3FRMA

The crystal structure of a functionally unknown conserved protein from staphylococcus epidermidis atcc 12228.
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
252
structure length
252
Chain Sequence
AMSKITFKDIYIDGNKITEDSRKAIYLLPPQPLKYASNTWIYKTMPTMNQWLKDIEVQKKMHLNQSSYHLSFSFPANEKIDEVLLEKIRELGFQIGVLELYVIEAKALKELSRKRDVDIQLVSSNNINDYLHVYDAFARPFGDSYANMVKQHIYSSYNLDDIERLVAYVNHQPVGIVDIIMTDKTIEIDGFGVLEEFQHQGIGSEIQAYVGRMANERPVILVADGKDTAKDMYLRQGYVYQGFKYHILKENI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized conserved protein
publication title The crystal structure of a functionally unknown conserved protein from Staphylococcus epidermidis ATCC 12228.
rcsb
source organism Staphylococcus epidermidis
total genus 70
structure length 252
sequence length 252
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
A PF18467 DUF5613 Domain of unknown function (DUF5613)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3frmA00
4QBJA 2FCKA 2CNMA 3LD2A 2VZZA 4YFJA 2JEVA 2PQ8A 3ZZIA 1YREA 4EVYA 4DNCA 4IUSA 4MBUA 1VHSA 3LODA 3TCVA 2CNSA 1QSNA 2G0BA 3CXQA 2JDCA 2HQYA 4KOVA 4HNYB 1S7KA 5GCNA 1S7NA 3ZJ0A 4FD7A 4R9MA 1SQHA 3W6SA 1N71A 2ZW7A 1QSMA 2OZGA 1YVKA 5HH1A 1M4GA 3CXSA 2Q04A 2B4DA 4XPKA 4XPDC 2FIWA 3TOBA 1Y9KA 2FT0A 2BSWA 3K9UA 5I0CA 4MJ8A 4UA3A 3GYAA 2G3AA 2G3TA 3MGDA 3TT2A 1B6BA 1PUAA 1Q2CA 1YVOA 4U9ZA 4U5YA 4J3GA 4KLVA 4JD6A 1NMTA 2FXFA 2WPWA 3S6GA 3OWCA 4CAXA 2ZXVA 1VKCA 2Z10A 5F49A 3CXPA 1I21A 4FD4A 3FBUA 2VZYA 4KOXA 3PGPA 1CM0A 3P2FA 1S60A 1MJBA 1Q2DA 1M1DA 1LRZA 3DDDA 3F8KA 3T90A 5ISVA 4AVBA 4F0YA 2OH1A 1M4IA 1K4JA 5J8CA 5F47A 3C26A 5JQ4A 4Y49B 3FXTA 3WR7A 4B5PB 5C82A 1M4DA 3F5BA 1IYLA 4XNHC 2R8VA 3DNSA 4XPLA 2Z0ZA 5F46A 1S7FA 3R9EA 2EVNA 4KVME 1ON0A 4M85A 1RO5A 2P6GA 1XMTA 3IGRA 3PZJA 4R3LA 1Y9WA 1BOBA 2D4OA 4MY3A 2Q7BA 2AJ6A 1UFHA 2Q0YA 2GE3A 3FIXA 4KOYA 2BEIA 3VWEA 3RYOA 4CRZB 2CNTA 4R3KA 2REEA 2B5GB 4ONUA 1IICA 4JJXA 2JLMA 2BL1A 5KTAA 4L89A 2FS5A 1NSLA 2ZW4A 4HNXB 3EO4A 4BMHA 3FNCA 4QVTA 4KORA 3P2HA 4PK2A 5HMNA 4NSQA 2QECA 3S6FA 4X5KA 3FB3A 4HNWB 3GKRA 4XNHB 3TTHA 4UBRA 1L0CA 2R98A 3R9GA 2FIAA 3BJ8A 4HKFA 1TIQA 2VXKA 1MK4A 4L8AA 3TE4A 1Y7RA 4AG7A 1I1DA 3G8WA 4AVCA 2OB0A 4Y49C 2VI7A 4AB7A 1B87A 3D8PA 3FYNA 2I79A 4PSXA 2WPXA 3VWDA 1V0CA 4PSWA 3R95A 2B58A 2ARHA 4KVXA 3JUWA 1PU9A 3T9YA 1GHEA 4H6UA 1KUYA 2H5MA 3EY5A 3S6HA 4YRHA 5H84A 4E8OA 1Z4EA 3EFAA 2Q44A 3EXNA 3NE7A 1YGHA 2QMLA 3EC4A 5DWNA 1S5KA 1RXTA 4JXQA 5CNPA 4U9YA 3SXNA 2Z11A 4CAWA 3S6KA 4QUSA 4KZTA 2X7BA 1S3ZA 4NCZA 2P6EA 1XE4A 1YLEA 4F6AA 1Z4RA 2PRBA 3W6XA 3DSBA 1FY7A 2Q4YA 2J8NA 4E2AA 1MJAA 3D3SA 3D2MA 3TO7A 2CY2A 4KOUA 2D4PA 1QSOA 4KUBA 4B5OA 2R1IA 4KOSA 4ORFA 2OZHA 1MJ9A 1NE9A 4UWIA 2B4DB 4MY0A 1WK4A 2GIVA 2K5TA 3D2PA 4GS4A 3IWGA 2VEZA 5DWMA 4LX9A 1I12A 2PC1A 4JXRA 1OZPA 2A4NA 4H6ZA 1QSTA 2AE6A 3BLNA 4ZBGA 1WWZA 5IB0A 2B3UA 2I00A 2REFA 4CS0B 3TO9A 4K30A 2J8RA 2VBQA 1KUXA 2PDOA 5H86A 4NXYA 2OU2A 2ZW5A 4KOWA 3I9SA 3QAHA 4H89A 1YK3A 5E96A 2RC4A 4B5PA 2HUZA 2DXQA 2ZW6A 3N7ZA 3SHPA 2B4BA 1M44A 2O28A 4MI4A 1BO4A 5IX3A 4QC6A 3SXOA 1P4NA 4OADA 1XEBA 2ATRA 4MHDA 3H4QA 3DR6A 4FD5A 2FL4A 1CJWA 2BUEA 2Y0MA 1XF8A 1Q2YA 4OLLA 4RS2A 4E0AA 4KVOE 1IIDA 1KZFA 4II9A 3GY9A 1IYKA 3TOAA 3DR8A 2HV2A 3FRMA 2IL4A 2KCWA 3V8IA 4YGOA 5C88A 2J8MA 4I49A 2B5GA 2EUIA 4NF1A 1YX0A 4NEXA 4AVAA 2OZUA 2GANA 2ZPAA 5EC4A 1KUVA 2PR8A 1QSRA 3B8GA 3E0KA 2FSRA 3W91A 4JLYA 2FE7A 4KLWA 3JVNA 4IF5A 3KKWA 1U6MA 4R57A 5KTCA 1P0HA 5FVJA 4PK3A 2F5IA 3G3SA 4OAEA 1J4JA 5J8FA 4PV6A 2JDDA 3TO6A 1Z9UA 3I3GA 3PP9A 2P6FA 2QIRA 2P0WA 5IV0A 2NMTA 4XPDB 4RI1A 2R7HA 5F48A 2C27A 3F0AA 2Q4VA 3R1KA 4QB9A 3R9FA 1YR0A 4FD6A 4AG9A 3QB8A 2PR1A 1R57A 1S7LA 4R87A 2PSWA 3R96A 4M3SA 3BJ7A 2B3VA 4JWPA 3TFYA 4UWJA 5KTDA 1IB1E 2VQYA 4KUAA 4KOTA 4LUAA 4CRYB 5JPHA 1XIXA 5EBVA 3UY5A 4CAVA
chains in the Genus database with same CATH superfamily
1YSJA 4W9YA 1QMUA 4ZX9A 2POKA 4TNUA 4QBJA 2FCKA 4P4BA 2CNMA 2GU2A 1F2OA 1TKJA 3IFEA 3MN8A 3SJXA 3LD2A 2VZZA 4YFJA 1UWYA 3IO1A 1A2ZA 2JEVA 3FVLA 3S9MA 2PQ8A 2PJ8A 3HLPA 3ZZIA 1TKHA 1YREA 3IJ3A 4EVYA 4DNCA 1HEEA 4IUSA 4MBUA 1VHSA 3LODA 3B3WA 4OC0A 3TCVA 5DS0A 3D7FA 2CNSA 1QSNA 3KHXA 2G0BA 3CXQA 5AG5A 2F7VA 2JDCA 2HQYA 3FF3A 4KOVA 1QQ9A 4HNYB 4OC5A 4A32A 1S7KA 5GCNA 1BPNA 2HC9A 1BAVA 1S7NA 1XRYA 1ZG9A 5A27A 3ZJ0A 4FD7A 4R9MA 3VATA 1SQHA 5D8NA 4P4DA 3W6SA 1N71A 1Z8TA 3SI0A 3PB8X 4P6YA 2ZW7A 1M4LA 1QSMA 3BI0A 2OZGA 1YVKA 1YLOA 5HH1A 1M4GA 2EBJA 2ZOGA 3CXSA 4OMEA 2Q04A 5G21A 4WJBA 2B4DA 2PIZA 4XPDC 2FIWA 4XPKA 3H8GA 2VL1A 3TOBA 2ZEOA 4LQ6A 1Y9KA 2FT0A 2BSWA 1CG2A 3K9UA 4FWUA 5I0CA 4MJ8A 4UA3A 3GYAA 5AGEA 2G3AA 4MHZA 2G3TA 3MGDA 4MXUA 2YGWA 4BINA 3TT2A 4F8ZA 1B6BA 2FVGA 1PUAA 1Q2CA 6CPAA 1YVOA 4U9ZA 1AYEA 1BLLE 4U5YA 4J3GA 4KLVA 4JD6A 1NMTA 4F9VA 5HVGA 2FXFA 5ELYA 1ZG7A 2WPWA 3S6GA 4A2ZA 4CGLA 2V8VA 4MFZA 5LYFA 3OWCA 3CPXA 4NGMA 1KWMA 4A39A 4CAXA 2ZXVA 1VKCA 2Z10A 3H8EA 5F49A 3CXPA 4OC4A 4NJRA 1I21A 4FD4A 3FBUA 3NH4A 5G20A 2VZYA 4MCPA 4KOXA 3PGPA 2EO8A 3PEIA 1CM0A 3P2FA 3NH8A 1S60A 1MJBA 1Q2DA 1M1DA 1LRZA 1ZLHA 3DDDA 3F8KA 1Z8XA 4P44A 3T90A 5ISVA 2EK9A 1Z5RA 4AVBA 4F0YA 4FAIA 4UCNA 2OH1A 2PJ4A 4UF4A 3H5ZA 3GIUA 1M4IA 1K4JA 3NH5A 5J8CA 4CPAA 4KS9A 5F47A 1CPXA 3KHZA 3C26A 3D7HA 2AFMA 5HVHA 4OC1A 1VHEA 2PJ1A 4P10A 3D67A 3D7DA 4MHPA 2GREA 5JQ4A 3KZWA 2QJ8A 3IU1A 3JRUA 4UIAA 4Y49B 4FUUA 5LYIA 3PB7X 2ZEGA 3FXTA 1AUGA 4K3NA 3WR7A 4B5PB 3H8FA 5C82A 4ZI6A 1M4DA 3BXMA 5J1QA 3BI1A 2J9AA 2AFSA 2CIJA 2DPSA 2JBJA 2ZEEA 3F5BA 2WUUA 3KL9A 5K8PA 1IYLA 4XNHC 4PXCA 2PJ6A 3IEHA 1TKFA 2R8VA 3DNSA 5LRJA 4XPLA 2Z0ZA 3RBUA 5F46A 4DYOA 1S7FA 3R9EA 4CYNA 4OP4A 2EVNA 4KVME 3WC5A 4TWEA 3I1UA 1ON0A 1VGYA 4M85A 1RO5A 2P6GA 3LMSA 1XMTA 3IGRA 3PZJA 3FX6A 4R3LA 2RB7A 1Y9WA 3B35A 1BOBA 2PJ3A 2D4OA 4MY3A 2Q7BA 2PVVA 2YNCC 1YQEA 2AJ6A 2JBKA 2YNDA 5K8MA 3B7IA 1UFHA 2GLJA 2GE3A 2Q0YA 3FIXA 3LACA 4KOYA 4UFXA 2BEIA 3VWEA 3RYOA 3B3SA 4CRZB 3RNZA 4RN7A 2CNTA 4R3KA 2REEA 2WZNA 2PJ7A 2B5GB 4ONUA 3VARA 3WC6A 4UEEA 4MRIA 3KI9A 3KR4A 1IICA 4JJXA 4MMOA 2JLMA 2BL1A 3CZXA 3A9LA 4M6GA 4CGPA 4L89A 1ELMP 5KTAA 2FS5A 3FECA 1NSLA 3IC1A 4FBEA 2AFOA 2ZW4A 4HNXB 3EO4A 4BMHA 3FNCA 3FH4A 4QVTA 4KORA 3TC8A 3P2HA 4OKOA 4BD9A 1Y0YA 2F8HA 4PXEA 4PK2A 4BBHA 3FMCA 2PJ9A 5HMNA 3S9NA 4NSQA 5AG7A 2QECA 4NGPA 3S6FA 4X5KA 1R3NA 3FB3A 4HNWB 3GKRA 4XNHB 3TTHA 4UBRA 1L0CA 1YW4A 2R98A 1ZO0A 4B6ZA 3R9GA 2FIAA 3BJ8A 3SJFA 4HKFA 1TIQA 2VXKA 1MK4A 3DGVA 4L8AA 2DEAA 4JYWA 3TE4A 1Y7RA 4AG7A 2Z3MA 4ZY0A 1LCPA 2XEFA 4P4EA 1I1DA 3G8WA 4AVCA 4X2TA 4C2YA 3HUVA 2O4HA 2OB0A 4Y49C 5LYDA 2VI7A 2PJCA 1OBRA 2ODFA 4AB7A 1B87A 3D8PA 3DLJA 3FJUA 3FYNA 4KSFA 2BOAA 2ZENA 3UY5A 2AFUA 2I79A 4MFKA 4OIDA 4R76A 2Q7SA 3PRTA 4PSXA 4B14A 4C7HA 4B12A 2WPXA 4ONWA 3RZAA 1X10A 2Z3KA 3VWDA 1V0CA 4PSWA 2PJ5A 3GUXA 3R95A 2B58A 1LAPA 2ARHA 4NGRA 4ZY2A 2ANPA 2ZEMA 3KQZA 4KVXA 3JUWA 5G22A 4ZY1A 3FEEA 1PU9A 4AXVA 3T9YA 1GHEA 4KSAA 4H6UA 5JGFA 1KUYA 4MFPA 2H5MA 3EY5A 1FNOA 3S6HA 1F2PA 4YRHA 5H84A 2ZELA 1Z4EA 3KQXA 3EFAA 2Q44A 1R43A 4UFWA 4E8OA 5CBMA 1YW6A 3EXNA 1ELLP 3NE7A 4PXBA 4A37A 3CDXA 1YGHA 4OC2A 1BPMA 4Q38A 2QMLA 4PQAA 3EC4A 3SI1A 5DWNA 1S5KA 1RXTA 2PJAA 4X8IA 4F9UA 2NYQA 2AFWA 4JXQA 5CNPA 4U9YA 5HXDA 5I4MA 2V8GA 3SXNA 1ARMA 2Z11A 4CAWA 3MRUA 3RAMA 2PJ0A 4NGNA 4C2XA 3S6KA 1YMEA 4QUSA 4CGNA 4KZTA 2OOTA 2CTBA 2X7BA 1S3ZA 4EFDA 4RUHA 1ZLIA 4NCZA 2P6EA 1XE4A 4G1PA 1YLEA 2C6PA 3V38A 4C68A 4M6IA 1X12A 3B3CA 4MHYA 4F6AA 1Z4RA 4NGSA 2PRBA 1IOFA 2BCOA 3DSBA 3W6XA 2QYVA 1XOVA 1FY7A 3TX8A 2Q4YA 2J8NA 5AG6A 4E2AA 4B10A 8CPAA 1MJAA 3D3SA 2IJZA 1IU8A 3V7ZA 3SJEA 1IY7A 3D2MA 3K9TA 3TO7A 2CY2A 4KOUA 3PBEA 2D4PA 3K2KA 1QSOA 4KUBA 1FT7A 1TF8A 2R1IA 4B5OA 4KOSA 3JTKA 1XBUA 2YNCA 5G1ZA 4ORFA 3QNVA 3B3VA 2OZHA 4MFLA 1MJ9A 1NE9A 4OIWA 4CYOA 2AFXA 4UWIA 1LFWA 2Q43A 2EWBA 2B4DB 2WSAA 3IWWA 4MY0A 4ZX8A 1WK4A 2GIVA 5AG4A 3L2NA 4R6TA 1VIXA 2YNEA 2K5TA 3D2PA 4GS4A 3IWGA 1ARLA 4A95A 3D68A 2VEZA 2ZEDA 5DWMA 3T8WA 4LX9A 2PJBA 2CF4A 3WABA 4P4FA 4Q7AA 3SJGA 1I12A 2PC1A 2QVPA 3GB0A 1CX8A 4JXRA 1PCAA 1OZPA 5D29A 4NGTA 4YWYA 4ZYQA 2XEJA 2A4NA 4A31A 4H6ZA 4LQGA 5HVFA 1QSTA 2AE6A 4UEFA 3BLNA 4MHNA 1DTDA 4IK2A 1WWZA 4GM5A 4ZBGA 5IB0A 2B3UA 2I00A 4P4IA 2NSMA 4A33A 4UEZA 2REFA 4CS0B 5A28A 3SI2A 4CGOA 3LWUA 3TO9A 4K30A 1TXRA 2PCUA 2J8RA 2VBQA 1KUXA 3NE8A 5CPAA 2Q51A 3KR5A 2PDOA 2O53A 2RFHA 4WWVA 5H86A 4NXYA 2OU2A 2ZW5A 3S9LA 3ISXA 2V77A 4KOWA 3B3TA 3I9SA 3BHXA 3QAHA 3PB6X 4H89A 1CBXA 1YK3A 5E96A 2RC4A 4B5PA 2HUZA 2DXQA 2PJ2A 2ZW6A 4KSIA 2OR4A 3N7ZA 3SHPA 2AFZA 2XEGA 2B4BA 1M44A 2O28A 4B13A 3CT9A 4MI4A 1BO4A 3WT4A 4CAEA 3KGQA 4QC6A 1P4NA 3SXOA 4OADA 1VHOA 4UFVA 1XEBA 5IX3A 5K8NA 2ATRA 4NGQA 4PXDA 4A38A 1EE3P 4MHDA 4C7IA 3H4QA 3DR6A 5BWAB 3PBBA 4IHMA 1XMBA 4FD5A 1LANA 2FL4A 3RO0A 3B2YA 1CJWA 3KASA 2BUEA 5LYLA 2PRQA 4HPSA 4B11A 1Z8LA 2GFQA 2Y0MA 1XF8A 1Q2YA 4OLLA 4RS2A 5JH9A 2I3CA 1IOIA 4E0AA 1ZG8A 3VH9A 5K8OA 1Z2LA 4KVOE 5JM6A 1Y0RA 1IIDA 1KZFA 4NFRA 4II9A 3GY9A 2HB6A 1IYKA 2PVWA 3TOAA 1IGBA 2ZEFA 3DR8A 5THWA 1XJOA 1CPSA 3PB9X 2HV2A 4MCRA 3FRMA 2IQ6A 2IL4A 2G9DA 2KCWA 3V8IA 3PB4X 4F0XA 4YGOA 2Z3LA 5C88A 2J8MA 4I49A 2B5GA 4IAVA 3D66A 2EUIA 2IMOA 4Q36A 4DUKA 4NF1A 1YX0A 2Q4ZA 3PFOA 5LRGA 4MCQA 4NEXA 4NJQA 4AVAA 2OZUA 2GANA 4MCSA 2ZPAA 5EC4A 1KUVA 2PR8A 3CPAA 3D7GA 4UCMA 1QSRA 3B8GA 2Z3OA 7CPAA 3E0KA 2FSRA 4O23A 3W91A 2WYRA 4JLYA 2FE7A 4X3RA 4A94A 4CYPA 2C1CA 4MFJA 4KLWA 4PPZA 3JVNA 5F09A 4IF5A 3KKWA 1U6MA 3PFEA 4R57A 5KTCA 1P0HA 5EMIA 2ZEHA 5FVJA 2PE3A 4PK3A 2F5IA 3G3SA 4OAEA 2C6CA 1J4JA 1GYTA 2ZEPA 5J8FA 4PV6A 4ZGYB 2JDDA 3TO6A 1Z9UA 2GLFA 1JQGA 3I3GA 1JWQA 4C2ZA 2V8DA 3PP9A 2P6FA 1TF9A 2QIRA 2P0WA 5IV0A 1F57A 3NA6A 4JZ0A 5IB9A 1Q7LA 2ABZA 4GXHA 1HDUA 2NMTA 4YU9A 4XPDB 2CXAA 4RI1A 3GLJA 2R7HA 4H2KA 4MFQA 2C27A 1LOKA 5F48A 3F0AA 2Q4VA 3R1KA 1CP6A 1Y7EA 3IWEA 4OC3A 4QB9A 4R8FA 1CP7A 1RTQA 3R9FA 3D4UA 4P45A 1YR0A 5LRKA 3QAYA 4CAFA 1AMPA 2DPTA 4EWTA 4FD6A 4AG9A 3IIBA 4CYQA 2CTCA 2EK8A 3QB8A 2PR1A 2Z3NA 1Z8WA 3WC7A 1R57A 1LAMA 1S7LA 2C6GA 4R87A 4A30A 4DJLA 2PSWA 3R96A 3FEDA 4M6HA 4M3SA 4P4JA 2PIYA 3BJ7A 1NSAA 2B3VA 4R7MA 4JWPA 4Z65A 1DE4C 3TFYA 3N5FA 1H8LA 2Z3PA 4UWJA 2DF5A 4EMEA 5KTDA 1HDQA 1IB1E 1XFOA 4UIBA 2BO9A 1PYTB 2JEWA 2VQYA 4KOTA 2XEIA 4KUAA 3IU2A 3NFZA 4LUAA 3ISZA 2ZOFA 4UCPA 4CGMA 1XIXA 4CRYB 5JPHA 5EBVA 2V8HA 4CAVA
chains in the Genus database with same CATH topology
4QBJA 2FCKA 2CNMA 3LD2A 2VZZA 4YFJA 2JEVA 2PQ8A 3ZZIA 1YREA 4EVYA 4DNCA 4IUSA 4MBUA 1VHSA 3LODA 3TCVA 2CNSA 1QSNA 5AG5A 2G0BA 3CXQA 2JDCA 2HQYA 4KOVA 4HNYB 4A32A 1S7KA 5GCNA 1S7NA 5A27A 3ZJ0A 4FD7A 4R9MA 1SQHA 3W6SA 1N71A 2ZW7A 1QSMA 2OZGA 1YVKA 5HH1A 1M4GA 3CXSA 2Q04A 5G21A 2B4DA 4XPKA 4XPDC 2FIWA 3TOBA 1Y9KA 2FT0A 2BSWA 3K9UA 5I0CA 4MJ8A 4UA3A 3GYAA 5AGEA 2G3AA 2G3TA 3MGDA 2YGWA 3TT2A 1B6BA 1PUAA 1Q2CA 1YVOA 4U9ZA 4U5YA 4J3GA 4KLVA 4JD6A 1NMTA 2FXFA 2WPWA 3S6GA 4A2ZA 4CGLA 4MFZA 3OWCA 4CAXA 2ZXVA 1VKCA 2Z10A 5F49A 3CXPA 1I21A 4FD4A 3FBUA 5G20A 2VZYA 4KOXA 3PGPA 1CM0A 3P2FA 1S60A 1MJBA 1Q2DA 1M1DA 1LRZA 3DDDA 3F8KA 3T90A 5ISVA 4AVBA 4F0YA 4UCNA 2OH1A 3H5ZA 1M4IA 1K4JA 5J8CA 4KS9A 5F47A 3C26A 5JQ4A 3IU1A 4Y49B 3FXTA 3WR7A 4B5PB 5C82A 1M4DA 2DPSA 3F5BA 2WUUA 1IYLA 4XNHC 2R8VA 3DNSA 4XPLA 2Z0ZA 5F46A 1S7FA 3R9EA 4CYNA 2EVNA 4KVME 1ON0A 4M85A 1RO5A 2P6GA 1XMTA 3IGRA 3PZJA 4R3LA 1Y9WA 1BOBA 2D4OA 4MY3A 2Q7BA 2YNCC 2AJ6A 2YNDA 1UFHA 2Q0YA 2GE3A 3FIXA 4KOYA 4UFXA 2BEIA 3VWEA 3RYOA 4CRZB 2CNTA 4R3KA 2REEA 2B5GB 4ONUA 1IICA 4JJXA 2JLMA 2BL1A 3A9LA 5KTAA 4CGPA 4L89A 2FS5A 1NSLA 2ZW4A 4HNXB 3EO4A 4BMHA 3FNCA 4QVTA 4KORA 3P2HA 4BBHA 4PK2A 5HMNA 4NSQA 5AG7A 2QECA 3S6FA 4X5KA 3FB3A 4HNWB 3GKRA 4XNHB 3TTHA 4UBRA 1L0CA 2R98A 1ZO0A 3R9GA 2FIAA 3BJ8A 4HKFA 1TIQA 2VXKA 1MK4A 4L8AA 3TE4A 1Y7RA 4AG7A 2Z3MA 1I1DA 3G8WA 4AVCA 4C2YA 2OB0A 4Y49C 2VI7A 4AB7A 1B87A 3D8PA 3FYNA 4KSFA 2I79A 4MFKA 4PSXA 4B14A 4C7HA 4B12A 2WPXA 2Z3KA 3VWDA 1V0CA 4PSWA 3R95A 2B58A 2ARHA 4KVXA 3JUWA 5G22A 1PU9A 3T9YA 1GHEA 4KSAA 4H6UA 1KUYA 4MFPA 2H5MA 3EY5A 3S6HA 4YRHA 5H84A 4UFWA 1Z4EA 4E8OA 3EFAA 2Q44A 3EXNA 3NE7A 1YGHA 4Q38A 2QMLA 3EC4A 5DWNA 1S5KA 1RXTA 4JXQA 5CNPA 4U9YA 3SXNA 2Z11A 4CAWA 4C2XA 3S6KA 4QUSA 4CGNA 4KZTA 2X7BA 1S3ZA 4NCZA 2P6EA 1XE4A 1YLEA 4C68A 4F6AA 1Z4RA 2PRBA 3W6XA 3DSBA 1FY7A 2Q4YA 2J8NA 5AG6A 4E2AA 4B10A 1MJAA 3D3SA 3D2MA 3TO7A 2CY2A 4KOUA 2D4PA 1QSOA 4KUBA 4B5OA 2R1IA 4KOSA 3JTKA 2YNCA 5G1ZA 4ORFA 2OZHA 4MFLA 1MJ9A 1NE9A 4CYOA 4UWIA 2WSAA 2B4DB 5AG4A 4MY0A 1WK4A 2GIVA 2YNEA 2K5TA 3D2PA 4GS4A 3IWGA 4A95A 2VEZA 5DWMA 4LX9A 1I12A 2PC1A 4JXRA 1OZPA 2A4NA 4A31A 4H6ZA 1QSTA 2AE6A 3BLNA 4ZBGA 1WWZA 5IB0A 2B3UA 2I00A 4A33A 2REFA 4CS0B 5A28A 4CGOA 3TO9A 4K30A 2J8RA 2VBQA 1KUXA 2PDOA 5H86A 4NXYA 2OU2A 2ZW5A 4KOWA 3I9SA 3QAHA 4H89A 1YK3A 5E96A 2RC4A 4B5PA 2HUZA 2DXQA 2ZW6A 3N7ZA 3SHPA 2B4BA 1M44A 2O28A 4B13A 4MI4A 1BO4A 4CAEA 5IX3A 4QC6A 3SXOA 1P4NA 4OADA 4UFVA 1XEBA 2ATRA 4MHDA 4C7IA 3H4QA 3DR6A 5BWAB 4FD5A 2FL4A 1CJWA 2BUEA 4B11A 2Y0MA 1XF8A 1Q2YA 4OLLA 4RS2A 4E0AA 4KVOE 1IIDA 1KZFA 4II9A 3GY9A 1IYKA 3TOAA 3DR8A 2HV2A 3FRMA 2IL4A 2KCWA 3V8IA 4F0XA 4YGOA 2Z3LA 5C88A 2J8MA 4I49A 2B5GA 2EUIA 4Q36A 4NF1A 1YX0A 4NEXA 4AVAA 2OZUA 2GANA 2ZPAA 5EC4A 1KUVA 2PR8A 4UCMA 1QSRA 3B8GA 2Z3OA 3E0KA 2FSRA 3W91A 4JLYA 2FE7A 4CYPA 4MFJA 4KLWA 3JVNA 4IF5A 3KKWA 1U6MA 4R57A 5KTCA 1P0HA 5FVJA 4PK3A 2F5IA 3G3SA 4OAEA 1J4JA 5J8FA 4PV6A 4ZGYB 2JDDA 3TO6A 1Z9UA 3I3GA 4C2ZA 3PP9A 2P6FA 2QIRA 2P0WA 5IV0A 2NMTA 4XPDB 2CXAA 4RI1A 2R7HA 4MFQA 2C27A 5F48A 3F0AA 2Q4VA 3R1KA 3IWEA 4QB9A 3R9FA 1YR0A 4CAFA 2DPTA 4FD6A 4AG9A 4CYQA 3QB8A 2PR1A 2Z3NA 1R57A 1S7LA 4A30A 4R87A 2PSWA 3R96A 4M3SA 3BJ7A 2B3VA 4JWPA 3TFYA 2Z3PA 4UWJA 5KTDA 1IB1E 2VQYA 4KUAA 4KOTA 3IU2A 4LUAA 4UCPA 4CGMA 4CRYB 5JPHA 1XIXA 5EBVA 3UY5A 4CAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QBJ A;  2FCK A;  2CNM A;  3LD2 A;  2VZZ A;  4YFJ A;  2JEV A;  2PQ8 A;  3ZZI A;  1YRE A;  4EVY A;  4DNC A;  4IUS A;  4MBU A;  1VHS A;  3LOD A;  3TCV A;  2CNS A;  1QSN A;  2G0B A;  3CXQ A;  2JDC A;  2HQY A;  4KOV A;  4HNY B;  1S7K A;  5GCN A;  1S7N A;  3ZJ0 A;  4FD7 A;  4R9M A;  1SQH A;  3W6S A;  1N71 A;  2ZW7 A;  1QSM A;  2OZG A;  1YVK A;  5HH1 A;  1M4G A;  3CXS A;  2Q04 A;  2B4D A;  4XPK A;  4XPD C;  2FIW A;  3TOB A;  1Y9K A;  2FT0 A;  2BSW A;  3K9U A;  5I0C A;  4MJ8 A;  4UA3 A;  3GYA A;  2G3A A;  2G3T A;  3MGD A;  3TT2 A;  1B6B A;  1PUA A;  1Q2C A;  1YVO A;  4U9Z A;  4U5Y A;  4J3G A;  4KLV A;  4JD6 A;  1NMT A;  2FXF A;  2WPW A;  3S6G A;  3OWC A;  4CAX A;  2ZXV A;  1VKC A;  2Z10 A;  5F49 A;  3CXP A;  1I21 A;  4FD4 A;  3FBU A;  2VZY A;  4KOX A;  3PGP A;  1CM0 A;  3P2F A;  1S60 A;  1MJB A;  1Q2D A;  1M1D A;  1LRZ A;  3DDD A;  3F8K A;  3T90 A;  5ISV A;  4AVB A;  4F0Y A;  2OH1 A;  1M4I A;  1K4J A;  5J8C A;  5F47 A;  3C26 A;  5JQ4 A;  4Y49 B;  3FXT A;  3WR7 A;  4B5P B;  5C82 A;  1M4D A;  3F5B A;  1IYL A;  4XNH C;  2R8V A;  3DNS A;  4XPL A;  2Z0Z A;  5F46 A;  1S7F A;  3R9E A;  2EVN A;  4KVM E;  1ON0 A;  4M85 A;  1RO5 A;  2P6G A;  1XMT A;  3IGR A;  3PZJ A;  4R3L A;  1Y9W A;  1BOB A;  2D4O A;  4MY3 A;  2Q7B A;  2AJ6 A;  1UFH A;  2Q0Y A;  2GE3 A;  3FIX A;  4KOY A;  2BEI A;  3VWE A;  3RYO A;  4CRZ B;  2CNT A;  4R3K A;  2REE A;  2B5G B;  4ONU A;  1IIC A;  4JJX A;  2JLM A;  2BL1 A;  5KTA A;  4L89 A;  2FS5 A;  1NSL A;  2ZW4 A;  4HNX B;  3EO4 A;  4BMH A;  3FNC A;  4QVT A;  4KOR A;  3P2H A;  4PK2 A;  5HMN A;  4NSQ A;  2QEC A;  3S6F A;  4X5K A;  3FB3 A;  4HNW B;  3GKR A;  4XNH B;  3TTH A;  4UBR A;  1L0C A;  2R98 A;  3R9G A;  2FIA A;  3BJ8 A;  4HKF A;  1TIQ A;  2VXK A;  1MK4 A;  4L8A A;  3TE4 A;  1Y7R A;  4AG7 A;  1I1D A;  3G8W A;  4AVC A;  2OB0 A;  4Y49 C;  2VI7 A;  4AB7 A;  1B87 A;  3D8P A;  3FYN A;  2I79 A;  4PSX A;  2WPX A;  3VWD A;  1V0C A;  4PSW A;  3R95 A;  2B58 A;  2ARH A;  4KVX A;  3JUW A;  1PU9 A;  3T9Y A;  1GHE A;  4H6U A;  1KUY A;  2H5M A;  3EY5 A;  3S6H A;  4YRH A;  5H84 A;  4E8O A;  1Z4E A;  3EFA A;  2Q44 A;  3EXN A;  3NE7 A;  1YGH A;  2QML A;  3EC4 A;  5DWN A;  1S5K A;  1RXT A;  4JXQ A;  5CNP A;  4U9Y A;  3SXN A;  2Z11 A;  4CAW A;  3S6K A;  4QUS A;  4KZT A;  2X7B A;  1S3Z A;  4NCZ A;  2P6E A;  1XE4 A;  1YLE A;  4F6A A;  1Z4R A;  2PRB A;  3W6X A;  3DSB A;  1FY7 A;  2Q4Y A;  2J8N A;  4E2A A;  1MJA A;  3D3S A;  3D2M A;  3TO7 A;  2CY2 A;  4KOU A;  2D4P A;  1QSO A;  4KUB A;  4B5O A;  2R1I A;  4KOS A;  4ORF A;  2OZH A;  1MJ9 A;  1NE9 A;  4UWI A;  2B4D B;  4MY0 A;  1WK4 A;  2GIV A;  2K5T A;  3D2P A;  4GS4 A;  3IWG A;  2VEZ A;  5DWM A;  4LX9 A;  1I12 A;  2PC1 A;  4JXR A;  1OZP A;  2A4N A;  4H6Z A;  1QST A;  2AE6 A;  3BLN A;  4ZBG A;  1WWZ A;  5IB0 A;  2B3U A;  2I00 A;  2REF A;  4CS0 B;  3TO9 A;  4K30 A;  2J8R A;  2VBQ A;  1KUX A;  2PDO A;  5H86 A;  4NXY A;  2OU2 A;  2ZW5 A;  4KOW A;  3I9S A;  3QAH A;  4H89 A;  1YK3 A;  5E96 A;  2RC4 A;  4B5P A;  2HUZ A;  2DXQ A;  2ZW6 A;  3N7Z A;  3SHP A;  2B4B A;  1M44 A;  2O28 A;  4MI4 A;  1BO4 A;  5IX3 A;  4QC6 A;  3SXO A;  1P4N A;  4OAD A;  1XEB A;  2ATR A;  4MHD A;  3H4Q A;  3DR6 A;  4FD5 A;  2FL4 A;  1CJW A;  2BUE A;  2Y0M A;  1XF8 A;  1Q2Y A;  4OLL A;  4RS2 A;  4E0A A;  4KVO E;  1IID A;  1KZF A;  4II9 A;  3GY9 A;  1IYK A;  3TOA A;  3DR8 A;  2HV2 A;  3FRM A;  2IL4 A;  2KCW A;  3V8I A;  4YGO A;  5C88 A;  2J8M A;  4I49 A;  2B5G A;  2EUI A;  4NF1 A;  1YX0 A;  4NEX A;  4AVA A;  2OZU A;  2GAN A;  2ZPA A;  5EC4 A;  1KUV A;  2PR8 A;  1QSR A;  3B8G A;  3E0K A;  2FSR A;  3W91 A;  4JLY A;  2FE7 A;  4KLW A;  3JVN A;  4IF5 A;  3KKW A;  1U6M A;  4R57 A;  5KTC A;  1P0H A;  5FVJ A;  4PK3 A;  2F5I A;  3G3S A;  4OAE A;  1J4J A;  5J8F A;  4PV6 A;  2JDD A;  3TO6 A;  1Z9U A;  3I3G A;  3PP9 A;  2P6F A;  2QIR A;  2P0W A;  5IV0 A;  2NMT A;  4XPD B;  4RI1 A;  2R7H A;  5F48 A;  2C27 A;  3F0A A;  2Q4V A;  3R1K A;  4QB9 A;  3R9F A;  1YR0 A;  4FD6 A;  4AG9 A;  3QB8 A;  2PR1 A;  1R57 A;  1S7L A;  4R87 A;  2PSW A;  3R96 A;  4M3S A;  3BJ7 A;  2B3V A;  4JWP A;  3TFY A;  4UWJ A;  5KTD A;  1IB1 E;  2VQY A;  4KUA A;  4KOT A;  4LUA A;  4CRY B;  5JPH A;  1XIX A;  5EBV A;  3UY5 A;  4CAV A; 
#chains in the Genus database with same CATH topology
 1YSJ A;  4W9Y A;  1QMU A;  4ZX9 A;  2POK A;  4TNU A;  4QBJ A;  2FCK A;  4P4B A;  2CNM A;  2GU2 A;  1F2O A;  1TKJ A;  3IFE A;  3MN8 A;  3SJX A;  3LD2 A;  2VZZ A;  4YFJ A;  1UWY A;  3IO1 A;  1A2Z A;  2JEV A;  3FVL A;  3S9M A;  2PQ8 A;  2PJ8 A;  3HLP A;  3ZZI A;  1TKH A;  1YRE A;  3IJ3 A;  4EVY A;  4DNC A;  1HEE A;  4IUS A;  4MBU A;  1VHS A;  3LOD A;  3B3W A;  4OC0 A;  3TCV A;  5DS0 A;  3D7F A;  2CNS A;  1QSN A;  3KHX A;  2G0B A;  3CXQ A;  5AG5 A;  2F7V A;  2JDC A;  2HQY A;  3FF3 A;  4KOV A;  1QQ9 A;  4HNY B;  4OC5 A;  4A32 A;  1S7K A;  5GCN A;  1BPN A;  2HC9 A;  1BAV A;  1S7N A;  1XRY A;  1ZG9 A;  5A27 A;  3ZJ0 A;  4FD7 A;  4R9M A;  3VAT A;  1SQH A;  5D8N A;  4P4D A;  3W6S A;  1N71 A;  1Z8T A;  3SI0 A;  3PB8 X;  4P6Y A;  2ZW7 A;  1M4L A;  1QSM A;  3BI0 A;  2OZG A;  1YVK A;  1YLO A;  5HH1 A;  1M4G A;  2EBJ A;  2ZOG A;  3CXS A;  4OME A;  2Q04 A;  5G21 A;  4WJB A;  2B4D A;  2PIZ A;  4XPD C;  2FIW A;  4XPK A;  3H8G A;  2VL1 A;  3TOB A;  2ZEO A;  4LQ6 A;  1Y9K A;  2FT0 A;  2BSW A;  1CG2 A;  3K9U A;  4FWU A;  5I0C A;  4MJ8 A;  4UA3 A;  3GYA A;  5AGE A;  2G3A A;  4MHZ A;  2G3T A;  3MGD A;  4MXU A;  2YGW A;  4BIN A;  3TT2 A;  4F8Z A;  1B6B A;  2FVG A;  1PUA A;  1Q2C A;  6CPA A;  1YVO A;  4U9Z A;  1AYE A;  1BLL E;  4U5Y A;  4J3G A;  4KLV A;  4JD6 A;  1NMT A;  4F9V A;  5HVG A;  2FXF A;  5ELY A;  1ZG7 A;  2WPW A;  3S6G A;  4A2Z A;  4CGL A;  2V8V A;  4MFZ A;  5LYF A;  3OWC A;  3CPX A;  4NGM A;  1KWM A;  4A39 A;  4CAX A;  2ZXV A;  1VKC A;  2Z10 A;  3H8E A;  5F49 A;  3CXP A;  4OC4 A;  4NJR A;  1I21 A;  4FD4 A;  3FBU A;  3NH4 A;  5G20 A;  2VZY A;  4MCP A;  4KOX A;  3PGP A;  2EO8 A;  3PEI A;  1CM0 A;  3P2F A;  3NH8 A;  1S60 A;  1MJB A;  1Q2D A;  1M1D A;  1LRZ A;  1ZLH A;  3DDD A;  3F8K A;  1Z8X A;  4P44 A;  3T90 A;  5ISV A;  2EK9 A;  1Z5R A;  4AVB A;  4F0Y A;  4FAI A;  4UCN A;  2OH1 A;  2PJ4 A;  4UF4 A;  3H5Z A;  3GIU A;  1M4I A;  1K4J A;  3NH5 A;  5J8C A;  4CPA A;  4KS9 A;  5F47 A;  1CPX A;  3KHZ A;  3C26 A;  3D7H A;  2AFM A;  5HVH A;  4OC1 A;  1VHE A;  2PJ1 A;  4P10 A;  3D67 A;  3D7D A;  4MHP A;  2GRE A;  5JQ4 A;  3KZW A;  2QJ8 A;  3IU1 A;  3JRU A;  4UIA A;  4Y49 B;  4FUU A;  5LYI A;  3PB7 X;  2ZEG A;  3FXT A;  1AUG A;  4K3N A;  3WR7 A;  4B5P B;  3H8F A;  5C82 A;  4ZI6 A;  1M4D A;  3BXM A;  5J1Q A;  3BI1 A;  2J9A A;  2AFS A;  2CIJ A;  2DPS A;  2JBJ A;  2ZEE A;  3F5B A;  2WUU A;  3KL9 A;  5K8P A;  1IYL A;  4XNH C;  4PXC A;  2PJ6 A;  3IEH A;  1TKF A;  2R8V A;  3DNS A;  5LRJ A;  4XPL A;  2Z0Z A;  3RBU A;  5F46 A;  4DYO A;  1S7F A;  3R9E A;  4CYN A;  4OP4 A;  2EVN A;  4KVM E;  3WC5 A;  4TWE A;  3I1U A;  1ON0 A;  1VGY A;  4M85 A;  1RO5 A;  2P6G A;  3LMS A;  1XMT A;  3IGR A;  3PZJ A;  3FX6 A;  4R3L A;  2RB7 A;  1Y9W A;  3B35 A;  1BOB A;  2PJ3 A;  2D4O A;  4MY3 A;  2Q7B A;  2PVV A;  2YNC C;  1YQE A;  2AJ6 A;  2JBK A;  2YND A;  5K8M A;  3B7I A;  1UFH A;  2GLJ A;  2GE3 A;  2Q0Y A;  3FIX A;  3LAC A;  4KOY A;  4UFX A;  2BEI A;  3VWE A;  3RYO A;  3B3S A;  4CRZ B;  3RNZ A;  4RN7 A;  2CNT A;  4R3K A;  2REE A;  2WZN A;  2PJ7 A;  2B5G B;  4ONU A;  3VAR A;  3WC6 A;  4UEE A;  4MRI A;  3KI9 A;  3KR4 A;  1IIC A;  4JJX A;  4MMO A;  2JLM A;  2BL1 A;  3CZX A;  3A9L A;  4M6G A;  4CGP A;  4L89 A;  1ELM P;  5KTA A;  2FS5 A;  3FEC A;  1NSL A;  3IC1 A;  4FBE A;  2AFO A;  2ZW4 A;  4HNX B;  3EO4 A;  4BMH A;  3FNC A;  3FH4 A;  4QVT A;  4KOR A;  3TC8 A;  3P2H A;  4OKO A;  4BD9 A;  1Y0Y A;  2F8H A;  4PXE A;  4PK2 A;  4BBH A;  3FMC A;  2PJ9 A;  5HMN A;  3S9N A;  4NSQ A;  5AG7 A;  2QEC A;  4NGP A;  3S6F A;  4X5K A;  1R3N A;  3FB3 A;  4HNW B;  3GKR A;  4XNH B;  3TTH A;  4UBR A;  1L0C A;  1YW4 A;  2R98 A;  1ZO0 A;  4B6Z A;  3R9G A;  2FIA A;  3BJ8 A;  3SJF A;  4HKF A;  1TIQ A;  2VXK A;  1MK4 A;  3DGV A;  4L8A A;  2DEA A;  4JYW A;  3TE4 A;  1Y7R A;  4AG7 A;  2Z3M A;  4ZY0 A;  1LCP A;  2XEF A;  4P4E A;  1I1D A;  3G8W A;  4AVC A;  4X2T A;  4C2Y A;  3HUV A;  2O4H A;  2OB0 A;  4Y49 C;  5LYD A;  2VI7 A;  2PJC A;  1OBR A;  2ODF A;  4AB7 A;  1B87 A;  3D8P A;  3DLJ A;  3FJU A;  3FYN A;  4KSF A;  2BOA A;  2ZEN A;  3UY5 A;  2AFU A;  2I79 A;  4MFK A;  4OID A;  4R76 A;  2Q7S A;  3PRT A;  4PSX A;  4B14 A;  4C7H A;  4B12 A;  2WPX A;  4ONW A;  3RZA A;  1X10 A;  2Z3K A;  3VWD A;  1V0C A;  4PSW A;  2PJ5 A;  3GUX A;  3R95 A;  2B58 A;  1LAP A;  2ARH A;  4NGR A;  4ZY2 A;  2ANP A;  2ZEM A;  3KQZ A;  4KVX A;  3JUW A;  5G22 A;  4ZY1 A;  3FEE A;  1PU9 A;  4AXV A;  3T9Y A;  1GHE A;  4KSA A;  4H6U A;  5JGF A;  1KUY A;  4MFP A;  2H5M A;  3EY5 A;  1FNO A;  3S6H A;  1F2P A;  4YRH A;  5H84 A;  2ZEL A;  1Z4E A;  3KQX A;  3EFA A;  2Q44 A;  1R43 A;  4UFW A;  4E8O A;  5CBM A;  1YW6 A;  3EXN A;  1ELL P;  3NE7 A;  4PXB A;  4A37 A;  3CDX A;  1YGH A;  4OC2 A;  1BPM A;  4Q38 A;  2QML A;  4PQA A;  3EC4 A;  3SI1 A;  5DWN A;  1S5K A;  1RXT A;  2PJA A;  4X8I A;  4F9U A;  2NYQ A;  2AFW A;  4JXQ A;  5CNP A;  4U9Y A;  5HXD A;  5I4M A;  2V8G A;  3SXN A;  1ARM A;  2Z11 A;  4CAW A;  3MRU A;  3RAM A;  2PJ0 A;  4NGN A;  4C2X A;  3S6K A;  1YME A;  4QUS A;  4CGN A;  4KZT A;  2OOT A;  2CTB A;  2X7B A;  1S3Z A;  4EFD A;  4RUH A;  1ZLI A;  4NCZ A;  2P6E A;  1XE4 A;  4G1P A;  1YLE A;  2C6P A;  3V38 A;  4C68 A;  4M6I A;  1X12 A;  3B3C A;  4MHY A;  4F6A A;  1Z4R A;  4NGS A;  2PRB A;  1IOF A;  2BCO A;  3DSB A;  3W6X A;  2QYV A;  1XOV A;  1FY7 A;  3TX8 A;  2Q4Y A;  2J8N A;  5AG6 A;  4E2A A;  4B10 A;  8CPA A;  1MJA A;  3D3S A;  2IJZ A;  1IU8 A;  3V7Z A;  3SJE A;  1IY7 A;  3D2M A;  3K9T A;  3TO7 A;  2CY2 A;  4KOU A;  3PBE A;  2D4P A;  3K2K A;  1QSO A;  4KUB A;  1FT7 A;  1TF8 A;  2R1I A;  4B5O A;  4KOS A;  3JTK A;  1XBU A;  2YNC A;  5G1Z A;  4ORF A;  3QNV A;  3B3V A;  2OZH A;  4MFL A;  1MJ9 A;  1NE9 A;  4OIW A;  4CYO A;  2AFX A;  4UWI A;  1LFW A;  2Q43 A;  2EWB A;  2B4D B;  2WSA A;  3IWW A;  4MY0 A;  4ZX8 A;  1WK4 A;  2GIV A;  5AG4 A;  3L2N A;  4R6T A;  1VIX A;  2YNE A;  2K5T A;  3D2P A;  4GS4 A;  3IWG A;  1ARL A;  4A95 A;  3D68 A;  2VEZ A;  2ZED A;  5DWM A;  3T8W A;  4LX9 A;  2PJB A;  2CF4 A;  3WAB A;  4P4F A;  4Q7A A;  3SJG A;  1I12 A;  2PC1 A;  2QVP A;  3GB0 A;  1CX8 A;  4JXR A;  1PCA A;  1OZP A;  5D29 A;  4NGT A;  4YWY A;  4ZYQ A;  2XEJ A;  2A4N A;  4A31 A;  4H6Z A;  4LQG A;  5HVF A;  1QST A;  2AE6 A;  4UEF A;  3BLN A;  4MHN A;  1DTD A;  4IK2 A;  1WWZ A;  4GM5 A;  4ZBG A;  5IB0 A;  2B3U A;  2I00 A;  4P4I A;  2NSM A;  4A33 A;  4UEZ A;  2REF A;  4CS0 B;  5A28 A;  3SI2 A;  4CGO A;  3LWU A;  3TO9 A;  4K30 A;  1TXR A;  2PCU A;  2J8R A;  2VBQ A;  1KUX A;  3NE8 A;  5CPA A;  2Q51 A;  3KR5 A;  2PDO A;  2O53 A;  2RFH A;  4WWV A;  5H86 A;  4NXY A;  2OU2 A;  2ZW5 A;  3S9L A;  3ISX A;  2V77 A;  4KOW A;  3B3T A;  3I9S A;  3BHX A;  3QAH A;  3PB6 X;  4H89 A;  1CBX A;  1YK3 A;  5E96 A;  2RC4 A;  4B5P A;  2HUZ A;  2DXQ A;  2PJ2 A;  2ZW6 A;  4KSI A;  2OR4 A;  3N7Z A;  3SHP A;  2AFZ A;  2XEG A;  2B4B A;  1M44 A;  2O28 A;  4B13 A;  3CT9 A;  4MI4 A;  1BO4 A;  3WT4 A;  4CAE A;  3KGQ A;  4QC6 A;  1P4N A;  3SXO A;  4OAD A;  1VHO A;  4UFV A;  1XEB A;  5IX3 A;  5K8N A;  2ATR A;  4NGQ A;  4PXD A;  4A38 A;  1EE3 P;  4MHD A;  4C7I A;  3H4Q A;  3DR6 A;  5BWA B;  3PBB A;  4IHM A;  1XMB A;  4FD5 A;  1LAN A;  2FL4 A;  3RO0 A;  3B2Y A;  1CJW A;  3KAS A;  2BUE A;  5LYL A;  2PRQ A;  4HPS A;  4B11 A;  1Z8L A;  2GFQ A;  2Y0M A;  1XF8 A;  1Q2Y A;  4OLL A;  4RS2 A;  5JH9 A;  2I3C A;  1IOI A;  4E0A A;  1ZG8 A;  3VH9 A;  5K8O A;  1Z2L A;  4KVO E;  5JM6 A;  1Y0R A;  1IID A;  1KZF A;  4NFR A;  4II9 A;  3GY9 A;  2HB6 A;  1IYK A;  2PVW A;  3TOA A;  1IGB A;  2ZEF A;  3DR8 A;  5THW A;  1XJO A;  1CPS A;  3PB9 X;  2HV2 A;  4MCR A;  3FRM A;  2IQ6 A;  2IL4 A;  2G9D A;  2KCW A;  3V8I A;  3PB4 X;  4F0X A;  4YGO A;  2Z3L A;  5C88 A;  2J8M A;  4I49 A;  2B5G A;  4IAV A;  3D66 A;  2EUI A;  2IMO A;  4Q36 A;  4DUK A;  4NF1 A;  1YX0 A;  2Q4Z A;  3PFO A;  5LRG A;  4MCQ A;  4NEX A;  4NJQ A;  4AVA A;  2OZU A;  2GAN A;  4MCS A;  2ZPA A;  5EC4 A;  1KUV A;  2PR8 A;  3CPA A;  3D7G A;  4UCM A;  1QSR A;  3B8G A;  2Z3O A;  7CPA A;  3E0K A;  2FSR A;  4O23 A;  3W91 A;  2WYR A;  4JLY A;  2FE7 A;  4X3R A;  4A94 A;  4CYP A;  2C1C A;  4MFJ A;  4KLW A;  4PPZ A;  3JVN A;  5F09 A;  4IF5 A;  3KKW A;  1U6M A;  3PFE A;  4R57 A;  5KTC A;  1P0H A;  5EMI A;  2ZEH A;  5FVJ A;  2PE3 A;  4PK3 A;  2F5I A;  3G3S A;  4OAE A;  2C6C A;  1J4J A;  1GYT A;  2ZEP A;  5J8F A;  4PV6 A;  4ZGY B;  2JDD A;  3TO6 A;  1Z9U A;  2GLF A;  1JQG A;  3I3G A;  1JWQ A;  4C2Z A;  2V8D A;  3PP9 A;  2P6F A;  1TF9 A;  2QIR A;  2P0W A;  5IV0 A;  1F57 A;  3NA6 A;  4JZ0 A;  5IB9 A;  1Q7L A;  2ABZ A;  4GXH A;  1HDU A;  2NMT A;  4YU9 A;  4XPD B;  2CXA A;  4RI1 A;  3GLJ A;  2R7H A;  4H2K A;  4MFQ A;  2C27 A;  1LOK A;  5F48 A;  3F0A A;  2Q4V A;  3R1K A;  1CP6 A;  1Y7E A;  3IWE A;  4OC3 A;  4QB9 A;  4R8F A;  1CP7 A;  1RTQ A;  3R9F A;  3D4U A;  4P45 A;  1YR0 A;  5LRK A;  3QAY A;  4CAF A;  1AMP A;  2DPT A;  4EWT A;  4FD6 A;  4AG9 A;  3IIB A;  4CYQ A;  2CTC A;  2EK8 A;  3QB8 A;  2PR1 A;  2Z3N A;  1Z8W A;  3WC7 A;  1R57 A;  1LAM A;  1S7L A;  2C6G A;  4R87 A;  4A30 A;  4DJL A;  2PSW A;  3R96 A;  3FED A;  4M6H A;  4M3S A;  4P4J A;  2PIY A;  3BJ7 A;  1NSA A;  2B3V A;  4R7M A;  4JWP A;  4Z65 A;  1DE4 C;  3TFY A;  3N5F A;  1H8L A;  2Z3P A;  4UWJ A;  2DF5 A;  4EME A;  5KTD A;  1HDQ A;  1IB1 E;  1XFO A;  4UIB A;  2BO9 A;  1PYT B;  2JEW A;  2VQY A;  4KOT A;  2XEI A;  4KUA A;  3IU2 A;  3NFZ A;  4LUA A;  3ISZ A;  2ZOF A;  4UCP A;  4CGM A;  1XIX A;  4CRY B;  5JPH A;  5EBV A;  2V8H A;  4CAV A; 
#chains in the Genus database with same CATH homology
 4QBJ A;  2FCK A;  2CNM A;  3LD2 A;  2VZZ A;  4YFJ A;  2JEV A;  2PQ8 A;  3ZZI A;  1YRE A;  4EVY A;  4DNC A;  4IUS A;  4MBU A;  1VHS A;  3LOD A;  3TCV A;  2CNS A;  1QSN A;  5AG5 A;  2G0B A;  3CXQ A;  2JDC A;  2HQY A;  4KOV A;  4HNY B;  4A32 A;  1S7K A;  5GCN A;  1S7N A;  5A27 A;  3ZJ0 A;  4FD7 A;  4R9M A;  1SQH A;  3W6S A;  1N71 A;  2ZW7 A;  1QSM A;  2OZG A;  1YVK A;  5HH1 A;  1M4G A;  3CXS A;  2Q04 A;  5G21 A;  2B4D A;  4XPK A;  4XPD C;  2FIW A;  3TOB A;  1Y9K A;  2FT0 A;  2BSW A;  3K9U A;  5I0C A;  4MJ8 A;  4UA3 A;  3GYA A;  5AGE A;  2G3A A;  2G3T A;  3MGD A;  2YGW A;  3TT2 A;  1B6B A;  1PUA A;  1Q2C A;  1YVO A;  4U9Z A;  4U5Y A;  4J3G A;  4KLV A;  4JD6 A;  1NMT A;  2FXF A;  2WPW A;  3S6G A;  4A2Z A;  4CGL A;  4MFZ A;  3OWC A;  4CAX A;  2ZXV A;  1VKC A;  2Z10 A;  5F49 A;  3CXP A;  1I21 A;  4FD4 A;  3FBU A;  5G20 A;  2VZY A;  4KOX A;  3PGP A;  1CM0 A;  3P2F A;  1S60 A;  1MJB A;  1Q2D A;  1M1D A;  1LRZ A;  3DDD A;  3F8K A;  3T90 A;  5ISV A;  4AVB A;  4F0Y A;  4UCN A;  2OH1 A;  3H5Z A;  1M4I A;  1K4J A;  5J8C A;  4KS9 A;  5F47 A;  3C26 A;  5JQ4 A;  3IU1 A;  4Y49 B;  3FXT A;  3WR7 A;  4B5P B;  5C82 A;  1M4D A;  2DPS A;  3F5B A;  2WUU A;  1IYL A;  4XNH C;  2R8V A;  3DNS A;  4XPL A;  2Z0Z A;  5F46 A;  1S7F A;  3R9E A;  4CYN A;  2EVN A;  4KVM E;  1ON0 A;  4M85 A;  1RO5 A;  2P6G A;  1XMT A;  3IGR A;  3PZJ A;  4R3L A;  1Y9W A;  1BOB A;  2D4O A;  4MY3 A;  2Q7B A;  2YNC C;  2AJ6 A;  2YND A;  1UFH A;  2Q0Y A;  2GE3 A;  3FIX A;  4KOY A;  4UFX A;  2BEI A;  3VWE A;  3RYO A;  4CRZ B;  2CNT A;  4R3K A;  2REE A;  2B5G B;  4ONU A;  1IIC A;  4JJX A;  2JLM A;  2BL1 A;  3A9L A;  5KTA A;  4CGP A;  4L89 A;  2FS5 A;  1NSL A;  2ZW4 A;  4HNX B;  3EO4 A;  4BMH A;  3FNC A;  4QVT A;  4KOR A;  3P2H A;  4BBH A;  4PK2 A;  5HMN A;  4NSQ A;  5AG7 A;  2QEC A;  3S6F A;  4X5K A;  3FB3 A;  4HNW B;  3GKR A;  4XNH B;  3TTH A;  4UBR A;  1L0C A;  2R98 A;  1ZO0 A;  3R9G A;  2FIA A;  3BJ8 A;  4HKF A;  1TIQ A;  2VXK A;  1MK4 A;  4L8A A;  3TE4 A;  1Y7R A;  4AG7 A;  2Z3M A;  1I1D A;  3G8W A;  4AVC A;  4C2Y A;  2OB0 A;  4Y49 C;  2VI7 A;  4AB7 A;  1B87 A;  3D8P A;  3FYN A;  4KSF A;  2I79 A;  4MFK A;  4PSX A;  4B14 A;  4C7H A;  4B12 A;  2WPX A;  2Z3K A;  3VWD A;  1V0C A;  4PSW A;  3R95 A;  2B58 A;  2ARH A;  4KVX A;  3JUW A;  5G22 A;  1PU9 A;  3T9Y A;  1GHE A;  4KSA A;  4H6U A;  1KUY A;  4MFP A;  2H5M A;  3EY5 A;  3S6H A;  4YRH A;  5H84 A;  4UFW A;  1Z4E A;  4E8O A;  3EFA A;  2Q44 A;  3EXN A;  3NE7 A;  1YGH A;  4Q38 A;  2QML A;  3EC4 A;  5DWN A;  1S5K A;  1RXT A;  4JXQ A;  5CNP A;  4U9Y A;  3SXN A;  2Z11 A;  4CAW A;  4C2X A;  3S6K A;  4QUS A;  4CGN A;  4KZT A;  2X7B A;  1S3Z A;  4NCZ A;  2P6E A;  1XE4 A;  1YLE A;  4C68 A;  4F6A A;  1Z4R A;  2PRB A;  3W6X A;  3DSB A;  1FY7 A;  2Q4Y A;  2J8N A;  5AG6 A;  4E2A A;  4B10 A;  1MJA A;  3D3S A;  3D2M A;  3TO7 A;  2CY2 A;  4KOU A;  2D4P A;  1QSO A;  4KUB A;  4B5O A;  2R1I A;  4KOS A;  3JTK A;  2YNC A;  5G1Z A;  4ORF A;  2OZH A;  4MFL A;  1MJ9 A;  1NE9 A;  4CYO A;  4UWI A;  2WSA A;  2B4D B;  5AG4 A;  4MY0 A;  1WK4 A;  2GIV A;  2YNE A;  2K5T A;  3D2P A;  4GS4 A;  3IWG A;  4A95 A;  2VEZ A;  5DWM A;  4LX9 A;  1I12 A;  2PC1 A;  4JXR A;  1OZP A;  2A4N A;  4A31 A;  4H6Z A;  1QST A;  2AE6 A;  3BLN A;  4ZBG A;  1WWZ A;  5IB0 A;  2B3U A;  2I00 A;  4A33 A;  2REF A;  4CS0 B;  5A28 A;  4CGO A;  3TO9 A;  4K30 A;  2J8R A;  2VBQ A;  1KUX A;  2PDO A;  5H86 A;  4NXY A;  2OU2 A;  2ZW5 A;  4KOW A;  3I9S A;  3QAH A;  4H89 A;  1YK3 A;  5E96 A;  2RC4 A;  4B5P A;  2HUZ A;  2DXQ A;  2ZW6 A;  3N7Z A;  3SHP A;  2B4B A;  1M44 A;  2O28 A;  4B13 A;  4MI4 A;  1BO4 A;  4CAE A;  5IX3 A;  4QC6 A;  3SXO A;  1P4N A;  4OAD A;  4UFV A;  1XEB A;  2ATR A;  4MHD A;  4C7I A;  3H4Q A;  3DR6 A;  5BWA B;  4FD5 A;  2FL4 A;  1CJW A;  2BUE A;  4B11 A;  2Y0M A;  1XF8 A;  1Q2Y A;  4OLL A;  4RS2 A;  4E0A A;  4KVO E;  1IID A;  1KZF A;  4II9 A;  3GY9 A;  1IYK A;  3TOA A;  3DR8 A;  2HV2 A;  3FRM A;  2IL4 A;  2KCW A;  3V8I A;  4F0X A;  4YGO A;  2Z3L A;  5C88 A;  2J8M A;  4I49 A;  2B5G A;  2EUI A;  4Q36 A;  4NF1 A;  1YX0 A;  4NEX A;  4AVA A;  2OZU A;  2GAN A;  2ZPA A;  5EC4 A;  1KUV A;  2PR8 A;  4UCM A;  1QSR A;  3B8G A;  2Z3O A;  3E0K A;  2FSR A;  3W91 A;  4JLY A;  2FE7 A;  4CYP A;  4MFJ A;  4KLW A;  3JVN A;  4IF5 A;  3KKW A;  1U6M A;  4R57 A;  5KTC A;  1P0H A;  5FVJ A;  4PK3 A;  2F5I A;  3G3S A;  4OAE A;  1J4J A;  5J8F A;  4PV6 A;  4ZGY B;  2JDD A;  3TO6 A;  1Z9U A;  3I3G A;  4C2Z A;  3PP9 A;  2P6F A;  2QIR A;  2P0W A;  5IV0 A;  2NMT A;  4XPD B;  2CXA A;  4RI1 A;  2R7H A;  4MFQ A;  2C27 A;  5F48 A;  3F0A A;  2Q4V A;  3R1K A;  3IWE A;  4QB9 A;  3R9F A;  1YR0 A;  4CAF A;  2DPT A;  4FD6 A;  4AG9 A;  4CYQ A;  3QB8 A;  2PR1 A;  2Z3N A;  1R57 A;  1S7L A;  4A30 A;  4R87 A;  2PSW A;  3R96 A;  4M3S A;  3BJ7 A;  2B3V A;  4JWP A;  3TFY A;  2Z3P A;  4UWJ A;  5KTD A;  1IB1 E;  2VQY A;  4KUA A;  4KOT A;  3IU2 A;  4LUA A;  4UCP A;  4CGM A;  4CRY B;  5JPH A;  1XIX A;  5EBV A;  3UY5 A;  4CAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...