1U6MA

The crystal structure of acetyltransferase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
189
structure length
189
Chain Sequence
SLIRSATKEDGQAIARLVLVILKDMELPILEEVSEEQMIDLLAEATAYPTYRYGYQRILVYEHAGEVAGIAVGYPAEDEKIIDEPLREVFKKHGLAEDVRLFIEEETLPNEWYLDTISVDERFRGMGIGSKLLDALPEVAKASGKQALGLNVDFDNPGARKLYASKGFKDVTTMTISGHLYNHMQKEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords acetyltransferase, GNAT family
publication title The crystal structure of acetyltransferase, GNAT family from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
total genus 50
structure length 189
sequence length 189
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1u6mA00
5CNPA 4Y49B 1OZPA 2EVNA 2QMLA 4II9A 4IF5A 3UY5A 3TO6A 2R98A 3CXSA 4KOWA 3S6FA 4KOXA 2EUIA 4M85A 3ZJ0A 1YVOA 4KVOE 2B5GA 2Z10A 2P6EA 4XPDB 2OH1A 4FD7A 3D2PA 1Y9WA 2G3AA 2ZXVA 3W91A 4PK3A 3SXOA 2OZUA 4X5KA 2P6FA 2REEA 2B4DB 2ATRA 4BMHA 1FY7A 4F6AA 5GCNA 2H5MA 2VQYA 2I00A 4FD6A 2CNTA 2VI7A 2ZW7A 3DNSA 3FBUA 1YX0A 4L8AA 2VEZA 4XPKA 4QUSA 5F49A 1NSLA 3P2FA 2D4PA 2BL1A 4AVBA 1YK3A 1MJAA 1Y7RA 1IB1E 1YREA 4KORA 4AVAA 3K9UA 3H4QA 5KTAA 2DXQA 5EBVA 2Q4YA 1IYLA 2B4BA 4UA3A 1QSRA 3RYOA 1P4NA 4KOSA 3BLNA 2Q7BA 3T9YA 1Q2DA 4E2AA 2ARHA 3MGDA 1B6BA 1V0CA 4PK2A 3TO7A 1M4GA 4QVTA 4NSQA 2GE3A 3FRMA 3DR8A 2AJ6A 4I49A 3FXTA 4MY3A 1M1DA 1S7KA 3FYNA 1NE9A 3I9SA 4KUAA 3F5BA 1IICA 2Q0YA 3LODA 4JWPA 2Q44A 2JEVA 1BO4A 3PGPA 2GIVA 2G0BA 3KKWA 4R3LA 4CAXA 4E0AA 4NCZA 4U9ZA 4GS4A 3GY9A 1KUVA 3EO4A 2Y0MA 3TO9A 5F46A 2PRBA 4HKFA 4CS0B 1RXTA 3CXQA 2FSRA 4MJ8A 1YVKA 5E96A 2PSWA 2CY2A 2GANA 2OU2A 5KTCA 1XE4A 3R1KA 4OADA 4AB7A 4Y49C 1CJWA 2WPWA 5F48A 4YFJA 4H89A 3V8IA 4KLWA 2RC4A 1MJBA 3QB8A 5H84A 3S6KA 1MJ9A 1S7NA 3BJ8A 3I3GA 1Z4RA 4MI4A 3G8WA 3TOAA 2OZGA 1SQHA 2X7BA 3S6HA 5H86A 3GKRA 4OLLA 3SHPA 2ZW6A 3TE4A 3PZJA 4FD5A 3T90A 3C26A 4UWJA 3JUWA 1QSTA 4JD6A 2HUZA 2FT0A 3FB3A 3TOBA 4AG9A 4KOYA 1I12A 4K30A 4YRHA 1Z4EA 1J4JA 1XIXA 4RS2A 2VZYA 3BJ7A 3DDDA 3TFYA 3GYAA 2J8RA 2A4NA 5JPHA 1BOBA 1M4IA 3QAHA 1QSMA 1YGHA 1Z9UA 2B58A 1WWZA 2J8NA 2OB0A 3DR6A 3D2MA 4ONUA 4JXRA 2PR8A 4B5PB 2BUEA 2Z0ZA 2R7HA 3D3SA 4KOUA 3R9EA 4L89A 1XEBA 4QC6A 2Q04A 5F47A 1RO5A 2VBQA 2J8MA 2JLMA 4NF1A 4KUBA 5C88A 4LX9A 5DWNA 3SXNA 2FXFA 1U6MA 1WK4A 4PSXA 3VWEA 2FCKA 3TT2A 4J3GA 3TTHA 1PU9A 2VZZA 4HNYB 1L0CA 4YGOA 1S3ZA 1CM0A 4UWIA 3R9GA 1I1DA 2ZPAA 4XNHB 4MY0A 4ORFA 1KZFA 3R96A 4HNWB 1XMTA 4KVXA 5HMNA 4KOTA 5I0CA 3P2HA 4H6UA 2Q4VA 3WR7A 1S60A 3FNCA 3EXNA 3VWDA 2HV2A 2JDCA 3G3SA 2P6GA 4JLYA 4R87A 1QSNA 1I21A 1S7FA 2C27A 4KZTA 4U5YA 4R57A 2QECA 4XPLA 3EC4A 2NMTA 4QBJA 1KUYA 4UBRA 4AVCA 3B8GA 2B3VA 1B87A 4M3SA 4KLVA 1YLEA 4JXQA 2VXKA 2O28A 3NE7A 4CAWA 4NXYA 2B4DA 2B5GB 4F0YA 4MHDA 5C82A 1NMTA 4CRZB 4XPDC 2FIAA 3R95A 2ZW5A 4U9YA 1P0HA 2FS5A 2PR1A 2JDDA 3DSBA 2QIRA 1IYKA 2PQ8A 3LD2A 2WPXA 3IWGA 4MBUA 2BSWA 2ZW4A 1ON0A 1Q2CA 2FIWA 3S6GA 4KOVA 4KVME 1Q2YA 4PSWA 2KCWA 5IX3A 2B3UA 2OZHA 4OAEA 2F5IA 4NEXA 1XF8A 1YR0A 1UFHA 5JQ4A 4RI1A 2REFA 3TCVA 5IV0A 4R9MA 1IIDA 1PUAA 2CNSA 2AE6A 4XNHC 4FD4A 2HQYA 1LRZA 3ZZIA 4E8OA 5IB0A 1S5KA 5J8FA 3JVNA 2R1IA 3OWCA 3F0AA 2G3TA 4B5PA 3IGRA 2Z11A 5FVJA 2P0WA 2CNMA 4H6ZA 1MK4A 3EY5A 5HH1A 4JJXA 5KTDA 4CAVA 1KUXA 2IL4A 4DNCA 1VHSA 5DWMA 3W6SA 5ISVA 4AG7A 1K4JA 4EVYA 3E0KA 1N71A 3W6XA 4B5OA 3EFAA 2FL4A 3FIXA 5J8CA 2K5TA 1R57A 3N7ZA 3CXPA 2PC1A 2R8VA 4PV6A 2BEIA 4CRYB 4LUAA 1QSOA 1TIQA 2FE7A 4HNXB 1Y9KA 4ZBGA 3F8KA 4IUSA 5EC4A 1GHEA 1VKCA 2I79A 1S7LA 4R3KA 3D8PA 3PP9A 2D4OA 3R9FA 1M44A 2PDOA 4QB9A 1M4DA
chains in the Genus database with same CATH superfamily
4CGMA 2EK9A 3BI0A 5CNPA 3TX8A 4Y49B 1OZPA 4A37A 2WZNA 2EVNA 2QMLA 4II9A 1HDQA 3IC1A 4NJQA 4A30A 3FECA 3NFZA 3KQXA 4IF5A 3UY5A 2BOAA 5F09A 3TO6A 3CPAA 3B7IA 2R98A 3CXSA 4KOWA 3NE8A 3S6FA 4P10A 4KOXA 2EUIA 2PVWA 3B2YA 2ZOGA 4M85A 3ZJ0A 1YVOA 4KVOE 4BD9A 1VHEA 2B5GA 2Z10A 4NGTA 2P6EA 4XPDB 2OH1A 3PFEA 4FD7A 2ZENA 1YMEA 3D2PA 4EWTA 2ZEHA 4B11A 4BBHA 1Y9WA 2C6PA 2G3AA 2ZXVA 1RTQA 3KR4A 5K8PA 4B12A 3W91A 2ZOFA 4PK3A 2PJ8A 1YW6A 3SXOA 4P4DA 3H8GA 2OZUA 4JZ0A 4X5KA 2P6FA 4NJRA 4QB9A 2PJAA 2REEA 4MHNA 1JWQA 2B4DB 1CP7A 2ATRA 4BMHA 4DUKA 1FY7A 4F6AA 2AFOA 5GCNA 4WWVA 4PQAA 2PIZA 2NYQA 4UEZA 3D66A 2H5MA 4MHYA 2FVGA 5J1QA 2VQYA 3SI1A 1HDUA 2F7VA 4CAFA 3IFEA 2I00A 3IWEA 4FD6A 2CNTA 3HLPA 3CT9A 2VI7A 2ZW7A 2CXAA 3DNSA 3FBUA 3IU1A 4Q7AA 1YX0A 4L8AA 1CX8A 1BAVA 2VEZA 1TKJA 4NGQA 4XPKA 4QUSA 5F49A 2GLJA 3S9MA 4C2XA 5CBMA 3QNVA 4UFXA 3NH4A 1NSLA 1CP6A 1CBXA 4RN7A 3P2FA 2D4PA 2BL1A 4AVBA 4LQGA 3SI2A 2Z3NA 1YK3A 1BPMA 4CGLA 3L2NA 5AG7A 1MJAA 1Y7RA 4ZY0A 1IB1E 1YREA 1M44A 3D7GA 4KORA 2O53A 4AVAA 2WUUA 3K9UA 3SJFA 5I4MA 4CPAA 3H4QA 5AG5A 4OIWA 1R43A 2V8GA 5KTAA 4EMEA 5HVFA 2DXQA 3LMSA 4OKOA 5EBVA 2Q4YA 1IYLA 1BLLE 2B4BA 4UA3A 3SJXA 2ABZA 4OC4A 1QSRA 3RYOA 5A28A 1P4NA 4KOSA 3BLNA 4OC0A 4YWYA 3H8EA 4X2TA 1YSJA 1Q2DA 3BI1A 2Q7BA 3T9YA 2ARHA 4E2AA 1F2OA 4CGPA 1IY7A 3MGDA 2Z3KA 3BHXA 1B6BA 1LAMA 3H8FA 1V0CA 4PK2A 3TO7A 1M4GA 4QVTA 4MFKA 4NSQA 1TXRA 3DLJA 2GE3A 3FJUA 1EE3P 4CYOA 2DEAA 3MRUA 3FRMA 3DR8A 2AJ6A 4I49A 4ZX9A 5K8NA 3FXTA 4KSAA 2ZEGA 4C2YA 4MY3A 2Q7SA 1M1DA 4G1PA 3B35A 3VARA 1S7KA 1BPNA 3FYNA 1NE9A 4OMEA 1UWYA 3RAMA 3I9SA 2Z3PA 3PB7X 5AG4A 2PCUA 4KUAA 4UIBA 3BXMA 3KASA 2QVPA 2C1CA 3F5BA 2V77A 1IICA 2Q0YA 1F2PA 1DE4C 3LODA 3GB0A 2CTBA 1IGBA 4JWPA 1ZG8A 3FEDA 2Q44A 2JEVA 3ISXA 4MFQA 5DS0A 1BO4A 1Y7EA 3PGPA 1Z8XA 2GIVA 2G0BA 2JBKA 4UCMA 3KKWA 4DYOA 3D7DA 4R3LA 4CAXA 2Z3LA 4E0AA 5A27A 4NCZA 4U9ZA 4FWUA 3SJGA 2ZEMA 3SI0A 4GS4A 4R6TA 4A32A 3GY9A 4NGPA 4CGOA 1KUVA 3EO4A 5JH9A 2Y0MA 3FEEA 4MFJA 3TO9A 5F46A 2PRBA 3FMCA 4PXDA 2PJ3A 5LRJA 3RO0A 2DPTA 3D67A 4HKFA 3GUXA 4CS0B 5ELYA 2AFXA 3WC6A 1RXTA 3CXQA 3IWWA 1VHOA 2CF4A 2Q51A 3GIUA 4P4JA 2FSRA 4FUUA 4MJ8A 2Q43A 5AGEA 5K8OA 1YVKA 5E96A 4B5PB 2PSWA 2CY2A 4A33A 1OBRA 4NGSA 2GANA 2OU2A 2IMOA 2PJ7A 4MFZA 5KTCA 1XE4A 1QMUA 2DF5A 3R1KA 4OADA 4Q36A 4AB7A 2EK8A 2F8HA 4MFLA 1CJWA 4Y49C 2WPWA 5F48A 4YFJA 4P4BA 3PB9X 4MCSA 1FT7A 4IHMA 4CGNA 4H89A 4YU9A 1AYEA 5G21A 3V8IA 4KLWA 2RC4A 1MJBA 1F57A 3QB8A 5H84A 3S6KA 1MJ9A 3IIBA 4O23A 1S7NA 4M6IA 2EO8A 3GLJA 3V7ZA 3BJ8A 4A95A 3PB8X 2PJ0A 3I3GA 1Z4RA 4B13A 4AXVA 1Q7LA 5AG6A 4MI4A 3G8WA 5G22A 3TOAA 2OZGA 1SQHA 2IJZA 2X7BA 4PXBA 4UCPA 5H86A 3S6HA 3WABA 1YW4A 3GKRA 2PJ2A 1H8LA 4K3NA 4OLLA 1ZLIA 1TKFA 3SHPA 4GM5A 3HUVA 4C7IA 4ZY1A 2ZW6A 4A2ZA 4WJBA 3TE4A 1HEEA 1LANA 3PZJA 4FD5A 2ZELA 4P4EA 3T90A 3C26A 4TWEA 5K8MA 1VGYA 2I3CA 4UWJA 3JUWA 1QSTA 1Z8WA 2PE3A 7CPAA 1TKHA 4IAVA 4JD6A 2HUZA 3PB4X 5G1ZA 5IB9A 4IK2A 2FT0A 3FB3A 3TOBA 3KR5A 4AG9A 5LYLA 4PPZA 5THWA 4KOYA 3LACA 1I12A 4K30A 4YRHA 1Z4EA 4HPSA 1J4JA 6CPAA 1XIXA 4A38A 3VATA 1ZLHA 2C6CA 4NGRA 4RS2A 4Q38A 2VZYA 1CPSA 5JGFA 3BJ7A 1LOKA 3SJEA 3KHZA 4ZY2A 3DDDA 3D4UA 4P4FA 3TFYA 3FX6A 3WC5A 3GYAA 1KWMA 2J8RA 1X10A 3D68A 2A4NA 2V8DA 5JPHA 1NSAA 1BOBA 4M6GA 1M4IA 1Z2LA 3QAHA 1M4LA 1QSMA 1YGHA 3B3TA 1Z9UA 2QJ8A 2B58A 1WWZA 1CG2A 2J8NA 2OB0A 3D2MA 2IQ6A 3DR6A 2PR8A 4JXRA 2BUEA 4ONUA 1LFWA 2Z0ZA 2Z3OA 3S9NA 2R7HA 4OC1A 3D3SA 4KOUA 3R9EA 4L89A 2PVVA 1XEBA 4QC6A 2Q04A 5F47A 1JQGA 1RO5A 2QYVA 2VBQA 4UCNA 2J8MA 2JLMA 3I1UA 4KUBA 4NF1A 5C88A 4LX9A 5HVHA 4KS9A 5DWNA 3SXNA 2PJBA 5BWAB 2FXFA 1U6MA 1WK4A 4PSXA 3VWEA 4F0XA 2G9DA 3KQZA 4A94A 1XRYA 2FCKA 3TT2A 4J3GA 3TTHA 4ZI6A 1PU9A 2VZZA 4MMOA 1CPXA 2VL1A 4HNYB 2AFSA 1XBUA 4ZGYB 1L0CA 3KZWA 1FNOA 3RNZA 4LQ6A 4C68A 4YGOA 1S3ZA 1CM0A 4UWIA 4OC2A 3FF3A 2YNDA 1I1DA 2ZPAA 3R9GA 4XNHB 2HB6A 3PBEA 4MY0A 1Y0RA 1KZFA 3NA6A 4ORFA 4HNWB 3R96A 3KI9A 1XMTA 3D7HA 4KVXA 2ZEOA 4C2ZA 4UIAA 1IOFA 4KOTA 5HMNA 4TNUA 3KL9A 5I0CA 3P2HA 1PYTB 3B3CA 4H6UA 1AMPA 4R7MA 2Q4VA 4MCQA 3WR7A 1S60A 3FNCA 4F9UA 4KSFA 5JM6A 3K2KA 5HXDA 3EXNA 3RBUA 3VWDA 2HV2A 2JDCA 2DPSA 2XEJA 3G3SA 4CYQA 2P6GA 2PJ4A 3IU2A 4JLYA 1ARLA 4R87A 1ZO0A 1QSNA 1I21A 1S7FA 2C27A 4MCPA 4KZTA 4BINA 3K9TA 4U5YA 4X8IA 5D8NA 4R57A 1XJOA 2QECA 4CAEA 3KGQA 2V8VA 4MHZA 4XPLA 3EC4A 3IO1A 2NMTA 5LRKA 3PBBA 1PCAA 4QBJA 2Q4ZA 3H5ZA 3PB6X 1KUYA 4UBRA 4AVCA 3B8GA 2ZEFA 2B3VA 4MHPA 3MN8A 1B87A 4M3SA 2PJCA 2RFHA 4KLVA 5G20A 1YLEA 3B3VA 4CYNA 1XFOA 4JXQA 1R3NA 2VXKA 2O28A 4FBEA 1A2ZA 3NE7A 2ANPA 4CAWA 4NXYA 2B4DA 2B5GB 2GREA 2ODFA 3DGVA 2ZEEA 5EMIA 3RZAA 4MHDA 4MCRA 4F0YA 5C82A 2AFMA 1NMTA 1LCPA 3QAYA 2PRQA 4CRZB 1LAPA 4XPDC 4F9VA 2AFWA 2FIAA 3R95A 2YGWA 2ZW5A 4P6YA 4NGMA 4U9YA 4EFDA 1P0HA 2FS5A 2PR1A 2CIJA 2JDDA 3DSBA 1XMBA 2GLFA 3B3WA 2QIRA 3S9LA 1IYKA 2PQ8A 3LD2A 3PFOA 1TF9A 5CPAA 2WPXA 3FH4A 3IWGA 4MBUA 4OIDA 2RB7A 3A9LA 2BSWA 2ZW4A 4RUHA 4UFVA 2POKA 1ON0A 1Q2CA 4KSIA 2XEIA 4UF4A 2ZEPA 3NH8A 4P45A 2PJ1A 2FIWA 3PRTA 3S6GA 4KOVA 8CPAA 4KVME 1Q2YA 4PSWA 1DTDA 2KCWA 5IX3A 4CYPA 2B3UA 2OZHA 3D7FA 2F5IA 4NEXA 4OAEA 1XF8A 1YR0A 2ZEDA 4A31A 4C7HA 1UFHA 2BO9A 1Z8LA 4DJLA 5JQ4A 4RI1A 2REFA 2YNCA 3TCVA 2PIYA 5IV0A 2BCOA 3WT4A 2WYRA 4R9MA 1IIDA 1PUAA 2XEGA 2NSMA 2CNSA 3PEIA 4ZX8A 5D29A 2AE6A 4XNHC 4FD4A 1ARMA 2HQYA 1LRZA 2XEFA 2WSAA 3ZZIA 4OC3A 1ZG9A 3N5FA 1Z8TA 2GU2A 4UEFA 4E8OA 1IU8A 4MFPA 4UFWA 5IB0A 1S5KA 3T8WA 5J8FA 3JVNA 3TC8A 2R1IA 4M6HA 3OWCA 3F0AA 2G3TA 4B5PA 1YLOA 3IGRA 1Y0YA 2Z11A 5FVJA 5LYDA 4F8ZA 2P0WA 2YNCC 2CNMA 2Z3MA 4OP4A 1AUGA 2HC9A 4OC5A 4R8FA 4H6ZA 4PXEA 1GYTA 4MRIA 1TF8A 1ELLP 3WC7A 3B3SA 2CTCA 1MK4A 3EY5A 3JRUA 2PJ6A 4JJXA 1YQEA 5HH1A 3CZXA 5KTDA 4CAVA 4ZYQA 1KUXA 4W9YA 2IL4A 2EWBA 1IOIA 4DNCA 2GFQA 4P44A 1VHSA 1X12A 4GXHA 5DWMA 3W6SA 4JYWA 3ISZA 1Z5RA 5ISVA 2V8HA 4AG7A 4MXUA 3NH5A 4R76A 4Z65A 2O4HA 5LRGA 1K4JA 4EVYA 3FVLA 2C6GA 3CPXA 3E0KA 3IEHA 1N71A 3W6XA 4B5OA 4FAIA 3EFAA 2FL4A 4NGNA 3FIXA 4B14A 5J8CA 2K5TA 1XOVA 1R57A 3N7ZA 4H2KA 2PJ5A 2JEWA 2YNEA 2PJ9A 2PC1A 3CXPA 5LYIA 2JBJA 2AFUA 2R8VA 3CDXA 3VH9A 4PV6A 2BEIA 3JTKA 4CRYB 5LYFA 4LUAA 1QSOA 1VIXA 4PXCA 1TIQA 2EBJA 2FE7A 3IJ3A 4HNXB 4NFRA 1Y9KA 4ZBGA 4B10A 3F8KA 4IUSA 4ONWA 5EC4A 1GHEA 1VKCA 4A39A 2I79A 2AFZA 1S7LA 4P4IA 5HVGA 2OOTA 4R3KA 3D8PA 3PP9A 4X3RA 1QQ9A 2D4OA 1ELMP 3LWUA 4UEEA 3R9FA 3V38A 4B6ZA 1ZG7A 3KHXA 2PDOA 2OR4A 2J9AA 1M4DA
chains in the Genus database with same CATH topology
4CGMA 5CNPA 4Y49B 1OZPA 2EVNA 2QMLA 4II9A 4A30A 4IF5A 3UY5A 3TO6A 2R98A 3CXSA 4KOWA 3S6FA 4KOXA 2EUIA 4M85A 3ZJ0A 1YVOA 4KVOE 2B5GA 2Z10A 2P6EA 4XPDB 2OH1A 4FD7A 3D2PA 4B11A 4BBHA 1Y9WA 2G3AA 2ZXVA 4B12A 3W91A 4PK3A 3SXOA 2OZUA 4X5KA 2P6FA 2REEA 2B4DB 2ATRA 4BMHA 1FY7A 4F6AA 5GCNA 2H5MA 2VQYA 4CAFA 3IWEA 4FD6A 2I00A 2CNTA 2VI7A 2ZW7A 2CXAA 3DNSA 3FBUA 3IU1A 1YX0A 4L8AA 2VEZA 4XPKA 4QUSA 5F49A 4C2XA 4UFXA 1NSLA 3P2FA 2D4PA 2BL1A 4AVBA 2Z3NA 1YK3A 4CGLA 5AG7A 1MJAA 1Y7RA 1IB1E 1YREA 4KORA 4AVAA 2WUUA 3K9UA 3H4QA 5AG5A 5KTAA 2DXQA 5EBVA 2Q4YA 1IYLA 2B4BA 4UA3A 1QSRA 3RYOA 5A28A 1P4NA 4KOSA 3BLNA 2Q7BA 3T9YA 1Q2DA 4E2AA 2ARHA 4CGPA 3MGDA 2Z3KA 1B6BA 1V0CA 4PK2A 3TO7A 1M4GA 4QVTA 4MFKA 4NSQA 2GE3A 4CYOA 3FRMA 3DR8A 2AJ6A 4I49A 3FXTA 4KSAA 4C2YA 4MY3A 1M1DA 1S7KA 3FYNA 1NE9A 3I9SA 2Z3PA 5AG4A 4KUAA 3F5BA 1IICA 2Q0YA 3LODA 4JWPA 4MFQA 2Q44A 2JEVA 1BO4A 3PGPA 2GIVA 2G0BA 4UCMA 3KKWA 4R3LA 4CAXA 4E0AA 2Z3LA 5A27A 4NCZA 4U9ZA 4GS4A 4A32A 3GY9A 4CGOA 1KUVA 3EO4A 2Y0MA 4MFJA 3TO9A 5F46A 2PRBA 2DPTA 4HKFA 4CS0B 1RXTA 3CXQA 2FSRA 4MJ8A 5AGEA 1YVKA 5E96A 2PSWA 2CY2A 4A33A 2GANA 2OU2A 4MFZA 5KTCA 1XE4A 3R1KA 4OADA 4Q36A 4AB7A 4MFLA 4Y49C 1CJWA 2WPWA 5F48A 4YFJA 4CGNA 4H89A 3V8IA 5G21A 4KLWA 2RC4A 1MJBA 3QB8A 5H84A 3S6KA 1MJ9A 1S7NA 3BJ8A 4A95A 3I3GA 1Z4RA 4B13A 5AG6A 4MI4A 3G8WA 5G22A 3TOAA 2OZGA 1SQHA 2X7BA 4UCPA 5H86A 3S6HA 3GKRA 4OLLA 3SHPA 4C7IA 2ZW6A 4A2ZA 3TE4A 3PZJA 4FD5A 3T90A 3C26A 4UWJA 3JUWA 1QSTA 4JD6A 2HUZA 5G1ZA 2FT0A 3FB3A 3TOBA 4AG9A 4KOYA 1I12A 4K30A 4YRHA 1Z4EA 1J4JA 1XIXA 4RS2A 4Q38A 2VZYA 3BJ7A 3DDDA 3TFYA 3GYAA 2J8RA 2A4NA 5JPHA 1BOBA 1M4IA 3QAHA 1QSMA 1YGHA 1Z9UA 2B58A 1WWZA 2J8NA 2OB0A 3DR6A 3D2MA 4ONUA 4JXRA 2PR8A 4B5PB 2BUEA 2Z0ZA 2Z3OA 2R7HA 3D3SA 4KOUA 3R9EA 4L89A 1XEBA 4QC6A 2Q04A 5F47A 1RO5A 2VBQA 4UCNA 2J8MA 2JLMA 4NF1A 4KUBA 5C88A 4LX9A 4KS9A 5DWNA 3SXNA 5BWAB 2FXFA 1U6MA 1WK4A 4PSXA 3VWEA 4F0XA 2FCKA 3TT2A 4J3GA 3TTHA 1PU9A 2VZZA 4HNYB 4ZGYB 1L0CA 4C68A 4YGOA 1S3ZA 1CM0A 4UWIA 2YNDA 1I1DA 2ZPAA 3R9GA 4XNHB 4MY0A 4ORFA 1KZFA 3R96A 4HNWB 1XMTA 4KVXA 4C2ZA 5HMNA 4KOTA 5I0CA 3P2HA 4H6UA 2Q4VA 3WR7A 1S60A 3FNCA 4KSFA 3EXNA 3VWDA 2HV2A 2JDCA 2DPSA 3G3SA 4CYQA 2P6GA 3IU2A 4JLYA 4R87A 1ZO0A 1QSNA 1I21A 1S7FA 2C27A 4KZTA 4U5YA 4R57A 2QECA 4CAEA 4XPLA 3EC4A 2NMTA 4QBJA 3H5ZA 1KUYA 4UBRA 4AVCA 3B8GA 2B3VA 1B87A 4M3SA 4KLVA 5G20A 1YLEA 4CYNA 4JXQA 2VXKA 2O28A 3NE7A 4CAWA 4NXYA 2B4DA 2B5GB 4F0YA 4MHDA 5C82A 1NMTA 4CRZB 4XPDC 2FIAA 3R95A 2YGWA 2ZW5A 4U9YA 1P0HA 2FS5A 2PR1A 2JDDA 3DSBA 2QIRA 1IYKA 2PQ8A 3LD2A 2WPXA 3IWGA 4MBUA 3A9LA 2BSWA 2ZW4A 4UFVA 1ON0A 1Q2CA 2FIWA 3S6GA 4KOVA 4KVME 1Q2YA 4PSWA 2KCWA 5IX3A 4CYPA 2B3UA 2OZHA 4OAEA 2F5IA 4NEXA 1XF8A 1YR0A 4A31A 4C7HA 1UFHA 5JQ4A 4RI1A 2REFA 2YNCA 3TCVA 5IV0A 4R9MA 1IIDA 1PUAA 2CNSA 2AE6A 4XNHC 4FD4A 2HQYA 1LRZA 2WSAA 3ZZIA 4E8OA 4MFPA 4UFWA 5IB0A 1S5KA 5J8FA 3JVNA 2R1IA 3OWCA 3F0AA 2G3TA 4B5PA 3IGRA 2Z11A 5FVJA 2P0WA 2YNCC 2CNMA 2Z3MA 4H6ZA 1MK4A 3EY5A 5HH1A 4JJXA 5KTDA 4CAVA 1KUXA 2IL4A 4DNCA 1VHSA 5DWMA 3W6SA 5ISVA 4AG7A 1K4JA 4EVYA 3E0KA 1N71A 3W6XA 4B5OA 3EFAA 2FL4A 3FIXA 4B14A 5J8CA 2K5TA 1R57A 3N7ZA 2YNEA 3CXPA 2PC1A 2R8VA 4PV6A 2BEIA 3JTKA 4CRYB 4LUAA 1QSOA 1TIQA 2FE7A 4HNXB 1Y9KA 4ZBGA 4B10A 3F8KA 4IUSA 5EC4A 1GHEA 1VKCA 2I79A 1S7LA 4R3KA 3D8PA 3PP9A 2D4OA 3R9FA 1M44A 2PDOA 4QB9A 1M4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CNP A;  4Y49 B;  1OZP A;  2EVN A;  2QML A;  4II9 A;  4IF5 A;  3UY5 A;  3TO6 A;  2R98 A;  3CXS A;  4KOW A;  3S6F A;  4KOX A;  2EUI A;  4M85 A;  3ZJ0 A;  1YVO A;  4KVO E;  2B5G A;  2Z10 A;  2P6E A;  4XPD B;  2OH1 A;  4FD7 A;  3D2P A;  1Y9W A;  2G3A A;  2ZXV A;  3W91 A;  4PK3 A;  3SXO A;  2OZU A;  4X5K A;  2P6F A;  2REE A;  2B4D B;  2ATR A;  4BMH A;  1FY7 A;  4F6A A;  5GCN A;  2H5M A;  2VQY A;  2I00 A;  4FD6 A;  2CNT A;  2VI7 A;  2ZW7 A;  3DNS A;  3FBU A;  1YX0 A;  4L8A A;  2VEZ A;  4XPK A;  4QUS A;  5F49 A;  1NSL A;  3P2F A;  2D4P A;  2BL1 A;  4AVB A;  1YK3 A;  1MJA A;  1Y7R A;  1IB1 E;  1YRE A;  4KOR A;  4AVA A;  3K9U A;  3H4Q A;  5KTA A;  2DXQ A;  5EBV A;  2Q4Y A;  1IYL A;  2B4B A;  4UA3 A;  1QSR A;  3RYO A;  1P4N A;  4KOS A;  3BLN A;  2Q7B A;  3T9Y A;  1Q2D A;  4E2A A;  2ARH A;  3MGD A;  1B6B A;  1V0C A;  4PK2 A;  3TO7 A;  1M4G A;  4QVT A;  4NSQ A;  2GE3 A;  3FRM A;  3DR8 A;  2AJ6 A;  4I49 A;  3FXT A;  4MY3 A;  1M1D A;  1S7K A;  3FYN A;  1NE9 A;  3I9S A;  4KUA A;  3F5B A;  1IIC A;  2Q0Y A;  3LOD A;  4JWP A;  2Q44 A;  2JEV A;  1BO4 A;  3PGP A;  2GIV A;  2G0B A;  3KKW A;  4R3L A;  4CAX A;  4E0A A;  4NCZ A;  4U9Z A;  4GS4 A;  3GY9 A;  1KUV A;  3EO4 A;  2Y0M A;  3TO9 A;  5F46 A;  2PRB A;  4HKF A;  4CS0 B;  1RXT A;  3CXQ A;  2FSR A;  4MJ8 A;  1YVK A;  5E96 A;  2PSW A;  2CY2 A;  2GAN A;  2OU2 A;  5KTC A;  1XE4 A;  3R1K A;  4OAD A;  4AB7 A;  4Y49 C;  1CJW A;  2WPW A;  5F48 A;  4YFJ A;  4H89 A;  3V8I A;  4KLW A;  2RC4 A;  1MJB A;  3QB8 A;  5H84 A;  3S6K A;  1MJ9 A;  1S7N A;  3BJ8 A;  3I3G A;  1Z4R A;  4MI4 A;  3G8W A;  3TOA A;  2OZG A;  1SQH A;  2X7B A;  3S6H A;  5H86 A;  3GKR A;  4OLL A;  3SHP A;  2ZW6 A;  3TE4 A;  3PZJ A;  4FD5 A;  3T90 A;  3C26 A;  4UWJ A;  3JUW A;  1QST A;  4JD6 A;  2HUZ A;  2FT0 A;  3FB3 A;  3TOB A;  4AG9 A;  4KOY A;  1I12 A;  4K30 A;  4YRH A;  1Z4E A;  1J4J A;  1XIX A;  4RS2 A;  2VZY A;  3BJ7 A;  3DDD A;  3TFY A;  3GYA A;  2J8R A;  2A4N A;  5JPH A;  1BOB A;  1M4I A;  3QAH A;  1QSM A;  1YGH A;  1Z9U A;  2B58 A;  1WWZ A;  2J8N A;  2OB0 A;  3DR6 A;  3D2M A;  4ONU A;  4JXR A;  2PR8 A;  4B5P B;  2BUE A;  2Z0Z A;  2R7H A;  3D3S A;  4KOU A;  3R9E A;  4L89 A;  1XEB A;  4QC6 A;  2Q04 A;  5F47 A;  1RO5 A;  2VBQ A;  2J8M A;  2JLM A;  4NF1 A;  4KUB A;  5C88 A;  4LX9 A;  5DWN A;  3SXN A;  2FXF A;  1U6M A;  1WK4 A;  4PSX A;  3VWE A;  2FCK A;  3TT2 A;  4J3G A;  3TTH A;  1PU9 A;  2VZZ A;  4HNY B;  1L0C A;  4YGO A;  1S3Z A;  1CM0 A;  4UWI A;  3R9G A;  1I1D A;  2ZPA A;  4XNH B;  4MY0 A;  4ORF A;  1KZF A;  3R96 A;  4HNW B;  1XMT A;  4KVX A;  5HMN A;  4KOT A;  5I0C A;  3P2H A;  4H6U A;  2Q4V A;  3WR7 A;  1S60 A;  3FNC A;  3EXN A;  3VWD A;  2HV2 A;  2JDC A;  3G3S A;  2P6G A;  4JLY A;  4R87 A;  1QSN A;  1I21 A;  1S7F A;  2C27 A;  4KZT A;  4U5Y A;  4R57 A;  2QEC A;  4XPL A;  3EC4 A;  2NMT A;  4QBJ A;  1KUY A;  4UBR A;  4AVC A;  3B8G A;  2B3V A;  1B87 A;  4M3S A;  4KLV A;  1YLE A;  4JXQ A;  2VXK A;  2O28 A;  3NE7 A;  4CAW A;  4NXY A;  2B4D A;  2B5G B;  4F0Y A;  4MHD A;  5C82 A;  1NMT A;  4CRZ B;  4XPD C;  2FIA A;  3R95 A;  2ZW5 A;  4U9Y A;  1P0H A;  2FS5 A;  2PR1 A;  2JDD A;  3DSB A;  2QIR A;  1IYK A;  2PQ8 A;  3LD2 A;  2WPX A;  3IWG A;  4MBU A;  2BSW A;  2ZW4 A;  1ON0 A;  1Q2C A;  2FIW A;  3S6G A;  4KOV A;  4KVM E;  1Q2Y A;  4PSW A;  2KCW A;  5IX3 A;  2B3U A;  2OZH A;  4OAE A;  2F5I A;  4NEX A;  1XF8 A;  1YR0 A;  1UFH A;  5JQ4 A;  4RI1 A;  2REF A;  3TCV A;  5IV0 A;  4R9M A;  1IID A;  1PUA A;  2CNS A;  2AE6 A;  4XNH C;  4FD4 A;  2HQY A;  1LRZ A;  3ZZI A;  4E8O A;  5IB0 A;  1S5K A;  5J8F A;  3JVN A;  2R1I A;  3OWC A;  3F0A A;  2G3T A;  4B5P A;  3IGR A;  2Z11 A;  5FVJ A;  2P0W A;  2CNM A;  4H6Z A;  1MK4 A;  3EY5 A;  5HH1 A;  4JJX A;  5KTD A;  4CAV A;  1KUX A;  2IL4 A;  4DNC A;  1VHS A;  5DWM A;  3W6S A;  5ISV A;  4AG7 A;  1K4J A;  4EVY A;  3E0K A;  1N71 A;  3W6X A;  4B5O A;  3EFA A;  2FL4 A;  3FIX A;  5J8C A;  2K5T A;  1R57 A;  3N7Z A;  3CXP A;  2PC1 A;  2R8V A;  4PV6 A;  2BEI A;  4CRY B;  4LUA A;  1QSO A;  1TIQ A;  2FE7 A;  4HNX B;  1Y9K A;  4ZBG A;  3F8K A;  4IUS A;  5EC4 A;  1GHE A;  1VKC A;  2I79 A;  1S7L A;  4R3K A;  3D8P A;  3PP9 A;  2D4O A;  3R9F A;  1M44 A;  2PDO A;  4QB9 A;  1M4D A; 
#chains in the Genus database with same CATH topology
 4CGM A;  2EK9 A;  3BI0 A;  5CNP A;  3TX8 A;  4Y49 B;  1OZP A;  4A37 A;  2WZN A;  2EVN A;  2QML A;  4II9 A;  1HDQ A;  3IC1 A;  4NJQ A;  4A30 A;  3FEC A;  3NFZ A;  3KQX A;  4IF5 A;  3UY5 A;  2BOA A;  5F09 A;  3TO6 A;  3CPA A;  3B7I A;  2R98 A;  3CXS A;  4KOW A;  3NE8 A;  3S6F A;  4P10 A;  4KOX A;  2EUI A;  2PVW A;  3B2Y A;  2ZOG A;  4M85 A;  3ZJ0 A;  1YVO A;  4KVO E;  4BD9 A;  1VHE A;  2B5G A;  2Z10 A;  4NGT A;  2P6E A;  4XPD B;  2OH1 A;  3PFE A;  4FD7 A;  2ZEN A;  1YME A;  3D2P A;  4EWT A;  2ZEH A;  4B11 A;  4BBH A;  1Y9W A;  2C6P A;  2G3A A;  2ZXV A;  1RTQ A;  3KR4 A;  5K8P A;  4B12 A;  3W91 A;  2ZOF A;  4PK3 A;  2PJ8 A;  1YW6 A;  3SXO A;  4P4D A;  3H8G A;  2OZU A;  4JZ0 A;  4X5K A;  2P6F A;  4NJR A;  4QB9 A;  2PJA A;  2REE A;  4MHN A;  1JWQ A;  2B4D B;  1CP7 A;  2ATR A;  4BMH A;  4DUK A;  1FY7 A;  4F6A A;  2AFO A;  5GCN A;  4WWV A;  4PQA A;  2PIZ A;  2NYQ A;  4UEZ A;  3D66 A;  2H5M A;  4MHY A;  2FVG A;  5J1Q A;  2VQY A;  3SI1 A;  1HDU A;  2F7V A;  4CAF A;  3IFE A;  2I00 A;  3IWE A;  4FD6 A;  2CNT A;  3HLP A;  3CT9 A;  2VI7 A;  2ZW7 A;  2CXA A;  3DNS A;  3FBU A;  3IU1 A;  4Q7A A;  1YX0 A;  4L8A A;  1CX8 A;  1BAV A;  2VEZ A;  1TKJ A;  4NGQ A;  4XPK A;  4QUS A;  5F49 A;  2GLJ A;  3S9M A;  4C2X A;  5CBM A;  3QNV A;  4UFX A;  3NH4 A;  1NSL A;  1CP6 A;  1CBX A;  4RN7 A;  3P2F A;  2D4P A;  2BL1 A;  4AVB A;  4LQG A;  3SI2 A;  2Z3N A;  1YK3 A;  1BPM A;  4CGL A;  3L2N A;  5AG7 A;  1MJA A;  1Y7R A;  4ZY0 A;  1IB1 E;  1YRE A;  1M44 A;  3D7G A;  4KOR A;  2O53 A;  4AVA A;  2WUU A;  3K9U A;  3SJF A;  5I4M A;  4CPA A;  3H4Q A;  5AG5 A;  4OIW A;  1R43 A;  2V8G A;  5KTA A;  4EME A;  5HVF A;  2DXQ A;  3LMS A;  4OKO A;  5EBV A;  2Q4Y A;  1IYL A;  1BLL E;  2B4B A;  4UA3 A;  3SJX A;  2ABZ A;  4OC4 A;  1QSR A;  3RYO A;  5A28 A;  1P4N A;  4KOS A;  3BLN A;  4OC0 A;  4YWY A;  3H8E A;  4X2T A;  1YSJ A;  1Q2D A;  3BI1 A;  2Q7B A;  3T9Y A;  2ARH A;  4E2A A;  1F2O A;  4CGP A;  1IY7 A;  3MGD A;  2Z3K A;  3BHX A;  1B6B A;  1LAM A;  3H8F A;  1V0C A;  4PK2 A;  3TO7 A;  1M4G A;  4QVT A;  4MFK A;  4NSQ A;  1TXR A;  3DLJ A;  2GE3 A;  3FJU A;  1EE3 P;  4CYO A;  2DEA A;  3MRU A;  3FRM A;  3DR8 A;  2AJ6 A;  4I49 A;  4ZX9 A;  5K8N A;  3FXT A;  4KSA A;  2ZEG A;  4C2Y A;  4MY3 A;  2Q7S A;  1M1D A;  4G1P A;  3B35 A;  3VAR A;  1S7K A;  1BPN A;  3FYN A;  1NE9 A;  4OME A;  1UWY A;  3RAM A;  3I9S A;  2Z3P A;  3PB7 X;  5AG4 A;  2PCU A;  4KUA A;  4UIB A;  3BXM A;  3KAS A;  2QVP A;  2C1C A;  3F5B A;  2V77 A;  1IIC A;  2Q0Y A;  1F2P A;  1DE4 C;  3LOD A;  3GB0 A;  2CTB A;  1IGB A;  4JWP A;  1ZG8 A;  3FED A;  2Q44 A;  2JEV A;  3ISX A;  4MFQ A;  5DS0 A;  1BO4 A;  1Y7E A;  3PGP A;  1Z8X A;  2GIV A;  2G0B A;  2JBK A;  4UCM A;  3KKW A;  4DYO A;  3D7D A;  4R3L A;  4CAX A;  2Z3L A;  4E0A A;  5A27 A;  4NCZ A;  4U9Z A;  4FWU A;  3SJG A;  2ZEM A;  3SI0 A;  4GS4 A;  4R6T A;  4A32 A;  3GY9 A;  4NGP A;  4CGO A;  1KUV A;  3EO4 A;  5JH9 A;  2Y0M A;  3FEE A;  4MFJ A;  3TO9 A;  5F46 A;  2PRB A;  3FMC A;  4PXD A;  2PJ3 A;  5LRJ A;  3RO0 A;  2DPT A;  3D67 A;  4HKF A;  3GUX A;  4CS0 B;  5ELY A;  2AFX A;  3WC6 A;  1RXT A;  3CXQ A;  3IWW A;  1VHO A;  2CF4 A;  2Q51 A;  3GIU A;  4P4J A;  2FSR A;  4FUU A;  4MJ8 A;  2Q43 A;  5AGE A;  5K8O A;  1YVK A;  5E96 A;  4B5P B;  2PSW A;  2CY2 A;  4A33 A;  1OBR A;  4NGS A;  2GAN A;  2OU2 A;  2IMO A;  2PJ7 A;  4MFZ A;  5KTC A;  1XE4 A;  1QMU A;  2DF5 A;  3R1K A;  4OAD A;  4Q36 A;  4AB7 A;  2EK8 A;  2F8H A;  4MFL A;  1CJW A;  4Y49 C;  2WPW A;  5F48 A;  4YFJ A;  4P4B A;  3PB9 X;  4MCS A;  1FT7 A;  4IHM A;  4CGN A;  4H89 A;  4YU9 A;  1AYE A;  5G21 A;  3V8I A;  4KLW A;  2RC4 A;  1MJB A;  1F57 A;  3QB8 A;  5H84 A;  3S6K A;  1MJ9 A;  3IIB A;  4O23 A;  1S7N A;  4M6I A;  2EO8 A;  3GLJ A;  3V7Z A;  3BJ8 A;  4A95 A;  3PB8 X;  2PJ0 A;  3I3G A;  1Z4R A;  4B13 A;  4AXV A;  1Q7L A;  5AG6 A;  4MI4 A;  3G8W A;  5G22 A;  3TOA A;  2OZG A;  1SQH A;  2IJZ A;  2X7B A;  4PXB A;  4UCP A;  5H86 A;  3S6H A;  3WAB A;  1YW4 A;  3GKR A;  2PJ2 A;  1H8L A;  4K3N A;  4OLL A;  1ZLI A;  1TKF A;  3SHP A;  4GM5 A;  3HUV A;  4C7I A;  4ZY1 A;  2ZW6 A;  4A2Z A;  4WJB A;  3TE4 A;  1HEE A;  1LAN A;  3PZJ A;  4FD5 A;  2ZEL A;  4P4E A;  3T90 A;  3C26 A;  4TWE A;  5K8M A;  1VGY A;  2I3C A;  4UWJ A;  3JUW A;  1QST A;  1Z8W A;  2PE3 A;  7CPA A;  1TKH A;  4IAV A;  4JD6 A;  2HUZ A;  3PB4 X;  5G1Z A;  5IB9 A;  4IK2 A;  2FT0 A;  3FB3 A;  3TOB A;  3KR5 A;  4AG9 A;  5LYL A;  4PPZ A;  5THW A;  4KOY A;  3LAC A;  1I12 A;  4K30 A;  4YRH A;  1Z4E A;  4HPS A;  1J4J A;  6CPA A;  1XIX A;  4A38 A;  3VAT A;  1ZLH A;  2C6C A;  4NGR A;  4RS2 A;  4Q38 A;  2VZY A;  1CPS A;  5JGF A;  3BJ7 A;  1LOK A;  3SJE A;  3KHZ A;  4ZY2 A;  3DDD A;  3D4U A;  4P4F A;  3TFY A;  3FX6 A;  3WC5 A;  3GYA A;  1KWM A;  2J8R A;  1X10 A;  3D68 A;  2A4N A;  2V8D A;  5JPH A;  1NSA A;  1BOB A;  4M6G A;  1M4I A;  1Z2L A;  3QAH A;  1M4L A;  1QSM A;  1YGH A;  3B3T A;  1Z9U A;  2QJ8 A;  2B58 A;  1WWZ A;  1CG2 A;  2J8N A;  2OB0 A;  3D2M A;  2IQ6 A;  3DR6 A;  2PR8 A;  4JXR A;  2BUE A;  4ONU A;  1LFW A;  2Z0Z A;  2Z3O A;  3S9N A;  2R7H A;  4OC1 A;  3D3S A;  4KOU A;  3R9E A;  4L89 A;  2PVV A;  1XEB A;  4QC6 A;  2Q04 A;  5F47 A;  1JQG A;  1RO5 A;  2QYV A;  2VBQ A;  4UCN A;  2J8M A;  2JLM A;  3I1U A;  4KUB A;  4NF1 A;  5C88 A;  4LX9 A;  5HVH A;  4KS9 A;  5DWN A;  3SXN A;  2PJB A;  5BWA B;  2FXF A;  1U6M A;  1WK4 A;  4PSX A;  3VWE A;  4F0X A;  2G9D A;  3KQZ A;  4A94 A;  1XRY A;  2FCK A;  3TT2 A;  4J3G A;  3TTH A;  4ZI6 A;  1PU9 A;  2VZZ A;  4MMO A;  1CPX A;  2VL1 A;  4HNY B;  2AFS A;  1XBU A;  4ZGY B;  1L0C A;  3KZW A;  1FNO A;  3RNZ A;  4LQ6 A;  4C68 A;  4YGO A;  1S3Z A;  1CM0 A;  4UWI A;  4OC2 A;  3FF3 A;  2YND A;  1I1D A;  2ZPA A;  3R9G A;  4XNH B;  2HB6 A;  3PBE A;  4MY0 A;  1Y0R A;  1KZF A;  3NA6 A;  4ORF A;  4HNW B;  3R96 A;  3KI9 A;  1XMT A;  3D7H A;  4KVX A;  2ZEO A;  4C2Z A;  4UIA A;  1IOF A;  4KOT A;  5HMN A;  4TNU A;  3KL9 A;  5I0C A;  3P2H A;  1PYT B;  3B3C A;  4H6U A;  1AMP A;  4R7M A;  2Q4V A;  4MCQ A;  3WR7 A;  1S60 A;  3FNC A;  4F9U A;  4KSF A;  5JM6 A;  3K2K A;  5HXD A;  3EXN A;  3RBU A;  3VWD A;  2HV2 A;  2JDC A;  2DPS A;  2XEJ A;  3G3S A;  4CYQ A;  2P6G A;  2PJ4 A;  3IU2 A;  4JLY A;  1ARL A;  4R87 A;  1ZO0 A;  1QSN A;  1I21 A;  1S7F A;  2C27 A;  4MCP A;  4KZT A;  4BIN A;  3K9T A;  4U5Y A;  4X8I A;  5D8N A;  4R57 A;  1XJO A;  2QEC A;  4CAE A;  3KGQ A;  2V8V A;  4MHZ A;  4XPL A;  3EC4 A;  3IO1 A;  2NMT A;  5LRK A;  3PBB A;  1PCA A;  4QBJ A;  2Q4Z A;  3H5Z A;  3PB6 X;  1KUY A;  4UBR A;  4AVC A;  3B8G A;  2ZEF A;  2B3V A;  4MHP A;  3MN8 A;  1B87 A;  4M3S A;  2PJC A;  2RFH A;  4KLV A;  5G20 A;  1YLE A;  3B3V A;  4CYN A;  1XFO A;  4JXQ A;  1R3N A;  2VXK A;  2O28 A;  4FBE A;  1A2Z A;  3NE7 A;  2ANP A;  4CAW A;  4NXY A;  2B4D A;  2B5G B;  2GRE A;  2ODF A;  3DGV A;  2ZEE A;  5EMI A;  3RZA A;  4MHD A;  4MCR A;  4F0Y A;  5C82 A;  2AFM A;  1NMT A;  1LCP A;  3QAY A;  2PRQ A;  4CRZ B;  1LAP A;  4XPD C;  4F9V A;  2AFW A;  2FIA A;  3R95 A;  2YGW A;  2ZW5 A;  4P6Y A;  4NGM A;  4U9Y A;  4EFD A;  1P0H A;  2FS5 A;  2PR1 A;  2CIJ A;  2JDD A;  3DSB A;  1XMB A;  2GLF A;  3B3W A;  2QIR A;  3S9L A;  1IYK A;  2PQ8 A;  3LD2 A;  3PFO A;  1TF9 A;  5CPA A;  2WPX A;  3FH4 A;  3IWG A;  4MBU A;  4OID A;  2RB7 A;  3A9L A;  2BSW A;  2ZW4 A;  4RUH A;  4UFV A;  2POK A;  1ON0 A;  1Q2C A;  4KSI A;  2XEI A;  4UF4 A;  2ZEP A;  3NH8 A;  4P45 A;  2PJ1 A;  2FIW A;  3PRT A;  3S6G A;  4KOV A;  8CPA A;  4KVM E;  1Q2Y A;  4PSW A;  1DTD A;  2KCW A;  5IX3 A;  4CYP A;  2B3U A;  2OZH A;  3D7F A;  2F5I A;  4NEX A;  4OAE A;  1XF8 A;  1YR0 A;  2ZED A;  4A31 A;  4C7H A;  1UFH A;  2BO9 A;  1Z8L A;  4DJL A;  5JQ4 A;  4RI1 A;  2REF A;  2YNC A;  3TCV A;  2PIY A;  5IV0 A;  2BCO A;  3WT4 A;  2WYR A;  4R9M A;  1IID A;  1PUA A;  2XEG A;  2NSM A;  2CNS A;  3PEI A;  4ZX8 A;  5D29 A;  2AE6 A;  4XNH C;  4FD4 A;  1ARM A;  2HQY A;  1LRZ A;  2XEF A;  2WSA A;  3ZZI A;  4OC3 A;  1ZG9 A;  3N5F A;  1Z8T A;  2GU2 A;  4UEF A;  4E8O A;  1IU8 A;  4MFP A;  4UFW A;  5IB0 A;  1S5K A;  3T8W A;  5J8F A;  3JVN A;  3TC8 A;  2R1I A;  4M6H A;  3OWC A;  3F0A A;  2G3T A;  4B5P A;  1YLO A;  3IGR A;  1Y0Y A;  2Z11 A;  5FVJ A;  5LYD A;  4F8Z A;  2P0W A;  2YNC C;  2CNM A;  2Z3M A;  4OP4 A;  1AUG A;  2HC9 A;  4OC5 A;  4R8F A;  4H6Z A;  4PXE A;  1GYT A;  4MRI A;  1TF8 A;  1ELL P;  3WC7 A;  3B3S A;  2CTC A;  1MK4 A;  3EY5 A;  3JRU A;  2PJ6 A;  4JJX A;  1YQE A;  5HH1 A;  3CZX A;  5KTD A;  4CAV A;  4ZYQ A;  1KUX A;  4W9Y A;  2IL4 A;  2EWB A;  1IOI A;  4DNC A;  2GFQ A;  4P44 A;  1VHS A;  1X12 A;  4GXH A;  5DWM A;  3W6S A;  4JYW A;  3ISZ A;  1Z5R A;  5ISV A;  2V8H A;  4AG7 A;  4MXU A;  3NH5 A;  4R76 A;  4Z65 A;  2O4H A;  5LRG A;  1K4J A;  4EVY A;  3FVL A;  2C6G A;  3CPX A;  3E0K A;  3IEH A;  1N71 A;  3W6X A;  4B5O A;  4FAI A;  3EFA A;  2FL4 A;  4NGN A;  3FIX A;  4B14 A;  5J8C A;  2K5T A;  1XOV A;  1R57 A;  3N7Z A;  4H2K A;  2PJ5 A;  2JEW A;  2YNE A;  2PJ9 A;  2PC1 A;  3CXP A;  5LYI A;  2JBJ A;  2AFU A;  2R8V A;  3CDX A;  3VH9 A;  4PV6 A;  2BEI A;  3JTK A;  4CRY B;  5LYF A;  4LUA A;  1QSO A;  1VIX A;  4PXC A;  1TIQ A;  2EBJ A;  2FE7 A;  3IJ3 A;  4HNX B;  4NFR A;  1Y9K A;  4ZBG A;  4B10 A;  3F8K A;  4IUS A;  4ONW A;  5EC4 A;  1GHE A;  1VKC A;  4A39 A;  2I79 A;  2AFZ A;  1S7L A;  4P4I A;  5HVG A;  2OOT A;  4R3K A;  3D8P A;  3PP9 A;  4X3R A;  1QQ9 A;  2D4O A;  1ELM P;  3LWU A;  4UEE A;  3R9F A;  3V38 A;  4B6Z A;  1ZG7 A;  3KHX A;  2PDO A;  2OR4 A;  2J9A A;  1M4D A; 
#chains in the Genus database with same CATH homology
 4CGM A;  5CNP A;  4Y49 B;  1OZP A;  2EVN A;  2QML A;  4II9 A;  4A30 A;  4IF5 A;  3UY5 A;  3TO6 A;  2R98 A;  3CXS A;  4KOW A;  3S6F A;  4KOX A;  2EUI A;  4M85 A;  3ZJ0 A;  1YVO A;  4KVO E;  2B5G A;  2Z10 A;  2P6E A;  4XPD B;  2OH1 A;  4FD7 A;  3D2P A;  4B11 A;  4BBH A;  1Y9W A;  2G3A A;  2ZXV A;  4B12 A;  3W91 A;  4PK3 A;  3SXO A;  2OZU A;  4X5K A;  2P6F A;  2REE A;  2B4D B;  2ATR A;  4BMH A;  1FY7 A;  4F6A A;  5GCN A;  2H5M A;  2VQY A;  4CAF A;  3IWE A;  4FD6 A;  2I00 A;  2CNT A;  2VI7 A;  2ZW7 A;  2CXA A;  3DNS A;  3FBU A;  3IU1 A;  1YX0 A;  4L8A A;  2VEZ A;  4XPK A;  4QUS A;  5F49 A;  4C2X A;  4UFX A;  1NSL A;  3P2F A;  2D4P A;  2BL1 A;  4AVB A;  2Z3N A;  1YK3 A;  4CGL A;  5AG7 A;  1MJA A;  1Y7R A;  1IB1 E;  1YRE A;  4KOR A;  4AVA A;  2WUU A;  3K9U A;  3H4Q A;  5AG5 A;  5KTA A;  2DXQ A;  5EBV A;  2Q4Y A;  1IYL A;  2B4B A;  4UA3 A;  1QSR A;  3RYO A;  5A28 A;  1P4N A;  4KOS A;  3BLN A;  2Q7B A;  3T9Y A;  1Q2D A;  4E2A A;  2ARH A;  4CGP A;  3MGD A;  2Z3K A;  1B6B A;  1V0C A;  4PK2 A;  3TO7 A;  1M4G A;  4QVT A;  4MFK A;  4NSQ A;  2GE3 A;  4CYO A;  3FRM A;  3DR8 A;  2AJ6 A;  4I49 A;  3FXT A;  4KSA A;  4C2Y A;  4MY3 A;  1M1D A;  1S7K A;  3FYN A;  1NE9 A;  3I9S A;  2Z3P A;  5AG4 A;  4KUA A;  3F5B A;  1IIC A;  2Q0Y A;  3LOD A;  4JWP A;  4MFQ A;  2Q44 A;  2JEV A;  1BO4 A;  3PGP A;  2GIV A;  2G0B A;  4UCM A;  3KKW A;  4R3L A;  4CAX A;  4E0A A;  2Z3L A;  5A27 A;  4NCZ A;  4U9Z A;  4GS4 A;  4A32 A;  3GY9 A;  4CGO A;  1KUV A;  3EO4 A;  2Y0M A;  4MFJ A;  3TO9 A;  5F46 A;  2PRB A;  2DPT A;  4HKF A;  4CS0 B;  1RXT A;  3CXQ A;  2FSR A;  4MJ8 A;  5AGE A;  1YVK A;  5E96 A;  2PSW A;  2CY2 A;  4A33 A;  2GAN A;  2OU2 A;  4MFZ A;  5KTC A;  1XE4 A;  3R1K A;  4OAD A;  4Q36 A;  4AB7 A;  4MFL A;  4Y49 C;  1CJW A;  2WPW A;  5F48 A;  4YFJ A;  4CGN A;  4H89 A;  3V8I A;  5G21 A;  4KLW A;  2RC4 A;  1MJB A;  3QB8 A;  5H84 A;  3S6K A;  1MJ9 A;  1S7N A;  3BJ8 A;  4A95 A;  3I3G A;  1Z4R A;  4B13 A;  5AG6 A;  4MI4 A;  3G8W A;  5G22 A;  3TOA A;  2OZG A;  1SQH A;  2X7B A;  4UCP A;  5H86 A;  3S6H A;  3GKR A;  4OLL A;  3SHP A;  4C7I A;  2ZW6 A;  4A2Z A;  3TE4 A;  3PZJ A;  4FD5 A;  3T90 A;  3C26 A;  4UWJ A;  3JUW A;  1QST A;  4JD6 A;  2HUZ A;  5G1Z A;  2FT0 A;  3FB3 A;  3TOB A;  4AG9 A;  4KOY A;  1I12 A;  4K30 A;  4YRH A;  1Z4E A;  1J4J A;  1XIX A;  4RS2 A;  4Q38 A;  2VZY A;  3BJ7 A;  3DDD A;  3TFY A;  3GYA A;  2J8R A;  2A4N A;  5JPH A;  1BOB A;  1M4I A;  3QAH A;  1QSM A;  1YGH A;  1Z9U A;  2B58 A;  1WWZ A;  2J8N A;  2OB0 A;  3DR6 A;  3D2M A;  4ONU A;  4JXR A;  2PR8 A;  4B5P B;  2BUE A;  2Z0Z A;  2Z3O A;  2R7H A;  3D3S A;  4KOU A;  3R9E A;  4L89 A;  1XEB A;  4QC6 A;  2Q04 A;  5F47 A;  1RO5 A;  2VBQ A;  4UCN A;  2J8M A;  2JLM A;  4NF1 A;  4KUB A;  5C88 A;  4LX9 A;  4KS9 A;  5DWN A;  3SXN A;  5BWA B;  2FXF A;  1U6M A;  1WK4 A;  4PSX A;  3VWE A;  4F0X A;  2FCK A;  3TT2 A;  4J3G A;  3TTH A;  1PU9 A;  2VZZ A;  4HNY B;  4ZGY B;  1L0C A;  4C68 A;  4YGO A;  1S3Z A;  1CM0 A;  4UWI A;  2YND A;  1I1D A;  2ZPA A;  3R9G A;  4XNH B;  4MY0 A;  4ORF A;  1KZF A;  3R96 A;  4HNW B;  1XMT A;  4KVX A;  4C2Z A;  5HMN A;  4KOT A;  5I0C A;  3P2H A;  4H6U A;  2Q4V A;  3WR7 A;  1S60 A;  3FNC A;  4KSF A;  3EXN A;  3VWD A;  2HV2 A;  2JDC A;  2DPS A;  3G3S A;  4CYQ A;  2P6G A;  3IU2 A;  4JLY A;  4R87 A;  1ZO0 A;  1QSN A;  1I21 A;  1S7F A;  2C27 A;  4KZT A;  4U5Y A;  4R57 A;  2QEC A;  4CAE A;  4XPL A;  3EC4 A;  2NMT A;  4QBJ A;  3H5Z A;  1KUY A;  4UBR A;  4AVC A;  3B8G A;  2B3V A;  1B87 A;  4M3S A;  4KLV A;  5G20 A;  1YLE A;  4CYN A;  4JXQ A;  2VXK A;  2O28 A;  3NE7 A;  4CAW A;  4NXY A;  2B4D A;  2B5G B;  4F0Y A;  4MHD A;  5C82 A;  1NMT A;  4CRZ B;  4XPD C;  2FIA A;  3R95 A;  2YGW A;  2ZW5 A;  4U9Y A;  1P0H A;  2FS5 A;  2PR1 A;  2JDD A;  3DSB A;  2QIR A;  1IYK A;  2PQ8 A;  3LD2 A;  2WPX A;  3IWG A;  4MBU A;  3A9L A;  2BSW A;  2ZW4 A;  4UFV A;  1ON0 A;  1Q2C A;  2FIW A;  3S6G A;  4KOV A;  4KVM E;  1Q2Y A;  4PSW A;  2KCW A;  5IX3 A;  4CYP A;  2B3U A;  2OZH A;  4OAE A;  2F5I A;  4NEX A;  1XF8 A;  1YR0 A;  4A31 A;  4C7H A;  1UFH A;  5JQ4 A;  4RI1 A;  2REF A;  2YNC A;  3TCV A;  5IV0 A;  4R9M A;  1IID A;  1PUA A;  2CNS A;  2AE6 A;  4XNH C;  4FD4 A;  2HQY A;  1LRZ A;  2WSA A;  3ZZI A;  4E8O A;  4MFP A;  4UFW A;  5IB0 A;  1S5K A;  5J8F A;  3JVN A;  2R1I A;  3OWC A;  3F0A A;  2G3T A;  4B5P A;  3IGR A;  2Z11 A;  5FVJ A;  2P0W A;  2YNC C;  2CNM A;  2Z3M A;  4H6Z A;  1MK4 A;  3EY5 A;  5HH1 A;  4JJX A;  5KTD A;  4CAV A;  1KUX A;  2IL4 A;  4DNC A;  1VHS A;  5DWM A;  3W6S A;  5ISV A;  4AG7 A;  1K4J A;  4EVY A;  3E0K A;  1N71 A;  3W6X A;  4B5O A;  3EFA A;  2FL4 A;  3FIX A;  4B14 A;  5J8C A;  2K5T A;  1R57 A;  3N7Z A;  2YNE A;  3CXP A;  2PC1 A;  2R8V A;  4PV6 A;  2BEI A;  3JTK A;  4CRY B;  4LUA A;  1QSO A;  1TIQ A;  2FE7 A;  4HNX B;  1Y9K A;  4ZBG A;  4B10 A;  3F8K A;  4IUS A;  5EC4 A;  1GHE A;  1VKC A;  2I79 A;  1S7L A;  4R3K A;  3D8P A;  3PP9 A;  2D4O A;  3R9F A;  1M44 A;  2PDO A;  4QB9 A;  1M4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...