1U6MA

The crystal structure of acetyltransferase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
189
structure length
189
Chain Sequence
SLIRSATKEDGQAIARLVLVILKDMELPILEEVSEEQMIDLLAEATAYPTYRYGYQRILVYEHAGEVAGIAVGYPAEDEKIIDEPLREVFKKHGLAEDVRLFIEEETLPNEWYLDTISVDERFRGMGIGSKLLDALPEVAKASGKQALGLNVDFDNPGARKLYASKGFKDVTTMTISGHLYNHMQKEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords acetyltransferase, GNAT family
publication title The crystal structure of acetyltransferase, GNAT family from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
molecule tags Transferase
total genus 50
structure length 189
sequence length 189
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1u6mA00
4QC6A 4YRHA 2QIRA 3ZZIA 4R57A 2FT0A 3R95A 2PR1A 1PUAA 4PK2A 2Q4YA 3GYAA 4B5OA 1YVOA 4E0AA 2PSWA 3FB3A 2FL4A 2REFA 2ZW5A 2Q7BA 3D8PA 2GANA 3R9EA 2PR8A 1N71A 3F8KA 4KOVA 1RO5A 3WR7A 1M4DA 1MJBA 5E96A 2OH1A 2DXQA 4IUSA 2R98A 2Z11A 4YFJA 5J8FA 1IIDA 4AG9A 4CAXA 2CNMA 3G8WA 5H86A 5ISVA 1S3ZA 2HQYA 4CAVA 3OWCA 2Q04A 3ZJ0A 2JDCA 4MJ8A 3FIXA 3PGPA 2B3UA 5KTAA 2FSRA 3IGRA 5JPHA 4RI1A 4LUAA 1TIQA 1Q2DA 1QSRA 3EY5A 1YREA 4OLLA 2VZYA 4R3KA 3FRMA 4KLVA 4QBJA 2HUZA 4MBUA 4KUBA 4FD4A 4JJXA 4RS2A 4FD7A 1YGHA 2GE3A 3FYNA 4KVOE 2PC1A 2JEVA 4XPDC 2R8VA 1CM0A 3TO7A 5IB0A 3W6SA 2B3VA 3I9SA 1BOBA 2JDDA 5CNPA 4MY3A 3F0AA 1Y7RA 1MJAA 4JLYA 2ZXVA 1XEBA 1KUXA 1VHSA 3CXSA 3R96A 4L8AA 2ZW7A 2VZZA 3FXTA 1M44A 4MI4A 2VBQA 4FD5A 3V8IA 3TE4A 2FIAA 3DDDA 1KUVA 4KVXA 2QMLA 3EC4A 4FD6A 4B5PB 3QAHA 3P2FA 4M85A 1S7FA 2C27A 4NSQA 3VWDA 5JQ4A 4HNWB 4JXQA 1Z4EA 4XNHB 4II9A 3NE7A 1NE9A 3IWGA 3TO6A 4PSXA 2X7BA 3JVNA 2BUEA 2VXKA 4CRYB 3R9FA 1IB1E 1OZPA 1YX0A 4JXRA 3R9GA 2J8RA 1R57A 3TT2A 1GHEA 1YVKA 1Y9KA 5GCNA 1J4JA 3C26A 3JUWA 4AG7A 3TO9A 4QVTA 2OB0A 3SXNA 2FCKA 4KOUA 4XPLA 4UA3A 2B5GA 4E8OA 2BL1A 3SXOA 4R87A 1B87A 4J3GA 3N7ZA 4QB9A 4IF5A 1XMTA 2EUIA 1M1DA 2Z10A 1XIXA 1RXTA 4UWJA 1P0HA 2D4OA 1V0CA 2OU2A 4E2AA 2B5GB 3TOAA 4L89A 2Y0MA 2P6FA 3B8GA 4H6UA 4EVYA 3PZJA 1MJ9A 2ATRA 3CXPA 4KOWA 5IX3A 1IICA 2EVNA 2R1IA 3BJ8A 3LD2A 3UY5A 2WPXA 2PRBA 2VEZA 2REEA 1S7KA 4U5YA 3S6GA 2B4DA 4AVAA 4ZBGA 3EFAA 4XPKA 3GY9A 1I1DA 4NXYA 1NMTA 1U6MA 2B4BA 1L0CA 3LODA 2NMTA 4B5PA 5I0CA 3TTHA 4R9MA 3VWEA 4U9ZA 4UBRA 2B4DB 4ORFA 4Y49B 1Z9UA 2JLMA 2D4PA 5C82A 1S60A 2ZW4A 4F0YA 2BEIA 3R1KA 1LRZA 5F47A 3SHPA 3F5BA 5IV0A 3BJ7A 2QECA 2CY2A 4K30A 2CNSA 2J8MA 5DWNA 4PSWA 2F5IA 3T9YA 2VQYA 2OZGA 4AB7A 4M3SA 2PQ8A 1M4IA 2P6EA 2OZHA 3TCVA 1IYLA 5FVJA 1Y9WA 1B6BA 4KZTA 4H6ZA 2H5MA 4KORA 3DR8A 2A4NA 1NSLA 4H89A 2ZW6A 4AVBA 5F48A 3PP9A 4UWIA 1SQHA 2G0BA 3KKWA 4XNHC 4MY0A 4BMHA 4MHDA 1KUYA 5HH1A 4NF1A 4KOYA 4CAWA 4OAEA 1XF8A 1WWZA 4HKFA 1YK3A 3FNCA 4JD6A 4JWPA 4KOSA 3DSBA 3FBUA 2FS5A 2P0WA 1MK4A 4I49A 4ONUA 3QB8A 3EXNA 2HV2A 3D2MA 1Q2YA 1S5KA 4KOTA 4X5KA 4HNXB 2P6GA 3TFYA 3DNSA 1QSNA 4KUAA 2FE7A 3E0KA 3H4QA 1K4JA 4KLWA 2KCWA 4CRZB 1WK4A 4HNYB 2AJ6A 2J8NA 1IYKA 4XPDB 5EC4A 2G3TA 4PV6A 3D2PA 2I00A 1QSTA 3W91A 2ARHA 5KTCA 4LX9A 2B58A 2O28A 4F6AA 1I12A 3BLNA 2Q4VA 2PDOA 1I21A 4KOXA 5C88A 3W6XA 4AVCA 3T90A 2GIVA 2BSWA 3I3GA 5J8CA 2K5TA 2Q44A 1P4NA 2OZUA 1QSOA 4GS4A 4OADA 5KTDA 1M4GA 1PU9A 2WPWA 1BO4A 2AE6A 3RYOA 1KZFA 5H84A 2FIWA 4PK3A 2R7HA 5F46A 5HMNA 1VKCA 3EO4A 2IL4A 2VI7A 4NEXA 2G3AA 3CXQA 3S6KA 4R3LA 5DWMA 2FXFA 4YGOA 4U9YA 3TOBA 3S6HA 4KVME 5F49A 4Y49C 1YR0A 1XE4A 5EBVA 1YLEA 4CS0B 4QUSA 1S7NA 2CNTA 1QSMA 2ZPAA 1FY7A 4DNCA 3K9UA 2Z0ZA 1S7LA 1UFHA 3MGDA 1CJWA 1Z4RA 3DR6A 3G3SA 1ON0A 2RC4A 3P2HA 3S6FA 4NCZA 1Q2CA 2Q0YA 2I79A 3D3SA 3GKRA
chains in the Genus database with same CATH superfamily
4QC6A 4YRHA 2QIRA 5BWAB 4OC3A 3NH8A 3ZZIA 4R57A 2FT0A 2XEJA 2BCOA 4W9YA 4A33A 5AG4A 3R95A 2PR1A 1PUAA 4PK2A 2Q4YA 3GYAA 3RBUA 3FH4A 4B5OA 1YVOA 4UCNA 2Z3MA 1ZG8A 3QAYA 4E0AA 2PJAA 4DYOA 2PSWA 3FB3A 2FL4A 2REFA 2ZW5A 3D4UA 4JYWA 4NGNA 3D8PA 2Q7BA 2GANA 4UFWA 3R9EA 2PR8A 4KS9A 6CPAA 1UWYA 1N71A 3F8KA 4KOVA 4YU9A 1RO5A 3A9LA 3PRTA 3WR7A 1M4DA 2PJ1A 1MJBA 3IU1A 2CXAA 3GIUA 5D8NA 3GB0A 2OH1A 2DXQA 5E96A 4RUHA 4IUSA 2R98A 2Z11A 4YFJA 5J8FA 3B3CA 1IIDA 3S9LA 4CAFA 2C6GA 4MFJA 4X2TA 4AG9A 4CAXA 4CAEA 4P44A 3K2KA 2PJ8A 2CNMA 3BXMA 3G8WA 5H86A 3FECA 3S9MA 3BHXA 4Q38A 4FAIA 1S3ZA 2HQYA 4CAVA 4OC0A 3OWCA 2Q04A 3ZJ0A 4EFDA 3NA6A 2JDCA 1Z8XA 2Z3OA 4MJ8A 3FIXA 2EO8A 3PGPA 4C2ZA 2B3UA 4HPSA 2FSRA 5KTAA 1CP7A 1DE4C 3IGRA 4MMOA 5HVHA 2GREA 4UCMA 4UEZA 5JPHA 4MFQA 4IK2A 4MFLA 3WC5A 1CG2A 3B7IA 4RI1A 1ARLA 4LUAA 4OP4A 3KI9A 1TIQA 4MHZA 1Q2DA 1QSRA 3EY5A 2ODFA 2F7VA 2AFSA 1YREA 3QNVA 2XEGA 4OLLA 4P4JA 2VZYA 4R3KA 1VHOA 3FRMA 2XEFA 4KLVA 4QBJA 5THWA 3IIBA 2HUZA 2PJ4A 2IQ6A 4MBUA 4KUBA 2DF5A 4B14A 2F8HA 4FD4A 4A38A 1AMPA 4M6IA 3HLPA 4JJXA 4RS2A 2Q51A 4FD7A 1YGHA 3SI2A 3DLJA 3KQXA 4R76A 2GE3A 4MHNA 2WZNA 4F8ZA 3FYNA 3IWEA 5AG5A 4KVOE 3PFEA 4OMEA 2PC1A 2JEVA 2ZEPA 2ZEEA 3H8GA 4XPDC 1TF9A 2R8VA 2QJ8A 2AFWA 1CM0A 3TO7A 5IB0A 3WT4A 4ZYQA 3W6SA 4P4EA 4UEEA 2B3VA 4Q7AA 1YQEA 4OIDA 3I9SA 3NE8A 1BOBA 2PVVA 5AG6A 4CYQA 2JDDA 4P4IA 3RO0A 2JBKA 2CTCA 4A95A 2PIYA 2V77A 3F0AA 4MY3A 5CNPA 1LFWA 1MJAA 1Y7RA 2Q7SA 4JLYA 2ZXVA 1XEBA 4M6GA 2IJZA 5HVFA 5I4MA 4MCSA 4NJRA 1KUXA 2YNCA 5CBMA 1VHSA 1Z8LA 5LYLA 1YSJA 3CXSA 3S9NA 3R96A 5K8OA 4L8AA 3D68A 1PCAA 2ZW7A 3VARA 2POKA 2VZZA 1TKHA 3FXTA 3IEHA 1M44A 4MI4A 3V7ZA 2VBQA 5K8PA 4FD5A 2CTBA 3V8IA 2GLJA 3TE4A 2PE3A 1ARMA 2FIAA 3DDDA 3H8FA 1XMBA 3PB8X 3FVLA 3B3SA 1KUVA 4KVXA 2QMLA 1HDUA 4WWVA 3EC4A 3JTKA 4FD6A 1FNOA 3QAHA 4B5PB 3P2FA 1LAPA 4M85A 3KASA 1AYEA 1S7FA 4UCPA 2C27A 4PXCA 2Q43A 2JBJA 4NSQA 3VWDA 1ZG7A 4CPAA 1XBUA 5JQ4A 4HNWB 4X3RA 4JXQA 3TC8A 1AUGA 4B11A 1Z4EA 4XNHB 4II9A 4CGOA 2EK9A 1NE9A 3IWGA 3NE7A 3TO6A 2PJ5A 4PSXA 4A30A 2AFUA 2X7BA 3JVNA 2BUEA 4CYPA 2VXKA 5AG7A 2IMOA 7CPAA 3KR4A 4CRYB 3SI0A 3K9TA 4PQAA 3FJUA 5CPAA 2YNCC 2PVWA 3R9FA 1IB1E 1OZPA 5A28A 1YX0A 3KR5A 4B12A 4JXRA 3R9GA 2J8RA 5A27A 3WABA 3PB9X 4MHPA 1R57A 1ZLIA 1HEEA 3TT2A 1GHEA 1YVKA 1Y9KA 4K3NA 4KSAA 5GCNA 1J4JA 1F2OA 3C26A 3JUWA 4P4BA 3TX8A 1CX8A 4AG7A 5JM6A 1Y0RA 3D66A 2J9AA 2EK8A 3PB4X 3TO9A 4QVTA 5K8MA 2WYRA 2OB0A 1QQ9A 3SXNA 2QYVA 2FCKA 4KOUA 4B10A 1TKJA 1XRYA 4XPLA 4UA3A 1TKFA 2BO9A 2B5GA 4E8OA 2BL1A 1LOKA 3SXOA 4R87A 1B87A 3BI0A 4OC1A 4J3GA 2WUUA 5ELYA 1CBXA 3N7ZA 4OIWA 4QB9A 4TNUA 4C7HA 3CZXA 4IF5A 1IOIA 3B3VA 4FWUA 2WSAA 1F2PA 1XMTA 1H8LA 3FF3A 2EUIA 1M1DA 2Z10A 4A31A 2PJ6A 4CGPA 1XIXA 3IJ3A 1RXTA 3JRUA 1CPSA 3GUXA 4ONWA 3D67A 4UWJA 1P0HA 4KSFA 3RZAA 2XEIA 5HXDA 1BPMA 2D4OA 2JEWA 3VH9A 1V0CA 4CGNA 2OU2A 4E2AA 5LYFA 4NGSA 2B5GB 2ZEHA 3IC1A 3TOAA 4L89A 2Y0MA 2P6FA 3B8GA 4MRIA 3D7GA 4H6UA 4P10A 4MXUA 4EVYA 3PZJA 1MJ9A 1X10A 3PFOA 3LACA 2ATRA 3CXPA 4KOWA 5IX3A 4UIBA 1IICA 2EVNA 2PCUA 1FT7A 2R1IA 3BJ8A 3LD2A 3UY5A 2WPXA 2PIZA 2GU2A 4F0XA 4H2KA 2PRBA 2VEZA 2HC9A 2DPTA 2REEA 1S7KA 4U5YA 3S6GA 1DTDA 3T8WA 2B4DA 4CGMA 4AVAA 5F09A 5JH9A 1Z8WA 3EFAA 1LANA 4XPKA 4ZBGA 4ZX9A 1NSAA 3FEDA 3GY9A 1I1DA 2O53A 2PJCA 4C7IA 4DJLA 4NXYA 1BAVA 1NMTA 1U6MA 2B4BA 3FX6A 3MN8A 1L0CA 4Q36A 3LODA 2NMTA 2PJ3A 2O4HA 1BLLE 3DGVA 4B5PA 4A39A 5I0CA 4MCRA 4NGQA 4ZY2A 3TTHA 4R9MA 4UFXA 3VWEA 3SJGA 4CYNA 2V8HA 1Z8TA 1IGBA 2CF4A 4OC5A 1Z5RA 2PJ0A 4A37A 4U9ZA 3CPXA 4UBRA 1X12A 2B4DB 5G22A 5K8NA 2ZEFA 4MFZA 1Z2LA 4ORFA 4Y49B 1Z9UA 2PJ9A 4ZY1A 2JLMA 2D4PA 5C82A 2AFZA 2EBJA 4YWYA 5IB9A 3H5ZA 5AGEA 1S60A 2ZW4A 4F0YA 2BEIA 3R1KA 4NGMA 1LRZA 4MFPA 2DPSA 5F47A 4DUKA 5G1ZA 1GYTA 2Z3NA 3SHPA 3WC6A 4A32A 3F5BA 3FMCA 4R8FA 3SJFA 5IV0A 4OKOA 3BJ7A 2QECA 1ELMP 2CY2A 4K30A 4NJQA 2CNSA 4C2XA 1KWMA 2J8MA 8CPAA 2HB6A 5J1QA 1IU8A 5DWNA 1Y7EA 2YGWA 4PSWA 4UFVA 2F5IA 2GLFA 4UF4A 2QVPA 3SI1A 3IO1A 3T9YA 2Z3LA 4F9VA 3PEIA 3RAMA 1VGYA 2VQYA 3ISXA 4CYOA 2OOTA 4R7MA 4B6ZA 1XOVA 2OZGA 2V8DA 3D7HA 4AB7A 4M3SA 2PQ8A 1CP6A 4A94A 1M4IA 2P6EA 2OZHA 3N5FA 1IYLA 5FVJA 1Y9WA 1B6BA 2FVGA 1TXRA 3NH5A 1LCPA 3TCVA 4KZTA 4H6ZA 2H5MA 1ZLHA 1RTQA 4KORA 4R6TA 3DR8A 3KHZA 3KHXA 3GLJA 2A4NA 2NYQA 1NSLA 3D7FA 1VIXA 4H89A 4C68A 2RB7A 2Z3PA 2ZW6A 4AVBA 2DEAA 5F48A 3PP9A 4UWIA 3CT9A 1SQHA 1ZG9A 4WJBA 4CGLA 4EWTA 2G0BA 3KKWA 4XNHC 4MY0A 4BMHA 2YNEA 2PRQA 4MHDA 1KUYA 5HH1A 5G21A 4FBEA 1A2ZA 1XFOA 3B35A 2ZEMA 4NF1A 3CPAA 5LRKA 5DS0A 2PJ7A 4KOYA 4LQ6A 4OC4A 4CAWA 3H8EA 4IHMA 4OAEA 1XF8A 4ZX8A 1WWZA 4HKFA 2EWBA 3KZWA 1YK3A 3FNCA 2AFMA 4JD6A 4JWPA 4NGTA 4RN7A 5HVGA 1HDQA 4ZY0A 4KOSA 2V8VA 4G1PA 1Y0YA 3RNZA 3DSBA 3FBUA 2FS5A 2ABZA 4C2YA 2P0WA 2ANPA 4OC2A 1EE3P 1IY7A 3ISZA 1MK4A 1VHEA 3B3TA 4I49A 1OBRA 3D7DA 4ONUA 4BINA 4P6YA 2ZOFA 3L2NA 3QB8A 2PJBA 2RFHA 1ELLP 3EXNA 3IWWA 2ZELA 3LWUA 4KSIA 2HV2A 5LRGA 1YW4A 1JQGA 2ZOGA 3D2MA 1JWQA 1Q2YA 1S5KA 2C1CA 4MHYA 4KOTA 4X5KA 4HNXB 4LQGA 4UIAA 2P6GA 4FUUA 3TFYA 1QMUA 3DNSA 1QSNA 3IFEA 3NH4A 4KUAA 2FE7A 3E0KA 3H4QA 4IAVA 3I1UA 1K4JA 4P45A 4KLWA 2KCWA 2ZEDA 1WK4A 4HNYB 4CRZB 1BPNA 3NFZA 5LRJA 2AJ6A 2J8NA 3BI1A 4PXEA 2G9DA 3KQZA 1IYKA 2NSMA 4XPDB 3LMSA 5EC4A 2G3TA 4MCQA 4PV6A 5D29A 2C6CA 2I00A 1QSTA 3D2PA 2AFOA 2ARHA 2ZEGA 3W91A 4GXHA 5KTCA 4LX9A 4P4DA 1IOFA 1YMEA 1YLOA 2B58A 2O28A 4TWEA 2GFQA 4F6AA 1I12A 1ZO0A 2ZENA 5LYDA 4AXVA 4F9UA 3BLNA 2Q4VA 4MCPA 2Q4ZA 2PDOA 1I21A 4KOXA 1TF8A 5C88A 3W6XA 4AVCA 4ZI6A 3PB6X 3T90A 3SJXA 2I3CA 2GIVA 3B3WA 4P4FA 2BSWA 3I3GA 4JZ0A 4EMEA 5J8CA 5JGFA 4ZGYB 2K5TA 2Q44A 2Z3KA 3VATA 4PXBA 5ISVA 2C6PA 5LYIA 1P4NA 3FEEA 2OZUA 1QSOA 3CDXA 4GS4A 4M6HA 4OADA 5G20A 5KTDA 1M4GA 1PU9A 2WPWA 1CPXA 1BO4A 2AE6A 3MRUA 4NFRA 4X8IA 4Z65A 3RYOA 1KZFA 4PPZA 5H84A 2FIWA 4NGPA 4PK3A 3HUVA 1LAMA 2R7HA 5F46A 1VKCA 3KL9A 4UEFA 5HMNA 4PXDA 3EO4A 4BD9A 2IL4A 2VI7A 2YNDA 2BOAA 3IU2A 2G3AA 3B2YA 3CXQA 4NEXA 3S6KA 3V38A 2PJ2A 4R3LA 5DWMA 2FXFA 1F57A 4O23A 3PBBA 4YGOA 3SJEA 4BBHA 2AFXA 4U9YA 3S6HA 3TOBA 4KVME 5F49A 5EMIA 4Y49C 1R43A 1Q7LA 3KGQA 1PYTB 1YR0A 1M4LA 1XE4A 5EBVA 1YLEA 4CS0B 4QUSA 3WC7A 1S7NA 2CNTA 2OR4A 4A2ZA 1QSMA 2ZPAA 1FY7A 4DNCA 2CIJA 3K9UA 2Z0ZA 2ZEOA 1S7LA 2VL1A 1UFHA 1YW6A 3MGDA 1CJWA 4MFKA 1Z4RA 3DR6A 3G3SA 3PBEA 1ON0A 3PB7X 2RC4A 3P2HA 4NGRA 1R3NA 3S6FA 4B13A 4GM5A 4NCZA 1Q2CA 2V8GA 2Q0YA 2I79A 1XJOA 3D3SA 3GKRA
chains in the Genus database with same CATH topology
4QC6A 4YRHA 2QIRA 5BWAB 3ZZIA 4R57A 2FT0A 4A33A 5AG4A 3R95A 2PR1A 1PUAA 4PK2A 2Q4YA 3GYAA 4B5OA 1YVOA 4UCNA 2Z3MA 4E0AA 2PSWA 3FB3A 2FL4A 2REFA 2ZW5A 2Q7BA 3D8PA 2GANA 4UFWA 3R9EA 2PR8A 4KS9A 1N71A 3F8KA 4KOVA 1RO5A 3A9LA 3WR7A 1M4DA 1MJBA 3IU1A 2CXAA 5E96A 2OH1A 2DXQA 4IUSA 2R98A 2Z11A 4YFJA 5J8FA 1IIDA 4CAFA 4AG9A 4MFJA 4CAXA 4CAEA 2CNMA 3G8WA 5H86A 5ISVA 4Q38A 1S3ZA 2HQYA 4CAVA 3OWCA 2Q04A 3ZJ0A 2JDCA 2Z3OA 4MJ8A 3FIXA 3PGPA 4C2ZA 2B3UA 5KTAA 2FSRA 3IGRA 4UCMA 5JPHA 4MFQA 4MFLA 4RI1A 4LUAA 1TIQA 1Q2DA 1QSRA 3EY5A 1YREA 4OLLA 2VZYA 4R3KA 3FRMA 4KLVA 4QBJA 2HUZA 4MBUA 4KUBA 4B14A 4FD4A 4JJXA 4RS2A 4FD7A 1YGHA 2GE3A 3FYNA 3IWEA 5AG5A 4KVOE 2PC1A 2JEVA 4XPDC 2R8VA 1CM0A 3TO7A 5IB0A 3W6SA 2B3VA 3I9SA 1BOBA 5AG6A 4CYQA 2JDDA 4A95A 5CNPA 4MY3A 3F0AA 1Y7RA 1MJAA 4JLYA 2ZXVA 1XEBA 1KUXA 2YNCA 1VHSA 3CXSA 3R96A 4L8AA 2ZW7A 2VZZA 3FXTA 1M44A 4MI4A 2VBQA 4FD5A 3V8IA 3TE4A 2FIAA 3DDDA 1KUVA 4KVXA 2QMLA 3EC4A 3JTKA 4FD6A 4B5PB 3QAHA 3P2FA 4M85A 1S7FA 4UCPA 2C27A 4NSQA 3VWDA 5JQ4A 4HNWB 4JXQA 4B11A 1Z4EA 4XNHB 4II9A 4CGOA 3NE7A 1NE9A 3IWGA 3TO6A 4A30A 4PSXA 2X7BA 3JVNA 2BUEA 4CYPA 2VXKA 5AG7A 4CRYB 2YNCC 3R9FA 1IB1E 1OZPA 5A28A 1YX0A 4B12A 4JXRA 3R9GA 2J8RA 5A27A 1R57A 3TT2A 1GHEA 1YVKA 1Y9KA 4KSAA 5GCNA 4ZGYB 1J4JA 3C26A 3JUWA 4AG7A 3TO9A 4QVTA 2OB0A 3SXNA 2FCKA 4KOUA 4B10A 4XPLA 4UA3A 2B5GA 4E8OA 2BL1A 3SXOA 4R87A 1B87A 4J3GA 2WUUA 3N7ZA 4QB9A 4C7HA 4IF5A 2WSAA 1XMTA 2EUIA 1M1DA 2Z10A 4A31A 4CGPA 1XIXA 1RXTA 4UWJA 1P0HA 4KSFA 2D4OA 1V0CA 4CGNA 2OU2A 4E2AA 2B5GB 3TOAA 4L89A 2Y0MA 2P6FA 3B8GA 4H6UA 4EVYA 3PZJA 1MJ9A 2ATRA 3CXPA 4KOWA 5IX3A 1IICA 2EVNA 2R1IA 3BJ8A 3LD2A 3UY5A 2WPXA 4F0XA 2PRBA 2VEZA 2DPTA 2REEA 1S7KA 4U5YA 3S6GA 2B4DA 4CGMA 4AVAA 4ZBGA 3EFAA 4XPKA 3GY9A 1I1DA 4C7IA 4NXYA 1NMTA 1U6MA 2B4BA 4Q36A 1L0CA 3LODA 2NMTA 4B5PA 5I0CA 3TTHA 4R9MA 4UFXA 3VWEA 4CYNA 4U9ZA 4UBRA 2B4DB 5G22A 4MFZA 4ORFA 4Y49B 1Z9UA 2JLMA 2D4PA 5C82A 3H5ZA 5AGEA 1S60A 2ZW4A 4F0YA 2BEIA 3R1KA 1LRZA 4MFPA 2DPSA 5F47A 5G1ZA 2Z3NA 3SHPA 4A32A 3F5BA 5IV0A 3BJ7A 2QECA 2CY2A 4K30A 2CNSA 4C2XA 2J8MA 5DWNA 2YGWA 4PSWA 4UFVA 2F5IA 3T9YA 2Z3LA 2VQYA 4CYOA 2OZGA 4AB7A 4M3SA 2PQ8A 1M4IA 2P6EA 2OZHA 3TCVA 1IYLA 5FVJA 1Y9WA 1B6BA 4KZTA 4H6ZA 2H5MA 4KORA 3DR8A 2A4NA 1NSLA 4H89A 4C68A 2Z3PA 2ZW6A 4AVBA 5F48A 3PP9A 4UWIA 4CGLA 1SQHA 2G0BA 3KKWA 4XNHC 4MY0A 4BMHA 2YNEA 4MHDA 1KUYA 5HH1A 5G21A 4NF1A 4KOYA 4CAWA 4OAEA 1XF8A 1WWZA 4HKFA 1YK3A 3FNCA 4JD6A 4JWPA 4KOSA 3DSBA 3FBUA 2FS5A 4C2YA 2P0WA 1MK4A 4I49A 4ONUA 3QB8A 3EXNA 2HV2A 3D2MA 1Q2YA 1S5KA 4KOTA 4X5KA 4HNXB 2P6GA 3TFYA 3DNSA 1QSNA 4KUAA 2FE7A 3E0KA 3H4QA 1K4JA 4KLWA 2KCWA 4CRZB 1WK4A 4HNYB 2AJ6A 2J8NA 1IYKA 4XPDB 5EC4A 2G3TA 4PV6A 3D2PA 2I00A 1QSTA 3W91A 2ARHA 5KTCA 4LX9A 2B58A 2O28A 4F6AA 1I12A 1ZO0A 3BLNA 2Q4VA 2PDOA 1I21A 4KOXA 5C88A 3W6XA 4AVCA 3T90A 2GIVA 2BSWA 3I3GA 5J8CA 2K5TA 2Q44A 2Z3KA 1P4NA 2OZUA 1QSOA 4GS4A 4OADA 5G20A 5KTDA 1M4GA 1PU9A 2WPWA 1BO4A 2AE6A 3RYOA 1KZFA 5H84A 2FIWA 4PK3A 2R7HA 5F46A 5HMNA 1VKCA 3EO4A 2IL4A 2VI7A 2YNDA 3IU2A 4NEXA 2G3AA 3CXQA 3S6KA 4R3LA 5DWMA 2FXFA 4YGOA 4BBHA 4U9YA 3TOBA 3S6HA 4KVME 5F49A 4Y49C 1YR0A 1XE4A 5EBVA 1YLEA 4CS0B 4QUSA 1S7NA 2CNTA 4A2ZA 1QSMA 2ZPAA 1FY7A 4DNCA 3K9UA 2Z0ZA 1S7LA 1UFHA 4MFKA 3MGDA 1CJWA 1Z4RA 3DR6A 3G3SA 1ON0A 2RC4A 3P2HA 3S6FA 4B13A 4NCZA 1Q2CA 2Q0YA 2I79A 3D3SA 3GKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QC6 A;  4YRH A;  2QIR A;  3ZZI A;  4R57 A;  2FT0 A;  3R95 A;  2PR1 A;  1PUA A;  4PK2 A;  2Q4Y A;  3GYA A;  4B5O A;  1YVO A;  4E0A A;  2PSW A;  3FB3 A;  2FL4 A;  2REF A;  2ZW5 A;  2Q7B A;  3D8P A;  2GAN A;  3R9E A;  2PR8 A;  1N71 A;  3F8K A;  4KOV A;  1RO5 A;  3WR7 A;  1M4D A;  1MJB A;  5E96 A;  2OH1 A;  2DXQ A;  4IUS A;  2R98 A;  2Z11 A;  4YFJ A;  5J8F A;  1IID A;  4AG9 A;  4CAX A;  2CNM A;  3G8W A;  5H86 A;  5ISV A;  1S3Z A;  2HQY A;  4CAV A;  3OWC A;  2Q04 A;  3ZJ0 A;  2JDC A;  4MJ8 A;  3FIX A;  3PGP A;  2B3U A;  5KTA A;  2FSR A;  3IGR A;  5JPH A;  4RI1 A;  4LUA A;  1TIQ A;  1Q2D A;  1QSR A;  3EY5 A;  1YRE A;  4OLL A;  2VZY A;  4R3K A;  3FRM A;  4KLV A;  4QBJ A;  2HUZ A;  4MBU A;  4KUB A;  4FD4 A;  4JJX A;  4RS2 A;  4FD7 A;  1YGH A;  2GE3 A;  3FYN A;  4KVO E;  2PC1 A;  2JEV A;  4XPD C;  2R8V A;  1CM0 A;  3TO7 A;  5IB0 A;  3W6S A;  2B3V A;  3I9S A;  1BOB A;  2JDD A;  5CNP A;  4MY3 A;  3F0A A;  1Y7R A;  1MJA A;  4JLY A;  2ZXV A;  1XEB A;  1KUX A;  1VHS A;  3CXS A;  3R96 A;  4L8A A;  2ZW7 A;  2VZZ A;  3FXT A;  1M44 A;  4MI4 A;  2VBQ A;  4FD5 A;  3V8I A;  3TE4 A;  2FIA A;  3DDD A;  1KUV A;  4KVX A;  2QML A;  3EC4 A;  4FD6 A;  4B5P B;  3QAH A;  3P2F A;  4M85 A;  1S7F A;  2C27 A;  4NSQ A;  3VWD A;  5JQ4 A;  4HNW B;  4JXQ A;  1Z4E A;  4XNH B;  4II9 A;  3NE7 A;  1NE9 A;  3IWG A;  3TO6 A;  4PSX A;  2X7B A;  3JVN A;  2BUE A;  2VXK A;  4CRY B;  3R9F A;  1IB1 E;  1OZP A;  1YX0 A;  4JXR A;  3R9G A;  2J8R A;  1R57 A;  3TT2 A;  1GHE A;  1YVK A;  1Y9K A;  5GCN A;  1J4J A;  3C26 A;  3JUW A;  4AG7 A;  3TO9 A;  4QVT A;  2OB0 A;  3SXN A;  2FCK A;  4KOU A;  4XPL A;  4UA3 A;  2B5G A;  4E8O A;  2BL1 A;  3SXO A;  4R87 A;  1B87 A;  4J3G A;  3N7Z A;  4QB9 A;  4IF5 A;  1XMT A;  2EUI A;  1M1D A;  2Z10 A;  1XIX A;  1RXT A;  4UWJ A;  1P0H A;  2D4O A;  1V0C A;  2OU2 A;  4E2A A;  2B5G B;  3TOA A;  4L89 A;  2Y0M A;  2P6F A;  3B8G A;  4H6U A;  4EVY A;  3PZJ A;  1MJ9 A;  2ATR A;  3CXP A;  4KOW A;  5IX3 A;  1IIC A;  2EVN A;  2R1I A;  3BJ8 A;  3LD2 A;  3UY5 A;  2WPX A;  2PRB A;  2VEZ A;  2REE A;  1S7K A;  4U5Y A;  3S6G A;  2B4D A;  4AVA A;  4ZBG A;  3EFA A;  4XPK A;  3GY9 A;  1I1D A;  4NXY A;  1NMT A;  1U6M A;  2B4B A;  1L0C A;  3LOD A;  2NMT A;  4B5P A;  5I0C A;  3TTH A;  4R9M A;  3VWE A;  4U9Z A;  4UBR A;  2B4D B;  4ORF A;  4Y49 B;  1Z9U A;  2JLM A;  2D4P A;  5C82 A;  1S60 A;  2ZW4 A;  4F0Y A;  2BEI A;  3R1K A;  1LRZ A;  5F47 A;  3SHP A;  3F5B A;  5IV0 A;  3BJ7 A;  2QEC A;  2CY2 A;  4K30 A;  2CNS A;  2J8M A;  5DWN A;  4PSW A;  2F5I A;  3T9Y A;  2VQY A;  2OZG A;  4AB7 A;  4M3S A;  2PQ8 A;  1M4I A;  2P6E A;  2OZH A;  3TCV A;  1IYL A;  5FVJ A;  1Y9W A;  1B6B A;  4KZT A;  4H6Z A;  2H5M A;  4KOR A;  3DR8 A;  2A4N A;  1NSL A;  4H89 A;  2ZW6 A;  4AVB A;  5F48 A;  3PP9 A;  4UWI A;  1SQH A;  2G0B A;  3KKW A;  4XNH C;  4MY0 A;  4BMH A;  4MHD A;  1KUY A;  5HH1 A;  4NF1 A;  4KOY A;  4CAW A;  4OAE A;  1XF8 A;  1WWZ A;  4HKF A;  1YK3 A;  3FNC A;  4JD6 A;  4JWP A;  4KOS A;  3DSB A;  3FBU A;  2FS5 A;  2P0W A;  1MK4 A;  4I49 A;  4ONU A;  3QB8 A;  3EXN A;  2HV2 A;  3D2M A;  1Q2Y A;  1S5K A;  4KOT A;  4X5K A;  4HNX B;  2P6G A;  3TFY A;  3DNS A;  1QSN A;  4KUA A;  2FE7 A;  3E0K A;  3H4Q A;  1K4J A;  4KLW A;  2KCW A;  4CRZ B;  1WK4 A;  4HNY B;  2AJ6 A;  2J8N A;  1IYK A;  4XPD B;  5EC4 A;  2G3T A;  4PV6 A;  3D2P A;  2I00 A;  1QST A;  3W91 A;  2ARH A;  5KTC A;  4LX9 A;  2B58 A;  2O28 A;  4F6A A;  1I12 A;  3BLN A;  2Q4V A;  2PDO A;  1I21 A;  4KOX A;  5C88 A;  3W6X A;  4AVC A;  3T90 A;  2GIV A;  2BSW A;  3I3G A;  5J8C A;  2K5T A;  2Q44 A;  1P4N A;  2OZU A;  1QSO A;  4GS4 A;  4OAD A;  5KTD A;  1M4G A;  1PU9 A;  2WPW A;  1BO4 A;  2AE6 A;  3RYO A;  1KZF A;  5H84 A;  2FIW A;  4PK3 A;  2R7H A;  5F46 A;  5HMN A;  1VKC A;  3EO4 A;  2IL4 A;  2VI7 A;  4NEX A;  2G3A A;  3CXQ A;  3S6K A;  4R3L A;  5DWM A;  2FXF A;  4YGO A;  4U9Y A;  3TOB A;  3S6H A;  4KVM E;  5F49 A;  4Y49 C;  1YR0 A;  1XE4 A;  5EBV A;  1YLE A;  4CS0 B;  4QUS A;  1S7N A;  2CNT A;  1QSM A;  2ZPA A;  1FY7 A;  4DNC A;  3K9U A;  2Z0Z A;  1S7L A;  1UFH A;  3MGD A;  1CJW A;  1Z4R A;  3DR6 A;  3G3S A;  1ON0 A;  2RC4 A;  3P2H A;  3S6F A;  4NCZ A;  1Q2C A;  2Q0Y A;  2I79 A;  3D3S A;  3GKR A; 
#chains in the Genus database with same CATH topology
 4QC6 A;  4YRH A;  2QIR A;  5BWA B;  4OC3 A;  3NH8 A;  3ZZI A;  4R57 A;  2FT0 A;  2XEJ A;  2BCO A;  4W9Y A;  4A33 A;  5AG4 A;  3R95 A;  2PR1 A;  1PUA A;  4PK2 A;  2Q4Y A;  3GYA A;  3RBU A;  3FH4 A;  4B5O A;  1YVO A;  4UCN A;  2Z3M A;  1ZG8 A;  3QAY A;  4E0A A;  2PJA A;  4DYO A;  2PSW A;  3FB3 A;  2FL4 A;  2REF A;  2ZW5 A;  3D4U A;  4JYW A;  4NGN A;  3D8P A;  2Q7B A;  2GAN A;  4UFW A;  3R9E A;  2PR8 A;  4KS9 A;  6CPA A;  1UWY A;  1N71 A;  3F8K A;  4KOV A;  4YU9 A;  1RO5 A;  3A9L A;  3PRT A;  3WR7 A;  1M4D A;  2PJ1 A;  1MJB A;  3IU1 A;  2CXA A;  3GIU A;  5D8N A;  3GB0 A;  2OH1 A;  2DXQ A;  5E96 A;  4RUH A;  4IUS A;  2R98 A;  2Z11 A;  4YFJ A;  5J8F A;  3B3C A;  1IID A;  3S9L A;  4CAF A;  2C6G A;  4MFJ A;  4X2T A;  4AG9 A;  4CAX A;  4CAE A;  4P44 A;  3K2K A;  2PJ8 A;  2CNM A;  3BXM A;  3G8W A;  5H86 A;  3FEC A;  3S9M A;  3BHX A;  4Q38 A;  4FAI A;  1S3Z A;  2HQY A;  4CAV A;  4OC0 A;  3OWC A;  2Q04 A;  3ZJ0 A;  4EFD A;  3NA6 A;  2JDC A;  1Z8X A;  2Z3O A;  4MJ8 A;  3FIX A;  2EO8 A;  3PGP A;  4C2Z A;  2B3U A;  4HPS A;  2FSR A;  5KTA A;  1CP7 A;  1DE4 C;  3IGR A;  4MMO A;  5HVH A;  2GRE A;  4UCM A;  4UEZ A;  5JPH A;  4MFQ A;  4IK2 A;  4MFL A;  3WC5 A;  1CG2 A;  3B7I A;  4RI1 A;  1ARL A;  4LUA A;  4OP4 A;  3KI9 A;  1TIQ A;  4MHZ A;  1Q2D A;  1QSR A;  3EY5 A;  2ODF A;  2F7V A;  2AFS A;  1YRE A;  3QNV A;  2XEG A;  4OLL A;  4P4J A;  2VZY A;  4R3K A;  1VHO A;  3FRM A;  2XEF A;  4KLV A;  4QBJ A;  5THW A;  3IIB A;  2HUZ A;  2PJ4 A;  2IQ6 A;  4MBU A;  4KUB A;  2DF5 A;  4B14 A;  2F8H A;  4FD4 A;  4A38 A;  1AMP A;  4M6I A;  3HLP A;  4JJX A;  4RS2 A;  2Q51 A;  4FD7 A;  1YGH A;  3SI2 A;  3DLJ A;  3KQX A;  4R76 A;  2GE3 A;  4MHN A;  2WZN A;  4F8Z A;  3FYN A;  3IWE A;  5AG5 A;  4KVO E;  3PFE A;  4OME A;  2PC1 A;  2JEV A;  2ZEP A;  2ZEE A;  3H8G A;  4XPD C;  1TF9 A;  2R8V A;  2QJ8 A;  2AFW A;  1CM0 A;  3TO7 A;  5IB0 A;  3WT4 A;  4ZYQ A;  3W6S A;  4P4E A;  4UEE A;  2B3V A;  4Q7A A;  1YQE A;  4OID A;  3I9S A;  3NE8 A;  1BOB A;  2PVV A;  5AG6 A;  4CYQ A;  2JDD A;  4P4I A;  3RO0 A;  2JBK A;  2CTC A;  4A95 A;  2PIY A;  2V77 A;  3F0A A;  4MY3 A;  5CNP A;  1LFW A;  1MJA A;  1Y7R A;  2Q7S A;  4JLY A;  2ZXV A;  1XEB A;  4M6G A;  2IJZ A;  5HVF A;  5I4M A;  4MCS A;  4NJR A;  1KUX A;  2YNC A;  5CBM A;  1VHS A;  1Z8L A;  5LYL A;  1YSJ A;  3CXS A;  3S9N A;  3R96 A;  5K8O A;  4L8A A;  3D68 A;  1PCA A;  2ZW7 A;  3VAR A;  2POK A;  2VZZ A;  1TKH A;  3FXT A;  3IEH A;  1M44 A;  4MI4 A;  3V7Z A;  2VBQ A;  5K8P A;  4FD5 A;  2CTB A;  3V8I A;  2GLJ A;  3TE4 A;  2PE3 A;  1ARM A;  2FIA A;  3DDD A;  3H8F A;  1XMB A;  3PB8 X;  3FVL A;  3B3S A;  1KUV A;  4KVX A;  2QML A;  1HDU A;  4WWV A;  3EC4 A;  3JTK A;  4FD6 A;  1FNO A;  3QAH A;  4B5P B;  3P2F A;  1LAP A;  4M85 A;  3KAS A;  1AYE A;  1S7F A;  4UCP A;  2C27 A;  4PXC A;  2Q43 A;  2JBJ A;  4NSQ A;  3VWD A;  1ZG7 A;  4CPA A;  1XBU A;  5JQ4 A;  4HNW B;  4X3R A;  4JXQ A;  3TC8 A;  1AUG A;  4B11 A;  1Z4E A;  4XNH B;  4II9 A;  4CGO A;  2EK9 A;  1NE9 A;  3IWG A;  3NE7 A;  3TO6 A;  2PJ5 A;  4PSX A;  4A30 A;  2AFU A;  2X7B A;  3JVN A;  2BUE A;  4CYP A;  2VXK A;  5AG7 A;  2IMO A;  7CPA A;  3KR4 A;  4CRY B;  3SI0 A;  3K9T A;  4PQA A;  3FJU A;  5CPA A;  2YNC C;  2PVW A;  3R9F A;  1IB1 E;  1OZP A;  5A28 A;  1YX0 A;  3KR5 A;  4B12 A;  4JXR A;  3R9G A;  2J8R A;  5A27 A;  3WAB A;  3PB9 X;  4MHP A;  1R57 A;  1ZLI A;  1HEE A;  3TT2 A;  1GHE A;  1YVK A;  1Y9K A;  4K3N A;  4KSA A;  5GCN A;  1J4J A;  1F2O A;  3C26 A;  3JUW A;  4P4B A;  3TX8 A;  1CX8 A;  4AG7 A;  5JM6 A;  1Y0R A;  3D66 A;  2J9A A;  2EK8 A;  3PB4 X;  3TO9 A;  4QVT A;  5K8M A;  2WYR A;  2OB0 A;  1QQ9 A;  3SXN A;  2QYV A;  2FCK A;  4KOU A;  4B10 A;  1TKJ A;  1XRY A;  4XPL A;  4UA3 A;  1TKF A;  2BO9 A;  2B5G A;  4E8O A;  2BL1 A;  1LOK A;  3SXO A;  4R87 A;  1B87 A;  3BI0 A;  4OC1 A;  4J3G A;  2WUU A;  5ELY A;  1CBX A;  3N7Z A;  4OIW A;  4QB9 A;  4TNU A;  4C7H A;  3CZX A;  4IF5 A;  1IOI A;  3B3V A;  4FWU A;  2WSA A;  1F2P A;  1XMT A;  1H8L A;  3FF3 A;  2EUI A;  1M1D A;  2Z10 A;  4A31 A;  2PJ6 A;  4CGP A;  1XIX A;  3IJ3 A;  1RXT A;  3JRU A;  1CPS A;  3GUX A;  4ONW A;  3D67 A;  4UWJ A;  1P0H A;  4KSF A;  3RZA A;  2XEI A;  5HXD A;  1BPM A;  2D4O A;  2JEW A;  3VH9 A;  1V0C A;  4CGN A;  2OU2 A;  4E2A A;  5LYF A;  4NGS A;  2B5G B;  2ZEH A;  3IC1 A;  3TOA A;  4L89 A;  2Y0M A;  2P6F A;  3B8G A;  4MRI A;  3D7G A;  4H6U A;  4P10 A;  4MXU A;  4EVY A;  3PZJ A;  1MJ9 A;  1X10 A;  3PFO A;  3LAC A;  2ATR A;  3CXP A;  4KOW A;  5IX3 A;  4UIB A;  1IIC A;  2EVN A;  2PCU A;  1FT7 A;  2R1I A;  3BJ8 A;  3LD2 A;  3UY5 A;  2WPX A;  2PIZ A;  2GU2 A;  4F0X A;  4H2K A;  2PRB A;  2VEZ A;  2HC9 A;  2DPT A;  2REE A;  1S7K A;  4U5Y A;  3S6G A;  1DTD A;  3T8W A;  2B4D A;  4CGM A;  4AVA A;  5F09 A;  5JH9 A;  1Z8W A;  3EFA A;  1LAN A;  4XPK A;  4ZBG A;  4ZX9 A;  1NSA A;  3FED A;  3GY9 A;  1I1D A;  2O53 A;  2PJC A;  4C7I A;  4DJL A;  4NXY A;  1BAV A;  1NMT A;  1U6M A;  2B4B A;  3FX6 A;  3MN8 A;  1L0C A;  4Q36 A;  3LOD A;  2NMT A;  2PJ3 A;  2O4H A;  1BLL E;  3DGV A;  4B5P A;  4A39 A;  5I0C A;  4MCR A;  4NGQ A;  4ZY2 A;  3TTH A;  4R9M A;  4UFX A;  3VWE A;  3SJG A;  4CYN A;  2V8H A;  1Z8T A;  1IGB A;  2CF4 A;  4OC5 A;  1Z5R A;  2PJ0 A;  4A37 A;  4U9Z A;  3CPX A;  4UBR A;  1X12 A;  2B4D B;  5G22 A;  5K8N A;  2ZEF A;  4MFZ A;  1Z2L A;  4ORF A;  4Y49 B;  1Z9U A;  2PJ9 A;  4ZY1 A;  2JLM A;  2D4P A;  5C82 A;  2AFZ A;  2EBJ A;  4YWY A;  5IB9 A;  3H5Z A;  5AGE A;  1S60 A;  2ZW4 A;  4F0Y A;  2BEI A;  3R1K A;  4NGM A;  1LRZ A;  4MFP A;  2DPS A;  5F47 A;  4DUK A;  5G1Z A;  1GYT A;  2Z3N A;  3SHP A;  3WC6 A;  4A32 A;  3F5B A;  3FMC A;  4R8F A;  3SJF A;  5IV0 A;  4OKO A;  3BJ7 A;  2QEC A;  1ELM P;  2CY2 A;  4K30 A;  4NJQ A;  2CNS A;  4C2X A;  1KWM A;  2J8M A;  8CPA A;  2HB6 A;  5J1Q A;  1IU8 A;  5DWN A;  1Y7E A;  2YGW A;  4PSW A;  4UFV A;  2F5I A;  2GLF A;  4UF4 A;  2QVP A;  3SI1 A;  3IO1 A;  3T9Y A;  2Z3L A;  4F9V A;  3PEI A;  3RAM A;  1VGY A;  2VQY A;  3ISX A;  4CYO A;  2OOT A;  4R7M A;  4B6Z A;  1XOV A;  2OZG A;  2V8D A;  3D7H A;  4AB7 A;  4M3S A;  2PQ8 A;  1CP6 A;  4A94 A;  1M4I A;  2P6E A;  2OZH A;  3N5F A;  1IYL A;  5FVJ A;  1Y9W A;  1B6B A;  2FVG A;  1TXR A;  3NH5 A;  1LCP A;  3TCV A;  4KZT A;  4H6Z A;  2H5M A;  1ZLH A;  1RTQ A;  4KOR A;  4R6T A;  3DR8 A;  3KHZ A;  3KHX A;  3GLJ A;  2A4N A;  2NYQ A;  1NSL A;  3D7F A;  1VIX A;  4H89 A;  4C68 A;  2RB7 A;  2Z3P A;  2ZW6 A;  4AVB A;  2DEA A;  5F48 A;  3PP9 A;  4UWI A;  3CT9 A;  1SQH A;  1ZG9 A;  4WJB A;  4CGL A;  4EWT A;  2G0B A;  3KKW A;  4XNH C;  4MY0 A;  4BMH A;  2YNE A;  2PRQ A;  4MHD A;  1KUY A;  5HH1 A;  5G21 A;  4FBE A;  1A2Z A;  1XFO A;  3B35 A;  2ZEM A;  4NF1 A;  3CPA A;  5LRK A;  5DS0 A;  2PJ7 A;  4KOY A;  4LQ6 A;  4OC4 A;  4CAW A;  3H8E A;  4IHM A;  4OAE A;  1XF8 A;  4ZX8 A;  1WWZ A;  4HKF A;  2EWB A;  3KZW A;  1YK3 A;  3FNC A;  2AFM A;  4JD6 A;  4JWP A;  4NGT A;  4RN7 A;  5HVG A;  1HDQ A;  4ZY0 A;  4KOS A;  2V8V A;  4G1P A;  1Y0Y A;  3RNZ A;  3DSB A;  3FBU A;  2FS5 A;  2ABZ A;  4C2Y A;  2P0W A;  2ANP A;  4OC2 A;  1EE3 P;  1IY7 A;  3ISZ A;  1MK4 A;  1VHE A;  3B3T A;  4I49 A;  1OBR A;  3D7D A;  4ONU A;  4BIN A;  4P6Y A;  2ZOF A;  3L2N A;  3QB8 A;  2PJB A;  2RFH A;  1ELL P;  3EXN A;  3IWW A;  2ZEL A;  3LWU A;  4KSI A;  2HV2 A;  5LRG A;  1YW4 A;  1JQG A;  2ZOG A;  3D2M A;  1JWQ A;  1Q2Y A;  1S5K A;  2C1C A;  4MHY A;  4KOT A;  4X5K A;  4HNX B;  4LQG A;  4UIA A;  2P6G A;  4FUU A;  3TFY A;  1QMU A;  3DNS A;  1QSN A;  3IFE A;  3NH4 A;  4KUA A;  2FE7 A;  3E0K A;  3H4Q A;  4IAV A;  3I1U A;  1K4J A;  4P45 A;  4KLW A;  2KCW A;  2ZED A;  1WK4 A;  4HNY B;  4CRZ B;  1BPN A;  3NFZ A;  5LRJ A;  2AJ6 A;  2J8N A;  3BI1 A;  4PXE A;  2G9D A;  3KQZ A;  1IYK A;  2NSM A;  4XPD B;  3LMS A;  5EC4 A;  2G3T A;  4MCQ A;  4PV6 A;  5D29 A;  2C6C A;  2I00 A;  1QST A;  3D2P A;  2AFO A;  2ARH A;  2ZEG A;  3W91 A;  4GXH A;  5KTC A;  4LX9 A;  4P4D A;  1IOF A;  1YME A;  1YLO A;  2B58 A;  2O28 A;  4TWE A;  2GFQ A;  4F6A A;  1I12 A;  1ZO0 A;  2ZEN A;  5LYD A;  4AXV A;  4F9U A;  3BLN A;  2Q4V A;  4MCP A;  2Q4Z A;  2PDO A;  1I21 A;  4KOX A;  1TF8 A;  5C88 A;  3W6X A;  4AVC A;  4ZI6 A;  3PB6 X;  3T90 A;  3SJX A;  2I3C A;  2GIV A;  3B3W A;  4P4F A;  2BSW A;  3I3G A;  4JZ0 A;  4EME A;  5J8C A;  5JGF A;  4ZGY B;  2K5T A;  2Q44 A;  2Z3K A;  3VAT A;  4PXB A;  5ISV A;  2C6P A;  5LYI A;  1P4N A;  3FEE A;  2OZU A;  1QSO A;  3CDX A;  4GS4 A;  4M6H A;  4OAD A;  5G20 A;  5KTD A;  1M4G A;  1PU9 A;  2WPW A;  1CPX A;  1BO4 A;  2AE6 A;  3MRU A;  4NFR A;  4X8I A;  4Z65 A;  3RYO A;  1KZF A;  4PPZ A;  5H84 A;  2FIW A;  4NGP A;  4PK3 A;  3HUV A;  1LAM A;  2R7H A;  5F46 A;  1VKC A;  3KL9 A;  4UEF A;  5HMN A;  4PXD A;  3EO4 A;  4BD9 A;  2IL4 A;  2VI7 A;  2YND A;  2BOA A;  3IU2 A;  2G3A A;  3B2Y A;  3CXQ A;  4NEX A;  3S6K A;  3V38 A;  2PJ2 A;  4R3L A;  5DWM A;  2FXF A;  1F57 A;  4O23 A;  3PBB A;  4YGO A;  3SJE A;  4BBH A;  2AFX A;  4U9Y A;  3S6H A;  3TOB A;  4KVM E;  5F49 A;  5EMI A;  4Y49 C;  1R43 A;  1Q7L A;  3KGQ A;  1PYT B;  1YR0 A;  1M4L A;  1XE4 A;  5EBV A;  1YLE A;  4CS0 B;  4QUS A;  3WC7 A;  1S7N A;  2CNT A;  2OR4 A;  4A2Z A;  1QSM A;  2ZPA A;  1FY7 A;  4DNC A;  2CIJ A;  3K9U A;  2Z0Z A;  2ZEO A;  1S7L A;  2VL1 A;  1UFH A;  1YW6 A;  3MGD A;  1CJW A;  4MFK A;  1Z4R A;  3DR6 A;  3G3S A;  3PBE A;  1ON0 A;  3PB7 X;  2RC4 A;  3P2H A;  4NGR A;  1R3N A;  3S6F A;  4B13 A;  4GM5 A;  4NCZ A;  1Q2C A;  2V8G A;  2Q0Y A;  2I79 A;  1XJO A;  3D3S A;  3GKR A; 
#chains in the Genus database with same CATH homology
 4QC6 A;  4YRH A;  2QIR A;  5BWA B;  3ZZI A;  4R57 A;  2FT0 A;  4A33 A;  5AG4 A;  3R95 A;  2PR1 A;  1PUA A;  4PK2 A;  2Q4Y A;  3GYA A;  4B5O A;  1YVO A;  4UCN A;  2Z3M A;  4E0A A;  2PSW A;  3FB3 A;  2FL4 A;  2REF A;  2ZW5 A;  2Q7B A;  3D8P A;  2GAN A;  4UFW A;  3R9E A;  2PR8 A;  4KS9 A;  1N71 A;  3F8K A;  4KOV A;  1RO5 A;  3A9L A;  3WR7 A;  1M4D A;  1MJB A;  3IU1 A;  2CXA A;  5E96 A;  2OH1 A;  2DXQ A;  4IUS A;  2R98 A;  2Z11 A;  4YFJ A;  5J8F A;  1IID A;  4CAF A;  4AG9 A;  4MFJ A;  4CAX A;  4CAE A;  2CNM A;  3G8W A;  5H86 A;  5ISV A;  4Q38 A;  1S3Z A;  2HQY A;  4CAV A;  3OWC A;  2Q04 A;  3ZJ0 A;  2JDC A;  2Z3O A;  4MJ8 A;  3FIX A;  3PGP A;  4C2Z A;  2B3U A;  5KTA A;  2FSR A;  3IGR A;  4UCM A;  5JPH A;  4MFQ A;  4MFL A;  4RI1 A;  4LUA A;  1TIQ A;  1Q2D A;  1QSR A;  3EY5 A;  1YRE A;  4OLL A;  2VZY A;  4R3K A;  3FRM A;  4KLV A;  4QBJ A;  2HUZ A;  4MBU A;  4KUB A;  4B14 A;  4FD4 A;  4JJX A;  4RS2 A;  4FD7 A;  1YGH A;  2GE3 A;  3FYN A;  3IWE A;  5AG5 A;  4KVO E;  2PC1 A;  2JEV A;  4XPD C;  2R8V A;  1CM0 A;  3TO7 A;  5IB0 A;  3W6S A;  2B3V A;  3I9S A;  1BOB A;  5AG6 A;  4CYQ A;  2JDD A;  4A95 A;  5CNP A;  4MY3 A;  3F0A A;  1Y7R A;  1MJA A;  4JLY A;  2ZXV A;  1XEB A;  1KUX A;  2YNC A;  1VHS A;  3CXS A;  3R96 A;  4L8A A;  2ZW7 A;  2VZZ A;  3FXT A;  1M44 A;  4MI4 A;  2VBQ A;  4FD5 A;  3V8I A;  3TE4 A;  2FIA A;  3DDD A;  1KUV A;  4KVX A;  2QML A;  3EC4 A;  3JTK A;  4FD6 A;  4B5P B;  3QAH A;  3P2F A;  4M85 A;  1S7F A;  4UCP A;  2C27 A;  4NSQ A;  3VWD A;  5JQ4 A;  4HNW B;  4JXQ A;  4B11 A;  1Z4E A;  4XNH B;  4II9 A;  4CGO A;  3NE7 A;  1NE9 A;  3IWG A;  3TO6 A;  4A30 A;  4PSX A;  2X7B A;  3JVN A;  2BUE A;  4CYP A;  2VXK A;  5AG7 A;  4CRY B;  2YNC C;  3R9F A;  1IB1 E;  1OZP A;  5A28 A;  1YX0 A;  4B12 A;  4JXR A;  3R9G A;  2J8R A;  5A27 A;  1R57 A;  3TT2 A;  1GHE A;  1YVK A;  1Y9K A;  4KSA A;  5GCN A;  4ZGY B;  1J4J A;  3C26 A;  3JUW A;  4AG7 A;  3TO9 A;  4QVT A;  2OB0 A;  3SXN A;  2FCK A;  4KOU A;  4B10 A;  4XPL A;  4UA3 A;  2B5G A;  4E8O A;  2BL1 A;  3SXO A;  4R87 A;  1B87 A;  4J3G A;  2WUU A;  3N7Z A;  4QB9 A;  4C7H A;  4IF5 A;  2WSA A;  1XMT A;  2EUI A;  1M1D A;  2Z10 A;  4A31 A;  4CGP A;  1XIX A;  1RXT A;  4UWJ A;  1P0H A;  4KSF A;  2D4O A;  1V0C A;  4CGN A;  2OU2 A;  4E2A A;  2B5G B;  3TOA A;  4L89 A;  2Y0M A;  2P6F A;  3B8G A;  4H6U A;  4EVY A;  3PZJ A;  1MJ9 A;  2ATR A;  3CXP A;  4KOW A;  5IX3 A;  1IIC A;  2EVN A;  2R1I A;  3BJ8 A;  3LD2 A;  3UY5 A;  2WPX A;  4F0X A;  2PRB A;  2VEZ A;  2DPT A;  2REE A;  1S7K A;  4U5Y A;  3S6G A;  2B4D A;  4CGM A;  4AVA A;  4ZBG A;  3EFA A;  4XPK A;  3GY9 A;  1I1D A;  4C7I A;  4NXY A;  1NMT A;  1U6M A;  2B4B A;  4Q36 A;  1L0C A;  3LOD A;  2NMT A;  4B5P A;  5I0C A;  3TTH A;  4R9M A;  4UFX A;  3VWE A;  4CYN A;  4U9Z A;  4UBR A;  2B4D B;  5G22 A;  4MFZ A;  4ORF A;  4Y49 B;  1Z9U A;  2JLM A;  2D4P A;  5C82 A;  3H5Z A;  5AGE A;  1S60 A;  2ZW4 A;  4F0Y A;  2BEI A;  3R1K A;  1LRZ A;  4MFP A;  2DPS A;  5F47 A;  5G1Z A;  2Z3N A;  3SHP A;  4A32 A;  3F5B A;  5IV0 A;  3BJ7 A;  2QEC A;  2CY2 A;  4K30 A;  2CNS A;  4C2X A;  2J8M A;  5DWN A;  2YGW A;  4PSW A;  4UFV A;  2F5I A;  3T9Y A;  2Z3L A;  2VQY A;  4CYO A;  2OZG A;  4AB7 A;  4M3S A;  2PQ8 A;  1M4I A;  2P6E A;  2OZH A;  3TCV A;  1IYL A;  5FVJ A;  1Y9W A;  1B6B A;  4KZT A;  4H6Z A;  2H5M A;  4KOR A;  3DR8 A;  2A4N A;  1NSL A;  4H89 A;  4C68 A;  2Z3P A;  2ZW6 A;  4AVB A;  5F48 A;  3PP9 A;  4UWI A;  4CGL A;  1SQH A;  2G0B A;  3KKW A;  4XNH C;  4MY0 A;  4BMH A;  2YNE A;  4MHD A;  1KUY A;  5HH1 A;  5G21 A;  4NF1 A;  4KOY A;  4CAW A;  4OAE A;  1XF8 A;  1WWZ A;  4HKF A;  1YK3 A;  3FNC A;  4JD6 A;  4JWP A;  4KOS A;  3DSB A;  3FBU A;  2FS5 A;  4C2Y A;  2P0W A;  1MK4 A;  4I49 A;  4ONU A;  3QB8 A;  3EXN A;  2HV2 A;  3D2M A;  1Q2Y A;  1S5K A;  4KOT A;  4X5K A;  4HNX B;  2P6G A;  3TFY A;  3DNS A;  1QSN A;  4KUA A;  2FE7 A;  3E0K A;  3H4Q A;  1K4J A;  4KLW A;  2KCW A;  4CRZ B;  1WK4 A;  4HNY B;  2AJ6 A;  2J8N A;  1IYK A;  4XPD B;  5EC4 A;  2G3T A;  4PV6 A;  3D2P A;  2I00 A;  1QST A;  3W91 A;  2ARH A;  5KTC A;  4LX9 A;  2B58 A;  2O28 A;  4F6A A;  1I12 A;  1ZO0 A;  3BLN A;  2Q4V A;  2PDO A;  1I21 A;  4KOX A;  5C88 A;  3W6X A;  4AVC A;  3T90 A;  2GIV A;  2BSW A;  3I3G A;  5J8C A;  2K5T A;  2Q44 A;  2Z3K A;  1P4N A;  2OZU A;  1QSO A;  4GS4 A;  4OAD A;  5G20 A;  5KTD A;  1M4G A;  1PU9 A;  2WPW A;  1BO4 A;  2AE6 A;  3RYO A;  1KZF A;  5H84 A;  2FIW A;  4PK3 A;  2R7H A;  5F46 A;  5HMN A;  1VKC A;  3EO4 A;  2IL4 A;  2VI7 A;  2YND A;  3IU2 A;  4NEX A;  2G3A A;  3CXQ A;  3S6K A;  4R3L A;  5DWM A;  2FXF A;  4YGO A;  4BBH A;  4U9Y A;  3TOB A;  3S6H A;  4KVM E;  5F49 A;  4Y49 C;  1YR0 A;  1XE4 A;  5EBV A;  1YLE A;  4CS0 B;  4QUS A;  1S7N A;  2CNT A;  4A2Z A;  1QSM A;  2ZPA A;  1FY7 A;  4DNC A;  3K9U A;  2Z0Z A;  1S7L A;  1UFH A;  4MFK A;  3MGD A;  1CJW A;  1Z4R A;  3DR6 A;  3G3S A;  1ON0 A;  2RC4 A;  3P2H A;  3S6F A;  4B13 A;  4NCZ A;  1Q2C A;  2Q0Y A;  2I79 A;  3D3S A;  3GKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...