3FRMA

The crystal structure of a functionally unknown conserved protein from staphylococcus epidermidis atcc 12228.
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
252
structure length
252
Chain Sequence
AMSKITFKDIYIDGNKITEDSRKAIYLLPPQPLKYASNTWIYKTMPTMNQWLKDIEVQKKMHLNQSSYHLSFSFPANEKIDEVLLEKIRELGFQIGVLELYVIEAKALKELSRKRDVDIQLVSSNNINDYLHVYDAFARPFGDSYANMVKQHIYSSYNLDDIERLVAYVNHQPVGIVDIIMTDKTIEIDGFGVLEEFQHQGIGSEIQAYVGRMANERPVILVADGKDTAKDMYLRQGYVYQGFKYHILKENI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a functionally unknown conserved protein from Staphylococcus epidermidis ATCC 12228.
rcsb
source organism Staphylococcus epidermidis
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized conserved protein
total genus 70
structure length 252
sequence length 252
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
A PF18467 DUF5613 Domain of unknown function (DUF5613)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3frmA00
2CY2A 4EVYA 4J3GA 4KVME 2PDOA 5C82A 3RYOA 4YRHA 2ZW6A 1YGHA 4L8AA 3S6FA 4Y49C 1B87A 4PK3A 2VBQA 3IWGA 1UFHA 3MGDA 3QAHA 1IB1E 3D2MA 4AVAA 1MJ9A 2G0BA 4AVBA 3CXSA 1B6BA 1YX0A 2ATRA 4LX9A 4UWJA 2FCKA 2FL4A 5IB0A 2OZUA 4X5KA 1OZPA 2Z0ZA 2B58A 1XE4A 4KZTA 2J8NA 2OZHA 2QMLA 4LUAA 1RO5A 3CXPA 2R98A 5F49A 3F8KA 3WR7A 5F48A 2J8RA 4R87A 4XPDB 3FIXA 4CAWA 2RC4A 3LD2A 3CXQA 3PGPA 3VWEA 5H84A 3D8PA 4KUBA 1XEBA 2IL4A 4IF5A 5HH1A 1KUVA 2FXFA 2AJ6A 1WK4A 1L0CA 5KTDA 5FVJA 1GHEA 2CNTA 2JLMA 3F0AA 3NE7A 4E0AA 4FD7A 1NE9A 5ISVA 4MHDA 1M44A 2FSRA 2BL1A 1Y7RA 2A4NA 4NXYA 2Q4YA 3GKRA 2FE7A 4FD5A 2PC1A 1U6MA 1Z4RA 3BJ7A 4ONUA 3H4QA 2QIRA 2P6GA 1KUYA 4B5PA 2GANA 3FNCA 1IYKA 1YREA 4RS2A 1SQHA 2OB0A 2WPXA 4F0YA 1M4DA 2Q0YA 3P2HA 3I3GA 4GS4A 1R57A 1S5KA 2P0WA 3SHPA 1Z9UA 1I21A 2VEZA 4QBJA 4PK2A 5JPHA 3W6XA 2ZW4A 5DWNA 4YGOA 2PQ8A 2QECA 2CNMA 4JJXA 1IYLA 4CS0B 3R9GA 3SXNA 2R7HA 4QUSA 4I49A 1S60A 3C26A 5KTAA 3EFAA 4XNHC 5KTCA 1CJWA 1Q2DA 4FD6A 3UY5A 2GIVA 2D4PA 1NMTA 2B4BA 2H5MA 3TO7A 4KOTA 2NMTA 3FXTA 3I9SA 4KLVA 4OAEA 3S6KA 4YFJA 4KOUA 2GE3A 1M4IA 4AG7A 3ZZIA 1QSRA 4R57A 2VQYA 4OLLA 2Y0MA 3S6GA 2Q4VA 2BEIA 4UBRA 4M85A 2FS5A 2ZPAA 1Q2YA 2PR8A 1IIDA 1I1DA 4AB7A 4F6AA 5F47A 1TIQA 2P6FA 5H86A 4DNCA 1IICA 2PR1A 1S7FA 2ARHA 3P2FA 4B5PB 2FT0A 4R3KA 3TCVA 3G8WA 2VZZA 2BUEA 1BOBA 4QC6A 2Z10A 2Z11A 3TO9A 3TFYA 4NF1A 1XIXA 3F5BA 2C27A 1K4JA 1LRZA 2OU2A 2R1IA 1P0HA 4AVCA 2PSWA 1KZFA 1MJBA 2Q04A 2G3AA 4M3SA 1RXTA 3FYNA 5IV0A 5JQ4A 3LODA 1QSOA 1I12A 2PRBA 2JDCA 4OADA 3TO6A 2HUZA 2HV2A 3ZJ0A 3TE4A 3B8GA 2B5GA 4IUSA 2VXKA 4R9MA 5HMNA 1VKCA 4U9YA 3PP9A 3D2PA 2ZXVA 4XPDC 3V8IA 4CRYB 4CRZB 4RI1A 4ZBGA 4KORA 4AG9A 4MJ8A 4HNXB 3G3SA 4CAXA 5EC4A 3GYAA 3W6SA 2D4OA 3DR6A 3BJ8A 3S6HA 4PSWA 5C88A 4XPLA 2X7BA 1QSNA 3R96A 4KOWA 4MBUA 1J4JA 4FD4A 4XNHB 4B5OA 2ZW7A 1XF8A 3VWDA 4QVTA 3SXOA 4UWIA 3R1KA 4JLYA 3EO4A 4HKFA 4UA3A 4H6ZA 2CNSA 4HNWB 4PSXA 2F5IA 4CAVA 1FY7A 3FRMA 2REFA 2REEA 3EXNA 1PUAA 4KVXA 5CNPA 3N7ZA 3W91A 2Q44A 3JUWA 2I79A 4XPKA 1VHSA 3PZJA 4NCZA 2AE6A 2HQYA 4KVOE 2OZGA 1Z4EA 2G3TA 2B3UA 5I0CA 4MY3A 4KOXA 2J8MA 5EBVA 3QB8A 2WPWA 2OH1A 1YK3A 2ZW5A 4MI4A 1V0CA 1Y9WA 1BO4A 1P4NA 1QSTA 2JDDA 3IGRA 3DSBA 4NEXA 3BLNA 3D3SA 1S3ZA 1KUXA 4H6UA 1S7LA 1S7KA 3KKWA 1Y9KA 1M1DA 4ORFA 4H89A 2FIWA 2JEVA 5DWMA 4K30A 5J8FA 4NSQA 3OWCA 3GY9A 4U5YA 4II9A 3T90A 2KCWA 2P6EA 2I00A 2EVNA 3K9UA 4QB9A 2O28A 4JXRA 4HNYB 1MK4A 3DR8A 1WWZA 5J8CA 1YVOA 4E8OA 3TT2A 4JD6A 2B4DA 3EC4A 3JVNA 1Q2CA 4PV6A 1YR0A 2K5TA 2EUIA 4L89A 3R9EA 5GCNA 3R95A 1MJAA 2VI7A 4KOYA 2B3VA 3R9FA 3TOAA 3TTHA 4JXQA 4R3LA 2DXQA 1N71A 5F46A 1YLEA 4U9ZA 3DDDA 2R8VA 4E2AA 1ON0A 1M4GA 3T9YA 1YVKA 3TOBA 2BSWA 1PU9A 4BMHA 3E0KA 4JWPA 4KLWA 1S7NA 3DNSA 4KOSA 2FIAA 2B4DB 1NSLA 4Y49B 3FB3A 4MY0A 4KUAA 3FBUA 2VZYA 1CM0A 1QSMA 4KOVA 5IX3A 2Q7BA 3EY5A 5E96A 2B5GB 1XMTA
chains in the Genus database with same CATH superfamily
2Z3KA 5K8NA 2CY2A 4EVYA 4J3GA 4KVME 4OC0A 2PDOA 4EWTA 3PB9X 4Z65A 1ELMP 3RYOA 2C6CA 3IWEA 4YRHA 5C82A 2ZW6A 3DLJA 1YGHA 4NJQA 4EFDA 2DPSA 4L8AA 1ZLHA 3S6FA 4FAIA 3WC6A 4K3NA 4Y49C 1B87A 1LCPA 4PK3A 2GLJA 2VBQA 4A38A 8CPAA 3IWGA 2Z3PA 1UFHA 4MHNA 3MGDA 3QAHA 5LYIA 1IB1E 3T8WA 3VARA 2PCUA 2PJ4A 3D7HA 3PB8X 1VIXA 3D2MA 3D7FA 1CP7A 4AVAA 1MJ9A 2G0BA 4NGQA 4P45A 2YNEA 3V7ZA 4AVBA 3CXSA 1B6BA 3PB6X 1F2OA 4OC2A 1XMBA 1YX0A 5THWA 4IAVA 4M6GA 2EWBA 3RAMA 4UCMA 2ATRA 4RUHA 2FVGA 4LX9A 4UWJA 2FCKA 2FL4A 3B3TA 2PJ7A 5IB0A 2OZUA 3PRTA 2RB7A 1ELLP 5HXDA 4X5KA 3HLPA 1OZPA 5AG7A 2Z0ZA 3PFOA 4RN7A 4B6ZA 2B58A 2PJCA 3JTKA 1CPXA 5LRJA 4OC1A 1XE4A 2I3CA 4WJBA 4KZTA 2J8NA 3SJGA 2OZHA 4C2YA 2QMLA 1Z8XA 4LUAA 1RO5A 3CXPA 2R98A 3FEDA 5F49A 2Z3LA 1XFOA 3F8KA 3SI2A 3WR7A 3FEEA 2PVVA 5F48A 4MFKA 2J8RA 4R87A 4XPDB 4ZY1A 3SJEA 2ZEOA 3FIXA 2PJ3A 4CAWA 3MN8A 2ZEEA 2RC4A 3LD2A 5DS0A 3CXQA 4Q7AA 2PJ6A 3PGPA 3VWEA 5CPAA 5H84A 3D8PA 2YNDA 4KUBA 1XEBA 2IL4A 4IF5A 5HH1A 3I1UA 1ARMA 1KUVA 2FXFA 3H5ZA 4M6IA 4P4BA 2AJ6A 1WK4A 1ZG7A 1L0CA 2JBKA 5KTDA 5FVJA 2POKA 1GHEA 4NGRA 2CNTA 2JLMA 3IIBA 4A37A 3F0AA 4C2XA 3KR5A 2WSAA 3NE7A 1BPNA 5LRKA 4E0AA 4FD7A 1NE9A 5ISVA 4CGOA 1PYTB 4KS9A 4MHDA 1M44A 5AG5A 2FSRA 2BL1A 2GLFA 2PVWA 3D4UA 1TF8A 1Y7RA 2WYRA 2A4NA 4NXYA 3ISXA 2Q4YA 3GKRA 1AMPA 4MFZA 2FE7A 3PBEA 4FD5A 2PC1A 1U6MA 1Z4RA 2IJZA 3BJ7A 3D68A 4ONUA 3H4QA 4WWVA 2EK9A 2QIRA 4DYOA 2P6GA 1KUYA 2AFZA 5J1QA 1UWYA 4B5PA 3KZWA 4KSAA 3SI0A 2GANA 2V8HA 4A33A 3FNCA 2XEFA 1IYKA 1YREA 4PQAA 4Q38A 4PXEA 5AG4A 4RS2A 1SQHA 4X8IA 2OB0A 2G9DA 4F0XA 2WPXA 4F0YA 4R7MA 2DF5A 1M4DA 2PJAA 2Q0YA 5IB9A 2BCOA 1RTQA 3P2HA 4P4IA 3I3GA 2F8HA 3WABA 4C7IA 1YMEA 2Z3NA 5LYLA 4IHMA 4W9YA 4GS4A 1R57A 3S9MA 1S5KA 4LQ6A 2P0WA 4NGMA 3GIUA 3SHPA 1Z9UA 3KHZA 2AFOA 4OC3A 1I21A 2VEZA 1EE3P 4QBJA 2V8DA 4PK2A 5JPHA 1PCAA 3HUVA 1YW4A 3W6XA 4UIBA 1GYTA 4GXHA 3KQXA 2ZW4A 5HVGA 3FMCA 2Q43A 3B3CA 5LYFA 5DWNA 6CPAA 4YGOA 2PJ1A 4DJLA 2PQ8A 2QECA 3PBBA 4OIDA 2CNMA 4JJXA 1IYLA 3NH8A 1IOIA 4CS0B 4MFQA 1A2ZA 2V8GA 3R9GA 1F2PA 1Z8WA 3SJFA 3SXNA 2R7HA 1AUGA 4QUSA 4B13A 4I49A 1S60A 3C26A 5KTAA 5K8PA 3PEIA 4B14A 1FNOA 3EFAA 4XNHC 2O53A 5KTCA 3D67A 4PXBA 1CJWA 1Q2DA 1Z2LA 4FD6A 1IGBA 4FBEA 2NYQA 2WUUA 3UY5A 1DE4C 2GIVA 2D4PA 1NMTA 2ZOGA 2B4BA 2H5MA 5LYDA 4KOTA 2AFMA 3TO7A 2NMTA 3FXTA 4F8ZA 4UFWA 3KQZA 5LRGA 3I9SA 3MRUA 4KLVA 4OAEA 3S6KA 4KSFA 4YFJA 4KOUA 2AFWA 4OC4A 5I4MA 2GE3A 1M4IA 2O4HA 4HPSA 4AG7A 2PJ8A 3A9LA 3ZZIA 1QSRA 2ZEGA 2ABZA 3H8GA 4R57A 4UFXA 4NFRA 4A32A 2VQYA 4OLLA 4C2ZA 2EO8A 3SJXA 2Y0MA 2ZEFA 4UFVA 3S6GA 3B7IA 3DGVA 2Q4VA 3D7GA 4R8FA 2BEIA 4UBRA 1CBXA 2PE3A 4MCPA 4M85A 2FS5A 3LACA 2ZPAA 4UEEA 1Q2YA 2PR8A 1IIDA 1I1DA 2GU2A 4AB7A 4OC5A 4F6AA 2Q51A 3QAYA 1TIQA 5F47A 3IO1A 1R43A 2P6FA 4KSIA 5H86A 4A39A 3B3SA 4DNCA 1IICA 1X12A 1Z8LA 2ODFA 2PR1A 1IU8A 1S7FA 2ARHA 2F7VA 3P2FA 4B5PB 2FT0A 4H2KA 4F9UA 4X2TA 1CX8A 4R3KA 4MCRA 4NGNA 3TCVA 2EK8A 3G8WA 4MCSA 4ONWA 4G1PA 2VZZA 1CPSA 1BOBA 1LOKA 2BUEA 4QC6A 4A94A 5JM6A 2AFUA 2Z10A 2Z11A 3TO9A 3VATA 3TFYA 3RZAA 4NF1A 4ZX9A 2CTCA 4JZ0A 3FX6A 4P4DA 3BXMA 1XIXA 3PFEA 3RNZA 3F5BA 2C27A 1K4JA 1LRZA 2AFXA 2IMOA 2OU2A 2YGWA 3K9TA 4MFPA 1Q7LA 1P0HA 2R1IA 2PSWA 1KZFA 3IU2A 3SI1A 1MJBA 3WC7A 4AVCA 4C68A 4FWUA 3RBUA 2Q04A 3FJUA 3PB7X 2GFQA 2G3AA 4M3SA 4P10A 1RXTA 3FYNA 5IV0A 5G22A 3LODA 5JQ4A 1QSOA 4ZY0A 1I12A 2PRBA 5K8OA 2JDCA 4OADA 3TO6A 1XOVA 2OR4A 2HUZA 2HV2A 5D8NA 3H8EA 3ZJ0A 3B35A 4PXCA 3TE4A 3D7DA 3B8GA 2B5GA 3PB4X 4IUSA 2VXKA 4R9MA 2PIYA 2DEAA 2RFHA 5HMNA 1VKCA 2ZEHA 4DUKA 3KASA 3IC1A 4U9YA 3PP9A 5G20A 1CP6A 1BAVA 2ZXVA 3D2PA 4MXUA 4XPDC 3V8IA 1HEEA 7CPAA 2PJ5A 4CRYB 4TNUA 4OP4A 3CPAA 4BBHA 4CRZB 4RI1A 4NGPA 4CPAA 2EBJA 4ZBGA 3CT9A 4KORA 4AG9A 2ZEMA 4MJ8A 4HNXB 3G3SA 4CAXA 5EC4A 3GYAA 3W6SA 2D4OA 4IK2A 3DR6A 5K8MA 4CYNA 1TKFA 1ZG8A 3K2KA 3BJ8A 3IEHA 4PXDA 3S6HA 3FVLA 1CG2A 4PSWA 5C88A 1BLLE 4XPLA 1ZLIA 2X7BA 2ZEPA 1QSNA 3R96A 4KOWA 4MBUA 1J4JA 4FD4A 4F9VA 1JWQA 3N5FA 4XNHB 4B5OA 4A30A 4P6YA 5ELYA 5A28A 2ZW7A 1H8LA 1XF8A 1Y0RA 1HDQA 2PIZA 4QVTA 3VWDA 3SXOA 4UWIA 1TKJA 3R1KA 3V38A 4CYQA 4JLYA 3EO4A 3KHXA 4CGLA 4R76A 4HKFA 4UA3A 4CAEA 4EMEA 4H6ZA 2QYVA 4UEZA 4B10A 3FECA 2CNSA 3GB0A 1NSAA 1VGYA 3KI9A 2YNCC 4NGTA 4CGMA 3TX8A 4HNWB 4Q36A 4PSXA 5G21A 1VHEA 3IU1A 3L2NA 2F5IA 1XRYA 2WZNA 3IJ3A 1M4LA 2PJ0A 4CAVA 3RO0A 1FY7A 3FRMA 5EMIA 1F57A 3S9LA 2REFA 2REEA 3EXNA 4MMOA 4YWYA 1PUAA 4MHPA 4CYOA 1YLOA 1TF9A 3GLJA 4KVXA 4ZX8A 5CNPA 3N7ZA 1Z5RA 1TXRA 3W91A 4OMEA 2HC9A 4A2ZA 2Q44A 1X10A 3JUWA 4NJRA 4P44A 1R3NA 2I79A 4A31A 3CZXA 1Z8TA 3FF3A 4XPKA 1VHSA 3PZJA 4NCZA 2AE6A 2NSMA 3CPXA 2HQYA 4CYPA 4KVOE 2OZGA 1ZG9A 2ANPA 2J9AA 4CGPA 5F09A 2CIJA 1Z4EA 2C1CA 1XJOA 2B3UA 2G3TA 5I0CA 5HVFA 2C6PA 4MY3A 3BI1A 1Y7EA 1IY7A 2HB6A 2J8MA 3B2YA 3NE8A 4KOXA 5EBVA 5A27A 3QB8A 4UEFA 2WPWA 2OH1A 1YK3A 1QMUA 2ZW5A 4MI4A 4UF4A 2GREA 1JQGA 1V0CA 1Y9WA 4AXVA 1BO4A 4MRIA 1P4NA 4P4JA 1QSTA 2JDDA 2XEJA 3IGRA 4BINA 3DSBA 4NEXA 4ZY2A 1YW6A 3BLNA 3D3SA 4O23A 4MHYA 4MCQA 1S3ZA 1KUXA 3B3VA 2AFSA 4H6UA 4MFLA 1S7LA 1S7KA 3KKWA 4GM5A 1Y9KA 2ZEDA 2V8VA 1M1DA 1DTDA 3VH9A 4B11A 2CF4A 4ORFA 4H89A 2FIWA 2JEVA 2Q4ZA 5AG6A 1ZO0A 3KL9A 4K30A 5DWMA 3WT4A 4ZGYB 2ZELA 5J8FA 5JGFA 5BWAB 4LQGA 4NSQA 3LMSA 5HVHA 5JH9A 3TC8A 3OWCA 1AYEA 1YSJA 3GY9A 3CDXA 3GUXA 4U5YA 4II9A 3T90A 4ZYQA 2KCWA 2CTBA 2JBJA 4OIWA 2P6EA 2OOTA 4ZI6A 4MFJA 4X3RA 5CBMA 3BHXA 2I00A 3KGQA 3NH4A 4UIAA 1TKHA 4C7HA 2EVNA 3B3WA 3BI0A 3K9UA 4QB9A 2C6GA 2O28A 4FUUA 2ZOFA 3D66A 5G1ZA 4JXRA 1YQEA 4HNYB 1MK4A 3DR8A 1WWZA 5J8CA 1YVOA 1LFWA 4E8OA 2QJ8A 3TT2A 1VHOA 4JD6A 2B4DA 2PJ2A 2BOAA 3JRUA 3EC4A 4UCPA 5AGEA 3IFEA 3FH4A 2Q7SA 3JVNA 1FT7A 3WC5A 1Q2CA 4PV6A 3LWUA 1LANA 2BO9A 3NH5A 4M6HA 4MHZA 4TWEA 4NGSA 1YR0A 2CXAA 2K5TA 2EUIA 4L89A 3R9EA 5GCNA 3ISZA 3R95A 4CGNA 1MJAA 2VI7A 4KOYA 3NFZA 2B3VA 4JYWA 4OKOA 4YU9A 3R9FA 1ARLA 3TOAA 3TTHA 2QVPA 4JXQA 4R3LA 1LAMA 2DXQA 3QNVA 1N71A 5F46A 1IOFA 2PRQA 4P4FA 3S9NA 2ZENA 1Y0YA 2DPTA 1XBUA 1YLEA 4U9ZA 3DDDA 4BD9A 2IQ6A 2R8VA 3NA6A 4E2AA 1ON0A 1M4GA 3T9YA 1YVKA 4R6TA 3TOBA 2BSWA 1BPMA 1PU9A 4A95A 3H8FA 4BMHA 2Z3OA 3E0KA 1OBRA 4JWPA 1KWMA 1S7NA 4KLWA 2XEIA 4P4EA 3DNSA 2PJBA 4KOSA 2FIAA 2B4DB 1HDUA 1NSLA 4UCNA 4Y49B 3FB3A 4MY0A 2JEWA 4KUAA 3FBUA 2VZYA 4CAFA 1CM0A 1QSMA 2XEGA 4KOVA 1QQ9A 5IX3A 4PPZA 2Q7BA 4B12A 2V77A 3EY5A 5D29A 2YNCA 5E96A 1LAPA 2PJ9A 3IWWA 2Z3MA 3KR4A 2B5GB 2VL1A 1XMTA
chains in the Genus database with same CATH topology
2Z3KA 2CY2A 4EVYA 4J3GA 4KVME 2PDOA 5C82A 3RYOA 4YRHA 3IWEA 2ZW6A 1YGHA 2DPSA 4L8AA 3S6FA 4Y49C 1B87A 4PK3A 2VBQA 3IWGA 2Z3PA 1UFHA 3MGDA 3QAHA 1IB1E 3D2MA 4AVAA 1MJ9A 2G0BA 4AVBA 2YNEA 3CXSA 1B6BA 1YX0A 4UCMA 2ATRA 4LX9A 4UWJA 2FCKA 2FL4A 5IB0A 2OZUA 4X5KA 1OZPA 5AG7A 2Z0ZA 2B58A 3JTKA 1XE4A 4KZTA 2J8NA 2OZHA 4C2YA 2QMLA 4LUAA 1RO5A 3CXPA 2R98A 5F49A 2Z3LA 3F8KA 3WR7A 5F48A 4MFKA 2J8RA 4R87A 4XPDB 3FIXA 4CAWA 2RC4A 3LD2A 3CXQA 3PGPA 3VWEA 5H84A 3D8PA 2YNDA 4KUBA 1XEBA 2IL4A 4IF5A 5HH1A 1KUVA 2FXFA 3H5ZA 2AJ6A 1WK4A 1L0CA 5KTDA 5FVJA 1GHEA 2CNTA 2JLMA 3F0AA 4C2XA 3NE7A 2WSAA 4E0AA 4FD7A 1NE9A 5ISVA 4CGOA 4KS9A 4MHDA 1M44A 5AG5A 2FSRA 2BL1A 1Y7RA 2A4NA 4NXYA 2Q4YA 3GKRA 4MFZA 2FE7A 4FD5A 2PC1A 1U6MA 1Z4RA 3BJ7A 4ONUA 3H4QA 2QIRA 2P6GA 1KUYA 4B5PA 4KSAA 2GANA 4A33A 3FNCA 1IYKA 1YREA 4Q38A 5AG4A 4RS2A 1SQHA 2OB0A 4F0XA 2WPXA 4F0YA 1M4DA 2Q0YA 3P2HA 3I3GA 4C7IA 2Z3NA 4GS4A 1R57A 1S5KA 2P0WA 3SHPA 1Z9UA 1I21A 2VEZA 4QBJA 4PK2A 5JPHA 3W6XA 2ZW4A 5DWNA 4YGOA 2PQ8A 2QECA 2CNMA 4JJXA 1IYLA 4CS0B 4MFQA 3R9GA 3SXNA 2R7HA 4QUSA 4B13A 4I49A 1S60A 3C26A 5KTAA 4B14A 3EFAA 4XNHC 5KTCA 1CJWA 1Q2DA 4FD6A 2WUUA 3UY5A 2GIVA 2D4PA 1NMTA 2B4BA 2H5MA 3TO7A 4KOTA 2NMTA 3FXTA 4UFWA 3I9SA 4KLVA 4OAEA 3S6KA 4KSFA 4YFJA 4KOUA 2GE3A 1M4IA 4AG7A 3A9LA 3ZZIA 1QSRA 4UFXA 4R57A 4A32A 2VQYA 4OLLA 4C2ZA 2Y0MA 4UFVA 3S6GA 2Q4VA 2BEIA 4UBRA 4M85A 2FS5A 2ZPAA 1Q2YA 2PR8A 1IIDA 1I1DA 4AB7A 4F6AA 5F47A 1TIQA 2P6FA 5H86A 4DNCA 1IICA 2PR1A 1S7FA 2ARHA 3P2FA 4B5PB 2FT0A 4R3KA 3TCVA 3G8WA 2VZZA 2BUEA 1BOBA 4QC6A 2Z10A 2Z11A 3TO9A 3TFYA 4NF1A 1XIXA 3F5BA 2C27A 1K4JA 1LRZA 2OU2A 2YGWA 4MFPA 2R1IA 1P0HA 4AVCA 2PSWA 3IU2A 1KZFA 1MJBA 4C68A 2Q04A 2G3AA 4M3SA 1RXTA 3FYNA 5IV0A 5G22A 3LODA 5JQ4A 1QSOA 1I12A 2PRBA 2JDCA 4OADA 3TO6A 2HUZA 2HV2A 3ZJ0A 3TE4A 3B8GA 2B5GA 4IUSA 2VXKA 4R9MA 5HMNA 1VKCA 4U9YA 3PP9A 5G20A 3D2PA 2ZXVA 4XPDC 3V8IA 4CRYB 4BBHA 4CRZB 4RI1A 4ZBGA 4KORA 4AG9A 4MJ8A 4HNXB 3G3SA 4CAXA 5EC4A 3GYAA 3W6SA 2D4OA 3DR6A 4CYNA 3BJ8A 3S6HA 4PSWA 5C88A 4XPLA 2X7BA 1QSNA 3R96A 4KOWA 4MBUA 1J4JA 4FD4A 4XNHB 4B5OA 4A30A 5A28A 2ZW7A 1XF8A 3VWDA 4QVTA 3SXOA 4UWIA 3R1KA 4CYQA 4JLYA 3EO4A 4CGLA 4HKFA 4UA3A 4CAEA 4H6ZA 4B10A 2CNSA 2YNCC 4CGMA 4HNWB 4Q36A 4PSXA 5G21A 3IU1A 2F5IA 4CAVA 1FY7A 3FRMA 2REFA 2REEA 3EXNA 1PUAA 4CYOA 4KVXA 5CNPA 3N7ZA 3W91A 4A2ZA 2Q44A 3JUWA 2I79A 4A31A 4XPKA 1VHSA 3PZJA 4NCZA 2AE6A 2HQYA 4CYPA 4KVOE 2OZGA 4CGPA 1Z4EA 2G3TA 2B3UA 5I0CA 4MY3A 4KOXA 2J8MA 5EBVA 5A27A 3QB8A 2WPWA 2OH1A 1YK3A 2ZW5A 4MI4A 1V0CA 1Y9WA 1BO4A 1P4NA 1QSTA 2JDDA 3IGRA 3DSBA 4NEXA 3BLNA 3D3SA 1S3ZA 1KUXA 4H6UA 4MFLA 1S7LA 1S7KA 3KKWA 1Y9KA 1M1DA 4B11A 4ORFA 4H89A 2FIWA 2JEVA 5AG6A 5DWMA 1ZO0A 4ZGYB 4K30A 5J8FA 5BWAB 4NSQA 3OWCA 3GY9A 4U5YA 4II9A 3T90A 2KCWA 2P6EA 4MFJA 2I00A 4C7HA 2EVNA 3K9UA 4QB9A 2O28A 5G1ZA 4JXRA 4HNYB 1MK4A 3DR8A 1WWZA 5J8CA 1YVOA 4E8OA 3TT2A 4JD6A 2B4DA 4UCPA 5AGEA 3EC4A 3JVNA 1Q2CA 4PV6A 1YR0A 2CXAA 2K5TA 2EUIA 4L89A 3R9EA 5GCNA 3R95A 4CGNA 1MJAA 2VI7A 4KOYA 2B3VA 3R9FA 3TOAA 3TTHA 4JXQA 4R3LA 2DXQA 1N71A 5F46A 2DPTA 1YLEA 4U9ZA 3DDDA 2R8VA 4E2AA 1ON0A 1M4GA 3T9YA 1YVKA 3TOBA 2BSWA 4A95A 1PU9A 4BMHA 2Z3OA 4KLWA 3E0KA 4JWPA 1S7NA 3DNSA 4KOSA 2FIAA 2B4DB 1NSLA 4UCNA 4Y49B 3FB3A 4MY0A 4KUAA 3FBUA 2VZYA 4CAFA 1CM0A 1QSMA 4KOVA 5IX3A 2Q7BA 4B12A 3EY5A 2YNCA 5E96A 2Z3MA 2B5GB 1XMTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CY2 A;  4EVY A;  4J3G A;  4KVM E;  2PDO A;  5C82 A;  3RYO A;  4YRH A;  2ZW6 A;  1YGH A;  4L8A A;  3S6F A;  4Y49 C;  1B87 A;  4PK3 A;  2VBQ A;  3IWG A;  1UFH A;  3MGD A;  3QAH A;  1IB1 E;  3D2M A;  4AVA A;  1MJ9 A;  2G0B A;  4AVB A;  3CXS A;  1B6B A;  1YX0 A;  2ATR A;  4LX9 A;  4UWJ A;  2FCK A;  2FL4 A;  5IB0 A;  2OZU A;  4X5K A;  1OZP A;  2Z0Z A;  2B58 A;  1XE4 A;  4KZT A;  2J8N A;  2OZH A;  2QML A;  4LUA A;  1RO5 A;  3CXP A;  2R98 A;  5F49 A;  3F8K A;  3WR7 A;  5F48 A;  2J8R A;  4R87 A;  4XPD B;  3FIX A;  4CAW A;  2RC4 A;  3LD2 A;  3CXQ A;  3PGP A;  3VWE A;  5H84 A;  3D8P A;  4KUB A;  1XEB A;  2IL4 A;  4IF5 A;  5HH1 A;  1KUV A;  2FXF A;  2AJ6 A;  1WK4 A;  1L0C A;  5KTD A;  5FVJ A;  1GHE A;  2CNT A;  2JLM A;  3F0A A;  3NE7 A;  4E0A A;  4FD7 A;  1NE9 A;  5ISV A;  4MHD A;  1M44 A;  2FSR A;  2BL1 A;  1Y7R A;  2A4N A;  4NXY A;  2Q4Y A;  3GKR A;  2FE7 A;  4FD5 A;  2PC1 A;  1U6M A;  1Z4R A;  3BJ7 A;  4ONU A;  3H4Q A;  2QIR A;  2P6G A;  1KUY A;  4B5P A;  2GAN A;  3FNC A;  1IYK A;  1YRE A;  4RS2 A;  1SQH A;  2OB0 A;  2WPX A;  4F0Y A;  1M4D A;  2Q0Y A;  3P2H A;  3I3G A;  4GS4 A;  1R57 A;  1S5K A;  2P0W A;  3SHP A;  1Z9U A;  1I21 A;  2VEZ A;  4QBJ A;  4PK2 A;  5JPH A;  3W6X A;  2ZW4 A;  5DWN A;  4YGO A;  2PQ8 A;  2QEC A;  2CNM A;  4JJX A;  1IYL A;  4CS0 B;  3R9G A;  3SXN A;  2R7H A;  4QUS A;  4I49 A;  1S60 A;  3C26 A;  5KTA A;  3EFA A;  4XNH C;  5KTC A;  1CJW A;  1Q2D A;  4FD6 A;  3UY5 A;  2GIV A;  2D4P A;  1NMT A;  2B4B A;  2H5M A;  3TO7 A;  4KOT A;  2NMT A;  3FXT A;  3I9S A;  4KLV A;  4OAE A;  3S6K A;  4YFJ A;  4KOU A;  2GE3 A;  1M4I A;  4AG7 A;  3ZZI A;  1QSR A;  4R57 A;  2VQY A;  4OLL A;  2Y0M A;  3S6G A;  2Q4V A;  2BEI A;  4UBR A;  4M85 A;  2FS5 A;  2ZPA A;  1Q2Y A;  2PR8 A;  1IID A;  1I1D A;  4AB7 A;  4F6A A;  5F47 A;  1TIQ A;  2P6F A;  5H86 A;  4DNC A;  1IIC A;  2PR1 A;  1S7F A;  2ARH A;  3P2F A;  4B5P B;  2FT0 A;  4R3K A;  3TCV A;  3G8W A;  2VZZ A;  2BUE A;  1BOB A;  4QC6 A;  2Z10 A;  2Z11 A;  3TO9 A;  3TFY A;  4NF1 A;  1XIX A;  3F5B A;  2C27 A;  1K4J A;  1LRZ A;  2OU2 A;  2R1I A;  1P0H A;  4AVC A;  2PSW A;  1KZF A;  1MJB A;  2Q04 A;  2G3A A;  4M3S A;  1RXT A;  3FYN A;  5IV0 A;  5JQ4 A;  3LOD A;  1QSO A;  1I12 A;  2PRB A;  2JDC A;  4OAD A;  3TO6 A;  2HUZ A;  2HV2 A;  3ZJ0 A;  3TE4 A;  3B8G A;  2B5G A;  4IUS A;  2VXK A;  4R9M A;  5HMN A;  1VKC A;  4U9Y A;  3PP9 A;  3D2P A;  2ZXV A;  4XPD C;  3V8I A;  4CRY B;  4CRZ B;  4RI1 A;  4ZBG A;  4KOR A;  4AG9 A;  4MJ8 A;  4HNX B;  3G3S A;  4CAX A;  5EC4 A;  3GYA A;  3W6S A;  2D4O A;  3DR6 A;  3BJ8 A;  3S6H A;  4PSW A;  5C88 A;  4XPL A;  2X7B A;  1QSN A;  3R96 A;  4KOW A;  4MBU A;  1J4J A;  4FD4 A;  4XNH B;  4B5O A;  2ZW7 A;  1XF8 A;  3VWD A;  4QVT A;  3SXO A;  4UWI A;  3R1K A;  4JLY A;  3EO4 A;  4HKF A;  4UA3 A;  4H6Z A;  2CNS A;  4HNW B;  4PSX A;  2F5I A;  4CAV A;  1FY7 A;  3FRM A;  2REF A;  2REE A;  3EXN A;  1PUA A;  4KVX A;  5CNP A;  3N7Z A;  3W91 A;  2Q44 A;  3JUW A;  2I79 A;  4XPK A;  1VHS A;  3PZJ A;  4NCZ A;  2AE6 A;  2HQY A;  4KVO E;  2OZG A;  1Z4E A;  2G3T A;  2B3U A;  5I0C A;  4MY3 A;  4KOX A;  2J8M A;  5EBV A;  3QB8 A;  2WPW A;  2OH1 A;  1YK3 A;  2ZW5 A;  4MI4 A;  1V0C A;  1Y9W A;  1BO4 A;  1P4N A;  1QST A;  2JDD A;  3IGR A;  3DSB A;  4NEX A;  3BLN A;  3D3S A;  1S3Z A;  1KUX A;  4H6U A;  1S7L A;  1S7K A;  3KKW A;  1Y9K A;  1M1D A;  4ORF A;  4H89 A;  2FIW A;  2JEV A;  5DWM A;  4K30 A;  5J8F A;  4NSQ A;  3OWC A;  3GY9 A;  4U5Y A;  4II9 A;  3T90 A;  2KCW A;  2P6E A;  2I00 A;  2EVN A;  3K9U A;  4QB9 A;  2O28 A;  4JXR A;  4HNY B;  1MK4 A;  3DR8 A;  1WWZ A;  5J8C A;  1YVO A;  4E8O A;  3TT2 A;  4JD6 A;  2B4D A;  3EC4 A;  3JVN A;  1Q2C A;  4PV6 A;  1YR0 A;  2K5T A;  2EUI A;  4L89 A;  3R9E A;  5GCN A;  3R95 A;  1MJA A;  2VI7 A;  4KOY A;  2B3V A;  3R9F A;  3TOA A;  3TTH A;  4JXQ A;  4R3L A;  2DXQ A;  1N71 A;  5F46 A;  1YLE A;  4U9Z A;  3DDD A;  2R8V A;  4E2A A;  1ON0 A;  1M4G A;  3T9Y A;  1YVK A;  3TOB A;  2BSW A;  1PU9 A;  4BMH A;  3E0K A;  4JWP A;  4KLW A;  1S7N A;  3DNS A;  4KOS A;  2FIA A;  2B4D B;  1NSL A;  4Y49 B;  3FB3 A;  4MY0 A;  4KUA A;  3FBU A;  2VZY A;  1CM0 A;  1QSM A;  4KOV A;  5IX3 A;  2Q7B A;  3EY5 A;  5E96 A;  2B5G B;  1XMT A; 
#chains in the Genus database with same CATH topology
 2Z3K A;  5K8N A;  2CY2 A;  4EVY A;  4J3G A;  4KVM E;  4OC0 A;  2PDO A;  4EWT A;  3PB9 X;  4Z65 A;  1ELM P;  3RYO A;  2C6C A;  3IWE A;  4YRH A;  5C82 A;  2ZW6 A;  3DLJ A;  1YGH A;  4NJQ A;  4EFD A;  2DPS A;  4L8A A;  1ZLH A;  3S6F A;  4FAI A;  3WC6 A;  4K3N A;  4Y49 C;  1B87 A;  1LCP A;  4PK3 A;  2GLJ A;  2VBQ A;  4A38 A;  8CPA A;  3IWG A;  2Z3P A;  1UFH A;  4MHN A;  3MGD A;  3QAH A;  5LYI A;  1IB1 E;  3T8W A;  3VAR A;  2PCU A;  2PJ4 A;  3D7H A;  3PB8 X;  1VIX A;  3D2M A;  3D7F A;  1CP7 A;  4AVA A;  1MJ9 A;  2G0B A;  4NGQ A;  4P45 A;  2YNE A;  3V7Z A;  4AVB A;  3CXS A;  1B6B A;  3PB6 X;  1F2O A;  4OC2 A;  1XMB A;  1YX0 A;  5THW A;  4IAV A;  4M6G A;  2EWB A;  3RAM A;  4UCM A;  2ATR A;  4RUH A;  2FVG A;  4LX9 A;  4UWJ A;  2FCK A;  2FL4 A;  3B3T A;  2PJ7 A;  5IB0 A;  2OZU A;  3PRT A;  2RB7 A;  1ELL P;  5HXD A;  4X5K A;  3HLP A;  1OZP A;  5AG7 A;  2Z0Z A;  3PFO A;  4RN7 A;  4B6Z A;  2B58 A;  2PJC A;  3JTK A;  1CPX A;  5LRJ A;  4OC1 A;  1XE4 A;  2I3C A;  4WJB A;  4KZT A;  2J8N A;  3SJG A;  2OZH A;  4C2Y A;  2QML A;  1Z8X A;  4LUA A;  1RO5 A;  3CXP A;  2R98 A;  3FED A;  5F49 A;  2Z3L A;  1XFO A;  3F8K A;  3SI2 A;  3WR7 A;  3FEE A;  2PVV A;  5F48 A;  4MFK A;  2J8R A;  4R87 A;  4XPD B;  4ZY1 A;  3SJE A;  2ZEO A;  3FIX A;  2PJ3 A;  4CAW A;  3MN8 A;  2ZEE A;  2RC4 A;  3LD2 A;  5DS0 A;  3CXQ A;  4Q7A A;  2PJ6 A;  3PGP A;  3VWE A;  5CPA A;  5H84 A;  3D8P A;  2YND A;  4KUB A;  1XEB A;  2IL4 A;  4IF5 A;  5HH1 A;  3I1U A;  1ARM A;  1KUV A;  2FXF A;  3H5Z A;  4M6I A;  4P4B A;  2AJ6 A;  1WK4 A;  1ZG7 A;  1L0C A;  2JBK A;  5KTD A;  5FVJ A;  2POK A;  1GHE A;  4NGR A;  2CNT A;  2JLM A;  3IIB A;  4A37 A;  3F0A A;  4C2X A;  3KR5 A;  2WSA A;  3NE7 A;  1BPN A;  5LRK A;  4E0A A;  4FD7 A;  1NE9 A;  5ISV A;  4CGO A;  1PYT B;  4KS9 A;  4MHD A;  1M44 A;  5AG5 A;  2FSR A;  2BL1 A;  2GLF A;  2PVW A;  3D4U A;  1TF8 A;  1Y7R A;  2WYR A;  2A4N A;  4NXY A;  3ISX A;  2Q4Y A;  3GKR A;  1AMP A;  4MFZ A;  2FE7 A;  3PBE A;  4FD5 A;  2PC1 A;  1U6M A;  1Z4R A;  2IJZ A;  3BJ7 A;  3D68 A;  4ONU A;  3H4Q A;  4WWV A;  2EK9 A;  2QIR A;  4DYO A;  2P6G A;  1KUY A;  2AFZ A;  5J1Q A;  1UWY A;  4B5P A;  3KZW A;  4KSA A;  3SI0 A;  2GAN A;  2V8H A;  4A33 A;  3FNC A;  2XEF A;  1IYK A;  1YRE A;  4PQA A;  4Q38 A;  4PXE A;  5AG4 A;  4RS2 A;  1SQH A;  4X8I A;  2OB0 A;  2G9D A;  4F0X A;  2WPX A;  4F0Y A;  4R7M A;  2DF5 A;  1M4D A;  2PJA A;  2Q0Y A;  5IB9 A;  2BCO A;  1RTQ A;  3P2H A;  4P4I A;  3I3G A;  2F8H A;  3WAB A;  4C7I A;  1YME A;  2Z3N A;  5LYL A;  4IHM A;  4W9Y A;  4GS4 A;  1R57 A;  3S9M A;  1S5K A;  4LQ6 A;  2P0W A;  4NGM A;  3GIU A;  3SHP A;  1Z9U A;  3KHZ A;  2AFO A;  4OC3 A;  1I21 A;  2VEZ A;  1EE3 P;  4QBJ A;  2V8D A;  4PK2 A;  5JPH A;  1PCA A;  3HUV A;  1YW4 A;  3W6X A;  4UIB A;  1GYT A;  4GXH A;  3KQX A;  2ZW4 A;  5HVG A;  3FMC A;  2Q43 A;  3B3C A;  5LYF A;  5DWN A;  6CPA A;  4YGO A;  2PJ1 A;  4DJL A;  2PQ8 A;  2QEC A;  3PBB A;  4OID A;  2CNM A;  4JJX A;  1IYL A;  3NH8 A;  1IOI A;  4CS0 B;  4MFQ A;  1A2Z A;  2V8G A;  3R9G A;  1F2P A;  1Z8W A;  3SJF A;  3SXN A;  2R7H A;  1AUG A;  4QUS A;  4B13 A;  4I49 A;  1S60 A;  3C26 A;  5KTA A;  5K8P A;  3PEI A;  4B14 A;  1FNO A;  3EFA A;  4XNH C;  2O53 A;  5KTC A;  3D67 A;  4PXB A;  1CJW A;  1Q2D A;  1Z2L A;  4FD6 A;  1IGB A;  4FBE A;  2NYQ A;  2WUU A;  3UY5 A;  1DE4 C;  2GIV A;  2D4P A;  1NMT A;  2ZOG A;  2B4B A;  2H5M A;  5LYD A;  4KOT A;  2AFM A;  3TO7 A;  2NMT A;  3FXT A;  4F8Z A;  4UFW A;  3KQZ A;  5LRG A;  3I9S A;  3MRU A;  4KLV A;  4OAE A;  3S6K A;  4KSF A;  4YFJ A;  4KOU A;  2AFW A;  4OC4 A;  5I4M A;  2GE3 A;  1M4I A;  2O4H A;  4HPS A;  4AG7 A;  2PJ8 A;  3A9L A;  3ZZI A;  1QSR A;  2ZEG A;  2ABZ A;  3H8G A;  4R57 A;  4UFX A;  4NFR A;  4A32 A;  2VQY A;  4OLL A;  4C2Z A;  2EO8 A;  3SJX A;  2Y0M A;  2ZEF A;  4UFV A;  3S6G A;  3B7I A;  3DGV A;  2Q4V A;  3D7G A;  4R8F A;  2BEI A;  4UBR A;  1CBX A;  2PE3 A;  4MCP A;  4M85 A;  2FS5 A;  3LAC A;  2ZPA A;  4UEE A;  1Q2Y A;  2PR8 A;  1IID A;  1I1D A;  2GU2 A;  4AB7 A;  4OC5 A;  4F6A A;  2Q51 A;  3QAY A;  1TIQ A;  5F47 A;  3IO1 A;  1R43 A;  2P6F A;  4KSI A;  5H86 A;  4A39 A;  3B3S A;  4DNC A;  1IIC A;  1X12 A;  1Z8L A;  2ODF A;  2PR1 A;  1IU8 A;  1S7F A;  2ARH A;  2F7V A;  3P2F A;  4B5P B;  2FT0 A;  4H2K A;  4F9U A;  4X2T A;  1CX8 A;  4R3K A;  4MCR A;  4NGN A;  3TCV A;  2EK8 A;  3G8W A;  4MCS A;  4ONW A;  4G1P A;  2VZZ A;  1CPS A;  1BOB A;  1LOK A;  2BUE A;  4QC6 A;  4A94 A;  5JM6 A;  2AFU A;  2Z10 A;  2Z11 A;  3TO9 A;  3VAT A;  3TFY A;  3RZA A;  4NF1 A;  4ZX9 A;  2CTC A;  4JZ0 A;  3FX6 A;  4P4D A;  3BXM A;  1XIX A;  3PFE A;  3RNZ A;  3F5B A;  2C27 A;  1K4J A;  1LRZ A;  2AFX A;  2IMO A;  2OU2 A;  2YGW A;  3K9T A;  4MFP A;  1Q7L A;  1P0H A;  2R1I A;  2PSW A;  1KZF A;  3IU2 A;  3SI1 A;  1MJB A;  3WC7 A;  4AVC A;  4C68 A;  4FWU A;  3RBU A;  2Q04 A;  3FJU A;  3PB7 X;  2GFQ A;  2G3A A;  4M3S A;  4P10 A;  1RXT A;  3FYN A;  5IV0 A;  5G22 A;  3LOD A;  5JQ4 A;  1QSO A;  4ZY0 A;  1I12 A;  2PRB A;  5K8O A;  2JDC A;  4OAD A;  3TO6 A;  1XOV A;  2OR4 A;  2HUZ A;  2HV2 A;  5D8N A;  3H8E A;  3ZJ0 A;  3B35 A;  4PXC A;  3TE4 A;  3D7D A;  3B8G A;  2B5G A;  3PB4 X;  4IUS A;  2VXK A;  4R9M A;  2PIY A;  2DEA A;  2RFH A;  5HMN A;  1VKC A;  2ZEH A;  4DUK A;  3KAS A;  3IC1 A;  4U9Y A;  3PP9 A;  5G20 A;  1CP6 A;  1BAV A;  2ZXV A;  3D2P A;  4MXU A;  4XPD C;  3V8I A;  1HEE A;  7CPA A;  2PJ5 A;  4CRY B;  4TNU A;  4OP4 A;  3CPA A;  4BBH A;  4CRZ B;  4RI1 A;  4NGP A;  4CPA A;  2EBJ A;  4ZBG A;  3CT9 A;  4KOR A;  4AG9 A;  2ZEM A;  4MJ8 A;  4HNX B;  3G3S A;  4CAX A;  5EC4 A;  3GYA A;  3W6S A;  2D4O A;  4IK2 A;  3DR6 A;  5K8M A;  4CYN A;  1TKF A;  1ZG8 A;  3K2K A;  3BJ8 A;  3IEH A;  4PXD A;  3S6H A;  3FVL A;  1CG2 A;  4PSW A;  5C88 A;  1BLL E;  4XPL A;  1ZLI A;  2X7B A;  2ZEP A;  1QSN A;  3R96 A;  4KOW A;  4MBU A;  1J4J A;  4FD4 A;  4F9V A;  1JWQ A;  3N5F A;  4XNH B;  4B5O A;  4A30 A;  4P6Y A;  5ELY A;  5A28 A;  2ZW7 A;  1H8L A;  1XF8 A;  1Y0R A;  1HDQ A;  2PIZ A;  4QVT A;  3VWD A;  3SXO A;  4UWI A;  1TKJ A;  3R1K A;  3V38 A;  4CYQ A;  4JLY A;  3EO4 A;  3KHX A;  4CGL A;  4R76 A;  4HKF A;  4UA3 A;  4CAE A;  4EME A;  4H6Z A;  2QYV A;  4UEZ A;  4B10 A;  3FEC A;  2CNS A;  3GB0 A;  1NSA A;  1VGY A;  3KI9 A;  2YNC C;  4NGT A;  4CGM A;  3TX8 A;  4HNW B;  4Q36 A;  4PSX A;  5G21 A;  1VHE A;  3IU1 A;  3L2N A;  2F5I A;  1XRY A;  2WZN A;  3IJ3 A;  1M4L A;  2PJ0 A;  4CAV A;  3RO0 A;  1FY7 A;  3FRM A;  5EMI A;  1F57 A;  3S9L A;  2REF A;  2REE A;  3EXN A;  4MMO A;  4YWY A;  1PUA A;  4MHP A;  4CYO A;  1YLO A;  1TF9 A;  3GLJ A;  4KVX A;  4ZX8 A;  5CNP A;  3N7Z A;  1Z5R A;  1TXR A;  3W91 A;  4OME A;  2HC9 A;  4A2Z A;  2Q44 A;  1X10 A;  3JUW A;  4NJR A;  4P44 A;  1R3N A;  2I79 A;  4A31 A;  3CZX A;  1Z8T A;  3FF3 A;  4XPK A;  1VHS A;  3PZJ A;  4NCZ A;  2AE6 A;  2NSM A;  3CPX A;  2HQY A;  4CYP A;  4KVO E;  2OZG A;  1ZG9 A;  2ANP A;  2J9A A;  4CGP A;  5F09 A;  2CIJ A;  1Z4E A;  2C1C A;  1XJO A;  2B3U A;  2G3T A;  5I0C A;  5HVF A;  2C6P A;  4MY3 A;  3BI1 A;  1Y7E A;  1IY7 A;  2HB6 A;  2J8M A;  3B2Y A;  3NE8 A;  4KOX A;  5EBV A;  5A27 A;  3QB8 A;  4UEF A;  2WPW A;  2OH1 A;  1YK3 A;  1QMU A;  2ZW5 A;  4MI4 A;  4UF4 A;  2GRE A;  1JQG A;  1V0C A;  1Y9W A;  4AXV A;  1BO4 A;  4MRI A;  1P4N A;  4P4J A;  1QST A;  2JDD A;  2XEJ A;  3IGR A;  4BIN A;  3DSB A;  4NEX A;  4ZY2 A;  1YW6 A;  3BLN A;  3D3S A;  4O23 A;  4MHY A;  4MCQ A;  1S3Z A;  1KUX A;  3B3V A;  2AFS A;  4H6U A;  4MFL A;  1S7L A;  1S7K A;  3KKW A;  4GM5 A;  1Y9K A;  2ZED A;  2V8V A;  1M1D A;  1DTD A;  3VH9 A;  4B11 A;  2CF4 A;  4ORF A;  4H89 A;  2FIW A;  2JEV A;  2Q4Z A;  5AG6 A;  1ZO0 A;  3KL9 A;  4K30 A;  5DWM A;  3WT4 A;  4ZGY B;  2ZEL A;  5J8F A;  5JGF A;  5BWA B;  4LQG A;  4NSQ A;  3LMS A;  5HVH A;  5JH9 A;  3TC8 A;  3OWC A;  1AYE A;  1YSJ A;  3GY9 A;  3CDX A;  3GUX A;  4U5Y A;  4II9 A;  3T90 A;  4ZYQ A;  2KCW A;  2CTB A;  2JBJ A;  4OIW A;  2P6E A;  2OOT A;  4ZI6 A;  4MFJ A;  4X3R A;  5CBM A;  3BHX A;  2I00 A;  3KGQ A;  3NH4 A;  4UIA A;  1TKH A;  4C7H A;  2EVN A;  3B3W A;  3BI0 A;  3K9U A;  4QB9 A;  2C6G A;  2O28 A;  4FUU A;  2ZOF A;  3D66 A;  5G1Z A;  4JXR A;  1YQE A;  4HNY B;  1MK4 A;  3DR8 A;  1WWZ A;  5J8C A;  1YVO A;  1LFW A;  4E8O A;  2QJ8 A;  3TT2 A;  1VHO A;  4JD6 A;  2B4D A;  2PJ2 A;  2BOA A;  3JRU A;  3EC4 A;  4UCP A;  5AGE A;  3IFE A;  3FH4 A;  2Q7S A;  3JVN A;  1FT7 A;  3WC5 A;  1Q2C A;  4PV6 A;  3LWU A;  1LAN A;  2BO9 A;  3NH5 A;  4M6H A;  4MHZ A;  4TWE A;  4NGS A;  1YR0 A;  2CXA A;  2K5T A;  2EUI A;  4L89 A;  3R9E A;  5GCN A;  3ISZ A;  3R95 A;  4CGN A;  1MJA A;  2VI7 A;  4KOY A;  3NFZ A;  2B3V A;  4JYW A;  4OKO A;  4YU9 A;  3R9F A;  1ARL A;  3TOA A;  3TTH A;  2QVP A;  4JXQ A;  4R3L A;  1LAM A;  2DXQ A;  3QNV A;  1N71 A;  5F46 A;  1IOF A;  2PRQ A;  4P4F A;  3S9N A;  2ZEN A;  1Y0Y A;  2DPT A;  1XBU A;  1YLE A;  4U9Z A;  3DDD A;  4BD9 A;  2IQ6 A;  2R8V A;  3NA6 A;  4E2A A;  1ON0 A;  1M4G A;  3T9Y A;  1YVK A;  4R6T A;  3TOB A;  2BSW A;  1BPM A;  1PU9 A;  4A95 A;  3H8F A;  4BMH A;  2Z3O A;  3E0K A;  1OBR A;  4JWP A;  1KWM A;  1S7N A;  4KLW A;  2XEI A;  4P4E A;  3DNS A;  2PJB A;  4KOS A;  2FIA A;  2B4D B;  1HDU A;  1NSL A;  4UCN A;  4Y49 B;  3FB3 A;  4MY0 A;  2JEW A;  4KUA A;  3FBU A;  2VZY A;  4CAF A;  1CM0 A;  1QSM A;  2XEG A;  4KOV A;  1QQ9 A;  5IX3 A;  4PPZ A;  2Q7B A;  4B12 A;  2V77 A;  3EY5 A;  5D29 A;  2YNC A;  5E96 A;  1LAP A;  2PJ9 A;  3IWW A;  2Z3M A;  3KR4 A;  2B5G B;  2VL1 A;  1XMT A; 
#chains in the Genus database with same CATH homology
 2Z3K A;  2CY2 A;  4EVY A;  4J3G A;  4KVM E;  2PDO A;  5C82 A;  3RYO A;  4YRH A;  3IWE A;  2ZW6 A;  1YGH A;  2DPS A;  4L8A A;  3S6F A;  4Y49 C;  1B87 A;  4PK3 A;  2VBQ A;  3IWG A;  2Z3P A;  1UFH A;  3MGD A;  3QAH A;  1IB1 E;  3D2M A;  4AVA A;  1MJ9 A;  2G0B A;  4AVB A;  2YNE A;  3CXS A;  1B6B A;  1YX0 A;  4UCM A;  2ATR A;  4LX9 A;  4UWJ A;  2FCK A;  2FL4 A;  5IB0 A;  2OZU A;  4X5K A;  1OZP A;  5AG7 A;  2Z0Z A;  2B58 A;  3JTK A;  1XE4 A;  4KZT A;  2J8N A;  2OZH A;  4C2Y A;  2QML A;  4LUA A;  1RO5 A;  3CXP A;  2R98 A;  5F49 A;  2Z3L A;  3F8K A;  3WR7 A;  5F48 A;  4MFK A;  2J8R A;  4R87 A;  4XPD B;  3FIX A;  4CAW A;  2RC4 A;  3LD2 A;  3CXQ A;  3PGP A;  3VWE A;  5H84 A;  3D8P A;  2YND A;  4KUB A;  1XEB A;  2IL4 A;  4IF5 A;  5HH1 A;  1KUV A;  2FXF A;  3H5Z A;  2AJ6 A;  1WK4 A;  1L0C A;  5KTD A;  5FVJ A;  1GHE A;  2CNT A;  2JLM A;  3F0A A;  4C2X A;  3NE7 A;  2WSA A;  4E0A A;  4FD7 A;  1NE9 A;  5ISV A;  4CGO A;  4KS9 A;  4MHD A;  1M44 A;  5AG5 A;  2FSR A;  2BL1 A;  1Y7R A;  2A4N A;  4NXY A;  2Q4Y A;  3GKR A;  4MFZ A;  2FE7 A;  4FD5 A;  2PC1 A;  1U6M A;  1Z4R A;  3BJ7 A;  4ONU A;  3H4Q A;  2QIR A;  2P6G A;  1KUY A;  4B5P A;  4KSA A;  2GAN A;  4A33 A;  3FNC A;  1IYK A;  1YRE A;  4Q38 A;  5AG4 A;  4RS2 A;  1SQH A;  2OB0 A;  4F0X A;  2WPX A;  4F0Y A;  1M4D A;  2Q0Y A;  3P2H A;  3I3G A;  4C7I A;  2Z3N A;  4GS4 A;  1R57 A;  1S5K A;  2P0W A;  3SHP A;  1Z9U A;  1I21 A;  2VEZ A;  4QBJ A;  4PK2 A;  5JPH A;  3W6X A;  2ZW4 A;  5DWN A;  4YGO A;  2PQ8 A;  2QEC A;  2CNM A;  4JJX A;  1IYL A;  4CS0 B;  4MFQ A;  3R9G A;  3SXN A;  2R7H A;  4QUS A;  4B13 A;  4I49 A;  1S60 A;  3C26 A;  5KTA A;  4B14 A;  3EFA A;  4XNH C;  5KTC A;  1CJW A;  1Q2D A;  4FD6 A;  2WUU A;  3UY5 A;  2GIV A;  2D4P A;  1NMT A;  2B4B A;  2H5M A;  3TO7 A;  4KOT A;  2NMT A;  3FXT A;  4UFW A;  3I9S A;  4KLV A;  4OAE A;  3S6K A;  4KSF A;  4YFJ A;  4KOU A;  2GE3 A;  1M4I A;  4AG7 A;  3A9L A;  3ZZI A;  1QSR A;  4UFX A;  4R57 A;  4A32 A;  2VQY A;  4OLL A;  4C2Z A;  2Y0M A;  4UFV A;  3S6G A;  2Q4V A;  2BEI A;  4UBR A;  4M85 A;  2FS5 A;  2ZPA A;  1Q2Y A;  2PR8 A;  1IID A;  1I1D A;  4AB7 A;  4F6A A;  5F47 A;  1TIQ A;  2P6F A;  5H86 A;  4DNC A;  1IIC A;  2PR1 A;  1S7F A;  2ARH A;  3P2F A;  4B5P B;  2FT0 A;  4R3K A;  3TCV A;  3G8W A;  2VZZ A;  2BUE A;  1BOB A;  4QC6 A;  2Z10 A;  2Z11 A;  3TO9 A;  3TFY A;  4NF1 A;  1XIX A;  3F5B A;  2C27 A;  1K4J A;  1LRZ A;  2OU2 A;  2YGW A;  4MFP A;  2R1I A;  1P0H A;  4AVC A;  2PSW A;  3IU2 A;  1KZF A;  1MJB A;  4C68 A;  2Q04 A;  2G3A A;  4M3S A;  1RXT A;  3FYN A;  5IV0 A;  5G22 A;  3LOD A;  5JQ4 A;  1QSO A;  1I12 A;  2PRB A;  2JDC A;  4OAD A;  3TO6 A;  2HUZ A;  2HV2 A;  3ZJ0 A;  3TE4 A;  3B8G A;  2B5G A;  4IUS A;  2VXK A;  4R9M A;  5HMN A;  1VKC A;  4U9Y A;  3PP9 A;  5G20 A;  3D2P A;  2ZXV A;  4XPD C;  3V8I A;  4CRY B;  4BBH A;  4CRZ B;  4RI1 A;  4ZBG A;  4KOR A;  4AG9 A;  4MJ8 A;  4HNX B;  3G3S A;  4CAX A;  5EC4 A;  3GYA A;  3W6S A;  2D4O A;  3DR6 A;  4CYN A;  3BJ8 A;  3S6H A;  4PSW A;  5C88 A;  4XPL A;  2X7B A;  1QSN A;  3R96 A;  4KOW A;  4MBU A;  1J4J A;  4FD4 A;  4XNH B;  4B5O A;  4A30 A;  5A28 A;  2ZW7 A;  1XF8 A;  3VWD A;  4QVT A;  3SXO A;  4UWI A;  3R1K A;  4CYQ A;  4JLY A;  3EO4 A;  4CGL A;  4HKF A;  4UA3 A;  4CAE A;  4H6Z A;  4B10 A;  2CNS A;  2YNC C;  4CGM A;  4HNW B;  4Q36 A;  4PSX A;  5G21 A;  3IU1 A;  2F5I A;  4CAV A;  1FY7 A;  3FRM A;  2REF A;  2REE A;  3EXN A;  1PUA A;  4CYO A;  4KVX A;  5CNP A;  3N7Z A;  3W91 A;  4A2Z A;  2Q44 A;  3JUW A;  2I79 A;  4A31 A;  4XPK A;  1VHS A;  3PZJ A;  4NCZ A;  2AE6 A;  2HQY A;  4CYP A;  4KVO E;  2OZG A;  4CGP A;  1Z4E A;  2G3T A;  2B3U A;  5I0C A;  4MY3 A;  4KOX A;  2J8M A;  5EBV A;  5A27 A;  3QB8 A;  2WPW A;  2OH1 A;  1YK3 A;  2ZW5 A;  4MI4 A;  1V0C A;  1Y9W A;  1BO4 A;  1P4N A;  1QST A;  2JDD A;  3IGR A;  3DSB A;  4NEX A;  3BLN A;  3D3S A;  1S3Z A;  1KUX A;  4H6U A;  4MFL A;  1S7L A;  1S7K A;  3KKW A;  1Y9K A;  1M1D A;  4B11 A;  4ORF A;  4H89 A;  2FIW A;  2JEV A;  5AG6 A;  5DWM A;  1ZO0 A;  4ZGY B;  4K30 A;  5J8F A;  5BWA B;  4NSQ A;  3OWC A;  3GY9 A;  4U5Y A;  4II9 A;  3T90 A;  2KCW A;  2P6E A;  4MFJ A;  2I00 A;  4C7H A;  2EVN A;  3K9U A;  4QB9 A;  2O28 A;  5G1Z A;  4JXR A;  4HNY B;  1MK4 A;  3DR8 A;  1WWZ A;  5J8C A;  1YVO A;  4E8O A;  3TT2 A;  4JD6 A;  2B4D A;  4UCP A;  5AGE A;  3EC4 A;  3JVN A;  1Q2C A;  4PV6 A;  1YR0 A;  2CXA A;  2K5T A;  2EUI A;  4L89 A;  3R9E A;  5GCN A;  3R95 A;  4CGN A;  1MJA A;  2VI7 A;  4KOY A;  2B3V A;  3R9F A;  3TOA A;  3TTH A;  4JXQ A;  4R3L A;  2DXQ A;  1N71 A;  5F46 A;  2DPT A;  1YLE A;  4U9Z A;  3DDD A;  2R8V A;  4E2A A;  1ON0 A;  1M4G A;  3T9Y A;  1YVK A;  3TOB A;  2BSW A;  4A95 A;  1PU9 A;  4BMH A;  2Z3O A;  4KLW A;  3E0K A;  4JWP A;  1S7N A;  3DNS A;  4KOS A;  2FIA A;  2B4D B;  1NSL A;  4UCN A;  4Y49 B;  3FB3 A;  4MY0 A;  4KUA A;  3FBU A;  2VZY A;  4CAF A;  1CM0 A;  1QSM A;  4KOV A;  5IX3 A;  2Q7B A;  4B12 A;  3EY5 A;  2YNC A;  5E96 A;  2Z3M A;  2B5G B;  1XMT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...