1V0CA

Structure of aac(6')-ib in complex with kanamycin c and acetylcoa.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
179
structure length
176
Chain Sequence
DSVTLRLMTEHDLAMLYEWLNRSHIVEWWGARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEEETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFERTRSDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords AAC(6')-IB
publication title Mechanistic and Structural Analysis of Aminoglycoside N-Acetyltransferase Aac(6')-Ib and its Bifunctional, Fluoroquinolone-Active Aac(6')-Ib-Cr Variant.
pubmed doi rcsb
source organism Escherichia coli
total genus 49
structure length 176
sequence length 179
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2008-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13523 Acetyltransf_8 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1v0cA00
4DNCA 3W6SA 3CXQA 2R1IA 4B5PB 4H89A 2FIWA 4AVCA 2GANA 1KZFA 4KUBA 2G3TA 4QVTA 3P2FA 4OLLA 3TOAA 1WWZA 4M3SA 3D2PA 3KKWA 2I79A 3P2HA 5F47A 2PR1A 2F5IA 2FSRA 4R87A 2P0WA 3FXTA 3S6KA 2J8RA 1NMTA 5DWNA 4U9ZA 1PU9A 4FD7A 5J8FA 2Q7BA 1M44A 2FE7A 4H6ZA 2NMTA 3T90A 2HV2A 1Z4EA 3EY5A 4L89A 4KUAA 2RC4A 2CY2A 5J8CA 1WK4A 3QB8A 2OH1A 2R7HA 3BJ8A 4GS4A 1YR0A 1MJ9A 4Y49B 4CAVA 3TO6A 2Q4VA 2X7BA 2ZPAA 4UBRA 4JXRA 4PK2A 2VI7A 3S6HA 5KTAA 2EVNA 4R9MA 2OZGA 3QAHA 3ZJ0A 1IB1E 4PSXA 4KOWA 4KOTA 4X5KA 1YGHA 3SXOA 4MBUA 4U9YA 1IYKA 3VWDA 4KOVA 2ZW6A 1YX0A 3TOBA 2JDDA 1Y9WA 4FD6A 2QIRA 2ZXVA 4HNXB 4MHDA 5EBVA 4JLYA 4JJXA 3DR8A 2Q04A 2QECA 1CJWA 3G3SA 5F46A 2Y0MA 3CXPA 4E0AA 2FS5A 4M85A 4B5OA 5E96A 1MJAA 3K9UA 4B5PA 3I3GA 1B87A 2BSWA 3G8WA 3VWEA 3TO7A 4BMHA 2PDOA 5HMNA 3TE4A 2B3UA 4PSWA 1I21A 1Q2YA 3WR7A 1GHEA 4KVME 4AVAA 4II9A 4F6AA 4HKFA 2J8MA 3V8IA 5F48A 4R3LA 1Q2DA 3FB3A 3DSBA 4YFJA 4AVBA 2P6FA 1SQHA 1NE9A 4H6UA 3D3SA 4LUAA 4KOSA 4KOYA 4XPDC 3EFAA 1MJBA 1BOBA 2WPWA 2REFA 2KCWA 1QSRA 4QBJA 4XPDB 3JUWA 1S60A 2ZW7A 5C82A 3SHPA 4ZBGA 4QB9A 2B3VA 4NEXA 1M4DA 1YVOA 2PRBA 4J3GA 2PR8A 3LODA 3TFYA 4NXYA 4XNHC 2P6GA 1V0CA 2B5GA 1QSOA 3DNSA 4KZTA 4IF5A 2AJ6A 3T9YA 3TO9A 3E0KA 3MGDA 3W6XA 4FD4A 4XNHB 3F0AA 3PZJA 3N7ZA 2B4BA 5JPHA 4RS2A 2H5MA 1XE4A 2D4OA 3TT2A 4R3KA 1Q2CA 3DDDA 5CNPA 3FIXA 1ON0A 1M4GA 2VBQA 2FT0A 2FCKA 2VXKA 1B6BA 2CNMA 4YRHA 3R9GA 1YVKA 1QSMA 2ZW5A 1J4JA 3R9EA 3TCVA 3FBUA 1L0CA 4EVYA 2B4DA 2B5GB 4XPLA 1VHSA 5H84A 2QMLA 1XF8A 3UY5A 2Q0YA 1M1DA 3F8KA 4FD5A 4CAWA 5EC4A 2IL4A 1R57A 5DWMA 4UWJA 4MJ8A 1KUYA 4JXQA 4UWIA 1IYLA 1S7KA 2O28A 2HQYA 1BO4A 2Q4YA 1OZPA 5IX3A 1XIXA 3D8PA 4AG7A 3LD2A 2A4NA 3EO4A 4ORFA 2JDCA 4HNYB 5ISVA 2B4DB 5KTDA 2ATRA 4HNWB 1S7FA 4KLWA 1QSTA 4U5YA 3S6GA 1S3ZA 5I0CA 1RO5A 4JD6A 4AB7A 4KVXA 1Y7RA 3BLNA 4ONUA 3C26A 1S7NA 1U6MA 1IIDA 2BL1A 5C88A 2VEZA 3NE7A 2G3AA 2VZYA 4QUSA 1MK4A 1XEBA 2GE3A 4LX9A 4NSQA 4YGOA 3PP9A 4PV6A 2AE6A 2BEIA 2VQYA 5JQ4A 2REEA 1Z4RA 2PC1A 4IUSA 4PK3A 4CRYB 3GY9A 3R96A 1CM0A 3IGRA 3W91A 3FRMA 3JVNA 2GIVA 2EUIA 1YLEA 2FIAA 4NF1A 1RXTA 2G0BA 4OAEA 4K30A 4KOXA 3S6FA 2ZW4A 3F5BA 2J8NA 4MI4A 3EC4A 2OZHA 1S7LA 3IWGA 4NCZA 5H86A 4XPKA 1KUXA 1P4NA 4Y49C 3R9FA 2WPXA 4KOUA 4CRZB 3CXSA 1YK3A 4F0YA 4QC6A 3EXNA 2OZUA 1S5KA 3RYOA 1PUAA 2Z11A 3D2MA 5HH1A 2JEVA 1N71A 4JWPA 1IICA 4OADA 1UFHA 4L8AA 1I1DA 2K5TA 2ARHA 2R98A 4AG9A 1LRZA 3PGPA 1KUVA 3TTHA 3I9SA 2VZZA 2BUEA 1Z9UA 4KVOE 3B8GA 4CAXA 2Q44A 5FVJA 4RI1A 1YREA 2B58A 1K4JA 5IV0A 4R57A 1M4IA 2HUZA 4CS0B 4KLVA 3R95A 1Y9KA 1FY7A 5KTCA 3H4QA 2OU2A 3ZZIA 1TIQA 5IB0A 2Z0ZA 2D4PA 2OB0A 1QSNA 1P0HA 2FL4A 3BJ7A 2Z10A 1I12A 2JLMA 2PQ8A 4E2AA 4E8OA 3GKRA 2P6EA 1XMTA 5F49A 3SXNA 2DXQA 2R8VA 4I49A 2FXFA 1VKCA 4MY3A 3OWCA 2I00A 4KORA 2CNSA 4UA3A 3FYNA 2CNTA 3R1KA 3DR6A 4MY0A 2PSWA 2C27A 5GCNA 3FNCA 3GYAA 1NSLA
chains in the Genus database with same CATH superfamily
4UEEA 4DNCA 3W6SA 3CXQA 3PB9X 3RAMA 2XEGA 2R1IA 5AG5A 4H89A 2GU2A 4B5PB 3JRUA 4CAEA 2PJ0A 2C6PA 2FIWA 3RBUA 2WSAA 4AVCA 2JBKA 2GANA 1JWQA 3S9LA 1KZFA 2PJ3A 2G3TA 1BPMA 4KUBA 4QVTA 3VARA 3P2FA 4OLLA 3TOAA 1WWZA 2YNEA 2OR4A 4M3SA 3QAYA 3D2PA 3NE8A 3KKWA 2I79A 2Z3LA 3P2HA 5F47A 2PR1A 2F5IA 2FSRA 4R87A 2P0WA 2AFOA 3FX6A 1LOKA 2NYQA 3FXTA 1Z8LA 3S6KA 4OC5A 2J8RA 1NMTA 1EE3P 3V7ZA 4OMEA 3K9TA 5DWNA 4U9ZA 1PU9A 4FD7A 3NH8A 5J8FA 2Q7BA 4NGPA 1M44A 5LRJA 2PIZA 3GUXA 4NGQA 4NGSA 4OC2A 2FE7A 2PJBA 4H6ZA 4K3NA 4M6HA 2NMTA 4MRIA 3T90A 3FJUA 2BOAA 2C6GA 2HV2A 1Z4EA 3EY5A 4L89A 5AGEA 1ARLA 4KUAA 3LMSA 2RC4A 2CY2A 4MFLA 3SI1A 5J8CA 1VHOA 4R7MA 1WK4A 4C2XA 5LYLA 1ZG9A 4C2ZA 3QB8A 1YW6A 4UFVA 2OH1A 2R7HA 3BJ8A 3KI9A 4GS4A 4TNUA 1YR0A 1MJ9A 2HB6A 3FECA 4Y49B 4NFRA 3TO6A 4CAVA 5HXDA 1YLOA 2Q4VA 4ZY1A 3MRUA 2X7BA 2ZPAA 4UBRA 2PVVA 4JXRA 4KSIA 1IGBA 4PK2A 2V77A 2VI7A 5G21A 1RTQA 3S6HA 5KTAA 2EVNA 4R9MA 4MFPA 2OZGA 3B3SA 3QAHA 3ZJ0A 2QVPA 1IB1E 4PSXA 6CPAA 4KOWA 5D29A 1GYTA 2GLFA 5HVHA 2DPTA 1Y0YA 4DYOA 2HC9A 4KOTA 4R6TA 4X5KA 1DE4C 4C7IA 1YGHA 4KSAA 3SXOA 5BWAB 2ZOFA 3GLJA 4MBUA 4U9YA 1IYKA 3VWDA 4KOVA 4A31A 2ZW6A 2PJAA 1YX0A 3TOBA 3H8GA 2JDDA 1Y9WA 1PCAA 1XMBA 3IWWA 4F9VA 3H5ZA 2Q51A 4FD6A 2O4HA 2QIRA 4IAVA 7CPAA 1BLLE 2ZXVA 4NGMA 4HNXB 4MHDA 4OC0A 2GREA 4JLYA 4JJXA 5EBVA 3DR8A 5LYIA 4ZY2A 2Q04A 2AFMA 4MXUA 2QECA 3IU2A 3PB8X 3IO1A 5K8NA 1CJWA 1X10A 4MHPA 4BD9A 5JGFA 3G3SA 4P6YA 1KWMA 5AG4A 3D7DA 5F46A 1NSAA 2XEFA 1DTDA 5DS0A 2Y0MA 3PRTA 3CXPA 4P44A 4E0AA 5HVFA 3KL9A 2FS5A 4P4BA 4M85A 4AXVA 5E96A 4B5OA 1MJAA 5G22A 1AYEA 3K9UA 4B5PA 4ZX9A 3I3GA 4CGMA 1B87A 2WYRA 2BSWA 3G8WA 3VWEA 3PFOA 3TO7A 3CPAA 4BMHA 1CP7A 2CTBA 2PDOA 5HMNA 1ZLHA 3TE4A 2V8HA 3WC7A 4IK2A 4B6ZA 1Y0RA 3VH9A 2B3UA 4PSWA 4UFXA 1I21A 1Q2YA 3WR7A 1GHEA 4KVME 1R3NA 4AVAA 4II9A 4F6AA 2BO9A 4HKFA 2PJ6A 2J8MA 3V8IA 4OIDA 5F48A 3SJFA 4R3LA 4A33A 2PVWA 4W9YA 4A2ZA 4CYNA 1Q2DA 3WT4A 4CAFA 4A39A 3FB3A 3DSBA 4MFQA 4UCPA 3CT9A 4AVBA 2P6FA 3S9MA 4YFJA 1R43A 1SQHA 1NE9A 3BI1A 4H6UA 2ZEPA 3D3SA 5CBMA 4P4FA 4LUAA 4KOSA 4P45A 3ISXA 3IU1A 1HDUA 4P10A 4KOYA 3CZXA 4XPDC 3PFEA 3EFAA 1MJBA 1XBUA 2POKA 2ZEGA 4B11A 3I1UA 4UEFA 1ELLP 4CPAA 1BOBA 2WPWA 2REFA 2KCWA 4PXDA 3RO0A 5AG7A 4ZYQA 1QSRA 3FMCA 4QBJA 4ZGYB 5I4MA 4XPDB 3JUWA 1S60A 2XEJA 2ZW7A 3D7FA 3SI2A 4A38A 1HEEA 1Z2LA 5C82A 2ZEMA 3BXMA 3SHPA 1Y7EA 4ZBGA 3HLPA 2ODFA 3PBEA 4QB9A 2B3VA 4NEXA 4P4EA 1M4DA 2IQ6A 4MCPA 1YVOA 2PJCA 2PRBA 3TX8A 4J3GA 2PR8A 3LODA 8CPAA 3RZAA 3TFYA 4NXYA 4XNHC 2EK9A 2P6GA 1V0CA 4B12A 4B13A 4A30A 2B5GA 2AFUA 4F9UA 1BAVA 1QSOA 3DNSA 4KZTA 2CIJA 2QJ8A 4IF5A 1ELMP 1LAMA 2AJ6A 3IC1A 3IIBA 3T9YA 4C7HA 3TO9A 3E0KA 3MGDA 3W6XA 1IY7A 3D4UA 4FD4A 4XNHB 1TKJA 3F0AA 2PJ7A 2CF4A 2YNCC 3N7ZA 2B4BA 3PZJA 4PXEA 2ZEOA 4UCNA 3PB4X 1NSLA 3SJGA 2J9AA 5JPHA 1Z8TA 4RS2A 2H5MA 1XE4A 1XOVA 4MHNA 4OIWA 2D4OA 3TT2A 4R3KA 1Q2CA 4EWTA 1XJOA 4OC4A 2C6CA 3DDDA 4KS9A 2GLJA 5CNPA 4A94A 3QNVA 1VGYA 1ON0A 3FIXA 1ZG8A 1M4GA 3D66A 1CG2A 2VBQA 2FT0A 2FCKA 2VXKA 3IFEA 4NJQA 1B6BA 1CBXA 1HDQA 2CNMA 4UIBA 4YRHA 1YVKA 3R9GA 1QSMA 4CGLA 2AFXA 4MCSA 2ZW5A 1J4JA 3B3TA 3H8EA 3R9EA 3TCVA 3FBUA 1L0CA 1LCPA 3IWEA 4EVYA 3TC8A 4LQGA 2B4DA 4WJBA 2B5GB 2DEAA 4XPLA 4C68A 1VHSA 4UF4A 3DLJA 5H84A 2QMLA 1XF8A 3KHXA 3UY5A 3LWUA 3KASA 4KSFA 2Q0YA 4ONWA 1M1DA 2BCOA 3F8KA 4FD5A 4CAWA 1F2PA 2ZEEA 4UIAA 1QQ9A 1LANA 5EC4A 2C1CA 4CYPA 2IL4A 5G20A 1R57A 5DWMA 4F0XA 4UWJA 2ZEDA 4MJ8A 1KUYA 2G9DA 2IJZA 1IU8A 2EO8A 4JXQA 4MCRA 4UWIA 2Z3OA 1TXRA 1TKFA 2F8HA 1IYLA 1S7KA 2O28A 2HQYA 1BO4A 2Q4YA 4M6IA 1OZPA 2WUUA 4UFWA 4PPZA 1LFWA 5IX3A 4A95A 1XIXA 3D8PA 4GM5A 4G1PA 4AG7A 3LD2A 2A4NA 3RNZA 1LAPA 3NFZA 3EO4A 4LQ6A 5IB9A 4ORFA 1F57A 2JDCA 4HNYB 4NJRA 3KR5A 5ISVA 2B4DB 2Z3NA 4X3RA 5KTDA 1X12A 4A37A 4MFKA 2ATRA 2ZEFA 4HNWB 4MFZA 1S7FA 4KLWA 1QSTA 1IOFA 4B10A 4JYWA 2RFHA 5CPAA 4U5YA 1FT7A 3S6GA 1S3ZA 4CYOA 5I0CA 4CGOA 3WABA 1RO5A 4JD6A 4B14A 1YQEA 2O53A 2ZELA 5K8OA 3FEEA 5ELYA 2JBJA 4AB7A 4KVXA 1Y7RA 3BLNA 4NGRA 4ONUA 1YW4A 1QMUA 3C26A 2VL1A 4ZY0A 1BPNA 1S7NA 1Z8XA 1U6MA 1IIDA 2BL1A 5C88A 2VEZA 3CPXA 5A27A 3NE7A 4X2TA 4BBHA 2G3AA 5AG6A 2EK8A 2VZYA 3SJEA 4QUSA 1MK4A 1XEBA 2GE3A 5A28A 1YSJA 1A2ZA 4UCMA 2PJ2A 4LX9A 4YU9A 3KR4A 4NSQA 3B3WA 4YGOA 2PCUA 4CGNA 2PIYA 1ARMA 4BINA 3PP9A 3FVLA 2V8GA 4Q38A 2Z3KA 2AE6A 4PV6A 4Q7AA 5EMIA 2BEIA 2VQYA 2YNDA 3IJ3A 3N5FA 4OKOA 5HVGA 5JQ4A 2REEA 1Z4RA 2PC1A 3MN8A 4IUSA 4PK3A 4CRYB 2YNCA 3ISZA 3FH4A 3GY9A 1TF8A 3KZWA 4MHZA 3L2NA 4JZ0A 5K8MA 1YMEA 3R96A 1CM0A 1F2OA 3B3VA 3JTKA 4X8IA 4EMEA 3KHZA 1CPSA 3IGRA 4M6GA 3W91A 3FRMA 1OBRA 3JVNA 1VIXA 3B35A 4PXBA 2GIVA 4R76A 3T8WA 1Z5RA 2EUIA 1YLEA 2FIAA 4NF1A 4WWVA 2F7VA 4F8ZA 4A32A 2Q4ZA 1AMPA 5LYDA 3LACA 3VATA 1RXTA 2G0BA 4OAEA 1VHEA 4K30A 4KOXA 4PXCA 3S6FA 3CDXA 2ZW4A 3F5BA 2ZENA 2J8NA 4YWYA 4MI4A 3EC4A 3KQZA 2OZHA 1S7LA 3IWGA 4NCZA 1XRYA 3IEHA 1ZG7A 4DJLA 5H86A 1FNOA 1UWYA 2OOTA 4ZX8A 3D7GA 3WC6A 3B7IA 4XPKA 1KUXA 1P4NA 4MFJA 4Y49C 3R9FA 1CPXA 2WPXA 4KOUA 4CRZB 3PBBA 3CXSA 1YK3A 3B3CA 4MCQA 4QC6A 4F0YA 3WC5A 5JM6A 2YGWA 3EXNA 4OP4A 2OZUA 1S5KA 2AFZA 4FAIA 2Z3MA 3RYOA 1PUAA 2Z11A 1CX8A 3D2MA 1H8LA 5HH1A 1JQGA 1N71A 2JEVA 3GIUA 1M4LA 4GXHA 4JWPA 1IICA 2EWBA 1CP6A 4R8FA 4OADA 5LYFA 4Q36A 1UFHA 4L8AA 1I1DA 5D8NA 4Z65A 3D7HA 2K5TA 2ARHA 2R98A 4AG9A 1LRZA 2WZNA 3PGPA 4MMOA 4NGTA 2ANPA 4OC1A 3V38A 2Q7SA 3D68A 4C2YA 1KUVA 3H8FA 4ZI6A 2PJ1A 3TTHA 4UEZA 3I9SA 2QYVA 2VZZA 2BUEA 1Z9UA 3BHXA 4KVOE 4MHYA 2PRQA 3B8GA 1Z8WA 5F09A 4CAXA 4FUUA 2Q44A 2AFWA 5FVJA 4RI1A 1YREA 2B58A 1K4JA 2PJ5A 5IV0A 4R57A 1M4IA 2HUZA 4CS0B 4KLVA 4CYQA 4NGNA 3R95A 4FWUA 3A9LA 2CTCA 2NSMA 4IHMA 4TWEA 1Y9KA 1FY7A 5KTCA 3HUVA 2DPSA 3H4QA 2RB7A 2OU2A 3NA6A 4P4DA 3ZZIA 2JEWA 2DF5A 1TIQA 1TF9A 3K2KA 4PQAA 1AUGA 1PYTB 5IB0A 2AFSA 3SI0A 1ZLIA 2Z0ZA 3NH5A 1TKHA 2D4PA 3PB7X 2OB0A 4OC3A 4CGPA 2PJ9A 1QSNA 1P0HA 2ZEHA 2FL4A 2PJ8A 3BJ7A 2Z10A 1I12A 2JLMA 2PQ8A 2IMOA 2Z3PA 4P4IA 4E2AA 3NH4A 2Q43A 4E8OA 3B2YA 5JH9A 3GKRA 5K8PA 5LRKA 2P6EA 2PE3A 3D67A 1XMTA 5F49A 5J1QA 2V8VA 3FF3A 3SXNA 2DXQA 2R8VA 4I49A 5THWA 4EFDA 2ZOGA 2FXFA 2GFQA 2XEIA 3KGQA 1VKCA 5LRGA 4P4JA 4FBEA 4MY3A 4RN7A 5G1ZA 3S9NA 3OWCA 2I00A 4HPSA 3BI0A 1ZO0A 4KORA 3GB0A 3PB6X 1XFOA 2CNSA 3KQXA 2CXAA 3PEIA 3FEDA 4UA3A 2EBJA 3FYNA 4DUKA 4RUHA 2CNTA 3R1KA 3DR6A 2ABZA 4O23A 4MY0A 2PJ4A 2FVGA 2V8DA 2PSWA 3SJXA 2C27A 5GCNA 3FNCA 2I3CA 3GYAA 3DGVA 1IOIA 1Q7LA 4H2KA
chains in the Genus database with same CATH topology
4DNCA 3W6SA 3CXQA 2R1IA 5AG5A 4H89A 4B5PB 4CAEA 2FIWA 2WSAA 4AVCA 2GANA 1KZFA 4KUBA 2G3TA 4QVTA 3P2FA 4OLLA 3TOAA 1WWZA 2YNEA 4M3SA 3D2PA 3KKWA 2I79A 3P2HA 2Z3LA 5F47A 2PR1A 2F5IA 2FSRA 4R87A 2P0WA 3FXTA 3S6KA 2J8RA 1NMTA 5DWNA 4U9ZA 1PU9A 4FD7A 5J8FA 2Q7BA 1M44A 2FE7A 4H6ZA 2NMTA 3T90A 2HV2A 1Z4EA 3EY5A 4L89A 5AGEA 4KUAA 4MFLA 2RC4A 2CY2A 5J8CA 1WK4A 4C2XA 4C2ZA 3QB8A 4UFVA 2OH1A 2R7HA 3BJ8A 4GS4A 1YR0A 1MJ9A 4Y49B 4CAVA 3TO6A 2Q4VA 2X7BA 2ZPAA 4UBRA 4JXRA 4PK2A 2VI7A 5G21A 3S6HA 5KTAA 2EVNA 4R9MA 4MFPA 2OZGA 3QAHA 3ZJ0A 1IB1E 4PSXA 4KOWA 2DPTA 4KOTA 4X5KA 4C7IA 1YGHA 4KSAA 3SXOA 4MBUA 4U9YA 1IYKA 3VWDA 4KOVA 4A31A 2ZW6A 1YX0A 3TOBA 2JDDA 1Y9WA 3H5ZA 4FD6A 2QIRA 2ZXVA 4HNXB 4MHDA 5EBVA 4JLYA 4JJXA 3DR8A 2Q04A 2QECA 3IU2A 1CJWA 3G3SA 5AG4A 5F46A 2Y0MA 3CXPA 4E0AA 2FS5A 4M85A 4B5OA 5E96A 1MJAA 5G22A 3K9UA 4B5PA 3I3GA 4CGMA 1B87A 2BSWA 3G8WA 3VWEA 3TO7A 4BMHA 2PDOA 5HMNA 3TE4A 2B3UA 4PSWA 4UFXA 1I21A 1Q2YA 3WR7A 1GHEA 4KVME 4AVAA 4II9A 4F6AA 4HKFA 2J8MA 3V8IA 5F48A 4A33A 4CYNA 4R3LA 4A2ZA 1Q2DA 4CAFA 3FB3A 3DSBA 4MFQA 4UCPA 4YFJA 4AVBA 2P6FA 5BWAB 1SQHA 1NE9A 4H6UA 3D3SA 4LUAA 4KOSA 3IU1A 4KOYA 4XPDC 3EFAA 1MJBA 4B11A 1BOBA 2WPWA 2REFA 2KCWA 5AG7A 1QSRA 4QBJA 4ZGYB 4XPDB 3JUWA 1S60A 2ZW7A 5C82A 3SHPA 4ZBGA 4QB9A 2B3VA 4NEXA 1M4DA 1YVOA 2PRBA 4J3GA 2PR8A 3LODA 3TFYA 4NXYA 4XNHC 2P6GA 1V0CA 4B12A 4B13A 4A30A 2B5GA 1QSOA 3DNSA 4KZTA 4IF5A 2AJ6A 3T9YA 4C7HA 3TO9A 3E0KA 3MGDA 3W6XA 4FD4A 4XNHB 3F0AA 3PZJA 2YNCC 3N7ZA 2B4BA 4UCNA 5JPHA 4RS2A 2H5MA 1XE4A 2D4OA 3TT2A 4R3KA 1Q2CA 3DDDA 4KS9A 5CNPA 3FIXA 1ON0A 1M4GA 2VBQA 2FT0A 2FCKA 2VXKA 1B6BA 2CNMA 4CGLA 4YRHA 3R9GA 1YVKA 1QSMA 2ZW5A 1J4JA 3R9EA 3TCVA 3FBUA 1L0CA 3IWEA 4EVYA 2B4DA 2B5GB 4C68A 4XPLA 1VHSA 5H84A 2QMLA 1XF8A 3UY5A 4KSFA 2Q0YA 1M1DA 3F8KA 4FD5A 4CAWA 5EC4A 4CYPA 2IL4A 5G20A 1R57A 5DWMA 4F0XA 4UWJA 4MJ8A 1KUYA 4JXQA 4UWIA 2Z3OA 1IYLA 1S7KA 2O28A 2HQYA 1BO4A 2Q4YA 1OZPA 2WUUA 4UFWA 5IX3A 4A95A 1XIXA 3D8PA 4AG7A 3LD2A 2A4NA 3EO4A 4ORFA 2JDCA 4HNYB 5ISVA 2B4DB 2Z3NA 5KTDA 4MFKA 2ATRA 4HNWB 4MFZA 1S7FA 4KLWA 1QSTA 4B10A 4U5YA 3S6GA 1S3ZA 4CYOA 5I0CA 4CGOA 1RO5A 4JD6A 4B14A 4AB7A 4KVXA 1Y7RA 3BLNA 4ONUA 3C26A 1S7NA 1U6MA 1IIDA 2BL1A 5C88A 2VEZA 5A27A 3NE7A 4BBHA 2G3AA 5AG6A 2VZYA 4QUSA 1MK4A 1XEBA 2GE3A 5A28A 4UCMA 4LX9A 4NSQA 4YGOA 4CGNA 3PP9A 4Q38A 2Z3KA 2AE6A 4PV6A 2BEIA 2VQYA 2YNDA 5JQ4A 2REEA 1Z4RA 2PC1A 4IUSA 4PK3A 4CRYB 2YNCA 3GY9A 3R96A 1CM0A 3JTKA 3IGRA 3W91A 3FRMA 3JVNA 2GIVA 2EUIA 1YLEA 2FIAA 4NF1A 4A32A 1RXTA 2G0BA 4OAEA 4K30A 4KOXA 3S6FA 2ZW4A 3F5BA 2J8NA 4MI4A 3EC4A 2OZHA 1S7LA 3IWGA 4NCZA 5H86A 4XPKA 1KUXA 1P4NA 4Y49C 3R9FA 2WPXA 4KOUA 4CRZB 3CXSA 1YK3A 4F0YA 4QC6A 2YGWA 3EXNA 2OZUA 1S5KA 2Z3MA 3RYOA 1PUAA 2Z11A 3D2MA 5HH1A 2JEVA 1N71A 4JWPA 1IICA 4OADA 4Q36A 1UFHA 4L8AA 1I1DA 2K5TA 2ARHA 2R98A 4AG9A 1LRZA 3PGPA 4C2YA 1KUVA 3TTHA 3I9SA 2VZZA 2BUEA 1Z9UA 4KVOE 3B8GA 4CAXA 2Q44A 5FVJA 4RI1A 1YREA 2B58A 1K4JA 5IV0A 4R57A 1M4IA 2HUZA 4CS0B 4KLVA 4CYQA 3R95A 3A9LA 1Y9KA 1FY7A 5KTCA 2DPSA 3H4QA 2OU2A 3ZZIA 1TIQA 5IB0A 2Z0ZA 2D4PA 2OB0A 4CGPA 1QSNA 1P0HA 2FL4A 3BJ7A 2Z10A 1I12A 2JLMA 2PQ8A 2Z3PA 4E2AA 4E8OA 3GKRA 2P6EA 1XMTA 5F49A 3SXNA 2DXQA 2R8VA 4I49A 2FXFA 1VKCA 4MY3A 5G1ZA 3OWCA 2I00A 1ZO0A 4KORA 2CNSA 2CXAA 4UA3A 3FYNA 2CNTA 3R1KA 3DR6A 4MY0A 2PSWA 2C27A 5GCNA 3FNCA 3GYAA 1NSLA 4MFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DNC A;  3W6S A;  3CXQ A;  2R1I A;  4B5P B;  4H89 A;  2FIW A;  4AVC A;  2GAN A;  1KZF A;  4KUB A;  2G3T A;  4QVT A;  3P2F A;  4OLL A;  3TOA A;  1WWZ A;  4M3S A;  3D2P A;  3KKW A;  2I79 A;  3P2H A;  5F47 A;  2PR1 A;  2F5I A;  2FSR A;  4R87 A;  2P0W A;  3FXT A;  3S6K A;  2J8R A;  1NMT A;  5DWN A;  4U9Z A;  1PU9 A;  4FD7 A;  5J8F A;  2Q7B A;  1M44 A;  2FE7 A;  4H6Z A;  2NMT A;  3T90 A;  2HV2 A;  1Z4E A;  3EY5 A;  4L89 A;  4KUA A;  2RC4 A;  2CY2 A;  5J8C A;  1WK4 A;  3QB8 A;  2OH1 A;  2R7H A;  3BJ8 A;  4GS4 A;  1YR0 A;  1MJ9 A;  4Y49 B;  4CAV A;  3TO6 A;  2Q4V A;  2X7B A;  2ZPA A;  4UBR A;  4JXR A;  4PK2 A;  2VI7 A;  3S6H A;  5KTA A;  2EVN A;  4R9M A;  2OZG A;  3QAH A;  3ZJ0 A;  1IB1 E;  4PSX A;  4KOW A;  4KOT A;  4X5K A;  1YGH A;  3SXO A;  4MBU A;  4U9Y A;  1IYK A;  3VWD A;  4KOV A;  2ZW6 A;  1YX0 A;  3TOB A;  2JDD A;  1Y9W A;  4FD6 A;  2QIR A;  2ZXV A;  4HNX B;  4MHD A;  5EBV A;  4JLY A;  4JJX A;  3DR8 A;  2Q04 A;  2QEC A;  1CJW A;  3G3S A;  5F46 A;  2Y0M A;  3CXP A;  4E0A A;  2FS5 A;  4M85 A;  4B5O A;  5E96 A;  1MJA A;  3K9U A;  4B5P A;  3I3G A;  1B87 A;  2BSW A;  3G8W A;  3VWE A;  3TO7 A;  4BMH A;  2PDO A;  5HMN A;  3TE4 A;  2B3U A;  4PSW A;  1I21 A;  1Q2Y A;  3WR7 A;  1GHE A;  4KVM E;  4AVA A;  4II9 A;  4F6A A;  4HKF A;  2J8M A;  3V8I A;  5F48 A;  4R3L A;  1Q2D A;  3FB3 A;  3DSB A;  4YFJ A;  4AVB A;  2P6F A;  1SQH A;  1NE9 A;  4H6U A;  3D3S A;  4LUA A;  4KOS A;  4KOY A;  4XPD C;  3EFA A;  1MJB A;  1BOB A;  2WPW A;  2REF A;  2KCW A;  1QSR A;  4QBJ A;  4XPD B;  3JUW A;  1S60 A;  2ZW7 A;  5C82 A;  3SHP A;  4ZBG A;  4QB9 A;  2B3V A;  4NEX A;  1M4D A;  1YVO A;  2PRB A;  4J3G A;  2PR8 A;  3LOD A;  3TFY A;  4NXY A;  4XNH C;  2P6G A;  1V0C A;  2B5G A;  1QSO A;  3DNS A;  4KZT A;  4IF5 A;  2AJ6 A;  3T9Y A;  3TO9 A;  3E0K A;  3MGD A;  3W6X A;  4FD4 A;  4XNH B;  3F0A A;  3PZJ A;  3N7Z A;  2B4B A;  5JPH A;  4RS2 A;  2H5M A;  1XE4 A;  2D4O A;  3TT2 A;  4R3K A;  1Q2C A;  3DDD A;  5CNP A;  3FIX A;  1ON0 A;  1M4G A;  2VBQ A;  2FT0 A;  2FCK A;  2VXK A;  1B6B A;  2CNM A;  4YRH A;  3R9G A;  1YVK A;  1QSM A;  2ZW5 A;  1J4J A;  3R9E A;  3TCV A;  3FBU A;  1L0C A;  4EVY A;  2B4D A;  2B5G B;  4XPL A;  1VHS A;  5H84 A;  2QML A;  1XF8 A;  3UY5 A;  2Q0Y A;  1M1D A;  3F8K A;  4FD5 A;  4CAW A;  5EC4 A;  2IL4 A;  1R57 A;  5DWM A;  4UWJ A;  4MJ8 A;  1KUY A;  4JXQ A;  4UWI A;  1IYL A;  1S7K A;  2O28 A;  2HQY A;  1BO4 A;  2Q4Y A;  1OZP A;  5IX3 A;  1XIX A;  3D8P A;  4AG7 A;  3LD2 A;  2A4N A;  3EO4 A;  4ORF A;  2JDC A;  4HNY B;  5ISV A;  2B4D B;  5KTD A;  2ATR A;  4HNW B;  1S7F A;  4KLW A;  1QST A;  4U5Y A;  3S6G A;  1S3Z A;  5I0C A;  1RO5 A;  4JD6 A;  4AB7 A;  4KVX A;  1Y7R A;  3BLN A;  4ONU A;  3C26 A;  1S7N A;  1U6M A;  1IID A;  2BL1 A;  5C88 A;  2VEZ A;  3NE7 A;  2G3A A;  2VZY A;  4QUS A;  1MK4 A;  1XEB A;  2GE3 A;  4LX9 A;  4NSQ A;  4YGO A;  3PP9 A;  4PV6 A;  2AE6 A;  2BEI A;  2VQY A;  5JQ4 A;  2REE A;  1Z4R A;  2PC1 A;  4IUS A;  4PK3 A;  4CRY B;  3GY9 A;  3R96 A;  1CM0 A;  3IGR A;  3W91 A;  3FRM A;  3JVN A;  2GIV A;  2EUI A;  1YLE A;  2FIA A;  4NF1 A;  1RXT A;  2G0B A;  4OAE A;  4K30 A;  4KOX A;  3S6F A;  2ZW4 A;  3F5B A;  2J8N A;  4MI4 A;  3EC4 A;  2OZH A;  1S7L A;  3IWG A;  4NCZ A;  5H86 A;  4XPK A;  1KUX A;  1P4N A;  4Y49 C;  3R9F A;  2WPX A;  4KOU A;  4CRZ B;  3CXS A;  1YK3 A;  4F0Y A;  4QC6 A;  3EXN A;  2OZU A;  1S5K A;  3RYO A;  1PUA A;  2Z11 A;  3D2M A;  5HH1 A;  2JEV A;  1N71 A;  4JWP A;  1IIC A;  4OAD A;  1UFH A;  4L8A A;  1I1D A;  2K5T A;  2ARH A;  2R98 A;  4AG9 A;  1LRZ A;  3PGP A;  1KUV A;  3TTH A;  3I9S A;  2VZZ A;  2BUE A;  1Z9U A;  4KVO E;  3B8G A;  4CAX A;  2Q44 A;  5FVJ A;  4RI1 A;  1YRE A;  2B58 A;  1K4J A;  5IV0 A;  4R57 A;  1M4I A;  2HUZ A;  4CS0 B;  4KLV A;  3R95 A;  1Y9K A;  1FY7 A;  5KTC A;  3H4Q A;  2OU2 A;  3ZZI A;  1TIQ A;  5IB0 A;  2Z0Z A;  2D4P A;  2OB0 A;  1QSN A;  1P0H A;  2FL4 A;  3BJ7 A;  2Z10 A;  1I12 A;  2JLM A;  2PQ8 A;  4E2A A;  4E8O A;  3GKR A;  2P6E A;  1XMT A;  5F49 A;  3SXN A;  2DXQ A;  2R8V A;  4I49 A;  2FXF A;  1VKC A;  4MY3 A;  3OWC A;  2I00 A;  4KOR A;  2CNS A;  4UA3 A;  3FYN A;  2CNT A;  3R1K A;  3DR6 A;  4MY0 A;  2PSW A;  2C27 A;  5GCN A;  3FNC A;  3GYA A;  1NSL A; 
#chains in the Genus database with same CATH topology
 4UEE A;  4DNC A;  3W6S A;  3CXQ A;  3PB9 X;  3RAM A;  2XEG A;  2R1I A;  5AG5 A;  4H89 A;  2GU2 A;  4B5P B;  3JRU A;  4CAE A;  2PJ0 A;  2C6P A;  2FIW A;  3RBU A;  2WSA A;  4AVC A;  2JBK A;  2GAN A;  1JWQ A;  3S9L A;  1KZF A;  2PJ3 A;  2G3T A;  1BPM A;  4KUB A;  4QVT A;  3VAR A;  3P2F A;  4OLL A;  3TOA A;  1WWZ A;  2YNE A;  2OR4 A;  4M3S A;  3QAY A;  3D2P A;  3NE8 A;  3KKW A;  2I79 A;  2Z3L A;  3P2H A;  5F47 A;  2PR1 A;  2F5I A;  2FSR A;  4R87 A;  2P0W A;  2AFO A;  3FX6 A;  1LOK A;  2NYQ A;  3FXT A;  1Z8L A;  3S6K A;  4OC5 A;  2J8R A;  1NMT A;  1EE3 P;  3V7Z A;  4OME A;  3K9T A;  5DWN A;  4U9Z A;  1PU9 A;  4FD7 A;  3NH8 A;  5J8F A;  2Q7B A;  4NGP A;  1M44 A;  5LRJ A;  2PIZ A;  3GUX A;  4NGQ A;  4NGS A;  4OC2 A;  2FE7 A;  2PJB A;  4H6Z A;  4K3N A;  4M6H A;  2NMT A;  4MRI A;  3T90 A;  3FJU A;  2BOA A;  2C6G A;  2HV2 A;  1Z4E A;  3EY5 A;  4L89 A;  5AGE A;  1ARL A;  4KUA A;  3LMS A;  2RC4 A;  2CY2 A;  4MFL A;  3SI1 A;  5J8C A;  1VHO A;  4R7M A;  1WK4 A;  4C2X A;  5LYL A;  1ZG9 A;  4C2Z A;  3QB8 A;  1YW6 A;  4UFV A;  2OH1 A;  2R7H A;  3BJ8 A;  3KI9 A;  4GS4 A;  4TNU A;  1YR0 A;  1MJ9 A;  2HB6 A;  3FEC A;  4Y49 B;  4NFR A;  3TO6 A;  4CAV A;  5HXD A;  1YLO A;  2Q4V A;  4ZY1 A;  3MRU A;  2X7B A;  2ZPA A;  4UBR A;  2PVV A;  4JXR A;  4KSI A;  1IGB A;  4PK2 A;  2V77 A;  2VI7 A;  5G21 A;  1RTQ A;  3S6H A;  5KTA A;  2EVN A;  4R9M A;  4MFP A;  2OZG A;  3B3S A;  3QAH A;  3ZJ0 A;  2QVP A;  1IB1 E;  4PSX A;  6CPA A;  4KOW A;  5D29 A;  1GYT A;  2GLF A;  5HVH A;  2DPT A;  1Y0Y A;  4DYO A;  2HC9 A;  4KOT A;  4R6T A;  4X5K A;  1DE4 C;  4C7I A;  1YGH A;  4KSA A;  3SXO A;  5BWA B;  2ZOF A;  3GLJ A;  4MBU A;  4U9Y A;  1IYK A;  3VWD A;  4KOV A;  4A31 A;  2ZW6 A;  2PJA A;  1YX0 A;  3TOB A;  3H8G A;  2JDD A;  1Y9W A;  1PCA A;  1XMB A;  3IWW A;  4F9V A;  3H5Z A;  2Q51 A;  4FD6 A;  2O4H A;  2QIR A;  4IAV A;  7CPA A;  1BLL E;  2ZXV A;  4NGM A;  4HNX B;  4MHD A;  4OC0 A;  2GRE A;  4JLY A;  4JJX A;  5EBV A;  3DR8 A;  5LYI A;  4ZY2 A;  2Q04 A;  2AFM A;  4MXU A;  2QEC A;  3IU2 A;  3PB8 X;  3IO1 A;  5K8N A;  1CJW A;  1X10 A;  4MHP A;  4BD9 A;  5JGF A;  3G3S A;  4P6Y A;  1KWM A;  5AG4 A;  3D7D A;  5F46 A;  1NSA A;  2XEF A;  1DTD A;  5DS0 A;  2Y0M A;  3PRT A;  3CXP A;  4P44 A;  4E0A A;  5HVF A;  3KL9 A;  2FS5 A;  4P4B A;  4M85 A;  4AXV A;  5E96 A;  4B5O A;  1MJA A;  5G22 A;  1AYE A;  3K9U A;  4B5P A;  4ZX9 A;  3I3G A;  4CGM A;  1B87 A;  2WYR A;  2BSW A;  3G8W A;  3VWE A;  3PFO A;  3TO7 A;  3CPA A;  4BMH A;  1CP7 A;  2CTB A;  2PDO A;  5HMN A;  1ZLH A;  3TE4 A;  2V8H A;  3WC7 A;  4IK2 A;  4B6Z A;  1Y0R A;  3VH9 A;  2B3U A;  4PSW A;  4UFX A;  1I21 A;  1Q2Y A;  3WR7 A;  1GHE A;  4KVM E;  1R3N A;  4AVA A;  4II9 A;  4F6A A;  2BO9 A;  4HKF A;  2PJ6 A;  2J8M A;  3V8I A;  4OID A;  5F48 A;  3SJF A;  4R3L A;  4A33 A;  2PVW A;  4W9Y A;  4A2Z A;  4CYN A;  1Q2D A;  3WT4 A;  4CAF A;  4A39 A;  3FB3 A;  3DSB A;  4MFQ A;  4UCP A;  3CT9 A;  4AVB A;  2P6F A;  3S9M A;  4YFJ A;  1R43 A;  1SQH A;  1NE9 A;  3BI1 A;  4H6U A;  2ZEP A;  3D3S A;  5CBM A;  4P4F A;  4LUA A;  4KOS A;  4P45 A;  3ISX A;  3IU1 A;  1HDU A;  4P10 A;  4KOY A;  3CZX A;  4XPD C;  3PFE A;  3EFA A;  1MJB A;  1XBU A;  2POK A;  2ZEG A;  4B11 A;  3I1U A;  4UEF A;  1ELL P;  4CPA A;  1BOB A;  2WPW A;  2REF A;  2KCW A;  4PXD A;  3RO0 A;  5AG7 A;  4ZYQ A;  1QSR A;  3FMC A;  4QBJ A;  4ZGY B;  5I4M A;  4XPD B;  3JUW A;  1S60 A;  2XEJ A;  2ZW7 A;  3D7F A;  3SI2 A;  4A38 A;  1HEE A;  1Z2L A;  5C82 A;  2ZEM A;  3BXM A;  3SHP A;  1Y7E A;  4ZBG A;  3HLP A;  2ODF A;  3PBE A;  4QB9 A;  2B3V A;  4NEX A;  4P4E A;  1M4D A;  2IQ6 A;  4MCP A;  1YVO A;  2PJC A;  2PRB A;  3TX8 A;  4J3G A;  2PR8 A;  3LOD A;  8CPA A;  3RZA A;  3TFY A;  4NXY A;  4XNH C;  2EK9 A;  2P6G A;  1V0C A;  4B12 A;  4B13 A;  4A30 A;  2B5G A;  2AFU A;  4F9U A;  1BAV A;  1QSO A;  3DNS A;  4KZT A;  2CIJ A;  2QJ8 A;  4IF5 A;  1ELM P;  1LAM A;  2AJ6 A;  3IC1 A;  3IIB A;  3T9Y A;  4C7H A;  3TO9 A;  3E0K A;  3MGD A;  3W6X A;  1IY7 A;  3D4U A;  4FD4 A;  4XNH B;  1TKJ A;  3F0A A;  2PJ7 A;  2CF4 A;  2YNC C;  3N7Z A;  2B4B A;  3PZJ A;  4PXE A;  2ZEO A;  4UCN A;  3PB4 X;  1NSL A;  3SJG A;  2J9A A;  5JPH A;  1Z8T A;  4RS2 A;  2H5M A;  1XE4 A;  1XOV A;  4MHN A;  4OIW A;  2D4O A;  3TT2 A;  4R3K A;  1Q2C A;  4EWT A;  1XJO A;  4OC4 A;  2C6C A;  3DDD A;  4KS9 A;  2GLJ A;  5CNP A;  4A94 A;  3QNV A;  1VGY A;  1ON0 A;  3FIX A;  1ZG8 A;  1M4G A;  3D66 A;  1CG2 A;  2VBQ A;  2FT0 A;  2FCK A;  2VXK A;  3IFE A;  4NJQ A;  1B6B A;  1CBX A;  1HDQ A;  2CNM A;  4UIB A;  4YRH A;  1YVK A;  3R9G A;  1QSM A;  4CGL A;  2AFX A;  4MCS A;  2ZW5 A;  1J4J A;  3B3T A;  3H8E A;  3R9E A;  3TCV A;  3FBU A;  1L0C A;  1LCP A;  3IWE A;  4EVY A;  3TC8 A;  4LQG A;  2B4D A;  4WJB A;  2B5G B;  2DEA A;  4XPL A;  4C68 A;  1VHS A;  4UF4 A;  3DLJ A;  5H84 A;  2QML A;  1XF8 A;  3KHX A;  3UY5 A;  3LWU A;  3KAS A;  4KSF A;  2Q0Y A;  4ONW A;  1M1D A;  2BCO A;  3F8K A;  4FD5 A;  4CAW A;  1F2P A;  2ZEE A;  4UIA A;  1QQ9 A;  1LAN A;  5EC4 A;  2C1C A;  4CYP A;  2IL4 A;  5G20 A;  1R57 A;  5DWM A;  4F0X A;  4UWJ A;  2ZED A;  4MJ8 A;  1KUY A;  2G9D A;  2IJZ A;  1IU8 A;  2EO8 A;  4JXQ A;  4MCR A;  4UWI A;  2Z3O A;  1TXR A;  1TKF A;  2F8H A;  1IYL A;  1S7K A;  2O28 A;  2HQY A;  1BO4 A;  2Q4Y A;  4M6I A;  1OZP A;  2WUU A;  4UFW A;  4PPZ A;  1LFW A;  5IX3 A;  4A95 A;  1XIX A;  3D8P A;  4GM5 A;  4G1P A;  4AG7 A;  3LD2 A;  2A4N A;  3RNZ A;  1LAP A;  3NFZ A;  3EO4 A;  4LQ6 A;  5IB9 A;  4ORF A;  1F57 A;  2JDC A;  4HNY B;  4NJR A;  3KR5 A;  5ISV A;  2B4D B;  2Z3N A;  4X3R A;  5KTD A;  1X12 A;  4A37 A;  4MFK A;  2ATR A;  2ZEF A;  4HNW B;  4MFZ A;  1S7F A;  4KLW A;  1QST A;  1IOF A;  4B10 A;  4JYW A;  2RFH A;  5CPA A;  4U5Y A;  1FT7 A;  3S6G A;  1S3Z A;  4CYO A;  5I0C A;  4CGO A;  3WAB A;  1RO5 A;  4JD6 A;  4B14 A;  1YQE A;  2O53 A;  2ZEL A;  5K8O A;  3FEE A;  5ELY A;  2JBJ A;  4AB7 A;  4KVX A;  1Y7R A;  3BLN A;  4NGR A;  4ONU A;  1YW4 A;  1QMU A;  3C26 A;  2VL1 A;  4ZY0 A;  1BPN A;  1S7N A;  1Z8X A;  1U6M A;  1IID A;  2BL1 A;  5C88 A;  2VEZ A;  3CPX A;  5A27 A;  3NE7 A;  4X2T A;  4BBH A;  2G3A A;  5AG6 A;  2EK8 A;  2VZY A;  3SJE A;  4QUS A;  1MK4 A;  1XEB A;  2GE3 A;  5A28 A;  1YSJ A;  1A2Z A;  4UCM A;  2PJ2 A;  4LX9 A;  4YU9 A;  3KR4 A;  4NSQ A;  3B3W A;  4YGO A;  2PCU A;  4CGN A;  2PIY A;  1ARM A;  4BIN A;  3PP9 A;  3FVL A;  2V8G A;  4Q38 A;  2Z3K A;  2AE6 A;  4PV6 A;  4Q7A A;  5EMI A;  2BEI A;  2VQY A;  2YND A;  3IJ3 A;  3N5F A;  4OKO A;  5HVG A;  5JQ4 A;  2REE A;  1Z4R A;  2PC1 A;  3MN8 A;  4IUS A;  4PK3 A;  4CRY B;  2YNC A;  3ISZ A;  3FH4 A;  3GY9 A;  1TF8 A;  3KZW A;  4MHZ A;  3L2N A;  4JZ0 A;  5K8M A;  1YME A;  3R96 A;  1CM0 A;  1F2O A;  3B3V A;  3JTK A;  4X8I A;  4EME A;  3KHZ A;  1CPS A;  3IGR A;  4M6G A;  3W91 A;  3FRM A;  1OBR A;  3JVN A;  1VIX A;  3B35 A;  4PXB A;  2GIV A;  4R76 A;  3T8W A;  1Z5R A;  2EUI A;  1YLE A;  2FIA A;  4NF1 A;  4WWV A;  2F7V A;  4F8Z A;  4A32 A;  2Q4Z A;  1AMP A;  5LYD A;  3LAC A;  3VAT A;  1RXT A;  2G0B A;  4OAE A;  1VHE A;  4K30 A;  4KOX A;  4PXC A;  3S6F A;  3CDX A;  2ZW4 A;  3F5B A;  2ZEN A;  2J8N A;  4YWY A;  4MI4 A;  3EC4 A;  3KQZ A;  2OZH A;  1S7L A;  3IWG A;  4NCZ A;  1XRY A;  3IEH A;  1ZG7 A;  4DJL A;  5H86 A;  1FNO A;  1UWY A;  2OOT A;  4ZX8 A;  3D7G A;  3WC6 A;  3B7I A;  4XPK A;  1KUX A;  1P4N A;  4MFJ A;  4Y49 C;  3R9F A;  1CPX A;  2WPX A;  4KOU A;  4CRZ B;  3PBB A;  3CXS A;  1YK3 A;  3B3C A;  4MCQ A;  4QC6 A;  4F0Y A;  3WC5 A;  5JM6 A;  2YGW A;  3EXN A;  4OP4 A;  2OZU A;  1S5K A;  2AFZ A;  4FAI A;  2Z3M A;  3RYO A;  1PUA A;  2Z11 A;  1CX8 A;  3D2M A;  1H8L A;  5HH1 A;  1JQG A;  1N71 A;  2JEV A;  3GIU A;  1M4L A;  4GXH A;  4JWP A;  1IIC A;  2EWB A;  1CP6 A;  4R8F A;  4OAD A;  5LYF A;  4Q36 A;  1UFH A;  4L8A A;  1I1D A;  5D8N A;  4Z65 A;  3D7H A;  2K5T A;  2ARH A;  2R98 A;  4AG9 A;  1LRZ A;  2WZN A;  3PGP A;  4MMO A;  4NGT A;  2ANP A;  4OC1 A;  3V38 A;  2Q7S A;  3D68 A;  4C2Y A;  1KUV A;  3H8F A;  4ZI6 A;  2PJ1 A;  3TTH A;  4UEZ A;  3I9S A;  2QYV A;  2VZZ A;  2BUE A;  1Z9U A;  3BHX A;  4KVO E;  4MHY A;  2PRQ A;  3B8G A;  1Z8W A;  5F09 A;  4CAX A;  4FUU A;  2Q44 A;  2AFW A;  5FVJ A;  4RI1 A;  1YRE A;  2B58 A;  1K4J A;  2PJ5 A;  5IV0 A;  4R57 A;  1M4I A;  2HUZ A;  4CS0 B;  4KLV A;  4CYQ A;  4NGN A;  3R95 A;  4FWU A;  3A9L A;  2CTC A;  2NSM A;  4IHM A;  4TWE A;  1Y9K A;  1FY7 A;  5KTC A;  3HUV A;  2DPS A;  3H4Q A;  2RB7 A;  2OU2 A;  3NA6 A;  4P4D A;  3ZZI A;  2JEW A;  2DF5 A;  1TIQ A;  1TF9 A;  3K2K A;  4PQA A;  1AUG A;  1PYT B;  5IB0 A;  2AFS A;  3SI0 A;  1ZLI A;  2Z0Z A;  3NH5 A;  1TKH A;  2D4P A;  3PB7 X;  2OB0 A;  4OC3 A;  4CGP A;  2PJ9 A;  1QSN A;  1P0H A;  2ZEH A;  2FL4 A;  2PJ8 A;  3BJ7 A;  2Z10 A;  1I12 A;  2JLM A;  2PQ8 A;  2IMO A;  2Z3P A;  4P4I A;  4E2A A;  3NH4 A;  2Q43 A;  4E8O A;  3B2Y A;  5JH9 A;  3GKR A;  5K8P A;  5LRK A;  2P6E A;  2PE3 A;  3D67 A;  1XMT A;  5F49 A;  5J1Q A;  2V8V A;  3FF3 A;  3SXN A;  2DXQ A;  2R8V A;  4I49 A;  5THW A;  4EFD A;  2ZOG A;  2FXF A;  2GFQ A;  2XEI A;  3KGQ A;  1VKC A;  5LRG A;  4P4J A;  4FBE A;  4MY3 A;  4RN7 A;  5G1Z A;  3S9N A;  3OWC A;  2I00 A;  4HPS A;  3BI0 A;  1ZO0 A;  4KOR A;  3GB0 A;  3PB6 X;  1XFO A;  2CNS A;  3KQX A;  2CXA A;  3PEI A;  3FED A;  4UA3 A;  2EBJ A;  3FYN A;  4DUK A;  4RUH A;  2CNT A;  3R1K A;  3DR6 A;  2ABZ A;  4O23 A;  4MY0 A;  2PJ4 A;  2FVG A;  2V8D A;  2PSW A;  3SJX A;  2C27 A;  5GCN A;  3FNC A;  2I3C A;  3GYA A;  3DGV A;  1IOI A;  1Q7L A;  4H2K A; 
#chains in the Genus database with same CATH homology
 4DNC A;  3W6S A;  3CXQ A;  2R1I A;  5AG5 A;  4H89 A;  4B5P B;  4CAE A;  2FIW A;  2WSA A;  4AVC A;  2GAN A;  1KZF A;  4KUB A;  2G3T A;  4QVT A;  3P2F A;  4OLL A;  3TOA A;  1WWZ A;  2YNE A;  4M3S A;  3D2P A;  3KKW A;  2I79 A;  3P2H A;  2Z3L A;  5F47 A;  2PR1 A;  2F5I A;  2FSR A;  4R87 A;  2P0W A;  3FXT A;  3S6K A;  2J8R A;  1NMT A;  5DWN A;  4U9Z A;  1PU9 A;  4FD7 A;  5J8F A;  2Q7B A;  1M44 A;  2FE7 A;  4H6Z A;  2NMT A;  3T90 A;  2HV2 A;  1Z4E A;  3EY5 A;  4L89 A;  5AGE A;  4KUA A;  4MFL A;  2RC4 A;  2CY2 A;  5J8C A;  1WK4 A;  4C2X A;  4C2Z A;  3QB8 A;  4UFV A;  2OH1 A;  2R7H A;  3BJ8 A;  4GS4 A;  1YR0 A;  1MJ9 A;  4Y49 B;  4CAV A;  3TO6 A;  2Q4V A;  2X7B A;  2ZPA A;  4UBR A;  4JXR A;  4PK2 A;  2VI7 A;  5G21 A;  3S6H A;  5KTA A;  2EVN A;  4R9M A;  4MFP A;  2OZG A;  3QAH A;  3ZJ0 A;  1IB1 E;  4PSX A;  4KOW A;  2DPT A;  4KOT A;  4X5K A;  4C7I A;  1YGH A;  4KSA A;  3SXO A;  4MBU A;  4U9Y A;  1IYK A;  3VWD A;  4KOV A;  4A31 A;  2ZW6 A;  1YX0 A;  3TOB A;  2JDD A;  1Y9W A;  3H5Z A;  4FD6 A;  2QIR A;  2ZXV A;  4HNX B;  4MHD A;  5EBV A;  4JLY A;  4JJX A;  3DR8 A;  2Q04 A;  2QEC A;  3IU2 A;  1CJW A;  3G3S A;  5AG4 A;  5F46 A;  2Y0M A;  3CXP A;  4E0A A;  2FS5 A;  4M85 A;  4B5O A;  5E96 A;  1MJA A;  5G22 A;  3K9U A;  4B5P A;  3I3G A;  4CGM A;  1B87 A;  2BSW A;  3G8W A;  3VWE A;  3TO7 A;  4BMH A;  2PDO A;  5HMN A;  3TE4 A;  2B3U A;  4PSW A;  4UFX A;  1I21 A;  1Q2Y A;  3WR7 A;  1GHE A;  4KVM E;  4AVA A;  4II9 A;  4F6A A;  4HKF A;  2J8M A;  3V8I A;  5F48 A;  4A33 A;  4CYN A;  4R3L A;  4A2Z A;  1Q2D A;  4CAF A;  3FB3 A;  3DSB A;  4MFQ A;  4UCP A;  4YFJ A;  4AVB A;  2P6F A;  5BWA B;  1SQH A;  1NE9 A;  4H6U A;  3D3S A;  4LUA A;  4KOS A;  3IU1 A;  4KOY A;  4XPD C;  3EFA A;  1MJB A;  4B11 A;  1BOB A;  2WPW A;  2REF A;  2KCW A;  5AG7 A;  1QSR A;  4QBJ A;  4ZGY B;  4XPD B;  3JUW A;  1S60 A;  2ZW7 A;  5C82 A;  3SHP A;  4ZBG A;  4QB9 A;  2B3V A;  4NEX A;  1M4D A;  1YVO A;  2PRB A;  4J3G A;  2PR8 A;  3LOD A;  3TFY A;  4NXY A;  4XNH C;  2P6G A;  1V0C A;  4B12 A;  4B13 A;  4A30 A;  2B5G A;  1QSO A;  3DNS A;  4KZT A;  4IF5 A;  2AJ6 A;  3T9Y A;  4C7H A;  3TO9 A;  3E0K A;  3MGD A;  3W6X A;  4FD4 A;  4XNH B;  3F0A A;  3PZJ A;  2YNC C;  3N7Z A;  2B4B A;  4UCN A;  5JPH A;  4RS2 A;  2H5M A;  1XE4 A;  2D4O A;  3TT2 A;  4R3K A;  1Q2C A;  3DDD A;  4KS9 A;  5CNP A;  3FIX A;  1ON0 A;  1M4G A;  2VBQ A;  2FT0 A;  2FCK A;  2VXK A;  1B6B A;  2CNM A;  4CGL A;  4YRH A;  3R9G A;  1YVK A;  1QSM A;  2ZW5 A;  1J4J A;  3R9E A;  3TCV A;  3FBU A;  1L0C A;  3IWE A;  4EVY A;  2B4D A;  2B5G B;  4C68 A;  4XPL A;  1VHS A;  5H84 A;  2QML A;  1XF8 A;  3UY5 A;  4KSF A;  2Q0Y A;  1M1D A;  3F8K A;  4FD5 A;  4CAW A;  5EC4 A;  4CYP A;  2IL4 A;  5G20 A;  1R57 A;  5DWM A;  4F0X A;  4UWJ A;  4MJ8 A;  1KUY A;  4JXQ A;  4UWI A;  2Z3O A;  1IYL A;  1S7K A;  2O28 A;  2HQY A;  1BO4 A;  2Q4Y A;  1OZP A;  2WUU A;  4UFW A;  5IX3 A;  4A95 A;  1XIX A;  3D8P A;  4AG7 A;  3LD2 A;  2A4N A;  3EO4 A;  4ORF A;  2JDC A;  4HNY B;  5ISV A;  2B4D B;  2Z3N A;  5KTD A;  4MFK A;  2ATR A;  4HNW B;  4MFZ A;  1S7F A;  4KLW A;  1QST A;  4B10 A;  4U5Y A;  3S6G A;  1S3Z A;  4CYO A;  5I0C A;  4CGO A;  1RO5 A;  4JD6 A;  4B14 A;  4AB7 A;  4KVX A;  1Y7R A;  3BLN A;  4ONU A;  3C26 A;  1S7N A;  1U6M A;  1IID A;  2BL1 A;  5C88 A;  2VEZ A;  5A27 A;  3NE7 A;  4BBH A;  2G3A A;  5AG6 A;  2VZY A;  4QUS A;  1MK4 A;  1XEB A;  2GE3 A;  5A28 A;  4UCM A;  4LX9 A;  4NSQ A;  4YGO A;  4CGN A;  3PP9 A;  4Q38 A;  2Z3K A;  2AE6 A;  4PV6 A;  2BEI A;  2VQY A;  2YND A;  5JQ4 A;  2REE A;  1Z4R A;  2PC1 A;  4IUS A;  4PK3 A;  4CRY B;  2YNC A;  3GY9 A;  3R96 A;  1CM0 A;  3JTK A;  3IGR A;  3W91 A;  3FRM A;  3JVN A;  2GIV A;  2EUI A;  1YLE A;  2FIA A;  4NF1 A;  4A32 A;  1RXT A;  2G0B A;  4OAE A;  4K30 A;  4KOX A;  3S6F A;  2ZW4 A;  3F5B A;  2J8N A;  4MI4 A;  3EC4 A;  2OZH A;  1S7L A;  3IWG A;  4NCZ A;  5H86 A;  4XPK A;  1KUX A;  1P4N A;  4Y49 C;  3R9F A;  2WPX A;  4KOU A;  4CRZ B;  3CXS A;  1YK3 A;  4F0Y A;  4QC6 A;  2YGW A;  3EXN A;  2OZU A;  1S5K A;  2Z3M A;  3RYO A;  1PUA A;  2Z11 A;  3D2M A;  5HH1 A;  2JEV A;  1N71 A;  4JWP A;  1IIC A;  4OAD A;  4Q36 A;  1UFH A;  4L8A A;  1I1D A;  2K5T A;  2ARH A;  2R98 A;  4AG9 A;  1LRZ A;  3PGP A;  4C2Y A;  1KUV A;  3TTH A;  3I9S A;  2VZZ A;  2BUE A;  1Z9U A;  4KVO E;  3B8G A;  4CAX A;  2Q44 A;  5FVJ A;  4RI1 A;  1YRE A;  2B58 A;  1K4J A;  5IV0 A;  4R57 A;  1M4I A;  2HUZ A;  4CS0 B;  4KLV A;  4CYQ A;  3R95 A;  3A9L A;  1Y9K A;  1FY7 A;  5KTC A;  2DPS A;  3H4Q A;  2OU2 A;  3ZZI A;  1TIQ A;  5IB0 A;  2Z0Z A;  2D4P A;  2OB0 A;  4CGP A;  1QSN A;  1P0H A;  2FL4 A;  3BJ7 A;  2Z10 A;  1I12 A;  2JLM A;  2PQ8 A;  2Z3P A;  4E2A A;  4E8O A;  3GKR A;  2P6E A;  1XMT A;  5F49 A;  3SXN A;  2DXQ A;  2R8V A;  4I49 A;  2FXF A;  1VKC A;  4MY3 A;  5G1Z A;  3OWC A;  2I00 A;  1ZO0 A;  4KOR A;  2CNS A;  2CXA A;  4UA3 A;  3FYN A;  2CNT A;  3R1K A;  3DR6 A;  4MY0 A;  2PSW A;  2C27 A;  5GCN A;  3FNC A;  3GYA A;  1NSL A;  4MFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...