4A94A

Structure of the carboxypeptidase inhibitor from nerita versicolor in complex with human cpa4
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
302
structure length
302
Chain Sequence
FNYGAYHSLEAIYHEMDNIAADFPDLARRVKIGHSFENRPMYVLKFSTGKGVRRPAVWLNAGIHSREWISQATAIWTARKIVSDYQRDPAITSILEKMDIFLLPVANPDGYVYTQTQNRLWRKTRSRNPGSSCIGADPNRNWNASFAGKGASDNPCSEVYHGPHANSEVEVKSVVDFIQKHGNFKGFIDLHSYSQLLMYPYGYSVKKAPDAEELDKVARLAAKALASVSGTEYQVGPTCTTVYPASGSSIDWAYDNGIKFAFTFELRDTGTYGFLLPANQIIPTAEETWLGLKTIMEHVRDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CARBOXYPEPTIDASE A4
publication title Crystal Structure of a Novel Metallo-Carboxypeptidase Inhibitor from the Marine Mollusk Nerita Versicolor in Complex with Human Carboxypeptidase A4.
pubmed doi rcsb
source organism Homo sapiens
total genus 111
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.4.17.-:
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4a94A00
2PRQA 2CTCA 2PJ5A 3B3CA 4EWTA 1ARLA 4EFDA 4OC0A 3FVLA 4P4EA 2PJ2A 1IGBA 3PBEA 3D68A 3WC7A 4RUHA 4MHPA 4NGMA 2QVPA 1XJOA 1VHOA 3IWWA 4P4DA 4W9YA 5IB9A 3T8WA 3CDXA 5LRJA 4OC3A 4MHYA 4DUKA 5JM6A 2F7VA 1ELLP 2GU2A 1Z8LA 4NGQA 1ZG7A 4OKOA 4P4IA 3FEDA 4A94A 1M4LA 1IY7A 3B7IA 1Y7EA 3B2YA 4ZI6A 3I1UA 3CPXA 8CPAA 2NYQA 2POKA 1F2OA 3PB7X 1ZG8A 2PJ6A 4OC4A 3BXMA 2ABZA 2XEIA 1F2PA 1VIXA 5DS0A 4F9VA 2VL1A 4NJQA 1YMEA 3DGVA 3KQXA 4MHZA 4B6ZA 4FBEA 4OIDA 2IMOA 3DLJA 2EK8A 3D4UA 1XFOA 1XMBA 2ZEFA 3D7FA 2BCOA 3SI2A 3NA6A 4K3NA 1XBUA 1NSAA 3PEIA 1ZG9A 2XEJA 4DJLA 1CP7A 3VATA 4MHNA 4AXVA 3HUVA 1LFWA 4LQGA 1DE4C 5J1QA 4Z65A 3RBUA 4X3RA 3SI0A 4R8FA 2PJAA 2C6CA 2PJ8A 4MCSA 2DEAA 2ZOFA 2ZEOA 3SJEA 2CIJA 1HDQA 3NH8A 5F09A 4PXCA 1LANA 4PPZA 3FMCA 1ZLIA 3PB8X 4JZ0A 3FH4A 3FEEA 4NJRA 1YSJA 2WYRA 3PRTA 5HVGA 4UF4A 2G9DA 3B3SA 3KHXA 3CPAA 3PB4X 1HEEA 2AFWA 2AFUA 2J9AA 3LWUA 3KL9A 1YW6A 1R43A 2ZOGA 3NH5A 2AFSA 2ANPA 3FECA 4PXDA 4F9UA 3FX6A 2PJ9A 5K8NA 2GLJA 4ZYQA 2JBKA 1TKFA 4UEEA 3K9TA 2ZELA 4PXEA 4UIAA 1CBXA 5LRKA 4IHMA 2PJ1A 5CPAA 4P4FA 2F8HA 1F57A 1BAVA 2PVWA 2AFMA 2JEWA 4MCRA 3IFEA 4X2TA 4A38A 1Z5RA 3IIBA 2C6GA 2RB7A 3CT9A 2Q4ZA 3JRUA 1TKJA 1LOKA 2BO9A 2WZNA 2FVGA 3HLPA 1LAMA 5LYLA 4WJBA 2PVVA 3IEHA 2QJ8A 3PFEA 2Q51A 3KGQA 3B35A 2RFHA 4ONWA 1VHEA 5ELYA 1TXRA 1XRYA 1CP6A 2NSMA 3D7DA 4FWUA 1CPXA 1TF8A 2XEFA 2ZEMA 4P6YA 5JH9A 4EMEA 2XEGA 3VH9A 2ZEEA 3BHXA 1PCAA 2GREA 2PIYA 4UIBA 4R76A 3IJ3A 4ZX8A 6CPAA 2BOAA 3KR5A 5JGFA 2AFZA 4IAVA 4PXBA 3PBBA 1FNOA 4MCQA 3SJGA 1AMPA 3GUXA 5LYDA 2AFOA 4R6TA 4FUUA 3D66A 2ZEPA 4NGTA 4ZY0A 1CPSA 3S9MA 1CG2A 5LYIA 1YW4A 3GB0A 3WC5A 2PJ4A 4GM5A 1BLLE 3WT4A 3VARA 4MMOA 4OMEA 3BI0A 4P4JA 5K8MA 2PCUA 4DYOA 3B3TA 1QMUA 1YLOA 1LAPA 3H8GA 4MCPA 3ISZA 3S9NA 2GLFA 3BI1A 4IK2A 5HVFA 1PYTB 3K2KA 3D67A 1EE3P 1LCPA 3V38A 1TF9A 3KZWA 4PQAA 3H8FA 4FAIA 3QNVA 2AFXA 2PIZA 4ZY2A 2Q43A 4MXUA 3RZAA 2EK9A 3V7ZA 5D8NA 2ZENA 1UWYA 3D7HA 4Q7AA 2PJ3A 3D7GA 4F8ZA 1HDUA 3RAMA 2IQ6A 1ZLHA 3KHZA 5LRGA 5K8PA 1DTDA 3H8EA 2JBJA 2ZEDA 2QYVA 5HVHA 1VGYA 3ISXA 3MN8A 4O23A 3PFOA 2ZEGA 3B3WA 4G1PA 3SI1A 4H2KA 7CPAA 1CX8A 2PJBA 4P4BA 3NFZA 3KR4A 2ZEHA 3KASA 4WWVA 3S9LA 2IJZA 3TX8A 1QQ9A 2O53A 2HB6A 3SJFA 4P10A 4BD9A 5CBMA 1AYEA 3GLJA 2PJ7A 3FF3A 1GYTA 2V8DA 2EWBA 3TC8A 4OC2A 2CF4A 4R7MA 4NGPA 1Y0RA 4NFRA 4JYWA 5THWA 4OC1A 2OR4A 4ZX9A 4P44A 2PE3A 4KSIA 3IC1A 4NGNA 1BPMA 4X8IA 3PB6X 5HXDA 2HC9A 4ZY1A 4YWYA 2OOTA 4P45A 3KQZA 3WABA 4A39A 4TWEA 3FJUA 1BPNA 1Y0YA 4NGSA 3LMSA 4UEZA 1FT7A 4OC5A 2C6PA 4A37A 3N5FA 2O4HA 1TKHA 3SJXA 4TNUA 4NGRA 2C1CA 4CPAA 1ARMA 1RTQA 1KWMA 4OP4A 2V8HA 3IO1A 3L2NA 1Z2LA 5K8OA 1R3NA 5LYFA 3KI9A 3B3VA 4OIWA 4UEFA 2CTBA 2V8GA 3MRUA 3WC6A 2I3CA 1ELMP 2V8VA 5D29A 2PJCA 2PJ0A 5I4MA 1H8LA 1OBRA 2V77A 1Q7LA 3NH4A 4YU9A 3PB9X 4MRIA 1JQGA
chains in the Genus database with same CATH superfamily
2PRQA 4FD7A 2CTCA 2BUEA 2PJ5A 3B3CA 3G8WA 4EWTA 1ARLA 5A27A 3EY5A 3T90A 4EFDA 4OC0A 4MFJA 3S6GA 5JPHA 4R9MA 2VI7A 3FVLA 4CYOA 4P4EA 2PJ2A 4MFKA 1IGBA 3PBEA 3D68A 3FYNA 2WUUA 3WC7A 4RUHA 5EC4A 4MHPA 4NGMA 2PSWA 2QVPA 1IICA 3PZJA 1XJOA 1OZPA 2Z3NA 1VHOA 3IWWA 4P4DA 4W9YA 3W6XA 5IB9A 1S60A 2KCWA 3D2MA 3FIXA 4KLWA 4MY3A 4A32A 4F0XA 2Q04A 5KTAA 3T8WA 3CDXA 5LRJA 5DWNA 4OC3A 4MHYA 2K5TA 4DUKA 5JM6A 1BO4A 2OZGA 2FIAA 2ARHA 4MFZA 1M44A 2PR8A 2JDCA 4PSWA 4CAEA 2F7VA 1ELLP 1YLEA 2GU2A 1Z8LA 4UFVA 4NGQA 1ZG7A 4OKOA 4MBUA 4P4IA 1RXTA 3FEDA 5HH1A 2HV2A 4A94A 1M4LA 1IY7A 3B7IA 1Y7EA 2FT0A 3B2YA 2R1IA 1NSLA 5C88A 1IOFA 4B14A 4ZI6A 3I1UA 4XPDB 4KUAA 4K30A 3JTKA 4IF5A 3CPXA 8CPAA 2NYQA 2POKA 5E96A 1F2OA 3PB7X 1IOIA 2F5IA 4C2YA 2PRBA 2CXAA 3E0KA 1ZG8A 2PJ6A 4OC4A 3BXMA 4GS4A 2VXKA 2ABZA 4M85A 4UFXA 4UBRA 3R96A 2XEIA 1F2PA 1VIXA 5DS0A 3W91A 2VL1A 4F9VA 2Q4VA 4NJQA 1QSRA 2EUIA 2J8MA 4XPKA 2Z3OA 1YMEA 3DGVA 3KQXA 4MHZA 4E8OA 3SXOA 4B6ZA 4FBEA 4OIDA 2IMOA 3DLJA 2EK8A 3D4UA 3I3GA 1XFOA 4CGLA 1XMBA 4B10A 2ZEFA 3D7FA 2BCOA 4KOSA 4KSAA 3SI2A 2ZW6A 3NA6A 3IWGA 4K3NA 1XBUA 4CYPA 3D3SA 5AG4A 3BJ8A 1NSAA 3PEIA 5KTCA 4IUSA 1P0HA 3CZXA 1ZG9A 2QECA 4GXHA 2XEJA 2PQ8A 4DJLA 4M6IA 1CP7A 3VATA 4MHNA 4AXVA 3HUVA 3TO9A 3W6SA 1LFWA 1R57A 3N7ZA 4Q38A 1Z9UA 2Q4YA 3D8PA 4B12A 4R57A 4LQGA 1DE4C 1MJAA 5G22A 4Y49C 5A28A 4AB7A 5J1QA 4Z65A 3RBUA 4X3RA 3SI0A 4R8FA 2PJAA 4JWPA 2C6CA 4XPDC 4FD5A 3ZZIA 2PJ8A 5JQ4A 4MCSA 2DEAA 2ZOFA 2ZEOA 3SJEA 2R8VA 2CIJA 4QB9A 1HDQA 2Z3KA 3NH8A 4PV6A 5F09A 4PXCA 1LANA 3CXPA 4PPZA 3FMCA 1M4IA 1ZLIA 3PB8X 4JZ0A 1IYKA 1KUVA 3FH4A 3FEEA 3P2FA 1I21A 1YSJA 3R1KA 2WYRA 1NE9A 3PRTA 4NJRA 4CGMA 5HVGA 1S7NA 2VQYA 4PK3A 4II9A 3R95A 4UF4A 2YNEA 4XNHC 3TE4A 2G9DA 2ZW4A 4YRHA 3B3SA 3MGDA 3KHXA 3CPAA 3IU1A 5AGEA 2JDDA 2YNCC 3PB4X 1HEEA 2AFWA 2AFUA 2J9AA 1N71A 3LWUA 5AG7A 3K9UA 4MY0A 3KL9A 3R9EA 1R43A 1YW6A 2ZOGA 2I00A 3NH5A 4M6GA 2AFSA 1S3ZA 2ANPA 3FECA 4MFPA 4PXDA 3GYAA 3FX6A 4F9UA 4C7IA 1Q2CA 2PJ9A 4UWIA 5K8NA 5EMIA 4OADA 2GLJA 4ZYQA 2JLMA 2JBKA 4DNCA 1TKFA 4UEEA 3K9TA 2Z0ZA 4PSXA 3VWDA 4KS9A 2R98A 2REFA 2ZELA 2HQYA 2ZW7A 3TO6A 4PXEA 1YREA 4UIAA 1S5KA 1CBXA 4KLVA 2P6EA 2OZUA 4KVOE 3S6FA 5LRKA 4IHMA 2YGWA 3FB3A 2PJ1A 5CPAA 3TCVA 4U9YA 4P4FA 1YR0A 4C7HA 1MJ9A 2F8HA 4CAFA 1F57A 1BAVA 2PVWA 2AFMA 2JEWA 4MCRA 4B5PA 2P0WA 3FNCA 1M4DA 4FD4A 4RI1A 3IWEA 3IFEA 4X2TA 4KORA 4A38A 1Z5RA 3IIBA 3JUWA 3NE8A 4UFWA 4KUBA 3S6HA 4CGPA 2C6GA 2RB7A 2Z3LA 2Q4ZA 3CT9A 3GY9A 3JRUA 1TKJA 4JXQA 5F49A 1LOKA 2BO9A 2WZNA 2FVGA 3HLPA 1LAMA 4X5KA 5LYLA 1FY7A 4M3SA 4B5PB 4WJBA 2PVVA 2WSAA 2CNMA 3RNZA 4A30A 2Q44A 4RN7A 3PP9A 1WWZA 4CAXA 3IEHA 2QJ8A 3PFEA 2Q51A 3KGQA 3B35A 2RFHA 4ONWA 1VHEA 5ELYA 1TXRA 1XRYA 3TFYA 1CP6A 2NSMA 3JVNA 5CNPA 4J3GA 1IB1E 3TOBA 3D7DA 4FWUA 3A9LA 2FCKA 1CPXA 5F48A 1TF8A 2XEFA 2ZEMA 4CS0B 4P6YA 5JH9A 2X7BA 4EMEA 4KOTA 1ON0A 2PDOA 4MJ8A 1LRZA 2XEGA 4ONUA 4UCPA 3VH9A 2ZEEA 4LUAA 4EVYA 3BHXA 4F6AA 1PCAA 2AJ6A 2Q7SA 1YK3A 2GREA 2PIYA 4JD6A 4UIBA 4R76A 3IJ3A 4C68A 4ZX8A 2CNSA 6CPAA 4L89A 2BOAA 3KR5A 5JGFA 1X10A 1XOVA 1P4NA 4AVCA 4H6UA 4KSFA 2VZZA 2GIVA 2J8NA 1XMTA 2GFQA 2O28A 4UCMA 2AFZA 2Z3MA 4IAVA 1QSTA 4PXBA 3PBBA 1FNOA 3DDDA 4MCQA 3SJGA 1AMPA 4A2ZA 1XE4A 5IX3A 4AG9A 1S7LA 4YGOA 5I0CA 2B3UA 3GUXA 5LYDA 2AFOA 4R6TA 2Q7BA 2REEA 1QSMA 1Y9WA 4FUUA 4L8AA 3F5BA 4KOVA 1XEBA 3D66A 2ZEPA 4NGTA 2G0BA 4HNWB 3T9YA 4ZY0A 1CPSA 3S9MA 1CG2A 5H84A 1VHSA 1TIQA 5LYIA 1YW4A 3GB0A 3WC5A 2PJ4A 1SQHA 5AG6A 2DF5A 4GM5A 3TTHA 4JJXA 1Q2YA 1BLLE 1I1DA 1KZFA 2R7HA 5AG5A 3GKRA 3FXTA 1QSOA 3VARA 3WT4A 5J8FA 2B4DA 4MMOA 2DXQA 3EC4A 3BI0A 4OMEA 4P4JA 5K8MA 4KOXA 2PCUA 1KUYA 4DYOA 3B3TA 4NEXA 2C27A 1QMUA 2PR1A 1YLOA 4CAVA 1LAPA 5IV0A 3H8GA 4MCPA 1YVOA 3ISZA 2PC1A 2B4DB 2GLFA 3BI1A 2P6GA 3S9NA 4IK2A 1MK4A 3IGRA 4R3LA 1PYTB 3K2KA 4OAEA 5HVFA 3RO0A 5J8CA 3D67A 4HNYB 4FD6A 4CAWA 1EE3P 1LCPA 2FE7A 3V38A 3FBUA 1QSNA 1TF9A 3KZWA 3V8IA 3DNSA 4HKFA 4PQAA 3H8FA 4FAIA 3QNVA 2AFXA 2PIZA 4KZTA 2Z10A 1Y9KA 2EVNA 5F47A 4HNXB 4ZY2A 3EO4A 4UA3A 1X12A 2Q43A 4NCZA 4MXUA 1Q2DA 4H89A 3RZAA 4CRZB 2EK9A 3V7ZA 4ZBGA 5D8NA 3GIUA 2BL1A 2B5GB 2ZPAA 2IL4A 2ZENA 1CJWA 1UWYA 3D7HA 4Q7AA 2PJ3A 5KTDA 2JEVA 3D7GA 1M1DA 2ZXVA 2NMTA 3SHPA 4QBJA 1WK4A 4LX9A 5FVJA 4F8ZA 4F0YA 1HDUA 4MHDA 3RAMA 2IQ6A 1XIXA 2B58A 2Z11A 2QIRA 4E2AA 3LODA 2B4BA 1V0CA 4YFJA 1ZLHA 2CY2A 4ZGYB 3KHZA 3LACA 4RS2A 5LRGA 2FS5A 5K8PA 1RO5A 1DTDA 3F0AA 3TT2A 3H8EA 1PUAA 5DWMA 3DR6A 2JBJA 4CRYB 3EXNA 3C26A 1MJBA 4A31A 1Z8WA 2ZEDA 3DSBA 2BSWA 2QYVA 4KOYA 1VGYA 3FRMA 3ISXA 3MN8A 4O23A 5EBVA 3PFOA 4B11A 5HVHA 1Y7RA 3VWEA 2ZEGA 3QAHA 4JXRA 3B3WA 4KOUA 2AE6A 2DPTA 3F8KA 4CGOA 4UWJA 4CYQA 4G1PA 5HMNA 5H86A 3SI1A 4H2KA 5BWAB 1M4GA 2A4NA 1PU9A 7CPAA 1KUXA 1CX8A 4NF1A 2PJBA 2WPXA 4P4BA 3NFZA 4H6ZA 3KR4A 1UFHA 2OU2A 2ZEHA 3KASA 1J4JA 4WWVA 4Y49B 3H5ZA 1CM0A 1Z8TA 3S9LA 2IJZA 3IU2A 3TX8A 1QQ9A 2O53A 2HB6A 2VBQA 4LQ6A 3SJFA 2QMLA 4QVTA 4P10A 2ATRA 1A2ZA 3B8GA 4BD9A 2OH1A 3H4QA 3SXNA 1AYEA 3GLJA 3R9FA 2PJ7A 3R9GA 5CBMA 4MFQA 3FF3A 1U6MA 1GYTA 2J8RA 1K4JA 4KVME 4AG7A 3G3SA 2YNCA 2VZYA 3ZJ0A 5C82A 2V8DA 2EWBA 4U5YA 4AVAA 3TC8A 4NSQA 4OC2A 3UY5A 1IU8A 1YQEA 2VEZA 2RC4A 2CF4A 2P6FA 4XNHB 3EFAA 4R7MA 3CXQA 4NGPA 3WR7A 3TO7A 1Y0RA 4HPSA 4BINA 1L0CA 4NFRA 4I49A 4JYWA 1S7KA 5THWA 4OC1A 1JWQA 4KOWA 2OR4A 2Q0YA 4P44A 4ZX9A 4B13A 4CGNA 1Z8XA 2HUZA 2PE3A 2H5MA 4C2XA 4KSIA 2D4PA 3IC1A 4QC6A 3KKWA 4NGNA 2D4OA 2GE3A 1BPMA 4A33A 4X8IA 3PB6X 3BLNA 5HXDA 1IIDA 2HC9A 4AVBA 4ZY1A 4YWYA 1YX0A 2OOTA 4U9ZA 4P45A 4E0AA 5G20A 3TOAA 1Z4EA 3KQZA 3D2PA 3WABA 4A39A 3LD2A 4KVXA 2Z3PA 4TWEA 5IB0A 1GHEA 1AUGA 1BPNA 1Y0YA 2OZHA 3FJUA 4Q36A 4NGSA 3LMSA 4UEZA 2WPWA 1FT7A 4OC5A 5ISVA 1VKCA 1I12A 2C6PA 2Y0MA 3CXSA 4A37A 3N5FA 4QUSA 2O4HA 1TKHA 4CYNA 2ODFA 2CNTA 2DPSA 3SJXA 4BMHA 1B6BA 4MI4A 4TNUA 4NGRA 5F46A 2ZW5A 2C1CA 1B87A 4CPAA 1ARMA 1NMTA 1RTQA 1IYLA 4JLYA 1XF8A 5G1ZA 1KWMA 2EO8A 4OP4A 2V8HA 4BBHA 2OB0A 3IO1A 4R3KA 3L2NA 2B5GA 2FL4A 4OLLA 4B5OA 1BOBA 1Z2LA 5K8OA 5G21A 1R3NA 3S6KA 5LYFA 3KI9A 4XPLA 3B3VA 4ORFA 2G3TA 4OIWA 4UEFA 1S7FA 1YVKA 3QB8A 3RYOA 3PGPA 1Z4RA 2CTBA 2V8GA 4UCNA 3MRUA 4PK2A 3WC6A 2EBJA 2I3CA 2I79A 2YNDA 4NXYA 5GCNA 2FXFA 3OWCA 1ELMP 2V8VA 4M6HA 3BJ7A 1YGHA 3NE7A 5D29A 2B3VA 2PJCA 2PJ0A 2BEIA 5I4MA 1H8LA 1OBRA 4C2ZA 2GANA 2V77A 2FSRA 3I9SA 4R87A 1Q7LA 2FIWA 3NH4A 2G3AA 4YU9A 3P2HA 3PB9X 4MFLA 3QAYA 4MRIA 1JQGA 4A95A 1ZO0A 3DR8A
chains in the Genus database with same CATH topology
2PRQA 2CTCA 2PJ5A 3B3CA 4EWTA 1ARLA 4EFDA 4OC0A 3FVLA 4P4EA 2PJ2A 1IGBA 3PBEA 3D68A 3WC7A 4RUHA 4MHPA 4NGMA 2QVPA 1XJOA 1VHOA 3IWWA 4P4DA 4W9YA 5IB9A 3T8WA 3CDXA 5LRJA 4OC3A 4MHYA 4DUKA 5JM6A 2F7VA 1ELLP 2GU2A 1Z8LA 4NGQA 1ZG7A 4OKOA 4P4IA 3FEDA 4A94A 1M4LA 1IY7A 3B7IA 1Y7EA 3B2YA 4ZI6A 3I1UA 3CPXA 8CPAA 2NYQA 2POKA 1F2OA 3PB7X 1ZG8A 2PJ6A 4OC4A 3BXMA 2ABZA 2XEIA 1F2PA 1VIXA 5DS0A 4F9VA 2VL1A 4NJQA 1YMEA 3DGVA 3KQXA 4MHZA 4B6ZA 4FBEA 4OIDA 2IMOA 3DLJA 2EK8A 3D4UA 1XFOA 1XMBA 2ZEFA 3D7FA 2BCOA 3SI2A 3NA6A 4K3NA 1XBUA 1NSAA 3PEIA 1ZG9A 2XEJA 4DJLA 1CP7A 3VATA 4MHNA 4AXVA 3HUVA 1LFWA 4LQGA 1DE4C 5J1QA 4Z65A 3RBUA 4X3RA 3SI0A 4R8FA 2PJAA 2C6CA 2PJ8A 4MCSA 2DEAA 2ZOFA 2ZEOA 3SJEA 2CIJA 1HDQA 3NH8A 5F09A 4PXCA 1LANA 4PPZA 3FMCA 1ZLIA 3PB8X 4JZ0A 3FH4A 3FEEA 4NJRA 1YSJA 2WYRA 3PRTA 5HVGA 4UF4A 2G9DA 3B3SA 3KHXA 3CPAA 3PB4X 1HEEA 2AFWA 2AFUA 2J9AA 3LWUA 3KL9A 1YW6A 1R43A 2ZOGA 3NH5A 2AFSA 2ANPA 3FECA 4PXDA 4F9UA 3FX6A 2PJ9A 5K8NA 2GLJA 4ZYQA 2JBKA 1TKFA 4UEEA 3K9TA 2ZELA 4PXEA 4UIAA 1CBXA 5LRKA 4IHMA 2PJ1A 5CPAA 4P4FA 2F8HA 1F57A 1BAVA 2PVWA 2AFMA 2JEWA 4MCRA 3IFEA 4X2TA 4A38A 1Z5RA 3IIBA 2C6GA 2RB7A 3CT9A 2Q4ZA 3JRUA 1TKJA 1LOKA 2BO9A 2WZNA 2FVGA 3HLPA 1LAMA 5LYLA 4WJBA 2PVVA 3IEHA 2QJ8A 3PFEA 2Q51A 3KGQA 3B35A 2RFHA 4ONWA 1VHEA 5ELYA 1TXRA 1XRYA 1CP6A 2NSMA 3D7DA 4FWUA 1CPXA 1TF8A 2XEFA 2ZEMA 4P6YA 5JH9A 4EMEA 2XEGA 3VH9A 2ZEEA 3BHXA 1PCAA 2GREA 2PIYA 4UIBA 4R76A 3IJ3A 4ZX8A 6CPAA 2BOAA 3KR5A 5JGFA 2AFZA 4IAVA 4PXBA 3PBBA 1FNOA 4MCQA 3SJGA 1AMPA 3GUXA 5LYDA 2AFOA 4R6TA 4FUUA 3D66A 2ZEPA 4NGTA 4ZY0A 1CPSA 3S9MA 1CG2A 5LYIA 1YW4A 3GB0A 3WC5A 2PJ4A 4GM5A 1BLLE 3WT4A 3VARA 4MMOA 4OMEA 3BI0A 4P4JA 5K8MA 2PCUA 4DYOA 3B3TA 1QMUA 1YLOA 1LAPA 3H8GA 4MCPA 3ISZA 3S9NA 2GLFA 3BI1A 4IK2A 5HVFA 1PYTB 3K2KA 3D67A 1EE3P 1LCPA 3V38A 1TF9A 3KZWA 4PQAA 3H8FA 4FAIA 3QNVA 2AFXA 2PIZA 4ZY2A 2Q43A 4MXUA 3RZAA 2EK9A 3V7ZA 5D8NA 2ZENA 1UWYA 3D7HA 4Q7AA 2PJ3A 3D7GA 4F8ZA 1HDUA 3RAMA 2IQ6A 1ZLHA 3KHZA 5LRGA 5K8PA 1DTDA 3H8EA 2JBJA 2ZEDA 2QYVA 5HVHA 1VGYA 3ISXA 3MN8A 4O23A 3PFOA 2ZEGA 3B3WA 4G1PA 3SI1A 4H2KA 7CPAA 1CX8A 2PJBA 4P4BA 3NFZA 3KR4A 2ZEHA 3KASA 4WWVA 3S9LA 2IJZA 3TX8A 1QQ9A 2O53A 2HB6A 3SJFA 4P10A 4BD9A 5CBMA 1AYEA 3GLJA 2PJ7A 3FF3A 1GYTA 2V8DA 2EWBA 3TC8A 4OC2A 2CF4A 4R7MA 4NGPA 1Y0RA 4NFRA 4JYWA 5THWA 4OC1A 2OR4A 4ZX9A 4P44A 2PE3A 4KSIA 3IC1A 4NGNA 1BPMA 4X8IA 3PB6X 5HXDA 2HC9A 4ZY1A 4YWYA 2OOTA 4P45A 3KQZA 3WABA 4A39A 4TWEA 3FJUA 1BPNA 1Y0YA 4NGSA 3LMSA 4UEZA 1FT7A 4OC5A 2C6PA 4A37A 3N5FA 2O4HA 1TKHA 3SJXA 4TNUA 4NGRA 2C1CA 4CPAA 1ARMA 1RTQA 1KWMA 4OP4A 2V8HA 3IO1A 3L2NA 1Z2LA 5K8OA 1R3NA 5LYFA 3KI9A 3B3VA 4OIWA 4UEFA 2CTBA 2V8GA 3MRUA 3WC6A 2I3CA 1ELMP 2V8VA 5D29A 2PJCA 2PJ0A 5I4MA 1H8LA 1OBRA 2V77A 1Q7LA 3NH4A 4YU9A 3PB9X 4MRIA 1JQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PRQ A;  2CTC A;  2PJ5 A;  3B3C A;  4EWT A;  1ARL A;  4EFD A;  4OC0 A;  3FVL A;  4P4E A;  2PJ2 A;  1IGB A;  3PBE A;  3D68 A;  3WC7 A;  4RUH A;  4MHP A;  4NGM A;  2QVP A;  1XJO A;  1VHO A;  3IWW A;  4P4D A;  4W9Y A;  5IB9 A;  3T8W A;  3CDX A;  5LRJ A;  4OC3 A;  4MHY A;  4DUK A;  5JM6 A;  2F7V A;  1ELL P;  2GU2 A;  1Z8L A;  4NGQ A;  1ZG7 A;  4OKO A;  4P4I A;  3FED A;  4A94 A;  1M4L A;  1IY7 A;  3B7I A;  1Y7E A;  3B2Y A;  4ZI6 A;  3I1U A;  3CPX A;  8CPA A;  2NYQ A;  2POK A;  1F2O A;  3PB7 X;  1ZG8 A;  2PJ6 A;  4OC4 A;  3BXM A;  2ABZ A;  2XEI A;  1F2P A;  1VIX A;  5DS0 A;  4F9V A;  2VL1 A;  4NJQ A;  1YME A;  3DGV A;  3KQX A;  4MHZ A;  4B6Z A;  4FBE A;  4OID A;  2IMO A;  3DLJ A;  2EK8 A;  3D4U A;  1XFO A;  1XMB A;  2ZEF A;  3D7F A;  2BCO A;  3SI2 A;  3NA6 A;  4K3N A;  1XBU A;  1NSA A;  3PEI A;  1ZG9 A;  2XEJ A;  4DJL A;  1CP7 A;  3VAT A;  4MHN A;  4AXV A;  3HUV A;  1LFW A;  4LQG A;  1DE4 C;  5J1Q A;  4Z65 A;  3RBU A;  4X3R A;  3SI0 A;  4R8F A;  2PJA A;  2C6C A;  2PJ8 A;  4MCS A;  2DEA A;  2ZOF A;  2ZEO A;  3SJE A;  2CIJ A;  1HDQ A;  3NH8 A;  5F09 A;  4PXC A;  1LAN A;  4PPZ A;  3FMC A;  1ZLI A;  3PB8 X;  4JZ0 A;  3FH4 A;  3FEE A;  4NJR A;  1YSJ A;  2WYR A;  3PRT A;  5HVG A;  4UF4 A;  2G9D A;  3B3S A;  3KHX A;  3CPA A;  3PB4 X;  1HEE A;  2AFW A;  2AFU A;  2J9A A;  3LWU A;  3KL9 A;  1YW6 A;  1R43 A;  2ZOG A;  3NH5 A;  2AFS A;  2ANP A;  3FEC A;  4PXD A;  4F9U A;  3FX6 A;  2PJ9 A;  5K8N A;  2GLJ A;  4ZYQ A;  2JBK A;  1TKF A;  4UEE A;  3K9T A;  2ZEL A;  4PXE A;  4UIA A;  1CBX A;  5LRK A;  4IHM A;  2PJ1 A;  5CPA A;  4P4F A;  2F8H A;  1F57 A;  1BAV A;  2PVW A;  2AFM A;  2JEW A;  4MCR A;  3IFE A;  4X2T A;  4A38 A;  1Z5R A;  3IIB A;  2C6G A;  2RB7 A;  3CT9 A;  2Q4Z A;  3JRU A;  1TKJ A;  1LOK A;  2BO9 A;  2WZN A;  2FVG A;  3HLP A;  1LAM A;  5LYL A;  4WJB A;  2PVV A;  3IEH A;  2QJ8 A;  3PFE A;  2Q51 A;  3KGQ A;  3B35 A;  2RFH A;  4ONW A;  1VHE A;  5ELY A;  1TXR A;  1XRY A;  1CP6 A;  2NSM A;  3D7D A;  4FWU A;  1CPX A;  1TF8 A;  2XEF A;  2ZEM A;  4P6Y A;  5JH9 A;  4EME A;  2XEG A;  3VH9 A;  2ZEE A;  3BHX A;  1PCA A;  2GRE A;  2PIY A;  4UIB A;  4R76 A;  3IJ3 A;  4ZX8 A;  6CPA A;  2BOA A;  3KR5 A;  5JGF A;  2AFZ A;  4IAV A;  4PXB A;  3PBB A;  1FNO A;  4MCQ A;  3SJG A;  1AMP A;  3GUX A;  5LYD A;  2AFO A;  4R6T A;  4FUU A;  3D66 A;  2ZEP A;  4NGT A;  4ZY0 A;  1CPS A;  3S9M A;  1CG2 A;  5LYI A;  1YW4 A;  3GB0 A;  3WC5 A;  2PJ4 A;  4GM5 A;  1BLL E;  3WT4 A;  3VAR A;  4MMO A;  4OME A;  3BI0 A;  4P4J A;  5K8M A;  2PCU A;  4DYO A;  3B3T A;  1QMU A;  1YLO A;  1LAP A;  3H8G A;  4MCP A;  3ISZ A;  3S9N A;  2GLF A;  3BI1 A;  4IK2 A;  5HVF A;  1PYT B;  3K2K A;  3D67 A;  1EE3 P;  1LCP A;  3V38 A;  1TF9 A;  3KZW A;  4PQA A;  3H8F A;  4FAI A;  3QNV A;  2AFX A;  2PIZ A;  4ZY2 A;  2Q43 A;  4MXU A;  3RZA A;  2EK9 A;  3V7Z A;  5D8N A;  2ZEN A;  1UWY A;  3D7H A;  4Q7A A;  2PJ3 A;  3D7G A;  4F8Z A;  1HDU A;  3RAM A;  2IQ6 A;  1ZLH A;  3KHZ A;  5LRG A;  5K8P A;  1DTD A;  3H8E A;  2JBJ A;  2ZED A;  2QYV A;  5HVH A;  1VGY A;  3ISX A;  3MN8 A;  4O23 A;  3PFO A;  2ZEG A;  3B3W A;  4G1P A;  3SI1 A;  4H2K A;  7CPA A;  1CX8 A;  2PJB A;  4P4B A;  3NFZ A;  3KR4 A;  2ZEH A;  3KAS A;  4WWV A;  3S9L A;  2IJZ A;  3TX8 A;  1QQ9 A;  2O53 A;  2HB6 A;  3SJF A;  4P10 A;  4BD9 A;  5CBM A;  1AYE A;  3GLJ A;  2PJ7 A;  3FF3 A;  1GYT A;  2V8D A;  2EWB A;  3TC8 A;  4OC2 A;  2CF4 A;  4R7M A;  4NGP A;  1Y0R A;  4NFR A;  4JYW A;  5THW A;  4OC1 A;  2OR4 A;  4ZX9 A;  4P44 A;  2PE3 A;  4KSI A;  3IC1 A;  4NGN A;  1BPM A;  4X8I A;  3PB6 X;  5HXD A;  2HC9 A;  4ZY1 A;  4YWY A;  2OOT A;  4P45 A;  3KQZ A;  3WAB A;  4A39 A;  4TWE A;  3FJU A;  1BPN A;  1Y0Y A;  4NGS A;  3LMS A;  4UEZ A;  1FT7 A;  4OC5 A;  2C6P A;  4A37 A;  3N5F A;  2O4H A;  1TKH A;  3SJX A;  4TNU A;  4NGR A;  2C1C A;  4CPA A;  1ARM A;  1RTQ A;  1KWM A;  4OP4 A;  2V8H A;  3IO1 A;  3L2N A;  1Z2L A;  5K8O A;  1R3N A;  5LYF A;  3KI9 A;  3B3V A;  4OIW A;  4UEF A;  2CTB A;  2V8G A;  3MRU A;  3WC6 A;  2I3C A;  1ELM P;  2V8V A;  5D29 A;  2PJC A;  2PJ0 A;  5I4M A;  1H8L A;  1OBR A;  2V77 A;  1Q7L A;  3NH4 A;  4YU9 A;  3PB9 X;  4MRI A;  1JQG A; 
#chains in the Genus database with same CATH topology
 2PRQ A;  4FD7 A;  2CTC A;  2BUE A;  2PJ5 A;  3B3C A;  3G8W A;  4EWT A;  1ARL A;  5A27 A;  3EY5 A;  3T90 A;  4EFD A;  4OC0 A;  4MFJ A;  3S6G A;  5JPH A;  4R9M A;  2VI7 A;  3FVL A;  4CYO A;  4P4E A;  2PJ2 A;  4MFK A;  1IGB A;  3PBE A;  3D68 A;  3FYN A;  2WUU A;  3WC7 A;  4RUH A;  5EC4 A;  4MHP A;  4NGM A;  2PSW A;  2QVP A;  1IIC A;  3PZJ A;  1XJO A;  1OZP A;  2Z3N A;  1VHO A;  3IWW A;  4P4D A;  4W9Y A;  3W6X A;  5IB9 A;  1S60 A;  2KCW A;  3D2M A;  3FIX A;  4KLW A;  4MY3 A;  4A32 A;  4F0X A;  2Q04 A;  5KTA A;  3T8W A;  3CDX A;  5LRJ A;  5DWN A;  4OC3 A;  4MHY A;  2K5T A;  4DUK A;  5JM6 A;  1BO4 A;  2OZG A;  2FIA A;  2ARH A;  4MFZ A;  1M44 A;  2PR8 A;  2JDC A;  4PSW A;  4CAE A;  2F7V A;  1ELL P;  1YLE A;  2GU2 A;  1Z8L A;  4UFV A;  4NGQ A;  1ZG7 A;  4OKO A;  4MBU A;  4P4I A;  1RXT A;  3FED A;  5HH1 A;  2HV2 A;  4A94 A;  1M4L A;  1IY7 A;  3B7I A;  1Y7E A;  2FT0 A;  3B2Y A;  2R1I A;  1NSL A;  5C88 A;  1IOF A;  4B14 A;  4ZI6 A;  3I1U A;  4XPD B;  4KUA A;  4K30 A;  3JTK A;  4IF5 A;  3CPX A;  8CPA A;  2NYQ A;  2POK A;  5E96 A;  1F2O A;  3PB7 X;  1IOI A;  2F5I A;  4C2Y A;  2PRB A;  2CXA A;  3E0K A;  1ZG8 A;  2PJ6 A;  4OC4 A;  3BXM A;  4GS4 A;  2VXK A;  2ABZ A;  4M85 A;  4UFX A;  4UBR A;  3R96 A;  2XEI A;  1F2P A;  1VIX A;  5DS0 A;  3W91 A;  2VL1 A;  4F9V A;  2Q4V A;  4NJQ A;  1QSR A;  2EUI A;  2J8M A;  4XPK A;  2Z3O A;  1YME A;  3DGV A;  3KQX A;  4MHZ A;  4E8O A;  3SXO A;  4B6Z A;  4FBE A;  4OID A;  2IMO A;  3DLJ A;  2EK8 A;  3D4U A;  3I3G A;  1XFO A;  4CGL A;  1XMB A;  4B10 A;  2ZEF A;  3D7F A;  2BCO A;  4KOS A;  4KSA A;  3SI2 A;  2ZW6 A;  3NA6 A;  3IWG A;  4K3N A;  1XBU A;  4CYP A;  3D3S A;  5AG4 A;  3BJ8 A;  1NSA A;  3PEI A;  5KTC A;  4IUS A;  1P0H A;  3CZX A;  1ZG9 A;  2QEC A;  4GXH A;  2XEJ A;  2PQ8 A;  4DJL A;  4M6I A;  1CP7 A;  3VAT A;  4MHN A;  4AXV A;  3HUV A;  3TO9 A;  3W6S A;  1LFW A;  1R57 A;  3N7Z A;  4Q38 A;  1Z9U A;  2Q4Y A;  3D8P A;  4B12 A;  4R57 A;  4LQG A;  1DE4 C;  1MJA A;  5G22 A;  4Y49 C;  5A28 A;  4AB7 A;  5J1Q A;  4Z65 A;  3RBU A;  4X3R A;  3SI0 A;  4R8F A;  2PJA A;  4JWP A;  2C6C A;  4XPD C;  4FD5 A;  3ZZI A;  2PJ8 A;  5JQ4 A;  4MCS A;  2DEA A;  2ZOF A;  2ZEO A;  3SJE A;  2R8V A;  2CIJ A;  4QB9 A;  1HDQ A;  2Z3K A;  3NH8 A;  4PV6 A;  5F09 A;  4PXC A;  1LAN A;  3CXP A;  4PPZ A;  3FMC A;  1M4I A;  1ZLI A;  3PB8 X;  4JZ0 A;  1IYK A;  1KUV A;  3FH4 A;  3FEE A;  3P2F A;  1I21 A;  1YSJ A;  3R1K A;  2WYR A;  1NE9 A;  3PRT A;  4NJR A;  4CGM A;  5HVG A;  1S7N A;  2VQY A;  4PK3 A;  4II9 A;  3R95 A;  4UF4 A;  2YNE A;  4XNH C;  3TE4 A;  2G9D A;  2ZW4 A;  4YRH A;  3B3S A;  3MGD A;  3KHX A;  3CPA A;  3IU1 A;  5AGE A;  2JDD A;  2YNC C;  3PB4 X;  1HEE A;  2AFW A;  2AFU A;  2J9A A;  1N71 A;  3LWU A;  5AG7 A;  3K9U A;  4MY0 A;  3KL9 A;  3R9E A;  1R43 A;  1YW6 A;  2ZOG A;  2I00 A;  3NH5 A;  4M6G A;  2AFS A;  1S3Z A;  2ANP A;  3FEC A;  4MFP A;  4PXD A;  3GYA A;  3FX6 A;  4F9U A;  4C7I A;  1Q2C A;  2PJ9 A;  4UWI A;  5K8N A;  5EMI A;  4OAD A;  2GLJ A;  4ZYQ A;  2JLM A;  2JBK A;  4DNC A;  1TKF A;  4UEE A;  3K9T A;  2Z0Z A;  4PSX A;  3VWD A;  4KS9 A;  2R98 A;  2REF A;  2ZEL A;  2HQY A;  2ZW7 A;  3TO6 A;  4PXE A;  1YRE A;  4UIA A;  1S5K A;  1CBX A;  4KLV A;  2P6E A;  2OZU A;  4KVO E;  3S6F A;  5LRK A;  4IHM A;  2YGW A;  3FB3 A;  2PJ1 A;  5CPA A;  3TCV A;  4U9Y A;  4P4F A;  1YR0 A;  4C7H A;  1MJ9 A;  2F8H A;  4CAF A;  1F57 A;  1BAV A;  2PVW A;  2AFM A;  2JEW A;  4MCR A;  4B5P A;  2P0W A;  3FNC A;  1M4D A;  4FD4 A;  4RI1 A;  3IWE A;  3IFE A;  4X2T A;  4KOR A;  4A38 A;  1Z5R A;  3IIB A;  3JUW A;  3NE8 A;  4UFW A;  4KUB A;  3S6H A;  4CGP A;  2C6G A;  2RB7 A;  2Z3L A;  2Q4Z A;  3CT9 A;  3GY9 A;  3JRU A;  1TKJ A;  4JXQ A;  5F49 A;  1LOK A;  2BO9 A;  2WZN A;  2FVG A;  3HLP A;  1LAM A;  4X5K A;  5LYL A;  1FY7 A;  4M3S A;  4B5P B;  4WJB A;  2PVV A;  2WSA A;  2CNM A;  3RNZ A;  4A30 A;  2Q44 A;  4RN7 A;  3PP9 A;  1WWZ A;  4CAX A;  3IEH A;  2QJ8 A;  3PFE A;  2Q51 A;  3KGQ A;  3B35 A;  2RFH A;  4ONW A;  1VHE A;  5ELY A;  1TXR A;  1XRY A;  3TFY A;  1CP6 A;  2NSM A;  3JVN A;  5CNP A;  4J3G A;  1IB1 E;  3TOB A;  3D7D A;  4FWU A;  3A9L A;  2FCK A;  1CPX A;  5F48 A;  1TF8 A;  2XEF A;  2ZEM A;  4CS0 B;  4P6Y A;  5JH9 A;  2X7B A;  4EME A;  4KOT A;  1ON0 A;  2PDO A;  4MJ8 A;  1LRZ A;  2XEG A;  4ONU A;  4UCP A;  3VH9 A;  2ZEE A;  4LUA A;  4EVY A;  3BHX A;  4F6A A;  1PCA A;  2AJ6 A;  2Q7S A;  1YK3 A;  2GRE A;  2PIY A;  4JD6 A;  4UIB A;  4R76 A;  3IJ3 A;  4C68 A;  4ZX8 A;  2CNS A;  6CPA A;  4L89 A;  2BOA A;  3KR5 A;  5JGF A;  1X10 A;  1XOV A;  1P4N A;  4AVC A;  4H6U A;  4KSF A;  2VZZ A;  2GIV A;  2J8N A;  1XMT A;  2GFQ A;  2O28 A;  4UCM A;  2AFZ A;  2Z3M A;  4IAV A;  1QST A;  4PXB A;  3PBB A;  1FNO A;  3DDD A;  4MCQ A;  3SJG A;  1AMP A;  4A2Z A;  1XE4 A;  5IX3 A;  4AG9 A;  1S7L A;  4YGO A;  5I0C A;  2B3U A;  3GUX A;  5LYD A;  2AFO A;  4R6T A;  2Q7B A;  2REE A;  1QSM A;  1Y9W A;  4FUU A;  4L8A A;  3F5B A;  4KOV A;  1XEB A;  3D66 A;  2ZEP A;  4NGT A;  2G0B A;  4HNW B;  3T9Y A;  4ZY0 A;  1CPS A;  3S9M A;  1CG2 A;  5H84 A;  1VHS A;  1TIQ A;  5LYI A;  1YW4 A;  3GB0 A;  3WC5 A;  2PJ4 A;  1SQH A;  5AG6 A;  2DF5 A;  4GM5 A;  3TTH A;  4JJX A;  1Q2Y A;  1BLL E;  1I1D A;  1KZF A;  2R7H A;  5AG5 A;  3GKR A;  3FXT A;  1QSO A;  3VAR A;  3WT4 A;  5J8F A;  2B4D A;  4MMO A;  2DXQ A;  3EC4 A;  3BI0 A;  4OME A;  4P4J A;  5K8M A;  4KOX A;  2PCU A;  1KUY A;  4DYO A;  3B3T A;  4NEX A;  2C27 A;  1QMU A;  2PR1 A;  1YLO A;  4CAV A;  1LAP A;  5IV0 A;  3H8G A;  4MCP A;  1YVO A;  3ISZ A;  2PC1 A;  2B4D B;  2GLF A;  3BI1 A;  2P6G A;  3S9N A;  4IK2 A;  1MK4 A;  3IGR A;  4R3L A;  1PYT B;  3K2K A;  4OAE A;  5HVF A;  3RO0 A;  5J8C A;  3D67 A;  4HNY B;  4FD6 A;  4CAW A;  1EE3 P;  1LCP A;  2FE7 A;  3V38 A;  3FBU A;  1QSN A;  1TF9 A;  3KZW A;  3V8I A;  3DNS A;  4HKF A;  4PQA A;  3H8F A;  4FAI A;  3QNV A;  2AFX A;  2PIZ A;  4KZT A;  2Z10 A;  1Y9K A;  2EVN A;  5F47 A;  4HNX B;  4ZY2 A;  3EO4 A;  4UA3 A;  1X12 A;  2Q43 A;  4NCZ A;  4MXU A;  1Q2D A;  4H89 A;  3RZA A;  4CRZ B;  2EK9 A;  3V7Z A;  4ZBG A;  5D8N A;  3GIU A;  2BL1 A;  2B5G B;  2ZPA A;  2IL4 A;  2ZEN A;  1CJW A;  1UWY A;  3D7H A;  4Q7A A;  2PJ3 A;  5KTD A;  2JEV A;  3D7G A;  1M1D A;  2ZXV A;  2NMT A;  3SHP A;  4QBJ A;  1WK4 A;  4LX9 A;  5FVJ A;  4F8Z A;  4F0Y A;  1HDU A;  4MHD A;  3RAM A;  2IQ6 A;  1XIX A;  2B58 A;  2Z11 A;  2QIR A;  4E2A A;  3LOD A;  2B4B A;  1V0C A;  4YFJ A;  1ZLH A;  2CY2 A;  4ZGY B;  3KHZ A;  3LAC A;  4RS2 A;  5LRG A;  2FS5 A;  5K8P A;  1RO5 A;  1DTD A;  3F0A A;  3TT2 A;  3H8E A;  1PUA A;  5DWM A;  3DR6 A;  2JBJ A;  4CRY B;  3EXN A;  3C26 A;  1MJB A;  4A31 A;  1Z8W A;  2ZED A;  3DSB A;  2BSW A;  2QYV A;  4KOY A;  1VGY A;  3FRM A;  3ISX A;  3MN8 A;  4O23 A;  5EBV A;  3PFO A;  4B11 A;  5HVH A;  1Y7R A;  3VWE A;  2ZEG A;  3QAH A;  4JXR A;  3B3W A;  4KOU A;  2AE6 A;  2DPT A;  3F8K A;  4CGO A;  4UWJ A;  4CYQ A;  4G1P A;  5HMN A;  5H86 A;  3SI1 A;  4H2K A;  5BWA B;  1M4G A;  2A4N A;  1PU9 A;  7CPA A;  1KUX A;  1CX8 A;  4NF1 A;  2PJB A;  2WPX A;  4P4B A;  3NFZ A;  4H6Z A;  3KR4 A;  1UFH A;  2OU2 A;  2ZEH A;  3KAS A;  1J4J A;  4WWV A;  4Y49 B;  3H5Z A;  1CM0 A;  1Z8T A;  3S9L A;  2IJZ A;  3IU2 A;  3TX8 A;  1QQ9 A;  2O53 A;  2HB6 A;  2VBQ A;  4LQ6 A;  3SJF A;  2QML A;  4QVT A;  4P10 A;  2ATR A;  1A2Z A;  3B8G A;  4BD9 A;  2OH1 A;  3H4Q A;  3SXN A;  1AYE A;  3GLJ A;  3R9F A;  2PJ7 A;  3R9G A;  5CBM A;  4MFQ A;  3FF3 A;  1U6M A;  1GYT A;  2J8R A;  1K4J A;  4KVM E;  4AG7 A;  3G3S A;  2YNC A;  2VZY A;  3ZJ0 A;  5C82 A;  2V8D A;  2EWB A;  4U5Y A;  4AVA A;  3TC8 A;  4NSQ A;  4OC2 A;  3UY5 A;  1IU8 A;  1YQE A;  2VEZ A;  2RC4 A;  2CF4 A;  2P6F A;  4XNH B;  3EFA A;  4R7M A;  3CXQ A;  4NGP A;  3WR7 A;  3TO7 A;  1Y0R A;  4HPS A;  4BIN A;  1L0C A;  4NFR A;  4I49 A;  4JYW A;  1S7K A;  5THW A;  4OC1 A;  1JWQ A;  4KOW A;  2OR4 A;  2Q0Y A;  4P44 A;  4ZX9 A;  4B13 A;  4CGN A;  1Z8X A;  2HUZ A;  2PE3 A;  2H5M A;  4C2X A;  4KSI A;  2D4P A;  3IC1 A;  4QC6 A;  3KKW A;  4NGN A;  2D4O A;  2GE3 A;  1BPM A;  4A33 A;  4X8I A;  3PB6 X;  3BLN A;  5HXD A;  1IID A;  2HC9 A;  4AVB A;  4ZY1 A;  4YWY A;  1YX0 A;  2OOT A;  4U9Z A;  4P45 A;  4E0A A;  5G20 A;  3TOA A;  1Z4E A;  3KQZ A;  3D2P A;  3WAB A;  4A39 A;  3LD2 A;  4KVX A;  2Z3P A;  4TWE A;  5IB0 A;  1GHE A;  1AUG A;  1BPN A;  1Y0Y A;  2OZH A;  3FJU A;  4Q36 A;  4NGS A;  3LMS A;  4UEZ A;  2WPW A;  1FT7 A;  4OC5 A;  5ISV A;  1VKC A;  1I12 A;  2C6P A;  2Y0M A;  3CXS A;  4A37 A;  3N5F A;  4QUS A;  2O4H A;  1TKH A;  4CYN A;  2ODF A;  2CNT A;  2DPS A;  3SJX A;  4BMH A;  1B6B A;  4MI4 A;  4TNU A;  4NGR A;  5F46 A;  2ZW5 A;  2C1C A;  1B87 A;  4CPA A;  1ARM A;  1NMT A;  1RTQ A;  1IYL A;  4JLY A;  1XF8 A;  5G1Z A;  1KWM A;  2EO8 A;  4OP4 A;  2V8H A;  4BBH A;  2OB0 A;  3IO1 A;  4R3K A;  3L2N A;  2B5G A;  2FL4 A;  4OLL A;  4B5O A;  1BOB A;  1Z2L A;  5K8O A;  5G21 A;  1R3N A;  3S6K A;  5LYF A;  3KI9 A;  4XPL A;  3B3V A;  4ORF A;  2G3T A;  4OIW A;  4UEF A;  1S7F A;  1YVK A;  3QB8 A;  3RYO A;  3PGP A;  1Z4R A;  2CTB A;  2V8G A;  4UCN A;  3MRU A;  4PK2 A;  3WC6 A;  2EBJ A;  2I3C A;  2I79 A;  2YND A;  4NXY A;  5GCN A;  2FXF A;  3OWC A;  1ELM P;  2V8V A;  4M6H A;  3BJ7 A;  1YGH A;  3NE7 A;  5D29 A;  2B3V A;  2PJC A;  2PJ0 A;  2BEI A;  5I4M A;  1H8L A;  1OBR A;  4C2Z A;  2GAN A;  2V77 A;  2FSR A;  3I9S A;  4R87 A;  1Q7L A;  2FIW A;  3NH4 A;  2G3A A;  4YU9 A;  3P2H A;  3PB9 X;  4MFL A;  3QAY A;  4MRI A;  1JQG A;  4A95 A;  1ZO0 A;  3DR8 A; 
#chains in the Genus database with same CATH homology
 2PRQ A;  2CTC A;  2PJ5 A;  3B3C A;  4EWT A;  1ARL A;  4EFD A;  4OC0 A;  3FVL A;  4P4E A;  2PJ2 A;  1IGB A;  3PBE A;  3D68 A;  3WC7 A;  4RUH A;  4MHP A;  4NGM A;  2QVP A;  1XJO A;  1VHO A;  3IWW A;  4P4D A;  4W9Y A;  5IB9 A;  3T8W A;  3CDX A;  5LRJ A;  4OC3 A;  4MHY A;  4DUK A;  5JM6 A;  2F7V A;  1ELL P;  2GU2 A;  1Z8L A;  4NGQ A;  1ZG7 A;  4OKO A;  4P4I A;  3FED A;  4A94 A;  1M4L A;  1IY7 A;  3B7I A;  1Y7E A;  3B2Y A;  4ZI6 A;  3I1U A;  3CPX A;  8CPA A;  2NYQ A;  2POK A;  1F2O A;  3PB7 X;  1ZG8 A;  2PJ6 A;  4OC4 A;  3BXM A;  2ABZ A;  2XEI A;  1F2P A;  1VIX A;  5DS0 A;  4F9V A;  2VL1 A;  4NJQ A;  1YME A;  3DGV A;  3KQX A;  4MHZ A;  4B6Z A;  4FBE A;  4OID A;  2IMO A;  3DLJ A;  2EK8 A;  3D4U A;  1XFO A;  1XMB A;  2ZEF A;  3D7F A;  2BCO A;  3SI2 A;  3NA6 A;  4K3N A;  1XBU A;  1NSA A;  3PEI A;  1ZG9 A;  2XEJ A;  4DJL A;  1CP7 A;  3VAT A;  4MHN A;  4AXV A;  3HUV A;  1LFW A;  4LQG A;  1DE4 C;  5J1Q A;  4Z65 A;  3RBU A;  4X3R A;  3SI0 A;  4R8F A;  2PJA A;  2C6C A;  2PJ8 A;  4MCS A;  2DEA A;  2ZOF A;  2ZEO A;  3SJE A;  2CIJ A;  1HDQ A;  3NH8 A;  5F09 A;  4PXC A;  1LAN A;  4PPZ A;  3FMC A;  1ZLI A;  3PB8 X;  4JZ0 A;  3FH4 A;  3FEE A;  4NJR A;  1YSJ A;  2WYR A;  3PRT A;  5HVG A;  4UF4 A;  2G9D A;  3B3S A;  3KHX A;  3CPA A;  3PB4 X;  1HEE A;  2AFW A;  2AFU A;  2J9A A;  3LWU A;  3KL9 A;  1YW6 A;  1R43 A;  2ZOG A;  3NH5 A;  2AFS A;  2ANP A;  3FEC A;  4PXD A;  4F9U A;  3FX6 A;  2PJ9 A;  5K8N A;  2GLJ A;  4ZYQ A;  2JBK A;  1TKF A;  4UEE A;  3K9T A;  2ZEL A;  4PXE A;  4UIA A;  1CBX A;  5LRK A;  4IHM A;  2PJ1 A;  5CPA A;  4P4F A;  2F8H A;  1F57 A;  1BAV A;  2PVW A;  2AFM A;  2JEW A;  4MCR A;  3IFE A;  4X2T A;  4A38 A;  1Z5R A;  3IIB A;  2C6G A;  2RB7 A;  3CT9 A;  2Q4Z A;  3JRU A;  1TKJ A;  1LOK A;  2BO9 A;  2WZN A;  2FVG A;  3HLP A;  1LAM A;  5LYL A;  4WJB A;  2PVV A;  3IEH A;  2QJ8 A;  3PFE A;  2Q51 A;  3KGQ A;  3B35 A;  2RFH A;  4ONW A;  1VHE A;  5ELY A;  1TXR A;  1XRY A;  1CP6 A;  2NSM A;  3D7D A;  4FWU A;  1CPX A;  1TF8 A;  2XEF A;  2ZEM A;  4P6Y A;  5JH9 A;  4EME A;  2XEG A;  3VH9 A;  2ZEE A;  3BHX A;  1PCA A;  2GRE A;  2PIY A;  4UIB A;  4R76 A;  3IJ3 A;  4ZX8 A;  6CPA A;  2BOA A;  3KR5 A;  5JGF A;  2AFZ A;  4IAV A;  4PXB A;  3PBB A;  1FNO A;  4MCQ A;  3SJG A;  1AMP A;  3GUX A;  5LYD A;  2AFO A;  4R6T A;  4FUU A;  3D66 A;  2ZEP A;  4NGT A;  4ZY0 A;  1CPS A;  3S9M A;  1CG2 A;  5LYI A;  1YW4 A;  3GB0 A;  3WC5 A;  2PJ4 A;  4GM5 A;  1BLL E;  3WT4 A;  3VAR A;  4MMO A;  4OME A;  3BI0 A;  4P4J A;  5K8M A;  2PCU A;  4DYO A;  3B3T A;  1QMU A;  1YLO A;  1LAP A;  3H8G A;  4MCP A;  3ISZ A;  3S9N A;  2GLF A;  3BI1 A;  4IK2 A;  5HVF A;  1PYT B;  3K2K A;  3D67 A;  1EE3 P;  1LCP A;  3V38 A;  1TF9 A;  3KZW A;  4PQA A;  3H8F A;  4FAI A;  3QNV A;  2AFX A;  2PIZ A;  4ZY2 A;  2Q43 A;  4MXU A;  3RZA A;  2EK9 A;  3V7Z A;  5D8N A;  2ZEN A;  1UWY A;  3D7H A;  4Q7A A;  2PJ3 A;  3D7G A;  4F8Z A;  1HDU A;  3RAM A;  2IQ6 A;  1ZLH A;  3KHZ A;  5LRG A;  5K8P A;  1DTD A;  3H8E A;  2JBJ A;  2ZED A;  2QYV A;  5HVH A;  1VGY A;  3ISX A;  3MN8 A;  4O23 A;  3PFO A;  2ZEG A;  3B3W A;  4G1P A;  3SI1 A;  4H2K A;  7CPA A;  1CX8 A;  2PJB A;  4P4B A;  3NFZ A;  3KR4 A;  2ZEH A;  3KAS A;  4WWV A;  3S9L A;  2IJZ A;  3TX8 A;  1QQ9 A;  2O53 A;  2HB6 A;  3SJF A;  4P10 A;  4BD9 A;  5CBM A;  1AYE A;  3GLJ A;  2PJ7 A;  3FF3 A;  1GYT A;  2V8D A;  2EWB A;  3TC8 A;  4OC2 A;  2CF4 A;  4R7M A;  4NGP A;  1Y0R A;  4NFR A;  4JYW A;  5THW A;  4OC1 A;  2OR4 A;  4ZX9 A;  4P44 A;  2PE3 A;  4KSI A;  3IC1 A;  4NGN A;  1BPM A;  4X8I A;  3PB6 X;  5HXD A;  2HC9 A;  4ZY1 A;  4YWY A;  2OOT A;  4P45 A;  3KQZ A;  3WAB A;  4A39 A;  4TWE A;  3FJU A;  1BPN A;  1Y0Y A;  4NGS A;  3LMS A;  4UEZ A;  1FT7 A;  4OC5 A;  2C6P A;  4A37 A;  3N5F A;  2O4H A;  1TKH A;  3SJX A;  4TNU A;  4NGR A;  2C1C A;  4CPA A;  1ARM A;  1RTQ A;  1KWM A;  4OP4 A;  2V8H A;  3IO1 A;  3L2N A;  1Z2L A;  5K8O A;  1R3N A;  5LYF A;  3KI9 A;  3B3V A;  4OIW A;  4UEF A;  2CTB A;  2V8G A;  3MRU A;  3WC6 A;  2I3C A;  1ELM P;  2V8V A;  5D29 A;  2PJC A;  2PJ0 A;  5I4M A;  1H8L A;  1OBR A;  2V77 A;  1Q7L A;  3NH4 A;  4YU9 A;  3PB9 X;  4MRI A;  1JQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...