3FRMA

The crystal structure of a functionally unknown conserved protein from staphylococcus epidermidis atcc 12228.
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
252
structure length
252
Chain Sequence
AMSKITFKDIYIDGNKITEDSRKAIYLLPPQPLKYASNTWIYKTMPTMNQWLKDIEVQKKMHLNQSSYHLSFSFPANEKIDEVLLEKIRELGFQIGVLELYVIEAKALKELSRKRDVDIQLVSSNNINDYLHVYDAFARPFGDSYANMVKQHIYSSYNLDDIERLVAYVNHQPVGIVDIIMTDKTIEIDGFGVLEEFQHQGIGSEIQAYVGRMANERPVILVADGKDTAKDMYLRQGYVYQGFKYHILKENI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a functionally unknown conserved protein from Staphylococcus epidermidis ATCC 12228.
rcsb
source organism Staphylococcus epidermidis
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized conserved protein
total genus 70
structure length 252
sequence length 252
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
A PF18467 DUF5613 Domain of unknown function (DUF5613)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3frmA00
2B4BA 4OAEA 3R1KA 2PR1A 4F6AA 1YVOA 1PU9A 4X5KA 3VWEA 5JQ4A 1OZPA 2FIWA 2PC1A 3DR6A 1P4NA 3PGPA 4XNHB 4UWIA 3JVNA 3CXPA 4HNWB 2JEVA 1I12A 2GANA 4FD5A 3F0AA 1BO4A 4PK3A 1MJ9A 2C27A 4B5OA 4KOSA 1ON0A 3TE4A 2BUEA 3EO4A 3G3SA 3S6HA 1N71A 4I49A 4AG9A 4MY0A 4B5PB 3EXNA 1YVKA 3PP9A 4HNXB 4QBJA 2ZPAA 1WK4A 1B6BA 3B8GA 2O28A 2HV2A 2FT0A 2EUIA 4B5PA 3GKRA 5CNPA 5H86A 4K30A 4RI1A 2VEZA 2GE3A 4Y49C 4QUSA 4JWPA 2B58A 2OZHA 4M3SA 3PZJA 1I1DA 1MJBA 4KOXA 3WR7A 2Z11A 1QSNA 3F5BA 4U9YA 1YK3A 4OLLA 3S6FA 2FSRA 1KUVA 3E0KA 1Z9UA 4AVBA 1GHEA 5KTDA 2CNTA 1YREA 1QSTA 3BLNA 5EC4A 3CXSA 2Z0ZA 2K5TA 4JXQA 5KTAA 3MGDA 4UA3A 4ORFA 5IB0A 2ZW4A 1QSRA 4H6UA 5FVJA 3W6SA 3R9FA 1CJWA 4LUAA 4KOTA 5E96A 1S3ZA 4LX9A 1L0CA 3OWCA 4AVAA 2G3TA 2I00A 3LD2A 2R98A 2BSWA 2CNSA 4CS0B 2FL4A 1BOBA 4NSQA 3R9EA 3TO7A 3K9UA 1IIDA 4YFJA 2WPWA 4NF1A 3FNCA 4JJXA 4CAXA 1XE4A 4PSWA 5DWMA 3P2FA 3QB8A 2Q44A 3EC4A 2Q4VA 3IGRA 4MHDA 1NSLA 2QECA 5DWNA 4KOUA 1IYKA 4AG7A 4NCZA 3T9YA 1KUYA 2FXFA 2FIAA 2B3UA 1YX0A 2NMTA 4CRYB 2PR8A 4GS4A 3DSBA 1KUXA 1VKCA 1PUAA 2Q7BA 2B4DB 1Z4EA 3FYNA 3DNSA 3FB3A 1U6MA 3F8KA 2R7HA 1WWZA 2REEA 1NMTA 2B3VA 1SQHA 2JDCA 3GY9A 3QAHA 4RS2A 5F49A 2OU2A 3EY5A 4AVCA 1XMTA 4OADA 1TIQA 3TCVA 1Y7RA 4E2AA 2R1IA 4PK2A 4R3LA 3ZZIA 4KOYA 1IB1E 2G3AA 2KCWA 2VBQA 2FS5A 3GYAA 4ZBGA 3BJ7A 1YGHA 4KVOE 1VHSA 2P6GA 2Y0MA 1S7LA 3SXOA 2FCKA 4F0YA 2X7BA 3EFAA 1P0HA 4E8OA 4KOVA 3I3GA 5IX3A 2A4NA 4CAVA 2I79A 3UY5A 4JLYA 1S7NA 2IL4A 2AJ6A 3I9SA 2HQYA 4PSXA 4II9A 1Q2DA 2D4PA 2J8NA 3TT2A 2OZUA 3DR8A 3H4QA 3JUWA 5KTCA 4H6ZA 3R95A 1K4JA 1I21A 1R57A 2EVNA 3LODA 2VXKA 3TFYA 4HNYB 2PRBA 4KUAA 4AB7A 2G0BA 4J3GA 2DXQA 3D2PA 3DDDA 4MBUA 3T90A 5J8CA 1YLEA 4MY3A 2Q04A 3R96A 1Q2CA 1V0CA 4L89A 3CXQA 5HMNA 4KVME 2RC4A 5C88A 5ISVA 2P0WA 5C82A 4R87A 2QMLA 2VQYA 4U9ZA 1S5KA 3ZJ0A 4FD7A 1XIXA 2OH1A 1M4DA 3D8PA 1IICA 1CM0A 1LRZA 2D4OA 4QC6A 3S6GA 4DNCA 5F47A 5HH1A 2P6EA 1M1DA 3SHPA 2P6FA 4IUSA 1B87A 2HUZA 1QSMA 2OZGA 3TOBA 3G8WA 5GCNA 3SXNA 1Y9KA 1YR0A 4MI4A 4R3KA 1Q2YA 3W91A 2Z10A 4NEXA 2JLMA 4MJ8A 3IWGA 2H5MA 3RYOA 2FE7A 3FXTA 1M4GA 2PQ8A 2ZW7A 4H89A 2GIVA 2AE6A 2B5GA 2J8MA 4NXYA 3BJ8A 3KKWA 4KOWA 4M85A 2R8VA 4BMHA 1XF8A 3TO9A 4E0AA 1Z4RA 3R9GA 1S60A 2REFA 4FD6A 1XEBA 2CNMA 4JXRA 1RO5A 2VZYA 2ZW5A 5H84A 4ONUA 3NE7A 3FRMA 3V8IA 5JPHA 3S6KA 1FY7A 3FBUA 4KVXA 3D2MA 2Q4YA 5F48A 2B4DA 1S7KA 4QVTA 2QIRA 3TTHA 1IYLA 3C26A 3P2HA 4KZTA 4FD4A 2OB0A 4XPKA 5EBVA 3D3SA 4KUBA 4UWJA 4YRHA 4QB9A 2ARHA 4XPLA 3W6XA 3VWDA 2CY2A 4KORA 3TOAA 2B5GB 4Y49B 2PSWA 4CRZB 2ATRA 1MJAA 2J8RA 1Y9WA 4KLVA 1QSOA 1MK4A 4HKFA 4R57A 2ZXVA 3TO6A 3FIXA 4R9MA 4L8AA 2BL1A 1UFHA 2BEIA 4YGOA 4UBRA 2Q0YA 4U5YA 1M44A 2F5IA 5IV0A 4XPDB 2PDOA 5J8FA 1J4JA 2VZZA 1M4IA 2ZW6A 5F46A 2VI7A 4JD6A 4KLWA 5I0CA 4CAWA 2JDDA 1NE9A 3N7ZA 1RXTA 4PV6A 4XNHC 2WPXA 4IF5A 4EVYA 1KZFA 1S7FA 4XPDC
chains in the Genus database with same CATH superfamily
2B4BA 4OAEA 1YMEA 3R1KA 2PR1A 3PBBA 4PXEA 4DYOA 4F6AA 1XBUA 1YVOA 5LRJA 3VH9A 4ZYQA 1PU9A 1BPNA 1CP6A 4OC1A 4OC0A 4X5KA 3VWEA 5JQ4A 1OZPA 2ABZA 2FIWA 2XEJA 2Z3MA 2PC1A 2ZEOA 3DR6A 1P4NA 3PGPA 3KASA 3PEIA 3CDXA 4MHNA 4UWIA 4XNHB 4ZY0A 2PVWA 3JVNA 3CXPA 2IMOA 4HNWB 2JEVA 1I12A 2GANA 4FD5A 1YW6A 4YU9A 3JRUA 4AXVA 3F0AA 2ZENA 1ARMA 1BO4A 4TWEA 4PK3A 1MJ9A 1PYTB 2ZOGA 3FH4A 1Z2LA 1TF9A 2C27A 1F57A 1ARLA 2POKA 3NH5A 3T8WA 2PJ8A 3KR5A 3B3SA 4B5OA 2Q7SA 4KOSA 3S9NA 1ON0A 3TE4A 1QQ9A 1TXRA 3CT9A 4P4FA 2BUEA 1IGBA 5F09A 3CZXA 3EO4A 3G3SA 1N71A 4I49A 4R6TA 4MY0A 1VGYA 3S6HA 4H2KA 4UFWA 2C6GA 3SJGA 4AG9A 2PJ6A 3EXNA 1YVKA 1VHEA 3PP9A 4HNXB 4PXBA 4F8ZA 5G20A 4QBJA 2ZPAA 4MFLA 1WK4A 5J1QA 1B6BA 3A9LA 3B8GA 1Y7EA 2O28A 2HV2A 2EBJA 2FT0A 2EUIA 4G1PA 4LQ6A 4MXUA 4B5PA 2PIYA 2BOAA 4GXHA 4MHZA 3GKRA 5CNPA 4UEZA 4A33A 3MRUA 4KSIA 5H86A 4A94A 1DTDA 1NSAA 4MFJA 4K30A 2VEZA 4RI1A 2WSAA 2GE3A 4Y49C 4QUSA 3DLJA 4JWPA 2B58A 4YRHA 4CYPA 2OZHA 4M3SA 1CPSA 4M6GA 3B35A 3PZJA 4CYOA 1I1DA 1MJBA 1JQGA 4KOXA 3CPXA 3WR7A 3KQZA 1DE4C 4FAIA 4OP4A 1TKHA 2Z11A 4OIWA 3B7IA 2Z3LA 1QSNA 2ZOFA 2XEFA 3F5BA 1YK3A 4U9YA 4A32A 4F9VA 4OLLA 3S6FA 2FSRA 1F2PA 4P6YA 1KUVA 1Z8LA 1Z9UA 3E0KA 5AGEA 4AVBA 2PJ1A 4X3RA 1GHEA 4JYWA 4A31A 2CNTA 2Z3KA 5KTDA 1YREA 1QSTA 3BLNA 3D4UA 3PBEA 5EC4A 4ZI6A 3CXSA 2Z0ZA 2K5TA 2PJ2A 3DGVA 4JXQA 3MGDA 5K8PA 5KTAA 4UA3A 4ORFA 5IB0A 2ZW4A 1QSRA 2HB6A 4H6UA 4DJLA 3FF3A 3N5FA 3WT4A 5CBMA 4NGPA 5FVJA 3WC7A 3W6SA 3R9FA 2PJ4A 2WZNA 5D29A 3SJFA 1CJWA 5LRKA 4LUAA 4KOTA 4WJBA 1S3ZA 5E96A 4LX9A 3SI0A 2IJZA 1L0CA 1H8LA 2V8DA 4C7IA 3OWCA 2VL1A 1LANA 1CP7A 4AVAA 1LFWA 1AYEA 2G3TA 2I00A 4OIDA 3RZAA 3LD2A 2AFMA 2R98A 5HVFA 2BSWA 1R43A 2CNSA 4CS0B 1UWYA 2PCUA 2C6CA 5THWA 1Z5RA 2FL4A 2ZEEA 4B12A 3IU1A 4MCPA 1BOBA 4NSQA 2C6PA 3R9EA 3FX6A 3K9UA 1IIDA 4NGSA 3TO7A 2OOTA 2BCOA 4YFJA 4EWTA 3QNVA 2WPWA 2F8HA 4NF1A 1Q7LA 3FNCA 4JJXA 4OKOA 1XE4A 4A2ZA 4CAXA 4PSWA 4Z65A 5DWMA 3P2FA 1R3NA 1ZLHA 3QB8A 3KGQA 2Q44A 3EC4A 4CAEA 2Q4VA 3IGRA 4CGOA 4MHDA 3FJUA 5AG6A 4CPAA 1NSLA 4OC4A 2QECA 4C2XA 3KHZA 5DWNA 4KOUA 2YNDA 4A39A 4O23A 1EE3P 1F2OA 1IYKA 3CPAA 4UIBA 3TX8A 4AG7A 4NCZA 3T9YA 1KUYA 3D7HA 2ZEPA 2FXFA 2FIAA 2B3UA 2I3CA 1YX0A 2NMTA 1Y0RA 3IWWA 4CRYB 5JM6A 2PR8A 1ZG7A 7CPAA 1VIXA 4GS4A 5K8MA 2PJ3A 3RNZA 3DSBA 1KUXA 1QMUA 1VKCA 1PUAA 1CX8A 2GU2A 1ZG9A 2Q7BA 3QAYA 2B4DB 3KZWA 3SJXA 1Z4EA 3D7DA 3FYNA 3VATA 5HVGA 2DF5A 2RB7A 2GLJA 3DNSA 3FB3A 1U6MA 5K8OA 1M4LA 3F8KA 2R7HA 4OC5A 3SI2A 2CIJA 3SJEA 1WWZA 2AFZA 2REEA 2Z3NA 4UFVA 2V8VA 1NMTA 1YW4A 1SQHA 2B3VA 4R8FA 2JDCA 1CG2A 3GY9A 3QAHA 4CGNA 4RS2A 3GLJA 5F49A 2OU2A 2ZELA 3EY5A 3L2NA 4AVCA 3S9LA 2O4HA 1XMTA 3KHXA 4RUHA 4OADA 1TIQA 3S9MA 3TCVA 1Y7RA 4E2AA 2R1IA 2YNEA 3BXMA 4MCQA 4PK2A 4R3LA 5IB9A 3ZZIA 4Q38A 2ZEFA 4KOYA 4HPSA 1IB1E 4ONWA 3D7GA 3IFEA 2BO9A 2G3AA 2KCWA 2VBQA 2FS5A 4PXDA 5G21A 4BBHA 2Z3PA 3GYAA 4MHPA 3IO1A 4P4JA 4ZBGA 5AG4A 3BJ7A 1PCAA 1YGHA 5G1ZA 4KVOE 2AFSA 5HVHA 4C2ZA 1VHSA 2EK8A 2JBKA 4IAVA 1FNOA 2P6GA 3VARA 2Y0MA 1S7LA 4JZ0A 4KSFA 3LWUA 2FCKA 4UEEA 3SXOA 4F0YA 2X7BA 3EFAA 1P0HA 4E8OA 4KOVA 3I3GA 5EMIA 1KWMA 4P4EA 4MMOA 5IX3A 2FVGA 2YNCC 3GB0A 1X10A 2O53A 3K2KA 2A4NA 4ZX9A 4CAVA 4CGLA 2I79A 4B13A 3PB9X 1CBXA 3UY5A 4JLYA 4MFQA 1S7NA 1ELLP 2IL4A 2NYQA 3HUVA 4P4IA 2ODFA 3BI1A 2AJ6A 4BINA 1IY7A 4NGQA 2EWBA 2NSMA 3PFOA 3ISZA 3I9SA 4UCMA 2PJ9A 2HQYA 1OBRA 4PSXA 3D7FA 4FBEA 4PQAA 4II9A 3PB8X 1ZO0A 1Q2DA 2D4PA 2EK9A 2J8NA 4LQGA 4UCNA 2V77A 3NA6A 2PIZA 2ZEMA 2OZUA 3NE8A 3TT2A 5LYFA 3DR8A 3H4QA 3JUWA 5KTCA 1BAVA 4H6ZA 1YSJA 1K4JA 1IOFA 1I21A 3R95A 1BPMA 1R57A 3IIBA 2EVNA 3LODA 2ANPA 2HC9A 1XFOA 3B3TA 2VXKA 5HXDA 4HNYB 2PJCA 2PJAA 2PRBA 4KUAA 3TFYA 2GLFA 1TF8A 4OMEA 3H5ZA 4AB7A 2G0BA 4J3GA 2DXQA 3D2PA 3DDDA 4MBUA 3T90A 4ZX8A 2RFHA 2PJ7A 2ZEHA 5J8CA 1YLEA 1YLOA 3FEEA 4MY3A 2ZEDA 4B5PB 2Q04A 6CPAA 3KI9A 4MCSA 4NGMA 3R96A 1Q2CA 5BWAB 3IJ3A 3WC5A 2Q4ZA 2Z3OA 1LAMA 5LYIA 1V0CA 3B2YA 3ISXA 3KQXA 3V38A 1X12A 4L89A 4MRIA 3RBUA 5G22A 3PB7X 1Z8XA 1ZLIA 3CXQA 1RTQA 4P45A 2DEAA 1Y0YA 5HMNA 4NGNA 4ZY1A 4KVME 2RC4A 4ZY2A 1AUGA 5CPAA 1Z8TA 4KS9A 5C88A 4CGPA 5ISVA 4C7HA 2GFQA 2P0WA 4IHMA 4F0XA 4DUKA 1AMPA 4NJQA 5C82A 4R87A 2QMLA 2VQYA 3GIUA 4U9ZA 1LAPA 1S5KA 4RN7A 1Z8WA 1XMBA 4F9UA 3ZJ0A 4FD7A 2WYRA 3B3CA 2CTBA 4UCPA 1XIXA 2OH1A 1M4DA 1HEEA 4X2TA 2XEGA 3D8PA 3MN8A 1IICA 4MHYA 3I1UA 1CM0A 1LRZA 2D4OA 2Q51A 4QC6A 1A2ZA 8CPAA 1XOVA 4UF4A 2IQ6A 4YWYA 5AG5A 2PJ0A 4PXCA 4M6IA 3S6GA 3FECA 3PRTA 4DNCA 4R7MA 5F47A 1IU8A 3IEHA 4P10A 4Q36A 4R76A 5HH1A 2AFXA 3PB6X 4OC2A 5LYLA 2P6EA 1M1DA 3SHPA 5D8NA 2P6FA 1JWQA 3RAMA 4KSAA 4IUSA 4B10A 1B87A 4CGMA 2HUZA 1QSMA 5LRGA 2OZGA 2J9AA 4P4DA 3NH8A 3TOBA 3G8WA 3PFEA 1XJOA 5GCNA 3SXNA 4EFDA 1Y9KA 5A28A 1YR0A 4MI4A 4R3KA 1BLLE 1Q2YA 3FVLA 3W91A 1ELMP 4Q7AA 2Z10A 4OC3A 4GM5A 2JLMA 4MJ8A 3IWGA 4NEXA 1YQEA 2H5MA 4NFRA 3RYOA 3SI1A 2FE7A 3FXTA 1M4GA 1GYTA 1TKJA 2PQ8A 2YGWA 2PVVA 2ZW7A 4H89A 2GIVA 2AE6A 2OR4A 2B5GA 4IK2A 4CYNA 1HDUA 2J8MA 2DPSA 4NXYA 3BJ8A 3KKWA 2WUUA 4A95A 4KOWA 4M85A 2R8VA 3KR4A 4BMHA 4EMEA 1CPXA 1XF8A 4A38A 2GREA 4FWUA 3TO9A 2AFUA 4E0AA 1Z4RA 2PJ5A 3H8FA 3R9GA 3K9TA 1S60A 2REFA 4NGTA 3LMSA 3B3WA 4A30A 4A37A 3BHXA 1FT7A 1TKFA 4FD6A 2CF4A 1XEBA 2CNMA 3H8EA 3RO0A 4JXRA 2C1CA 1RO5A 2VZYA 2ZW5A 5H84A 5A27A 5ELYA 4ONUA 3D67A 1IOIA 3NE7A 2DPTA 3FRMA 3V8IA 1VHOA 3H8GA 4MCRA 5JPHA 2EO8A 5AG7A 3S6KA 2JBJA 1FY7A 3FBUA 4KVXA 3D2MA 2Q4YA 4NGRA 2QYVA 4B14A 3WABA 5F48A 2B4DA 3LACA 4CAFA 3V7ZA 1S7KA 4QVTA 2QIRA 3TTHA 3WC6A 1IYLA 3C26A 3P2HA 4KZTA 4FD4A 3D66A 2OB0A 3JTKA 3NH4A 4K3NA 4XPKA 5EBVA 2QJ8A 3D3SA 2PE3A 4KUBA 3FEDA 4UWJA 3KL9A 1HDQA 3FMCA 2ARHA 4QB9A 4UFXA 4WWVA 2AFWA 2Q43A 4XPLA 3W6XA 3VWDA 2CY2A 4KORA 4C68A 1LOKA 3TOAA 2B5GB 4Y49B 4MFKA 2PSWA 2PRQA 4CRZB 4UEFA 2ATRA 1MJAA 2J8RA 5K8NA 1Y9WA 1ZG8A 3B3VA 4KLVA 1QSOA 1MK4A 4PPZA 4HKFA 4R57A 2ZEGA 4CYQA 3IWEA 2AFOA 2ZXVA 3TO6A 3FIXA 2JEWA 2PJBA 4R9MA 4X8IA 5DS0A 4L8AA 2XEIA 2BL1A 1UFHA 2BEIA 4YGOA 4UBRA 4M6HA 2Q0YA 4U5YA 1M44A 2CXAA 2F5IA 4MFPA 5LYDA 2V8GA 4B11A 4ZGYB 5IV0A 4W9YA 4XPDB 4NJRA 2PDOA 2YNCA 4MFZA 5J8FA 4B6ZA 1J4JA 2VZZA 1M4IA 2ZW6A 5F46A 2F7VA 2VI7A 3IU2A 4JD6A 4KLWA 4P44A 4UIAA 3TC8A 5I0CA 4FUUA 5JH9A 2QVPA 3HLPA 4BD9A 4CAWA 3PB4X 2JDDA 2V8HA 1NE9A 3IC1A 3NFZA 3N7ZA 1XRYA 4P4BA 1RXTA 4PV6A 4XNHC 1LCPA 5I4MA 4C2YA 2WPXA 2CTCA 2G9DA 4IF5A 3BI0A 5JGFA 3GUXA 4EVYA 1KZFA 4TNUA 3D68A 1S7FA 4XPDC
chains in the Genus database with same CATH topology
2B4BA 4OAEA 3R1KA 2PR1A 4F6AA 1YVOA 1PU9A 4X5KA 3VWEA 5JQ4A 1OZPA 2FIWA 2Z3MA 2PC1A 3DR6A 1P4NA 3PGPA 4XNHB 4UWIA 3JVNA 3CXPA 4HNWB 2JEVA 1I12A 2GANA 4FD5A 3F0AA 1BO4A 4PK3A 1MJ9A 2C27A 4B5OA 4KOSA 1ON0A 3TE4A 2BUEA 3EO4A 3G3SA 3S6HA 1N71A 4I49A 4AG9A 4MY0A 4B5PB 4UFWA 3EXNA 1YVKA 3PP9A 4HNXB 5G20A 4QBJA 2ZPAA 4MFLA 1WK4A 1B6BA 3A9LA 3B8GA 2O28A 2HV2A 2FT0A 2EUIA 4B5PA 3GKRA 5CNPA 4A33A 5H86A 4MFJA 4K30A 2VEZA 4RI1A 2WSAA 2GE3A 4Y49C 4QUSA 4JWPA 2B58A 2OZHA 4M3SA 3PZJA 4CYOA 1I1DA 1MJBA 4KOXA 3WR7A 2Z11A 2Z3LA 1QSNA 3F5BA 4U9YA 1YK3A 4A32A 4OLLA 3S6FA 2FSRA 1KUVA 3E0KA 1Z9UA 5AGEA 4AVBA 1GHEA 4A31A 5KTDA 2CNTA 2Z3KA 1YREA 1QSTA 3BLNA 5EC4A 3CXSA 2Z0ZA 2K5TA 4JXQA 5KTAA 3MGDA 4UA3A 4ORFA 5IB0A 2ZW4A 1QSRA 4H6UA 5FVJA 3W6SA 3R9FA 1CJWA 4LUAA 4KOTA 5E96A 1S3ZA 4LX9A 1L0CA 4C7IA 3OWCA 4AVAA 2G3TA 2I00A 3LD2A 2R98A 2BSWA 2CNSA 4CS0B 2FL4A 4B12A 3IU1A 1BOBA 4NSQA 3R9EA 3TO7A 3K9UA 1IIDA 4YFJA 2WPWA 4NF1A 3FNCA 4JJXA 4CAXA 1XE4A 4A2ZA 4PSWA 5DWMA 3P2FA 3QB8A 2Q44A 3EC4A 4CAEA 2Q4VA 3IGRA 4CGOA 4MHDA 5AG6A 1NSLA 2QECA 4C2XA 5DWNA 4KOUA 2YNDA 1IYKA 4AG7A 4NCZA 3T9YA 1KUYA 2FXFA 2FIAA 2B3UA 1YX0A 2NMTA 4CRYB 2PR8A 4GS4A 3DSBA 1KUXA 1VKCA 1PUAA 2Q7BA 2B4DB 1Z4EA 3FYNA 3DNSA 3FB3A 1U6MA 3F8KA 2R7HA 1WWZA 2REEA 2Z3NA 4UFVA 1NMTA 2B3VA 1SQHA 4CGNA 2JDCA 3GY9A 3QAHA 4RS2A 5F49A 2OU2A 3EY5A 4AVCA 1XMTA 4OADA 1TIQA 3TCVA 1Y7RA 4E2AA 2R1IA 2YNEA 4PK2A 4R3LA 3ZZIA 4Q38A 4KOYA 1IB1E 2G3AA 2KCWA 2VBQA 2FS5A 5G21A 4BBHA 2Z3PA 3GYAA 4ZBGA 5AG4A 3BJ7A 1YGHA 5G1ZA 4KVOE 4C2ZA 1VHSA 2P6GA 2Y0MA 1S7LA 4KSFA 3SXOA 2FCKA 4F0YA 2X7BA 3EFAA 1P0HA 4E8OA 4KOVA 3I3GA 5IX3A 2YNCC 2A4NA 4CAVA 4CGLA 2I79A 4B13A 3UY5A 4JLYA 4MFQA 1S7NA 2IL4A 2AJ6A 3I9SA 4UCMA 2HQYA 4PSXA 4II9A 1ZO0A 1Q2DA 2D4PA 2J8NA 4UCNA 3TT2A 2OZUA 3DR8A 3H4QA 3JUWA 5KTCA 4H6ZA 3R95A 1K4JA 1I21A 1R57A 2EVNA 3LODA 2VXKA 3TFYA 4HNYB 2PRBA 4KUAA 3H5ZA 4AB7A 2G0BA 4J3GA 2DXQA 3D2PA 3DDDA 4MBUA 3T90A 5J8CA 1YLEA 4MY3A 2Q04A 3R96A 1Q2CA 5BWAB 2Z3OA 1V0CA 4L89A 5G22A 3CXQA 5HMNA 4KVME 2RC4A 4KS9A 5C88A 4CGPA 5ISVA 4C7HA 2P0WA 4F0XA 5C82A 4R87A 2QMLA 2VQYA 4U9ZA 1S5KA 3ZJ0A 4FD7A 4UCPA 1XIXA 2OH1A 1M4DA 3D8PA 1IICA 1CM0A 1LRZA 2D4OA 4QC6A 5AG5A 3S6GA 4DNCA 5F47A 4Q36A 5HH1A 2P6EA 1M1DA 3SHPA 2P6FA 4KSAA 4IUSA 4B10A 1B87A 4CGMA 2HUZA 1QSMA 2OZGA 3TOBA 3G8WA 5GCNA 3SXNA 1Y9KA 5A28A 1YR0A 4MI4A 4R3KA 1Q2YA 3W91A 2Z10A 4NEXA 2JLMA 4MJ8A 3IWGA 5A27A 2H5MA 3RYOA 2FE7A 3FXTA 1M4GA 2PQ8A 2YGWA 2ZW7A 4H89A 2GIVA 2AE6A 2B5GA 4CYNA 2J8MA 2DPSA 4NXYA 3BJ8A 3KKWA 2WUUA 4A95A 4KOWA 4M85A 2R8VA 4BMHA 1XF8A 3TO9A 4E0AA 1Z4RA 3R9GA 1S60A 2REFA 4A30A 4FD6A 1XEBA 2CNMA 4JXRA 1RO5A 2VZYA 2ZW5A 5H84A 4ONUA 3NE7A 2DPTA 3FRMA 3V8IA 5JPHA 5AG7A 3S6KA 1FY7A 3FBUA 4KVXA 3D2MA 2Q4YA 4B14A 5F48A 2B4DA 4CAFA 1S7KA 4QVTA 2QIRA 3TTHA 1IYLA 3C26A 3P2HA 4KZTA 4FD4A 2OB0A 3JTKA 4XPKA 5EBVA 3D3SA 4KUBA 4UWJA 4YRHA 4CYPA 4QB9A 2ARHA 4UFXA 4XPLA 3W6XA 3VWDA 2CY2A 4KORA 4C68A 3TOAA 2B5GB 4Y49B 4MFKA 2PSWA 4CRZB 2ATRA 1MJAA 2J8RA 1Y9WA 4KLVA 1QSOA 1MK4A 4HKFA 4R57A 4CYQA 3IWEA 2ZXVA 3TO6A 3FIXA 4R9MA 4L8AA 2BL1A 1UFHA 2BEIA 4YGOA 4UBRA 2Q0YA 4U5YA 1M44A 2CXAA 2F5IA 4MFPA 4B11A 4ZGYB 5IV0A 4XPDB 2PDOA 2YNCA 4MFZA 5J8FA 1J4JA 2VZZA 1M4IA 2ZW6A 5F46A 2VI7A 3IU2A 4JD6A 4KLWA 5I0CA 4CAWA 2JDDA 1NE9A 3N7ZA 1RXTA 4PV6A 4XNHC 4C2YA 2WPXA 4IF5A 4EVYA 1KZFA 1S7FA 4XPDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B4B A;  4OAE A;  3R1K A;  2PR1 A;  4F6A A;  1YVO A;  1PU9 A;  4X5K A;  3VWE A;  5JQ4 A;  1OZP A;  2FIW A;  2PC1 A;  3DR6 A;  1P4N A;  3PGP A;  4XNH B;  4UWI A;  3JVN A;  3CXP A;  4HNW B;  2JEV A;  1I12 A;  2GAN A;  4FD5 A;  3F0A A;  1BO4 A;  4PK3 A;  1MJ9 A;  2C27 A;  4B5O A;  4KOS A;  1ON0 A;  3TE4 A;  2BUE A;  3EO4 A;  3G3S A;  3S6H A;  1N71 A;  4I49 A;  4AG9 A;  4MY0 A;  4B5P B;  3EXN A;  1YVK A;  3PP9 A;  4HNX B;  4QBJ A;  2ZPA A;  1WK4 A;  1B6B A;  3B8G A;  2O28 A;  2HV2 A;  2FT0 A;  2EUI A;  4B5P A;  3GKR A;  5CNP A;  5H86 A;  4K30 A;  4RI1 A;  2VEZ A;  2GE3 A;  4Y49 C;  4QUS A;  4JWP A;  2B58 A;  2OZH A;  4M3S A;  3PZJ A;  1I1D A;  1MJB A;  4KOX A;  3WR7 A;  2Z11 A;  1QSN A;  3F5B A;  4U9Y A;  1YK3 A;  4OLL A;  3S6F A;  2FSR A;  1KUV A;  3E0K A;  1Z9U A;  4AVB A;  1GHE A;  5KTD A;  2CNT A;  1YRE A;  1QST A;  3BLN A;  5EC4 A;  3CXS A;  2Z0Z A;  2K5T A;  4JXQ A;  5KTA A;  3MGD A;  4UA3 A;  4ORF A;  5IB0 A;  2ZW4 A;  1QSR A;  4H6U A;  5FVJ A;  3W6S A;  3R9F A;  1CJW A;  4LUA A;  4KOT A;  5E96 A;  1S3Z A;  4LX9 A;  1L0C A;  3OWC A;  4AVA A;  2G3T A;  2I00 A;  3LD2 A;  2R98 A;  2BSW A;  2CNS A;  4CS0 B;  2FL4 A;  1BOB A;  4NSQ A;  3R9E A;  3TO7 A;  3K9U A;  1IID A;  4YFJ A;  2WPW A;  4NF1 A;  3FNC A;  4JJX A;  4CAX A;  1XE4 A;  4PSW A;  5DWM A;  3P2F A;  3QB8 A;  2Q44 A;  3EC4 A;  2Q4V A;  3IGR A;  4MHD A;  1NSL A;  2QEC A;  5DWN A;  4KOU A;  1IYK A;  4AG7 A;  4NCZ A;  3T9Y A;  1KUY A;  2FXF A;  2FIA A;  2B3U A;  1YX0 A;  2NMT A;  4CRY B;  2PR8 A;  4GS4 A;  3DSB A;  1KUX A;  1VKC A;  1PUA A;  2Q7B A;  2B4D B;  1Z4E A;  3FYN A;  3DNS A;  3FB3 A;  1U6M A;  3F8K A;  2R7H A;  1WWZ A;  2REE A;  1NMT A;  2B3V A;  1SQH A;  2JDC A;  3GY9 A;  3QAH A;  4RS2 A;  5F49 A;  2OU2 A;  3EY5 A;  4AVC A;  1XMT A;  4OAD A;  1TIQ A;  3TCV A;  1Y7R A;  4E2A A;  2R1I A;  4PK2 A;  4R3L A;  3ZZI A;  4KOY A;  1IB1 E;  2G3A A;  2KCW A;  2VBQ A;  2FS5 A;  3GYA A;  4ZBG A;  3BJ7 A;  1YGH A;  4KVO E;  1VHS A;  2P6G A;  2Y0M A;  1S7L A;  3SXO A;  2FCK A;  4F0Y A;  2X7B A;  3EFA A;  1P0H A;  4E8O A;  4KOV A;  3I3G A;  5IX3 A;  2A4N A;  4CAV A;  2I79 A;  3UY5 A;  4JLY A;  1S7N A;  2IL4 A;  2AJ6 A;  3I9S A;  2HQY A;  4PSX A;  4II9 A;  1Q2D A;  2D4P A;  2J8N A;  3TT2 A;  2OZU A;  3DR8 A;  3H4Q A;  3JUW A;  5KTC A;  4H6Z A;  3R95 A;  1K4J A;  1I21 A;  1R57 A;  2EVN A;  3LOD A;  2VXK A;  3TFY A;  4HNY B;  2PRB A;  4KUA A;  4AB7 A;  2G0B A;  4J3G A;  2DXQ A;  3D2P A;  3DDD A;  4MBU A;  3T90 A;  5J8C A;  1YLE A;  4MY3 A;  2Q04 A;  3R96 A;  1Q2C A;  1V0C A;  4L89 A;  3CXQ A;  5HMN A;  4KVM E;  2RC4 A;  5C88 A;  5ISV A;  2P0W A;  5C82 A;  4R87 A;  2QML A;  2VQY A;  4U9Z A;  1S5K A;  3ZJ0 A;  4FD7 A;  1XIX A;  2OH1 A;  1M4D A;  3D8P A;  1IIC A;  1CM0 A;  1LRZ A;  2D4O A;  4QC6 A;  3S6G A;  4DNC A;  5F47 A;  5HH1 A;  2P6E A;  1M1D A;  3SHP A;  2P6F A;  4IUS A;  1B87 A;  2HUZ A;  1QSM A;  2OZG A;  3TOB A;  3G8W A;  5GCN A;  3SXN A;  1Y9K A;  1YR0 A;  4MI4 A;  4R3K A;  1Q2Y A;  3W91 A;  2Z10 A;  4NEX A;  2JLM A;  4MJ8 A;  3IWG A;  2H5M A;  3RYO A;  2FE7 A;  3FXT A;  1M4G A;  2PQ8 A;  2ZW7 A;  4H89 A;  2GIV A;  2AE6 A;  2B5G A;  2J8M A;  4NXY A;  3BJ8 A;  3KKW A;  4KOW A;  4M85 A;  2R8V A;  4BMH A;  1XF8 A;  3TO9 A;  4E0A A;  1Z4R A;  3R9G A;  1S60 A;  2REF A;  4FD6 A;  1XEB A;  2CNM A;  4JXR A;  1RO5 A;  2VZY A;  2ZW5 A;  5H84 A;  4ONU A;  3NE7 A;  3FRM A;  3V8I A;  5JPH A;  3S6K A;  1FY7 A;  3FBU A;  4KVX A;  3D2M A;  2Q4Y A;  5F48 A;  2B4D A;  1S7K A;  4QVT A;  2QIR A;  3TTH A;  1IYL A;  3C26 A;  3P2H A;  4KZT A;  4FD4 A;  2OB0 A;  4XPK A;  5EBV A;  3D3S A;  4KUB A;  4UWJ A;  4YRH A;  4QB9 A;  2ARH A;  4XPL A;  3W6X A;  3VWD A;  2CY2 A;  4KOR A;  3TOA A;  2B5G B;  4Y49 B;  2PSW A;  4CRZ B;  2ATR A;  1MJA A;  2J8R A;  1Y9W A;  4KLV A;  1QSO A;  1MK4 A;  4HKF A;  4R57 A;  2ZXV A;  3TO6 A;  3FIX A;  4R9M A;  4L8A A;  2BL1 A;  1UFH A;  2BEI A;  4YGO A;  4UBR A;  2Q0Y A;  4U5Y A;  1M44 A;  2F5I A;  5IV0 A;  4XPD B;  2PDO A;  5J8F A;  1J4J A;  2VZZ A;  1M4I A;  2ZW6 A;  5F46 A;  2VI7 A;  4JD6 A;  4KLW A;  5I0C A;  4CAW A;  2JDD A;  1NE9 A;  3N7Z A;  1RXT A;  4PV6 A;  4XNH C;  2WPX A;  4IF5 A;  4EVY A;  1KZF A;  1S7F A;  4XPD C; 
#chains in the Genus database with same CATH topology
 2B4B A;  4OAE A;  1YME A;  3R1K A;  2PR1 A;  3PBB A;  4PXE A;  4DYO A;  4F6A A;  1XBU A;  1YVO A;  5LRJ A;  3VH9 A;  4ZYQ A;  1PU9 A;  1BPN A;  1CP6 A;  4OC1 A;  4OC0 A;  4X5K A;  3VWE A;  5JQ4 A;  1OZP A;  2ABZ A;  2FIW A;  2XEJ A;  2Z3M A;  2PC1 A;  2ZEO A;  3DR6 A;  1P4N A;  3PGP A;  3KAS A;  3PEI A;  3CDX A;  4MHN A;  4UWI A;  4XNH B;  4ZY0 A;  2PVW A;  3JVN A;  3CXP A;  2IMO A;  4HNW B;  2JEV A;  1I12 A;  2GAN A;  4FD5 A;  1YW6 A;  4YU9 A;  3JRU A;  4AXV A;  3F0A A;  2ZEN A;  1ARM A;  1BO4 A;  4TWE A;  4PK3 A;  1MJ9 A;  1PYT B;  2ZOG A;  3FH4 A;  1Z2L A;  1TF9 A;  2C27 A;  1F57 A;  1ARL A;  2POK A;  3NH5 A;  3T8W A;  2PJ8 A;  3KR5 A;  3B3S A;  4B5O A;  2Q7S A;  4KOS A;  3S9N A;  1ON0 A;  3TE4 A;  1QQ9 A;  1TXR A;  3CT9 A;  4P4F A;  2BUE A;  1IGB A;  5F09 A;  3CZX A;  3EO4 A;  3G3S A;  1N71 A;  4I49 A;  4R6T A;  4MY0 A;  1VGY A;  3S6H A;  4H2K A;  4UFW A;  2C6G A;  3SJG A;  4AG9 A;  2PJ6 A;  3EXN A;  1YVK A;  1VHE A;  3PP9 A;  4HNX B;  4PXB A;  4F8Z A;  5G20 A;  4QBJ A;  2ZPA A;  4MFL A;  1WK4 A;  5J1Q A;  1B6B A;  3A9L A;  3B8G A;  1Y7E A;  2O28 A;  2HV2 A;  2EBJ A;  2FT0 A;  2EUI A;  4G1P A;  4LQ6 A;  4MXU A;  4B5P A;  2PIY A;  2BOA A;  4GXH A;  4MHZ A;  3GKR A;  5CNP A;  4UEZ A;  4A33 A;  3MRU A;  4KSI A;  5H86 A;  4A94 A;  1DTD A;  1NSA A;  4MFJ A;  4K30 A;  2VEZ A;  4RI1 A;  2WSA A;  2GE3 A;  4Y49 C;  4QUS A;  3DLJ A;  4JWP A;  2B58 A;  4YRH A;  4CYP A;  2OZH A;  4M3S A;  1CPS A;  4M6G A;  3B35 A;  3PZJ A;  4CYO A;  1I1D A;  1MJB A;  1JQG A;  4KOX A;  3CPX A;  3WR7 A;  3KQZ A;  1DE4 C;  4FAI A;  4OP4 A;  1TKH A;  2Z11 A;  4OIW A;  3B7I A;  2Z3L A;  1QSN A;  2ZOF A;  2XEF A;  3F5B A;  1YK3 A;  4U9Y A;  4A32 A;  4F9V A;  4OLL A;  3S6F A;  2FSR A;  1F2P A;  4P6Y A;  1KUV A;  1Z8L A;  1Z9U A;  3E0K A;  5AGE A;  4AVB A;  2PJ1 A;  4X3R A;  1GHE A;  4JYW A;  4A31 A;  2CNT A;  2Z3K A;  5KTD A;  1YRE A;  1QST A;  3BLN A;  3D4U A;  3PBE A;  5EC4 A;  4ZI6 A;  3CXS A;  2Z0Z A;  2K5T A;  2PJ2 A;  3DGV A;  4JXQ A;  3MGD A;  5K8P A;  5KTA A;  4UA3 A;  4ORF A;  5IB0 A;  2ZW4 A;  1QSR A;  2HB6 A;  4H6U A;  4DJL A;  3FF3 A;  3N5F A;  3WT4 A;  5CBM A;  4NGP A;  5FVJ A;  3WC7 A;  3W6S A;  3R9F A;  2PJ4 A;  2WZN A;  5D29 A;  3SJF A;  1CJW A;  5LRK A;  4LUA A;  4KOT A;  4WJB A;  1S3Z A;  5E96 A;  4LX9 A;  3SI0 A;  2IJZ A;  1L0C A;  1H8L A;  2V8D A;  4C7I A;  3OWC A;  2VL1 A;  1LAN A;  1CP7 A;  4AVA A;  1LFW A;  1AYE A;  2G3T A;  2I00 A;  4OID A;  3RZA A;  3LD2 A;  2AFM A;  2R98 A;  5HVF A;  2BSW A;  1R43 A;  2CNS A;  4CS0 B;  1UWY A;  2PCU A;  2C6C A;  5THW A;  1Z5R A;  2FL4 A;  2ZEE A;  4B12 A;  3IU1 A;  4MCP A;  1BOB A;  4NSQ A;  2C6P A;  3R9E A;  3FX6 A;  3K9U A;  1IID A;  4NGS A;  3TO7 A;  2OOT A;  2BCO A;  4YFJ A;  4EWT A;  3QNV A;  2WPW A;  2F8H A;  4NF1 A;  1Q7L A;  3FNC A;  4JJX A;  4OKO A;  1XE4 A;  4A2Z A;  4CAX A;  4PSW A;  4Z65 A;  5DWM A;  3P2F A;  1R3N A;  1ZLH A;  3QB8 A;  3KGQ A;  2Q44 A;  3EC4 A;  4CAE A;  2Q4V A;  3IGR A;  4CGO A;  4MHD A;  3FJU A;  5AG6 A;  4CPA A;  1NSL A;  4OC4 A;  2QEC A;  4C2X A;  3KHZ A;  5DWN A;  4KOU A;  2YND A;  4A39 A;  4O23 A;  1EE3 P;  1F2O A;  1IYK A;  3CPA A;  4UIB A;  3TX8 A;  4AG7 A;  4NCZ A;  3T9Y A;  1KUY A;  3D7H A;  2ZEP A;  2FXF A;  2FIA A;  2B3U A;  2I3C A;  1YX0 A;  2NMT A;  1Y0R A;  3IWW A;  4CRY B;  5JM6 A;  2PR8 A;  1ZG7 A;  7CPA A;  1VIX A;  4GS4 A;  5K8M A;  2PJ3 A;  3RNZ A;  3DSB A;  1KUX A;  1QMU A;  1VKC A;  1PUA A;  1CX8 A;  2GU2 A;  1ZG9 A;  2Q7B A;  3QAY A;  2B4D B;  3KZW A;  3SJX A;  1Z4E A;  3D7D A;  3FYN A;  3VAT A;  5HVG A;  2DF5 A;  2RB7 A;  2GLJ A;  3DNS A;  3FB3 A;  1U6M A;  5K8O A;  1M4L A;  3F8K A;  2R7H A;  4OC5 A;  3SI2 A;  2CIJ A;  3SJE A;  1WWZ A;  2AFZ A;  2REE A;  2Z3N A;  4UFV A;  2V8V A;  1NMT A;  1YW4 A;  1SQH A;  2B3V A;  4R8F A;  2JDC A;  1CG2 A;  3GY9 A;  3QAH A;  4CGN A;  4RS2 A;  3GLJ A;  5F49 A;  2OU2 A;  2ZEL A;  3EY5 A;  3L2N A;  4AVC A;  3S9L A;  2O4H A;  1XMT A;  3KHX A;  4RUH A;  4OAD A;  1TIQ A;  3S9M A;  3TCV A;  1Y7R A;  4E2A A;  2R1I A;  2YNE A;  3BXM A;  4MCQ A;  4PK2 A;  4R3L A;  5IB9 A;  3ZZI A;  4Q38 A;  2ZEF A;  4KOY A;  4HPS A;  1IB1 E;  4ONW A;  3D7G A;  3IFE A;  2BO9 A;  2G3A A;  2KCW A;  2VBQ A;  2FS5 A;  4PXD A;  5G21 A;  4BBH A;  2Z3P A;  3GYA A;  4MHP A;  3IO1 A;  4P4J A;  4ZBG A;  5AG4 A;  3BJ7 A;  1PCA A;  1YGH A;  5G1Z A;  4KVO E;  2AFS A;  5HVH A;  4C2Z A;  1VHS A;  2EK8 A;  2JBK A;  4IAV A;  1FNO A;  2P6G A;  3VAR A;  2Y0M A;  1S7L A;  4JZ0 A;  4KSF A;  3LWU A;  2FCK A;  4UEE A;  3SXO A;  4F0Y A;  2X7B A;  3EFA A;  1P0H A;  4E8O A;  4KOV A;  3I3G A;  5EMI A;  1KWM A;  4P4E A;  4MMO A;  5IX3 A;  2FVG A;  2YNC C;  3GB0 A;  1X10 A;  2O53 A;  3K2K A;  2A4N A;  4ZX9 A;  4CAV A;  4CGL A;  2I79 A;  4B13 A;  3PB9 X;  1CBX A;  3UY5 A;  4JLY A;  4MFQ A;  1S7N A;  1ELL P;  2IL4 A;  2NYQ A;  3HUV A;  4P4I A;  2ODF A;  3BI1 A;  2AJ6 A;  4BIN A;  1IY7 A;  4NGQ A;  2EWB A;  2NSM A;  3PFO A;  3ISZ A;  3I9S A;  4UCM A;  2PJ9 A;  2HQY A;  1OBR A;  4PSX A;  3D7F A;  4FBE A;  4PQA A;  4II9 A;  3PB8 X;  1ZO0 A;  1Q2D A;  2D4P A;  2EK9 A;  2J8N A;  4LQG A;  4UCN A;  2V77 A;  3NA6 A;  2PIZ A;  2ZEM A;  2OZU A;  3NE8 A;  3TT2 A;  5LYF A;  3DR8 A;  3H4Q A;  3JUW A;  5KTC A;  1BAV A;  4H6Z A;  1YSJ A;  1K4J A;  1IOF A;  1I21 A;  3R95 A;  1BPM A;  1R57 A;  3IIB A;  2EVN A;  3LOD A;  2ANP A;  2HC9 A;  1XFO A;  3B3T A;  2VXK A;  5HXD A;  4HNY B;  2PJC A;  2PJA A;  2PRB A;  4KUA A;  3TFY A;  2GLF A;  1TF8 A;  4OME A;  3H5Z A;  4AB7 A;  2G0B A;  4J3G A;  2DXQ A;  3D2P A;  3DDD A;  4MBU A;  3T90 A;  4ZX8 A;  2RFH A;  2PJ7 A;  2ZEH A;  5J8C A;  1YLE A;  1YLO A;  3FEE A;  4MY3 A;  2ZED A;  4B5P B;  2Q04 A;  6CPA A;  3KI9 A;  4MCS A;  4NGM A;  3R96 A;  1Q2C A;  5BWA B;  3IJ3 A;  3WC5 A;  2Q4Z A;  2Z3O A;  1LAM A;  5LYI A;  1V0C A;  3B2Y A;  3ISX A;  3KQX A;  3V38 A;  1X12 A;  4L89 A;  4MRI A;  3RBU A;  5G22 A;  3PB7 X;  1Z8X A;  1ZLI A;  3CXQ A;  1RTQ A;  4P45 A;  2DEA A;  1Y0Y A;  5HMN A;  4NGN A;  4ZY1 A;  4KVM E;  2RC4 A;  4ZY2 A;  1AUG A;  5CPA A;  1Z8T A;  4KS9 A;  5C88 A;  4CGP A;  5ISV A;  4C7H A;  2GFQ A;  2P0W A;  4IHM A;  4F0X A;  4DUK A;  1AMP A;  4NJQ A;  5C82 A;  4R87 A;  2QML A;  2VQY A;  3GIU A;  4U9Z A;  1LAP A;  1S5K A;  4RN7 A;  1Z8W A;  1XMB A;  4F9U A;  3ZJ0 A;  4FD7 A;  2WYR A;  3B3C A;  2CTB A;  4UCP A;  1XIX A;  2OH1 A;  1M4D A;  1HEE A;  4X2T A;  2XEG A;  3D8P A;  3MN8 A;  1IIC A;  4MHY A;  3I1U A;  1CM0 A;  1LRZ A;  2D4O A;  2Q51 A;  4QC6 A;  1A2Z A;  8CPA A;  1XOV A;  4UF4 A;  2IQ6 A;  4YWY A;  5AG5 A;  2PJ0 A;  4PXC A;  4M6I A;  3S6G A;  3FEC A;  3PRT A;  4DNC A;  4R7M A;  5F47 A;  1IU8 A;  3IEH A;  4P10 A;  4Q36 A;  4R76 A;  5HH1 A;  2AFX A;  3PB6 X;  4OC2 A;  5LYL A;  2P6E A;  1M1D A;  3SHP A;  5D8N A;  2P6F A;  1JWQ A;  3RAM A;  4KSA A;  4IUS A;  4B10 A;  1B87 A;  4CGM A;  2HUZ A;  1QSM A;  5LRG A;  2OZG A;  2J9A A;  4P4D A;  3NH8 A;  3TOB A;  3G8W A;  3PFE A;  1XJO A;  5GCN A;  3SXN A;  4EFD A;  1Y9K A;  5A28 A;  1YR0 A;  4MI4 A;  4R3K A;  1BLL E;  1Q2Y A;  3FVL A;  3W91 A;  1ELM P;  4Q7A A;  2Z10 A;  4OC3 A;  4GM5 A;  2JLM A;  4MJ8 A;  3IWG A;  4NEX A;  1YQE A;  2H5M A;  4NFR A;  3RYO A;  3SI1 A;  2FE7 A;  3FXT A;  1M4G A;  1GYT A;  1TKJ A;  2PQ8 A;  2YGW A;  2PVV A;  2ZW7 A;  4H89 A;  2GIV A;  2AE6 A;  2OR4 A;  2B5G A;  4IK2 A;  4CYN A;  1HDU A;  2J8M A;  2DPS A;  4NXY A;  3BJ8 A;  3KKW A;  2WUU A;  4A95 A;  4KOW A;  4M85 A;  2R8V A;  3KR4 A;  4BMH A;  4EME A;  1CPX A;  1XF8 A;  4A38 A;  2GRE A;  4FWU A;  3TO9 A;  2AFU A;  4E0A A;  1Z4R A;  2PJ5 A;  3H8F A;  3R9G A;  3K9T A;  1S60 A;  2REF A;  4NGT A;  3LMS A;  3B3W A;  4A30 A;  4A37 A;  3BHX A;  1FT7 A;  1TKF A;  4FD6 A;  2CF4 A;  1XEB A;  2CNM A;  3H8E A;  3RO0 A;  4JXR A;  2C1C A;  1RO5 A;  2VZY A;  2ZW5 A;  5H84 A;  5A27 A;  5ELY A;  4ONU A;  3D67 A;  1IOI A;  3NE7 A;  2DPT A;  3FRM A;  3V8I A;  1VHO A;  3H8G A;  4MCR A;  5JPH A;  2EO8 A;  5AG7 A;  3S6K A;  2JBJ A;  1FY7 A;  3FBU A;  4KVX A;  3D2M A;  2Q4Y A;  4NGR A;  2QYV A;  4B14 A;  3WAB A;  5F48 A;  2B4D A;  3LAC A;  4CAF A;  3V7Z A;  1S7K A;  4QVT A;  2QIR A;  3TTH A;  3WC6 A;  1IYL A;  3C26 A;  3P2H A;  4KZT A;  4FD4 A;  3D66 A;  2OB0 A;  3JTK A;  3NH4 A;  4K3N A;  4XPK A;  5EBV A;  2QJ8 A;  3D3S A;  2PE3 A;  4KUB A;  3FED A;  4UWJ A;  3KL9 A;  1HDQ A;  3FMC A;  2ARH A;  4QB9 A;  4UFX A;  4WWV A;  2AFW A;  2Q43 A;  4XPL A;  3W6X A;  3VWD A;  2CY2 A;  4KOR A;  4C68 A;  1LOK A;  3TOA A;  2B5G B;  4Y49 B;  4MFK A;  2PSW A;  2PRQ A;  4CRZ B;  4UEF A;  2ATR A;  1MJA A;  2J8R A;  5K8N A;  1Y9W A;  1ZG8 A;  3B3V A;  4KLV A;  1QSO A;  1MK4 A;  4PPZ A;  4HKF A;  4R57 A;  2ZEG A;  4CYQ A;  3IWE A;  2AFO A;  2ZXV A;  3TO6 A;  3FIX A;  2JEW A;  2PJB A;  4R9M A;  4X8I A;  5DS0 A;  4L8A A;  2XEI A;  2BL1 A;  1UFH A;  2BEI A;  4YGO A;  4UBR A;  4M6H A;  2Q0Y A;  4U5Y A;  1M44 A;  2CXA A;  2F5I A;  4MFP A;  5LYD A;  2V8G A;  4B11 A;  4ZGY B;  5IV0 A;  4W9Y A;  4XPD B;  4NJR A;  2PDO A;  2YNC A;  4MFZ A;  5J8F A;  4B6Z A;  1J4J A;  2VZZ A;  1M4I A;  2ZW6 A;  5F46 A;  2F7V A;  2VI7 A;  3IU2 A;  4JD6 A;  4KLW A;  4P44 A;  4UIA A;  3TC8 A;  5I0C A;  4FUU A;  5JH9 A;  2QVP A;  3HLP A;  4BD9 A;  4CAW A;  3PB4 X;  2JDD A;  2V8H A;  1NE9 A;  3IC1 A;  3NFZ A;  3N7Z A;  1XRY A;  4P4B A;  1RXT A;  4PV6 A;  4XNH C;  1LCP A;  5I4M A;  4C2Y A;  2WPX A;  2CTC A;  2G9D A;  4IF5 A;  3BI0 A;  5JGF A;  3GUX A;  4EVY A;  1KZF A;  4TNU A;  3D68 A;  1S7F A;  4XPD C; 
#chains in the Genus database with same CATH homology
 2B4B A;  4OAE A;  3R1K A;  2PR1 A;  4F6A A;  1YVO A;  1PU9 A;  4X5K A;  3VWE A;  5JQ4 A;  1OZP A;  2FIW A;  2Z3M A;  2PC1 A;  3DR6 A;  1P4N A;  3PGP A;  4XNH B;  4UWI A;  3JVN A;  3CXP A;  4HNW B;  2JEV A;  1I12 A;  2GAN A;  4FD5 A;  3F0A A;  1BO4 A;  4PK3 A;  1MJ9 A;  2C27 A;  4B5O A;  4KOS A;  1ON0 A;  3TE4 A;  2BUE A;  3EO4 A;  3G3S A;  3S6H A;  1N71 A;  4I49 A;  4AG9 A;  4MY0 A;  4B5P B;  4UFW A;  3EXN A;  1YVK A;  3PP9 A;  4HNX B;  5G20 A;  4QBJ A;  2ZPA A;  4MFL A;  1WK4 A;  1B6B A;  3A9L A;  3B8G A;  2O28 A;  2HV2 A;  2FT0 A;  2EUI A;  4B5P A;  3GKR A;  5CNP A;  4A33 A;  5H86 A;  4MFJ A;  4K30 A;  2VEZ A;  4RI1 A;  2WSA A;  2GE3 A;  4Y49 C;  4QUS A;  4JWP A;  2B58 A;  2OZH A;  4M3S A;  3PZJ A;  4CYO A;  1I1D A;  1MJB A;  4KOX A;  3WR7 A;  2Z11 A;  2Z3L A;  1QSN A;  3F5B A;  4U9Y A;  1YK3 A;  4A32 A;  4OLL A;  3S6F A;  2FSR A;  1KUV A;  3E0K A;  1Z9U A;  5AGE A;  4AVB A;  1GHE A;  4A31 A;  5KTD A;  2CNT A;  2Z3K A;  1YRE A;  1QST A;  3BLN A;  5EC4 A;  3CXS A;  2Z0Z A;  2K5T A;  4JXQ A;  5KTA A;  3MGD A;  4UA3 A;  4ORF A;  5IB0 A;  2ZW4 A;  1QSR A;  4H6U A;  5FVJ A;  3W6S A;  3R9F A;  1CJW A;  4LUA A;  4KOT A;  5E96 A;  1S3Z A;  4LX9 A;  1L0C A;  4C7I A;  3OWC A;  4AVA A;  2G3T A;  2I00 A;  3LD2 A;  2R98 A;  2BSW A;  2CNS A;  4CS0 B;  2FL4 A;  4B12 A;  3IU1 A;  1BOB A;  4NSQ A;  3R9E A;  3TO7 A;  3K9U A;  1IID A;  4YFJ A;  2WPW A;  4NF1 A;  3FNC A;  4JJX A;  4CAX A;  1XE4 A;  4A2Z A;  4PSW A;  5DWM A;  3P2F A;  3QB8 A;  2Q44 A;  3EC4 A;  4CAE A;  2Q4V A;  3IGR A;  4CGO A;  4MHD A;  5AG6 A;  1NSL A;  2QEC A;  4C2X A;  5DWN A;  4KOU A;  2YND A;  1IYK A;  4AG7 A;  4NCZ A;  3T9Y A;  1KUY A;  2FXF A;  2FIA A;  2B3U A;  1YX0 A;  2NMT A;  4CRY B;  2PR8 A;  4GS4 A;  3DSB A;  1KUX A;  1VKC A;  1PUA A;  2Q7B A;  2B4D B;  1Z4E A;  3FYN A;  3DNS A;  3FB3 A;  1U6M A;  3F8K A;  2R7H A;  1WWZ A;  2REE A;  2Z3N A;  4UFV A;  1NMT A;  2B3V A;  1SQH A;  4CGN A;  2JDC A;  3GY9 A;  3QAH A;  4RS2 A;  5F49 A;  2OU2 A;  3EY5 A;  4AVC A;  1XMT A;  4OAD A;  1TIQ A;  3TCV A;  1Y7R A;  4E2A A;  2R1I A;  2YNE A;  4PK2 A;  4R3L A;  3ZZI A;  4Q38 A;  4KOY A;  1IB1 E;  2G3A A;  2KCW A;  2VBQ A;  2FS5 A;  5G21 A;  4BBH A;  2Z3P A;  3GYA A;  4ZBG A;  5AG4 A;  3BJ7 A;  1YGH A;  5G1Z A;  4KVO E;  4C2Z A;  1VHS A;  2P6G A;  2Y0M A;  1S7L A;  4KSF A;  3SXO A;  2FCK A;  4F0Y A;  2X7B A;  3EFA A;  1P0H A;  4E8O A;  4KOV A;  3I3G A;  5IX3 A;  2YNC C;  2A4N A;  4CAV A;  4CGL A;  2I79 A;  4B13 A;  3UY5 A;  4JLY A;  4MFQ A;  1S7N A;  2IL4 A;  2AJ6 A;  3I9S A;  4UCM A;  2HQY A;  4PSX A;  4II9 A;  1ZO0 A;  1Q2D A;  2D4P A;  2J8N A;  4UCN A;  3TT2 A;  2OZU A;  3DR8 A;  3H4Q A;  3JUW A;  5KTC A;  4H6Z A;  3R95 A;  1K4J A;  1I21 A;  1R57 A;  2EVN A;  3LOD A;  2VXK A;  3TFY A;  4HNY B;  2PRB A;  4KUA A;  3H5Z A;  4AB7 A;  2G0B A;  4J3G A;  2DXQ A;  3D2P A;  3DDD A;  4MBU A;  3T90 A;  5J8C A;  1YLE A;  4MY3 A;  2Q04 A;  3R96 A;  1Q2C A;  5BWA B;  2Z3O A;  1V0C A;  4L89 A;  5G22 A;  3CXQ A;  5HMN A;  4KVM E;  2RC4 A;  4KS9 A;  5C88 A;  4CGP A;  5ISV A;  4C7H A;  2P0W A;  4F0X A;  5C82 A;  4R87 A;  2QML A;  2VQY A;  4U9Z A;  1S5K A;  3ZJ0 A;  4FD7 A;  4UCP A;  1XIX A;  2OH1 A;  1M4D A;  3D8P A;  1IIC A;  1CM0 A;  1LRZ A;  2D4O A;  4QC6 A;  5AG5 A;  3S6G A;  4DNC A;  5F47 A;  4Q36 A;  5HH1 A;  2P6E A;  1M1D A;  3SHP A;  2P6F A;  4KSA A;  4IUS A;  4B10 A;  1B87 A;  4CGM A;  2HUZ A;  1QSM A;  2OZG A;  3TOB A;  3G8W A;  5GCN A;  3SXN A;  1Y9K A;  5A28 A;  1YR0 A;  4MI4 A;  4R3K A;  1Q2Y A;  3W91 A;  2Z10 A;  4NEX A;  2JLM A;  4MJ8 A;  3IWG A;  5A27 A;  2H5M A;  3RYO A;  2FE7 A;  3FXT A;  1M4G A;  2PQ8 A;  2YGW A;  2ZW7 A;  4H89 A;  2GIV A;  2AE6 A;  2B5G A;  4CYN A;  2J8M A;  2DPS A;  4NXY A;  3BJ8 A;  3KKW A;  2WUU A;  4A95 A;  4KOW A;  4M85 A;  2R8V A;  4BMH A;  1XF8 A;  3TO9 A;  4E0A A;  1Z4R A;  3R9G A;  1S60 A;  2REF A;  4A30 A;  4FD6 A;  1XEB A;  2CNM A;  4JXR A;  1RO5 A;  2VZY A;  2ZW5 A;  5H84 A;  4ONU A;  3NE7 A;  2DPT A;  3FRM A;  3V8I A;  5JPH A;  5AG7 A;  3S6K A;  1FY7 A;  3FBU A;  4KVX A;  3D2M A;  2Q4Y A;  4B14 A;  5F48 A;  2B4D A;  4CAF A;  1S7K A;  4QVT A;  2QIR A;  3TTH A;  1IYL A;  3C26 A;  3P2H A;  4KZT A;  4FD4 A;  2OB0 A;  3JTK A;  4XPK A;  5EBV A;  3D3S A;  4KUB A;  4UWJ A;  4YRH A;  4CYP A;  4QB9 A;  2ARH A;  4UFX A;  4XPL A;  3W6X A;  3VWD A;  2CY2 A;  4KOR A;  4C68 A;  3TOA A;  2B5G B;  4Y49 B;  4MFK A;  2PSW A;  4CRZ B;  2ATR A;  1MJA A;  2J8R A;  1Y9W A;  4KLV A;  1QSO A;  1MK4 A;  4HKF A;  4R57 A;  4CYQ A;  3IWE A;  2ZXV A;  3TO6 A;  3FIX A;  4R9M A;  4L8A A;  2BL1 A;  1UFH A;  2BEI A;  4YGO A;  4UBR A;  2Q0Y A;  4U5Y A;  1M44 A;  2CXA A;  2F5I A;  4MFP A;  4B11 A;  4ZGY B;  5IV0 A;  4XPD B;  2PDO A;  2YNC A;  4MFZ A;  5J8F A;  1J4J A;  2VZZ A;  1M4I A;  2ZW6 A;  5F46 A;  2VI7 A;  3IU2 A;  4JD6 A;  4KLW A;  5I0C A;  4CAW A;  2JDD A;  1NE9 A;  3N7Z A;  1RXT A;  4PV6 A;  4XNH C;  4C2Y A;  2WPX A;  4IF5 A;  4EVY A;  1KZF A;  1S7F A;  4XPD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...