4A94A

Structure of the carboxypeptidase inhibitor from nerita versicolor in complex with human cpa4
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
302
structure length
302
Chain Sequence
b'FNYGAYHSLEAIYHEMDNIAADFPDLARRVKIGHSFENRPMYVLKFSTGKGVRRPAVWLNAGIHSREWISQATAIWTARKIVSDYQRDPAITSILEKMDIFLLPVANPDGYVYTQTQNRLWRKTRSRNPGSSCIGADPNRNWNASFAGKGASDNPCSEVYHGPHANSEVEVKSVVDFIQKHGNFKGFIDLHSYSQLLMYPYGYSVKKAPDAEELDKVARLAAKALASVSGTEYQVGPTCTTVYPASGSSIDWAYDNGIKFAFTFELRDTGTYGFLLPANQIIPTAEETWLGLKTIMEHVRDN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBOXYPEPTIDASE A4
publication title Crystal Structure of a Novel Metallo-Carboxypeptidase Inhibitor from the Marine Mollusk Nerita Versicolor in Complex with Human Carboxypeptidase A4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 111
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.4.17.-:
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4a94A00
3FF3A 4MHNA 3PB7X 2BCOA 2CF4A 3GUXA 3IC1A 6CPAA 4OC2A 1YLOA 3I1UA 3ISXA 3IJ3A 2I3CA 3FEEA 2ABZA 2RFHA 2ZOFA 1TXRA 5J1QA 1TF9A 1LAMA 4PXBA 4OIDA 3V7ZA 3NFZA 4P4DA 3WC6A 2ZEGA 5ELYA 3B3TA 1TKHA 3SJFA 1TKFA 3B3CA 4NGMA 4PPZA 1Z2LA 1BPMA 4OC4A 5K8PA 4DYOA 4MCQA 2ZEPA 3D7DA 4DUKA 1XMBA 1F2PA 3FECA 2ZEFA 4UIBA 2PJ1A 1RTQA 5LRKA 2PJ3A 3JRUA 4P4JA 1Y0YA 2F8HA 2NSMA 4H2KA 4NJQA 1UWYA 2CTBA 2O4HA 5LRJA 3TX8A 4EMEA 4P45A 1IGBA 2AFUA 4P4BA 1CX8A 2PJ6A 5LYLA 3RZAA 5F09A 1JQGA 2PVWA 3FJUA 1Y7EA 2PJ8A 2HC9A 2XEFA 3FMCA 1LAPA 2J9AA 3SI0A 2V77A 1ZG9A 4JZ0A 5K8MA 2JEWA 3WC5A 1LANA 2AFXA 1R3NA 3S9LA 4R6TA 5HVGA 3S9MA 2AFSA 4ONWA 3KZWA 2OOTA 1LOKA 4R8FA 4F8ZA 4PXEA 1Q7LA 4W9YA 3VH9A 3D7FA 3MN8A 3WABA 4OC3A 3B35A 1DE4C 4A94A 1CBXA 4MCPA 2Q4ZA 4P4IA 2CIJA 2PJCA 4F9UA 1EE3P 3KHZA 4MHPA 1ELMP 3NA6A 3SJGA 3SJEA 5HVFA 3VARA 3PB6X 3D7HA 1YMEA 3NH8A 5I4MA 4G1PA 4P4EA 4X3RA 3KR4A 4RUHA 4WWVA 4ZI6A 4P4FA 4NGTA 2PJAA 2ZEOA 4FUUA 2PIZA 3FX6A 5K8OA 3IWWA 2GREA 3D7GA 4R76A 2XEJA 4UEEA 5CBMA 4ZY0A 4CPAA 3T8WA 2IJZA 2NYQA 1IY7A 3GB0A 3WT4A 4OKOA 3B3VA 3S9NA 3H8GA 4NGQA 5DS0A 2V8DA 5LYDA 4FAIA 3CDXA 1Y0RA 3PB8X 2PVVA 4NFRA 2PJ9A 2BOAA 4PQAA 4EFDA 4FBEA 4B6ZA 4P6YA 1VIXA 2WZNA 1M4LA 3N5FA 4X8IA 5JH9A 3B7IA 2GLJA 2AFOA 2Q43A 3PBEA 2ZEEA 3RAMA 1ELLP 2PJ7A 1DTDA 1XBUA 4OMEA 2XEGA 4Z65A 4ZX9A 3D4UA 2C6PA 1QQ9A 2IMOA 1ARMA 1F2OA 2V8VA 4A38A 4O23A 1PYTB 4TNUA 1XJOA 4WJBA 1AMPA 4OC5A 3B3WA 3LMSA 4LQGA 2CTCA 3B2YA 4MCRA 1LCPA 2OR4A 5LYIA 4AXVA 4ZY2A 4F9VA 2C6GA 2WYRA 4NJRA 4UIAA 5D29A 3IFEA 5JGFA 4YWYA 3RBUA 2PE3A 3D66A 1HEEA 4IAVA 2FVGA 4MCSA 4UF4A 1TF8A 1LFWA 3BI0A 3K9TA 3ISZA 1VGYA 4Q7AA 1Z5RA 2ZELA 4KSIA 2PJBA 3KASA 5HXDA 3SI2A 3PB4X 3BXMA 3KGQA 4OC1A 4MMOA 3QNVA 1BLLE 2PCUA 3K2KA 2JBJA 1PCAA 2PJ2A 4NGPA 2F7VA 2BO9A 4R7MA 1BAVA 4A39A 2QJ8A 3PB9X 2ZEMA 2PJ4A 1ZG8A 3V38A 4DJLA 3CPXA 3NH5A 4FWUA 2O53A 3DLJA 4EWTA 2ANPA 4IK2A 1FNOA 2AFWA 4OC0A 2GU2A 5D8NA 3PFOA 1Z8LA 4YU9A 4IHMA 5THWA 4ZYQA 2IQ6A 1R43A 1CPXA 2ZENA 1FT7A 2RB7A 2GLFA 3D67A 4PXDA 1YW4A 2JBKA 3KL9A 5LYFA 3KQXA 2C6CA 3FH4A 3IEHA 4K3NA 2Q51A 1YW6A 1HDQA 8CPAA 2POKA 4UEZA 3CPAA 1BPNA 3IO1A 1H8LA 4GM5A 1VHOA 1ZLIA 4ZX8A 4OP4A 5IB9A 1KWMA 1TKJA 3KQZA 4OIWA 4P10A 5CPAA 2AFMA 2AFZA 4A37A 1CP6A 3VATA 1AYEA 3IIBA 1OBRA 2VL1A 4BD9A 4MHYA 2QVPA 2EWBA 3PBBA 3CT9A 3BI1A 3L2NA 3FVLA 3NH4A 1XFOA 5JM6A 2V8GA 2EK8A 3GLJA 2G9DA 4P44A 3KHXA 3BHXA 3D68A 2QYVA 2EK9A 1ZG7A 2PIYA 2DEAA 3PFEA 1ZLHA 3PEIA 3HUVA 2ZEDA 3LWUA 1ARLA 5K8NA 1CPSA 4MRIA 3SI1A 1HDUA 1QMUA 5HVHA 1CG2A 1XRYA 4NGNA 3MRUA 3SJXA 4ZY1A 3H8EA 3B3SA 1VHEA 5LRGA 1YSJA 2C1CA 4TWEA 7CPAA 4PXCA 2V8HA 2ZEHA 2PRQA 3WC7A 4X2TA 3TC8A 2XEIA 2PJ5A 2ZOGA 2HB6A 4JYWA 1GYTA 4NGRA 4NGSA 1NSAA 4MHZA 3H8FA 1F57A 1CP7A 3KR5A 3HLPA 4MXUA 4UEFA 3FEDA 3KI9A 3DGVA 3PRTA 2PJ0A
chains in the Genus database with same CATH superfamily
2ATRA 2KCWA 3FF3A 1P0HA 3PB7X 2BCOA 2CF4A 4MHNA 5JPHA 3GUXA 3IC1A 4UWIA 5IV0A 6CPAA 2EUIA 4OC2A 4C2ZA 1YLOA 3I1UA 5AGEA 3ISXA 4B5PA 4R87A 3IJ3A 1MJBA 4MFLA 5KTCA 2I3CA 3FEEA 5HMNA 2ABZA 2RFHA 4AG9A 2B5GB 2ZOFA 2ZW6A 1TXRA 5J1QA 4BINA 4A31A 1TF9A 5F47A 1LAMA 4PXBA 4BMHA 4OIDA 1M4IA 3V7ZA 3NFZA 4NCZA 4P4DA 3WC6A 2ZEGA 2CXAA 5ELYA 1I21A 3TE4A 2REFA 1Z8XA 4QB9A 4U5YA 3B3TA 4MJ8A 1TKHA 4Q38A 1YX0A 1I12A 3SJFA 1TKFA 4PK3A 1CJWA 3B3CA 4NGMA 4OLLA 3QB8A 3S6FA 3CXQA 4PPZA 1Z2LA 1BPMA 4OC4A 5K8PA 2BUEA 4XPDB 4DYOA 3R9GA 1XMTA 4MCQA 2ZEPA 3G3SA 1YGHA 4MFJA 3D7DA 4DUKA 1XMBA 1F2PA 2FXFA 3FECA 2ZEFA 4UIBA 2PJ1A 3T90A 4KUBA 1RTQA 5LRKA 2ODFA 2Q7SA 4KSFA 2Z3LA 2FL4A 3CZXA 2PJ3A 3IU2A 3JRUA 4H89A 4P4JA 4KOVA 3FRMA 3LACA 4HNYB 1Y0YA 3OWCA 2B4DB 2F8HA 4MFZA 3N7ZA 2NSMA 4H2KA 4NJQA 1UWYA 2CTBA 1S7LA 2O4HA 2VEZA 5LRJA 3TX8A 4QC6A 4UCPA 4B13A 4EMEA 4KSAA 4P45A 1IGBA 2AFUA 2Z11A 5LYFA 4P4BA 3EC4A 3ZZIA 3VWEA 1CX8A 2YNCA 2PJ6A 5H84A 5LYLA 3RZAA 5F09A 1JQGA 2PVWA 2P0WA 3FJUA 4KVOE 1Y7EA 2PJ8A 2HC9A 2R1IA 2XEFA 3FMCA 1LAPA 1IYKA 4CAEA 1ON0A 2PSWA 2NMTA 1S7KA 4XPDC 1Q2YA 2J9AA 4F6AA 3SI0A 1Q2DA 1K4JA 2BL1A 4KUAA 2V77A 4ORFA 1ZG9A 2JLMA 1M4GA 2Z0ZA 4FD5A 4AVCA 5A28A 4JZ0A 1Z4EA 3T9YA 5K8MA 2JEWA 2B58A 4OADA 2JEVA 3WC5A 1LANA 2AFXA 2BSWA 1R3NA 2YNEA 4B5OA 3S9LA 2Q04A 4R6TA 1XOVA 3S9MA 4H6UA 5HVGA 4JXRA 1KUYA 2AFSA 3FB3A 4ONWA 4FD7A 3KZWA 1NMTA 2OZUA 4RI1A 2OOTA 1PU9A 2K5TA 2YNCC 1LOKA 4LUAA 2ZW4A 4R8FA 2Q4YA 3R96A 4F8ZA 4ONUA 1YR0A 1QSOA 4PXEA 3B8GA 1Q7LA 4W9YA 4UCMA 4HNWB 3D7FA 3EO4A 3VH9A 5ISVA 3GYAA 3MN8A 2FT0A 5AG4A 1YQEA 2FE7A 3WABA 1YVOA 4OC3A 2HV2A 4LQ6A 3B35A 1NSLA 4F0XA 1FY7A 2G3AA 2Q0YA 1DE4C 3R9FA 4A94A 1CBXA 4MCPA 2Q4ZA 2Z3NA 4P4IA 3FIXA 2VZYA 4AG7A 4Q36A 2CIJA 2PJCA 4F9UA 3WR7A 1EE3P 4CAWA 2FIWA 1J4JA 1YREA 2FCKA 3KHZA 4HKFA 1ELMP 4MHPA 4A95A 2BEIA 3I9SA 3NA6A 4FD6A 3SJGA 2X7BA 3EFAA 3RNZA 3SJEA 2Y0MA 1B6BA 5HVFA 5F48A 2Q7BA 3VARA 3PB6X 2R98A 4MBUA 4PV6A 2VBQA 4CYOA 3D7HA 2P6GA 2D4OA 1YMEA 3NH8A 5I4MA 4G1PA 4P4EA 4X3RA 3KR4A 2P6EA 4RUHA 3F5BA 1QSRA 4WWVA 4ZI6A 4P4FA 4NGTA 4QUSA 3IWEA 5G21A 4DNCA 5E96A 4C7IA 2PJAA 3DDDA 3PGPA 1YK3A 2WPXA 2ZEOA 4CRYB 4FUUA 4M6IA 2PIZA 3D2PA 3FX6A 5K8OA 2Z10A 3IWWA 3DNSA 2GREA 3D7GA 4R76A 2XEJA 4UEEA 4RS2A 5CBMA 4ZY0A 4CPAA 3T8WA 1X10A 2B5GA 2IJZA 1MJAA 2NYQA 4QBJA 1IY7A 3GB0A 4UFVA 3WT4A 4OKOA 1N71A 3B3VA 2DF5A 3K9UA 3S9NA 3H8GA 4NGQA 4KORA 5DS0A 4XNHB 1MK4A 2V8DA 5LYDA 4FAIA 3TOAA 4YGOA 1B87A 2J8NA 1XE4A 2QMLA 3CDXA 4MFQA 1Y0RA 1YLEA 2FSRA 4KVXA 2DPSA 3IWGA 5DWNA 3PB8X 2PVVA 4NFRA 2PJ9A 1Z8TA 2BOAA 2VI7A 4PQAA 4EFDA 4FBEA 4B6ZA 4JXQA 3GKRA 2B3UA 4P6YA 1VIXA 2WZNA 1M4LA 3N5FA 4X8IA 5JH9A 3JUWA 2IL4A 2CY2A 3F0AA 4H6ZA 1XEBA 3B7IA 2GLJA 2ZW5A 3W6SA 2AFOA 2Q43A 4OAEA 3PBEA 2ZEEA 3RAMA 1ELLP 2PJ7A 1DTDA 1XBUA 3CXSA 4OMEA 1QSNA 5KTDA 4B14A 2XEGA 4Z65A 4U9ZA 4ZX9A 2B4DA 3D4UA 2C6PA 1QQ9A 2PC1A 4I49A 4AVBA 3IGRA 2IMOA 1ARMA 1F2OA 2V8VA 4A38A 2Q4VA 1PYTB 4O23A 4TNUA 1XJOA 5KTAA 1Z9UA 2WUUA 4RN7A 4L89A 3W6XA 5EMIA 3QAHA 4WJBA 1AMPA 4U9YA 4OC5A 5BWAB 5C82A 4C68A 4XNHC 3V8IA 1NE9A 3B3WA 3LMSA 4CGPA 2GANA 4Y49B 4LQGA 4CYPA 4CYNA 1I1DA 1WK4A 2CTCA 3NE8A 3B2YA 3DR6A 5I0CA 4MCRA 4KZTA 4FD4A 1LCPA 4QVTA 1SQHA 2A4NA 2OR4A 5HH1A 4PSXA 1WWZA 5LYIA 3S6GA 3TCVA 4NF1A 4AXVA 4KOWA 4CGNA 4K30A 3BJ8A 2HUZA 4UCNA 4ZY2A 1R57A 2C6GA 2WYRA 4F9VA 5A27A 2Z3PA 4NJRA 5G1ZA 1IIDA 1KZFA 4UIAA 5D29A 4JLYA 4M85A 4KLWA 3IFEA 4KLVA 4M6GA 2EBJA 5JGFA 4YWYA 2B4BA 3RBUA 2PE3A 3D66A 2VQYA 4A30A 1HEEA 1IOIA 2F5IA 4IAVA 2FVGA 3LD2A 1QSMA 4KOXA 4IF5A 4MCSA 2OZHA 4R9MA 4UF4A 2DXQA 1TF8A 3F8KA 1V0CA 5GCNA 3SXOA 1LFWA 3BI0A 3K9TA 1IU8A 3DR8A 3ISZA 2CNSA 3TTHA 4XPLA 2B3VA 4KOTA 1M4DA 1VGYA 2J8RA 3BLNA 1Z5RA 4Q7AA 4E8OA 4E0AA 2ZELA 5J8CA 4KSIA 2PJBA 3KASA 3GIUA 5HXDA 3SI2A 4R3KA 4EVYA 3PB4X 1KUXA 3P2FA 3W91A 3BXMA 5IX3A 4II9A 2AJ6A 3KGQA 1YVKA 3TO6A 4CGLA 1Y9KA 1M44A 4MMOA 4OC1A 1IYLA 1IICA 3P2HA 3QNVA 1BLLE 2PCUA 3K2KA 1CM0A 2JBJA 1PCAA 1MJ9A 2Z3KA 5AG7A 5DWMA 4R57A 4MY3A 2PJ2A 3R9EA 3I3GA 2EVNA 4NGPA 1BOBA 2F7VA 2PR8A 2BO9A 4NSQA 4R7MA 2C27A 1BAVA 5FVJA 1TIQA 1L0CA 3FXTA 2PR1A 4A39A 2QJ8A 3PB9X 4KOYA 4MFPA 2WSAA 3FNCA 4GXHA 4C7HA 2ZEMA 2I00A 2PJ4A 1ZG8A 1GHEA 1S60A 2ZXVA 5CNPA 3V38A 1S5KA 4PK2A 2YNDA 1XIXA 1VHSA 4B5PB 3IU1A 2ARHA 4DJLA 3CPXA 3JTKA 3EY5A 3NH5A 2Q44A 4UBRA 4FWUA 2O53A 3DLJA 2Z3OA 3E0KA 4EWTA 4AVAA 2ANPA 4IK2A 2Z3MA 1FNOA 2AFWA 4OC0A 2GU2A 2H5MA 5D8NA 5JQ4A 3PFOA 1Z8LA 4YU9A 3UY5A 4IHMA 2R8VA 5EBVA 1Q2CA 5THWA 4ZYQA 5F49A 2IQ6A 1R43A 1CPXA 2ZENA 3VWDA 1FT7A 2RB7A 2GLFA 3D67A 4JWPA 4PXDA 4CGMA 1YW4A 2JBKA 2OZGA 4CAXA 2FS5A 3KL9A 3SHPA 3KQXA 1OZPA 2QIRA 2C6CA 1LRZA 4B12A 3FH4A 3IEHA 5IB0A 4K3NA 4MI4A 2Q51A 2OB0A 3D8PA 1YW6A 1HDQA 8CPAA 1AUGA 4KVME 3FBUA 2POKA 4UEZA 3CPAA 1BPNA 3IO1A 1IB1E 1H8LA 4GM5A 1VHOA 4MFKA 5G22A 1ZLIA 4ZX8A 2G3TA 4JJXA 1U6MA 2D4PA 2GE3A 2VZZA 4OP4A 4CAFA 5IB9A 3KI9A 1KWMA 4PSWA 1TKJA 2G0BA 4CRZB 1IOFA 3KQZA 4OIWA 4CGOA 3GY9A 4BBHA 4P10A 5CPAA 2AFMA 3TO7A 2AFZA 4UWJA 4XPKA 4A37A 4KS9A 1CP6A 2O28A 3VATA 2R7HA 1AYEA 4AB7A 3IIBA 1OBRA 4A32A 4HNXB 2VL1A 2ZW7A 1PUAA 3PP9A 1JWQA 4MHDA 5F46A 4BD9A 4MHYA 2QVPA 2EWBA 2ZPAA 3PBBA 3H5ZA 1XF8A 3CT9A 3TFYA 2I79A 3C26A 3BI1A 3G8WA 4KOSA 3L2NA 2AE6A 2HQYA 3TT2A 3FVLA 3RO0A 4HPSA 3NH4A 1XFOA 5J8FA 2V8GA 2EK8A 2OU2A 2G9DA 3GLJA 4P44A 5JM6A 3KHXA 3BHXA 4M3SA 5EC4A 3JVNA 2DPTA 3D68A 3ZJ0A 2QYVA 4C2XA 1A2ZA 2EK9A 3SXNA 4B11A 1ZG7A 2PRBA 2WPWA 5G20A 3R95A 3TO9A 5AG5A 3TOBA 1X12A 2PIYA 2JDDA 2REEA 4B10A 2DEAA 2PQ8A 3PFEA 4A33A 1ZLHA 2P6FA 2CNTA 4NEXA 3PEIA 4R3LA 3HUVA 3RYOA 5C88A 2YGWA 2ZEDA 1KUVA 2GIVA 3LWUA 2PDOA 1ARLA 4KOUA 1CPSA 5K8NA 1M1DA 4CAVA 4MRIA 3SI1A 3EXNA 1HDUA 1QMUA 2JDCA 5HVHA 1CG2A 1XRYA 4NGNA 2RC4A 2GFQA 2VXKA 1Z8WA 3MRUA 4A2ZA 1BO4A 3SJXA 4ZY1A 3DSBA 3MGDA 3PZJA 3H8EA 1S7FA 1VHEA 3B3SA 5LRGA 1Y9WA 4C2YA 1YSJA 4Y49C 5H86A 4L8AA 2C1CA 4LX9A 4NXYA 2OH1A 4TWEA 7CPAA 1VKCA 4JD6A 4PXCA 2V8HA 2ZEHA 3D3SA 4IUSA 4F0YA 3KKWA 2PRQA 3BJ7A 4M6HA 4UFXA 3WC7A 4X2TA 1RXTA 2EO8A 2FIAA 3LODA 2CNMA 3QAYA 4YFJA 3NE7A 3A9LA 3TC8A 2XEIA 1Z4RA 3R1KA 1P4NA 1S3ZA 4J3GA 4ZBGA 4CS0B 5AG6A 4GS4A 4UA3A 2PJ5A 4UFWA 1QSTA 2ZOGA 3S6HA 3FYNA 1UFHA 4CYQA 2HB6A 4JYWA 1GYTA 4NGRA 4NGSA 1RO5A 4YRHA 1NSAA 4MY0A 4ZGYB 1ZO0A 4MHZA 1Y7RA 3H8FA 3CXPA 1F57A 4E2AA 2QECA 1CP7A 3D2MA 4X5KA 3KR5A 3HLPA 3S6KA 4MXUA 2J8MA 3FEDA 1S7NA 3DGVA 3PRTA 3H4QA 4UEFA 2PJ0A
chains in the Genus database with same CATH topology
3FF3A 4MHNA 3PB7X 2BCOA 2CF4A 3GUXA 3IC1A 6CPAA 4OC2A 1YLOA 3I1UA 3ISXA 3IJ3A 2I3CA 3FEEA 2ABZA 2RFHA 2ZOFA 1TXRA 5J1QA 1TF9A 1LAMA 4PXBA 4OIDA 3V7ZA 3NFZA 4P4DA 3WC6A 2ZEGA 5ELYA 3B3TA 1TKHA 3SJFA 1TKFA 3B3CA 4NGMA 4PPZA 1Z2LA 1BPMA 4OC4A 5K8PA 4DYOA 4MCQA 2ZEPA 3D7DA 4DUKA 1XMBA 1F2PA 3FECA 2ZEFA 4UIBA 2PJ1A 1RTQA 5LRKA 2PJ3A 3JRUA 4P4JA 1Y0YA 2F8HA 2NSMA 4H2KA 4NJQA 1UWYA 2CTBA 2O4HA 5LRJA 3TX8A 4EMEA 4P45A 1IGBA 2AFUA 4P4BA 1CX8A 2PJ6A 5LYLA 3RZAA 5F09A 1JQGA 2PVWA 3FJUA 1Y7EA 2PJ8A 2HC9A 2XEFA 3FMCA 1LAPA 2J9AA 3SI0A 2V77A 1ZG9A 4JZ0A 5K8MA 2JEWA 3WC5A 1LANA 2AFXA 1R3NA 3S9LA 4R6TA 5HVGA 3S9MA 2AFSA 4ONWA 3KZWA 2OOTA 1LOKA 4R8FA 4F8ZA 4PXEA 1Q7LA 4W9YA 3VH9A 3D7FA 3MN8A 3WABA 4OC3A 3B35A 1DE4C 4A94A 1CBXA 4MCPA 2Q4ZA 4P4IA 2CIJA 2PJCA 4F9UA 1EE3P 3KHZA 4MHPA 1ELMP 3NA6A 3SJGA 3SJEA 5HVFA 3VARA 3PB6X 3D7HA 1YMEA 3NH8A 5I4MA 4G1PA 4P4EA 4X3RA 3KR4A 4RUHA 4WWVA 4ZI6A 4P4FA 4NGTA 2PJAA 2ZEOA 4FUUA 2PIZA 3FX6A 5K8OA 3IWWA 2GREA 3D7GA 4R76A 2XEJA 4UEEA 5CBMA 4ZY0A 4CPAA 3T8WA 2IJZA 2NYQA 1IY7A 3GB0A 3WT4A 4OKOA 3B3VA 3S9NA 3H8GA 4NGQA 5DS0A 2V8DA 5LYDA 4FAIA 3CDXA 1Y0RA 3PB8X 2PVVA 4NFRA 2PJ9A 2BOAA 4PQAA 4EFDA 4FBEA 4B6ZA 4P6YA 1VIXA 2WZNA 1M4LA 3N5FA 4X8IA 5JH9A 3B7IA 2GLJA 2AFOA 2Q43A 3PBEA 2ZEEA 3RAMA 1ELLP 2PJ7A 1DTDA 1XBUA 4OMEA 2XEGA 4Z65A 4ZX9A 3D4UA 2C6PA 1QQ9A 2IMOA 1ARMA 1F2OA 2V8VA 4A38A 4O23A 1PYTB 4TNUA 1XJOA 4WJBA 1AMPA 4OC5A 3B3WA 3LMSA 4LQGA 2CTCA 3B2YA 4MCRA 1LCPA 2OR4A 5LYIA 4AXVA 4ZY2A 4F9VA 2C6GA 2WYRA 4NJRA 4UIAA 5D29A 3IFEA 5JGFA 4YWYA 3RBUA 2PE3A 3D66A 1HEEA 4IAVA 2FVGA 4MCSA 4UF4A 1TF8A 1LFWA 3BI0A 3K9TA 3ISZA 1VGYA 4Q7AA 1Z5RA 2ZELA 4KSIA 2PJBA 3KASA 5HXDA 3SI2A 3PB4X 3BXMA 3KGQA 4OC1A 4MMOA 3QNVA 1BLLE 2PCUA 3K2KA 2JBJA 1PCAA 2PJ2A 4NGPA 2F7VA 2BO9A 4R7MA 1BAVA 4A39A 2QJ8A 3PB9X 2ZEMA 2PJ4A 1ZG8A 3V38A 4DJLA 3CPXA 3NH5A 4FWUA 2O53A 3DLJA 4EWTA 2ANPA 4IK2A 1FNOA 2AFWA 4OC0A 2GU2A 5D8NA 3PFOA 1Z8LA 4YU9A 4IHMA 5THWA 4ZYQA 2IQ6A 1R43A 1CPXA 2ZENA 1FT7A 2RB7A 2GLFA 3D67A 4PXDA 1YW4A 2JBKA 3KL9A 5LYFA 3KQXA 2C6CA 3FH4A 3IEHA 4K3NA 2Q51A 1YW6A 1HDQA 8CPAA 2POKA 4UEZA 3CPAA 1BPNA 3IO1A 1H8LA 4GM5A 1VHOA 1ZLIA 4ZX8A 4OP4A 5IB9A 1KWMA 1TKJA 3KQZA 4OIWA 4P10A 5CPAA 2AFMA 2AFZA 4A37A 1CP6A 3VATA 1AYEA 3IIBA 1OBRA 2VL1A 4BD9A 4MHYA 2QVPA 2EWBA 3PBBA 3CT9A 3BI1A 3L2NA 3FVLA 3NH4A 1XFOA 5JM6A 2V8GA 2EK8A 3GLJA 2G9DA 4P44A 3KHXA 3BHXA 3D68A 2QYVA 2EK9A 1ZG7A 2PIYA 2DEAA 3PFEA 1ZLHA 3PEIA 3HUVA 2ZEDA 3LWUA 1ARLA 5K8NA 1CPSA 4MRIA 3SI1A 1HDUA 1QMUA 5HVHA 1CG2A 1XRYA 4NGNA 3MRUA 3SJXA 4ZY1A 3H8EA 3B3SA 1VHEA 5LRGA 1YSJA 2C1CA 4TWEA 7CPAA 4PXCA 2V8HA 2ZEHA 2PRQA 3WC7A 4X2TA 3TC8A 2XEIA 2PJ5A 2ZOGA 2HB6A 4JYWA 1GYTA 4NGRA 4NGSA 1NSAA 4MHZA 3H8FA 1F57A 1CP7A 3KR5A 3HLPA 4MXUA 4UEFA 3FEDA 3KI9A 3DGVA 3PRTA 2PJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FF3 A;  4MHN A;  3PB7 X;  2BCO A;  2CF4 A;  3GUX A;  3IC1 A;  6CPA A;  4OC2 A;  1YLO A;  3I1U A;  3ISX A;  3IJ3 A;  2I3C A;  3FEE A;  2ABZ A;  2RFH A;  2ZOF A;  1TXR A;  5J1Q A;  1TF9 A;  1LAM A;  4PXB A;  4OID A;  3V7Z A;  3NFZ A;  4P4D A;  3WC6 A;  2ZEG A;  5ELY A;  3B3T A;  1TKH A;  3SJF A;  1TKF A;  3B3C A;  4NGM A;  4PPZ A;  1Z2L A;  1BPM A;  4OC4 A;  5K8P A;  4DYO A;  4MCQ A;  2ZEP A;  3D7D A;  4DUK A;  1XMB A;  1F2P A;  3FEC A;  2ZEF A;  4UIB A;  2PJ1 A;  1RTQ A;  5LRK A;  2PJ3 A;  3JRU A;  4P4J A;  1Y0Y A;  2F8H A;  2NSM A;  4H2K A;  4NJQ A;  1UWY A;  2CTB A;  2O4H A;  5LRJ A;  3TX8 A;  4EME A;  4P45 A;  1IGB A;  2AFU A;  4P4B A;  1CX8 A;  2PJ6 A;  5LYL A;  3RZA A;  5F09 A;  1JQG A;  2PVW A;  3FJU A;  1Y7E A;  2PJ8 A;  2HC9 A;  2XEF A;  3FMC A;  1LAP A;  2J9A A;  3SI0 A;  2V77 A;  1ZG9 A;  4JZ0 A;  5K8M A;  2JEW A;  3WC5 A;  1LAN A;  2AFX A;  1R3N A;  3S9L A;  4R6T A;  5HVG A;  3S9M A;  2AFS A;  4ONW A;  3KZW A;  2OOT A;  1LOK A;  4R8F A;  4F8Z A;  4PXE A;  1Q7L A;  4W9Y A;  3VH9 A;  3D7F A;  3MN8 A;  3WAB A;  4OC3 A;  3B35 A;  1DE4 C;  4A94 A;  1CBX A;  4MCP A;  2Q4Z A;  4P4I A;  2CIJ A;  2PJC A;  4F9U A;  1EE3 P;  3KHZ A;  4MHP A;  1ELM P;  3NA6 A;  3SJG A;  3SJE A;  5HVF A;  3VAR A;  3PB6 X;  3D7H A;  1YME A;  3NH8 A;  5I4M A;  4G1P A;  4P4E A;  4X3R A;  3KR4 A;  4RUH A;  4WWV A;  4ZI6 A;  4P4F A;  4NGT A;  2PJA A;  2ZEO A;  4FUU A;  2PIZ A;  3FX6 A;  5K8O A;  3IWW A;  2GRE A;  3D7G A;  4R76 A;  2XEJ A;  4UEE A;  5CBM A;  4ZY0 A;  4CPA A;  3T8W A;  2IJZ A;  2NYQ A;  1IY7 A;  3GB0 A;  3WT4 A;  4OKO A;  3B3V A;  3S9N A;  3H8G A;  4NGQ A;  5DS0 A;  2V8D A;  5LYD A;  4FAI A;  3CDX A;  1Y0R A;  3PB8 X;  2PVV A;  4NFR A;  2PJ9 A;  2BOA A;  4PQA A;  4EFD A;  4FBE A;  4B6Z A;  4P6Y A;  1VIX A;  2WZN A;  1M4L A;  3N5F A;  4X8I A;  5JH9 A;  3B7I A;  2GLJ A;  2AFO A;  2Q43 A;  3PBE A;  2ZEE A;  3RAM A;  1ELL P;  2PJ7 A;  1DTD A;  1XBU A;  4OME A;  2XEG A;  4Z65 A;  4ZX9 A;  3D4U A;  2C6P A;  1QQ9 A;  2IMO A;  1ARM A;  1F2O A;  2V8V A;  4A38 A;  4O23 A;  1PYT B;  4TNU A;  1XJO A;  4WJB A;  1AMP A;  4OC5 A;  3B3W A;  3LMS A;  4LQG A;  2CTC A;  3B2Y A;  4MCR A;  1LCP A;  2OR4 A;  5LYI A;  4AXV A;  4ZY2 A;  4F9V A;  2C6G A;  2WYR A;  4NJR A;  4UIA A;  5D29 A;  3IFE A;  5JGF A;  4YWY A;  3RBU A;  2PE3 A;  3D66 A;  1HEE A;  4IAV A;  2FVG A;  4MCS A;  4UF4 A;  1TF8 A;  1LFW A;  3BI0 A;  3K9T A;  3ISZ A;  1VGY A;  4Q7A A;  1Z5R A;  2ZEL A;  4KSI A;  2PJB A;  3KAS A;  5HXD A;  3SI2 A;  3PB4 X;  3BXM A;  3KGQ A;  4OC1 A;  4MMO A;  3QNV A;  1BLL E;  2PCU A;  3K2K A;  2JBJ A;  1PCA A;  2PJ2 A;  4NGP A;  2F7V A;  2BO9 A;  4R7M A;  1BAV A;  4A39 A;  2QJ8 A;  3PB9 X;  2ZEM A;  2PJ4 A;  1ZG8 A;  3V38 A;  4DJL A;  3CPX A;  3NH5 A;  4FWU A;  2O53 A;  3DLJ A;  4EWT A;  2ANP A;  4IK2 A;  1FNO A;  2AFW A;  4OC0 A;  2GU2 A;  5D8N A;  3PFO A;  1Z8L A;  4YU9 A;  4IHM A;  5THW A;  4ZYQ A;  2IQ6 A;  1R43 A;  1CPX A;  2ZEN A;  1FT7 A;  2RB7 A;  2GLF A;  3D67 A;  4PXD A;  1YW4 A;  2JBK A;  3KL9 A;  5LYF A;  3KQX A;  2C6C A;  3FH4 A;  3IEH A;  4K3N A;  2Q51 A;  1YW6 A;  1HDQ A;  8CPA A;  2POK A;  4UEZ A;  3CPA A;  1BPN A;  3IO1 A;  1H8L A;  4GM5 A;  1VHO A;  1ZLI A;  4ZX8 A;  4OP4 A;  5IB9 A;  1KWM A;  1TKJ A;  3KQZ A;  4OIW A;  4P10 A;  5CPA A;  2AFM A;  2AFZ A;  4A37 A;  1CP6 A;  3VAT A;  1AYE A;  3IIB A;  1OBR A;  2VL1 A;  4BD9 A;  4MHY A;  2QVP A;  2EWB A;  3PBB A;  3CT9 A;  3BI1 A;  3L2N A;  3FVL A;  3NH4 A;  1XFO A;  5JM6 A;  2V8G A;  2EK8 A;  3GLJ A;  2G9D A;  4P44 A;  3KHX A;  3BHX A;  3D68 A;  2QYV A;  2EK9 A;  1ZG7 A;  2PIY A;  2DEA A;  3PFE A;  1ZLH A;  3PEI A;  3HUV A;  2ZED A;  3LWU A;  1ARL A;  5K8N A;  1CPS A;  4MRI A;  3SI1 A;  1HDU A;  1QMU A;  5HVH A;  1CG2 A;  1XRY A;  4NGN A;  3MRU A;  3SJX A;  4ZY1 A;  3H8E A;  3B3S A;  1VHE A;  5LRG A;  1YSJ A;  2C1C A;  4TWE A;  7CPA A;  4PXC A;  2V8H A;  2ZEH A;  2PRQ A;  3WC7 A;  4X2T A;  3TC8 A;  2XEI A;  2PJ5 A;  2ZOG A;  2HB6 A;  4JYW A;  1GYT A;  4NGR A;  4NGS A;  1NSA A;  4MHZ A;  3H8F A;  1F57 A;  1CP7 A;  3KR5 A;  3HLP A;  4MXU A;  4UEF A;  3FED A;  3KI9 A;  3DGV A;  3PRT A;  2PJ0 A; 
#chains in the Genus database with same CATH topology
 2ATR A;  2KCW A;  3FF3 A;  1P0H A;  3PB7 X;  2BCO A;  2CF4 A;  4MHN A;  5JPH A;  3GUX A;  3IC1 A;  4UWI A;  5IV0 A;  6CPA A;  2EUI A;  4OC2 A;  4C2Z A;  1YLO A;  3I1U A;  5AGE A;  3ISX A;  4B5P A;  4R87 A;  3IJ3 A;  1MJB A;  4MFL A;  5KTC A;  2I3C A;  3FEE A;  5HMN A;  2ABZ A;  2RFH A;  4AG9 A;  2B5G B;  2ZOF A;  2ZW6 A;  1TXR A;  5J1Q A;  4BIN A;  4A31 A;  1TF9 A;  5F47 A;  1LAM A;  4PXB A;  4BMH A;  4OID A;  1M4I A;  3V7Z A;  3NFZ A;  4NCZ A;  4P4D A;  3WC6 A;  2ZEG A;  2CXA A;  5ELY A;  1I21 A;  3TE4 A;  2REF A;  1Z8X A;  4QB9 A;  4U5Y A;  3B3T A;  4MJ8 A;  1TKH A;  4Q38 A;  1YX0 A;  1I12 A;  3SJF A;  1TKF A;  4PK3 A;  1CJW A;  3B3C A;  4NGM A;  4OLL A;  3QB8 A;  3S6F A;  3CXQ A;  4PPZ A;  1Z2L A;  1BPM A;  4OC4 A;  5K8P A;  2BUE A;  4XPD B;  4DYO A;  3R9G A;  1XMT A;  4MCQ A;  2ZEP A;  3G3S A;  1YGH A;  4MFJ A;  3D7D A;  4DUK A;  1XMB A;  1F2P A;  2FXF A;  3FEC A;  2ZEF A;  4UIB A;  2PJ1 A;  3T90 A;  4KUB A;  1RTQ A;  5LRK A;  2ODF A;  2Q7S A;  4KSF A;  2Z3L A;  2FL4 A;  3CZX A;  2PJ3 A;  3IU2 A;  3JRU A;  4H89 A;  4P4J A;  4KOV A;  3FRM A;  3LAC A;  4HNY B;  1Y0Y A;  3OWC A;  2B4D B;  2F8H A;  4MFZ A;  3N7Z A;  2NSM A;  4H2K A;  4NJQ A;  1UWY A;  2CTB A;  1S7L A;  2O4H A;  2VEZ A;  5LRJ A;  3TX8 A;  4QC6 A;  4UCP A;  4B13 A;  4EME A;  4KSA A;  4P45 A;  1IGB A;  2AFU A;  2Z11 A;  5LYF A;  4P4B A;  3EC4 A;  3ZZI A;  3VWE A;  1CX8 A;  2YNC A;  2PJ6 A;  5H84 A;  5LYL A;  3RZA A;  5F09 A;  1JQG A;  2PVW A;  2P0W A;  3FJU A;  4KVO E;  1Y7E A;  2PJ8 A;  2HC9 A;  2R1I A;  2XEF A;  3FMC A;  1LAP A;  1IYK A;  4CAE A;  1ON0 A;  2PSW A;  2NMT A;  1S7K A;  4XPD C;  1Q2Y A;  2J9A A;  4F6A A;  3SI0 A;  1Q2D A;  1K4J A;  2BL1 A;  4KUA A;  2V77 A;  4ORF A;  1ZG9 A;  2JLM A;  1M4G A;  2Z0Z A;  4FD5 A;  4AVC A;  5A28 A;  4JZ0 A;  1Z4E A;  3T9Y A;  5K8M A;  2JEW A;  2B58 A;  4OAD A;  2JEV A;  3WC5 A;  1LAN A;  2AFX A;  2BSW A;  1R3N A;  2YNE A;  4B5O A;  3S9L A;  2Q04 A;  4R6T A;  1XOV A;  3S9M A;  4H6U A;  5HVG A;  4JXR A;  1KUY A;  2AFS A;  3FB3 A;  4ONW A;  4FD7 A;  3KZW A;  1NMT A;  2OZU A;  4RI1 A;  2OOT A;  1PU9 A;  2K5T A;  2YNC C;  1LOK A;  4LUA A;  2ZW4 A;  4R8F A;  2Q4Y A;  3R96 A;  4F8Z A;  4ONU A;  1YR0 A;  1QSO A;  4PXE A;  3B8G A;  1Q7L A;  4W9Y A;  4UCM A;  4HNW B;  3D7F A;  3EO4 A;  3VH9 A;  5ISV A;  3GYA A;  3MN8 A;  2FT0 A;  5AG4 A;  1YQE A;  2FE7 A;  3WAB A;  1YVO A;  4OC3 A;  2HV2 A;  4LQ6 A;  3B35 A;  1NSL A;  4F0X A;  1FY7 A;  2G3A A;  2Q0Y A;  1DE4 C;  3R9F A;  4A94 A;  1CBX A;  4MCP A;  2Q4Z A;  2Z3N A;  4P4I A;  3FIX A;  2VZY A;  4AG7 A;  4Q36 A;  2CIJ A;  2PJC A;  4F9U A;  3WR7 A;  1EE3 P;  4CAW A;  2FIW A;  1J4J A;  1YRE A;  2FCK A;  3KHZ A;  4HKF A;  1ELM P;  4MHP A;  4A95 A;  2BEI A;  3I9S A;  3NA6 A;  4FD6 A;  3SJG A;  2X7B A;  3EFA A;  3RNZ A;  3SJE A;  2Y0M A;  1B6B A;  5HVF A;  5F48 A;  2Q7B A;  3VAR A;  3PB6 X;  2R98 A;  4MBU A;  4PV6 A;  2VBQ A;  4CYO A;  3D7H A;  2P6G A;  2D4O A;  1YME A;  3NH8 A;  5I4M A;  4G1P A;  4P4E A;  4X3R A;  3KR4 A;  2P6E A;  4RUH A;  3F5B A;  1QSR A;  4WWV A;  4ZI6 A;  4P4F A;  4NGT A;  4QUS A;  3IWE A;  5G21 A;  4DNC A;  5E96 A;  4C7I A;  2PJA A;  3DDD A;  3PGP A;  1YK3 A;  2WPX A;  2ZEO A;  4CRY B;  4FUU A;  4M6I A;  2PIZ A;  3D2P A;  3FX6 A;  5K8O A;  2Z10 A;  3IWW A;  3DNS A;  2GRE A;  3D7G A;  4R76 A;  2XEJ A;  4UEE A;  4RS2 A;  5CBM A;  4ZY0 A;  4CPA A;  3T8W A;  1X10 A;  2B5G A;  2IJZ A;  1MJA A;  2NYQ A;  4QBJ A;  1IY7 A;  3GB0 A;  4UFV A;  3WT4 A;  4OKO A;  1N71 A;  3B3V A;  2DF5 A;  3K9U A;  3S9N A;  3H8G A;  4NGQ A;  4KOR A;  5DS0 A;  4XNH B;  1MK4 A;  2V8D A;  5LYD A;  4FAI A;  3TOA A;  4YGO A;  1B87 A;  2J8N A;  1XE4 A;  2QML A;  3CDX A;  4MFQ A;  1Y0R A;  1YLE A;  2FSR A;  4KVX A;  2DPS A;  3IWG A;  5DWN A;  3PB8 X;  2PVV A;  4NFR A;  2PJ9 A;  1Z8T A;  2BOA A;  2VI7 A;  4PQA A;  4EFD A;  4FBE A;  4B6Z A;  4JXQ A;  3GKR A;  2B3U A;  4P6Y A;  1VIX A;  2WZN A;  1M4L A;  3N5F A;  4X8I A;  5JH9 A;  3JUW A;  2IL4 A;  2CY2 A;  3F0A A;  4H6Z A;  1XEB A;  3B7I A;  2GLJ A;  2ZW5 A;  3W6S A;  2AFO A;  2Q43 A;  4OAE A;  3PBE A;  2ZEE A;  3RAM A;  1ELL P;  2PJ7 A;  1DTD A;  1XBU A;  3CXS A;  4OME A;  1QSN A;  5KTD A;  4B14 A;  2XEG A;  4Z65 A;  4U9Z A;  4ZX9 A;  2B4D A;  3D4U A;  2C6P A;  1QQ9 A;  2PC1 A;  4I49 A;  4AVB A;  3IGR A;  2IMO A;  1ARM A;  1F2O A;  2V8V A;  4A38 A;  2Q4V A;  1PYT B;  4O23 A;  4TNU A;  1XJO A;  5KTA A;  1Z9U A;  2WUU A;  4RN7 A;  4L89 A;  3W6X A;  5EMI A;  3QAH A;  4WJB A;  1AMP A;  4U9Y A;  4OC5 A;  5BWA B;  5C82 A;  4C68 A;  4XNH C;  3V8I A;  1NE9 A;  3B3W A;  3LMS A;  4CGP A;  2GAN A;  4Y49 B;  4LQG A;  4CYP A;  4CYN A;  1I1D A;  1WK4 A;  2CTC A;  3NE8 A;  3B2Y A;  3DR6 A;  5I0C A;  4MCR A;  4KZT A;  4FD4 A;  1LCP A;  4QVT A;  1SQH A;  2A4N A;  2OR4 A;  5HH1 A;  4PSX A;  1WWZ A;  5LYI A;  3S6G A;  3TCV A;  4NF1 A;  4AXV A;  4KOW A;  4CGN A;  4K30 A;  3BJ8 A;  2HUZ A;  4UCN A;  4ZY2 A;  1R57 A;  2C6G A;  2WYR A;  4F9V A;  5A27 A;  2Z3P A;  4NJR A;  5G1Z A;  1IID A;  1KZF A;  4UIA A;  5D29 A;  4JLY A;  4M85 A;  4KLW A;  3IFE A;  4KLV A;  4M6G A;  2EBJ A;  5JGF A;  4YWY A;  2B4B A;  3RBU A;  2PE3 A;  3D66 A;  2VQY A;  4A30 A;  1HEE A;  1IOI A;  2F5I A;  4IAV A;  2FVG A;  3LD2 A;  1QSM A;  4KOX A;  4IF5 A;  4MCS A;  2OZH A;  4R9M A;  4UF4 A;  2DXQ A;  1TF8 A;  3F8K A;  1V0C A;  5GCN A;  3SXO A;  1LFW A;  3BI0 A;  3K9T A;  1IU8 A;  3DR8 A;  3ISZ A;  2CNS A;  3TTH A;  4XPL A;  2B3V A;  4KOT A;  1M4D A;  1VGY A;  2J8R A;  3BLN A;  1Z5R A;  4Q7A A;  4E8O A;  4E0A A;  2ZEL A;  5J8C A;  4KSI A;  2PJB A;  3KAS A;  3GIU A;  5HXD A;  3SI2 A;  4R3K A;  4EVY A;  3PB4 X;  1KUX A;  3P2F A;  3W91 A;  3BXM A;  5IX3 A;  4II9 A;  2AJ6 A;  3KGQ A;  1YVK A;  3TO6 A;  4CGL A;  1Y9K A;  1M44 A;  4MMO A;  4OC1 A;  1IYL A;  1IIC A;  3P2H A;  3QNV A;  1BLL E;  2PCU A;  3K2K A;  1CM0 A;  2JBJ A;  1PCA A;  1MJ9 A;  2Z3K A;  5AG7 A;  5DWM A;  4R57 A;  4MY3 A;  2PJ2 A;  3R9E A;  3I3G A;  2EVN A;  4NGP A;  1BOB A;  2F7V A;  2PR8 A;  2BO9 A;  4NSQ A;  4R7M A;  2C27 A;  1BAV A;  5FVJ A;  1TIQ A;  1L0C A;  3FXT A;  2PR1 A;  4A39 A;  2QJ8 A;  3PB9 X;  4KOY A;  4MFP A;  2WSA A;  3FNC A;  4GXH A;  4C7H A;  2ZEM A;  2I00 A;  2PJ4 A;  1ZG8 A;  1GHE A;  1S60 A;  2ZXV A;  5CNP A;  3V38 A;  1S5K A;  4PK2 A;  2YND A;  1XIX A;  1VHS A;  4B5P B;  3IU1 A;  2ARH A;  4DJL A;  3CPX A;  3JTK A;  3EY5 A;  3NH5 A;  2Q44 A;  4UBR A;  4FWU A;  2O53 A;  3DLJ A;  2Z3O A;  3E0K A;  4EWT A;  4AVA A;  2ANP A;  4IK2 A;  2Z3M A;  1FNO A;  2AFW A;  4OC0 A;  2GU2 A;  2H5M A;  5D8N A;  5JQ4 A;  3PFO A;  1Z8L A;  4YU9 A;  3UY5 A;  4IHM A;  2R8V A;  5EBV A;  1Q2C A;  5THW A;  4ZYQ A;  5F49 A;  2IQ6 A;  1R43 A;  1CPX A;  2ZEN A;  3VWD A;  1FT7 A;  2RB7 A;  2GLF A;  3D67 A;  4JWP A;  4PXD A;  4CGM A;  1YW4 A;  2JBK A;  2OZG A;  4CAX A;  2FS5 A;  3KL9 A;  3SHP A;  3KQX A;  1OZP A;  2QIR A;  2C6C A;  1LRZ A;  4B12 A;  3FH4 A;  3IEH A;  5IB0 A;  4K3N A;  4MI4 A;  2Q51 A;  2OB0 A;  3D8P A;  1YW6 A;  1HDQ A;  8CPA A;  1AUG A;  4KVM E;  3FBU A;  2POK A;  4UEZ A;  3CPA A;  1BPN A;  3IO1 A;  1IB1 E;  1H8L A;  4GM5 A;  1VHO A;  4MFK A;  5G22 A;  1ZLI A;  4ZX8 A;  2G3T A;  4JJX A;  1U6M A;  2D4P A;  2GE3 A;  2VZZ A;  4OP4 A;  4CAF A;  5IB9 A;  3KI9 A;  1KWM A;  4PSW A;  1TKJ A;  2G0B A;  4CRZ B;  1IOF A;  3KQZ A;  4OIW A;  4CGO A;  3GY9 A;  4BBH A;  4P10 A;  5CPA A;  2AFM A;  3TO7 A;  2AFZ A;  4UWJ A;  4XPK A;  4A37 A;  4KS9 A;  1CP6 A;  2O28 A;  3VAT A;  2R7H A;  1AYE A;  4AB7 A;  3IIB A;  1OBR A;  4A32 A;  4HNX B;  2VL1 A;  2ZW7 A;  1PUA A;  3PP9 A;  1JWQ A;  4MHD A;  5F46 A;  4BD9 A;  4MHY A;  2QVP A;  2EWB A;  2ZPA A;  3PBB A;  3H5Z A;  1XF8 A;  3CT9 A;  3TFY A;  2I79 A;  3C26 A;  3BI1 A;  3G8W A;  4KOS A;  3L2N A;  2AE6 A;  2HQY A;  3TT2 A;  3FVL A;  3RO0 A;  4HPS A;  3NH4 A;  1XFO A;  5J8F A;  2V8G A;  2EK8 A;  2OU2 A;  2G9D A;  3GLJ A;  4P44 A;  5JM6 A;  3KHX A;  3BHX A;  4M3S A;  5EC4 A;  3JVN A;  2DPT A;  3D68 A;  3ZJ0 A;  2QYV A;  4C2X A;  1A2Z A;  2EK9 A;  3SXN A;  4B11 A;  1ZG7 A;  2PRB A;  2WPW A;  5G20 A;  3R95 A;  3TO9 A;  5AG5 A;  3TOB A;  1X12 A;  2PIY A;  2JDD A;  2REE A;  4B10 A;  2DEA A;  2PQ8 A;  3PFE A;  4A33 A;  1ZLH A;  2P6F A;  2CNT A;  4NEX A;  3PEI A;  4R3L A;  3HUV A;  3RYO A;  5C88 A;  2YGW A;  2ZED A;  1KUV A;  2GIV A;  3LWU A;  2PDO A;  1ARL A;  4KOU A;  1CPS A;  5K8N A;  1M1D A;  4CAV A;  4MRI A;  3SI1 A;  3EXN A;  1HDU A;  1QMU A;  2JDC A;  5HVH A;  1CG2 A;  1XRY A;  4NGN A;  2RC4 A;  2GFQ A;  2VXK A;  1Z8W A;  3MRU A;  4A2Z A;  1BO4 A;  3SJX A;  4ZY1 A;  3DSB A;  3MGD A;  3PZJ A;  3H8E A;  1S7F A;  1VHE A;  3B3S A;  5LRG A;  1Y9W A;  4C2Y A;  1YSJ A;  4Y49 C;  5H86 A;  4L8A A;  2C1C A;  4LX9 A;  4NXY A;  2OH1 A;  4TWE A;  7CPA A;  1VKC A;  4JD6 A;  4PXC A;  2V8H A;  2ZEH A;  3D3S A;  4IUS A;  4F0Y A;  3KKW A;  2PRQ A;  3BJ7 A;  4M6H A;  4UFX A;  3WC7 A;  4X2T A;  1RXT A;  2EO8 A;  2FIA A;  3LOD A;  2CNM A;  3QAY A;  4YFJ A;  3NE7 A;  3A9L A;  3TC8 A;  2XEI A;  1Z4R A;  3R1K A;  1P4N A;  1S3Z A;  4J3G A;  4ZBG A;  4CS0 B;  5AG6 A;  4GS4 A;  4UA3 A;  2PJ5 A;  4UFW A;  1QST A;  2ZOG A;  3S6H A;  3FYN A;  1UFH A;  4CYQ A;  2HB6 A;  4JYW A;  1GYT A;  4NGR A;  4NGS A;  1RO5 A;  4YRH A;  1NSA A;  4MY0 A;  4ZGY B;  1ZO0 A;  4MHZ A;  1Y7R A;  3H8F A;  3CXP A;  1F57 A;  4E2A A;  2QEC A;  1CP7 A;  3D2M A;  4X5K A;  3KR5 A;  3HLP A;  3S6K A;  4MXU A;  2J8M A;  3FED A;  1S7N A;  3DGV A;  3PRT A;  3H4Q A;  4UEF A;  2PJ0 A; 
#chains in the Genus database with same CATH homology
 3FF3 A;  4MHN A;  3PB7 X;  2BCO A;  2CF4 A;  3GUX A;  3IC1 A;  6CPA A;  4OC2 A;  1YLO A;  3I1U A;  3ISX A;  3IJ3 A;  2I3C A;  3FEE A;  2ABZ A;  2RFH A;  2ZOF A;  1TXR A;  5J1Q A;  1TF9 A;  1LAM A;  4PXB A;  4OID A;  3V7Z A;  3NFZ A;  4P4D A;  3WC6 A;  2ZEG A;  5ELY A;  3B3T A;  1TKH A;  3SJF A;  1TKF A;  3B3C A;  4NGM A;  4PPZ A;  1Z2L A;  1BPM A;  4OC4 A;  5K8P A;  4DYO A;  4MCQ A;  2ZEP A;  3D7D A;  4DUK A;  1XMB A;  1F2P A;  3FEC A;  2ZEF A;  4UIB A;  2PJ1 A;  1RTQ A;  5LRK A;  2PJ3 A;  3JRU A;  4P4J A;  1Y0Y A;  2F8H A;  2NSM A;  4H2K A;  4NJQ A;  1UWY A;  2CTB A;  2O4H A;  5LRJ A;  3TX8 A;  4EME A;  4P45 A;  1IGB A;  2AFU A;  4P4B A;  1CX8 A;  2PJ6 A;  5LYL A;  3RZA A;  5F09 A;  1JQG A;  2PVW A;  3FJU A;  1Y7E A;  2PJ8 A;  2HC9 A;  2XEF A;  3FMC A;  1LAP A;  2J9A A;  3SI0 A;  2V77 A;  1ZG9 A;  4JZ0 A;  5K8M A;  2JEW A;  3WC5 A;  1LAN A;  2AFX A;  1R3N A;  3S9L A;  4R6T A;  5HVG A;  3S9M A;  2AFS A;  4ONW A;  3KZW A;  2OOT A;  1LOK A;  4R8F A;  4F8Z A;  4PXE A;  1Q7L A;  4W9Y A;  3VH9 A;  3D7F A;  3MN8 A;  3WAB A;  4OC3 A;  3B35 A;  1DE4 C;  4A94 A;  1CBX A;  4MCP A;  2Q4Z A;  4P4I A;  2CIJ A;  2PJC A;  4F9U A;  1EE3 P;  3KHZ A;  4MHP A;  1ELM P;  3NA6 A;  3SJG A;  3SJE A;  5HVF A;  3VAR A;  3PB6 X;  3D7H A;  1YME A;  3NH8 A;  5I4M A;  4G1P A;  4P4E A;  4X3R A;  3KR4 A;  4RUH A;  4WWV A;  4ZI6 A;  4P4F A;  4NGT A;  2PJA A;  2ZEO A;  4FUU A;  2PIZ A;  3FX6 A;  5K8O A;  3IWW A;  2GRE A;  3D7G A;  4R76 A;  2XEJ A;  4UEE A;  5CBM A;  4ZY0 A;  4CPA A;  3T8W A;  2IJZ A;  2NYQ A;  1IY7 A;  3GB0 A;  3WT4 A;  4OKO A;  3B3V A;  3S9N A;  3H8G A;  4NGQ A;  5DS0 A;  2V8D A;  5LYD A;  4FAI A;  3CDX A;  1Y0R A;  3PB8 X;  2PVV A;  4NFR A;  2PJ9 A;  2BOA A;  4PQA A;  4EFD A;  4FBE A;  4B6Z A;  4P6Y A;  1VIX A;  2WZN A;  1M4L A;  3N5F A;  4X8I A;  5JH9 A;  3B7I A;  2GLJ A;  2AFO A;  2Q43 A;  3PBE A;  2ZEE A;  3RAM A;  1ELL P;  2PJ7 A;  1DTD A;  1XBU A;  4OME A;  2XEG A;  4Z65 A;  4ZX9 A;  3D4U A;  2C6P A;  1QQ9 A;  2IMO A;  1ARM A;  1F2O A;  2V8V A;  4A38 A;  4O23 A;  1PYT B;  4TNU A;  1XJO A;  4WJB A;  1AMP A;  4OC5 A;  3B3W A;  3LMS A;  4LQG A;  2CTC A;  3B2Y A;  4MCR A;  1LCP A;  2OR4 A;  5LYI A;  4AXV A;  4ZY2 A;  4F9V A;  2C6G A;  2WYR A;  4NJR A;  4UIA A;  5D29 A;  3IFE A;  5JGF A;  4YWY A;  3RBU A;  2PE3 A;  3D66 A;  1HEE A;  4IAV A;  2FVG A;  4MCS A;  4UF4 A;  1TF8 A;  1LFW A;  3BI0 A;  3K9T A;  3ISZ A;  1VGY A;  4Q7A A;  1Z5R A;  2ZEL A;  4KSI A;  2PJB A;  3KAS A;  5HXD A;  3SI2 A;  3PB4 X;  3BXM A;  3KGQ A;  4OC1 A;  4MMO A;  3QNV A;  1BLL E;  2PCU A;  3K2K A;  2JBJ A;  1PCA A;  2PJ2 A;  4NGP A;  2F7V A;  2BO9 A;  4R7M A;  1BAV A;  4A39 A;  2QJ8 A;  3PB9 X;  2ZEM A;  2PJ4 A;  1ZG8 A;  3V38 A;  4DJL A;  3CPX A;  3NH5 A;  4FWU A;  2O53 A;  3DLJ A;  4EWT A;  2ANP A;  4IK2 A;  1FNO A;  2AFW A;  4OC0 A;  2GU2 A;  5D8N A;  3PFO A;  1Z8L A;  4YU9 A;  4IHM A;  5THW A;  4ZYQ A;  2IQ6 A;  1R43 A;  1CPX A;  2ZEN A;  1FT7 A;  2RB7 A;  2GLF A;  3D67 A;  4PXD A;  1YW4 A;  2JBK A;  3KL9 A;  5LYF A;  3KQX A;  2C6C A;  3FH4 A;  3IEH A;  4K3N A;  2Q51 A;  1YW6 A;  1HDQ A;  8CPA A;  2POK A;  4UEZ A;  3CPA A;  1BPN A;  3IO1 A;  1H8L A;  4GM5 A;  1VHO A;  1ZLI A;  4ZX8 A;  4OP4 A;  5IB9 A;  1KWM A;  1TKJ A;  3KQZ A;  4OIW A;  4P10 A;  5CPA A;  2AFM A;  2AFZ A;  4A37 A;  1CP6 A;  3VAT A;  1AYE A;  3IIB A;  1OBR A;  2VL1 A;  4BD9 A;  4MHY A;  2QVP A;  2EWB A;  3PBB A;  3CT9 A;  3BI1 A;  3L2N A;  3FVL A;  3NH4 A;  1XFO A;  5JM6 A;  2V8G A;  2EK8 A;  3GLJ A;  2G9D A;  4P44 A;  3KHX A;  3BHX A;  3D68 A;  2QYV A;  2EK9 A;  1ZG7 A;  2PIY A;  2DEA A;  3PFE A;  1ZLH A;  3PEI A;  3HUV A;  2ZED A;  3LWU A;  1ARL A;  5K8N A;  1CPS A;  4MRI A;  3SI1 A;  1HDU A;  1QMU A;  5HVH A;  1CG2 A;  1XRY A;  4NGN A;  3MRU A;  3SJX A;  4ZY1 A;  3H8E A;  3B3S A;  1VHE A;  5LRG A;  1YSJ A;  2C1C A;  4TWE A;  7CPA A;  4PXC A;  2V8H A;  2ZEH A;  2PRQ A;  3WC7 A;  4X2T A;  3TC8 A;  2XEI A;  2PJ5 A;  2ZOG A;  2HB6 A;  4JYW A;  1GYT A;  4NGR A;  4NGS A;  1NSA A;  4MHZ A;  3H8F A;  1F57 A;  1CP7 A;  3KR5 A;  3HLP A;  4MXU A;  4UEF A;  3FED A;  3KI9 A;  3DGV A;  3PRT A;  2PJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...