1V0CA

Structure of aac(6')-ib in complex with kanamycin c and acetylcoa.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
179
structure length
176
Chain Sequence
DSVTLRLMTEHDLAMLYEWLNRSHIVEWWGARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEEETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFERTRSDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AAC(6')-IB
publication title Mechanistic and Structural Analysis of Aminoglycoside N-Acetyltransferase Aac(6')-Ib and its Bifunctional, Fluoroquinolone-Active Aac(6')-Ib-Cr Variant.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 49
structure length 176
sequence length 179
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2008-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13523 Acetyltransf_8 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1v0cA00
3FXTA 1FY7A 3EO4A 1CM0A 5FVJA 3TTHA 2REEA 4PSXA 2D4OA 1XIXA 3BJ8A 4X5KA 2ZW6A 5E96A 1NE9A 3LODA 2R98A 5IX3A 4QC6A 2BSWA 1KUYA 4JLYA 4KOSA 1UFHA 2Q44A 2HQYA 4ZBGA 3H4QA 4L8AA 4M85A 2Q4VA 2FT0A 3ZJ0A 3SXOA 4XPKA 4JXRA 4ORFA 1S7KA 3W6XA 4R3LA 2FIAA 3BLNA 3FYNA 2VZZA 2P0WA 3R9FA 2JEVA 1M4DA 4F0YA 3FNCA 2I00A 2GANA 4KOVA 4U9YA 2Z11A 5H84A 4H6ZA 3PZJA 4QBJA 1K4JA 4MJ8A 2ARHA 4FD4A 1KZFA 3TO9A 2X7BA 5H86A 3JUWA 4II9A 2B3VA 3TO6A 1Y9KA 4KZTA 3GYAA 4OADA 2ZW7A 2R8VA 2RC4A 1GHEA 1PU9A 2J8RA 3BJ7A 3JVNA 2Q04A 4AG7A 3D3SA 5HMNA 2JDCA 1M1DA 3F0AA 1S5KA 3TE4A 1QSMA 4R3KA 2VZYA 3EC4A 2FSRA 1VKCA 3DDDA 2Z0ZA 2AE6A 2C27A 5DWMA 5I0CA 1OZPA 3W6SA 1I21A 2B4DB 4B5PA 1S7LA 5JPHA 2OB0A 2CY2A 3N7ZA 3D8PA 2FIWA 4NXYA 2PR1A 1TIQA 1Q2DA 4U9ZA 5F47A 4IF5A 4ONUA 1IB1E 2PSWA 1YGHA 1I12A 3IGRA 1NMTA 4HNYB 3F5BA 1P0HA 2B58A 2EUIA 2CNTA 2DXQA 2GIVA 2ZW4A 4E8OA 3TO7A 5KTDA 3DR8A 3TOAA 2OU2A 3PP9A 2O28A 2P6FA 4B5PB 1IICA 2CNSA 2ZXVA 1Y7RA 4PK2A 3LD2A 1S3ZA 1M44A 4NF1A 2Y0MA 3IWGA 5DWNA 3S6KA 4U5YA 1IIDA 4KUAA 5F46A 4OLLA 1J4JA 1VHSA 3D2MA 3QAHA 4EVYA 2G3AA 3TFYA 4KVOE 2B5GA 2VXKA 4K30A 5ISVA 1MJBA 1YVKA 1Z4RA 1MJAA 2AJ6A 3S6HA 2FS5A 2HV2A 1S60A 2PQ8A 4KVXA 3DR6A 4I49A 3I9SA 1YX0A 4AVBA 4XNHB 5IV0A 2CNMA 2EVNA 1WWZA 3EXNA 4RS2A 1YREA 2ZW5A 3RYOA 5C82A 4NSQA 4MI4A 1XE4A 4MY0A 2WPXA 4KOTA 2P6EA 3KKWA 2FL4A 3EFAA 2Q7BA 2FCKA 2VI7A 5KTCA 5CNPA 3VWEA 4AVCA 1YK3A 3R9GA 4CAVA 1WK4A 4KLVA 4R57A 1Z9UA 3ZZIA 1XEBA 2BL1A 4PK3A 2I79A 4XNHC 2A4NA 2NMTA 2VBQA 1V0CA 2H5MA 4YRHA 4KOWA 4KUBA 5JQ4A 4YGOA 5HH1A 2JDDA 3TCVA 1PUAA 4KOXA 4HNXB 4UA3A 3UY5A 3CXQA 4CRYB 2QMLA 4H6UA 2ZPAA 2Q4YA 3TOBA 3FRMA 4J3GA 4XPLA 4JD6A 3GKRA 5J8CA 3DNSA 4YFJA 1RO5A 4UWJA 1NSLA 4L89A 2PDOA 4QB9A 5IB0A 3WR7A 5EC4A 1YLEA 4AB7A 4FD7A 2Z10A 5GCNA 4RI1A 1Q2YA 4DNCA 2FE7A 4LX9A 1QSOA 4M3SA 3E0KA 1S7NA 3GY9A 2ATRA 3FB3A 4JXQA 1ON0A 3NE7A 4H89A 3G3SA 4Y49B 2REFA 1BOBA 3R95A 3P2FA 2OH1A 2OZGA 3EY5A 4NEXA 3CXPA 2HUZA 4XPDB 2PC1A 3VWDA 2GE3A 2PR8A 3S6FA 3FBUA 4AG9A 2FXFA 1QSNA 1CJWA 3D2PA 1KUVA 3R96A 5EBVA 4UBRA 4MBUA 4UWIA 4GS4A 4Y49C 4KOYA 5KTAA 2OZUA 1U6MA 2B5GB 3K9UA 3F8KA 5F48A 4HNWB 2VQYA 2OZHA 4HKFA 3SHPA 1S7FA 4KORA 3V8IA 4KLWA 1R57A 3T90A 4XPDC 1QSRA 1P4NA 2B4BA 2VEZA 1XMTA 1I1DA 4MHDA 1MJ9A 3B8GA 4PV6A 2B4DA 4R87A 2J8MA 4FD6A 3G8WA 4PSWA 1BO4A 5J8FA 2QIRA 1MK4A 2J8NA 4KOUA 4CRZB 3SXNA 4E0AA 2R1IA 3R9EA 3DSBA 2F5IA 4FD5A 4JWPA 2WPWA 1LRZA 2P6GA 1M4GA 1RXTA 3P2HA 4KVME 3MGDA 1M4IA 3C26A 4CAXA 5C88A 1IYKA 2JLMA 3W91A 4MY3A 3I3GA 4E2AA 2BUEA 2IL4A 3FIXA 3QB8A 2PRBA 3T9YA 4LUAA 1N71A 2G0BA 4OAEA 2R7HA 3TT2A 3R1KA 4CAWA 2B3UA 2Q0YA 5F49A 1KUXA 1IYLA 1B6BA 1SQHA 4QVTA 4QUSA 3S6GA 2BEIA 1L0CA 1B87A 4R9MA 2D4PA 1YR0A 2KCWA 1Y9WA 3CXSA 4IUSA 4CS0B 2G3TA 4B5OA 2K5TA 3PGPA 4BMHA 4JJXA 4F6AA 1XF8A 1Z4EA 4AVAA 1Q2CA 1YVOA 1QSTA 2QECA 4NCZA 3OWCA
chains in the Genus database with same CATH superfamily
3FXTA 4P4FA 1CG2A 4MHNA 1FY7A 3EO4A 4PPZA 1CM0A 5FVJA 3TTHA 2REEA 4PSXA 4A33A 2D4OA 1VGYA 1XIXA 3B2YA 2PJ6A 2Q43A 3BJ8A 4X5KA 3BI1A 2PCUA 2ZW6A 3KQZA 5E96A 1NE9A 2F7VA 3LODA 1H8LA 4K3NA 4FWUA 2R98A 2QVPA 5IX3A 4QC6A 5K8MA 2BSWA 1CPSA 1KUYA 4JLYA 1UFHA 4KOSA 4C2XA 4MCQA 1BAVA 1Z8LA 4MFPA 2YNEA 3PBEA 2Q44A 3H8FA 2ZOFA 4A32A 1CPXA 1Y0YA 2HQYA 3B3WA 2ODFA 3H4QA 4L8AA 4ZBGA 5K8NA 4M85A 2Q51A 2WZNA 4A30A 4BD9A 4FBEA 2Q4VA 4ZY2A 4PXEA 2FT0A 3ZJ0A 3SXOA 5JH9A 1ZO0A 4XPKA 4JXRA 4ORFA 4ZI6A 1S7KA 2IJZA 3W6XA 3IEHA 1YQEA 3PB4X 3A9LA 4R3LA 2FIAA 3BLNA 4UF4A 2ZELA 4TWEA 3FYNA 4PXCA 3KGQA 2VZZA 4PXBA 3RAMA 2P0WA 5JM6A 3R9FA 2JEVA 1M4DA 4F0YA 3FNCA 2I00A 2BCOA 4WJBA 2GANA 4KOVA 4U9YA 1YLOA 4C2ZA 2Z11A 5H84A 4H6ZA 3NH4A 3PZJA 2WUUA 3CPXA 2V8DA 4CYOA 4QBJA 3HLPA 1K4JA 4MJ8A 2ARHA 2FVGA 3CT9A 4FD4A 1KZFA 4NGRA 2AFOA 2X7BA 3TO9A 2AFXA 5H86A 3JUWA 1VHOA 4II9A 2Z3OA 2B3VA 3TO6A 1Y9KA 4DJLA 2Z3PA 5K8PA 3FEEA 4B10A 4KZTA 3GYAA 4OADA 4MCRA 3MRUA 4P44A 2ZW7A 2PRQA 2R8VA 4M6HA 2RC4A 1GHEA 3SJEA 1PU9A 4P6YA 2J8RA 3IC1A 1LOKA 3BJ7A 3JVNA 3BXMA 2Q04A 4AG7A 3D66A 3SI2A 3RO0A 4NGPA 3D3SA 5HMNA 2JDCA 1M1DA 3F0AA 1S5KA 1Z5RA 5AG7A 1LANA 4ZX8A 3TE4A 3WC7A 3IWWA 4MMOA 1QSMA 4R3KA 3RZAA 2VZYA 3GLJA 1GYTA 3EC4A 2FSRA 1VKCA 2PIYA 3DDDA 4R6TA 2Z0ZA 1HEEA 2AE6A 2PE3A 2C27A 4UCPA 2YNDA 4P4JA 5G21A 2ZEFA 2BOAA 1Y7EA 2XEJA 5DWMA 4UEEA 1AYEA 5I0CA 3D7DA 1OZPA 3W6SA 3S9LA 1I21A 2IQ6A 2B4DB 4B5PA 4ZGYB 1TXRA 1S7LA 2GU2A 4OC5A 5JPHA 2CXAA 1F2OA 2GLFA 2OB0A 4MFQA 2CY2A 3N7ZA 4TNUA 3D8PA 2FIWA 4P10A 4NXYA 1TIQA 1Q2DA 2PR1A 4ONWA 3WC5A 1Z8WA 4OC4A 4U9ZA 5F47A 3S9NA 1XRYA 3D7GA 4IF5A 4HPSA 3KR4A 4ONUA 4CPAA 2PJ7A 3H8EA 1IB1E 4UFXA 2PSWA 2CF4A 3K9TA 3D67A 3LMSA 3KI9A 4EWTA 1YGHA 2PVVA 3KR5A 2EWBA 2GLJA 3SI0A 1QMUA 1I12A 3PB9X 3IGRA 4CYNA 4R8FA 1NMTA 2PIZA 4HNYB 3F5BA 3PFOA 5AGEA 4JZ0A 1YMEA 1P0HA 2B58A 2OR4A 2YNCA 3KL9A 5EMIA 2EUIA 4NFRA 4OIDA 2CNTA 2DXQA 1Z2LA 2V8VA 2GIVA 4CAEA 5LYLA 2ZW4A 2AFSA 5A27A 2ZOGA 4WWVA 4E8OA 4MFJA 4R76A 3TO7A 4NGNA 5KTDA 1TKFA 3PB6X 3DR8A 3TOAA 5HVGA 2OU2A 3PP9A 2O28A 2P6FA 5CPAA 1IICA 4B5PB 2CNSA 2ZXVA 1Y7RA 3FMCA 4PK2A 3LD2A 5LRGA 1S3ZA 4JYWA 4EMEA 1BPNA 5ELYA 4ZY1A 1FT7A 1M44A 4UCNA 4NF1A 2Y0MA 3IWGA 5DWNA 3S6KA 5LYIA 4U5YA 1XOVA 3GB0A 3FEDA 1KWMA 1HDUA 4YU9A 3KZWA 1IIDA 5D8NA 2NYQA 4KUAA 5F46A 4CYPA 1ARMA 4OLLA 1J4JA 1VHSA 2Z3KA 3D2MA 3QAHA 4EVYA 4MFLA 2G3AA 3FJUA 3IJ3A 3KQXA 1BLLE 1AUGA 3IIBA 4KVOE 3TFYA 5DS0A 4MFKA 2B5GA 1F2PA 2VXKA 4K30A 2PJ8A 1UWYA 4A38A 5ISVA 5THWA 2ZEOA 1MJBA 4A94A 1YVKA 2GFQA 1Z4RA 2O4HA 1MJAA 3CZXA 2PJ1A 2XEFA 4BBHA 2XEIA 2AJ6A 3S6HA 1M4LA 5HVHA 1IU8A 3KHZA 4MCSA 2FS5A 2HV2A 2AFWA 3RBUA 1X10A 1S60A 2PQ8A 3I1UA 4KVXA 3DR6A 2V8GA 5AG6A 5G1ZA 4A2ZA 4P45A 4I49A 2CIJA 3I9SA 1YX0A 1DTDA 4AVBA 3KASA 1JWQA 4XNHB 5IV0A 2CNMA 4C68A 3N5FA 2EVNA 2Z3LA 3B7IA 1WWZA 2PJAA 1IOFA 2DPTA 3EXNA 1DE4C 4ZY0A 4KSFA 2CTBA 4RS2A 4OC0A 1YREA 2ZW5A 3RYOA 2AFZA 5C82A 5LYDA 2C1CA 4NSQA 1TKJA 4MI4A 1XE4A 4MY0A 3VARA 2WPXA 3FVLA 5HXDA 4KOTA 2JEWA 2P6EA 3KKWA 2FL4A 3EFAA 2Z3MA 2Q7BA 3QNVA 2FCKA 1EE3P 1YSJA 4ZX9A 2DPSA 4DUKA 4UEFA 2VI7A 2PJCA 2Z3NA 3NE8A 5KTCA 5CNPA 3VWEA 4AVCA 1YK3A 3R9GA 4CAVA 1WK4A 1R3NA 3NH5A 4KLVA 4R57A 5LRKA 1Z9UA 5K8OA 3ZZIA 1XEBA 2C6GA 4B14A 1TKHA 4C2YA 2BL1A 3CPAA 4PK3A 4P4EA 2I79A 5G22A 4KSIA 4OC2A 4XNHC 8CPAA 4UEZA 4A39A 3K2KA 1LAMA 2GREA 1ARLA 3L2NA 2A4NA 2NMTA 1R43A 2VBQA 1V0CA 2H5MA 3BHXA 4Q36A 1PCAA 4YRHA 3TX8A 4KOWA 4KUBA 5JQ4A 4P4IA 3B3TA 1A2ZA 1TF8A 1YW6A 4M6IA 4YGOA 3VH9A 7CPAA 5HH1A 2JDDA 2PJ5A 4EFDA 4FAIA 3TCVA 1PUAA 1ZLIA 4KOXA 4HNXB 4UA3A 2QJ8A 3UY5A 2ZEGA 3VATA 4KS9A 4CAFA 3CXQA 4CRYB 1X12A 1Z8TA 2QMLA 4H6UA 2ZPAA 2HB6A 4P4BA 2Q4YA 3IU1A 3NFZA 3TOBA 4CGPA 3QAYA 3FRMA 4J3GA 2ANPA 4OP4A 3HUVA 4MCPA 4O23A 2QYVA 4XPLA 4JD6A 2EK8A 3GKRA 3GIUA 3DNSA 5J8CA 4LQGA 4F0XA 4IHMA 4YFJA 1RO5A 1AMPA 1HDQA 4UWJA 4KSAA 1NSLA 4L89A 3D68A 4MXUA 2PDOA 3H5ZA 4QB9A 2G9DA 4MHYA 4OMEA 5IB0A 3WR7A 1Q7LA 3PB8X 5EC4A 1YLEA 4MFZA 3B3CA 4AB7A 4CYQA 4FD7A 4LQ6A 2RB7A 1ZG8A 1RTQA 2Z10A 5GCNA 4OIWA 4RI1A 1Q2YA 1XJOA 3FF3A 4X8IA 4DNCA 2FE7A 4CGOA 1QQ9A 2JBKA 4LX9A 3ISZA 1QSOA 4M3SA 4UCMA 3BI0A 3S9MA 4M6GA 3E0KA 2IMOA 3D7HA 2PJ4A 1S7NA 3GY9A 4A95A 5A28A 1ZLHA 2ATRA 3FB3A 3FECA 3IU2A 4JXQA 3PFEA 1NSAA 5AG5A 4Q38A 1ON0A 3NE7A 1IGBA 2Q4ZA 1ZG9A 4H89A 2CTCA 3G3SA 4Y49B 2REFA 1BOBA 4BINA 2POKA 4Q7AA 3ISXA 2WSAA 2EBJA 2ZEEA 3CDXA 3JRUA 4UFVA 2YGWA 3R95A 3P2FA 4G1PA 2BO9A 2OH1A 2OZGA 3EY5A 3FH4A 4NEXA 3CXPA 5J1QA 4RUHA 2PJ3A 4PQAA 4B13A 2HUZA 4XPDB 1LAPA 1LCPA 2PC1A 5D29A 2WYRA 3VWDA 2GE3A 5CBMA 4X2TA 2PR8A 3S6FA 3FBUA 4PXDA 4AG9A 2C6CA 2VL1A 2FXFA 4A31A 1QSNA 1CJWA 4W9YA 4NJRA 3D2PA 1KUVA 3R96A 5EBVA 2ZEHA 5LRJA 3NH8A 4UBRA 4DYOA 1JQGA 4MBUA 2F8HA 4AXVA 1CX8A 3B3VA 4UWIA 3TC8A 4GS4A 4Y49C 2Q7SA 3V38A 3LWUA 1Y0RA 4KOYA 5KTAA 4YWYA 4CGMA 2OZUA 3D7FA 1U6MA 2YNCC 2B5GB 3K9UA 4RN7A 1PYTB 3F8KA 1ELMP 3MN8A 3PEIA 3T8WA 5F48A 2J9AA 4HNWB 2VQYA 4NGSA 2OZHA 4B6ZA 2ZENA 4HKFA 3SHPA 5IB9A 1S7FA 4KORA 4OC3A 3B3SA 3LACA 3NA6A 4KLWA 3V8IA 1R57A 3T90A 2PJ9A 4XPDC 2ZEMA 4UIBA 4IAVA 1QSRA 4MHPA 1P4NA 3SJFA 2B4BA 3RNZA 3DGVA 4C7HA 4P4DA 2VEZA 1XMTA 1Z8XA 1I1DA 3V7ZA 4GXHA 4MHDA 1OBRA 2EK9A 1MJ9A 4CGLA 4Z65A 3B8GA 2ZEDA 4PV6A 1XMBA 2B4DA 2OOTA 4R87A 2O53A 1BPMA 3IO1A 4R7MA 2RFHA 2J8MA 4FD6A 3G8WA 4NGTA 4PSWA 1BO4A 5J8FA 2QIRA 2JBJA 5BWAB 5I4MA 1MK4A 2J8NA 3D4UA 4KOUA 3SXNA 3WABA 4CRZB 4E0AA 2R1IA 3R9EA 3DSBA 4UIAA 4F8ZA 1VHEA 2F5IA 6CPAA 4FD5A 4JWPA 3SI1A 3FX6A 2WPWA 1LRZA 2P6GA 4NGMA 1M4GA 1RXTA 5JGFA 3P2HA 3SJXA 4KVME 2I3CA 3MGDA 1M4IA 3C26A 3JTKA 2PJBA 4B12A 1IYKA 2JLMA 3GUXA 3H8GA 3W91A 4CAXA 5C88A 4MY3A 3I3GA 4OC1A 1IY7A 5G20A 4E2AA 1FNOA 4C7IA 5LYFA 1IOIA 2BUEA 3PBBA 1XFOA 3WT4A 2V77A 4NJQA 2IL4A 1ELLP 2NSMA 3FIXA 3QB8A 2PRBA 1F57A 2DF5A 3T9YA 4LUAA 1N71A 2G0BA 4OAEA 2R7HA 2ABZA 2AFMA 2DEAA 2HC9A 2XEGA 1YW4A 4MRIA 3IWEA 3TT2A 4UFWA 5F09A 1CP6A 3R1KA 4CAWA 3B35A 2C6PA 2B3UA 4X3RA 2V8HA 4FUUA 2PJ2A 2Q0YA 4F9VA 4B11A 2PJ0A 5F49A 1IYLA 1KUXA 1B6BA 4OKOA 1SQHA 1LFWA 4H2KA 5AG4A 4QVTA 4IK2A 2PVWA 4QUSA 3S6GA 2BEIA 1L0CA 1B87A 4R9MA 2EO8A 1XBUA 2D4PA 1YR0A 3PB7X 2KCWA 1Y9WA 3KHXA 1ZG7A 1TF9A 2AFUA 1CBXA 4GM5A 4NGQA 3CXSA 2ZEPA 3WC6A 1VIXA 4IUSA 4CS0B 2G3TA 4ZYQA 3IFEA 4B5OA 4F9UA 2K5TA 3PGPA 3SJGA 4BMHA 4JJXA 1CP7A 5HVFA 4F6AA 1XF8A 4CGNA 1Z4EA 4MHZA 4AVAA 1Q2CA 1YVOA 3DLJA 1QSTA 2QECA 4NCZA 4A37A 3PRTA 3OWCA
chains in the Genus database with same CATH topology
3FXTA 1FY7A 3EO4A 1CM0A 5FVJA 3TTHA 2REEA 4PSXA 4A33A 2D4OA 1XIXA 3BJ8A 4X5KA 2ZW6A 5E96A 1NE9A 3LODA 2R98A 5IX3A 4QC6A 2BSWA 1KUYA 4JLYA 4KOSA 1UFHA 4C2XA 4MFPA 2YNEA 2Q44A 4A32A 2HQYA 4ZBGA 3H4QA 4L8AA 4M85A 4A30A 2Q4VA 2FT0A 3ZJ0A 3SXOA 1ZO0A 4XPKA 4JXRA 4ORFA 1S7KA 3W6XA 3A9LA 4R3LA 2FIAA 3BLNA 3FYNA 2VZZA 2P0WA 3R9FA 2JEVA 1M4DA 4F0YA 3FNCA 2I00A 2GANA 4KOVA 4U9YA 4C2ZA 2Z11A 5H84A 4H6ZA 3PZJA 2WUUA 4CYOA 4QBJA 1K4JA 4MJ8A 2ARHA 4FD4A 1KZFA 3TO9A 2X7BA 5H86A 3JUWA 4II9A 2Z3OA 2B3VA 3TO6A 1Y9KA 2Z3PA 4B10A 4KZTA 3GYAA 4OADA 2ZW7A 2R8VA 2RC4A 1GHEA 1PU9A 2J8RA 3BJ7A 3JVNA 2Q04A 4AG7A 3D3SA 5HMNA 2JDCA 1M1DA 3F0AA 1S5KA 5AG7A 3TE4A 1QSMA 4R3KA 2VZYA 3EC4A 2FSRA 1VKCA 3DDDA 2Z0ZA 2AE6A 4UCPA 2C27A 5G21A 2YNDA 5DWMA 5I0CA 1OZPA 3W6SA 1I21A 2B4DB 4B5PA 4ZGYB 1S7LA 5JPHA 2CXAA 4MFQA 2OB0A 2CY2A 3N7ZA 3D8PA 2FIWA 4NXYA 2PR1A 1TIQA 1Q2DA 4U9ZA 5F47A 4IF5A 4ONUA 1IB1E 4UFXA 2PSWA 1YGHA 1I12A 3IGRA 4CYNA 1NMTA 4HNYB 3F5BA 5AGEA 1P0HA 2B58A 2YNCA 2EUIA 2CNTA 2DXQA 2GIVA 4CAEA 2ZW4A 5A27A 4E8OA 4MFJA 3TO7A 5KTDA 3DR8A 3TOAA 2OU2A 3PP9A 2O28A 2P6FA 4B5PB 1IICA 2CNSA 2ZXVA 1Y7RA 4PK2A 3LD2A 1S3ZA 1M44A 4UCNA 4NF1A 2Y0MA 3IWGA 5DWNA 3S6KA 4U5YA 1IIDA 4KUAA 5F46A 4CYPA 4OLLA 1J4JA 1VHSA 2Z3KA 3D2MA 3QAHA 4EVYA 4MFLA 2G3AA 3TFYA 4KVOE 4MFKA 2B5GA 2VXKA 4K30A 5ISVA 1MJBA 1YVKA 1Z4RA 1MJAA 4BBHA 2AJ6A 3S6HA 2FS5A 2HV2A 1S60A 2PQ8A 4KVXA 4A2ZA 3DR6A 5AG6A 5G1ZA 4I49A 3I9SA 1YX0A 4AVBA 4XNHB 5IV0A 2CNMA 4C68A 2EVNA 2Z3LA 1WWZA 2DPTA 3EXNA 4KSFA 4RS2A 1YREA 2ZW5A 3RYOA 5C82A 4NSQA 4MI4A 1XE4A 4MY0A 2WPXA 4KOTA 2P6EA 3KKWA 2FL4A 3EFAA 2Z3MA 2Q7BA 2FCKA 2DPSA 2VI7A 2Z3NA 5KTCA 5CNPA 3VWEA 4AVCA 1YK3A 3R9GA 4CAVA 1WK4A 4KLVA 4R57A 1Z9UA 3ZZIA 1XEBA 4B14A 4C2YA 2BL1A 4PK3A 2I79A 5G22A 4XNHC 2A4NA 2NMTA 2VBQA 1V0CA 2H5MA 4Q36A 4YRHA 4KOWA 4KUBA 5JQ4A 4YGOA 5HH1A 2JDDA 3TCVA 1PUAA 4KOXA 4HNXB 4UA3A 3UY5A 4KS9A 4CAFA 3CXQA 4CRYB 2QMLA 4H6UA 2ZPAA 2Q4YA 3IU1A 3TOBA 4CGPA 3FRMA 4J3GA 4XPLA 4JD6A 3GKRA 5J8CA 3DNSA 4F0XA 4YFJA 1RO5A 4UWJA 4KSAA 1NSLA 4L89A 2PDOA 3H5ZA 4QB9A 5IB0A 3WR7A 5EC4A 1YLEA 4MFZA 4AB7A 4CYQA 4FD7A 2Z10A 5GCNA 4RI1A 1Q2YA 4DNCA 2FE7A 4CGOA 4LX9A 1QSOA 4M3SA 4UCMA 3E0KA 1S7NA 3GY9A 4A95A 5A28A 2ATRA 3FB3A 4JXQA 3IU2A 5AG5A 4Q38A 1ON0A 3NE7A 4H89A 3G3SA 4Y49B 2REFA 1BOBA 2WSAA 4UFVA 2YGWA 3R95A 3P2FA 2OH1A 2OZGA 3EY5A 4NEXA 3CXPA 4B13A 2HUZA 4XPDB 2PC1A 3VWDA 2GE3A 2PR8A 3S6FA 3FBUA 4AG9A 2FXFA 4A31A 1QSNA 1CJWA 3D2PA 1KUVA 3R96A 5EBVA 4UBRA 4MBUA 4UWIA 4GS4A 4Y49C 4KOYA 5KTAA 4CGMA 2OZUA 1U6MA 2YNCC 2B5GB 3K9UA 3F8KA 5F48A 4HNWB 2VQYA 2OZHA 4HKFA 3SHPA 1S7FA 4KORA 3V8IA 4KLWA 1R57A 3T90A 4XPDC 1QSRA 1P4NA 2B4BA 4C7HA 2VEZA 1XMTA 1I1DA 4MHDA 1MJ9A 4CGLA 3B8GA 4PV6A 2B4DA 4R87A 2J8MA 4FD6A 3G8WA 4PSWA 1BO4A 5J8FA 2QIRA 5BWAB 1MK4A 2J8NA 4KOUA 4CRZB 3SXNA 4E0AA 2R1IA 3R9EA 3DSBA 2F5IA 4FD5A 4JWPA 2WPWA 1LRZA 2P6GA 1M4GA 1RXTA 3P2HA 4KVME 3MGDA 1M4IA 3C26A 3JTKA 4CAXA 4B12A 1IYKA 2JLMA 5C88A 3W91A 4MY3A 3I3GA 5G20A 4E2AA 4C7IA 2BUEA 2IL4A 3FIXA 3QB8A 2PRBA 3T9YA 4LUAA 1N71A 2G0BA 4OAEA 2R7HA 3IWEA 3TT2A 4UFWA 3R1KA 4CAWA 2B3UA 2Q0YA 4B11A 5F49A 1KUXA 1IYLA 1B6BA 5AG4A 1SQHA 4QVTA 4QUSA 3S6GA 2BEIA 1L0CA 1B87A 4R9MA 2D4PA 1YR0A 2KCWA 1Y9WA 3CXSA 4IUSA 4CS0B 2G3TA 4B5OA 2K5TA 3PGPA 4BMHA 4JJXA 4F6AA 1XF8A 4CGNA 1Z4EA 4AVAA 1Q2CA 1YVOA 1QSTA 2QECA 4NCZA 3OWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FXT A;  1FY7 A;  3EO4 A;  1CM0 A;  5FVJ A;  3TTH A;  2REE A;  4PSX A;  2D4O A;  1XIX A;  3BJ8 A;  4X5K A;  2ZW6 A;  5E96 A;  1NE9 A;  3LOD A;  2R98 A;  5IX3 A;  4QC6 A;  2BSW A;  1KUY A;  4JLY A;  4KOS A;  1UFH A;  2Q44 A;  2HQY A;  4ZBG A;  3H4Q A;  4L8A A;  4M85 A;  2Q4V A;  2FT0 A;  3ZJ0 A;  3SXO A;  4XPK A;  4JXR A;  4ORF A;  1S7K A;  3W6X A;  4R3L A;  2FIA A;  3BLN A;  3FYN A;  2VZZ A;  2P0W A;  3R9F A;  2JEV A;  1M4D A;  4F0Y A;  3FNC A;  2I00 A;  2GAN A;  4KOV A;  4U9Y A;  2Z11 A;  5H84 A;  4H6Z A;  3PZJ A;  4QBJ A;  1K4J A;  4MJ8 A;  2ARH A;  4FD4 A;  1KZF A;  3TO9 A;  2X7B A;  5H86 A;  3JUW A;  4II9 A;  2B3V A;  3TO6 A;  1Y9K A;  4KZT A;  3GYA A;  4OAD A;  2ZW7 A;  2R8V A;  2RC4 A;  1GHE A;  1PU9 A;  2J8R A;  3BJ7 A;  3JVN A;  2Q04 A;  4AG7 A;  3D3S A;  5HMN A;  2JDC A;  1M1D A;  3F0A A;  1S5K A;  3TE4 A;  1QSM A;  4R3K A;  2VZY A;  3EC4 A;  2FSR A;  1VKC A;  3DDD A;  2Z0Z A;  2AE6 A;  2C27 A;  5DWM A;  5I0C A;  1OZP A;  3W6S A;  1I21 A;  2B4D B;  4B5P A;  1S7L A;  5JPH A;  2OB0 A;  2CY2 A;  3N7Z A;  3D8P A;  2FIW A;  4NXY A;  2PR1 A;  1TIQ A;  1Q2D A;  4U9Z A;  5F47 A;  4IF5 A;  4ONU A;  1IB1 E;  2PSW A;  1YGH A;  1I12 A;  3IGR A;  1NMT A;  4HNY B;  3F5B A;  1P0H A;  2B58 A;  2EUI A;  2CNT A;  2DXQ A;  2GIV A;  2ZW4 A;  4E8O A;  3TO7 A;  5KTD A;  3DR8 A;  3TOA A;  2OU2 A;  3PP9 A;  2O28 A;  2P6F A;  4B5P B;  1IIC A;  2CNS A;  2ZXV A;  1Y7R A;  4PK2 A;  3LD2 A;  1S3Z A;  1M44 A;  4NF1 A;  2Y0M A;  3IWG A;  5DWN A;  3S6K A;  4U5Y A;  1IID A;  4KUA A;  5F46 A;  4OLL A;  1J4J A;  1VHS A;  3D2M A;  3QAH A;  4EVY A;  2G3A A;  3TFY A;  4KVO E;  2B5G A;  2VXK A;  4K30 A;  5ISV A;  1MJB A;  1YVK A;  1Z4R A;  1MJA A;  2AJ6 A;  3S6H A;  2FS5 A;  2HV2 A;  1S60 A;  2PQ8 A;  4KVX A;  3DR6 A;  4I49 A;  3I9S A;  1YX0 A;  4AVB A;  4XNH B;  5IV0 A;  2CNM A;  2EVN A;  1WWZ A;  3EXN A;  4RS2 A;  1YRE A;  2ZW5 A;  3RYO A;  5C82 A;  4NSQ A;  4MI4 A;  1XE4 A;  4MY0 A;  2WPX A;  4KOT A;  2P6E A;  3KKW A;  2FL4 A;  3EFA A;  2Q7B A;  2FCK A;  2VI7 A;  5KTC A;  5CNP A;  3VWE A;  4AVC A;  1YK3 A;  3R9G A;  4CAV A;  1WK4 A;  4KLV A;  4R57 A;  1Z9U A;  3ZZI A;  1XEB A;  2BL1 A;  4PK3 A;  2I79 A;  4XNH C;  2A4N A;  2NMT A;  2VBQ A;  1V0C A;  2H5M A;  4YRH A;  4KOW A;  4KUB A;  5JQ4 A;  4YGO A;  5HH1 A;  2JDD A;  3TCV A;  1PUA A;  4KOX A;  4HNX B;  4UA3 A;  3UY5 A;  3CXQ A;  4CRY B;  2QML A;  4H6U A;  2ZPA A;  2Q4Y A;  3TOB A;  3FRM A;  4J3G A;  4XPL A;  4JD6 A;  3GKR A;  5J8C A;  3DNS A;  4YFJ A;  1RO5 A;  4UWJ A;  1NSL A;  4L89 A;  2PDO A;  4QB9 A;  5IB0 A;  3WR7 A;  5EC4 A;  1YLE A;  4AB7 A;  4FD7 A;  2Z10 A;  5GCN A;  4RI1 A;  1Q2Y A;  4DNC A;  2FE7 A;  4LX9 A;  1QSO A;  4M3S A;  3E0K A;  1S7N A;  3GY9 A;  2ATR A;  3FB3 A;  4JXQ A;  1ON0 A;  3NE7 A;  4H89 A;  3G3S A;  4Y49 B;  2REF A;  1BOB A;  3R95 A;  3P2F A;  2OH1 A;  2OZG A;  3EY5 A;  4NEX A;  3CXP A;  2HUZ A;  4XPD B;  2PC1 A;  3VWD A;  2GE3 A;  2PR8 A;  3S6F A;  3FBU A;  4AG9 A;  2FXF A;  1QSN A;  1CJW A;  3D2P A;  1KUV A;  3R96 A;  5EBV A;  4UBR A;  4MBU A;  4UWI A;  4GS4 A;  4Y49 C;  4KOY A;  5KTA A;  2OZU A;  1U6M A;  2B5G B;  3K9U A;  3F8K A;  5F48 A;  4HNW B;  2VQY A;  2OZH A;  4HKF A;  3SHP A;  1S7F A;  4KOR A;  3V8I A;  4KLW A;  1R57 A;  3T90 A;  4XPD C;  1QSR A;  1P4N A;  2B4B A;  2VEZ A;  1XMT A;  1I1D A;  4MHD A;  1MJ9 A;  3B8G A;  4PV6 A;  2B4D A;  4R87 A;  2J8M A;  4FD6 A;  3G8W A;  4PSW A;  1BO4 A;  5J8F A;  2QIR A;  1MK4 A;  2J8N A;  4KOU A;  4CRZ B;  3SXN A;  4E0A A;  2R1I A;  3R9E A;  3DSB A;  2F5I A;  4FD5 A;  4JWP A;  2WPW A;  1LRZ A;  2P6G A;  1M4G A;  1RXT A;  3P2H A;  4KVM E;  3MGD A;  1M4I A;  3C26 A;  4CAX A;  5C88 A;  1IYK A;  2JLM A;  3W91 A;  4MY3 A;  3I3G A;  4E2A A;  2BUE A;  2IL4 A;  3FIX A;  3QB8 A;  2PRB A;  3T9Y A;  4LUA A;  1N71 A;  2G0B A;  4OAE A;  2R7H A;  3TT2 A;  3R1K A;  4CAW A;  2B3U A;  2Q0Y A;  5F49 A;  1KUX A;  1IYL A;  1B6B A;  1SQH A;  4QVT A;  4QUS A;  3S6G A;  2BEI A;  1L0C A;  1B87 A;  4R9M A;  2D4P A;  1YR0 A;  2KCW A;  1Y9W A;  3CXS A;  4IUS A;  4CS0 B;  2G3T A;  4B5O A;  2K5T A;  3PGP A;  4BMH A;  4JJX A;  4F6A A;  1XF8 A;  1Z4E A;  4AVA A;  1Q2C A;  1YVO A;  1QST A;  2QEC A;  4NCZ A;  3OWC A; 
#chains in the Genus database with same CATH topology
 3FXT A;  4P4F A;  1CG2 A;  4MHN A;  1FY7 A;  3EO4 A;  4PPZ A;  1CM0 A;  5FVJ A;  3TTH A;  2REE A;  4PSX A;  4A33 A;  2D4O A;  1VGY A;  1XIX A;  3B2Y A;  2PJ6 A;  2Q43 A;  3BJ8 A;  4X5K A;  3BI1 A;  2PCU A;  2ZW6 A;  3KQZ A;  5E96 A;  1NE9 A;  2F7V A;  3LOD A;  1H8L A;  4K3N A;  4FWU A;  2R98 A;  2QVP A;  5IX3 A;  4QC6 A;  5K8M A;  2BSW A;  1CPS A;  1KUY A;  4JLY A;  1UFH A;  4KOS A;  4C2X A;  4MCQ A;  1BAV A;  1Z8L A;  4MFP A;  2YNE A;  3PBE A;  2Q44 A;  3H8F A;  2ZOF A;  4A32 A;  1CPX A;  1Y0Y A;  2HQY A;  3B3W A;  2ODF A;  3H4Q A;  4L8A A;  4ZBG A;  5K8N A;  4M85 A;  2Q51 A;  2WZN A;  4A30 A;  4BD9 A;  4FBE A;  2Q4V A;  4ZY2 A;  4PXE A;  2FT0 A;  3ZJ0 A;  3SXO A;  5JH9 A;  1ZO0 A;  4XPK A;  4JXR A;  4ORF A;  4ZI6 A;  1S7K A;  2IJZ A;  3W6X A;  3IEH A;  1YQE A;  3PB4 X;  3A9L A;  4R3L A;  2FIA A;  3BLN A;  4UF4 A;  2ZEL A;  4TWE A;  3FYN A;  4PXC A;  3KGQ A;  2VZZ A;  4PXB A;  3RAM A;  2P0W A;  5JM6 A;  3R9F A;  2JEV A;  1M4D A;  4F0Y A;  3FNC A;  2I00 A;  2BCO A;  4WJB A;  2GAN A;  4KOV A;  4U9Y A;  1YLO A;  4C2Z A;  2Z11 A;  5H84 A;  4H6Z A;  3NH4 A;  3PZJ A;  2WUU A;  3CPX A;  2V8D A;  4CYO A;  4QBJ A;  3HLP A;  1K4J A;  4MJ8 A;  2ARH A;  2FVG A;  3CT9 A;  4FD4 A;  1KZF A;  4NGR A;  2AFO A;  2X7B A;  3TO9 A;  2AFX A;  5H86 A;  3JUW A;  1VHO A;  4II9 A;  2Z3O A;  2B3V A;  3TO6 A;  1Y9K A;  4DJL A;  2Z3P A;  5K8P A;  3FEE A;  4B10 A;  4KZT A;  3GYA A;  4OAD A;  4MCR A;  3MRU A;  4P44 A;  2ZW7 A;  2PRQ A;  2R8V A;  4M6H A;  2RC4 A;  1GHE A;  3SJE A;  1PU9 A;  4P6Y A;  2J8R A;  3IC1 A;  1LOK A;  3BJ7 A;  3JVN A;  3BXM A;  2Q04 A;  4AG7 A;  3D66 A;  3SI2 A;  3RO0 A;  4NGP A;  3D3S A;  5HMN A;  2JDC A;  1M1D A;  3F0A A;  1S5K A;  1Z5R A;  5AG7 A;  1LAN A;  4ZX8 A;  3TE4 A;  3WC7 A;  3IWW A;  4MMO A;  1QSM A;  4R3K A;  3RZA A;  2VZY A;  3GLJ A;  1GYT A;  3EC4 A;  2FSR A;  1VKC A;  2PIY A;  3DDD A;  4R6T A;  2Z0Z A;  1HEE A;  2AE6 A;  2PE3 A;  2C27 A;  4UCP A;  2YND A;  4P4J A;  5G21 A;  2ZEF A;  2BOA A;  1Y7E A;  2XEJ A;  5DWM A;  4UEE A;  1AYE A;  5I0C A;  3D7D A;  1OZP A;  3W6S A;  3S9L A;  1I21 A;  2IQ6 A;  2B4D B;  4B5P A;  4ZGY B;  1TXR A;  1S7L A;  2GU2 A;  4OC5 A;  5JPH A;  2CXA A;  1F2O A;  2GLF A;  2OB0 A;  4MFQ A;  2CY2 A;  3N7Z A;  4TNU A;  3D8P A;  2FIW A;  4P10 A;  4NXY A;  1TIQ A;  1Q2D A;  2PR1 A;  4ONW A;  3WC5 A;  1Z8W A;  4OC4 A;  4U9Z A;  5F47 A;  3S9N A;  1XRY A;  3D7G A;  4IF5 A;  4HPS A;  3KR4 A;  4ONU A;  4CPA A;  2PJ7 A;  3H8E A;  1IB1 E;  4UFX A;  2PSW A;  2CF4 A;  3K9T A;  3D67 A;  3LMS A;  3KI9 A;  4EWT A;  1YGH A;  2PVV A;  3KR5 A;  2EWB A;  2GLJ A;  3SI0 A;  1QMU A;  1I12 A;  3PB9 X;  3IGR A;  4CYN A;  4R8F A;  1NMT A;  2PIZ A;  4HNY B;  3F5B A;  3PFO A;  5AGE A;  4JZ0 A;  1YME A;  1P0H A;  2B58 A;  2OR4 A;  2YNC A;  3KL9 A;  5EMI A;  2EUI A;  4NFR A;  4OID A;  2CNT A;  2DXQ A;  1Z2L A;  2V8V A;  2GIV A;  4CAE A;  5LYL A;  2ZW4 A;  2AFS A;  5A27 A;  2ZOG A;  4WWV A;  4E8O A;  4MFJ A;  4R76 A;  3TO7 A;  4NGN A;  5KTD A;  1TKF A;  3PB6 X;  3DR8 A;  3TOA A;  5HVG A;  2OU2 A;  3PP9 A;  2O28 A;  2P6F A;  5CPA A;  1IIC A;  4B5P B;  2CNS A;  2ZXV A;  1Y7R A;  3FMC A;  4PK2 A;  3LD2 A;  5LRG A;  1S3Z A;  4JYW A;  4EME A;  1BPN A;  5ELY A;  4ZY1 A;  1FT7 A;  1M44 A;  4UCN A;  4NF1 A;  2Y0M A;  3IWG A;  5DWN A;  3S6K A;  5LYI A;  4U5Y A;  1XOV A;  3GB0 A;  3FED A;  1KWM A;  1HDU A;  4YU9 A;  3KZW A;  1IID A;  5D8N A;  2NYQ A;  4KUA A;  5F46 A;  4CYP A;  1ARM A;  4OLL A;  1J4J A;  1VHS A;  2Z3K A;  3D2M A;  3QAH A;  4EVY A;  4MFL A;  2G3A A;  3FJU A;  3IJ3 A;  3KQX A;  1BLL E;  1AUG A;  3IIB A;  4KVO E;  3TFY A;  5DS0 A;  4MFK A;  2B5G A;  1F2P A;  2VXK A;  4K30 A;  2PJ8 A;  1UWY A;  4A38 A;  5ISV A;  5THW A;  2ZEO A;  1MJB A;  4A94 A;  1YVK A;  2GFQ A;  1Z4R A;  2O4H A;  1MJA A;  3CZX A;  2PJ1 A;  2XEF A;  4BBH A;  2XEI A;  2AJ6 A;  3S6H A;  1M4L A;  5HVH A;  1IU8 A;  3KHZ A;  4MCS A;  2FS5 A;  2HV2 A;  2AFW A;  3RBU A;  1X10 A;  1S60 A;  2PQ8 A;  3I1U A;  4KVX A;  3DR6 A;  2V8G A;  5AG6 A;  5G1Z A;  4A2Z A;  4P45 A;  4I49 A;  2CIJ A;  3I9S A;  1YX0 A;  1DTD A;  4AVB A;  3KAS A;  1JWQ A;  4XNH B;  5IV0 A;  2CNM A;  4C68 A;  3N5F A;  2EVN A;  2Z3L A;  3B7I A;  1WWZ A;  2PJA A;  1IOF A;  2DPT A;  3EXN A;  1DE4 C;  4ZY0 A;  4KSF A;  2CTB A;  4RS2 A;  4OC0 A;  1YRE A;  2ZW5 A;  3RYO A;  2AFZ A;  5C82 A;  5LYD A;  2C1C A;  4NSQ A;  1TKJ A;  4MI4 A;  1XE4 A;  4MY0 A;  3VAR A;  2WPX A;  3FVL A;  5HXD A;  4KOT A;  2JEW A;  2P6E A;  3KKW A;  2FL4 A;  3EFA A;  2Z3M A;  2Q7B A;  3QNV A;  2FCK A;  1EE3 P;  1YSJ A;  4ZX9 A;  2DPS A;  4DUK A;  4UEF A;  2VI7 A;  2PJC A;  2Z3N A;  3NE8 A;  5KTC A;  5CNP A;  3VWE A;  4AVC A;  1YK3 A;  3R9G A;  4CAV A;  1WK4 A;  1R3N A;  3NH5 A;  4KLV A;  4R57 A;  5LRK A;  1Z9U A;  5K8O A;  3ZZI A;  1XEB A;  2C6G A;  4B14 A;  1TKH A;  4C2Y A;  2BL1 A;  3CPA A;  4PK3 A;  4P4E A;  2I79 A;  5G22 A;  4KSI A;  4OC2 A;  4XNH C;  8CPA A;  4UEZ A;  4A39 A;  3K2K A;  1LAM A;  2GRE A;  1ARL A;  3L2N A;  2A4N A;  2NMT A;  1R43 A;  2VBQ A;  1V0C A;  2H5M A;  3BHX A;  4Q36 A;  1PCA A;  4YRH A;  3TX8 A;  4KOW A;  4KUB A;  5JQ4 A;  4P4I A;  3B3T A;  1A2Z A;  1TF8 A;  1YW6 A;  4M6I A;  4YGO A;  3VH9 A;  7CPA A;  5HH1 A;  2JDD A;  2PJ5 A;  4EFD A;  4FAI A;  3TCV A;  1PUA A;  1ZLI A;  4KOX A;  4HNX B;  4UA3 A;  2QJ8 A;  3UY5 A;  2ZEG A;  3VAT A;  4KS9 A;  4CAF A;  3CXQ A;  4CRY B;  1X12 A;  1Z8T A;  2QML A;  4H6U A;  2ZPA A;  2HB6 A;  4P4B A;  2Q4Y A;  3IU1 A;  3NFZ A;  3TOB A;  4CGP A;  3QAY A;  3FRM A;  4J3G A;  2ANP A;  4OP4 A;  3HUV A;  4MCP A;  4O23 A;  2QYV A;  4XPL A;  4JD6 A;  2EK8 A;  3GKR A;  3GIU A;  3DNS A;  5J8C A;  4LQG A;  4F0X A;  4IHM A;  4YFJ A;  1RO5 A;  1AMP A;  1HDQ A;  4UWJ A;  4KSA A;  1NSL A;  4L89 A;  3D68 A;  4MXU A;  2PDO A;  3H5Z A;  4QB9 A;  2G9D A;  4MHY A;  4OME A;  5IB0 A;  3WR7 A;  1Q7L A;  3PB8 X;  5EC4 A;  1YLE A;  4MFZ A;  3B3C A;  4AB7 A;  4CYQ A;  4FD7 A;  4LQ6 A;  2RB7 A;  1ZG8 A;  1RTQ A;  2Z10 A;  5GCN A;  4OIW A;  4RI1 A;  1Q2Y A;  1XJO A;  3FF3 A;  4X8I A;  4DNC A;  2FE7 A;  4CGO A;  1QQ9 A;  2JBK A;  4LX9 A;  3ISZ A;  1QSO A;  4M3S A;  4UCM A;  3BI0 A;  3S9M A;  4M6G A;  3E0K A;  2IMO A;  3D7H A;  2PJ4 A;  1S7N A;  3GY9 A;  4A95 A;  5A28 A;  1ZLH A;  2ATR A;  3FB3 A;  3FEC A;  3IU2 A;  4JXQ A;  3PFE A;  1NSA A;  5AG5 A;  4Q38 A;  1ON0 A;  3NE7 A;  1IGB A;  2Q4Z A;  1ZG9 A;  4H89 A;  2CTC A;  3G3S A;  4Y49 B;  2REF A;  1BOB A;  4BIN A;  2POK A;  4Q7A A;  3ISX A;  2WSA A;  2EBJ A;  2ZEE A;  3CDX A;  3JRU A;  4UFV A;  2YGW A;  3R95 A;  3P2F A;  4G1P A;  2BO9 A;  2OH1 A;  2OZG A;  3EY5 A;  3FH4 A;  4NEX A;  3CXP A;  5J1Q A;  4RUH A;  2PJ3 A;  4PQA A;  4B13 A;  2HUZ A;  4XPD B;  1LAP A;  1LCP A;  2PC1 A;  5D29 A;  2WYR A;  3VWD A;  2GE3 A;  5CBM A;  4X2T A;  2PR8 A;  3S6F A;  3FBU A;  4PXD A;  4AG9 A;  2C6C A;  2VL1 A;  2FXF A;  4A31 A;  1QSN A;  1CJW A;  4W9Y A;  4NJR A;  3D2P A;  1KUV A;  3R96 A;  5EBV A;  2ZEH A;  5LRJ A;  3NH8 A;  4UBR A;  4DYO A;  1JQG A;  4MBU A;  2F8H A;  4AXV A;  1CX8 A;  3B3V A;  4UWI A;  3TC8 A;  4GS4 A;  4Y49 C;  2Q7S A;  3V38 A;  3LWU A;  1Y0R A;  4KOY A;  5KTA A;  4YWY A;  4CGM A;  2OZU A;  3D7F A;  1U6M A;  2YNC C;  2B5G B;  3K9U A;  4RN7 A;  1PYT B;  3F8K A;  1ELM P;  3MN8 A;  3PEI A;  3T8W A;  5F48 A;  2J9A A;  4HNW B;  2VQY A;  4NGS A;  2OZH A;  4B6Z A;  2ZEN A;  4HKF A;  3SHP A;  5IB9 A;  1S7F A;  4KOR A;  4OC3 A;  3B3S A;  3LAC A;  3NA6 A;  4KLW A;  3V8I A;  1R57 A;  3T90 A;  2PJ9 A;  4XPD C;  2ZEM A;  4UIB A;  4IAV A;  1QSR A;  4MHP A;  1P4N A;  3SJF A;  2B4B A;  3RNZ A;  3DGV A;  4C7H A;  4P4D A;  2VEZ A;  1XMT A;  1Z8X A;  1I1D A;  3V7Z A;  4GXH A;  4MHD A;  1OBR A;  2EK9 A;  1MJ9 A;  4CGL A;  4Z65 A;  3B8G A;  2ZED A;  4PV6 A;  1XMB A;  2B4D A;  2OOT A;  4R87 A;  2O53 A;  1BPM A;  3IO1 A;  4R7M A;  2RFH A;  2J8M A;  4FD6 A;  3G8W A;  4NGT A;  4PSW A;  1BO4 A;  5J8F A;  2QIR A;  2JBJ A;  5BWA B;  5I4M A;  1MK4 A;  2J8N A;  3D4U A;  4KOU A;  3SXN A;  3WAB A;  4CRZ B;  4E0A A;  2R1I A;  3R9E A;  3DSB A;  4UIA A;  4F8Z A;  1VHE A;  2F5I A;  6CPA A;  4FD5 A;  4JWP A;  3SI1 A;  3FX6 A;  2WPW A;  1LRZ A;  2P6G A;  4NGM A;  1M4G A;  1RXT A;  5JGF A;  3P2H A;  3SJX A;  4KVM E;  2I3C A;  3MGD A;  1M4I A;  3C26 A;  3JTK A;  2PJB A;  4B12 A;  1IYK A;  2JLM A;  3GUX A;  3H8G A;  3W91 A;  4CAX A;  5C88 A;  4MY3 A;  3I3G A;  4OC1 A;  1IY7 A;  5G20 A;  4E2A A;  1FNO A;  4C7I A;  5LYF A;  1IOI A;  2BUE A;  3PBB A;  1XFO A;  3WT4 A;  2V77 A;  4NJQ A;  2IL4 A;  1ELL P;  2NSM A;  3FIX A;  3QB8 A;  2PRB A;  1F57 A;  2DF5 A;  3T9Y A;  4LUA A;  1N71 A;  2G0B A;  4OAE A;  2R7H A;  2ABZ A;  2AFM A;  2DEA A;  2HC9 A;  2XEG A;  1YW4 A;  4MRI A;  3IWE A;  3TT2 A;  4UFW A;  5F09 A;  1CP6 A;  3R1K A;  4CAW A;  3B35 A;  2C6P A;  2B3U A;  4X3R A;  2V8H A;  4FUU A;  2PJ2 A;  2Q0Y A;  4F9V A;  4B11 A;  2PJ0 A;  5F49 A;  1IYL A;  1KUX A;  1B6B A;  4OKO A;  1SQH A;  1LFW A;  4H2K A;  5AG4 A;  4QVT A;  4IK2 A;  2PVW A;  4QUS A;  3S6G A;  2BEI A;  1L0C A;  1B87 A;  4R9M A;  2EO8 A;  1XBU A;  2D4P A;  1YR0 A;  3PB7 X;  2KCW A;  1Y9W A;  3KHX A;  1ZG7 A;  1TF9 A;  2AFU A;  1CBX A;  4GM5 A;  4NGQ A;  3CXS A;  2ZEP A;  3WC6 A;  1VIX A;  4IUS A;  4CS0 B;  2G3T A;  4ZYQ A;  3IFE A;  4B5O A;  4F9U A;  2K5T A;  3PGP A;  3SJG A;  4BMH A;  4JJX A;  1CP7 A;  5HVF A;  4F6A A;  1XF8 A;  4CGN A;  1Z4E A;  4MHZ A;  4AVA A;  1Q2C A;  1YVO A;  3DLJ A;  1QST A;  2QEC A;  4NCZ A;  4A37 A;  3PRT A;  3OWC A; 
#chains in the Genus database with same CATH homology
 3FXT A;  1FY7 A;  3EO4 A;  1CM0 A;  5FVJ A;  3TTH A;  2REE A;  4PSX A;  4A33 A;  2D4O A;  1XIX A;  3BJ8 A;  4X5K A;  2ZW6 A;  5E96 A;  1NE9 A;  3LOD A;  2R98 A;  5IX3 A;  4QC6 A;  2BSW A;  1KUY A;  4JLY A;  4KOS A;  1UFH A;  4C2X A;  4MFP A;  2YNE A;  2Q44 A;  4A32 A;  2HQY A;  4ZBG A;  3H4Q A;  4L8A A;  4M85 A;  4A30 A;  2Q4V A;  2FT0 A;  3ZJ0 A;  3SXO A;  1ZO0 A;  4XPK A;  4JXR A;  4ORF A;  1S7K A;  3W6X A;  3A9L A;  4R3L A;  2FIA A;  3BLN A;  3FYN A;  2VZZ A;  2P0W A;  3R9F A;  2JEV A;  1M4D A;  4F0Y A;  3FNC A;  2I00 A;  2GAN A;  4KOV A;  4U9Y A;  4C2Z A;  2Z11 A;  5H84 A;  4H6Z A;  3PZJ A;  2WUU A;  4CYO A;  4QBJ A;  1K4J A;  4MJ8 A;  2ARH A;  4FD4 A;  1KZF A;  3TO9 A;  2X7B A;  5H86 A;  3JUW A;  4II9 A;  2Z3O A;  2B3V A;  3TO6 A;  1Y9K A;  2Z3P A;  4B10 A;  4KZT A;  3GYA A;  4OAD A;  2ZW7 A;  2R8V A;  2RC4 A;  1GHE A;  1PU9 A;  2J8R A;  3BJ7 A;  3JVN A;  2Q04 A;  4AG7 A;  3D3S A;  5HMN A;  2JDC A;  1M1D A;  3F0A A;  1S5K A;  5AG7 A;  3TE4 A;  1QSM A;  4R3K A;  2VZY A;  3EC4 A;  2FSR A;  1VKC A;  3DDD A;  2Z0Z A;  2AE6 A;  4UCP A;  2C27 A;  5G21 A;  2YND A;  5DWM A;  5I0C A;  1OZP A;  3W6S A;  1I21 A;  2B4D B;  4B5P A;  4ZGY B;  1S7L A;  5JPH A;  2CXA A;  4MFQ A;  2OB0 A;  2CY2 A;  3N7Z A;  3D8P A;  2FIW A;  4NXY A;  2PR1 A;  1TIQ A;  1Q2D A;  4U9Z A;  5F47 A;  4IF5 A;  4ONU A;  1IB1 E;  4UFX A;  2PSW A;  1YGH A;  1I12 A;  3IGR A;  4CYN A;  1NMT A;  4HNY B;  3F5B A;  5AGE A;  1P0H A;  2B58 A;  2YNC A;  2EUI A;  2CNT A;  2DXQ A;  2GIV A;  4CAE A;  2ZW4 A;  5A27 A;  4E8O A;  4MFJ A;  3TO7 A;  5KTD A;  3DR8 A;  3TOA A;  2OU2 A;  3PP9 A;  2O28 A;  2P6F A;  4B5P B;  1IIC A;  2CNS A;  2ZXV A;  1Y7R A;  4PK2 A;  3LD2 A;  1S3Z A;  1M44 A;  4UCN A;  4NF1 A;  2Y0M A;  3IWG A;  5DWN A;  3S6K A;  4U5Y A;  1IID A;  4KUA A;  5F46 A;  4CYP A;  4OLL A;  1J4J A;  1VHS A;  2Z3K A;  3D2M A;  3QAH A;  4EVY A;  4MFL A;  2G3A A;  3TFY A;  4KVO E;  4MFK A;  2B5G A;  2VXK A;  4K30 A;  5ISV A;  1MJB A;  1YVK A;  1Z4R A;  1MJA A;  4BBH A;  2AJ6 A;  3S6H A;  2FS5 A;  2HV2 A;  1S60 A;  2PQ8 A;  4KVX A;  4A2Z A;  3DR6 A;  5AG6 A;  5G1Z A;  4I49 A;  3I9S A;  1YX0 A;  4AVB A;  4XNH B;  5IV0 A;  2CNM A;  4C68 A;  2EVN A;  2Z3L A;  1WWZ A;  2DPT A;  3EXN A;  4KSF A;  4RS2 A;  1YRE A;  2ZW5 A;  3RYO A;  5C82 A;  4NSQ A;  4MI4 A;  1XE4 A;  4MY0 A;  2WPX A;  4KOT A;  2P6E A;  3KKW A;  2FL4 A;  3EFA A;  2Z3M A;  2Q7B A;  2FCK A;  2DPS A;  2VI7 A;  2Z3N A;  5KTC A;  5CNP A;  3VWE A;  4AVC A;  1YK3 A;  3R9G A;  4CAV A;  1WK4 A;  4KLV A;  4R57 A;  1Z9U A;  3ZZI A;  1XEB A;  4B14 A;  4C2Y A;  2BL1 A;  4PK3 A;  2I79 A;  5G22 A;  4XNH C;  2A4N A;  2NMT A;  2VBQ A;  1V0C A;  2H5M A;  4Q36 A;  4YRH A;  4KOW A;  4KUB A;  5JQ4 A;  4YGO A;  5HH1 A;  2JDD A;  3TCV A;  1PUA A;  4KOX A;  4HNX B;  4UA3 A;  3UY5 A;  4KS9 A;  4CAF A;  3CXQ A;  4CRY B;  2QML A;  4H6U A;  2ZPA A;  2Q4Y A;  3IU1 A;  3TOB A;  4CGP A;  3FRM A;  4J3G A;  4XPL A;  4JD6 A;  3GKR A;  5J8C A;  3DNS A;  4F0X A;  4YFJ A;  1RO5 A;  4UWJ A;  4KSA A;  1NSL A;  4L89 A;  2PDO A;  3H5Z A;  4QB9 A;  5IB0 A;  3WR7 A;  5EC4 A;  1YLE A;  4MFZ A;  4AB7 A;  4CYQ A;  4FD7 A;  2Z10 A;  5GCN A;  4RI1 A;  1Q2Y A;  4DNC A;  2FE7 A;  4CGO A;  4LX9 A;  1QSO A;  4M3S A;  4UCM A;  3E0K A;  1S7N A;  3GY9 A;  4A95 A;  5A28 A;  2ATR A;  3FB3 A;  4JXQ A;  3IU2 A;  5AG5 A;  4Q38 A;  1ON0 A;  3NE7 A;  4H89 A;  3G3S A;  4Y49 B;  2REF A;  1BOB A;  2WSA A;  4UFV A;  2YGW A;  3R95 A;  3P2F A;  2OH1 A;  2OZG A;  3EY5 A;  4NEX A;  3CXP A;  4B13 A;  2HUZ A;  4XPD B;  2PC1 A;  3VWD A;  2GE3 A;  2PR8 A;  3S6F A;  3FBU A;  4AG9 A;  2FXF A;  4A31 A;  1QSN A;  1CJW A;  3D2P A;  1KUV A;  3R96 A;  5EBV A;  4UBR A;  4MBU A;  4UWI A;  4GS4 A;  4Y49 C;  4KOY A;  5KTA A;  4CGM A;  2OZU A;  1U6M A;  2YNC C;  2B5G B;  3K9U A;  3F8K A;  5F48 A;  4HNW B;  2VQY A;  2OZH A;  4HKF A;  3SHP A;  1S7F A;  4KOR A;  3V8I A;  4KLW A;  1R57 A;  3T90 A;  4XPD C;  1QSR A;  1P4N A;  2B4B A;  4C7H A;  2VEZ A;  1XMT A;  1I1D A;  4MHD A;  1MJ9 A;  4CGL A;  3B8G A;  4PV6 A;  2B4D A;  4R87 A;  2J8M A;  4FD6 A;  3G8W A;  4PSW A;  1BO4 A;  5J8F A;  2QIR A;  5BWA B;  1MK4 A;  2J8N A;  4KOU A;  4CRZ B;  3SXN A;  4E0A A;  2R1I A;  3R9E A;  3DSB A;  2F5I A;  4FD5 A;  4JWP A;  2WPW A;  1LRZ A;  2P6G A;  1M4G A;  1RXT A;  3P2H A;  4KVM E;  3MGD A;  1M4I A;  3C26 A;  3JTK A;  4CAX A;  4B12 A;  1IYK A;  2JLM A;  5C88 A;  3W91 A;  4MY3 A;  3I3G A;  5G20 A;  4E2A A;  4C7I A;  2BUE A;  2IL4 A;  3FIX A;  3QB8 A;  2PRB A;  3T9Y A;  4LUA A;  1N71 A;  2G0B A;  4OAE A;  2R7H A;  3IWE A;  3TT2 A;  4UFW A;  3R1K A;  4CAW A;  2B3U A;  2Q0Y A;  4B11 A;  5F49 A;  1KUX A;  1IYL A;  1B6B A;  5AG4 A;  1SQH A;  4QVT A;  4QUS A;  3S6G A;  2BEI A;  1L0C A;  1B87 A;  4R9M A;  2D4P A;  1YR0 A;  2KCW A;  1Y9W A;  3CXS A;  4IUS A;  4CS0 B;  2G3T A;  4B5O A;  2K5T A;  3PGP A;  4BMH A;  4JJX A;  4F6A A;  1XF8 A;  4CGN A;  1Z4E A;  4AVA A;  1Q2C A;  1YVO A;  1QST A;  2QEC A;  4NCZ A;  3OWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...