA 3KR5A 4MI4A 4OADA 4A39A 1V0CA 3B3TA 4UFVA 3TE4A 4CS0B 4CYQA 5LYLA 1FT7A 4NGMA 4QUSA 2VXKA 1Z8TA 2AFUA 3D8PA 3S6GA 1CPXA 2Z3MA 2GU2A 4E8OA 2V8DA 2QVPA 2PVVA 2WPWA 3SJGA 4KUBA 1YMEA 3SI0A 2PJ1A 2PJ6A 1XF8A 3JVNA 4CGPA 2V8GA 3BHXA 1LAPA 4CAVA 2V8VA 4QVTA 2ANPA 3NA6A 4HNWB 3L2NA 2Q4YA 4L89A 2ZOGA 1LRZA 5J8FA 3DSBA 4YFJA 2X7BA 3EFAA 4U9YA 2NSMA 5CNPA 1S60A 3K2KA 1XIXA 2P6GA 3KQXA 4C7HA 4DNCA 2EWBA 4EWTA 3UY5A 3JRUA 5AG5A 2ATRA 3R9GA 4CGOA 2DPTA 4KVXA 4MHYA 3B3CA 3R9FA 4ZGYB 4R76A 3SI1A 1NE9A 3QNVA 3IFEA 2JBJA 4XPDB 4B5PA 2HV2A 3RAMA 2PJCA 5JQ4A 3GKRA 4KOWA 5LYFA 2B4DA 2HQYA 3LD2A 3D7FA 2ZW6A 3WABA 4MFPA 3CDXA 1VKCA 5LRGA 4BBHA 4A2ZA 2F8HA 4TNUA 1Z8LA 4CRYB 3F5BA 2Z3KA 3SI2A 4UIBA 3D7GA 4EVYA 1SQHA 1I21A 2CIJA 4MY0A 8CPAA 3KHXA 3IEHA 3S9MA 4C2XA 3SHPA 4CAXA 4C2YA 1YVKA 1KUXA 3FF3A 3NH4A 1I1DA 4B12A 4MHDA 2POKA 2QMLA 3A9LA 3GY9A 4OC4A 3CXSA 3G3SA 3P2HA 3C26A 3S9LA 1PCAA 5IX3A 4UA3A 1UWYA 4FD7A 1S3ZA 1OZPA 2AE6A 4RN7A 2VEZA 4QC6A 3KI9A 1Q2CA 4ONWA 3T9YA 1H8LA 1RO5A 4UWIA 5JGFA 4X5KA 2PJBA 2Z10A 4JYWA 1BPMA 5C88A 1ZO0A 2XEGA 4LQ6A 4Z65A 4EMEA 1YK3A 4KOVA 1IOIA 4PK2A 1CJWA 2EUIA 2PRBA 3NH8A 3TX8A 5JM6A 4II9A 5CBMA 4E0AA 1YW6A 4WWVA 3KL9A 3WC6A 5LRKA 3IWEA 2ZEFA 4QB9A 1M4DA 4EFDA 2IL4A 4P4EA 3FVLA 5FVJA 4HPSA 3D7HA 1M1DA 1AYEA 1K4JA 2PR8A 2REEA 1AUGA 4NGQA 2O28A 4OC2A 2YNCC 3VARA 3T8WA 2FIAA 2KCWA 2FSRA 2OB0A 2F5IA 3CZXA 4KSIA 3VH9A 4BMHA 2CTBA 5H84A 2OOTA 3KR4A 1XEBA 4OC3A 2DEAA 2R98A 3CPXA 2JEVA 3DGVA 3IJ3A 2G3TA 2QYVA 5F49A 2PJ9A 1YREA 2G0BA 1CBXA 2PJ0A 3HUVA 4XPDC 4UFXA 4M6IA 5F47A 3DR8A 3RYOA 1IYLA 2BUEA 2PJ3A 3IGRA 2D4PA 5J8CA 5A27A 5LYDA 4F8ZA 4MFLA 3B2YA 4ZX8A 4IK2A 4MCSA 1CM0A 1XOVA 4C7IA 1NMTA 3WR7A 1XMBA 1BLLE 3VWEA 2Q7SA 3DNSA 4Q38A 4A31A 1RTQA 2JDCA 1PYTB
chains in the Genus database with same CATH topology
5EBVA 3PGPA 4M85A 3TOBA 5E96A 5G1ZA 5G22A 3EC4A 4QBJA 4K30A 2J8RA 3T90A 3H4QA 1S5KA 4PK3A 2YNDA 2FE7A 3V8IA 1J4JA 3S6FA 4CGLA 1YLEA 3PZJA 2P0WA 4KSFA 4A32A 1XE4A 2BL1A 3DDDA 1KUYA 3SXNA 4CYPA 1N71A 3R96A 4UCPA 5KTDA 1R57A 5HMNA 4UBRA 4IF5A 4PSXA 3EY5A 4F0XA 3BLNA 1Z4RA 1MK4A 2PDOA 2B5GA 5AGEA 4GS4A 4ORFA 2CY2A 2VZZA 4U9ZA 4CGMA 1S7FA 3D3SA 2Z3PA 1TIQA 3P2FA 4B5OA 4IUSA 4NCZA 3QAHA 4MY3A 1U6MA 3BJ8A 4XPKA 2RC4A 2ZW7A 4YGOA 3I3GA 2OU2A 2D4OA 4CRZB 2REFA 2FL4A 2J8NA 4JXQA 3B8GA 5H86A 1Z4EA 3D2PA 2K5TA 4JXRA 4E2AA 4H6ZA 4B13A 1GHEA 3JTKA 4B11A 2BSWA 3NE7A 4LX9A 4OAEA 2B58A 4R87A 4AVAA 1Y9KA 2DXQA 4KS9A 4CAWA 4KLVA 1VHSA 2PC1A 1KUVA 3F0AA 2VI7A 2FXFA 3FB3A 3JUWA 4F6AA 1IICA 5AG4A 1ON0A 4KUAA 2J8MA 3FIXA 4KOSA 3ZJ0A 1IYKA 2AJ6A 3W91A 4JWPA 5F48A 4AG7A 1KZFA 4KVME 4CAFA 1RXTA 3FBUA 5IB0A 2B3VA 2GIVA 4NSQA 4R57A 4YRHA 2CXAA 2Y0MA 2ZXVA 3TFYA 2Q04A 1BOBA 3H5ZA 5KTAA 2Z0ZA 3KKWA 1PU9A 5IV0A 1YGHA 2GANA 1P4NA 2G3AA 4KOYA 4CGNA 2GE3A 2Z3LA 2B5GB 5EC4A 3FRMA 4KOTA 3TCVA 2EVNA 4KORA 2ZW5A 1WWZA 4LUAA 2B3UA 3IWGA 4XPLA 1FY7A 3PP9A 1BO4A 2I79A 4I49A 1Y9WA 4KZTA 4H6UA 4A33A 3MGDA 2WPXA 2ZPAA 1YX0A 4MFKA 3R1KA 3FXTA 2I00A 4FD6A 4B5PB 2CNMA 2B4DB 5G20A 2PQ8A 3W6XA 2CNTA 4HNXB 4KSAA 1MJBA 3LODA 5JPHA 5BWAB 4MJ8A 3TO6A 3F8KA 2OZHA 2FT0A 2R7HA 3VWDA 3DR6A 4JJXA 4MFJA 3GYAA 3EXNA 4HKFA 1B87A 3FYNA 2Q44A 3G8WA 5ISVA 3BJ7A 4KLWA 2JDDA 4M3SA 2YNEA 2FCKA 4UWJA 2PR1A 3SXOA 3TTHA 1S7LA 1S7KA 2Z3OA 2OH1A 3W6SA 4RI1A 4R3KA 2WSAA 5A28A 1QSTA 2P6EA 4ZBGA 4CYNA 4NXYA 3N7ZA 4MBUA 2VBQA 4OLLA 3TT2A 1Q2DA 2OZGA 1NSLA 3D2MA 3OWCA 2FS5A 2HUZA 5KTCA 2VQYA 3I9SA 1Y7RA 5AG7A 5G21A 3EO4A 4KOXA 4MFZA 2NMTA 1M44A 4CAEA 1YR0A 1UFHA 4HNYB 2VZYA 5C82A 4UCNA 2ZW4A 5GCNA 4A30A 1WK4A 3QB8A 2Q4VA 1MJ9A 4MFQA 3R95A 1IB1E 2OZUA 2R8VA 1QSOA 2WUUA 4C2ZA 1XMTA 3K9UA 4JLYA 4FD5A 2Q7BA 3ZZIA 1L0CA 4NF1A 5DWMA 5F46A 2FIWA 2DPSA 4A95A 1QSNA 1QSMA 2P6FA 1QSRA 3CXPA 4ONUA 4F0YA 4XNHB 4AVBA 3CXQA 4JD6A 5AG6A 4Y49B 1P0HA 3S6HA 4AB7A 2R1IA 4RS2A 2YGWA 4J3GA 2JLMA 2QECA 5I0CA 1Z9UA 4R9MA 2H5MA 3R9EA 3TOAA 3IU2A 2ARHA 4B10A 2Q0YA 2YNCA 2A4NA 4U5YA 2C27A 4AG9A 3E0KA 1YVOA 2CNSA 2Z3NA 2BEIA 4FD4A 4B14A 4H89A 3S6KA 4UCMA 4KVOE 1IIDA 4PSWA 2PSWA 1B6BA 1S7NA 4L8AA 3TO7A 1M4GA 4R3LA 1PUAA 3FNCA 4PV6A 5HH1A 1Q2YA 4KOUA 3IU1A 4AVCA 4C68A 4Q36A 4XNHC 1M4IA 1I12A 1MJAA 4UFWA 4Y49C 4NEXA 5DWNA 4CYOA 3TO9A 2Z11A 2B4BA 4MI4A 4OADA 3TE4A 1V0CA 4UFVA 4CS0B 4CYQA 4QUSA 2VXKA 3S6GA 3D8PA 2Z3MA 4E8OA 2WPWA 4KUBA 1XF8A 3JVNA 4CGPA 4CAVA 4QVTA 4HNWB 4L89A 2Q4YA 1LRZA 5J8FA 3DSBA 4YFJA 2X7BA 3EFAA 4U9YA 5CNPA 1S60A 4C7HA 1XIXA 2P6GA 4DNCA 3UY5A 5AG5A 2ATRA 3R9GA 4CGOA 2DPTA 4KVXA 3R9FA 4ZGYB 1NE9A 4XPDB 4B5PA 2HV2A 5JQ4A 3GKRA 4KOWA 2B4DA 2HQYA 3LD2A 2ZW6A 4MFPA 1VKCA 4BBHA 4A2ZA 4CRYB 3F5BA 2Z3KA 4EVYA 1SQHA 1I21A 4MY0A 4C2XA 3SHPA 4CAXA 4C2YA 1YVKA 1KUXA 1I1DA 4B12A 4MHDA 3GY9A 2QMLA 3A9LA 3CXSA 3G3SA 3P2HA 3C26A 5IX3A 4UA3A 4FD7A 1S3ZA 1OZPA 2AE6A 2VEZA 4QC6A 1Q2CA 3T9YA 1RO5A 4UWIA 4X5KA 2Z10A 5C88A 1ZO0A 1YK3A 4KOVA 4PK2A 1CJWA 2EUIA 2PRBA 4II9A 4E0AA 3IWEA 4QB9A 1M4DA 2IL4A 5FVJA 1M1DA 2REEA 1K4JA 2PR8A 2O28A 2YNCC 2FIAA 2KCWA 2FSRA 2OB0A 2F5IA 4BMHA 5H84A 1XEBA 2R98A 2JEVA 2G3TA 5F49A 1YREA 2G0BA 4XPDC 4UFXA 5F47A 3DR8A 3RYOA 1IYLA 2BUEA 3IGRA 2D4PA 5J8CA 5A27A 4MFLA 1CM0A 4C7IA 1NMTA 3WR7A 3VWEA 3DNSA 4Q38A 4A31A 2QIRA 2JDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EBV A;  3PGP A;  4M85 A;  3TOB A;  5E96 A;  3EC4 A;  4QBJ A;  4K30 A;  2J8R A;  3T90 A;  3H4Q A;  1S5K A;  4PK3 A;  2FE7 A;  3V8I A;  1J4J A;  3S6F A;  1YLE A;  3PZJ A;  2P0W A;  1XE4 A;  2BL1 A;  3DDD A;  1KUY A;  3SXN A;  1N71 A;  3R96 A;  5KTD A;  1R57 A;  5HMN A;  4UBR A;  4IF5 A;  4PSX A;  3EY5 A;  3BLN A;  1Z4R A;  1MK4 A;  2PDO A;  2B5G A;  4GS4 A;  4ORF A;  2CY2 A;  2VZZ A;  4U9Z A;  1S7F A;  3D3S A;  1TIQ A;  3P2F A;  4B5O A;  4IUS A;  4NCZ A;  3QAH A;  4MY3 A;  1U6M A;  3BJ8 A;  4XPK A;  2RC4 A;  2ZW7 A;  4YGO A;  3I3G A;  2OU2 A;  2D4O A;  4CRZ B;  2REF A;  2FL4 A;  2J8N A;  4JXQ A;  3B8G A;  5H86 A;  1Z4E A;  3D2P A;  2K5T A;  4JXR A;  4E2A A;  4H6Z A;  1GHE A;  2BSW A;  3NE7 A;  4LX9 A;  4OAE A;  2B58 A;  4R87 A;  4AVA A;  1Y9K A;  2DXQ A;  4CAW A;  4KLV A;  1VHS A;  2PC1 A;  1KUV A;  3F0A A;  2VI7 A;  2FXF A;  3FB3 A;  3JUW A;  4F6A A;  1IIC A;  1ON0 A;  4KUA A;  2J8M A;  3FIX A;  4KOS A;  3ZJ0 A;  1IYK A;  2AJ6 A;  3W91 A;  4JWP A;  5F48 A;  4AG7 A;  1KZF A;  4KVM E;  5IB0 A;  1RXT A;  3FBU A;  2B3V A;  2GIV A;  4NSQ A;  4R57 A;  4YRH A;  2Y0M A;  2ZXV A;  3TFY A;  2Q04 A;  1BOB A;  5KTA A;  2Z0Z A;  3KKW A;  1PU9 A;  5IV0 A;  1YGH A;  2GAN A;  1P4N A;  2G3A A;  4KOY A;  2GE3 A;  2B5G B;  5EC4 A;  3FRM A;  4KOT A;  3TCV A;  2EVN A;  4KOR A;  2ZW5 A;  1WWZ A;  4LUA A;  2B3U A;  3IWG A;  4XPL A;  1FY7 A;  3PP9 A;  1BO4 A;  2I79 A;  4I49 A;  1Y9W A;  4KZT A;  4H6U A;  3MGD A;  2WPX A;  2ZPA A;  1YX0 A;  3R1K A;  3FXT A;  2I00 A;  4FD6 A;  4B5P B;  2CNM A;  2B4D B;  2PQ8 A;  3W6X A;  2CNT A;  4HNX B;  1MJB A;  3LOD A;  5JPH A;  4MJ8 A;  3TO6 A;  3F8K A;  2OZH A;  2FT0 A;  2R7H A;  3VWD A;  3DR6 A;  4JJX A;  3GYA A;  3EXN A;  4HKF A;  1B87 A;  3FYN A;  2Q44 A;  3G8W A;  5ISV A;  3BJ7 A;  4KLW A;  2JDD A;  4M3S A;  4UWJ A;  2FCK A;  2PR1 A;  3SXO A;  3TTH A;  1S7L A;  1S7K A;  2OH1 A;  3W6S A;  4RI1 A;  4R3K A;  1QST A;  2P6E A;  4ZBG A;  4NXY A;  3N7Z A;  4MBU A;  2VBQ A;  4OLL A;  3TT2 A;  1Q2D A;  2OZG A;  1NSL A;  3D2M A;  3OWC A;  2FS5 A;  2HUZ A;  5KTC A;  2VQY A;  3I9S A;  1Y7R A;  3EO4 A;  4KOX A;  2NMT A;  1M44 A;  1YR0 A;  1UFH A;  4HNY B;  2VZY A;  5C82 A;  2ZW4 A;  5GCN A;  1WK4 A;  3QB8 A;  2Q4V A;  1MJ9 A;  3R95 A;  1IB1 E;  2OZU A;  2R8V A;  1QSO A;  1XMT A;  3K9U A;  4JLY A;  4FD5 A;  2Q7B A;  3ZZI A;  1L0C A;  4NF1 A;  5DWM A;  5F46 A;  2FIW A;  1QSN A;  1QSM A;  2P6F A;  1QSR A;  3CXP A;  4ONU A;  4F0Y A;  4XNH B;  4AVB A;  3CXQ A;  4JD6 A;  4Y49 B;  1P0H A;  3S6H A;  4AB7 A;  2R1I A;  4RS2 A;  4J3G A;  2JLM A;  2QEC A;  5I0C A;  1Z9U A;  4R9M A;  2H5M A;  3R9E A;  3TOA A;  2ARH A;  2Q0Y A;  2A4N A;  4U5Y A;  2C27 A;  4AG9 A;  3E0K A;  1YVO A;  2CNS A;  2BEI A;  4FD4 A;  4H89 A;  3S6K A;  4KVO E;  1IID A;  4PSW A;  2PSW A;  1B6B A;  1S7N A;  4L8A A;  3TO7 A;  1M4G A;  4R3L A;  1PUA A;  3FNC A;  4PV6 A;  5HH1 A;  1Q2Y A;  4KOU A;  4AVC A;  4XNH C;  1M4I A;  1I12 A;  1MJA A;  4Y49 C;  4NEX A;  5DWN A;  3TO9 A;  2Z11 A;  2B4B A;  4MI4 A;  4OAD A;  3TE4 A;  1V0C A;  4CS0 B;  4QUS A;  2VXK A;  3S6G A;  3D8P A;  4E8O A;  2WPW A;  4KUB A;  1XF8 A;  3JVN A;  4CAV A;  4QVT A;  4HNW B;  4L89 A;  2Q4Y A;  1LRZ A;  5J8F A;  3DSB A;  4YFJ A;  2X7B A;  3EFA A;  4U9Y A;  5CNP A;  1S60 A;  1XIX A;  2P6G A;  4DNC A;  3UY5 A;  2ATR A;  3R9G A;  4KVX A;  3R9F A;  1NE9 A;  4XPD B;  4B5P A;  2HV2 A;  5JQ4 A;  3GKR A;  4KOW A;  2B4D A;  2HQY A;  3LD2 A;  2ZW6 A;  1VKC A;  4CRY B;  3F5B A;  4EVY A;  1SQH A;  1I21 A;  4MY0 A;  3SHP A;  4CAX A;  1YVK A;  1KUX A;  1I1D A;  4MHD A;  3GY9 A;  2QML A;  3CXS A;  3G3S A;  3P2H A;  3C26 A;  5IX3 A;  4UA3 A;  4FD7 A;  1S3Z A;  1OZP A;  2AE6 A;  2VEZ A;  4QC6 A;  1Q2C A;  3T9Y A;  1RO5 A;  4UWI A;  4X5K A;  2Z10 A;  5C88 A;  1YK3 A;  4KOV A;  4PK2 A;  1CJW A;  2EUI A;  2PRB A;  4II9 A;  4E0A A;  4QB9 A;  1M4D A;  2IL4 A;  5FVJ A;  1M1D A;  2REE A;  1K4J A;  2PR8 A;  2O28 A;  2FIA A;  2KCW A;  2FSR A;  2OB0 A;  2F5I A;  4BMH A;  5H84 A;  1XEB A;  2R98 A;  2JEV A;  2G3T A;  5F49 A;  1YRE A;  2G0B A;  4XPD C;  5F47 A;  3DR8 A;  3RYO A;  1IYL A;  2BUE A;  3IGR A;  2D4P A;  5J8C A;  1CM0 A;  1NMT A;  3WR7 A;  3VWE A;  3DNS A;  2QIR A;  2JDC A; 
#chains in the Genus database with same CATH topology
 3LMS A;  3PGP A;  4M85 A;  2G9D A;  5EBV A;  3TOB A;  5E96 A;  5G1Z A;  5G22 A;  1TF8 A;  3EC4 A;  4DJL A;  5HXD A;  4PQA A;  4UEF A;  4QBJ A;  4K30 A;  2GFQ A;  2J8R A;  2AFS A;  3D66 A;  3T90 A;  3H4Q A;  1S5K A;  4JZ0 A;  4PK3 A;  4TWE A;  4FUU A;  3LAC A;  1Z8W A;  4Q7A A;  2YND A;  3KZW A;  3FEE A;  2FE7 A;  3V8I A;  4OKO A;  3RZA A;  1LOK A;  1J4J A;  3S6F A;  4CGL A;  3B7I A;  1ZLH A;  4P4D A;  4FAI A;  1YLE A;  4P4I A;  4F9V A;  4NJQ A;  3KAS A;  3PZJ A;  2P0W A;  4KSF A;  4A32 A;  1XE4 A;  2BL1 A;  3DDD A;  1KUY A;  3SXN A;  4CYP A;  1YW4 A;  3SJF A;  1N71 A;  3BI1 A;  3R96 A;  1HEE A;  1IOF A;  4UCP A;  4ZYQ A;  2GLJ A;  1R57 A;  2J9A A;  3GLJ A;  1OBR A;  4IF5 A;  4PSX A;  4UBR A;  3EY5 A;  5HMN A;  1KWM A;  4F0X A;  3BLN A;  1X10 A;  1Z4R A;  1MK4 A;  2PDO A;  2B5G A;  2ZEP A;  5DS0 A;  3FEC A;  4GS4 A;  3PB6 X;  4OID A;  4ORF A;  2CY2 A;  5AGE A;  2VZZ A;  4U9Z A;  1TKH A;  3KQZ A;  4CGM A;  4UF4 A;  1S7F A;  3D3S A;  2Z3P A;  1TIQ A;  1VHE A;  3ISX A;  2Q43 A;  3ISZ A;  3P2F A;  4P4B A;  4B5O A;  4IUS A;  4NCZ A;  2Q4Z A;  3QAH A;  4MY3 A;  4MHP A;  1U6M A;  4P10 A;  3BJ8 A;  5J1Q A;  4XPK A;  1HDU A;  1TKJ A;  1XFO A;  2RC4 A;  4MXU A;  2AFW A;  2ZW7 A;  3I3G A;  1JQG A;  2OU2 A;  2EO8 A;  4YGO A;  5I4M A;  2D4O A;  3RO0 A;  4CRZ B;  2REF A;  2FL4 A;  3BXM A;  2OR4 A;  2EBJ A;  4IAV A;  5HVF A;  2J8N A;  3V38 A;  2PJA A;  2PRQ A;  4JXQ A;  3B8G A;  5H86 A;  1Z4E A;  4DUK A;  3D67 A;  1HDQ A;  3D2P A;  2K5T A;  3HLP A;  4JXR A;  4E2A A;  4H6Z A;  1AMP A;  2C1C A;  4B13 A;  1GHE A;  3JTK A;  4B11 A;  2BSW A;  3NE7 A;  3B3V A;  3KHZ A;  2AFX A;  3SJX A;  4LX9 A;  4OAE A;  4PXB A;  2B58 A;  2V8H A;  1TKF A;  2BOA A;  4R87 A;  4AVA A;  3SJE A;  1Y9K A;  2DXQ A;  4KS9 A;  4PPZ A;  4CAW A;  4KLV A;  3H8F A;  1VHS A;  2ODF A;  4ZY2 A;  1DE4 C;  2PC1 A;  1KUV A;  3F0A A;  2VI7 A;  2FXF A;  3N5F A;  3FB3 A;  3JUW A;  6CPA A;  2QIR A;  4F6A A;  1IIC A;  5AG4 A;  1ON0 A;  4O23 A;  3WC7 A;  4KUA A;  2J8M A;  3FIX A;  4KOS A;  3ZJ0 A;  1Z2L A;  1IYK A;  3BI0 A;  2AJ6 A;  3W91 A;  2GRE A;  2O53 A;  2PE3 A;  4JWP A;  5F48 A;  5K8N A;  4AG7 A;  1KZF A;  4F9U A;  4KVM E;  1TXR A;  1RXT A;  3FBU A;  4CAF A;  5IB0 A;  2B3V A;  1XJO A;  2EK9 A;  2GIV A;  1BAV A;  4NSQ A;  4R57 A;  4YRH A;  2CXA A;  3IO1 A;  2Y0M A;  4NGR A;  2ZXV A;  3TFY A;  2Q04 A;  2PJ7 A;  1BOB A;  3H5Z A;  5K8M A;  1NSA A;  5K8O A;  5KTA A;  2Z0Z A;  3KKW A;  1PU9 A;  3LWU A;  4K3N A;  4H2K A;  4OC0 A;  4R7M A;  5IV0 A;  4A94 A;  4P4J A;  2CTC A;  1YGH A;  2GAN A;  1P4N A;  2G3A A;  2ZEE A;  3FH4 A;  3PB7 X;  4KOY A;  4CGN A;  2GE3 A;  4MHZ A;  1CP7 A;  2Z3L A;  2B5G B;  5EC4 A;  2BO9 A;  3FRM A;  4KOT A;  2PJ4 A;  3B35 A;  3TCV A;  2EVN A;  2ZEL A;  4OP4 A;  4KOR A;  2ZW5 A;  1IY7 A;  1WWZ A;  4LUA A;  2C6G A;  2B3U A;  2QJ8 A;  3IWG A;  4PXD A;  3PB4 X;  4XPL A;  1FY7 A;  3PP9 A;  1BO4 A;  2I79 A;  4I49 A;  1Y9W A;  4KZT A;  4H6U A;  3NFZ A;  2PJ8 A;  1Q7L A;  4A33 A;  3K9T A;  3MGD A;  2WPX A;  3IIB A;  3I1U A;  3PBE A;  2ZPA A;  1YX0 A;  4MFK A;  3R1K A;  3FXT A;  2I00 A;  1Y0Y A;  1LAN A;  4FD6 A;  2CNM A;  4B5P B;  4YU9 A;  2RB7 A;  2F7V A;  2WZN A;  2ZEM A;  2B4D B;  5G20 A;  2PQ8 A;  2AFZ A;  2BCO A;  3W6X A;  2CNT A;  4GXH A;  4HNX B;  4P4F A;  4M6H A;  1ZLI A;  4A38 A;  1GYT A;  4KSA A;  2ZEG A;  1MJB A;  3LOD A;  4CPA A;  5JPH A;  1FNO A;  1ARL A;  3GB0 A;  3PBB A;  4MJ8 A;  3TO6 A;  4NGP A;  1EE3 P;  1Y7E A;  5BWA B;  3F8K A;  3PFO A;  4NGN A;  3PRT A;  2OZH A;  4YWY A;  2FT0 A;  2R7H A;  3WC5 A;  3FJU A;  3VWD A;  3DR6 A;  4JJX A;  1LFW A;  3FX6 A;  4MFJ A;  4AXV A;  2PIZ A;  2XEI A;  3V7Z A;  1QMU A;  2PIY A;  1VHO A;  3GYA A;  3EXN A;  4HKF A;  1B87 A;  3FYN A;  4MMO A;  2Q44 A;  4R8F A;  3G8W A;  4UEZ A;  2ABZ A;  5ISV A;  3BJ7 A;  4KLW A;  1Y0R A;  2JDD A;  2V77 A;  2IMO A;  5THW A;  5HVG A;  4M3S A;  7CPA A;  2YNE A;  2FCK A;  4UWJ A;  5D8N A;  4ZY0 A;  2PR1 A;  3SXO A;  4X8I A;  3TTH A;  1S7L A;  1S7K A;  2Z3O A;  2OH1 A;  3W6S A;  4M6G A;  4RI1 A;  4R3K A;  2WSA A;  5A28 A;  1QST A;  2P6E A;  1ELL P;  4ZBG A;  4NXY A;  4CYN A;  3N7Z A;  3PB8 X;  4MBU A;  4ZY1 A;  4X3R A;  2VBQ A;  2PJ5 A;  2GLF A;  4OLL A;  1Z8X A;  3TT2 A;  4B6Z A;  1Q2D A;  5LRJ A;  4BD9 A;  4A37 A;  2OZG A;  1NSL A;  1LAM A;  1A2Z A;  3D2M A;  3OWC A;  3NE8 A;  2FS5 A;  2ZEH A;  2HUZ A;  5KTC A;  2VQY A;  3D68 A;  3I9S A;  4GM5 A;  1Y7R A;  5AG7 A;  3IC1 A;  4NJR A;  5K8P A;  5G21 A;  2DF5 A;  4NGS A;  3EO4 A;  4KOX A;  4MFZ A;  2NMT A;  1M44 A;  4G1P A;  4W9Y A;  2ZEN A;  4CAE A;  1YR0 A;  4ZI6 A;  1UFH A;  1YLO A;  4HNY B;  1F2O A;  2AFO A;  1F2P A;  2VZY A;  4IHM A;  1M4L A;  2ZW4 A;  4UCN A;  5GCN A;  3RBU A;  1WK4 A;  4A30 A;  2WYR A;  3QB8 A;  2Q4V A;  1MJ9 A;  4MFQ A;  4P45 A;  3R95 A;  1ZG8 A;  1IB1 E;  2OZU A;  2R8V A;  1QSO A;  2WUU A;  1XRY A;  4MRI A;  1R3N A;  3RNZ A;  4BIN A;  4P44 A;  4C2Z A;  2PCU A;  1XMT A;  3K9U A;  3PFE A;  3DLJ A;  4JLY A;  1CPS A;  4FD5 A;  1XBU A;  2Q7B A;  1L0C A;  3ZZI A;  5HVH A;  4NF1 A;  4UEE A;  3D7D A;  5DWM A;  1R43 A;  1X12 A;  5F46 A;  2Q51 A;  4FBE A;  2FIW A;  1BPN A;  2FVG A;  4UIA A;  2DPS A;  4A95 A;  1QSN A;  1YSJ A;  1QSM A;  3H8G A;  2P6F A;  1QSR A;  3PEI A;  3WT4 A;  5IB9 A;  3CXP A;  5CPA A;  1Z5R A;  4ONU A;  2JEW A;  4F0Y A;  4MCR A;  3KGQ A;  4XNH B;  4AVB A;  5C82 A;  2C6P A;  3CXQ A;  4JD6 A;  5AG6 A;  5ELY A;  4Y49 B;  1P0H A;  3B3W A;  3S6H A;  4AB7 A;  2R1I A;  1ARM A;  3MN8 A;  4RS2 A;  2YGW A;  1YQE A;  4J3G A;  2JLM A;  2QEC A;  5I0C A;  1Z9U A;  2ZEO A;  4R9M A;  2H5M A;  3R9E A;  1JWQ A;  1ZG7 A;  1ZG9 A;  3IU2 A;  1LCP A;  3TOA A;  4MCQ A;  3VAT A;  2ARH A;  2IJZ A;  1CX8 A;  5EMI A;  4B10 A;  3H8E A;  3PB9 X;  3NH5 A;  1F57 A;  2Q0Y A;  2XEJ A;  3CPA A;  3B3S A;  2O4H A;  2EK8 A;  2JBK A;  1VIX A;  2YNC A;  2A4N A;  4U5Y A;  2C27 A;  4AG9 A;  2RFH A;  1QQ9 A;  4PXE A;  2PJ2 A;  4LQG A;  1CP6 A;  2XEF A;  3E0K A;  1YVO A;  2CNS A;  2Z3N A;  2BEI A;  3GIU A;  2HC9 A;  2IQ6 A;  4FD4 A;  2ZOF A;  3IWW A;  4B14 A;  2I3C A;  4ZX9 A;  4OIW A;  4H89 A;  2ZED A;  3S6K A;  2HB6 A;  4UCM A;  4KVO E;  4RUH A;  2CF4 A;  1IID A;  4PSW A;  2PSW A;  3S9N A;  2NYQ A;  1TF9 A;  3QAY A;  1B6B A;  1DTD A;  1S7N A;  4L8A A;  3TO7 A;  4MCP A;  1M4G A;  1CG2 A;  4R3L A;  1PUA A;  4OC1 A;  2VL1 A;  3FNC A;  1IU8 A;  5JH9 A;  5LYI A;  4R6T A;  4PV6 A;  3MRU A;  4OME A;  5HH1 A;  1Q2Y A;  4PXC A;  4NFR A;  4KOU A;  3IU1 A;  4AVC A;  3GUX A;  4C68 A;  4Q36 A;  5KTD A;  3FED A;  4XNH C;  3CT9 A;  5D29 A;  1M4I A;  1I12 A;  1IGB A;  1ELM P;  1MJA A;  4UFW A;  4Y49 C;  2C6C A;  4NEX A;  5DWN A;  4P6Y A;  4OC5 A;  4MHN A;  2PVW A;  3D4U A;  4NGT A;  3TC8 A;  2Z11 A;  2B4B A;  4FWU A;  3TO9 A;  4CYO A;  3FMC A;  4DYO A;  5F09 A;  2AFM A;  1VGY A;  4WJB A;  4X2T A;  3KR5 A;  4MI4 A;  4OAD A;  4A39 A;  1V0C A;  3B3T A;  4UFV A;  3TE4 A;  4CS0 B;  4CYQ A;  5LYL A;  1FT7 A;  4NGM A;  4QUS A;  2VXK A;  1Z8T A;  2AFU A;  3D8P A;  3S6G A;  1CPX A;  2Z3M A;  2GU2 A;  4E8O A;  2V8D A;  2QVP A;  2PVV A;  2WPW A;  3SJG A;  4KUB A;  1YME A;  3SI0 A;  2PJ1 A;  2PJ6 A;  1XF8 A;  3JVN A;  4CGP A;  2V8G A;  3BHX A;  1LAP A;  4CAV A;  2V8V A;  4QVT A;  2ANP A;  3NA6 A;  4HNW B;  3L2N A;  2Q4Y A;  4L89 A;  2ZOG A;  1LRZ A;  5J8F A;  3DSB A;  4YFJ A;  2X7B A;  3EFA A;  4U9Y A;  2NSM A;  5CNP A;  1S60 A;  3K2K A;  1XIX A;  2P6G A;  3KQX A;  4C7H A;  4DNC A;  2EWB A;  4EWT A;  3UY5 A;  3JRU A;  5AG5 A;  2ATR A;  3R9G A;  4CGO A;  2DPT A;  4KVX A;  4MHY A;  3B3C A;  3R9F A;  4ZGY B;  4R76 A;  3SI1 A;  1NE9 A;  3QNV A;  3IFE A;  2JBJ A;  4XPD B;  4B5P A;  2HV2 A;  3RAM A;  2PJC A;  5JQ4 A;  3GKR A;  4KOW A;  5LYF A;  2B4D A;  2HQY A;  3LD2 A;  3D7F A;  2ZW6 A;  3WAB A;  4MFP A;  3CDX A;  1VKC A;  5LRG A;  4BBH A;  4A2Z A;  2F8H A;  4TNU A;  1Z8L A;  4CRY B;  3F5B A;  2Z3K A;  3SI2 A;  4UIB A;  3D7G A;  4EVY A;  1SQH A;  1I21 A;  2CIJ A;  4MY0 A;  8CPA A;  3KHX A;  3IEH A;  3S9M A;  4C2X A;  3SHP A;  4CAX A;  4C2Y A;  1YVK A;  1KUX A;  3FF3 A;  3NH4 A;  1I1D A;  4B12 A;  4MHD A;  2POK A;  2QML A;  3A9L A;  3GY9 A;  4OC4 A;  3CXS A;  3G3S A;  3P2H A;  3C26 A;  3S9L A;  1PCA A;  5IX3 A;  4UA3 A;  1UWY A;  4FD7 A;  1S3Z A;  1OZP A;  2AE6 A;  4RN7 A;  2VEZ A;  4QC6 A;  3KI9 A;  1Q2C A;  4ONW A;  3T9Y A;  1H8L A;  1RO5 A;  4UWI A;  5JGF A;  4X5K A;  2PJB A;  2Z10 A;  4JYW A;  1BPM A;  5C88 A;  1ZO0 A;  2XEG A;  4LQ6 A;  4Z65 A;  4EME A;  1YK3 A;  4KOV A;  1IOI A;  4PK2 A;  1CJW A;  2EUI A;  2PRB A;  3NH8 A;  3TX8 A;  5JM6 A;  4II9 A;  5CBM A;  4E0A A;  1YW6 A;  4WWV A;  3KL9 A;  3WC6 A;  5LRK A;  3IWE A;  2ZEF A;  4QB9 A;  1M4D A;  4EFD A;  2IL4 A;  4P4E A;  3FVL A;  5FVJ A;  4HPS A;  3D7H A;  1M1D A;  1AYE A;  1K4J A;  2PR8 A;  2REE A;  1AUG A;  4NGQ A;  2O28 A;  4OC2 A;  2YNC C;  3VAR A;  3T8W A;  2FIA A;  2KCW A;  2FSR A;  2OB0 A;  2F5I A;  3CZX A;  4KSI A;  3VH9 A;  4BMH A;  2CTB A;  5H84 A;  2OOT A;  3KR4 A;  1XEB A;  4OC3 A;  2DEA A;  2R98 A;  3CPX A;  2JEV A;  3DGV A;  3IJ3 A;  2G3T A;  2QYV A;  5F49 A;  2PJ9 A;  1YRE A;  2G0B A;  1CBX A;  2PJ0 A;  3HUV A;  4XPD C;  4UFX A;  4M6I A;  5F47 A;  3DR8 A;  3RYO A;  1IYL A;  2BUE A;  2PJ3 A;  3IGR A;  2D4P A;  5J8C A;  5A27 A;  5LYD A;  4F8Z A;  4MFL A;  3B2Y A;  4ZX8 A;  4IK2 A;  4MCS A;  1CM0 A;  1XOV A;  4C7I A;  1NMT A;  3WR7 A;  1XMB A;  1BLL E;  3VWE A;  2Q7S A;  3DNS A;  4Q38 A;  4A31 A;  1RTQ A;  2JDC A;  1PYT B; 
#chains in the Genus database with same CATH homology
 5EBV A;  3PGP A;  4M85 A;  3TOB A;  5E96 A;  5G1Z A;  5G22 A;  3EC4 A;  4QBJ A;  4K30 A;  2J8R A;  3T90 A;  3H4Q A;  1S5K A;  4PK3 A;  2YND A;  2FE7 A;  3V8I A;  1J4J A;  3S6F A;  4CGL A;  1YLE A;  3PZJ A;  2P0W A;  4KSF A;  4A32 A;  1XE4 A;  2BL1 A;  3DDD A;  1KUY A;  3SXN A;  4CYP A;  1N71 A;  3R96 A;  4UCP A;  5KTD A;  1R57 A;  5HMN A;  4UBR A;  4IF5 A;  4PSX A;  3EY5 A;  4F0X A;  3BLN A;  1Z4R A;  1MK4 A;  2PDO A;  2B5G A;  5AGE A;  4GS4 A;  4ORF A;  2CY2 A;  2VZZ A;  4U9Z A;  4CGM A;  1S7F A;  3D3S A;  2Z3P A;  1TIQ A;  3P2F A;  4B5O A;  4IUS A;  4NCZ A;  3QAH A;  4MY3 A;  1U6M A;  3BJ8 A;  4XPK A;  2RC4 A;  2ZW7 A;  4YGO A;  3I3G A;  2OU2 A;  2D4O A;  4CRZ B;  2REF A;  2FL4 A;  2J8N A;  4JXQ A;  3B8G A;  5H86 A;  1Z4E A;  3D2P A;  2K5T A;  4JXR A;  4E2A A;  4H6Z A;  4B13 A;  1GHE A;  3JTK A;  4B11 A;  2BSW A;  3NE7 A;  4LX9 A;  4OAE A;  2B58 A;  4R87 A;  4AVA A;  1Y9K A;  2DXQ A;  4KS9 A;  4CAW A;  4KLV A;  1VHS A;  2PC1 A;  1KUV A;  3F0A A;  2VI7 A;  2FXF A;  3FB3 A;  3JUW A;  4F6A A;  1IIC A;  5AG4 A;  1ON0 A;  4KUA A;  2J8M A;  3FIX A;  4KOS A;  3ZJ0 A;  1IYK A;  2AJ6 A;  3W91 A;  4JWP A;  5F48 A;  4AG7 A;  1KZF A;  4KVM E;  4CAF A;  1RXT A;  3FBU A;  5IB0 A;  2B3V A;  2GIV A;  4NSQ A;  4R57 A;  4YRH A;  2CXA A;  2Y0M A;  2ZXV A;  3TFY A;  2Q04 A;  1BOB A;  3H5Z A;  5KTA A;  2Z0Z A;  3KKW A;  1PU9 A;  5IV0 A;  1YGH A;  2GAN A;  1P4N A;  2G3A A;  4KOY A;  4CGN A;  2GE3 A;  2Z3L A;  2B5G B;  5EC4 A;  3FRM A;  4KOT A;  3TCV A;  2EVN A;  4KOR A;  2ZW5 A;  1WWZ A;  4LUA A;  2B3U A;  3IWG A;  4XPL A;  1FY7 A;  3PP9 A;  1BO4 A;  2I79 A;  4I49 A;  1Y9W A;  4KZT A;  4H6U A;  4A33 A;  3MGD A;  2WPX A;  2ZPA A;  1YX0 A;  4MFK A;  3R1K A;  3FXT A;  2I00 A;  4FD6 A;  4B5P B;  2CNM A;  2B4D B;  5G20 A;  2PQ8 A;  3W6X A;  2CNT A;  4HNX B;  4KSA A;  1MJB A;  3LOD A;  5JPH A;  5BWA B;  4MJ8 A;  3TO6 A;  3F8K A;  2OZH A;  2FT0 A;  2R7H A;  3VWD A;  3DR6 A;  4JJX A;  4MFJ A;  3GYA A;  3EXN A;  4HKF A;  1B87 A;  3FYN A;  2Q44 A;  3G8W A;  5ISV A;  3BJ7 A;  4KLW A;  2JDD A;  4M3S A;  2YNE A;  2FCK A;  4UWJ A;  2PR1 A;  3SXO A;  3TTH A;  1S7L A;  1S7K A;  2Z3O A;  2OH1 A;  3W6S A;  4RI1 A;  4R3K A;  2WSA A;  5A28 A;  1QST A;  2P6E A;  4ZBG A;  4CYN A;  4NXY A;  3N7Z A;  4MBU A;  2VBQ A;  4OLL A;  3TT2 A;  1Q2D A;  2OZG A;  1NSL A;  3D2M A;  3OWC A;  2FS5 A;  2HUZ A;  5KTC A;  2VQY A;  3I9S A;  1Y7R A;  5AG7 A;  5G21 A;  3EO4 A;  4KOX A;  4MFZ A;  2NMT A;  1M44 A;  4CAE A;  1YR0 A;  1UFH A;  4HNY B;  2VZY A;  5C82 A;  4UCN A;  2ZW4 A;  5GCN A;  4A30 A;  1WK4 A;  3QB8 A;  2Q4V A;  1MJ9 A;  4MFQ A;  3R95 A;  1IB1 E;  2OZU A;  2R8V A;  1QSO A;  2WUU A;  4C2Z A;  1XMT A;  3K9U A;  4JLY A;  4FD5 A;  2Q7B A;  3ZZI A;  1L0C A;  4NF1 A;  5DWM A;  5F46 A;  2FIW A;  2DPS A;  4A95 A;  1QSN A;  1QSM A;  2P6F A;  1QSR A;  3CXP A;  4ONU A;  4F0Y A;  4XNH B;  4AVB A;  3CXQ A;  4JD6 A;  5AG6 A;  4Y49 B;  1P0H A;  3S6H A;  4AB7 A;  2R1I A;  4RS2 A;  2YGW A;  4J3G A;  2JLM A;  2QEC A;  5I0C A;  1Z9U A;  4R9M A;  2H5M A;  3R9E A;  3TOA A;  3IU2 A;  2ARH A;  4B10 A;  2Q0Y A;  2YNC A;  2A4N A;  4U5Y A;  2C27 A;  4AG9 A;  3E0K A;  1YVO A;  2CNS A;  2Z3N A;  2BEI A;  4FD4 A;  4B14 A;  4H89 A;  3S6K A;  4UCM A;  4KVO E;  1IID A;  4PSW A;  2PSW A;  1B6B A;  1S7N A;  4L8A A;  3TO7 A;  1M4G A;  4R3L A;  1PUA A;  3FNC A;  4PV6 A;  5HH1 A;  1Q2Y A;  4KOU A;  3IU1 A;  4AVC A;  4C68 A;  4Q36 A;  4XNH C;  1M4I A;  1I12 A;  1MJA A;  4UFW A;  4Y49 C;  4NEX A;  5DWN A;  4CYO A;  3TO9 A;  2Z11 A;  2B4B A;  4MI4 A;  4OAD A;  3TE4 A;  1V0C A;  4UFV A;  4CS0 B;  4CYQ A;  4QUS A;  2VXK A;  3S6G A;  3D8P A;  2Z3M A;  4E8O A;  2WPW A;  4KUB A;  1XF8 A;  3JVN A;  4CGP A;  4CAV A;  4QVT A;  4HNW B;  4L89 A;  2Q4Y A;  1LRZ A;  5J8F A;  3DSB A;  4YFJ A;  2X7B A;  3EFA A;  4U9Y A;  5CNP A;  1S60 A;  4C7H A;  1XIX A;  2P6G A;  4DNC A;  3UY5 A;  5AG5 A;  2ATR A;  3R9G A;  4CGO A;  2DPT A;  4KVX A;  3R9F A;  4ZGY B;  1NE9 A;  4XPD B;  4B5P A;  2HV2 A;  5JQ4 A;  3GKR A;  4KOW A;  2B4D A;  2HQY A;  3LD2 A;  2ZW6 A;  4MFP A;  1VKC A;  4BBH A;  4A2Z A;  4CRY B;  3F5B A;  2Z3K A;  4EVY A;  1SQH A;  1I21 A;  4MY0 A;  4C2X A;  3SHP A;  4CAX A;  4C2Y A;  1YVK A;  1KUX A;  1I1D A;  4B12 A;  4MHD A;  3GY9 A;  2QML A;  3A9L A;  3CXS A;  3G3S A;  3P2H A;  3C26 A;  5IX3 A;  4UA3 A;  4FD7 A;  1S3Z A;  1OZP A;  2AE6 A;  2VEZ A;  4QC6 A;  1Q2C A;  3T9Y A;  1RO5 A;  4UWI A;  4X5K A;  2Z10 A;  5C88 A;  1ZO0 A;  1YK3 A;  4KOV A;  4PK2 A;  1CJW A;  2EUI A;  2PRB A;  4II9 A;  4E0A A;  3IWE A;  4QB9 A;  1M4D A;  2IL4 A;  5FVJ A;  1M1D A;  2REE A;  1K4J A;  2PR8 A;  2O28 A;  2YNC C;  2FIA A;  2KCW A;  2FSR A;  2OB0 A;  2F5I A;  4BMH A;  5H84 A;  1XEB A;  2R98 A;  2JEV A;  2G3T A;  5F49 A;  1YRE A;  2G0B A;  4XPD C;  4UFX A;  5F47 A;  3DR8 A;  3RYO A;  1IYL A;  2BUE A;  3IGR A;  2D4P A;  5J8C A;  5A27 A;  4MFL A;  1CM0 A;  4C7I A;  1NMT A;  3WR7 A;  3VWE A;  3DNS A;  4Q38 A;  4A31 A;  2QIR A;  2JDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...