1U6MA

The crystal structure of acetyltransferase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
189
structure length
189
Chain Sequence
SLIRSATKEDGQAIARLVLVILKDMELPILEEVSEEQMIDLLAEATAYPTYRYGYQRILVYEHAGEVAGIAVGYPAEDEKIIDEPLREVFKKHGLAEDVRLFIEEETLPNEWYLDTISVDERFRGMGIGSKLLDALPEVAKASGKQALGLNVDFDNPGARKLYASKGFKDVTTMTISGHLYNHMQKEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords acetyltransferase, GNAT family
publication title The crystal structure of acetyltransferase, GNAT family from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
molecule tags Transferase
total genus 50
structure length 189
sequence length 189
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1u6mA00
1I12A 3E0KA 1VKCA 2PDOA 4E0AA 4UWJA 2FIAA 5KTCA 4M85A 2AE6A 3S6KA 2B58A 1P4NA 3G8WA 4RI1A 1FY7A 2ZW6A 4KOYA 1S3ZA 3FYNA 4KVME 4QB9A 3TO9A 2Y0MA 3D3SA 3TTHA 2FCKA 2QIRA 2O28A 1M4IA 2HV2A 4FD5A 5IX3A 3EFAA 3JVNA 2Z10A 1WWZA 4RS2A 2Z11A 3F8KA 1VHSA 4CS0B 5DWNA 5DWMA 1QSOA 3MGDA 2EVNA 3CXSA 4UWIA 1U6MA 1PUAA 3W6SA 2VI7A 1YVOA 4H6UA 4PV6A 4KVOE 1MK4A 4KORA 4XPKA 1MJ9A 3UY5A 1L0CA 1CJWA 2FSRA 3ZJ0A 4FD6A 3QB8A 4IUSA 5F46A 4HNYB 4AG7A 1S7NA 4JLYA 1N71A 4JXRA 4NXYA 4AVBA 4F0YA 2R7HA 4LUAA 3TE4A 4JXQA 3TFYA 2PR1A 1YK3A 1QSNA 4CRZB 4KOVA 3S6GA 4Y49C 1CM0A 4JWPA 1XE4A 3R9GA 4B5OA 5C82A 4KUBA 4QBJA 3QAHA 4FD4A 3D2PA 1M44A 3F0AA 2WPXA 1QSTA 2VZZA 1NSLA 3D8PA 2FXFA 2VXKA 4PK3A 2CNMA 2BL1A 4EVYA 1KZFA 1Z4EA 2NMTA 2P6FA 4JJXA 4U9YA 4CRYB 1XMTA 1MJBA 4X5KA 4NF1A 5I0CA 4U9ZA 2GE3A 2B3UA 4MI4A 4B5PB 4XNHB 1OZPA 1UFHA 1XIXA 4OAEA 1NMTA 3PZJA 4PSWA 4J3GA 4R3LA 1IB1E 1TIQA 3EO4A 2OH1A 3P2FA 4MHDA 2OU2A 2R8VA 2ZXVA 3T9YA 1YX0A 2VQYA 4KOUA 1Z9UA 2ATRA 1P0HA 2P6EA 3R1KA 2D4PA 2C27A 2J8RA 3R95A 2PQ8A 4YFJA 4XPDB 3R9FA 5HH1A 5F49A 2Q0YA 4QUSA 5EC4A 1IIDA 3FIXA 2PSWA 4E2AA 2JEVA 2QMLA 4R57A 4AG9A 1Q2DA 3D2MA 1YVKA 2CNSA 2ZW7A 2JDDA 4PSXA 2AJ6A 5J8CA 1YGHA 4AB7A 3I9SA 1BOBA 3R96A 1XF8A 4UA3A 5E96A 1QSMA 1YLEA 4MY3A 2B4DB 2J8MA 3LODA 4GS4A 4YGOA 4UBRA 2BSWA 1BO4A 1K4JA 2CNTA 2ZW4A 1I21A 3TO7A 2QECA 1Y7RA 2GANA 1M1DA 1Q2CA 4U5YA 3RYOA 2KCWA 3IWGA 2G0BA 4H89A 4HNWB 3NE7A 3F5BA 1PU9A 1Y9KA 4QC6A 5CNPA 2B3VA 3P2HA 5IB0A 4QVTA 1RXTA 4IF5A 2PR8A 3C26A 5ISVA 1B87A 4E8OA 3W91A 2ARHA 3TOAA 4HKFA 4ZBGA 4K30A 2HUZA 2B4BA 2OZGA 4XNHC 3SXOA 3TCVA 5JQ4A 5FVJA 3OWCA 5KTDA 2OZUA 4AVCA 3S6HA 4KLWA 2Q4VA 2Z0ZA 1YREA 4BMHA 1I1DA 5KTAA 2P6GA 2JLMA 4CAVA 2Q04A 2OB0A 4MJ8A 4B5PA 2H5MA 3TT2A 5JPHA 3DNSA 2FE7A 3FNCA 4XPDC 1R57A 5H84A 2VBQA 5HMNA 2VEZA 4HNXB 4KOSA 4PK2A 2K5TA 3SXNA 2P0WA 4KLVA 2G3TA 3K9UA 1WK4A 2BUEA 4I49A 4NSQA 1NE9A 3CXQA 4KOTA 2I79A 2Q4YA 2B5GB 2EUIA 4R87A 1KUVA 1M4DA 4ONUA 2ZW5A 2ZPAA 3WR7A 2G3AA 2DXQA 3CXPA 4KOWA 4OLLA 2B5GA 3FRMA 3BJ7A 3PGPA 2R98A 3GY9A 2CY2A 4DNCA 3DR6A 2REEA 1J4JA 1LRZA 2FIWA 2HQYA 4KZTA 1MJAA 3DDDA 3GKRA 4KVXA 2REFA 2IL4A 1QSRA 3BLNA 1S5KA 4XPLA 3JUWA 4H6ZA 2B4DA 3TO6A 2X7BA 3S6FA 1YR0A 1RO5A 1S60A 2PC1A 3EXNA 2D4OA 2FL4A 3EC4A 3GYAA 3LD2A 4JD6A 4ORFA 1KUYA 4MBUA 4R9MA 3R9EA 1Y9WA 2OZHA 3I3GA 4KUAA 2R1IA 4NCZA 4OADA 5F48A 2RC4A 3V8IA 1S7LA 3EY5A 1M4GA 2JDCA 3T90A 1S7KA 1IYLA 3H4QA 3G3SA 1SQHA 4FD7A 4AVAA 1KUXA 2Q44A 5EBVA 3VWDA 5IV0A 1IICA 1GHEA 3DSBA 5F47A 1XEBA 3FBUA 4M3SA 2GIVA 3B8GA 2I00A 3IGRA 4F6AA 3FB3A 4MY0A 2WPWA 2FS5A 1IYKA 2F5IA 3VWEA 4II9A 1Z4RA 2BEIA 4Y49B 3BJ8A 3KKWA 2FT0A 3SHPA 3DR8A 2VZYA 4KOXA 3TOBA 1Q2YA 1ON0A 1S7FA 4L89A 3N7ZA 4CAWA 5H86A 3ZZIA 3PP9A 5GCNA 2PRBA 4R3KA 4L8AA 2Q7BA 2A4NA 1V0CA 3W6XA 2J8NA 4CAXA 1B6BA 4NEXA 5C88A 4YRHA 3FXTA 4LX9A 5J8FA
chains in the Genus database with same CATH superfamily
1I12A 3E0KA 1VKCA 2PDOA 3IO1A 4E0AA 4UWJA 2FIAA 4H2KA 4A37A 3ISXA 4P4FA 4A32A 5HVGA 5KTCA 4M85A 2AE6A 2PJCA 4NGPA 3S6KA 2B58A 4CAFA 4P6YA 1P4NA 3G8WA 4RI1A 1FY7A 1EE3P 2EBJA 4KS9A 2PJBA 1Y0RA 2ZW6A 3PB6X 2AFWA 1S3ZA 4KOYA 5HVFA 3FYNA 3WC7A 5AG6A 2IMOA 4KVME 4QB9A 3TO9A 2Y0MA 3D3SA 3TTHA 5D29A 2FCKA 2QIRA 2O28A 1M4IA 2HV2A 4FD5A 4Q38A 4RUHA 5IX3A 3EFAA 2PJ0A 3JVNA 3L2NA 2Z10A 1WWZA 3IJ3A 4UFXA 4MFZA 3K2KA 2DPSA 4RS2A 5DS0A 2PVVA 1Z2LA 2Z11A 3SI1A 3F8KA 2JBJA 1LCPA 4UCPA 1VHSA 4CS0B 5DWNA 2C6GA 4M6GA 4A33A 3BHXA 3PFEA 5DWMA 3NA6A 2ZOFA 1VIXA 1OBRA 4PXBA 1QSOA 2QVPA 1CX8A 3MGDA 4KSFA 4UIBA 5EMIA 2PJ1A 1TKFA 1ZG8A 1FT7A 5IB9A 3I1UA 4MXUA 4GM5A 2EVNA 3JTKA 1TKJA 3CXSA 4UWIA 1U6MA 1PUAA 4UCNA 3W6SA 4MHYA 1JQGA 2VI7A 1YVOA 4H6UA 3TX8A 1XRYA 4PV6A 4KVOE 1MK4A 3GIUA 4OC2A 5JH9A 4KORA 2PJAA 2PJ4A 5HVHA 4XPKA 2F7VA 4UEEA 2ODFA 1MJ9A 3UY5A 1L0CA 1CJWA 1R3NA 3CZXA 4X8IA 2FSRA 3ZJ0A 1XJOA 4FD6A 3QB8A 2Q51A 4CYPA 1IOFA 4IUSA 5LRJA 3NE8A 1LANA 4ZI6A 2ZEGA 4HNYB 5F46A 2CTBA 5JM6A 4AG7A 1S7NA 4JLYA 1DTDA 1N71A 5HXDA 4JXRA 3LWUA 4NXYA 3MRUA 3D66A 4AVBA 4F0YA 2R7HA 4LUAA 3TE4A 4JXQA 3SI0A 2PR1A 3TFYA 1YK3A 3VH9A 1QSNA 4CRZB 1RTQA 2Z3KA 1DE4C 4KOVA 4MRIA 4X3RA 3S6GA 4NFRA 4Y49C 1CM0A 3H8EA 4JWPA 1TF8A 1XE4A 3R9GA 4B5OA 5C82A 4KUBA 2XEFA 3KHZA 4MCRA 1TXRA 4QBJA 3QAHA 4FD4A 3D2PA 1M44A 1R43A 3F0AA 3GUXA 3IIBA 2WPXA 1JWQA 1QSTA 2VZZA 4P4BA 3D7DA 4OIWA 1NSLA 3D8PA 1KWMA 2V77A 2FXFA 2VXKA 4PK3A 4CGPA 2CNMA 4JZ0A 2BL1A 4EVYA 1KZFA 1Z4EA 2NMTA 2P6FA 4JJXA 4U9YA 4AXVA 1XMTA 2WZNA 1MJBA 4X5KA 4CRYB 4Z65A 5J1QA 2YNCC 4NF1A 2IJZA 5BWAB 5I0CA 4U9ZA 4PQAA 2GE3A 2B3UA 4MI4A 4NGRA 4PXEA 1TKHA 4B5PB 1A2ZA 4XNHB 4B6ZA 1OZPA 1LOKA 1UFHA 1XIXA 1H8LA 4OAEA 1NMTA 3PZJA 4PSWA 4J3GA 3QNVA 2C6PA 3IWWA 4OC3A 3WABA 4P4IA 4R3LA 1IB1E 2CIJA 1TIQA 3EO4A 4WJBA 1Z8WA 3D68A 1BLLE 2OH1A 1Z8XA 3P2FA 4MHDA 4NGQA 4UEFA 2YNCA 4OP4A 2Z3PA 2OU2A 5K8MA 1Y7EA 5G22A 2R8VA 2ZXVA 3SI2A 2BO9A 4NJRA 3KQXA 3T9YA 1YX0A 1PCAA 2VQYA 4KOUA 4DJLA 3FEDA 4EFDA 1X12A 1Z9UA 2ATRA 8CPAA 2GU2A 1P0HA 3RZAA 1HDQA 4MMOA 2P6EA 3R1KA 4LQGA 5I4MA 2JBKA 2D4PA 2J8RA 2C27A 2DF5A 1VGYA 3PFOA 4RN7A 1YMEA 3R95A 2PQ8A 4YFJA 1QMUA 4XPDB 3R9FA 3SJEA 5LRGA 5HH1A 5F49A 2Q0YA 2HB6A 4QUSA 5JGFA 6CPAA 5EC4A 1IIDA 5LYFA 3FIXA 2PCUA 2PSWA 4F9VA 4E2AA 4HPSA 2JEVA 3D67A 4P4EA 1ZG7A 2QMLA 4C68A 4R57A 4AG9A 3B3TA 3S9NA 1HEEA 2Q7SA 3PB7X 1AUGA 4MFKA 1Q2DA 3D2MA 2Q4ZA 1YVKA 2CNSA 3FECA 3A9LA 2ZW7A 5LYDA 2V8HA 4CGLA 4OC0A 2JDDA 4PSXA 2AJ6A 5J8CA 1YGHA 4CYQA 3SJXA 4ZY2A 4AB7A 4FUUA 3KI9A 5AGEA 2PJ6A 3IFEA 4B13A 2Z3OA 3B3CA 4MFLA 3I9SA 1BOBA 1YW6A 4MHNA 1XF8A 3BXMA 2WUUA 3R96A 1AYEA 5AG7A 4UA3A 1IOIA 5E96A 3KGQA 4Q7AA 1QSMA 1YLEA 3PB9X 4MHPA 4MY3A 2B4DB 4ZYQA 2J8MA 3LODA 4GS4A 4YGOA 2WYRA 1BPMA 2XEIA 2EK9A 4MFJA 4UBRA 2BSWA 5A27A 1Z8LA 1BO4A 1XFOA 4R6TA 3H5ZA 2AFMA 1K4JA 2PE3A 4A31A 2CNTA 2ZW4A 3KR5A 1Z5RA 4P4JA 1I21A 3TO7A 5LYIA 2QECA 1GYTA 1Y7RA 2DPTA 3IU1A 2GANA 3BI0A 4R8FA 1M1DA 1Q2CA 4U5YA 3RYOA 3ISZA 2KCWA 3IWGA 2G0BA 4H89A 4HNWB 5AG4A 3NE7A 2C6CA 4K3NA 1F2PA 3F5BA 2O53A 3CPAA 4PPZA 2ZEHA 1PU9A 1Y9KA 1Q7LA 4QC6A 5CNPA 3KQZA 2B3VA 4MCQA 2CF4A 2YGWA 5ELYA 4ZY0A 3KZWA 1ARLA 2ABZA 3P2HA 3DLJA 4C7IA 5IB0A 4NGSA 4QVTA 1RXTA 1LAMA 4YWYA 2ZELA 4IF5A 3IU2A 7CPAA 5K8OA 1M4LA 2PR8A 3C26A 5G20A 4C2ZA 5ISVA 1B87A 4E8OA 3W91A 3B7IA 2ARHA 2CXAA 3NFZA 1CG2A 3FMCA 3PBEA 1LAPA 3TOAA 4ZGYB 4HKFA 4MFQA 4ZBGA 4BD9A 4K30A 2HUZA 2IQ6A 2B4BA 2OZGA 2ZEMA 2NSMA 4XNHC 2ZEPA 3B2YA 3RNZA 3SXOA 3MN8A 3TCVA 2JEWA 3PB8X 5JQ4A 2DEAA 4MFPA 2V8DA 5FVJA 2POKA 4UIAA 3OWCA 4FBEA 5KTDA 2OZUA 4AVCA 2NYQA 2EWBA 2AFSA 3S6HA 4KLWA 2Q4VA 4CGOA 3JRUA 2Z0ZA 5F09A 2ZEEA 3LACA 1CPSA 2PVWA 3S9MA 1YREA 4BMHA 2BCOA 1ARMA 3DGVA 1I1DA 4OC5A 5KTAA 3B3SA 2P6GA 4TNUA 4W9YA 2JLMA 3TC8A 5LRKA 4CAVA 2Q04A 2OB0A 3CDXA 4MJ8A 4Q36A 4B5PA 1IU8A 5D8NA 4M6IA 3VATA 2RFHA 1IGBA 2H5MA 4M6HA 3TT2A 4EWTA 1BPNA 2PRQA 3DNSA 5JPHA 2FE7A 3FNCA 4OKOA 3HLPA 4R76A 4XPDC 1R57A 5H84A 2VBQA 4P10A 5HMNA 2VEZA 3K9TA 1X10A 2PJ8A 4NGMA 3T8WA 4HNXB 2YNEA 3B3WA 4KOSA 4JYWA 4PK2A 2K5TA 3SXNA 5G1ZA 4IK2A 2P0WA 2C1CA 2F8HA 2G3TA 3K9UA 1LFWA 2QJ8A 4KLVA 4WWVA 1WK4A 2BUEA 4I49A 4NSQA 1NE9A 4P44A 3KR4A 3CXQA 4KOTA 3BI1A 4P45A 2I79A 4ZX9A 2CTCA 2Q4YA 4IAVA 2AFUA 1XBUA 3V38A 2B5GB 2EUIA 4A39A 4C2XA 3SJGA 2XEGA 4FWUA 5CBMA 4R87A 1KUVA 1ELMP 2EO8A 1M4DA 3QAYA 1ZLHA 4G1PA 4ONUA 2ZW5A 2ZPAA 2I3CA 3WR7A 2G3AA 2DXQA 3CXPA 4LQ6A 4O23A 2OOTA 4A95A 4KOWA 4OLLA 3SJFA 2AFZA 2B5GA 4UCMA 3WT4A 3FRMA 4ZX8A 3BJ7A 4B11A 3IWEA 3PGPA 4C7HA 3PB4X 4CGNA 4CYNA 3KASA 2HC9A 2R98A 3GY9A 4OC4A 2CY2A 4DNCA 3DR6A 2REEA 3NH8A 1J4JA 2VL1A 3FJUA 1LRZA 1CPXA 3PBBA 3D7GA 2FIWA 2G9DA 2BOAA 3VARA 1FNOA 2HQYA 4KZTA 2V8VA 1MJAA 3DDDA 4MHZA 1UWYA 1TF9A 3GKRA 2OR4A 3NH4A 3PRTA 4KVXA 2REFA 2IL4A 2RB7A 1QSRA 2ZEFA 4OC1A 3RO0A 3BLNA 1ELLP 5CPAA 2PJ5A 4B10A 1S5KA 2AFOA 3CT9A 3D7HA 4XPLA 3JUWA 4H6ZA 2ZOGA 3GB0A 2PJ7A 3B35A 3B3VA 2FVGA 1CP6A 3H8FA 2B4DA 1ZO0A 3TO6A 2X7BA 3S6FA 1YR0A 4CAEA 1RO5A 1S60A 2PC1A 1Y0YA 3EXNA 2D4OA 2FL4A 2QYVA 3EC4A 3GYAA 3LD2A 2GFQA 4UF4A 4JD6A 1QQ9A 4MCPA 4ORFA 1KUYA 3IC1A 4MBUA 4A30A 4R9MA 3R9EA 3LMSA 1Y9WA 3KL9A 2OZHA 3I3GA 4KUAA 5THWA 2R1IA 4NCZA 3HUVA 4A38A 4BBHA 4GXHA 4OADA 1HDUA 5F48A 1YLOA 1Z8TA 5G21A 4C2YA 4CPAA 3NH5A 2RC4A 3V8IA 1CBXA 1S7LA 2ANPA 4ONWA 1VHOA 3EY5A 1M4GA 2JDCA 3T90A 1S7KA 2GLFA 1CP7A 1IYLA 3H4QA 4MCSA 3G3SA 1AMPA 4B14A 1SQHA 2AFXA 3CPXA 2V8GA 4CGMA 4FD7A 3N5FA 4UEZA 3RBUA 4AVAA 4F0XA 1VHEA 1KUXA 2Q44A 5EBVA 1BAVA 5LYLA 2ZENA 3VWDA 4ZY1A 1YSJA 4A94A 5IV0A 1IICA 1GHEA 2PIYA 4TWEA 3RAMA 3DSBA 4DUKA 5F47A 1XEBA 3FBUA 4M3SA 5K8PA 2GIVA 3B8GA 2I00A 4BINA 3IGRA 5AG5A 4F6AA 4IHMA 3FB3A 3PEIA 4MY0A 4R7MA 1XMBA 2WPWA 2FS5A 4OIDA 4X2TA 3S9LA 4CYOA 1F57A 1IYKA 2F5IA 4KSIA 4UFWA 4NGNA 4PXDA 1NSAA 3FVLA 3FEEA 3VWEA 4II9A 2Z3NA 4A2ZA 2PIZA 1ZLIA 1Z4RA 4FAIA 2BEIA 2YNDA 4NJQA 5A28A 5K8NA 2PJ3A 4Y49B 1YQEA 4YU9A 3BJ8A 4NGTA 3KKWA 2PJ9A 2O4HA 3H8GA 2GLJA 2PJ2A 3D4UA 2FT0A 3SHPA 3DR8A 2Z3MA 4DYOA 3KHXA 2VZYA 4KOXA 2EK8A 2Q43A 1YW4A 4PXCA 3TOBA 1ZG9A 1IY7A 1Q2YA 1ON0A 1S7FA 3IEHA 4L89A 3N7ZA 1PYTB 4OMEA 4CAWA 3D7FA 2ZEOA 2XEJA 4UFVA 3FH4A 2Z3LA 5H86A 3GLJA 3ZZIA 3PP9A 4B12A 5GCNA 3WC5A 2PRBA 3FX6A 4R3KA 2GREA 4KSAA 4L8AA 2ZEDA 2Q7BA 2A4NA 2WSAA 3WC6A 2J9AA 4F9UA 1V0CA 3W6XA 2J8NA 4CAXA 1B6BA 1XOVA 3FF3A 4P4DA 3V7ZA 1F2OA 4NEXA 5C88A 4YRHA 4F8ZA 3FXTA 4LX9A 5J8FA 4EMEA
chains in the Genus database with same CATH topology
1I12A 3E0KA 1VKCA 2PDOA 4E0AA 4UWJA 2FIAA 4A32A 5KTCA 4M85A 2AE6A 3S6KA 2B58A 4CAFA 1P4NA 3G8WA 4RI1A 1FY7A 4KS9A 2ZW6A 4KOYA 1S3ZA 3FYNA 5AG6A 4KVME 4QB9A 3TO9A 2Y0MA 3D3SA 3TTHA 2FCKA 2QIRA 2O28A 1M4IA 2HV2A 4FD5A 4Q38A 5IX3A 3EFAA 3JVNA 2Z10A 1WWZA 4UFXA 4MFZA 2DPSA 4RS2A 2Z11A 3F8KA 4UCPA 1VHSA 4CS0B 5DWNA 4A33A 5DWMA 4C7HA 1QSOA 3MGDA 4KSFA 2EVNA 3JTKA 3CXSA 4UWIA 1U6MA 1PUAA 4UCNA 3W6SA 2VI7A 1YVOA 4H6UA 4PV6A 4KVOE 1MK4A 4KORA 4XPKA 1MJ9A 3UY5A 1L0CA 1CJWA 2FSRA 3ZJ0A 4FD6A 3QB8A 4CYPA 4IUSA 5F46A 4HNYB 4AG7A 1S7NA 4JLYA 1N71A 4JXRA 4NXYA 4AVBA 4F0YA 2R7HA 4LUAA 3TE4A 4JXQA 3TFYA 2PR1A 1YK3A 1QSNA 4CRZB 2Z3KA 4KOVA 3S6GA 4Y49C 1CM0A 4JWPA 1XE4A 3R9GA 4B5OA 5C82A 4KUBA 4QBJA 3QAHA 4FD4A 3D2PA 1M44A 3F0AA 2WPXA 1QSTA 2VZZA 1NSLA 3D8PA 2FXFA 2VXKA 4PK3A 4CGPA 2CNMA 2BL1A 4EVYA 1KZFA 1Z4EA 2NMTA 2P6FA 4JJXA 4U9YA 4CRYB 1XMTA 1MJBA 4X5KA 2YNCC 4NF1A 5BWAB 5I0CA 4U9ZA 2GE3A 2B3UA 4MI4A 4B5PB 4XNHB 1OZPA 1UFHA 1XIXA 4OAEA 1NMTA 3PZJA 4PSWA 4J3GA 4R3LA 1IB1E 1TIQA 3EO4A 2OH1A 3P2FA 4MHDA 2YNCA 2Z3PA 2OU2A 5G22A 2R8VA 2ZXVA 3T9YA 1YX0A 2VQYA 4KOUA 1Z9UA 2ATRA 1P0HA 2P6EA 3R1KA 2D4PA 2C27A 2J8RA 3R95A 2PQ8A 4YFJA 4XPDB 3R9FA 5HH1A 5F49A 2Q0YA 4QUSA 5EC4A 1IIDA 3FIXA 2PSWA 4E2AA 2JEVA 2QMLA 4C68A 4R57A 4AG9A 4MFKA 1Q2DA 3D2MA 1YVKA 2CNSA 3A9LA 2ZW7A 4CGLA 2JDDA 4PSXA 2AJ6A 5J8CA 1YGHA 4CYQA 4AB7A 5AGEA 4B13A 2Z3OA 4MFLA 3I9SA 1BOBA 3R96A 1XF8A 2WUUA 5AG7A 4UA3A 5E96A 1QSMA 1YLEA 4MY3A 2B4DB 2J8MA 3LODA 4GS4A 4YGOA 4MFJA 4UBRA 2BSWA 5A27A 1BO4A 3H5ZA 1K4JA 4A31A 2CNTA 2ZW4A 1I21A 3TO7A 2QECA 3IU1A 2DPTA 1Y7RA 2GANA 1M1DA 1Q2CA 4U5YA 3RYOA 2KCWA 3IWGA 2G0BA 4H89A 4HNWB 5AG4A 3NE7A 3F5BA 1PU9A 1Y9KA 4QC6A 5CNPA 2B3VA 2YGWA 3P2HA 4C7IA 5IB0A 4QVTA 1RXTA 4IF5A 3IU2A 2PR8A 3C26A 5G20A 4C2ZA 5ISVA 1B87A 4E8OA 3W91A 2ARHA 2CXAA 3TOAA 4ZGYB 4HKFA 4MFQA 4ZBGA 4K30A 2HUZA 2B4BA 2OZGA 4XNHC 3SXOA 3TCVA 5JQ4A 4MFPA 5FVJA 3OWCA 5KTDA 2OZUA 4AVCA 3S6HA 4KLWA 2Q4VA 4CGOA 2Z0ZA 1YREA 4BMHA 1I1DA 5KTAA 2P6GA 2JLMA 4CAVA 2Q04A 2OB0A 4MJ8A 4Q36A 4B5PA 2H5MA 3TT2A 5JPHA 3DNSA 2FE7A 3FNCA 4XPDC 1R57A 5H84A 2VBQA 5HMNA 2VEZA 4HNXB 2YNEA 4KOSA 4PK2A 2K5TA 3SXNA 5G1ZA 2P0WA 4KLVA 2G3TA 3K9UA 1WK4A 2BUEA 4I49A 4NSQA 1NE9A 3CXQA 4KOTA 2I79A 2Q4YA 2B5GB 2EUIA 4C2XA 4R87A 1KUVA 1M4DA 4ONUA 2ZW5A 2ZPAA 3WR7A 2G3AA 2DXQA 3CXPA 4A95A 4KOWA 4OLLA 2B5GA 4UCMA 3FRMA 4B11A 3BJ7A 3IWEA 3PGPA 4CYNA 4CGNA 2R98A 3GY9A 2CY2A 4DNCA 3DR6A 2REEA 1J4JA 1LRZA 2FIWA 2HQYA 4KZTA 1MJAA 3DDDA 3GKRA 4KVXA 2REFA 2IL4A 1QSRA 3BLNA 4B10A 1S5KA 4XPLA 3JUWA 4H6ZA 2B4DA 1ZO0A 3TO6A 2X7BA 3S6FA 1YR0A 4CAEA 1RO5A 1S60A 2PC1A 3EXNA 2D4OA 2FL4A 3EC4A 3GYAA 3LD2A 4JD6A 4ORFA 1KUYA 4MBUA 4A30A 4R9MA 3R9EA 1Y9WA 2OZHA 3I3GA 4KUAA 2R1IA 4NCZA 4BBHA 4OADA 5F48A 5G21A 4C2YA 2RC4A 3V8IA 1S7LA 3EY5A 1M4GA 2JDCA 3T90A 1S7KA 1IYLA 3H4QA 4B14A 3G3SA 1SQHA 4CGMA 4FD7A 4AVAA 4F0XA 1KUXA 2Q44A 5EBVA 3VWDA 5IV0A 1IICA 1GHEA 3DSBA 5F47A 1XEBA 3FBUA 4M3SA 2GIVA 3B8GA 2I00A 3IGRA 5AG5A 4F6AA 3FB3A 4MY0A 2WPWA 2FS5A 4CYOA 1IYKA 2F5IA 4UFWA 3VWEA 4II9A 2Z3NA 4A2ZA 1Z4RA 2BEIA 2YNDA 5A28A 4Y49B 3BJ8A 3KKWA 2FT0A 3SHPA 3DR8A 2Z3MA 2VZYA 4KOXA 3TOBA 1Q2YA 1ON0A 1S7FA 4L89A 3N7ZA 4CAWA 4UFVA 2Z3LA 5H86A 3ZZIA 3PP9A 4B12A 5GCNA 2PRBA 4R3KA 4KSAA 4L8AA 2Q7BA 2A4NA 2WSAA 1V0CA 3W6XA 2J8NA 4CAXA 1B6BA 4NEXA 5C88A 4YRHA 3FXTA 4LX9A 5J8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I12 A;  3E0K A;  1VKC A;  2PDO A;  4E0A A;  4UWJ A;  2FIA A;  5KTC A;  4M85 A;  2AE6 A;  3S6K A;  2B58 A;  1P4N A;  3G8W A;  4RI1 A;  1FY7 A;  2ZW6 A;  4KOY A;  1S3Z A;  3FYN A;  4KVM E;  4QB9 A;  3TO9 A;  2Y0M A;  3D3S A;  3TTH A;  2FCK A;  2QIR A;  2O28 A;  1M4I A;  2HV2 A;  4FD5 A;  5IX3 A;  3EFA A;  3JVN A;  2Z10 A;  1WWZ A;  4RS2 A;  2Z11 A;  3F8K A;  1VHS A;  4CS0 B;  5DWN A;  5DWM A;  1QSO A;  3MGD A;  2EVN A;  3CXS A;  4UWI A;  1U6M A;  1PUA A;  3W6S A;  2VI7 A;  1YVO A;  4H6U A;  4PV6 A;  4KVO E;  1MK4 A;  4KOR A;  4XPK A;  1MJ9 A;  3UY5 A;  1L0C A;  1CJW A;  2FSR A;  3ZJ0 A;  4FD6 A;  3QB8 A;  4IUS A;  5F46 A;  4HNY B;  4AG7 A;  1S7N A;  4JLY A;  1N71 A;  4JXR A;  4NXY A;  4AVB A;  4F0Y A;  2R7H A;  4LUA A;  3TE4 A;  4JXQ A;  3TFY A;  2PR1 A;  1YK3 A;  1QSN A;  4CRZ B;  4KOV A;  3S6G A;  4Y49 C;  1CM0 A;  4JWP A;  1XE4 A;  3R9G A;  4B5O A;  5C82 A;  4KUB A;  4QBJ A;  3QAH A;  4FD4 A;  3D2P A;  1M44 A;  3F0A A;  2WPX A;  1QST A;  2VZZ A;  1NSL A;  3D8P A;  2FXF A;  2VXK A;  4PK3 A;  2CNM A;  2BL1 A;  4EVY A;  1KZF A;  1Z4E A;  2NMT A;  2P6F A;  4JJX A;  4U9Y A;  4CRY B;  1XMT A;  1MJB A;  4X5K A;  4NF1 A;  5I0C A;  4U9Z A;  2GE3 A;  2B3U A;  4MI4 A;  4B5P B;  4XNH B;  1OZP A;  1UFH A;  1XIX A;  4OAE A;  1NMT A;  3PZJ A;  4PSW A;  4J3G A;  4R3L A;  1IB1 E;  1TIQ A;  3EO4 A;  2OH1 A;  3P2F A;  4MHD A;  2OU2 A;  2R8V A;  2ZXV A;  3T9Y A;  1YX0 A;  2VQY A;  4KOU A;  1Z9U A;  2ATR A;  1P0H A;  2P6E A;  3R1K A;  2D4P A;  2C27 A;  2J8R A;  3R95 A;  2PQ8 A;  4YFJ A;  4XPD B;  3R9F A;  5HH1 A;  5F49 A;  2Q0Y A;  4QUS A;  5EC4 A;  1IID A;  3FIX A;  2PSW A;  4E2A A;  2JEV A;  2QML A;  4R57 A;  4AG9 A;  1Q2D A;  3D2M A;  1YVK A;  2CNS A;  2ZW7 A;  2JDD A;  4PSX A;  2AJ6 A;  5J8C A;  1YGH A;  4AB7 A;  3I9S A;  1BOB A;  3R96 A;  1XF8 A;  4UA3 A;  5E96 A;  1QSM A;  1YLE A;  4MY3 A;  2B4D B;  2J8M A;  3LOD A;  4GS4 A;  4YGO A;  4UBR A;  2BSW A;  1BO4 A;  1K4J A;  2CNT A;  2ZW4 A;  1I21 A;  3TO7 A;  2QEC A;  1Y7R A;  2GAN A;  1M1D A;  1Q2C A;  4U5Y A;  3RYO A;  2KCW A;  3IWG A;  2G0B A;  4H89 A;  4HNW B;  3NE7 A;  3F5B A;  1PU9 A;  1Y9K A;  4QC6 A;  5CNP A;  2B3V A;  3P2H A;  5IB0 A;  4QVT A;  1RXT A;  4IF5 A;  2PR8 A;  3C26 A;  5ISV A;  1B87 A;  4E8O A;  3W91 A;  2ARH A;  3TOA A;  4HKF A;  4ZBG A;  4K30 A;  2HUZ A;  2B4B A;  2OZG A;  4XNH C;  3SXO A;  3TCV A;  5JQ4 A;  5FVJ A;  3OWC A;  5KTD A;  2OZU A;  4AVC A;  3S6H A;  4KLW A;  2Q4V A;  2Z0Z A;  1YRE A;  4BMH A;  1I1D A;  5KTA A;  2P6G A;  2JLM A;  4CAV A;  2Q04 A;  2OB0 A;  4MJ8 A;  4B5P A;  2H5M A;  3TT2 A;  5JPH A;  3DNS A;  2FE7 A;  3FNC A;  4XPD C;  1R57 A;  5H84 A;  2VBQ A;  5HMN A;  2VEZ A;  4HNX B;  4KOS A;  4PK2 A;  2K5T A;  3SXN A;  2P0W A;  4KLV A;  2G3T A;  3K9U A;  1WK4 A;  2BUE A;  4I49 A;  4NSQ A;  1NE9 A;  3CXQ A;  4KOT A;  2I79 A;  2Q4Y A;  2B5G B;  2EUI A;  4R87 A;  1KUV A;  1M4D A;  4ONU A;  2ZW5 A;  2ZPA A;  3WR7 A;  2G3A A;  2DXQ A;  3CXP A;  4KOW A;  4OLL A;  2B5G A;  3FRM A;  3BJ7 A;  3PGP A;  2R98 A;  3GY9 A;  2CY2 A;  4DNC A;  3DR6 A;  2REE A;  1J4J A;  1LRZ A;  2FIW A;  2HQY A;  4KZT A;  1MJA A;  3DDD A;  3GKR A;  4KVX A;  2REF A;  2IL4 A;  1QSR A;  3BLN A;  1S5K A;  4XPL A;  3JUW A;  4H6Z A;  2B4D A;  3TO6 A;  2X7B A;  3S6F A;  1YR0 A;  1RO5 A;  1S60 A;  2PC1 A;  3EXN A;  2D4O A;  2FL4 A;  3EC4 A;  3GYA A;  3LD2 A;  4JD6 A;  4ORF A;  1KUY A;  4MBU A;  4R9M A;  3R9E A;  1Y9W A;  2OZH A;  3I3G A;  4KUA A;  2R1I A;  4NCZ A;  4OAD A;  5F48 A;  2RC4 A;  3V8I A;  1S7L A;  3EY5 A;  1M4G A;  2JDC A;  3T90 A;  1S7K A;  1IYL A;  3H4Q A;  3G3S A;  1SQH A;  4FD7 A;  4AVA A;  1KUX A;  2Q44 A;  5EBV A;  3VWD A;  5IV0 A;  1IIC A;  1GHE A;  3DSB A;  5F47 A;  1XEB A;  3FBU A;  4M3S A;  2GIV A;  3B8G A;  2I00 A;  3IGR A;  4F6A A;  3FB3 A;  4MY0 A;  2WPW A;  2FS5 A;  1IYK A;  2F5I A;  3VWE A;  4II9 A;  1Z4R A;  2BEI A;  4Y49 B;  3BJ8 A;  3KKW A;  2FT0 A;  3SHP A;  3DR8 A;  2VZY A;  4KOX A;  3TOB A;  1Q2Y A;  1ON0 A;  1S7F A;  4L89 A;  3N7Z A;  4CAW A;  5H86 A;  3ZZI A;  3PP9 A;  5GCN A;  2PRB A;  4R3K A;  4L8A A;  2Q7B A;  2A4N A;  1V0C A;  3W6X A;  2J8N A;  4CAX A;  1B6B A;  4NEX A;  5C88 A;  4YRH A;  3FXT A;  4LX9 A;  5J8F A; 
#chains in the Genus database with same CATH topology
 1I12 A;  3E0K A;  1VKC A;  2PDO A;  3IO1 A;  4E0A A;  4UWJ A;  2FIA A;  4H2K A;  4A37 A;  3ISX A;  4P4F A;  4A32 A;  5HVG A;  5KTC A;  4M85 A;  2AE6 A;  2PJC A;  4NGP A;  3S6K A;  2B58 A;  4CAF A;  4P6Y A;  1P4N A;  3G8W A;  4RI1 A;  1FY7 A;  1EE3 P;  2EBJ A;  4KS9 A;  2PJB A;  1Y0R A;  2ZW6 A;  3PB6 X;  2AFW A;  1S3Z A;  4KOY A;  5HVF A;  3FYN A;  3WC7 A;  5AG6 A;  2IMO A;  4KVM E;  4QB9 A;  3TO9 A;  2Y0M A;  3D3S A;  3TTH A;  5D29 A;  2FCK A;  2QIR A;  2O28 A;  1M4I A;  2HV2 A;  4FD5 A;  4Q38 A;  4RUH A;  5IX3 A;  3EFA A;  2PJ0 A;  3JVN A;  3L2N A;  2Z10 A;  1WWZ A;  3IJ3 A;  4UFX A;  4MFZ A;  3K2K A;  2DPS A;  4RS2 A;  5DS0 A;  2PVV A;  1Z2L A;  2Z11 A;  3SI1 A;  3F8K A;  2JBJ A;  1LCP A;  4UCP A;  1VHS A;  4CS0 B;  5DWN A;  2C6G A;  4M6G A;  4A33 A;  3BHX A;  3PFE A;  5DWM A;  3NA6 A;  2ZOF A;  1VIX A;  1OBR A;  4PXB A;  1QSO A;  2QVP A;  1CX8 A;  3MGD A;  4KSF A;  4UIB A;  5EMI A;  2PJ1 A;  1TKF A;  1ZG8 A;  1FT7 A;  5IB9 A;  3I1U A;  4MXU A;  4GM5 A;  2EVN A;  3JTK A;  1TKJ A;  3CXS A;  4UWI A;  1U6M A;  1PUA A;  4UCN A;  3W6S A;  4MHY A;  1JQG A;  2VI7 A;  1YVO A;  4H6U A;  3TX8 A;  1XRY A;  4PV6 A;  4KVO E;  1MK4 A;  3GIU A;  4OC2 A;  5JH9 A;  4KOR A;  2PJA A;  2PJ4 A;  5HVH A;  4XPK A;  2F7V A;  4UEE A;  2ODF A;  1MJ9 A;  3UY5 A;  1L0C A;  1CJW A;  1R3N A;  3CZX A;  4X8I A;  2FSR A;  3ZJ0 A;  1XJO A;  4FD6 A;  3QB8 A;  2Q51 A;  4CYP A;  1IOF A;  4IUS A;  5LRJ A;  3NE8 A;  1LAN A;  4ZI6 A;  2ZEG A;  4HNY B;  5F46 A;  2CTB A;  5JM6 A;  4AG7 A;  1S7N A;  4JLY A;  1DTD A;  1N71 A;  5HXD A;  4JXR A;  3LWU A;  4NXY A;  3MRU A;  3D66 A;  4AVB A;  4F0Y A;  2R7H A;  4LUA A;  3TE4 A;  4JXQ A;  3SI0 A;  2PR1 A;  3TFY A;  1YK3 A;  3VH9 A;  1QSN A;  4CRZ B;  1RTQ A;  2Z3K A;  1DE4 C;  4KOV A;  4MRI A;  4X3R A;  3S6G A;  4NFR A;  4Y49 C;  1CM0 A;  3H8E A;  4JWP A;  1TF8 A;  1XE4 A;  3R9G A;  4B5O A;  5C82 A;  4KUB A;  2XEF A;  3KHZ A;  4MCR A;  1TXR A;  4QBJ A;  3QAH A;  4FD4 A;  3D2P A;  1M44 A;  1R43 A;  3F0A A;  3GUX A;  3IIB A;  2WPX A;  1JWQ A;  1QST A;  2VZZ A;  4P4B A;  3D7D A;  4OIW A;  1NSL A;  3D8P A;  1KWM A;  2V77 A;  2FXF A;  2VXK A;  4PK3 A;  4CGP A;  2CNM A;  4JZ0 A;  2BL1 A;  4EVY A;  1KZF A;  1Z4E A;  2NMT A;  2P6F A;  4JJX A;  4U9Y A;  4AXV A;  1XMT A;  2WZN A;  1MJB A;  4X5K A;  4CRY B;  4Z65 A;  5J1Q A;  2YNC C;  4NF1 A;  2IJZ A;  5BWA B;  5I0C A;  4U9Z A;  4PQA A;  2GE3 A;  2B3U A;  4MI4 A;  4NGR A;  4PXE A;  1TKH A;  4B5P B;  1A2Z A;  4XNH B;  4B6Z A;  1OZP A;  1LOK A;  1UFH A;  1XIX A;  1H8L A;  4OAE A;  1NMT A;  3PZJ A;  4PSW A;  4J3G A;  3QNV A;  2C6P A;  3IWW A;  4OC3 A;  3WAB A;  4P4I A;  4R3L A;  1IB1 E;  2CIJ A;  1TIQ A;  3EO4 A;  4WJB A;  1Z8W A;  3D68 A;  1BLL E;  2OH1 A;  1Z8X A;  3P2F A;  4MHD A;  4NGQ A;  4UEF A;  2YNC A;  4OP4 A;  2Z3P A;  2OU2 A;  5K8M A;  1Y7E A;  5G22 A;  2R8V A;  2ZXV A;  3SI2 A;  2BO9 A;  4NJR A;  3KQX A;  3T9Y A;  1YX0 A;  1PCA A;  2VQY A;  4KOU A;  4DJL A;  3FED A;  4EFD A;  1X12 A;  1Z9U A;  2ATR A;  8CPA A;  2GU2 A;  1P0H A;  3RZA A;  1HDQ A;  4MMO A;  2P6E A;  3R1K A;  4LQG A;  5I4M A;  2JBK A;  2D4P A;  2J8R A;  2C27 A;  2DF5 A;  1VGY A;  3PFO A;  4RN7 A;  1YME A;  3R95 A;  2PQ8 A;  4YFJ A;  1QMU A;  4XPD B;  3R9F A;  3SJE A;  5LRG A;  5HH1 A;  5F49 A;  2Q0Y A;  2HB6 A;  4QUS A;  5JGF A;  6CPA A;  5EC4 A;  1IID A;  5LYF A;  3FIX A;  2PCU A;  2PSW A;  4F9V A;  4E2A A;  4HPS A;  2JEV A;  3D67 A;  4P4E A;  1ZG7 A;  2QML A;  4C68 A;  4R57 A;  4AG9 A;  3B3T A;  3S9N A;  1HEE A;  2Q7S A;  3PB7 X;  1AUG A;  4MFK A;  1Q2D A;  3D2M A;  2Q4Z A;  1YVK A;  2CNS A;  3FEC A;  3A9L A;  2ZW7 A;  5LYD A;  2V8H A;  4CGL A;  4OC0 A;  2JDD A;  4PSX A;  2AJ6 A;  5J8C A;  1YGH A;  4CYQ A;  3SJX A;  4ZY2 A;  4AB7 A;  4FUU A;  3KI9 A;  5AGE A;  2PJ6 A;  3IFE A;  4B13 A;  2Z3O A;  3B3C A;  4MFL A;  3I9S A;  1BOB A;  1YW6 A;  4MHN A;  1XF8 A;  3BXM A;  2WUU A;  3R96 A;  1AYE A;  5AG7 A;  4UA3 A;  1IOI A;  5E96 A;  3KGQ A;  4Q7A A;  1QSM A;  1YLE A;  3PB9 X;  4MHP A;  4MY3 A;  2B4D B;  4ZYQ A;  2J8M A;  3LOD A;  4GS4 A;  4YGO A;  2WYR A;  1BPM A;  2XEI A;  2EK9 A;  4MFJ A;  4UBR A;  2BSW A;  5A27 A;  1Z8L A;  1BO4 A;  1XFO A;  4R6T A;  3H5Z A;  2AFM A;  1K4J A;  2PE3 A;  4A31 A;  2CNT A;  2ZW4 A;  3KR5 A;  1Z5R A;  4P4J A;  1I21 A;  3TO7 A;  5LYI A;  2QEC A;  1GYT A;  1Y7R A;  2DPT A;  3IU1 A;  2GAN A;  3BI0 A;  4R8F A;  1M1D A;  1Q2C A;  4U5Y A;  3RYO A;  3ISZ A;  2KCW A;  3IWG A;  2G0B A;  4H89 A;  4HNW B;  5AG4 A;  3NE7 A;  2C6C A;  4K3N A;  1F2P A;  3F5B A;  2O53 A;  3CPA A;  4PPZ A;  2ZEH A;  1PU9 A;  1Y9K A;  1Q7L A;  4QC6 A;  5CNP A;  3KQZ A;  2B3V A;  4MCQ A;  2CF4 A;  2YGW A;  5ELY A;  4ZY0 A;  3KZW A;  1ARL A;  2ABZ A;  3P2H A;  3DLJ A;  4C7I A;  5IB0 A;  4NGS A;  4QVT A;  1RXT A;  1LAM A;  4YWY A;  2ZEL A;  4IF5 A;  3IU2 A;  7CPA A;  5K8O A;  1M4L A;  2PR8 A;  3C26 A;  5G20 A;  4C2Z A;  5ISV A;  1B87 A;  4E8O A;  3W91 A;  3B7I A;  2ARH A;  2CXA A;  3NFZ A;  1CG2 A;  3FMC A;  3PBE A;  1LAP A;  3TOA A;  4ZGY B;  4HKF A;  4MFQ A;  4ZBG A;  4BD9 A;  4K30 A;  2HUZ A;  2IQ6 A;  2B4B A;  2OZG A;  2ZEM A;  2NSM A;  4XNH C;  2ZEP A;  3B2Y A;  3RNZ A;  3SXO A;  3MN8 A;  3TCV A;  2JEW A;  3PB8 X;  5JQ4 A;  2DEA A;  4MFP A;  2V8D A;  5FVJ A;  2POK A;  4UIA A;  3OWC A;  4FBE A;  5KTD A;  2OZU A;  4AVC A;  2NYQ A;  2EWB A;  2AFS A;  3S6H A;  4KLW A;  2Q4V A;  4CGO A;  3JRU A;  2Z0Z A;  5F09 A;  2ZEE A;  3LAC A;  1CPS A;  2PVW A;  3S9M A;  1YRE A;  4BMH A;  2BCO A;  1ARM A;  3DGV A;  1I1D A;  4OC5 A;  5KTA A;  3B3S A;  2P6G A;  4TNU A;  4W9Y A;  2JLM A;  3TC8 A;  5LRK A;  4CAV A;  2Q04 A;  2OB0 A;  3CDX A;  4MJ8 A;  4Q36 A;  4B5P A;  1IU8 A;  5D8N A;  4M6I A;  3VAT A;  2RFH A;  1IGB A;  2H5M A;  4M6H A;  3TT2 A;  4EWT A;  1BPN A;  2PRQ A;  3DNS A;  5JPH A;  2FE7 A;  3FNC A;  4OKO A;  3HLP A;  4R76 A;  4XPD C;  1R57 A;  5H84 A;  2VBQ A;  4P10 A;  5HMN A;  2VEZ A;  3K9T A;  1X10 A;  2PJ8 A;  4NGM A;  3T8W A;  4HNX B;  2YNE A;  3B3W A;  4KOS A;  4JYW A;  4PK2 A;  2K5T A;  3SXN A;  5G1Z A;  4IK2 A;  2P0W A;  2C1C A;  2F8H A;  2G3T A;  3K9U A;  1LFW A;  2QJ8 A;  4KLV A;  4WWV A;  1WK4 A;  2BUE A;  4I49 A;  4NSQ A;  1NE9 A;  4P44 A;  3KR4 A;  3CXQ A;  4KOT A;  3BI1 A;  4P45 A;  2I79 A;  4ZX9 A;  2CTC A;  2Q4Y A;  4IAV A;  2AFU A;  1XBU A;  3V38 A;  2B5G B;  2EUI A;  4A39 A;  4C2X A;  3SJG A;  2XEG A;  4FWU A;  5CBM A;  4R87 A;  1KUV A;  1ELM P;  2EO8 A;  1M4D A;  3QAY A;  1ZLH A;  4G1P A;  4ONU A;  2ZW5 A;  2ZPA A;  2I3C A;  3WR7 A;  2G3A A;  2DXQ A;  3CXP A;  4LQ6 A;  4O23 A;  2OOT A;  4A95 A;  4KOW A;  4OLL A;  3SJF A;  2AFZ A;  2B5G A;  4UCM A;  3WT4 A;  3FRM A;  4ZX8 A;  3BJ7 A;  4B11 A;  3IWE A;  3PGP A;  4C7H A;  3PB4 X;  4CGN A;  4CYN A;  3KAS A;  2HC9 A;  2R98 A;  3GY9 A;  4OC4 A;  2CY2 A;  4DNC A;  3DR6 A;  2REE A;  3NH8 A;  1J4J A;  2VL1 A;  3FJU A;  1LRZ A;  1CPX A;  3PBB A;  3D7G A;  2FIW A;  2G9D A;  2BOA A;  3VAR A;  1FNO A;  2HQY A;  4KZT A;  2V8V A;  1MJA A;  3DDD A;  4MHZ A;  1UWY A;  1TF9 A;  3GKR A;  2OR4 A;  3NH4 A;  3PRT A;  4KVX A;  2REF A;  2IL4 A;  2RB7 A;  1QSR A;  2ZEF A;  4OC1 A;  3RO0 A;  3BLN A;  1ELL P;  5CPA A;  2PJ5 A;  4B10 A;  1S5K A;  2AFO A;  3CT9 A;  3D7H A;  4XPL A;  3JUW A;  4H6Z A;  2ZOG A;  3GB0 A;  2PJ7 A;  3B35 A;  3B3V A;  2FVG A;  1CP6 A;  3H8F A;  2B4D A;  1ZO0 A;  3TO6 A;  2X7B A;  3S6F A;  1YR0 A;  4CAE A;  1RO5 A;  1S60 A;  2PC1 A;  1Y0Y A;  3EXN A;  2D4O A;  2FL4 A;  2QYV A;  3EC4 A;  3GYA A;  3LD2 A;  2GFQ A;  4UF4 A;  4JD6 A;  1QQ9 A;  4MCP A;  4ORF A;  1KUY A;  3IC1 A;  4MBU A;  4A30 A;  4R9M A;  3R9E A;  3LMS A;  1Y9W A;  3KL9 A;  2OZH A;  3I3G A;  4KUA A;  5THW A;  2R1I A;  4NCZ A;  3HUV A;  4A38 A;  4BBH A;  4GXH A;  4OAD A;  1HDU A;  5F48 A;  1YLO A;  1Z8T A;  5G21 A;  4C2Y A;  4CPA A;  3NH5 A;  2RC4 A;  3V8I A;  1CBX A;  1S7L A;  2ANP A;  4ONW A;  1VHO A;  3EY5 A;  1M4G A;  2JDC A;  3T90 A;  1S7K A;  2GLF A;  1CP7 A;  1IYL A;  3H4Q A;  4MCS A;  3G3S A;  1AMP A;  4B14 A;  1SQH A;  2AFX A;  3CPX A;  2V8G A;  4CGM A;  4FD7 A;  3N5F A;  4UEZ A;  3RBU A;  4AVA A;  4F0X A;  1VHE A;  1KUX A;  2Q44 A;  5EBV A;  1BAV A;  5LYL A;  2ZEN A;  3VWD A;  4ZY1 A;  1YSJ A;  4A94 A;  5IV0 A;  1IIC A;  1GHE A;  2PIY A;  4TWE A;  3RAM A;  3DSB A;  4DUK A;  5F47 A;  1XEB A;  3FBU A;  4M3S A;  5K8P A;  2GIV A;  3B8G A;  2I00 A;  4BIN A;  3IGR A;  5AG5 A;  4F6A A;  4IHM A;  3FB3 A;  3PEI A;  4MY0 A;  4R7M A;  1XMB A;  2WPW A;  2FS5 A;  4OID A;  4X2T A;  3S9L A;  4CYO A;  1F57 A;  1IYK A;  2F5I A;  4KSI A;  4UFW A;  4NGN A;  4PXD A;  1NSA A;  3FVL A;  3FEE A;  3VWE A;  4II9 A;  2Z3N A;  4A2Z A;  2PIZ A;  1ZLI A;  1Z4R A;  4FAI A;  2BEI A;  2YND A;  4NJQ A;  5A28 A;  5K8N A;  2PJ3 A;  4Y49 B;  1YQE A;  4YU9 A;  3BJ8 A;  4NGT A;  3KKW A;  2PJ9 A;  2O4H A;  3H8G A;  2GLJ A;  2PJ2 A;  3D4U A;  2FT0 A;  3SHP A;  3DR8 A;  2Z3M A;  4DYO A;  3KHX A;  2VZY A;  4KOX A;  2EK8 A;  2Q43 A;  1YW4 A;  4PXC A;  3TOB A;  1ZG9 A;  1IY7 A;  1Q2Y A;  1ON0 A;  1S7F A;  3IEH A;  4L89 A;  3N7Z A;  1PYT B;  4OME A;  4CAW A;  3D7F A;  2ZEO A;  2XEJ A;  4UFV A;  3FH4 A;  2Z3L A;  5H86 A;  3GLJ A;  3ZZI A;  3PP9 A;  4B12 A;  5GCN A;  3WC5 A;  2PRB A;  3FX6 A;  4R3K A;  2GRE A;  4KSA A;  4L8A A;  2ZED A;  2Q7B A;  2A4N A;  2WSA A;  3WC6 A;  2J9A A;  4F9U A;  1V0C A;  3W6X A;  2J8N A;  4CAX A;  1B6B A;  1XOV A;  3FF3 A;  4P4D A;  3V7Z A;  1F2O A;  4NEX A;  5C88 A;  4YRH A;  4F8Z A;  3FXT A;  4LX9 A;  5J8F A;  4EME A; 
#chains in the Genus database with same CATH homology
 1I12 A;  3E0K A;  1VKC A;  2PDO A;  4E0A A;  4UWJ A;  2FIA A;  4A32 A;  5KTC A;  4M85 A;  2AE6 A;  3S6K A;  2B58 A;  4CAF A;  1P4N A;  3G8W A;  4RI1 A;  1FY7 A;  4KS9 A;  2ZW6 A;  4KOY A;  1S3Z A;  3FYN A;  5AG6 A;  4KVM E;  4QB9 A;  3TO9 A;  2Y0M A;  3D3S A;  3TTH A;  2FCK A;  2QIR A;  2O28 A;  1M4I A;  2HV2 A;  4FD5 A;  4Q38 A;  5IX3 A;  3EFA A;  3JVN A;  2Z10 A;  1WWZ A;  4UFX A;  4MFZ A;  2DPS A;  4RS2 A;  2Z11 A;  3F8K A;  4UCP A;  1VHS A;  4CS0 B;  5DWN A;  4A33 A;  5DWM A;  4C7H A;  1QSO A;  3MGD A;  4KSF A;  2EVN A;  3JTK A;  3CXS A;  4UWI A;  1U6M A;  1PUA A;  4UCN A;  3W6S A;  2VI7 A;  1YVO A;  4H6U A;  4PV6 A;  4KVO E;  1MK4 A;  4KOR A;  4XPK A;  1MJ9 A;  3UY5 A;  1L0C A;  1CJW A;  2FSR A;  3ZJ0 A;  4FD6 A;  3QB8 A;  4CYP A;  4IUS A;  5F46 A;  4HNY B;  4AG7 A;  1S7N A;  4JLY A;  1N71 A;  4JXR A;  4NXY A;  4AVB A;  4F0Y A;  2R7H A;  4LUA A;  3TE4 A;  4JXQ A;  3TFY A;  2PR1 A;  1YK3 A;  1QSN A;  4CRZ B;  2Z3K A;  4KOV A;  3S6G A;  4Y49 C;  1CM0 A;  4JWP A;  1XE4 A;  3R9G A;  4B5O A;  5C82 A;  4KUB A;  4QBJ A;  3QAH A;  4FD4 A;  3D2P A;  1M44 A;  3F0A A;  2WPX A;  1QST A;  2VZZ A;  1NSL A;  3D8P A;  2FXF A;  2VXK A;  4PK3 A;  4CGP A;  2CNM A;  2BL1 A;  4EVY A;  1KZF A;  1Z4E A;  2NMT A;  2P6F A;  4JJX A;  4U9Y A;  4CRY B;  1XMT A;  1MJB A;  4X5K A;  2YNC C;  4NF1 A;  5BWA B;  5I0C A;  4U9Z A;  2GE3 A;  2B3U A;  4MI4 A;  4B5P B;  4XNH B;  1OZP A;  1UFH A;  1XIX A;  4OAE A;  1NMT A;  3PZJ A;  4PSW A;  4J3G A;  4R3L A;  1IB1 E;  1TIQ A;  3EO4 A;  2OH1 A;  3P2F A;  4MHD A;  2YNC A;  2Z3P A;  2OU2 A;  5G22 A;  2R8V A;  2ZXV A;  3T9Y A;  1YX0 A;  2VQY A;  4KOU A;  1Z9U A;  2ATR A;  1P0H A;  2P6E A;  3R1K A;  2D4P A;  2C27 A;  2J8R A;  3R95 A;  2PQ8 A;  4YFJ A;  4XPD B;  3R9F A;  5HH1 A;  5F49 A;  2Q0Y A;  4QUS A;  5EC4 A;  1IID A;  3FIX A;  2PSW A;  4E2A A;  2JEV A;  2QML A;  4C68 A;  4R57 A;  4AG9 A;  4MFK A;  1Q2D A;  3D2M A;  1YVK A;  2CNS A;  3A9L A;  2ZW7 A;  4CGL A;  2JDD A;  4PSX A;  2AJ6 A;  5J8C A;  1YGH A;  4CYQ A;  4AB7 A;  5AGE A;  4B13 A;  2Z3O A;  4MFL A;  3I9S A;  1BOB A;  3R96 A;  1XF8 A;  2WUU A;  5AG7 A;  4UA3 A;  5E96 A;  1QSM A;  1YLE A;  4MY3 A;  2B4D B;  2J8M A;  3LOD A;  4GS4 A;  4YGO A;  4MFJ A;  4UBR A;  2BSW A;  5A27 A;  1BO4 A;  3H5Z A;  1K4J A;  4A31 A;  2CNT A;  2ZW4 A;  1I21 A;  3TO7 A;  2QEC A;  3IU1 A;  2DPT A;  1Y7R A;  2GAN A;  1M1D A;  1Q2C A;  4U5Y A;  3RYO A;  2KCW A;  3IWG A;  2G0B A;  4H89 A;  4HNW B;  5AG4 A;  3NE7 A;  3F5B A;  1PU9 A;  1Y9K A;  4QC6 A;  5CNP A;  2B3V A;  2YGW A;  3P2H A;  4C7I A;  5IB0 A;  4QVT A;  1RXT A;  4IF5 A;  3IU2 A;  2PR8 A;  3C26 A;  5G20 A;  4C2Z A;  5ISV A;  1B87 A;  4E8O A;  3W91 A;  2ARH A;  2CXA A;  3TOA A;  4ZGY B;  4HKF A;  4MFQ A;  4ZBG A;  4K30 A;  2HUZ A;  2B4B A;  2OZG A;  4XNH C;  3SXO A;  3TCV A;  5JQ4 A;  4MFP A;  5FVJ A;  3OWC A;  5KTD A;  2OZU A;  4AVC A;  3S6H A;  4KLW A;  2Q4V A;  4CGO A;  2Z0Z A;  1YRE A;  4BMH A;  1I1D A;  5KTA A;  2P6G A;  2JLM A;  4CAV A;  2Q04 A;  2OB0 A;  4MJ8 A;  4Q36 A;  4B5P A;  2H5M A;  3TT2 A;  5JPH A;  3DNS A;  2FE7 A;  3FNC A;  4XPD C;  1R57 A;  5H84 A;  2VBQ A;  5HMN A;  2VEZ A;  4HNX B;  2YNE A;  4KOS A;  4PK2 A;  2K5T A;  3SXN A;  5G1Z A;  2P0W A;  4KLV A;  2G3T A;  3K9U A;  1WK4 A;  2BUE A;  4I49 A;  4NSQ A;  1NE9 A;  3CXQ A;  4KOT A;  2I79 A;  2Q4Y A;  2B5G B;  2EUI A;  4C2X A;  4R87 A;  1KUV A;  1M4D A;  4ONU A;  2ZW5 A;  2ZPA A;  3WR7 A;  2G3A A;  2DXQ A;  3CXP A;  4A95 A;  4KOW A;  4OLL A;  2B5G A;  4UCM A;  3FRM A;  4B11 A;  3BJ7 A;  3IWE A;  3PGP A;  4CYN A;  4CGN A;  2R98 A;  3GY9 A;  2CY2 A;  4DNC A;  3DR6 A;  2REE A;  1J4J A;  1LRZ A;  2FIW A;  2HQY A;  4KZT A;  1MJA A;  3DDD A;  3GKR A;  4KVX A;  2REF A;  2IL4 A;  1QSR A;  3BLN A;  4B10 A;  1S5K A;  4XPL A;  3JUW A;  4H6Z A;  2B4D A;  1ZO0 A;  3TO6 A;  2X7B A;  3S6F A;  1YR0 A;  4CAE A;  1RO5 A;  1S60 A;  2PC1 A;  3EXN A;  2D4O A;  2FL4 A;  3EC4 A;  3GYA A;  3LD2 A;  4JD6 A;  4ORF A;  1KUY A;  4MBU A;  4A30 A;  4R9M A;  3R9E A;  1Y9W A;  2OZH A;  3I3G A;  4KUA A;  2R1I A;  4NCZ A;  4BBH A;  4OAD A;  5F48 A;  5G21 A;  4C2Y A;  2RC4 A;  3V8I A;  1S7L A;  3EY5 A;  1M4G A;  2JDC A;  3T90 A;  1S7K A;  1IYL A;  3H4Q A;  4B14 A;  3G3S A;  1SQH A;  4CGM A;  4FD7 A;  4AVA A;  4F0X A;  1KUX A;  2Q44 A;  5EBV A;  3VWD A;  5IV0 A;  1IIC A;  1GHE A;  3DSB A;  5F47 A;  1XEB A;  3FBU A;  4M3S A;  2GIV A;  3B8G A;  2I00 A;  3IGR A;  5AG5 A;  4F6A A;  3FB3 A;  4MY0 A;  2WPW A;  2FS5 A;  4CYO A;  1IYK A;  2F5I A;  4UFW A;  3VWE A;  4II9 A;  2Z3N A;  4A2Z A;  1Z4R A;  2BEI A;  2YND A;  5A28 A;  4Y49 B;  3BJ8 A;  3KKW A;  2FT0 A;  3SHP A;  3DR8 A;  2Z3M A;  2VZY A;  4KOX A;  3TOB A;  1Q2Y A;  1ON0 A;  1S7F A;  4L89 A;  3N7Z A;  4CAW A;  4UFV A;  2Z3L A;  5H86 A;  3ZZI A;  3PP9 A;  4B12 A;  5GCN A;  2PRB A;  4R3K A;  4KSA A;  4L8A A;  2Q7B A;  2A4N A;  2WSA A;  1V0C A;  3W6X A;  2J8N A;  4CAX A;  1B6B A;  4NEX A;  5C88 A;  4YRH A;  3FXT A;  4LX9 A;  5J8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...