1V0CA

Structure of aac(6')-ib in complex with kanamycin c and acetylcoa.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
179
structure length
176
Chain Sequence
DSVTLRLMTEHDLAMLYEWLNRSHIVEWWGARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEEETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFERTRSDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AAC(6')-IB
publication title Mechanistic and Structural Analysis of Aminoglycoside N-Acetyltransferase Aac(6')-Ib and its Bifunctional, Fluoroquinolone-Active Aac(6')-Ib-Cr Variant.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 49
structure length 176
sequence length 179
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2008-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13523 Acetyltransf_8 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1v0cA00
1S7LA 4U5YA 3TO6A 4JXQA 4YFJA 2BSWA 4PSXA 4YGOA 2Q0YA 4KZTA 4E2AA 2C27A 2J8NA 2JEVA 3OWCA 1XF8A 1XIXA 2Z11A 3FXTA 3N7ZA 2PRBA 3TT2A 5E96A 1V0CA 4L89A 2ZW7A 3SHPA 4LUAA 2A4NA 4MY0A 4OAEA 2I79A 3TCVA 4CAXA 4R87A 5HMNA 3NE7A 2OH1A 1KUVA 2RC4A 1Y7RA 4B5PA 1XE4A 1NMTA 3D2PA 2ZPAA 1MJ9A 4R9MA 5F48A 2DXQA 4XPKA 2B5GA 3RYOA 1TIQA 4I49A 5KTAA 2HUZA 3FRMA 2OZHA 3FNCA 1Q2CA 3EY5A 4JJXA 4LX9A 1M4DA 3BJ7A 3FIXA 3QAHA 4JLYA 4L8AA 2QIRA 2WPXA 2EUIA 3KKWA 2GANA 4H6ZA 2REFA 3GY9A 1M1DA 3SXNA 4XPDC 1ON0A 2GE3A 2CNTA 2IL4A 2OB0A 1YLEA 4UWIA 4NEXA 4HNWB 3W6XA 2OZGA 4K30A 2ZXVA 2AJ6A 4PK2A 5EBVA 2P6FA 4Y49B 4AG9A 1VKCA 2QMLA 5JPHA 3QB8A 3TO9A 2Z0ZA 3CXSA 3R96A 2OU2A 1BOBA 4NF1A 5KTCA 2CNMA 3D8PA 3TFYA 2B4DB 2ZW5A 2REEA 4OLLA 4MHDA 5C88A 1BO4A 4KOSA 4KOYA 3TE4A 4AVCA 3R1KA 4UBRA 4U9YA 3PGPA 3PZJA 2ARHA 2FL4A 1UFHA 3S6HA 4M3SA 2P0WA 2FIAA 4AB7A 5ISVA 2O28A 3UY5A 2BL1A 2QECA 3EC4A 4MJ8A 1I21A 4B5OA 4KOWA 3WR7A 1QSNA 2B4BA 3B8GA 4CAVA 3MGDA 1QSMA 2R1IA 1WK4A 3W91A 1VHSA 1KUXA 2CY2A 1LRZA 2B3UA 1B6BA 4ZBGA 4MY3A 5H86A 2X7BA 3H4QA 4E0AA 2VEZA 1R57A 4CRYB 1XEBA 4X5KA 3EXNA 4R3LA 2R8VA 4UWJA 4PSWA 4KOXA 4E8OA 3SXOA 4ONUA 1I1DA 1IB1E 2FS5A 2HQYA 2D4OA 1CM0A 3T9YA 3R9EA 1PU9A 4EVYA 5GCNA 2VZZA 2HV2A 4KOTA 1IIDA 2B3VA 1KZFA 4HKFA 1SQHA 5C82A 1S60A 4NCZA 4XNHC 2JDCA 5JQ4A 3D3SA 3G3SA 2R98A 2PSWA 2F5IA 1CJWA 2B4DA 3FYNA 1GHEA 2J8RA 3IWGA 3LODA 2FXFA 2B58A 4PV6A 3JUWA 2P6EA 3ZZIA 3S6GA 3S6FA 3ZJ0A 2OZUA 4R57A 4R3KA 1MJBA 1S3ZA 1Y9WA 2ATRA 4JWPA 1Z9UA 1RXTA 4AG7A 1MK4A 1YVKA 4KOUA 2PR8A 1I12A 1S5KA 3CXPA 2H5MA 4II9A 4GS4A 3VWDA 1L0CA 4FD6A 1RO5A 4XPDB 2AE6A 2VI7A 4CAWA 3PP9A 1M44A 3F5BA 3P2FA 3DR8A 2ZW4A 2Q4YA 4KUBA 3R95A 2J8MA 4JXRA 3T90A 3GKRA 4F6AA 4U9ZA 3V8IA 2PDOA 4RS2A 1KUYA 2PQ8A 4QC6A 3GYAA 4CRZB 4IUSA 3K9UA 2GIVA 2JLMA 5DWMA 2EVNA 2FSRA 4CS0B 4FD4A 4AVBA 1IYLA 1WWZA 3JVNA 4MI4A 4UA3A 2ZW6A 2I00A 2FCKA 3W6SA 4QUSA 3DR6A 2D4PA 4YRHA 3DSBA 5IV0A 2G3AA 1MJAA 3DDDA 3EO4A 4FD7A 1YK3A 2G0BA 4OADA 5F49A 4H6UA 2BUEA 4QBJA 3FB3A 4KLVA 5I0CA 2VXKA 5F46A 1QSTA 2VZYA 1U6MA 4F0YA 1S7NA 4JD6A 3I9SA 4Y49C 2Q4VA 4QVTA 1NE9A 4KLWA 1B87A 1Q2YA 4IF5A 3P2HA 4KVOE 4NSQA 3R9FA 5J8FA 1J4JA 3TTHA 1YVOA 3R9GA 4KUAA 4DNCA 2Q44A 1FY7A 1Y9KA 4AVAA 3F8KA 4MBUA 3LD2A 2BEIA 3BJ8A 2K5TA 3E0KA 2Q04A 2PC1A 1K4JA 1QSRA 5EC4A 1M4GA 2G3TA 3DNSA 5J8CA 5IX3A 1QSOA 3BLNA 1S7KA 1Z4RA 4B5PB 3CXQA 1YREA 3C26A 4J3GA 2B5GB 5IB0A 1M4IA 2P6GA 1YGHA 2Y0MA 3S6KA 1S7FA 2Z10A 2FT0A 5HH1A 4M85A 4KOVA 4NXYA 1OZPA 3EFAA 2VBQA 2PR1A 4H89A 4HNYB 4BMHA 2VQYA 2WPWA 3D2MA 2FE7A 1XMTA 4RI1A 1IICA 1PUAA 1P0HA 3TOBA 3F0AA 3TO7A 1YR0A 4XNHB 4HNXB 4QB9A 5CNPA 5KTDA 5F47A 2JDDA 2CNSA 2Q7BA 4PK3A 4XPLA 1Q2DA 3IGRA 5H84A 4KVXA 2R7HA 4FD5A 2KCWA 3I3GA 4ORFA 4KORA 1Z4EA 3TOAA 1P4NA 4KVME 2NMTA 1IYKA 5DWNA 5FVJA 1N71A 1YX0A 3VWEA 2FIWA 3FBUA 3G8WA 1NSLA
chains in the Genus database with same CATH superfamily
2AFUA 5G1ZA 1S7LA 4U5YA 3TO6A 4JXQA 4YFJA 4ZX8A 4FUUA 4BINA 3IC1A 1XOVA 2FVGA 5DS0A 4C2YA 2BSWA 2PVVA 3BXMA 4K3NA 4UCPA 2YNEA 4PSXA 2PVWA 4YGOA 2Q0YA 4KZTA 2PJ4A 4E2AA 2C27A 2J8NA 2JEVA 3H8GA 3OWCA 1OBRA 1XF8A 2ZEMA 1TKFA 1XIXA 4OIWA 2Z11A 4PXDA 5LRGA 5CBMA 4CYPA 3FXTA 3N7ZA 2PRBA 5G22A 5K8MA 4CAFA 3TT2A 1YLOA 1KWMA 5E96A 2CTCA 1V0CA 4L89A 4B6ZA 5K8NA 2ZW7A 3SHPA 3ISZA 1H8LA 4LUAA 2PE3A 2A4NA 3PFEA 4C68A 4UFVA 4MY0A 4LQGA 1VHEA 1Z5RA 2I79A 4OAEA 3NH8A 3TCVA 4CAXA 3WC6A 4R87A 4A94A 2Z3OA 5HMNA 3NE7A 4KSAA 2OH1A 1KUVA 2RC4A 3GB0A 5ELYA 1Y7RA 2C1CA 4GM5A 4OC4A 1XE4A 4B5PA 2VL1A 1NMTA 4GXHA 3D2PA 1DE4C 1MJ9A 2ZPAA 4M6HA 2DXQA 4R9MA 5F48A 3B2YA 4OC5A 2B5GA 4XPKA 3RYOA 1TIQA 4I49A 3GIUA 3H8FA 4C2XA 5KTAA 4Q38A 2HUZA 4P4DA 2F8HA 3FRMA 3PB7X 2YGWA 4EFDA 5D8NA 4X3RA 2OZHA 4A30A 3FNCA 2O53A 2PJAA 1Q2CA 3EY5A 4JJXA 4LX9A 4UEZA 4MCRA 5HVGA 1BPMA 2ZENA 5G21A 1M4DA 3BJ7A 3FIXA 3QAHA 4JLYA 1BPNA 4L8AA 2QIRA 2WPXA 2EUIA 3KKWA 2GANA 4Q36A 4H6ZA 2Z3LA 2REFA 2AFMA 3GY9A 1M1DA 3CZXA 4CGOA 3SXNA 4XPDC 1ON0A 1ARMA 4HPSA 2GE3A 2CNTA 2IL4A 3DLJA 2OB0A 2ODFA 3S9LA 1F2PA 1YLEA 4UWIA 3SI1A 2EBJA 4NEXA 3NE8A 4HNWB 3SI2A 4UCNA 3W6XA 2OZGA 3KR5A 2ZXVA 4K30A 2AJ6A 4OP4A 5LYLA 4PK2A 2ZEOA 4YWYA 2Q51A 4UIBA 4RN7A 3S9NA 2IJZA 1CG2A 4NGNA 5EBVA 3HLPA 2C6PA 2P6FA 1Z8LA 4Y49B 4AG9A 1AMPA 4Q7AA 1VKCA 2QMLA 5G20A 5JPHA 2C6GA 3QB8A 3BI1A 2XEIA 3TO9A 2Q4ZA 2GREA 2Z0ZA 3CXSA 3R96A 1PYTB 2PJBA 4LQ6A 3KASA 2OU2A 4P6YA 1BOBA 4NF1A 4WWVA 4OC1A 5KTCA 2CNMA 3D8PA 1ZO0A 1Y0YA 3TFYA 1RTQA 2V8GA 1TKJA 4ZX9A 2B4DB 2ZW5A 1ZLIA 3IWWA 5LRKA 2HC9A 2REEA 2YNDA 4OLLA 3CT9A 5LYDA 1QQ9A 4MHDA 5C88A 3B3WA 1BO4A 2HB6A 4KOSA 4MCPA 2ZOGA 4KOYA 3TE4A 3PB6X 2Z3NA 4AVCA 3HUVA 3R1KA 2V8HA 4PXEA 4G1PA 2QVPA 4UBRA 4MFQA 4U9YA 3PGPA 5A28A 3PZJA 4ZGYB 2ARHA 2FL4A 1LAPA 1UFHA 4P4IA 4F0XA 3B7IA 3S6HA 3T8WA 5JH9A 2ZELA 1BLLE 1CX8A 2PJCA 2QYVA 3D66A 3IWEA 2P0WA 4M3SA 4W9YA 2FIAA 4AB7A 1ZG7A 5ISVA 2O28A 3UY5A 3RZAA 2BL1A 2QECA 2PJ9A 3EC4A 2CF4A 2WUUA 4MJ8A 1I21A 4KSIA 4B5OA 3KL9A 4AXVA 3SJXA 1X10A 3CDXA 2POKA 4KOWA 3NH5A 3WR7A 1QSNA 3I1UA 2B4BA 2OR4A 3PB4X 3B8GA 2PIZA 4CAVA 3MGDA 1DTDA 3RAMA 4DJLA 1QSMA 5BWAB 2R1IA 1WK4A 3NH4A 2V8DA 3W91A 1VHSA 3D7DA 2AFSA 3D68A 1KUXA 1X12A 3QAYA 1PCAA 4PQAA 1XFOA 2CY2A 4MFLA 4NJRA 4O23A 2WSAA 3IJ3A 1LCPA 2QJ8A 1LRZA 2B3UA 1B6BA 2F7VA 2Z3MA 2Z3KA 2Z3PA 4ZBGA 4MY3A 2XEGA 5H86A 1ZLHA 4P44A 1AYEA 4R8FA 2X7BA 1QMUA 3H4QA 4MCQA 4E0AA 1Y7EA 4UIAA 2VEZA 4A38A 1TXRA 4PPZA 1R57A 3D67A 3KQZA 2I3CA 3H5ZA 4H2KA 4CRYB 2GFQA 1XEBA 3JRUA 4X5KA 3EXNA 4R3LA 2R8VA 2ZEFA 4UWJA 4CGNA 4PSWA 4KOXA 4E8OA 3VH9A 3KHXA 4B13A 3CPAA 4OIDA 2PJ1A 3SXOA 4CGLA 4ONUA 1I1DA 3PBEA 2AFOA 1IB1E 5HVHA 2FS5A 2PIYA 3PBBA 4A32A 2HQYA 2D4OA 1CM0A 2G9DA 3T9YA 3TC8A 1GYTA 3R9EA 1Z8TA 1M4LA 1PU9A 1LANA 2V8VA 4EVYA 5GCNA 5K8OA 2VZZA 1YW6A 1R43A 2HV2A 4ZYQA 2ANPA 2NSMA 4UEEA 3TX8A 2XEFA 4KOTA 3WT4A 4IAVA 1IIDA 4MFKA 5A27A 5JM6A 1IOIA 2B3VA 2PCUA 4MRIA 4NJQA 1KZFA 4EMEA 4HKFA 1SQHA 4A39A 5C82A 1S60A 3FEEA 3ISXA 4CYNA 4NCZA 3B35A 4XNHC 4EWTA 2JDCA 4ZI6A 5JQ4A 3D3SA 3G3SA 4OC2A 2R98A 4OMEA 1CBXA 3PRTA 2PSWA 2F5IA 1CJWA 2B4DA 3KQXA 2Q43A 1CP6A 2PJ2A 4B14A 2DF5A 2V77A 3FYNA 1GHEA 2OOTA 2NYQA 2J8RA 3IWGA 3V38A 3LODA 2FXFA 2B58A 4PV6A 3JUWA 4X2TA 4F9VA 1CPXA 2P6EA 3JTKA 1CP7A 5AGEA 1IU8A 2YNCC 4UFXA 3ZZIA 5J1QA 3S6GA 3S6FA 1ELLP 3ZJ0A 2OZUA 3LWUA 4MMOA 4R57A 2JBJA 4NGPA 4R3KA 4X8IA 1MJBA 1S3ZA 1Y9WA 2ATRA 2YNCA 1Z9UA 4JWPA 1ZG8A 1RXTA 4CAEA 4AG7A 4P4EA 1MK4A 3PB8X 5AG4A 2DPTA 2Q7SA 4BD9A 1YVKA 4NGTA 1IOFA 4KOUA 2PR8A 1I12A 1S5KA 1JWQA 2RB7A 4R76A 5HXDA 3CXPA 4MFJA 2H5MA 2ZEPA 4II9A 4GS4A 2RFHA 4MHPA 4R6TA 3NFZA 3VWDA 1L0CA 4B12A 3KHZA 3RNZA 2EWBA 2BCOA 3IU2A 4FD6A 4UFWA 4KSFA 1RO5A 4XPDB 2AE6A 2O4HA 3FECA 2VI7A 4UCMA 4CAWA 1UWYA 3N5FA 4FAIA 1HEEA 3PP9A 3WABA 1M44A 3IO1A 3F5BA 3P2FA 3VARA 3DR8A 2ZW4A 2DPSA 2Q4YA 1F2OA 4KUBA 3R95A 1VHOA 2J8MA 4ZY2A 5LRJA 4JXRA 1XJOA 1NSAA 1YMEA 2ZEEA 3B3TA 3T90A 1CPSA 5AG7A 2DEAA 2PRQA 4MHYA 3GKRA 4F6AA 5CPAA 4P4BA 4U9ZA 1R3NA 3D4UA 4M6IA 4P4JA 1EE3P 2PDOA 3V8IA 4FWUA 4NGMA 4RS2A 1KUYA 3WC5A 4TNUA 2PQ8A 4CGMA 4QC6A 3GYAA 4B11A 4CRZB 4C7HA 2WZNA 4IUSA 4NFRA 3K2KA 2GLJA 3D7FA 3K9UA 2GIVA 2JLMA 4NGSA 4P4FA 5DWMA 2EVNA 2FSRA 4A31A 2ZEHA 4CS0B 4FD4A 4AVBA 1IYLA 5HVFA 4IHMA 1WWZA 3JVNA 3PFOA 2IQ6A 4MI4A 3MN8A 4UA3A 2ZW6A 4A95A 5I4MA 4OC3A 2I00A 4KS9A 3SI0A 2FCKA 4P45A 3W6SA 4QUSA 3DR6A 1F57A 2D4PA 1HDUA 1LFWA 4YRHA 3DSBA 3LACA 1Q7LA 2EK8A 5IV0A 3PEIA 4F9UA 2PJ8A 3FX6A 3IFEA 2G3AA 1MJAA 4NGQA 3DDDA 3EO4A 4FD7A 1YK3A 1VGYA 3L2NA 2G0BA 4MHZA 3CPXA 4OKOA 4P10A 4OADA 3H8EA 2CTBA 5F49A 2BO9A 2BUEA 2J9AA 1ZG9A 4H6UA 3WC7A 4QBJA 3FB3A 2ZOFA 4KLVA 3S9MA 3KGQA 4MFPA 2EK9A 3B3VA 5AG6A 3SJEA 5I0CA 3IEHA 2VXKA 5AG5A 3SJGA 5F46A 3FF3A 1QSTA 4A37A 2VZYA 1U6MA 3QNVA 4DUKA 2AFWA 4F0YA 1S7NA 3B3SA 2XEJA 4JD6A 2C6CA 5IB9A 3I9SA 4Y49C 2Q4VA 5K8PA 5LYFA 4QVTA 1ARLA 1NE9A 4KLWA 1B87A 1Q2YA 4ONWA 3FJUA 1YW4A 3IU1A 4IF5A 3P2HA 4KVOE 4NSQA 3R9FA 1IY7A 5J8FA 2ABZA 1J4JA 1Z2LA 3K9TA 4PXCA 3TTHA 1YVOA 3R9GA 3NA6A 4TWEA 3KZWA 4KUAA 4CYQA 4DNCA 2Q44A 2ZEDA 1FY7A 1Y9KA 4AVAA 3F8KA 4MBUA 3LD2A 2IMOA 3D7GA 4B5PB 2JBKA 2BEIA 1A2ZA 3A9LA 3BJ8A 5D29A 3VATA 2K5TA 3E0KA 4RUHA 4ZY1A 3GLJA 2CIJA 3FEDA 4MXUA 2Q04A 2PC1A 1K4JA 3D7HA 1QSRA 5EC4A 1M4GA 2G3TA 1LAMA 4WJBA 7CPAA 3DNSA 4M6GA 5IX3A 5J8CA 4FBEA 1QSOA 1XMBA 3BLNA 1S7KA 1Z4RA 5THWA 3CXQA 1YREA 2EO8A 2PJ5A 3B3CA 4MFZA 3SJFA 3V7ZA 3C26A 2PJ3A 4J3GA 2B5GB 5IB0A 1M4IA 2P6GA 3FH4A 2PJ7A 8CPAA 1YGHA 2Y0MA 1ELMP 1YQEA 3S6KA 1S7FA 2Z10A 2FT0A 1HDQA 2PJ0A 5HH1A 4M85A 5EMIA 3BI0A 4OC0A 4UEFA 4YU9A 5JGFA 4KOVA 3RBUA 1TKHA 3FVLA 4NXYA 1OZPA 2PJ6A 4CPAA 3EFAA 2VBQA 2PR1A 4H89A 4HNYB 4BMHA 2VQYA 2AFZA 3MRUA 3DGVA 2WPWA 4A2ZA 1BAVA 4BBHA 3LMSA 4NGRA 2GLFA 3D2MA 2FE7A 6CPAA 1XMTA 3IIBA 2BOAA 4PXBA 1FNOA 4RI1A 4CYOA 1IICA 3BHXA 1PUAA 1P0HA 1AUGA 4DYOA 3TOBA 3F0AA 4A33A 1YSJA 3TO7A 4B10A 1VIXA 1YR0A 4XNHB 1TF9A 1Y0RA 4HNXB 4QB9A 2GU2A 5CNPA 5KTDA 5F47A 2JDDA 2AFXA 4JYWA 1JQGA 4ZY0A 1XRYA 3PB9X 2CNSA 2WYRA 2Q7BA 4PK3A 4XPLA 4MHNA 4JZ0A 4IK2A 1Q2DA 3GUXA 3IGRA 5H84A 4C7IA 4KVXA 1Z8WA 2CXAA 1FT7A 2R7HA 2KCWA 1IGBA 4FD5A 3RO0A 4F8ZA 1XBUA 3I3GA 1Z8XA 4KORA 4ORFA 4UF4A 4Z65A 1Z4EA 3TOAA 2ZEGA 1P4NA 1LOKA 4KVME 5F09A 5LYIA 2NMTA 1IYKA 4C2ZA 3FMCA 5DWNA 5FVJA 1N71A 4MCSA 2JEWA 4CGPA 1YX0A 3VWEA 2FIWA 3FBUA 3KI9A 4R7MA 3G8WA 1TF8A 1NSLA 3KR4A
chains in the Genus database with same CATH topology
5G1ZA 1S7LA 4U5YA 3TO6A 4JXQA 4YFJA 4C2YA 2BSWA 4UCPA 2YNEA 4PSXA 4YGOA 2Q0YA 4KZTA 4E2AA 2C27A 2J8NA 2JEVA 3OWCA 1XF8A 1XIXA 2Z11A 4CYPA 3FXTA 3N7ZA 2PRBA 5G22A 4CAFA 3TT2A 5E96A 1V0CA 4L89A 2ZW7A 3SHPA 4LUAA 2A4NA 4C68A 4UFVA 4MY0A 4OAEA 2I79A 3TCVA 4CAXA 4R87A 2Z3OA 5HMNA 3NE7A 4KSAA 2OH1A 1KUVA 2RC4A 1Y7RA 4B5PA 1XE4A 1NMTA 3D2PA 2ZPAA 1MJ9A 4R9MA 5F48A 2DXQA 4XPKA 2B5GA 3RYOA 1TIQA 4I49A 4C2XA 5KTAA 4Q38A 2HUZA 3FRMA 2YGWA 4A30A 2OZHA 3FNCA 1Q2CA 3EY5A 4JJXA 4LX9A 5G21A 1M4DA 3BJ7A 3FIXA 3QAHA 4JLYA 4L8AA 2QIRA 2WPXA 2EUIA 3KKWA 2GANA 4Q36A 4H6ZA 2Z3LA 2REFA 3GY9A 1M1DA 4CGOA 3SXNA 4XPDC 1ON0A 2GE3A 2CNTA 2IL4A 2OB0A 1YLEA 4UWIA 4NEXA 4HNWB 4UCNA 3W6XA 2OZGA 4K30A 2ZXVA 2AJ6A 4PK2A 5EBVA 2P6FA 4Y49B 4AG9A 1VKCA 2QMLA 5G20A 5JPHA 3QB8A 3TO9A 2Z0ZA 3CXSA 3R96A 2OU2A 1BOBA 4NF1A 5KTCA 2CNMA 3D8PA 1ZO0A 3TFYA 2B4DB 2ZW5A 2REEA 2YNDA 4OLLA 4MHDA 5C88A 1BO4A 4KOSA 4KOYA 3TE4A 2Z3NA 4AVCA 3R1KA 4UBRA 4MFQA 4U9YA 3PGPA 5A28A 3PZJA 4ZGYB 2ARHA 2FL4A 1UFHA 4F0XA 3S6HA 4M3SA 3IWEA 2P0WA 2FIAA 4AB7A 5ISVA 2O28A 3UY5A 2BL1A 2QECA 3EC4A 2WUUA 4MJ8A 1I21A 4B5OA 4KOWA 3WR7A 1QSNA 2B4BA 3B8GA 4CAVA 3MGDA 1QSMA 5BWAB 2R1IA 1WK4A 3W91A 1VHSA 1KUXA 2CY2A 4MFLA 2WSAA 1LRZA 2B3UA 1B6BA 2Z3MA 2Z3KA 2Z3PA 4ZBGA 4MY3A 5H86A 2X7BA 3H4QA 4E0AA 2VEZA 1R57A 3H5ZA 4CRYB 4CGNA 1XEBA 4X5KA 3EXNA 4R3LA 2R8VA 4UWJA 4PSWA 4KOXA 4E8OA 4B13A 3SXOA 4CGLA 4ONUA 1I1DA 1IB1E 2FS5A 4A32A 2HQYA 2D4OA 1CM0A 3T9YA 3R9EA 1PU9A 4EVYA 5GCNA 2VZZA 2HV2A 4KOTA 4MFKA 1IIDA 5A27A 2B3VA 1KZFA 4HKFA 1SQHA 5C82A 1S60A 4CYNA 4NCZA 4XNHC 2JDCA 5JQ4A 3D3SA 3G3SA 2R98A 2PSWA 2F5IA 1CJWA 2B4DA 4B14A 3FYNA 1GHEA 2J8RA 3IWGA 3LODA 2FXFA 2B58A 4PV6A 3JUWA 2P6EA 3JTKA 5AGEA 2YNCC 4UFXA 3ZZIA 3S6GA 3S6FA 3ZJ0A 2OZUA 4R57A 4R3KA 1MJBA 1S3ZA 1Y9WA 2ATRA 2YNCA 1Z9UA 4JWPA 1RXTA 4CAEA 4AG7A 1MK4A 5AG4A 2DPTA 1YVKA 4KOUA 2PR8A 1I12A 1S5KA 3CXPA 4MFJA 2H5MA 4II9A 4GS4A 3VWDA 1L0CA 4B12A 3IU2A 4FD6A 4UFWA 4KSFA 1RO5A 4XPDB 2AE6A 2VI7A 4UCMA 4CAWA 3PP9A 1M44A 3F5BA 3P2FA 3DR8A 2ZW4A 2DPSA 2Q4YA 4KUBA 3R95A 2J8MA 4JXRA 3T90A 5AG7A 3GKRA 4F6AA 4U9ZA 3V8IA 2PDOA 4RS2A 1KUYA 4CGMA 2PQ8A 4QC6A 3GYAA 4B11A 4CRZB 4C7HA 4IUSA 3K9UA 2GIVA 2JLMA 5DWMA 2EVNA 2FSRA 4A31A 4CS0B 4FD4A 4AVBA 1IYLA 1WWZA 3JVNA 4MI4A 4UA3A 2ZW6A 4A95A 2I00A 4KS9A 2FCKA 3W6SA 4QUSA 3DR6A 2D4PA 4YRHA 3DSBA 5IV0A 2G3AA 1MJAA 3DDDA 3EO4A 4FD7A 1YK3A 2G0BA 4OADA 5F49A 4H6UA 2BUEA 4QBJA 3FB3A 4KLVA 4MFPA 5I0CA 5AG6A 5AG5A 2VXKA 5F46A 1QSTA 2VZYA 1U6MA 4F0YA 1S7NA 4JD6A 3I9SA 4Y49C 2Q4VA 4QVTA 1NE9A 4KLWA 1B87A 1Q2YA 3IU1A 4IF5A 3P2HA 4KVOE 4NSQA 3R9FA 5J8FA 1J4JA 3TTHA 1YVOA 3R9GA 4KUAA 4CYQA 4DNCA 2Q44A 1FY7A 1Y9KA 4AVAA 3F8KA 4MBUA 3LD2A 2BEIA 3BJ8A 3A9LA 2K5TA 3E0KA 2Q04A 2PC1A 1K4JA 1QSRA 5EC4A 1M4GA 2G3TA 3DNSA 5J8CA 5IX3A 1QSOA 3BLNA 1S7KA 1Z4RA 4B5PB 3CXQA 1YREA 4MFZA 3C26A 4J3GA 2B5GB 5IB0A 1M4IA 2P6GA 1YGHA 2Y0MA 3S6KA 1S7FA 2Z10A 2FT0A 5HH1A 4M85A 4KOVA 4NXYA 1OZPA 3EFAA 2VBQA 2PR1A 4H89A 4HNYB 4BMHA 2VQYA 2WPWA 4A2ZA 4BBHA 3D2MA 2FE7A 1XMTA 4RI1A 4CYOA 1IICA 1PUAA 1P0HA 3TOBA 3F0AA 4A33A 3TO7A 4B10A 1YR0A 4XNHB 4HNXB 4QB9A 5CNPA 5KTDA 5F47A 2JDDA 2CNSA 2Q7BA 4PK3A 4XPLA 1Q2DA 3IGRA 5H84A 4C7IA 4KVXA 2CXAA 2R7HA 4FD5A 2KCWA 3I3GA 4ORFA 4KORA 1Z4EA 3TOAA 1P4NA 4KVME 2NMTA 1IYKA 4C2ZA 5DWNA 5FVJA 1N71A 4CGPA 1YX0A 3VWEA 2FIWA 3FBUA 3G8WA 1NSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S7L A;  4U5Y A;  3TO6 A;  4JXQ A;  4YFJ A;  2BSW A;  4PSX A;  4YGO A;  2Q0Y A;  4KZT A;  4E2A A;  2C27 A;  2J8N A;  2JEV A;  3OWC A;  1XF8 A;  1XIX A;  2Z11 A;  3FXT A;  3N7Z A;  2PRB A;  3TT2 A;  5E96 A;  1V0C A;  4L89 A;  2ZW7 A;  3SHP A;  4LUA A;  2A4N A;  4MY0 A;  4OAE A;  2I79 A;  3TCV A;  4CAX A;  4R87 A;  5HMN A;  3NE7 A;  2OH1 A;  1KUV A;  2RC4 A;  1Y7R A;  4B5P A;  1XE4 A;  1NMT A;  3D2P A;  2ZPA A;  1MJ9 A;  4R9M A;  5F48 A;  2DXQ A;  4XPK A;  2B5G A;  3RYO A;  1TIQ A;  4I49 A;  5KTA A;  2HUZ A;  3FRM A;  2OZH A;  3FNC A;  1Q2C A;  3EY5 A;  4JJX A;  4LX9 A;  1M4D A;  3BJ7 A;  3FIX A;  3QAH A;  4JLY A;  4L8A A;  2QIR A;  2WPX A;  2EUI A;  3KKW A;  2GAN A;  4H6Z A;  2REF A;  3GY9 A;  1M1D A;  3SXN A;  4XPD C;  1ON0 A;  2GE3 A;  2CNT A;  2IL4 A;  2OB0 A;  1YLE A;  4UWI A;  4NEX A;  4HNW B;  3W6X A;  2OZG A;  4K30 A;  2ZXV A;  2AJ6 A;  4PK2 A;  5EBV A;  2P6F A;  4Y49 B;  4AG9 A;  1VKC A;  2QML A;  5JPH A;  3QB8 A;  3TO9 A;  2Z0Z A;  3CXS A;  3R96 A;  2OU2 A;  1BOB A;  4NF1 A;  5KTC A;  2CNM A;  3D8P A;  3TFY A;  2B4D B;  2ZW5 A;  2REE A;  4OLL A;  4MHD A;  5C88 A;  1BO4 A;  4KOS A;  4KOY A;  3TE4 A;  4AVC A;  3R1K A;  4UBR A;  4U9Y A;  3PGP A;  3PZJ A;  2ARH A;  2FL4 A;  1UFH A;  3S6H A;  4M3S A;  2P0W A;  2FIA A;  4AB7 A;  5ISV A;  2O28 A;  3UY5 A;  2BL1 A;  2QEC A;  3EC4 A;  4MJ8 A;  1I21 A;  4B5O A;  4KOW A;  3WR7 A;  1QSN A;  2B4B A;  3B8G A;  4CAV A;  3MGD A;  1QSM A;  2R1I A;  1WK4 A;  3W91 A;  1VHS A;  1KUX A;  2CY2 A;  1LRZ A;  2B3U A;  1B6B A;  4ZBG A;  4MY3 A;  5H86 A;  2X7B A;  3H4Q A;  4E0A A;  2VEZ A;  1R57 A;  4CRY B;  1XEB A;  4X5K A;  3EXN A;  4R3L A;  2R8V A;  4UWJ A;  4PSW A;  4KOX A;  4E8O A;  3SXO A;  4ONU A;  1I1D A;  1IB1 E;  2FS5 A;  2HQY A;  2D4O A;  1CM0 A;  3T9Y A;  3R9E A;  1PU9 A;  4EVY A;  5GCN A;  2VZZ A;  2HV2 A;  4KOT A;  1IID A;  2B3V A;  1KZF A;  4HKF A;  1SQH A;  5C82 A;  1S60 A;  4NCZ A;  4XNH C;  2JDC A;  5JQ4 A;  3D3S A;  3G3S A;  2R98 A;  2PSW A;  2F5I A;  1CJW A;  2B4D A;  3FYN A;  1GHE A;  2J8R A;  3IWG A;  3LOD A;  2FXF A;  2B58 A;  4PV6 A;  3JUW A;  2P6E A;  3ZZI A;  3S6G A;  3S6F A;  3ZJ0 A;  2OZU A;  4R57 A;  4R3K A;  1MJB A;  1S3Z A;  1Y9W A;  2ATR A;  4JWP A;  1Z9U A;  1RXT A;  4AG7 A;  1MK4 A;  1YVK A;  4KOU A;  2PR8 A;  1I12 A;  1S5K A;  3CXP A;  2H5M A;  4II9 A;  4GS4 A;  3VWD A;  1L0C A;  4FD6 A;  1RO5 A;  4XPD B;  2AE6 A;  2VI7 A;  4CAW A;  3PP9 A;  1M44 A;  3F5B A;  3P2F A;  3DR8 A;  2ZW4 A;  2Q4Y A;  4KUB A;  3R95 A;  2J8M A;  4JXR A;  3T90 A;  3GKR A;  4F6A A;  4U9Z A;  3V8I A;  2PDO A;  4RS2 A;  1KUY A;  2PQ8 A;  4QC6 A;  3GYA A;  4CRZ B;  4IUS A;  3K9U A;  2GIV A;  2JLM A;  5DWM A;  2EVN A;  2FSR A;  4CS0 B;  4FD4 A;  4AVB A;  1IYL A;  1WWZ A;  3JVN A;  4MI4 A;  4UA3 A;  2ZW6 A;  2I00 A;  2FCK A;  3W6S A;  4QUS A;  3DR6 A;  2D4P A;  4YRH A;  3DSB A;  5IV0 A;  2G3A A;  1MJA A;  3DDD A;  3EO4 A;  4FD7 A;  1YK3 A;  2G0B A;  4OAD A;  5F49 A;  4H6U A;  2BUE A;  4QBJ A;  3FB3 A;  4KLV A;  5I0C A;  2VXK A;  5F46 A;  1QST A;  2VZY A;  1U6M A;  4F0Y A;  1S7N A;  4JD6 A;  3I9S A;  4Y49 C;  2Q4V A;  4QVT A;  1NE9 A;  4KLW A;  1B87 A;  1Q2Y A;  4IF5 A;  3P2H A;  4KVO E;  4NSQ A;  3R9F A;  5J8F A;  1J4J A;  3TTH A;  1YVO A;  3R9G A;  4KUA A;  4DNC A;  2Q44 A;  1FY7 A;  1Y9K A;  4AVA A;  3F8K A;  4MBU A;  3LD2 A;  2BEI A;  3BJ8 A;  2K5T A;  3E0K A;  2Q04 A;  2PC1 A;  1K4J A;  1QSR A;  5EC4 A;  1M4G A;  2G3T A;  3DNS A;  5J8C A;  5IX3 A;  1QSO A;  3BLN A;  1S7K A;  1Z4R A;  4B5P B;  3CXQ A;  1YRE A;  3C26 A;  4J3G A;  2B5G B;  5IB0 A;  1M4I A;  2P6G A;  1YGH A;  2Y0M A;  3S6K A;  1S7F A;  2Z10 A;  2FT0 A;  5HH1 A;  4M85 A;  4KOV A;  4NXY A;  1OZP A;  3EFA A;  2VBQ A;  2PR1 A;  4H89 A;  4HNY B;  4BMH A;  2VQY A;  2WPW A;  3D2M A;  2FE7 A;  1XMT A;  4RI1 A;  1IIC A;  1PUA A;  1P0H A;  3TOB A;  3F0A A;  3TO7 A;  1YR0 A;  4XNH B;  4HNX B;  4QB9 A;  5CNP A;  5KTD A;  5F47 A;  2JDD A;  2CNS A;  2Q7B A;  4PK3 A;  4XPL A;  1Q2D A;  3IGR A;  5H84 A;  4KVX A;  2R7H A;  4FD5 A;  2KCW A;  3I3G A;  4ORF A;  4KOR A;  1Z4E A;  3TOA A;  1P4N A;  4KVM E;  2NMT A;  1IYK A;  5DWN A;  5FVJ A;  1N71 A;  1YX0 A;  3VWE A;  2FIW A;  3FBU A;  3G8W A;  1NSL A; 
#chains in the Genus database with same CATH topology
 2AFU A;  5G1Z A;  1S7L A;  4U5Y A;  3TO6 A;  4JXQ A;  4YFJ A;  4ZX8 A;  4FUU A;  4BIN A;  3IC1 A;  1XOV A;  2FVG A;  5DS0 A;  4C2Y A;  2BSW A;  2PVV A;  3BXM A;  4K3N A;  4UCP A;  2YNE A;  4PSX A;  2PVW A;  4YGO A;  2Q0Y A;  4KZT A;  2PJ4 A;  4E2A A;  2C27 A;  2J8N A;  2JEV A;  3H8G A;  3OWC A;  1OBR A;  1XF8 A;  2ZEM A;  1TKF A;  1XIX A;  4OIW A;  2Z11 A;  4PXD A;  5LRG A;  5CBM A;  4CYP A;  3FXT A;  3N7Z A;  2PRB A;  5G22 A;  5K8M A;  4CAF A;  3TT2 A;  1YLO A;  1KWM A;  5E96 A;  2CTC A;  1V0C A;  4L89 A;  4B6Z A;  5K8N A;  2ZW7 A;  3SHP A;  3ISZ A;  1H8L A;  4LUA A;  2PE3 A;  2A4N A;  3PFE A;  4C68 A;  4UFV A;  4MY0 A;  4LQG A;  1VHE A;  1Z5R A;  2I79 A;  4OAE A;  3NH8 A;  3TCV A;  4CAX A;  3WC6 A;  4R87 A;  4A94 A;  2Z3O A;  5HMN A;  3NE7 A;  4KSA A;  2OH1 A;  1KUV A;  2RC4 A;  3GB0 A;  5ELY A;  1Y7R A;  2C1C A;  4GM5 A;  4OC4 A;  1XE4 A;  4B5P A;  2VL1 A;  1NMT A;  4GXH A;  3D2P A;  1DE4 C;  1MJ9 A;  2ZPA A;  4M6H A;  2DXQ A;  4R9M A;  5F48 A;  3B2Y A;  4OC5 A;  2B5G A;  4XPK A;  3RYO A;  1TIQ A;  4I49 A;  3GIU A;  3H8F A;  4C2X A;  5KTA A;  4Q38 A;  2HUZ A;  4P4D A;  2F8H A;  3FRM A;  3PB7 X;  2YGW A;  4EFD A;  5D8N A;  4X3R A;  2OZH A;  4A30 A;  3FNC A;  2O53 A;  2PJA A;  1Q2C A;  3EY5 A;  4JJX A;  4LX9 A;  4UEZ A;  4MCR A;  5HVG A;  1BPM A;  2ZEN A;  5G21 A;  1M4D A;  3BJ7 A;  3FIX A;  3QAH A;  4JLY A;  1BPN A;  4L8A A;  2QIR A;  2WPX A;  2EUI A;  3KKW A;  2GAN A;  4Q36 A;  4H6Z A;  2Z3L A;  2REF A;  2AFM A;  3GY9 A;  1M1D A;  3CZX A;  4CGO A;  3SXN A;  4XPD C;  1ON0 A;  1ARM A;  4HPS A;  2GE3 A;  2CNT A;  2IL4 A;  3DLJ A;  2OB0 A;  2ODF A;  3S9L A;  1F2P A;  1YLE A;  4UWI A;  3SI1 A;  2EBJ A;  4NEX A;  3NE8 A;  4HNW B;  3SI2 A;  4UCN A;  3W6X A;  2OZG A;  3KR5 A;  2ZXV A;  4K30 A;  2AJ6 A;  4OP4 A;  5LYL A;  4PK2 A;  2ZEO A;  4YWY A;  2Q51 A;  4UIB A;  4RN7 A;  3S9N A;  2IJZ A;  1CG2 A;  4NGN A;  5EBV A;  3HLP A;  2C6P A;  2P6F A;  1Z8L A;  4Y49 B;  4AG9 A;  1AMP A;  4Q7A A;  1VKC A;  2QML A;  5G20 A;  5JPH A;  2C6G A;  3QB8 A;  3BI1 A;  2XEI A;  3TO9 A;  2Q4Z A;  2GRE A;  2Z0Z A;  3CXS A;  3R96 A;  1PYT B;  2PJB A;  4LQ6 A;  3KAS A;  2OU2 A;  4P6Y A;  1BOB A;  4NF1 A;  4WWV A;  4OC1 A;  5KTC A;  2CNM A;  3D8P A;  1ZO0 A;  1Y0Y A;  3TFY A;  1RTQ A;  2V8G A;  1TKJ A;  4ZX9 A;  2B4D B;  2ZW5 A;  1ZLI A;  3IWW A;  5LRK A;  2HC9 A;  2REE A;  2YND A;  4OLL A;  3CT9 A;  5LYD A;  1QQ9 A;  4MHD A;  5C88 A;  3B3W A;  1BO4 A;  2HB6 A;  4KOS A;  4MCP A;  2ZOG A;  4KOY A;  3TE4 A;  3PB6 X;  2Z3N A;  4AVC A;  3HUV A;  3R1K A;  2V8H A;  4PXE A;  4G1P A;  2QVP A;  4UBR A;  4MFQ A;  4U9Y A;  3PGP A;  5A28 A;  3PZJ A;  4ZGY B;  2ARH A;  2FL4 A;  1LAP A;  1UFH A;  4P4I A;  4F0X A;  3B7I A;  3S6H A;  3T8W A;  5JH9 A;  2ZEL A;  1BLL E;  1CX8 A;  2PJC A;  2QYV A;  3D66 A;  3IWE A;  2P0W A;  4M3S A;  4W9Y A;  2FIA A;  4AB7 A;  1ZG7 A;  5ISV A;  2O28 A;  3UY5 A;  3RZA A;  2BL1 A;  2QEC A;  2PJ9 A;  3EC4 A;  2CF4 A;  2WUU A;  4MJ8 A;  1I21 A;  4KSI A;  4B5O A;  3KL9 A;  4AXV A;  3SJX A;  1X10 A;  3CDX A;  2POK A;  4KOW A;  3NH5 A;  3WR7 A;  1QSN A;  3I1U A;  2B4B A;  2OR4 A;  3PB4 X;  3B8G A;  2PIZ A;  4CAV A;  3MGD A;  1DTD A;  3RAM A;  4DJL A;  1QSM A;  5BWA B;  2R1I A;  1WK4 A;  3NH4 A;  2V8D A;  3W91 A;  1VHS A;  3D7D A;  2AFS A;  3D68 A;  1KUX A;  1X12 A;  3QAY A;  1PCA A;  4PQA A;  1XFO A;  2CY2 A;  4MFL A;  4NJR A;  4O23 A;  2WSA A;  3IJ3 A;  1LCP A;  2QJ8 A;  1LRZ A;  2B3U A;  1B6B A;  2F7V A;  2Z3M A;  2Z3K A;  2Z3P A;  4ZBG A;  4MY3 A;  2XEG A;  5H86 A;  1ZLH A;  4P44 A;  1AYE A;  4R8F A;  2X7B A;  1QMU A;  3H4Q A;  4MCQ A;  4E0A A;  1Y7E A;  4UIA A;  2VEZ A;  4A38 A;  1TXR A;  4PPZ A;  1R57 A;  3D67 A;  3KQZ A;  2I3C A;  3H5Z A;  4H2K A;  4CRY B;  2GFQ A;  1XEB A;  3JRU A;  4X5K A;  3EXN A;  4R3L A;  2R8V A;  2ZEF A;  4UWJ A;  4CGN A;  4PSW A;  4KOX A;  4E8O A;  3VH9 A;  3KHX A;  4B13 A;  3CPA A;  4OID A;  2PJ1 A;  3SXO A;  4CGL A;  4ONU A;  1I1D A;  3PBE A;  2AFO A;  1IB1 E;  5HVH A;  2FS5 A;  2PIY A;  3PBB A;  4A32 A;  2HQY A;  2D4O A;  1CM0 A;  2G9D A;  3T9Y A;  3TC8 A;  1GYT A;  3R9E A;  1Z8T A;  1M4L A;  1PU9 A;  1LAN A;  2V8V A;  4EVY A;  5GCN A;  5K8O A;  2VZZ A;  1YW6 A;  1R43 A;  2HV2 A;  4ZYQ A;  2ANP A;  2NSM A;  4UEE A;  3TX8 A;  2XEF A;  4KOT A;  3WT4 A;  4IAV A;  1IID A;  4MFK A;  5A27 A;  5JM6 A;  1IOI A;  2B3V A;  2PCU A;  4MRI A;  4NJQ A;  1KZF A;  4EME A;  4HKF A;  1SQH A;  4A39 A;  5C82 A;  1S60 A;  3FEE A;  3ISX A;  4CYN A;  4NCZ A;  3B35 A;  4XNH C;  4EWT A;  2JDC A;  4ZI6 A;  5JQ4 A;  3D3S A;  3G3S A;  4OC2 A;  2R98 A;  4OME A;  1CBX A;  3PRT A;  2PSW A;  2F5I A;  1CJW A;  2B4D A;  3KQX A;  2Q43 A;  1CP6 A;  2PJ2 A;  4B14 A;  2DF5 A;  2V77 A;  3FYN A;  1GHE A;  2OOT A;  2NYQ A;  2J8R A;  3IWG A;  3V38 A;  3LOD A;  2FXF A;  2B58 A;  4PV6 A;  3JUW A;  4X2T A;  4F9V A;  1CPX A;  2P6E A;  3JTK A;  1CP7 A;  5AGE A;  1IU8 A;  2YNC C;  4UFX A;  3ZZI A;  5J1Q A;  3S6G A;  3S6F A;  1ELL P;  3ZJ0 A;  2OZU A;  3LWU A;  4MMO A;  4R57 A;  2JBJ A;  4NGP A;  4R3K A;  4X8I A;  1MJB A;  1S3Z A;  1Y9W A;  2ATR A;  2YNC A;  1Z9U A;  4JWP A;  1ZG8 A;  1RXT A;  4CAE A;  4AG7 A;  4P4E A;  1MK4 A;  3PB8 X;  5AG4 A;  2DPT A;  2Q7S A;  4BD9 A;  1YVK A;  4NGT A;  1IOF A;  4KOU A;  2PR8 A;  1I12 A;  1S5K A;  1JWQ A;  2RB7 A;  4R76 A;  5HXD A;  3CXP A;  4MFJ A;  2H5M A;  2ZEP A;  4II9 A;  4GS4 A;  2RFH A;  4MHP A;  4R6T A;  3NFZ A;  3VWD A;  1L0C A;  4B12 A;  3KHZ A;  3RNZ A;  2EWB A;  2BCO A;  3IU2 A;  4FD6 A;  4UFW A;  4KSF A;  1RO5 A;  4XPD B;  2AE6 A;  2O4H A;  3FEC A;  2VI7 A;  4UCM A;  4CAW A;  1UWY A;  3N5F A;  4FAI A;  1HEE A;  3PP9 A;  3WAB A;  1M44 A;  3IO1 A;  3F5B A;  3P2F A;  3VAR A;  3DR8 A;  2ZW4 A;  2DPS A;  2Q4Y A;  1F2O A;  4KUB A;  3R95 A;  1VHO A;  2J8M A;  4ZY2 A;  5LRJ A;  4JXR A;  1XJO A;  1NSA A;  1YME A;  2ZEE A;  3B3T A;  3T90 A;  1CPS A;  5AG7 A;  2DEA A;  2PRQ A;  4MHY A;  3GKR A;  4F6A A;  5CPA A;  4P4B A;  4U9Z A;  1R3N A;  3D4U A;  4M6I A;  4P4J A;  1EE3 P;  2PDO A;  3V8I A;  4FWU A;  4NGM A;  4RS2 A;  1KUY A;  3WC5 A;  4TNU A;  2PQ8 A;  4CGM A;  4QC6 A;  3GYA A;  4B11 A;  4CRZ B;  4C7H A;  2WZN A;  4IUS A;  4NFR A;  3K2K A;  2GLJ A;  3D7F A;  3K9U A;  2GIV A;  2JLM A;  4NGS A;  4P4F A;  5DWM A;  2EVN A;  2FSR A;  4A31 A;  2ZEH A;  4CS0 B;  4FD4 A;  4AVB A;  1IYL A;  5HVF A;  4IHM A;  1WWZ A;  3JVN A;  3PFO A;  2IQ6 A;  4MI4 A;  3MN8 A;  4UA3 A;  2ZW6 A;  4A95 A;  5I4M A;  4OC3 A;  2I00 A;  4KS9 A;  3SI0 A;  2FCK A;  4P45 A;  3W6S A;  4QUS A;  3DR6 A;  1F57 A;  2D4P A;  1HDU A;  1LFW A;  4YRH A;  3DSB A;  3LAC A;  1Q7L A;  2EK8 A;  5IV0 A;  3PEI A;  4F9U A;  2PJ8 A;  3FX6 A;  3IFE A;  2G3A A;  1MJA A;  4NGQ A;  3DDD A;  3EO4 A;  4FD7 A;  1YK3 A;  1VGY A;  3L2N A;  2G0B A;  4MHZ A;  3CPX A;  4OKO A;  4P10 A;  4OAD A;  3H8E A;  2CTB A;  5F49 A;  2BO9 A;  2BUE A;  2J9A A;  1ZG9 A;  4H6U A;  3WC7 A;  4QBJ A;  3FB3 A;  2ZOF A;  4KLV A;  3S9M A;  3KGQ A;  4MFP A;  2EK9 A;  3B3V A;  5AG6 A;  3SJE A;  5I0C A;  3IEH A;  2VXK A;  5AG5 A;  3SJG A;  5F46 A;  3FF3 A;  1QST A;  4A37 A;  2VZY A;  1U6M A;  3QNV A;  4DUK A;  2AFW A;  4F0Y A;  1S7N A;  3B3S A;  2XEJ A;  4JD6 A;  2C6C A;  5IB9 A;  3I9S A;  4Y49 C;  2Q4V A;  5K8P A;  5LYF A;  4QVT A;  1ARL A;  1NE9 A;  4KLW A;  1B87 A;  1Q2Y A;  4ONW A;  3FJU A;  1YW4 A;  3IU1 A;  4IF5 A;  3P2H A;  4KVO E;  4NSQ A;  3R9F A;  1IY7 A;  5J8F A;  2ABZ A;  1J4J A;  1Z2L A;  3K9T A;  4PXC A;  3TTH A;  1YVO A;  3R9G A;  3NA6 A;  4TWE A;  3KZW A;  4KUA A;  4CYQ A;  4DNC A;  2Q44 A;  2ZED A;  1FY7 A;  1Y9K A;  4AVA A;  3F8K A;  4MBU A;  3LD2 A;  2IMO A;  3D7G A;  4B5P B;  2JBK A;  2BEI A;  1A2Z A;  3A9L A;  3BJ8 A;  5D29 A;  3VAT A;  2K5T A;  3E0K A;  4RUH A;  4ZY1 A;  3GLJ A;  2CIJ A;  3FED A;  4MXU A;  2Q04 A;  2PC1 A;  1K4J A;  3D7H A;  1QSR A;  5EC4 A;  1M4G A;  2G3T A;  1LAM A;  4WJB A;  7CPA A;  3DNS A;  4M6G A;  5IX3 A;  5J8C A;  4FBE A;  1QSO A;  1XMB A;  3BLN A;  1S7K A;  1Z4R A;  5THW A;  3CXQ A;  1YRE A;  2EO8 A;  2PJ5 A;  3B3C A;  4MFZ A;  3SJF A;  3V7Z A;  3C26 A;  2PJ3 A;  4J3G A;  2B5G B;  5IB0 A;  1M4I A;  2P6G A;  3FH4 A;  2PJ7 A;  8CPA A;  1YGH A;  2Y0M A;  1ELM P;  1YQE A;  3S6K A;  1S7F A;  2Z10 A;  2FT0 A;  1HDQ A;  2PJ0 A;  5HH1 A;  4M85 A;  5EMI A;  3BI0 A;  4OC0 A;  4UEF A;  4YU9 A;  5JGF A;  4KOV A;  3RBU A;  1TKH A;  3FVL A;  4NXY A;  1OZP A;  2PJ6 A;  4CPA A;  3EFA A;  2VBQ A;  2PR1 A;  4H89 A;  4HNY B;  4BMH A;  2VQY A;  2AFZ A;  3MRU A;  3DGV A;  2WPW A;  4A2Z A;  1BAV A;  4BBH A;  3LMS A;  4NGR A;  2GLF A;  3D2M A;  2FE7 A;  6CPA A;  1XMT A;  3IIB A;  2BOA A;  4PXB A;  1FNO A;  4RI1 A;  4CYO A;  1IIC A;  3BHX A;  1PUA A;  1P0H A;  1AUG A;  4DYO A;  3TOB A;  3F0A A;  4A33 A;  1YSJ A;  3TO7 A;  4B10 A;  1VIX A;  1YR0 A;  4XNH B;  1TF9 A;  1Y0R A;  4HNX B;  4QB9 A;  2GU2 A;  5CNP A;  5KTD A;  5F47 A;  2JDD A;  2AFX A;  4JYW A;  1JQG A;  4ZY0 A;  1XRY A;  3PB9 X;  2CNS A;  2WYR A;  2Q7B A;  4PK3 A;  4XPL A;  4MHN A;  4JZ0 A;  4IK2 A;  1Q2D A;  3GUX A;  3IGR A;  5H84 A;  4C7I A;  4KVX A;  1Z8W A;  2CXA A;  1FT7 A;  2R7H A;  2KCW A;  1IGB A;  4FD5 A;  3RO0 A;  4F8Z A;  1XBU A;  3I3G A;  1Z8X A;  4KOR A;  4ORF A;  4UF4 A;  4Z65 A;  1Z4E A;  3TOA A;  2ZEG A;  1P4N A;  1LOK A;  4KVM E;  5F09 A;  5LYI A;  2NMT A;  1IYK A;  4C2Z A;  3FMC A;  5DWN A;  5FVJ A;  1N71 A;  4MCS A;  2JEW A;  4CGP A;  1YX0 A;  3VWE A;  2FIW A;  3FBU A;  3KI9 A;  4R7M A;  3G8W A;  1TF8 A;  1NSL A;  3KR4 A; 
#chains in the Genus database with same CATH homology
 5G1Z A;  1S7L A;  4U5Y A;  3TO6 A;  4JXQ A;  4YFJ A;  4C2Y A;  2BSW A;  4UCP A;  2YNE A;  4PSX A;  4YGO A;  2Q0Y A;  4KZT A;  4E2A A;  2C27 A;  2J8N A;  2JEV A;  3OWC A;  1XF8 A;  1XIX A;  2Z11 A;  4CYP A;  3FXT A;  3N7Z A;  2PRB A;  5G22 A;  4CAF A;  3TT2 A;  5E96 A;  1V0C A;  4L89 A;  2ZW7 A;  3SHP A;  4LUA A;  2A4N A;  4C68 A;  4UFV A;  4MY0 A;  4OAE A;  2I79 A;  3TCV A;  4CAX A;  4R87 A;  2Z3O A;  5HMN A;  3NE7 A;  4KSA A;  2OH1 A;  1KUV A;  2RC4 A;  1Y7R A;  4B5P A;  1XE4 A;  1NMT A;  3D2P A;  2ZPA A;  1MJ9 A;  4R9M A;  5F48 A;  2DXQ A;  4XPK A;  2B5G A;  3RYO A;  1TIQ A;  4I49 A;  4C2X A;  5KTA A;  4Q38 A;  2HUZ A;  3FRM A;  2YGW A;  4A30 A;  2OZH A;  3FNC A;  1Q2C A;  3EY5 A;  4JJX A;  4LX9 A;  5G21 A;  1M4D A;  3BJ7 A;  3FIX A;  3QAH A;  4JLY A;  4L8A A;  2QIR A;  2WPX A;  2EUI A;  3KKW A;  2GAN A;  4Q36 A;  4H6Z A;  2Z3L A;  2REF A;  3GY9 A;  1M1D A;  4CGO A;  3SXN A;  4XPD C;  1ON0 A;  2GE3 A;  2CNT A;  2IL4 A;  2OB0 A;  1YLE A;  4UWI A;  4NEX A;  4HNW B;  4UCN A;  3W6X A;  2OZG A;  4K30 A;  2ZXV A;  2AJ6 A;  4PK2 A;  5EBV A;  2P6F A;  4Y49 B;  4AG9 A;  1VKC A;  2QML A;  5G20 A;  5JPH A;  3QB8 A;  3TO9 A;  2Z0Z A;  3CXS A;  3R96 A;  2OU2 A;  1BOB A;  4NF1 A;  5KTC A;  2CNM A;  3D8P A;  1ZO0 A;  3TFY A;  2B4D B;  2ZW5 A;  2REE A;  2YND A;  4OLL A;  4MHD A;  5C88 A;  1BO4 A;  4KOS A;  4KOY A;  3TE4 A;  2Z3N A;  4AVC A;  3R1K A;  4UBR A;  4MFQ A;  4U9Y A;  3PGP A;  5A28 A;  3PZJ A;  4ZGY B;  2ARH A;  2FL4 A;  1UFH A;  4F0X A;  3S6H A;  4M3S A;  3IWE A;  2P0W A;  2FIA A;  4AB7 A;  5ISV A;  2O28 A;  3UY5 A;  2BL1 A;  2QEC A;  3EC4 A;  2WUU A;  4MJ8 A;  1I21 A;  4B5O A;  4KOW A;  3WR7 A;  1QSN A;  2B4B A;  3B8G A;  4CAV A;  3MGD A;  1QSM A;  5BWA B;  2R1I A;  1WK4 A;  3W91 A;  1VHS A;  1KUX A;  2CY2 A;  4MFL A;  2WSA A;  1LRZ A;  2B3U A;  1B6B A;  2Z3M A;  2Z3K A;  2Z3P A;  4ZBG A;  4MY3 A;  5H86 A;  2X7B A;  3H4Q A;  4E0A A;  2VEZ A;  1R57 A;  3H5Z A;  4CRY B;  4CGN A;  1XEB A;  4X5K A;  3EXN A;  4R3L A;  2R8V A;  4UWJ A;  4PSW A;  4KOX A;  4E8O A;  4B13 A;  3SXO A;  4CGL A;  4ONU A;  1I1D A;  1IB1 E;  2FS5 A;  4A32 A;  2HQY A;  2D4O A;  1CM0 A;  3T9Y A;  3R9E A;  1PU9 A;  4EVY A;  5GCN A;  2VZZ A;  2HV2 A;  4KOT A;  4MFK A;  1IID A;  5A27 A;  2B3V A;  1KZF A;  4HKF A;  1SQH A;  5C82 A;  1S60 A;  4CYN A;  4NCZ A;  4XNH C;  2JDC A;  5JQ4 A;  3D3S A;  3G3S A;  2R98 A;  2PSW A;  2F5I A;  1CJW A;  2B4D A;  4B14 A;  3FYN A;  1GHE A;  2J8R A;  3IWG A;  3LOD A;  2FXF A;  2B58 A;  4PV6 A;  3JUW A;  2P6E A;  3JTK A;  5AGE A;  2YNC C;  4UFX A;  3ZZI A;  3S6G A;  3S6F A;  3ZJ0 A;  2OZU A;  4R57 A;  4R3K A;  1MJB A;  1S3Z A;  1Y9W A;  2ATR A;  2YNC A;  1Z9U A;  4JWP A;  1RXT A;  4CAE A;  4AG7 A;  1MK4 A;  5AG4 A;  2DPT A;  1YVK A;  4KOU A;  2PR8 A;  1I12 A;  1S5K A;  3CXP A;  4MFJ A;  2H5M A;  4II9 A;  4GS4 A;  3VWD A;  1L0C A;  4B12 A;  3IU2 A;  4FD6 A;  4UFW A;  4KSF A;  1RO5 A;  4XPD B;  2AE6 A;  2VI7 A;  4UCM A;  4CAW A;  3PP9 A;  1M44 A;  3F5B A;  3P2F A;  3DR8 A;  2ZW4 A;  2DPS A;  2Q4Y A;  4KUB A;  3R95 A;  2J8M A;  4JXR A;  3T90 A;  5AG7 A;  3GKR A;  4F6A A;  4U9Z A;  3V8I A;  2PDO A;  4RS2 A;  1KUY A;  4CGM A;  2PQ8 A;  4QC6 A;  3GYA A;  4B11 A;  4CRZ B;  4C7H A;  4IUS A;  3K9U A;  2GIV A;  2JLM A;  5DWM A;  2EVN A;  2FSR A;  4A31 A;  4CS0 B;  4FD4 A;  4AVB A;  1IYL A;  1WWZ A;  3JVN A;  4MI4 A;  4UA3 A;  2ZW6 A;  4A95 A;  2I00 A;  4KS9 A;  2FCK A;  3W6S A;  4QUS A;  3DR6 A;  2D4P A;  4YRH A;  3DSB A;  5IV0 A;  2G3A A;  1MJA A;  3DDD A;  3EO4 A;  4FD7 A;  1YK3 A;  2G0B A;  4OAD A;  5F49 A;  4H6U A;  2BUE A;  4QBJ A;  3FB3 A;  4KLV A;  4MFP A;  5I0C A;  5AG6 A;  5AG5 A;  2VXK A;  5F46 A;  1QST A;  2VZY A;  1U6M A;  4F0Y A;  1S7N A;  4JD6 A;  3I9S A;  4Y49 C;  2Q4V A;  4QVT A;  1NE9 A;  4KLW A;  1B87 A;  1Q2Y A;  3IU1 A;  4IF5 A;  3P2H A;  4KVO E;  4NSQ A;  3R9F A;  5J8F A;  1J4J A;  3TTH A;  1YVO A;  3R9G A;  4KUA A;  4CYQ A;  4DNC A;  2Q44 A;  1FY7 A;  1Y9K A;  4AVA A;  3F8K A;  4MBU A;  3LD2 A;  2BEI A;  3BJ8 A;  3A9L A;  2K5T A;  3E0K A;  2Q04 A;  2PC1 A;  1K4J A;  1QSR A;  5EC4 A;  1M4G A;  2G3T A;  3DNS A;  5J8C A;  5IX3 A;  1QSO A;  3BLN A;  1S7K A;  1Z4R A;  4B5P B;  3CXQ A;  1YRE A;  4MFZ A;  3C26 A;  4J3G A;  2B5G B;  5IB0 A;  1M4I A;  2P6G A;  1YGH A;  2Y0M A;  3S6K A;  1S7F A;  2Z10 A;  2FT0 A;  5HH1 A;  4M85 A;  4KOV A;  4NXY A;  1OZP A;  3EFA A;  2VBQ A;  2PR1 A;  4H89 A;  4HNY B;  4BMH A;  2VQY A;  2WPW A;  4A2Z A;  4BBH A;  3D2M A;  2FE7 A;  1XMT A;  4RI1 A;  4CYO A;  1IIC A;  1PUA A;  1P0H A;  3TOB A;  3F0A A;  4A33 A;  3TO7 A;  4B10 A;  1YR0 A;  4XNH B;  4HNX B;  4QB9 A;  5CNP A;  5KTD A;  5F47 A;  2JDD A;  2CNS A;  2Q7B A;  4PK3 A;  4XPL A;  1Q2D A;  3IGR A;  5H84 A;  4C7I A;  4KVX A;  2CXA A;  2R7H A;  4FD5 A;  2KCW A;  3I3G A;  4ORF A;  4KOR A;  1Z4E A;  3TOA A;  1P4N A;  4KVM E;  2NMT A;  1IYK A;  4C2Z A;  5DWN A;  5FVJ A;  1N71 A;  4CGP A;  1YX0 A;  3VWE A;  2FIW A;  3FBU A;  3G8W A;  1NSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...