1R43A

Crystal structure of beta-alanine synthase from saccharomyces kluyveri (selenomethionine substituted protein)
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
438
structure length
438
Chain Sequence
GTLNLPAAAPLSIASGRLNQTILETGSQFGGVARWGQESHEFGMRRLAGTALDGAMRDWFTNECESLGCKVKVDKIGNMFAVYPGKNGGKPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNYVPNYDVCVVVWFNEEGARFARSCTGSSVWSHDLSLEEAYGLMSVGEDKPESVYDSLKNIGYIGDTPASYKENEIDAHFELHIEQGPILEDENKAIGIVTGVQAYNWQKVTVHGVGAHAGTTPWRLRKDALLMSSKMIVAASEIAQRHNGLFTCGIIDAKPYSVNIIPGEVSFTLDFRHPSDDVLATMLKEAAAEFDRLIKINDGGALSYESETLQVSPAVNFHEVCIECVSRSAFAQFKKDQVRQIWSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPEEIENGFKVLLQAIINYDNYRVIRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Yeast beta-Alanine Synthase Shares a Structural Scaffold and Origin with Dizinc-dependent Exopeptidases
pubmed doi rcsb
source organism Lachancea kluyveri
molecule tags Hydrolase
molecule keywords beta-alanine synthase
total genus 143
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature ec 3.5.1.6: Beta-ureidopropionase.
pdb deposition date 2003-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r43A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1r43A01
4MHYA 3WT4A 3K2KA 2F8HA 1CX8A 5LYFA 3LWUA 3BXMA 2PJ3A 4JYWA 4B6ZA 1VHOA 3KR4A 2XEGA 3IIBA 5J1QA 2QJ8A 4PPZA 1ELMP 3H8GA 4PXBA 4K3NA 1AMPA 2PJ2A 2HC9A 3FJUA 2WZNA 2C6GA 3GB0A 1Y0YA 2AFZA 3NFZA 1LCPA 2OR4A 3S9NA 4R76A 1EE3P 1F2OA 2RB7A 1BPNA 1VHEA 4PXCA 2POKA 5DS0A 3KQXA 3HLPA 4NGMA 4ZY0A 3VATA 4X8IA 4P44A 4X3RA 4OC1A 2IJZA 4IHMA 4R6TA 8CPAA 2GREA 2ZOGA 1XJOA 5LYDA 4W9YA 3B7IA 4OKOA 3VARA 1Q7LA 1VIXA 3ISXA 1XBUA 4NJRA 3I1UA 3WABA 2ZEHA 1HDQA 3NH8A 3SI2A 3NH5A 3PBEA 5I4MA 3NH4A 1GYTA 3B3CA 1ARMA 3MRUA 5IB9A 4P6YA 1CG2A 1CPSA 4FAIA 1LFWA 1CBXA 2PIZA 4NFRA 2AFWA 3CDXA 2PVVA 2IQ6A 4FBEA 1YSJA 2F7VA 4NJQA 2BO9A 3RBUA 4A94A 4UIAA 2C6CA 4LQGA 3DLJA 4DJLA 5JGFA 4Z65A 1AYEA 1ZLHA 4ZX9A 4OIWA 2NSMA 3PB4X 1TXRA 3CPAA 1DE4C 2GLJA 4FWUA 4P4IA 1TKHA 1HDUA 4P10A 1CP7A 3CT9A 4A37A 3VH9A 1BPMA 4R7MA 2GLFA 2ZEMA 3B3SA 1NSAA 4MHZA 2PCUA 1PYTB 1Z5RA 1TKFA 2BCOA 1TF8A 5HVGA 2PJ5A 3LMSA 3B3VA 3JRUA 3RAMA 1FNOA 1RTQA 4PXDA 3FMCA 4GM5A 4DUKA 1ZLIA 3SI1A 4PXEA 4P4BA 4MCRA 4WWVA 4TNUA 1ELLP 1ZG7A 3V38A 2CIJA 3PB7X 3IO1A 2G9DA 3D66A 4RUHA 3MN8A 2V8DA 3D7FA 3FEDA 2PIYA 4MXUA 2ZEFA 3RZAA 2JBKA 4F8ZA 4TWEA 1IY7A 4ZI6A 3IJ3A 4F9UA 3KI9A 3TC8A 4NGQA 1QMUA 4UEFA 4OC5A 4MRIA 1JQGA 4KSIA 1FT7A 3D7HA 3QNVA 4OC3A 3HUVA 5D29A 4ZY2A 4OC4A 1LOKA 3D4UA 4IAVA 1R3NA 2PJ0A 5HXDA 2JBJA 3V7ZA 5THWA 3BI1A 1ARLA 4WJBA 3PB6X 5F09A 2DEAA 1ZG8A 3B3WA 1XFOA 2PJ8A 5HVHA 3FEEA 2ZEEA 3PEIA 2AFSA 1DTDA 4NGTA 1H8LA 3S9LA 1BLLE 2C6PA 2PJCA 4MCPA 1TF9A 4OIDA 3WC7A 2AFMA 4FUUA 5HVFA 4OC2A 2ANPA 1XRYA 4MCQA 4P4FA 3H8EA 4P45A 2QYVA 4JZ0A 5JH9A 2I3CA 1CP6A 3D7DA 3IWWA 2EWBA 2HB6A 2PJBA 3KASA 3FX6A 2V8GA 3GLJA 1R43A 5LYLA 3FVLA 5CPAA 4P4EA 3SJGA 4EWTA 4ONWA 4P4DA 5D8NA 4DYOA 3N5FA 4UIBA 4G1PA 1M4LA 4UEZA 3FF3A 1F2PA 5LYIA 2PJ1A 1KWMA 1XMBA 3T8WA 3PB8X 1VGYA 3IEHA 2PJ6A 2IMOA 1LAPA 2CTBA 1QQ9A 4MHNA 4EFDA 4NGRA 3PBBA 3SJXA 2ABZA 3TX8A 6CPAA 2EK9A 5LRKA 1UWYA 3WC5A 3BHXA 4ZX8A 2FVGA 2O4HA 1LANA 3KHXA 3KQZA 2VL1A 3L2NA 2JEWA 2PJ4A 2XEFA 5LRGA 2PJAA 2BOAA 2XEIA 5K8PA 5K8OA 1ZG9A 2C1CA 4F9VA 2Q4ZA 3CPXA 2CTCA 2NYQA 4NGPA 4A39A 4MCSA 3PFEA 3B35A 4A38A 3NA6A 2RFHA 1IGBA 4UEEA 5ELYA 2ZOFA 4AXVA 2GU2A 1LAMA 1Y7EA 3D68A 1Z8LA 3SI0A 4BD9A 5CBMA 1Z2LA 2ZENA 3SJFA 1CPXA 2PJ7A 3KZWA 4IK2A 4YWYA 2PRQA 2QVPA 2V8VA 3WC6A 2PE3A 3KR5A 4MHPA 5K8NA 4H2KA 2XEJA 1TKJA 3DGVA 4OMEA 4OC0A 5K8MA 3PB9X 2ZEPA 2AFUA 3S9MA 3FH4A 4P4JA 7CPAA 4Q7AA 1Y0RA 2AFOA 3D7GA 2O53A 2PVWA 4CPAA 3B2YA 4R8FA 4PQAA 1YMEA 2AFXA 2PJ9A 3BI0A 4ZY1A 5LRJA 3IFEA 2Q51A 3ISZA 4X2TA 4ZYQA 1PCAA 1BAVA 2V77A 3D67A 2ZEOA 3H8FA 4YU9A 3B3TA 4OP4A 3KL9A 3FECA 2OOTA 3KHZA 2ZEGA 2CF4A 4MMOA 4NGSA 2V8HA 1F57A 3GUXA 3K9TA 3KGQA 4UF4A 4NGNA 3SJEA 1YLOA 2WYRA 2ZEDA 5JM6A 2J9AA 2EK8A 1YW6A 1YW4A 1OBRA 4O23A 4EMEA 3PRTA 3IC1A 2ZELA 1HEEA 3PFOA 2Q43A
chains in the Genus database with same CATH superfamily
1HQEA 4X62F 1NKCA 1Q79A 4J9NA 1NJWA 2ZH2A 4FYYB 1WORA 2ZJPQ 2ZC3A 5B0EA 3IIBA 4JV5F 2AV5A 4F4KA 4PXBA 3CE8A 2YVSA 1TUWA 2C3YA 3GP9A 3AAWB 3VCDA 3M1VA 4RO0A 2E1AA 4OADA 4RUCA 4WIIA 4GRSA 2OELA 2OR4A 3J7YU 5CYJA 1TIQA 4PG8A 2M8DB 1HNZF 3QAYA 3VGVA 2ZH1A 3W6SA 3LGHA 4IHMA 2FJXA 4J5OA 4W9YA 2CDRB 5ETTA 2YWFA 1C0UA 2XNRA 5LMUF 5HJYA 5IXUA 3NH8A 3I3GA 3CULA 2ACYA 1T94A 2WAQD 2BXJA 4OHVA 3OSPA 4QVTA 2IDLA 1S4FA 2AF6A 2WSEC 1TL7A 4O4GA 1CG2A 2OAUA 2B7CB 5ETOA 2KXHA 2EFQA 4NJQA 4HDHA 2MGZB 3OFHA 2PDAA 5J2NA 1UVKA 4EI2A 3HKZD 2VBWA 1I12A 4DMZA 4DJLA 3JXOA 1AFIA 1I94F 1KLNA 2MQMA 1LKZA 4M5DA 9ATCB 4M5IA 5C25B 1A7GE 1RHJB 2RH3A 1FD8A 3OXFA 5A8RB 4YFUA 2CQBA 1ZTWA 2LYVA 2DYAA 4DV3F 1GNKA 1K1QA 2WB1D 1YRTA 4PR6A 3IXQA 2GLFA 4OLLA 2YQ1A 2XWXA 4KUBA 2KTQA 1GQEA 1V5IB 2B3TB 2ZBRA 3KLGB 4OLPA 1JLCA 2FGCA 5T7LB 2HIQA 2EKYA 3VALA 4ED8A 5HK4A 2A3JA 3OXLA 3CCZA 4HT5A 5IC4B 5B0FA 2AIRB 2ZEFA 4LSLB 4MY3A 2CWKA 1WKLA 3MUVP 4C2XA 1DQ8A 3CCTA 1WF1A 4NI2A 1VYAA 2B5JA 2M70A 3RU0A 2D1CA 2QFIA 4Y2CA 5C24A 3IAS9 4LR9A 4CLZA 2DIUA 3CIZA 1VQ6S 2AWZA 4F6AA 3NY0A 5D29A 3PY8A 1YGHA 4KOVA 3EE3A 2KVIA 4DF4A 4B9UA 3A4TA 1LOUA 3BI1A 2PMZD 2RU9A 3EZUA 2GVDA 4OYAA 3RB3A 1ACMB 2CDQA 2DEIA 3N9UC 2YNIB 1PSDA 3UDCA 1TL7B 4O3NA 5HMXA 1ZETA 2PJCA 3AXMA 3DOMB 4G1QB 2AFMA 4DR5F 1HMVA 4NLQA 3Q8RB 4EBDA 4EZ6A 2I2YA 3C16B 2QYVA 2DF5A 2DY9A 2EXUA 2KXFA 1F3FA 4BBHA 4H89A 3K5OA 5A8RA 1J5OB 2YKPA 1JNZB 3MCNA 3CUNA 1KQSR 2HRYA 1N5TA 5KTDA 2NQPA 5DQHA 1IKXA 2J76E 1RSCA 2R2UA 3IEHA 2JNJA 5BWAB 2WONB 3PBBA 2R8HA 3GSIA 3FUYA 4DV5F 4JXQA 3P45B 2HNYB 2V68A 3A9LA 4CM0A 5I3QA 1FKAF 1X0PA 3IBWA 2NCKL 2EBGA 1KC8T 3PFEA 4EO8A 3H98A 3TZYA 5CAAA 4OX6A 2XULA 4X4QA 3L7OA 1IGBA 1LWFA 2UUBF 1RZMA 3HD2A 3PJ9A 3QT7A 1FVQA 4RJVA 3D68A 2GANA 4LR7A 3KYLA 3MR2A 1R57A 2EC0A 1RAAB 4C3KA 5E3QA 3O2IA 1T95A 3UD5A 2R9LA 1IIDA 1GX5A 4CO1A 1NUEA 2VDHA 1NRKA 1DAXA 3K5PA 4ZCLA 1TKJA 5ETKA 1K0VA 1EZZB 1U2FA 5K8MA 3UD4P 4UQTA 4WE1B 2DHSA 2MLYA 4USWA 2O01C 2BACA 4DSJA 3ILOA 3T19A 3D7GA 3HULA 1O6XA 1I21A 3SV3A 2V0NA 3ILJA 1NDCA 2EFGA 1TU0B 3BI0A 1HMVB 4OZJA 3F0NA 5KG0A 1AA1B 4IOAQ 1EETB 3C16A 1PCAA 3NS6A 1F1BB 1T3NA 1H7XA 3BPSP 1SQGA 4B9TA 1QSSA 3IRXB 1JMTA 1UPMB 3Q8UA 2MKHA 1PKUA 3TA1A 4DR3J 1JXLA 2MLZA 3QWUA 1D9AA 4NGNA 4ED3A 3M9OB 5JM6A 2CUYA 2HBQB 5F8GA 5DLFA 4R5PA 4JI1J 3QLHB 4DCOB 2F9JA 2JL9A 2ZELA 2XSFA 1RKIA 3QIPB 3DDNA 2VFTA 3OJSA 1HEEA 4QW9A 1LNQA 2HQIA 2UUAJ 3QNWB 4NLSA 2ZJRQ 3BKUA 2KG0A 2R2SA 1V3RA 4CP5A 4MH8A 2PJ2A 4JV2A 1FJCA 2M88A 2PD1A 1NHKL 4RI1A 2MHEA 1WJ9A 3L7UA 1RBOB 1MROA 1U2RA 4PXCA 2E9TA 4IOBA 4OZ0A 2XMUA 3W7BA 3H5SA 4WYLA 4JI3J 1H72C 4L72B 3GJQB 2GMHA 1U47A 2IJZA 3OWCA 8CPAA 1FD2A 2WOMB 3TQ1A 1DARA 4IRKA 2GJIA 5IOLA 2EBJA 1HBMB 5DDPC 4FBUA 3C19A 3F41A 5ETLA 3QT8A 5KAKA 2W1BA 2DR5A 2FSRA 2DRAA 5CD4H 2ROGA 1CQNA 4A2ZA 4DR1J 3JUWA 4EU0A 4BHQA 4C3LA 3EPGA 1CJVA 3BGRA 4LF4F 3CO9A 3R9LA 4DI6A 2B5JB 3VWDA 2FTRA 1Z8TA 3JB9k 4C0OC 3MEDA 1NZ8A 3R9FA 2P6SA 4A94A 1IUJA 4DR7J 1U1PA 1P1LA 3BYPA 4DUYF 5IX3A 3BJYA 3V2UC 3KKFA 1VRUB 1OYDA 2E5JA 1N33F 4Z7CA 3G8TA 4OYOA 4P10A 2AYMA 4WK1A 2OPPB 2QA2A 3N6MA 1I1DA 5GAEU 1QLNA 3AXKA 1PGZA 2ZEMA 3D0GE 5F47A 2M3DA 4K4SA 1MLAA 4X4TA 1TL1A 3I87A 3MM5A 3I9V9 4IRCA 4N41A 4P4BA 2DPIA 3FSXA 5LOQA 4TNUA 1CM0A 3OL6A 2YKMA 1RJJA 3HMJG 4EBEA 5DZ6A 2VG5A 4ZLJA 2KI2A 3C6TA 1S7NA 2YXLA 1Y9OA 2BJ8A 2CAJA 3FBUA 3M8YA 4LRBA 1QMUA 1W2BR 3CCES 1FT7A 1HNXJ 4DR2J 2E7XA 1Q16B 1SBRA 3EZOA 2ZUAA 3K17A 3MMCB 2KDOA 4OC4A 3CJTA 1FRMA 4C68A 5F3ZA 3I56S 5H9EK 3PP9A 2FJVA 1P0HA 1R3NA 3CGIA 2DR9A 3J7Z5 1IU8A 3NOCA 5HATA 4UFXA 1RU1A 2CJXB 1BOBA 1S0NA 4ID8A 2OPQB 1BUXA 3I9ZA 2WVEA 1XBWA 1S1XA 3OUYA 1Y9KA 2Z2MA 4OC2A 2GO8A 3TW0A 3CJQA 3BH6B 1RT1A 5JPHA 2EEYA 1NPRA 2OEKA 3DMJB 4P2XA 1IBMJ 3IWWA 2MJUA 4AT1B 1LXJA 3NWRA 4TN2A 1YQHA 3I4HX 3CXCR 1HHQA 2Q66A 2C3MA 1UVIA 3GG0A 2H54B 4O0NA 3JSRA 5J1PA 1F2PA 2A10A 4WE1A 2FZGB 3OVAA 3OL8A 4DFJA 4PK3A 1NNDA 4MK9A 4NXNJ 4A47A 5E2QA 3RJMB 3KQZA 1LK7A 3HHKA 2XEIA 2YPYA 3R27A 1X31C 3TCVA 3BN7A 5T41A 3M9NB 1UJ6A 1CBKA 4QIVA 3PO4A 2B9XA 4YP3A 3T5JA 3LPYA 4DQQA 3H2UB 5ADZA 4DG1A 5D0RA 1S97A 2RFHA 3NE8A 1TL3A 2V4JA 2CQGA 2E9ZA 1WOOA 2QG9B 1XR5A 4E0AA 5J2MA 4MBUA 4IH6A 1CPXA 4A8YA 3AJ2A 3I96A 1K8AT 4XDCA 1HBNA 2DT9A 1M5OC 3KR5A 2C2NA 4D3GA 1UPPA 2X1GA 3G6ES 4TYBA 1EP4A 1OQ6A 2OGUA 2RU3A 3LAKA 1ZZFA 2JRSA 4HKFA 2F1FA 2X3DA 1FE0A 2HNYA 1NK0A 4JV0A 1NM2A 2NSBA 1QUPA 4DR6F 4CPAA 2YQ3A 4WKRA 3GKRA 2LDYA 5JVHQ 1VRTA 2I38A 1RT1B 2I6WA 3GFHA 4CGLA 4X2TA 4MKAA 2XY7A 3MM7B 4QQBA 1VQLS 2V77A 3R5DA 3MXHP 4QBJA 3LOUA 3T9NA 2ZH8A 3CJ0A 5HMYA 2BKOA 4E2AA 4RR5A 3PYGA 5J8FA 3ZZTA 2HHHJ 2DNNA 4ED0A 4RW6A 4RW8B 2B43A 4O3PA 3VGUA 4Q44A 5IT4A 3IBCB 4NOHA 2ABYA 1V6HA 2OPPA 3H90A 1Q53A 3PFOA 2YNGB 4ZMMA 3V6KA 2F8HA 1SJQA 4LF6J 5FDLA 4CNYA 3OD2A 2V6AA 4UWJA 3G6YA 1SJ4P 2DXQA 1ZA1B 2XYPB 2MZQA 1Y5NB 5J2PB 4CAWA 5LM7E 2H5MA 2V4JB 1ULRA 5GMDA 1QSRA 2Z4PA 3D1HA 2PC1A 2CQHA 4DF8A 1VHEA 4M85A 4V19X 2MY7A 2QMXA 5KTQA 2QE5A 4ZJOA 4I6YA 2G1HA 3MMJA 1Y00A 5IV0A 4K5SA 2MHNA 4F36A 2FCKA 3FMBA 3LP2B 2QA4S 1L3SA 4I4BA 3KK1B 2MQ8A 2JLGA 1O51A 2ZM6J 2BVZA 1RT4B 1HNWJ 4F25A 1QD1A 2AJFE 4LFBJ 1VQ9S 3EM1A 3B3CA 3OFGA 2QFJA 1FERA 2BE2B 4I6AA 3S01A 4JI0J 5KFHA 5CXTA 2IHR1 1NJZA 2GAGC 4TU9A 1B7YB 1L3TA 3TO7A 2HEKA 2J9DE 2YX1A 4ZVPB 4X4SA 1JLGB 4ECXA 4F4XA 3OR2A 2I8EA 4UIAA 3EJMA 3MECA 2Z0GA 2Z57B 3GIIA 5KG7A 1AYEA 5M2UA 3M6UA 3H2LA 3DDKA 2Z56B 1R27B 5BJRA 1ZPWX 1B4SA 4P4IA 4NXMF 2ILZA 2QRRA 2OPQA 4FF4A 2PCUA 5CD4A 5HL7Q 1J4JA 4UT4A 2OPRB 3ETOA 3NGKA 1CJWA 3PZJA 3RAMA 1T0TV 1IYKA 4DSIA 4PXEA 2XZTB 1JLFA 4QUSA 1NK9A 3GJRB 1NHVA 2OUGA 1ZG7A 3MPYA 1T3OA 2HURA 5GADI 5HH1A 4IR1A 3JSMB 4NEXA 3K89A 1CVJA 2XNQA 5GCNA 1VQOS 4GS4A 5A8KB 2HZCA 3C46A 1FTRA 1NZAA 1LW2B 2G2YA 5F8JA 4AL6A 5L1LA 2AE6A 5DG7A 3QNVA 2RKIA 1ZAWA 3UNGC 1BD6A 4ILLA 2YKNB 2W9BB 2LDIA 3OR1A 2YX7A 3M05A 1T9XA 2QLBB 2ZH9A 4AQYF 3FBBA 3E3XA 1QVGR 3CJKA 4UOGA 1NH7A 4OI6A 3M8QB 4ID5A 2VC1A 4M5NA 3UPFA 4F0KA 2VDIA 2OTJS 4MCPA 4I67A 3D5MA 2YKMB 4WPAA 3GV8B 3W9IA 1VRQC 2ANPA 1XRYA 4C7IA 3AOAA 3JTKA 2O3DA 2DGUA 3MECB 5HO4A 4U96A 4K8RA 3TA2A 3KASA 4WF9Q 3S7RA 1I1GA 4UZBA 1Y10A 2BABA 4RNHA 1NSKL 2P6EA 1H73A 1L5UA 3T8WA 4MK8A 1RA6A 1HR0F 2GIVA 2W7OA 1VKCA 4NGRA 1NE9A 2VBXA 4DPTA 5DGAA 4QCLA 1H2TZ 4KOTA 4ZA1A 2P5VA 1JLFB 4ZPBA 2VPZB 4A33A 1BWVA 3D0IE 2AJ2A 1U1OA 2QA4G 1VHFA 5K8PA 1GMVA 2PMHA 4L76A 2P9GA 2XLIA 4H4OA 2A6MA 4K7QA 3BF4A 1I6JA 1GTHA 3Q23A 2DPSA 3CCSS 1XNQF 3C14B 3F5BA 2R8GA 2OMLA 1U24A 1S79A 3QQCD 1IBKF 2RF2A 3IAM9 2MZSA 2G13A 1S7IA 3KZWA 1S72S 3MMBB 4YWYA 3EXCX 4YQWA 5IV4A 3PR4A 3W1YC 1VBYA 3ZTRA 1Y0HA 4NZ7A 3PRDA 1U1MA 3KDNA 2CG8A 2H3EB 3K2YA 1F5BA 5J8CA 2ZNZA 4WFZA 5AG7A 1M90T 3E8OA 5KFFA 1IR0A 5BYSA 2RQMA 4ZVUB 1F9HA 1YG0A 1P9YA 4DR7F 3PJXA 3MPWA 4Q2LA 2WW4A 1YIJS 2NSCA 1SKWA 2B4VA 1S6PA 2ACMA 1TL3B 5CA5A 2ZH4A 1D9FA 4FBTA 1R89A 1S1TB 4UUWA 2K5TA 3W2WB 2QC3A 4NGSA 1RCOB 1QSYA 3BSNA 1PIEA 2G2ZA 2ZEDA 4Q45A 3H59A 3I5BA 3LPEA 2FVSA 1N52B 2Y1IA 1ELOA 1U7LA 4UZCA 4USIA 3NRBA 2ALZA 3UR3C 1NAQA 1S7FA 4MHYA 2CJYB 5CZXA 3UVJA 4O4GB 1NSPA 4ZBGA 3PX4A 4CLSA 3EUNA 3HFKA 2DPTA 5F9LA 3H8GA 1P6TA 1FWKA 4XPEA 5GAGI 2W9CB 2BKPA 1FVSA 1MJ9A 2OEJA 4JI8F 2IL4A 3UW1A 1BPNA 4B13A 1PAUB 4L3NA 3H2VE 3VZIA 3BSOA 4DXLA 4KHPJ 3VGTA 2EO8A 2LQJA 5MAOA 2GV1A 1WHXA 4JI1F 2B6AA 3VARA 1S76D 1RT3A 4ZPDA 4OYIA 1RAHB 3SCLE 3DRYA 4QWEA 4OJHA 2IVMA 2ZJQQ 3FMWA 3OFFA 3BREA 2KG1A 3SMZA 2JDJA 2GQCA 1T9WA 1LWFB 1KBRA 4CO2A 2IY5B 1ZS6A 3MRUA 4P6YA 8RUCA 2DNOA 4B08A 4RUBA 2JSXA 2HHQA 3GFXA 2BV3A 1YSJA 4ECVA 2AQ4A 4ZGYB 4A8XA 3RBUA 4HR2A 5C24B 3R8YA 5HJXA 3NS5A 5J1NA 5CHCB 3AJDA 3D1QA 2EKNA 5I42A 4JP8A 3CPAA 3PHTA 3BSCA 2X1BA 3ZO7A 4JXRA 2QJ3A 5M2PA 3MZIA 2OD6A 3L7PA 1PBAA 1FXLA 3MAAB 4Y6IA 4X4VA 2YWWA 3ZZ0A 1GEHA 4EVYA 4F4YA 4DV7J 2BL1A 2WVCA 4F8RA 1ITPA 1RTQA 1NXIA 2J0WA 3RRGA 4KO0A 2KFZA 2HUZA 1GT8A 4IDKB 3QB8A 4X62J 1QJHA 3GYGA 1S6OA 1MWZA 2RHSB 3PM9A 2JBKA 3V81A 4B9SA 3R6LB 1N88A 1TAQA 1TV6B 4QJVA 3CTRA 3N5BA 5G1ZA 3QYYA 1LRZA 2AZ3A 4ANDA 3RB0A 2HMIA 1MWQA 1UW4A 4QOTA 2APOA 1KEKA 3D4UA 2HBYB 3BH7B 4IAVA 4O0IA 2DR7A 3GWCA 5A2QY 1RT3B 4LF8J 3QGIA 3IGVA 5THWA 4C2MA 2B4DA 3HKWA 1XFOA 4ED2A 2AP6A 2ZEEA 1DTDA 4KSEB 1F5CA 2AJ1A 5LXYA 3JQKA 4USTA 4FS1A 2DXDA 2DGVA 1G3OA 2HQ3A 4OYWA 4USHA 3TI0A 4K0KJ 4MCQA 1DBDA 5IFMA 1IBCB 3TUJC 5A8KA 1BMQB 1EQMA 1NK8A 1K1SA 5LYLA 3E2EA 2R2RA 3I82A 3OTOF 3SJGA 4P4DA 2VV5A 4UIBA 2YNHA 1N54B 4G1PA 1U1QA 4WU2A 3FCHA 5HQMA 2FHKA 3KDOA 2EBEA 2HVZA 2AEMA 3M32B 2XO6A 1HNXF 4PWUA 3KLGA 3VAGA 2REFA 4KB7A 1RAJA 4GXHA 2K8GA 1GXLA 2D3OR 5AGEA 4X64J 4K59A 4FS2A 1RISA 4J3GA 2HG4A 4NEYA 2P6FA 3FZ2A 2HFNA 1N0VC 3IMQJ 3FNCA 4ENOA 2XQCA 4KV8A 3WZ0A 2JFKA 4NLDA 5ELYA 3QBCA 2AZ1A 2GU2A 1FDNA 3OL9A 2JWNA 4F67A 3H4QA 2N7YA 1M5HA 3ZZUA 3P96A 1XN9A 2M2BA 4CH1A 5LSOA 4DQPA 4YFJA 5KFGA 2HVEA 3R95A 2D9PA 3W2VA 2BEFA 4Y3CA 1S1WB 2B56A 1V3ZA 2AFUA 2P6TA 1HI8A 3HSDA 4YR3A 2ERRA 4M8LA 4YEAA 4R8FA 2CJ9A 2K2PA 1S99A 1B99A 2PJ9A 1X10A 3ISZA 1MN9A 1X4EA 2JH3A 2V69A 2CVIA 1YJUA 3H8FA 1J5OA 3QJJA 1YZ6A 2C42A 2FC8A 3GYNA 4KSFA 1CJKB 4X84A 1SJ3P 1TFYA 3K9TA 3EMTA 1D9DA 1VFJA 4HTIA 2VA2A 3GE9A 2J8AA 2X3GA 4O44B 4U7UD 2YBVA 5D78A 3U1LA 2WSAA 4NL5A 3UCUP 3JAMY 5KFNA 2XO7A 3ZZIA 2RILA 2OSRA 1RQ0A 3K2KA 1CJTB 2L9DA 3VHQA 1AZSB 2XEGA 1TVRA 1QTNB 1SC1B 2IJNA 1UVJA 3MD3A 1CS4B 2JEGA 4F50A 2RHQB 4ZP9A 4AUKA 1S59A 3F44A 1A9NB 4HEA9 4LRFA 1MU2B 2OO4A 4RBVA 3Q0AA 4K4VA 2SXLA 3ITHA 4R6TA 4NYZA 1RE1B 5D4OA 4CGNA 1Q86T 3G8QA 3DHWC 3NGSA 2CPIA 4OKOA 3MPUB 2GFFA 4Y2KA 1UVNA 4CYOA 4GVBA 1ON0A 4NJRA 3QJLA 3C66A 4KYZA 4DL6A 1Q8KA 2COLA 5HMNA 4P6QA 5FJ4A 1YJ9S 1D8ZA 3ENWA 6FDRA 4BC9A 1JLBB 1PJ7A 2R7VA 2PIZA 1M5SA 4ECTA 1OQ3A 1Q82T 3TOAA 3C6TB 3ISNC 1FFWB 1IKYB 3BO3A 3Q86A 4G6VB 4GO7X 4OZ5A 3RO0A 3ICLA 2CPXA 3U7JA 2XYGB 4OHWA 2CJBA 3W91A 1RWVB 2DH8A 2ZXVA 1HR0J 4B3MJ 2NSMA 1HBUA 3H5XA 1U0HA 4MFPA 4RS2A 4N8NA 3SZ2A 1Q81T 5GAGU 4LT6A 4A46A 2UVWA 1QAYA 1OSCA 4F0XA 3LWLA 3B3SA 1Q8BA 2P9EA 1RYSA 3ENQA 4L74A 4DS5A 1Z5RA 1C4CA 4DV2J 1KUXA 4WK3A 3CD0A 4JI0F 3C26A 3CXSA 1YI2S 5KFZA 4Y34A 2XB2D 4BWMA 3G86A 3QRPA 3SDEA 4J9KA 4J9MA 5D3GA 3D6TB 1KVJA 3ETMA 3G8WA 1XJWB 5KT2A 3S1TA 2KZZA 1FEHA 2QIRA 3KI9A 2O67A 4DN9A 1S7KA 3KJVB 3KUHA 3CW2C 1LWXA 2E7WA 2R7OA 4WP8A 3MTJA 2LQBA 2UUAF 3RAQA 4U7CA 1IQZA 4NA3A 1N32J 3PXGa 4DSEA 5HLFA 4GVBB 1QDUB 4ZN1A 1XK8A 1RLCL 3B3WA 3D2WA 1VQ5S 1U6BA 1FKPB 2Q3PA 2WUUA 1SQEA 3ZJ0A 2GJ2A 4ETXA 1QTMA 2VF3A 3VVTA 4C8KA 1RAEB 4JI4F 4KJIA 4JBCA 5AXMA 2CJKA 5BXIA 1X4DA 4CTAB 4FUUA 1FTCA 2ATCB 1GMWA 4TU7A 2J7UA 3NP5A 3BDEA 2OZUA 2I3CA 2VQFF 4DV0J 2RE1A 1RHQB 2J9EA 3P5BP 3DRRB 2FVCA 2V8GA 1X4AA 2B4PA 4LF7F 4P72A 3AB2B 2DNZA 4DPYA 4ONWA 3OTDA 2CXEA 4CYUB 3W8PA 5LMNF 3POTB 4H4KC 2QLXA 2IMOA 4AVBA 1QQ9A 3I0SB 2J5AA 4MYTA 5HROB 3DKDA 3JSBA 2HZAA 3M30A 3WC5A 1D8YA 1JXEA 3FYNA 1N33J 3V4IA 2HGLA 2PJ4A 3PIPQ 2IBKA 3K9UA 3W5XA 5K8OA 1CJUB 4GC6A 2MQNA 2P0WA 1KHVA 4JLYA 5ETQA 1S4EA 4OZ1A 2E44A 2GCFA 4DUZJ 3WX8A 4DX6A 1KOOA 4FZVA 4AVAA 3GILA 2FUG9 5D0HA 4UEEA 3DLGB 2DH7A 4CLYA 1LAMA 2HQYA 4UCMA 4URSA 3N6NA 5G0RA 5CBMA 5ETMA 1YRUA 4DV6F 1WKKA 4QC6A 4QYRA 3SI8A 1RBAA 2Y3YA 2YNFA 1SJRA 4RL1A 4Y0FA 1R8BA 3TJ8A 3Q24A 2XEJA 3FBFA 4CH0S 5AE1A 4XNHC 3IGNA 4JOUA 2CQ3A 2YKAA 1NB7A 1WHVA 3NCRA 2JOQA 5GAHI 1OZPA 4IR9A 3P4UB 2ATRA 4ELUA 4KHMA 4RW7A 4JI4J 4DU8A 4ZVSB 2RJZA 3CJ8A 5K20B 4K4XA 2H5EA 1X4CA 1WOPA 4F0YA 1Z8WA 2ZEOA 3NNHA 5AXLA 4H4MA 3TAMA 2VQYA 1UWAA 4ZHRB 1D3WA 2V8HA 1F57A 3G71S 1G2EA 4K5RA 4YDXA 5G4DA 2B3UA 5DGBA 3ONQA 2B5GA 1KUVA 1YW4A 1OBRA 3OLAA 2DR6A 3IC1A 2F40A 4A32A 3RAXA 3PYDA 2HAIA 4IF5A 2X7IA 1YJWS 3V4IB 3GIUA 2PA8D 1F9FA 3O1LA 3D3BJ 4UUXA 3TZZA 5LYFA 1R31A 3LP1B 4B6ZA 5AXKA 2BA9A 5HSPA 4YR2A 4FKXA 1ELMP 5BR8J 4YY3J 3BB5A 4C6AA 5J2MB 4F4AA 1RLDA 4QB9A 2AYGA 2KHCA 4P7VA 2POKA 1N36F 3KQXA 2CFXA 1AUDA 2NYIA 3IS9A 2GNKA 2XMJA 3M8WA 4LFCF 1TK5A 1IB1E 3TRGA 5JMNA 5HAOA 3T1YF 2ZHBA 1BLUA 1NPPA 4QR1A 2C28A 2ODFA 3OHAA 2F5GA 4KOYA 5H9FJ 1IXKA 5HMZA 5DRKA 2W4PA 3TQEA 2Y0MA 4UFWA 2UXCF 2DGQA 2Z58B 3PBEA 3NG8A 3CZXA 4ILMA 3LANA 3OTCA 1WUUA 5BYQA 1GMUA 2KKHA 4A8OA 1DLOA 1RWKB 5GVQA 4UQGA 2J6UA 4NI2B 2HNDA 2QX0A 3KLFA 2H65B 1RHMB 2PVVA 4E8OA 3RR8A 5F8HA 1NMEB 1RP5A 2AJQA 3IRXA 4IFYA 4K4TA 5AE2A 2AYBA 2CG4A 5KFPA 4ECZA 1BQMA 2IYGA 2OMOA 3N01A 3IR5B 1FWLA 2Y8YA 1RTHB 1JB0C 4NYPA 2OB0A 2YNIA 2R7WA 2J8SA 1YITS 2OP5A 3KG4A 3FMCA 4DUKA 2PI4A 4G1QA 3I5CA 2RAQA 3KNGA 3I0RB 3V4MA 3MUMP 2H48B 3D28A 4OI1A 4ZITA 2L41A 3D66A 4YS2A 3MN8A 2V8DA 3TUZC 2RNEA 1LWCB 2F5IA 1JLBA 1U1RA 2R8VA 2HIYA 4E2FB 4MFJA 1RAOA 1F6TA 4CCHA 4OI2A 4CAEA 4MRIA 3CEDA 1X5SA 4KGMA 3PYEA 4USJC 3DFEA 1JJCB 3T5HA 1ZA2B 5DO2A 1M1DA 2KJVA 1JLAA 1UEUA 4LBHA 1EJ7L 2G0BA 4IH5A 5LSRA 2EWHA 1KUYA 3HM9A 3V7ZA 2AX1A 5E5NA 4ED4A 2DD8S 2PJ8A 5HVHA 2VG6B 1HQ2A 1YREA 3HJVA 3UCGA 3H4DA 5IT0A 1HD1A 4NGTA 1DLOB 2C6PA 1FJ7A 1T03A 1GAOA 5AE3A 1IKVA 2B9WA 4LFBF 1EKRA 1X9MA 1PC5A 4PSXA 5KFCA 2PE8A 3K8VA 1DY3A 2ZBIA 4FN5A 3H4BA 3HHLC 4F3MA 3H20A 4MFLA 1FX4A 4DR3F 4LR8A 3PW5A 1NKEA 1L0CA 4PKDB 5ETRA 1DZ5A 3OW2R 2Z3MA 2B7BB 4LRCA 3N5FA 5EDWA 1Q7YT 4JI7F 1QVFR 2W7AA 1IWAA 2GMLA 3EX7B 1BY9A 5CCMA 1GFWB 3EVWA 2JEIA 3A1YG 1AT1B 4EFDA 1YZ7A 3SJXA 3PIOQ 4LREA 1U09A 3KLIB 1XERA 1LFPA 4B17A 1PAEX 2FVGA 2O4HA 2ROEA 3QSYB 4L75A 1B87A 2XEFA 2EVZA 1WDDA 1XMQF 1V5VA 4B11A 3MGDA 4F9VA 2V8PA 2MY8A 3MM6A 2RUSA 3AHPA 1TMJA 4A39A 3IWEA 2OD4A 4UW2A 1HWIA 1URNA 4ZPVR 2QSFA 2RT3A 3M2VB 2VZYA 4R3LA 3K59A 3R5AA 4OV6A 2IRYA 4K0KF 2ZENA 4EFAC 1RB0A 4IK2A 2B5GB 2BBEA 1OO0B 4FD7A 4AXJA 4URQU 1SV5A 4MT1A 4V19J 3NNCA 3A8JA 2KT5A 4QU6A 2FS5A 2RS8A 2AX0A 3J81j 2MZRA 3WR7A 3FH4A 4CIOA 3UCZP 4FYDA 2FHJD 1RT7A 1WC6A 1YVFA 3AY0A 4MK7A 1XWLA 2AFXA 1CJUA 2J0SD 3BGOP 2DGSA 4ZYQA 2HWHA 4DSKA 4M6GA 4X64F 3N28A 3G8SA 4QYZK 1IKWB 3ZC4A 3EPIA 1S1VA 4RZRA 2WVDA 1KVKA 3EXYA 4LIRA 2KCWA 3T9YA 2ZOMA 2QT7A 5KFBA 2FD2A 3HLUA 4HNXB 4KGKA 2XI2A 2FL4A 2D69A 4AG7A 3GUXA 2IM3A 1OWXA 2DR8A 2IAJA 2YKQA 1YLOA 4RN7A 1D0EA 2MQLA 3CPWR 4M5KA 3GU0A 4XIUA 5GAEI 4EMEA 1WI8A 4H6UA 4EBCA 2PSZA 1PU9A 3AOBA 2GAHC 4M94A 3R5JB 3EC4A 2XGQA 3WT4A 2BJ1A 3IRWP 1TUGB 4NLVA 4KH0B 2IRXA 1X4FA 4IFVB 2QJ8A 2R7XA 2QYCA 2NLWA 2IJRA 4F2SA 3UN3A 3UR0A 1FJGJ 4QIEA 2H51B 5D0EA 4DL3A 3NFZA 4PV6A 3DOKA 2DNYA 1I94J 3Q22A 3IM8A 3JYTB 4P2SA 4NGMA 1ZM4A 3J7YI 1HBNB 4KH1B 3OJUA 3VATA 4P44A 1VC5A 2CZVC 1RT4A 1FK9B 4FPRA 4PQUA 5L8RC 5DQIA 4ECQA 3MM5B 5EGYA 1IICA 2Z3OA 1RTIB 3TO6A 2QTWA 4CLWA 2JHEA 3SBMA 3O5TB 1Q4RA 4ZPWR 3NH4A 3MM8A 2K06A 1IJFB 4UWIA 3TR5A 3TWZA 1LEOA 2XYHB 1TKTB 3RW7A 5IM0B 3KHHA 1IKWA 2IC3B 4MJKA 3Q8PB 1EP4B 2B4BA 2LA6A 4OX9J 4OX8A 3E0KA 3KLVA 5JGFA 2GW8A 1HHSA 3GIRA 2CKWA 3ULHA 2XY6A 3F0AA 4Y2MA 2XZWA 3IS9B 1TXRA 4NXNF 4R87A 1VRTB 2WZ1A 4K4WA 5C2CA 2F9DA 4X4OA 2JEFA 4OMFG 3W5ZA 1SPBP 2ZBPA 1PYTB 3GCXP 4ZPCA 1K4JA 1XEBA 4OAEA 4EO6A 1EAYC 1FNOA 1RWNB 1R7IA 1CULA 2XCAA 4L6V3 4CGMA 5AG6A 1OYEA 3EO4A 3HSZA 3TUIC 3VVUA 2M9KA 3D7FA 4ZDNA 5J2PA 2DHAA 3IBFB 1CJKA 3LUYA 1V9OA 1H2VZ 5JUMA 4B3TF 2JJ4D 4JWPA 1T9VA 1IY7A 4ZI6A 4P75A 2PFFB 2XSJB 3BJ8A 1RT6A 1URRA 2GVDB 3NAIA 3E51A 4A4JA 2LP4A 2CYYA 4HL9A 4IYQA 1VOMA 4DNCA 2FB0A 4X65J 2P6GA 5EMIA 1HQEB 2WTFA 2LEBA 1SI9A 4ZP8A 3BGFA 4FXVA 1N71A 5DDQC 1LW0A 1AW0A 4KOUA 2G3AA 2DEAA 3D2MA 1X5OA 3M4XA 2XMMA 3ZZRA 2VASA 4B5PB 4CI0B 5JVGQ 1FXDA 2Z8QA 4M95A 3S9LA 2PO4A 1X0FA 2HBZB 1YKWA 3AT1B 2GGPA 2RMLA 4C8MA 2V2ZA 4PG4A 3J7ZT 4G3IA 2HVDA 4KV8B 1NMTA 3VQSA 3DHXA 3NGTA 1EQ0A 3MOJB 2JVOA 1TL5A 4LQ3A 4MI4A 1GK8A 5ISVA 3GYXB 5JH9A 1S49A 3R7BB 4QWDA 3W9JA 3SFGA 4LQ9A 2C22A 4TQSA 2UP1A 4DCPB 5AJ3J 5DJBA 3UE2A 5D8NA 2HBRB 3KJNB 2VFSA 2YWEA 4RNFA 1TL4A 5CCLA 3WC2A 3F73A 2VFRA 1JX4A 4QIGA 2RS2A 4KLWA 3MOZA 3HI9A 4OX9F 2EK9A 2NXUA 4LMZA 3A8EA 2ZE2B 1WWHA 3TEGA 5IWAJ 1S0OA 2VG6A 5LJ5Y 1WG5A 5BR8F 3FBEA 2YY3A 2GC8A 3CD7A 4JUZA 1HI1A 1QY7A 3QSIA 3JSMA 1I51B 2B58A 4DZDA 1SKRA 1DFDA 4KKOA 2J7WA 3DU5A 4MCSA 3QGHA 4PYAA 1YVOA 1BGXT 5DZ7A 4II9A 2BW2A 2UZAA 1S57A 2ZOFA 1RT6B 4WZMA 3GJTB 3KUEA 3CD6S 3E01B 2WHOA 2VC0A 2ASYA 1Z8LA 1T9YA 5KFEA 1RHKB 3DC2A 3H25A 3T3FA 1FI4A 1ZM2A 4HACA 4BDPA 2EG1A 4KT0C 5K8NA 4DV0F 4ZVQB 2E66A 1KQFB 3A3PB 4BS2A 2GE3A 4BWJA 2CPEA 3CJKB 3PW2A 1TKXB 2NXEA 1NK4A 4B3SF 2BQRA 4DL5A 1ZPVA 3DRSA 4Q7AA 4DN0A 1GX6A 2DBBA 3UN5A 1AZSA 2OZHA 2LCWA 2NZ4A 1YR0A 1ZOTA 1T05B 4ZY1A 3LAMA 2JZ5A 4CYQA 2HHUA 2XHCA 1HFEL 3M6VA 1JLQB 3CD5A 4ALZA 2DNPA 2XM3A 2YNHB 4USVA 4OP4A 2PEHA 3DR8A 2EC2A 4K4ZA 1HWLA 3SXOA 1FRKA 4L89A 4ID5B 2HSEB 3U02A 3SJEA 5EC4A 5RUBA 4OYXA 2KM8C 1DTTB 2VQEJ 1FHTA 4O23A 5E96A 1NKBA 2LEAA 4Z7YA 4MFZA 2Y1JA 2ASLA 3G9CA 2QZ8A 4YHHJ 4CH7A 1RTDB 2QGFB 3SCJE 2AJ0A 4ICLB 3R2DJ 2PR1A 4YB6A 2EK6A 4JYWA 3US5A 4CDIA 4PPDA 5SZTA 4DR1F 2BM1A 2WBRA 1YGYA 4HTJA 3UDEA 3LA0A 4ZVOB 1U6MA 2C6GA 2A1BA 4E98A 1K0TA 2G4BA 1CSJA 1LCPA 3SCKE 4DV5J 3HLPA 4N7TA 1UFWA 3I4PA 2W2NP 4HACB 3M30B 4OC1A 3KUGA 2H5IB 2QL7B 1X4BA 4H4OB 2FLNA 2VOOA 2PEBA 4A8QA 2KFNA 1IBLF 2HQDA 3ISXA 3C15B 1NLKL 3MEDB 2GIFA 4J9VA 3WABA 2ZEHA 4DDFA 5ITHA 4GKKF 2RF2B 2FVPA 1F60B 1ZH5A 3OT9A 5I4MA 1GTEA 3D4JA 1HYSB 2FDNA 3CMAS 3D54A 1SIWB 3BZQA 4TKTA 1WTFA 5GADU 2N3LA 4Z37A 1HW8A 2W2MP 4LF6F 3MM9A 1OJ4A 3W3SA 3RBXA 2DHGA 3DGPA 3DOKB 3B6BA 3BGRB 2PDOA 1Q0NA 2GLJA 2UUWA 1HDUA 4FXDA 2R7QA 5HLFB 2DCLA 3G6VA 1B0VA 3NKYA 3GY9A 2YTCA 4H4KA 2CY2A 3B4DA 4F2RA 2VUGA 1NK7A 1X5PA 3MR5A 3KHGA 2R4FA 1YQEA 4ANEA 6FD1A 3MPDA 2ALYB 4M5GA 5GAHU 1WC4A 4DX5A 2KVQE 1R8AA 2ZVIA 2HYIB 1TKDA 4RUHA 1ZAXA 4CTAA 4M5MA 3QT5A 1SKUB 4MXUA 1MU2A 4CO3A 3K5NA 2FY8A 1SH0A 3CDAA 3AJ1A 4CAXA 2QMUB 2OFHX 4EEYA 4EYHB 3TT2A 1T02A 2ZW5A 2ATLA 1M0SA 2UU9J 4KFBA 3ENVA 2OLWA 3AB4B 5KFLA 3VF0B 3CIMA 2EFVA 2ZWPA 3CJ2A 2QLWA 2W4CA 3OVSA 3IWNC 2CNSA 5KOXA 1C0TB 3RNZA 3D3CJ 1KN6A 1FRHA 1S12A 2IYIA 2W9CA 4W4MA 1Q8LA 2HQGA 4W92B 4F3QA 4Z2XA 3LACA 4I49A 5AG5A 4N77A 4DR4F 3GR0A 4OI4A 3R6GB 1R0BG 5KT3A 2IJFA 1BLLE 2CQ0A 1PJ6A 3AD7C 2X1AA 1RWOB 3ZFVA 3TFYA 2E1RA 3MTKA 3HK2A 1FRXA 3ZXWA 2YNCA 3MF5A 3H8EA 4ZVRB 4ITSA 1S3ZA 2E9RX 3CC2S 3OV7A 1VHIA 1Q78A 5IS2A 2E5LJ 1KS2A 4I2QB 4B3OB 3TVKA 2CA9A 3FVLA 2YPZA 2AW0A 3HPOA 1DJ0A 2JEJA 4DUYJ 1VQMS 4K2JA 2VI7A 3MAAA 5HMWA 1U1LA 2PJ6A 5DLGA 3TE4A 3TX8A 3FRMA 5H9FK 2HFVA 1UWYA 1ROFA 1FO1A 4NLTA 4PWWA 2PJAA 4S0MA 4IDKA 4LSNA 1N5QA 4KSAA 2D74B 4FYWB 2OJ3A 3KTQA 3NA6A 3J81Y 2K3IA 5C88A 3AQOA 2VH7A 3AQPA 1Y7EA 1JKHB 1Y3KA 4NSQA 2DISA 2QLFB 4RU9A 3Q8YA 1NSQA 4FYXB 1HNVA 1F0XA 3SQGA 5EN1A 4TY8B 3TARA 1R6YA 8ATCB 1RTJB 3VAMA 3BJ7A 5HI7A 4Q0BB 2VOPA 1Q1KA 3NBPA 3KMSA 3DLKB 4DR4J 5C2GA 2ZW6A 2NXJA 3HHNB 1IR2A 1SXLA 3B2YA 4CAVA 1WF2A 1SCJB 5E41A 4Y28C 4DQSA 3AD9C 2UXBF 1CPZA 1UFLA 4OFZA 2Y1LB 4IH7A 2DGWA 3KHZA 2OOTA 3FSYA 1Q5YA 1BQNA 3Q8SB 5J2QA 1HNWF 2JX2A 3CB4A 1RUSA 1E6YB 5KFRA 2MKIA 3DRPA 4YR0A 4QU7A 4AXIA 1HD0A 2V94A 5L9XA 3HX9A 4ZLNA 1YX2A 1A0OB 2QEXS 1UTAA 3AA8A 1B64A 4PG5A 1CX8A 2J8MA 3BEGB 4PUOB 1XTZA 1VHOA 2CADA 2OZGA 3MM9B 4X66F 3FFIB 5J1QA 3GV5B 4C7HA 2CQ4A 1I3OB 1RHUB 1JKHA 1YJNS 2YNGA 5B0AA 3OFEA 4ES1A 4MKYA 3D3SA 2EPIA 3MAQA 5DS0A 4UA3A 4ZY0A 4DV6J 1RACB 3RBDA 3SQGB 3QIDA 1O8BA 5DQGA 1F3VA 1F2GA 1NEEA 3IA0A 1Q7LA 2ASJA 3CMES 1MG7A 1NHUA 3M2UB 4CLPA 3FEYB 1OMSA 1FRIA 5L1KA 5CH7B 3KNAA 3I1UA 1OY8A 4DLEA 2Y0BB 4P2MA 3HT3A 2CPFA 1C0UB 3Q2SC 3D9BA 4NFRA 4M5DB 1DTQB 4LF2A 1ZM9A 3PJWA 2R8KA 2ASDA 3KK3B 5F48A 4RW4A 4GC7A 2D3O1 4R57A 1N6QB 2EFNA 2M7SA 4CRYB 1PBUA 2OPRA 3FQLA 1X60A 2UU9F 2I5JB 1ZLHA 4RBUA 1WD6A 1MJBA 3DM2A 3TA0A 3IWGA 2G0IA 3MI7X 3MCOA 2NXNA 4ES3A 4LF9J 1ZZNA 4AB7A 1JLGA 3DRPB 4XPKA 1N0UA 4R7MA 3JVNA 1V3SA 3JTOA 1KSPA 1TKFA 2BCOA 1TF8A 1KQGB 1CJTA 4J7CA 5KFQA 4ZK7M 4YRHA 1BXNA 4WFXA 2J6TA 1PYSB 4WFBQ 1VLOA 1OPZA 2GQ2A 2PIYA 3DYAB 1CS4A 2FIWA 1WHWA 3MPVA 2HLTA 4ZP7A 4ZN3A 2I00A 1IM6A 3HD1A 3SCIE 3WIVA 1B3TA 3ITHB 1MMLA 3HUVA 4ZY2A 2HK3A 2IM1A 4D3HA 4RW9A 3S6KA 3EGWB 4NCAA 3V6DB 5CZVA 5LL6d 3HVTA 2R42A 1WSRA 2A2CA 2CQIA 4WJBA 2VJUA 2R7HA 1Y11A 4IFVA 3FC9A 2U2FA 2AFSA 3KLFB 4F0MA 4MFKA 1S0VA 1U1NA 3FGVA 3Q89A 1Q2CA 3T1YJ 4ERDA 1Z4UA 1FRLA 2HKEA 4R5PB 4NA1A 4OZNA 3QIPA 2YH1A 2XTJP 4OYMA 3D7DA 2HB6A 3DXSX 2PJBA 4I64A 1T7PA 3FX6A 1RAGB 3DOMA 1KTVA 1R43A 5D4PA 3KK1A 2Z3PA 3IU2A 1W7WA 4LJMA 4EWTA 2AU0A 2E1PA 3FCWA 2C2MB 1KR4A 3ENAA 3JS9A 1RT2B 3DN9A 5SUHA 2UXCJ 1MK4A 1A6LA 4C2ZA 4BMHA 3T6BA 3MM8B 1XIQA 2PN6A 5EX3A 2GIRA 4DFKA 2HFOA 3CCUS 1NK5A 2E1CA 2IA6A 3HDSA 5EUHA 4FPIA 2HGNA 3DLGA 1ZG9A 4G65A 3BGLA 4RNMA 2FC9A 4O4RA 5EWEA 1YTYA 2ZDOA 3CJRA 3RR7A 2BDPA 2GFQA 4ED1A 2ZZNA 4RBTA 3FXTA 4KR0B 2DO4A 4KIAA 2N3OA 3CCMS 2RDDA 1QSNA 5E3PA 4TU8A 1DRZA 2CRLA 4C48A 4CRJA 3EZ5A 1S10A 5HBMB 1EKSA 1AB8A 4O44A 3C3LA 4HKQA 1QE1B 4C8YA 3KFWX 4FVCA 4KE5A 3D1OA 3HVTB 4TVAB 3BR9A 2QMWA 4R0JA 1JWWA 3CCQS 4LUAA 1FKPA 2LXFA 4C3MA 2NS1B 1RT5A 3LGNA 2CVEA 1RYRA 2ZW7A 2LA4A 3FKBA 2BQUA 1Y0RA 5FLXU 2AFOA 4CWBA 5B0GA 4U5YA 2F65A 1LW2A 4KAIA 3S8SA 1S1UB 4URGA 2OH2A 4IG3B 1SUQB 2LU1A 4ELVA 2I9SA 3B78A 5KG1A 2M0GB 2VIHA 2L9WA 1SL0A 1F9EB 2VFUA 3OR1B 4M6IA 3QAUA 4TLRA 4AQYJ 4ZJQA 2CF4A 3PNIA 5KT5A 1LXNA 3W62A 2Z3NA 4RW4B 4U7UK 3O3LA 2YNEA 2Q44A 3KLIA 4OI3A 1VBZA 3DCAA 3K5MA 1Q5VA 1NH8A 3N6LA 4JJXA 3TZXA 2WW8A 2GGPB 3RUBL 4KGZB 1S1TA 1QAJA 2D9OA 4MIWA 2ZC4A 1XMQJ 2G0JA 1TKTA 4DJBA 3KK3A 2MMYA 2KJWA 2B6AB 2HHXA 3TJAA 1QSOA 1OPIA 3X1LB 3BV8A 3M9MB 2AFZA 3DYAA 4QIFA 4P71A 2WVFA 1C2PA 1IQTA 4O3SA 2GREA 5E3CA 3KG0A 1YX0A 2V50A 3I5AA 1PYTA 2DNHA 4FP9A 1CJVB 2J0XA 1XBUA 4ILRA 5H1SV 4A8WA 1XNQJ 1Z9UA 2CPZA 1K73T 4GMKA 1CULB 3HJFA 4E0DA 1BQXA 1UAWA 2OTLS 4EMDA 4QPXA 4LVOP 1WF0A 1WOSA 2QECA 4O3QA 1ARMA 1T9UA 1FWPA 3QAHA 3KXDA 2Y8WA 2VZ9A 4CT8A 4QYZJ 1AXQA 2KYZA 4DPUA 3PHEA 4IG0A 2R8JA 1WC3A 1XR7A 4X65F 2DVIA 3WHIA 1XEZA 3W65A 4Z65A 1IN0A 4ZX9A 4R0EA 4LUBA 3OLBA 1UEVA 5HP1A 4RW7B 4OX7A 1DE4C 4FWUA 2HRTA 2UUTA 2LXUA 3QRQA 2CZ9A 1RT2A 4DUZF 3BO2A 4UOFA 2JLEA 1LWEB 3CXPA 3JRUA 3N4WA 2UV8A 4TLQA 3SI1A 2BYCA 3LP1A 3U27A 1OY6A 3MCMA 3V38A 1F5AA 4XO0A 2GA7A 4TNOA 4DCJB 3M8RA 5AJ3F 3W2WA 1M44A 1NBEB 2DRDA 3DRRA 3NE7A 3HHLA 4AG9A 1K47A 5HQLA 5KOWA 4UOCA 4J9LA 4IQXA 3MGJA 4P9SA 4C8LA 3KJFB 5F41A 1XQIA 1JQGA 3RB6A 2E5IA 3NEKA 1RWWB 4PABA 3FIXA 2HV2A 3VTIA 3PTWA 2KM8B 4XK8C 1RKJA 1LOKA 1RWPB 2UXBJ 5B0CA 5IC6B 3ADAC 4I69A 3BR8A 2YH0A 4YOEA 4NLXA 1XF8A 4K2XA 5ETNA 2A0FB 3QRRA 1S7HA 3FVYA 1UL3A 5D0GA 3C6UB 3FDSA 1UZDA 2X51A 3HFZB 3CJSA 4CT9A 5IQ6A 5IM0A 5DETA 4JYAJ 3QZ8A 5LSLA 4ATNA 3NL0A 4ZVHA 2MZJA 4DS4A 2DGXA 5HBMA 4P45A 4XPDC 4DL4A 2YWHA 1VK3A 4G1IA 4JD6A 4DV1J 4I2PB 3PO5A 4C98A 2KH9A 4DBQA 5J1EB 1FA0A 1IOFA 3BBFA 3M1VB 5FIIA 2IVFB 4B3SJ 2OH1A 5F9NA 1T8EA 4J9OA 3BM7A 3DLEB 1ZYQA 6CPAA 5LRKA 3GJSB 3KLEB 3GG1A 3BHXA 3VAHA 3SXNA 4ZX8A 5A28A 1X5TA 5KFAA 5LRGA 1RABB 2Q4VA 5CYQA 1S6QB 2Z2LA 3V5RA 3SSQA 1LWCA 1UP1A 3TJ9A 1XR6A 3LO3A 2W24A 3TAMB 2L08A 4EGLA 2VQFJ 4NGPA 4KY3A 3B35A 2VB6A 3W6XA 1SV5B 1U02A 1YJ7A 2W2OP 3W61A 3GIJA 4ZKAA 2GVZA 3QPIA 2C2KB 3IR7B 3W8GA 3SJFA 2PJ7A 1X4HA 2PRQA 3HVWA 1G1XA 2CNKB 4WU3A 3MEEA 3FNNA 1WEZA 4OZ2A 2V4QA 2F8MA 4OYBA 4MTPA 3RYOA 2U1AA 4OC0A 1S6UA 4X4UA 3HVRA 5IT9Y 2A18A 1RTDA 2X7BA 2P9CA 3CJ4A 2PQ8A 7CPAA 1NPKA 3UN2A 5LMNJ 1NCLA 3PW7A 2D4OA 5KT6A 4DU7A 2DNGA 4PQAA 4JI6F 3EYZA 3P6YC 4NEZA 5LRJA 1YLEA 3PEJA 2ZDPA 2ZD1B 3TOQA 5C42A 2AKWB 2RD5C 1XNRF 3RRHA 3IG1A 4RW6B 4YU9A 1JIHA 4M63A 3DNSA 3KL9A 5A0YB 2PGCA 4QWCA 1QSLA 3M6XA 2MKSA 1SJFA 2EI5A 2WK4A 1QE1A 4JV1A 1JNRB 1VC6A 4NWBA 3DLEA 5B7WA 3HVAA 1YK3A 4KLVA 3LD2A 3GONA 4OZLA 2BX6A 1HQUB 3K58A 2AGPA 5KG5A 3J7AN 5DWMA 3JSYA 4ZLPA 2GHPA 1AROP 1XIXA 4DV4J 4J9PA 1HPZA 4BBYA 1HYSA 4R9MA 1VQ8S 3B4MA 2PJ3A 3UDVA 2F63A 1PILA 2DH9A 2BJ3A 1WNEA 1YVKA 5DDOC 2XY5A 4PPZA 4IG3A 1R6VA 2ILYA 3K57A 2KT2A 2VODA 4B3MF 2V2QA 1AMPA 2ADCA 2HC9A 2J0QD 5L9NA 4C7QA 3MMAB 1W2IA 3GB0A 4TQRA 4F3OA 5KFOA 3VAJA 4A95A 3LP2A 1N5YB 4AL5A 2LQ5A 1VQPS 3F56A 1R8CA 2W2QP 1FDBA 3SV4A 3DI6B 2ZZMA 4ZCIA 3B7IA 1Y5LB 2HZVA 4C4WA 4K30A 5L38A 3TX0A 3DNCA 4YB1P 3SHPA 1NJXA 3J7A1 3VAFA 1T05A 2BJEA 3M2VA 4LFAF 2Z30B 1E6VB 4JV5J 4RNNA 1M1KT 2NYHA 3R9GA 2C1EB 1DQ9A 1KNZA 3MR3A 2PMWA 4FBEA 4IO1A 3D2PA 1U48A 3IG1B 3RBZA 2E29A 1QAXA 3ILLA 2JC0A 2ZWOA 1OSDA 3KHLA 2BO9A 3IP0A 2AEJA 4OYPA 3R1HA 2FZKB 3MWBA 5KFIA 1YRXA 3HZEA 2PA3A 1SL1A 1RT7B 4EZ9A 2RDJA 4A8MP 4AL7A 2YNDA 1HHTP 4JI5F 1CP7A 3UQSA 5LMUJ 3CT9A 4PG7A 2XS7A 2A2DA 1M4DA 3MD1A 2OEMA 1NSAA 2Z2ZA 1KVIA 2GO9A 2BJ9A 1NSLA 4HI1A 2GQQA 1HA1A 4RWXA 4M1KA 5BYRA 2K3KA 1VQ4S 1HPZB 2JFDA 2BRLA 4HLBA 3EY5A 4UTGA 5EHHA 3QFWA 3PB7X 5A6PA 3PYFA 3R5CA 2N82B 4RUAA 1PO6A 2UXDJ 2C27A 1KTQA 2IAJB 2XC9A 3DLHA 5LT5A 3MUTP 2L3MA 3MMAA 1G6BA 2BE9B 4OJ1A 3TC8A 3H8YA 2GX8A 2H4YB 1N48A 1Q2DA 2RQKA 3KK2A 2DHXA 2VFVA 3N79A 2JC1A 4LF9F 2NZCA 4C0BA 5FDLB 3H7HB 4CLFA 5D3GB 4NLRA 1T11A 1SC4B 1QUVA 1IJEB 1EX8A 1PUAA 2PJ0A 5HXDA 2JLMA 2O5DA 3BGUA 2VHGA 1TVRB 2BE7D 4P74A 5F8LA 1Q95G 2ZM6F 3K8WA 3FEEA 1FXRA 2XMVA 3B54A 3CSKA 4NPOA 1M1HA 2XMTA 1IBLJ 1H98A 4QZVB 1B0PA 4CZCA 3ZTSA 3Q8QB 4PZVA 1S0MA 2QMLA 3HHDA 1H6KX 4PQUB 3PDNA 4U9RA 3POTA 4QIWD 3H42A 3P2HA 3M8QA 3R7SB 2XI3A 5HROA 2ADBA 2XLJA 3MEEB 4HHJA 2B4OA 4RX6A 3NCQA 3UVJB 4C8OA 2W8KA 2PR8A 4L73A 3DOLA 1KRPA 2V4RA 4ZVFA 1EARA 2AHOB 5LYIA 2DIVA 4TY8A 1XMBA 1XOVA 2KZMA 2XLKA 2ARHA 2HVIA 1Z8XA 2O1PA 1H7WA 2B4UA 2CQCA 2ABZA 2KN4A 3B82A 2FHJA 3AOCA 4QR2A 2WOMA 3KHXA 3L2NA 2JEWA 3BYRA 2FGOA 1S9EB 1K9MT 1N5SA 3MEKA 4F4ZA 5D6GA 3O44A 2CIMA 1NDPA 4P52A 5I3PA 2MTLA 2CTCA 2I1RA 3RW6A 1RHRB 3I0SA 4A38A 1ZTTA 1TP7A 2GJFA 1NJYA 3QO9A 3KWMA 2EVNA 2OPSB 5JJBA 3BKTA 1KKHA 4DL7A 1JXVA 1D09B 1GXTA 2PE3A 1H2UX 1N5YA 4B9NA 1LW0B 3LP0B 1JLEB 1SKSA 4OMEA 5D15A 1O0PA 3SDEB 2RQCA 3Q8VA 1NDKA 4HNYB 4R25A 3PR5B 3PB9X 2N4DA 3DU6A 4N76A 3L3CA 4FD6A 1GH8A 1RADB 1MSWD 1UFHA 1Z2ZA 5I42B 2EK1A 2PVWA 1J27A 3DR6A 2RKIB 2IFXA 4U8YA 3FRZA 3CCWA 2F8EX 2J7KA 3CJ5A 4B9LA 2H5JB 5F49A 3JYTA 4CYPA 3EXNA 4Y65A 5IZHA 1UJ4A 3B3TA 3G3SA 1O5JA 3OSNA 3PV8A 3OXGA 1FNXH 2VPYB 1DURA 2MSSA 2F4VJ 3LH2S 3BQ2A 4MFQA 4PEOA 1CC7A 1VJWA 4ICLA 4LVNP 1YW6A 5CQGA 4CO4A 1FNMA 2ZH3A 1H38A 1E6VA 1M5VC 3G6XA 3UY5A 1S77D 3T90A 4YHHF 3VV2B 2HHVA 3WBZA 4GKJJ 4DV4F 2C3PA 4LSNB 1J2VA 5AXNA 4ZVEA 3JTNA 3BXMA 4KGVB 1FKOA 3BKFA 5EBVA 3PX6A 2PT0A 4HYKA 3THTA 2MQOA 5D8HB 2GZOA 3MHYA 2B4DB 4ES2A 1U25A 5KFDA 3QLHA 5HANA 4LF1A 3IM9A 4DSLA 1Y0YA 2XS5A 3TVZA 3S9NA 4R76A 1EE3P 2ZITA 2RB7A 5K9FA 1NJIT 4I68A 3D0HE 1UMJA 1B6BA 1SH2A 2FLLA 3CCRS 3D6FB 3OTEA 4KTQA 2CPYA 2VKZG 2BEIA 1XJOA 3PKYA 5LYDA 2DHHA 4NA2A 4Y49B 1VIXA 1IBMF 2BR0A 3DLKA 3J81U 3M8PA 1D1UA 2B3VA 3UFCX 1S5ZA 1HDQA 4PYDA 3SI2A 3TUPA 3ZZOA 4XDDA 5KFUA 4AFFA 4P2FA 2I0XA 3I32A 3HP6A 5F8NA 4ZCMA 1UA1A 2M4MA 4K4YA 5IB0A 3ISND 1WACA 2F7VA 4C8NA 2B51A 4RWWA 3SYZA 1DHMA 5KG6A 3WQPA 3P5TL 2HFZA 4C9DA 1IWGA 1SL2A 3PB4X 1JJHA 3R5GA 3CF5Q 1P4NA 2BRKA 4USUA 2IPOB 4A37A 1FX2A 4BC7A 1FRJA 1YWXA 6AT1B 1FT8A 3VAKA 4FD4A 4KVME 4F7VA 4OIXA 3R1LA 2DKOB 3IU1A 3B3VA 3LMSA 1AUGA 4GKJF 4RLEA 4WFYA 3M8ZA 3GQCA 2VKRA 4LSZB 1SH3A 2HRUA 1CLFA 1KP6A 2UXDF 2CIJA 1OIAA 2G9DA 1YBUA 4CGOA 4C8ZA 2FYXA 1S9EA 2P2CB 2KFYA 3BDPA 5U47A 4B12A 1UWBA 3A3NB 4UEFA 2Y9HA 4M3SA 3HSGA 4U67Q 4F4WA 4YB7A 3P3DA 5H84A 3JQJA 2X1FA 2MGZA 3FQKA 4NZ0A 1S1XB 3OUYB 3A12A 1RTZA 1WC5A 1Z1ZA 4JI7J 1P27B 3C15A 2N7CA 2Q1LA 1WEXA 9RUBA 2DJWA 2CNTA 3PEIA 4W98A 3WX4A 2FQQB 3CMQA 5CABA 4HNWB 3S6GA 4YDDB 1W25A 4PSWA 4NMLA 2EFOA 2ZKTA 4FVMA 3IGRA 3W63A 1TF9A 5T7LA 2FJWA 1GHEA 2C3UA 2HQFA 3A8KA 3ZZZA 4ZIVA 3TZWA 4DL2A 3QGGA 4DQRA 2ZHOA 4QW8A 3BBCA 3K5LA 1M4LA 2QL9B 2RRNA 5F3TA 2PJ1A 2Z11A 3D6HB 3PB8X 4FXWA 1RAIB 1P1TA 5FD1A 1WWZA 2RVJA 1XMTA 2KRBA 4A8SA 1M4IA 2R7SA 3DDDA 5JXSA 2Z0ZA 4NZ6A 4WBFA 3OL7A 4KPYA 2KU7A 4B3RF 1TAUA 2NPIA 4OQJA 2G1DA 1S1UA 1CEZA 1X12A 2O66A 2M8HA 4IUSA 4ONUA 4FDFA 2ZBQA 3S6HA 2BZ2A 4TXSA 4X4RA 2Q4YA 1Y5IB 4KVXA 5LXRA 4QBUA 2UVRA 5EWFA 4I7FB 2HAFA 2HHPA 3SEOA 4XPCA 2XHWA 3DSBA 1DTTA 1WI6A 2BMBA 4IUFA 1N34F 3MM6B 1WK4A 4M5JA 4HVZA 4H2KA 3G2XA 4KOSA 4DG1B 2W4DA 4Q38A 3RTVA 1TV6A 1W26A 4PRFA 4ZPAA 2VA3A 1TR0A 3CDEA 3R1KA 2O53A 4CO0A 4RNOA 2FJEB 3A13A 4OI0A 2RDIA 2HMIB 2HHSA 4JB8B 4B5OA 4QPTA 2QSWA 3TOBA 4NLOA 4YUDA 3D67A 1U6FA 2VBZA 2XMKA 2R98A 3JQMA 1YBAA 3QAEA 1E6YA 2OFGX 3EVOA 2QA1A 4NLPA 5A2QU 4CYNA 3V8IA 1QM9A 1NK6A 4NLGA 4ECWA 4A8FA 4DFPA 5MLCV 5C25A 3SIPB 1YDLA 2IM0A 3SFUA 5L1IA 5CYMB 1GMWD 2J9AA 2VPWB 5DG9A 4CRZB 3C8YA 3AH6A 1IKVB 1BC6A 2KT3A 3NNAA 3KKWA 2Z10A 4C97A 3RB4A 4ECRA 2UUCF 3CCJS 4LF5F 2CNOB 3SXLA 2CQDA 1VIOA 4AVCA 1J5EJ 2DGTA 4C2YA 5FVJA 1VI7A 5AT1B 5GMEA 4LRAA 2VBQA 1Q7LB 3O6QA 5KFXA 4ORFA 4X8IA 2LVWA 2Z3LA 4DPWA 2IBOA 3UWTA 4I56A 3I31A 1X9WA 2FLPA 3LALA 4IO9Q 5C82A 4RU2A 2NMTA 4U9YA 1FDAA 3WDOA 2OI2A 2W2PP 2VG7A 4J37A 1L3KA 4OHXA 3THPA 1UZHA 3W60A 2RUGA 4OZ3A 1RBLA 2K7KA 3TNVA 2VQEF 4RKUC 4UFVA 4CLUA 4CYUA 4X4NA 4USKA 1ZM3A 2AFWA 3CDXA 1SQHA 2GIQA 8AT1B 3UI3A 3T5LA 1VISA 4KFBB 3IWLA 4ER8A 3J80Y 4L8AA 4ELTA 4HHHA 3GFZA 3R9EA 4Y2AA 1IOIA 5DM7Q 2BW7A 4LF7J 1VR6A 4M5HA 2C2RA 3C2PA 4OV1A 1WKJA 5E7OB 4LFCJ 5I0CA 1BPMA 1UJ5A 4WFAQ 3FBCA 2QN6B 3EDQB 4U8VA 1YK9A 2XG8A 4LFAJ 5HVGA 2A4NA 1Y4ZB 4ED5A 4ANCA 5B0DA 3R97A 1U8SA 3BPDA 3NAHA 5KFWA 2B9EA 3K0JA 2Y1RI 2YWGA 1DQAA 2D41A 1BWEA 1R0AA 1BE4A 1VS3A 1U4BA 4NLUA 1JLCB 2ZVSA 2K1RA 1GXUA 1X8DA 3PEHA 4NGQA 1BHNA 1RWXB 3IR6B 4OJ3A 3LGMA 3V6DA 3P49B 1KHWA 4DPOA 1S9GB 5KFVA 3D7HA 2CWXA 4XPLA 2MKCA 5C5JA 3UNYA 1FJGF 3OQ2A 1HI0P 4LSLA 2HQCA 3ZNUA 3V6HA 4JI2F 3KLHB 3KJQB 2DNKA 2QLJB 5H9EJ 2VD3A 3MEGA 4JI5J 3BO4A 2AJ6A 5G22A 3MAHA 1ARLA 3PB6X 4M6HA 3SSRA 2DITA 3TTHA 4Q8FA 2QV6A 1TMMA 4IRDA 3L09A 3CDUA 3R5BA 2AJ4A 4NRTA 4PAAA 3VWSA 1AFJA 5HVFA 3Q83A 4KGXB 1FEEA 2LU2A 1HKAA 2MKYA 3SQOP 5HP1B 3VWEA 4JZ0A 1EIYB 3RG6A 4BINA 2HVHA 5DWNA 3OTOJ 2MSTA 5CPAA 2GHVC 5L39A 1WG1A 4YGOA 2ZEJA 4UEZA 2PC6A 2ZFHA 1K44A 2EFPA 4DL0C 2ZH5A 2AGOA 3MR6A 5GMKa 3D6MB 2CJAA 5CYMA 5F8MA 3PRVA 1SJ1A 4NLYA 3CC4S 1LANA 4LBPA 1Z4EA 2FZCB 4MKVA 4CLLA 1G4CA 2C2ZB 4PG6A 2Q4ZA 3CPXA 4V1Ak 2ZH6A 4ZVTB 2MQQA 1HBUB 5E3AA 2NYQA 2HHHF 4ECUA 2HFSA 4HHUA 2HGMA 1RU2A 5G21A 3DLLQ 2BANB 3CDBA 1S60A 2H1YA 4Q43A 2RIJA 1N36J 4BD9A 5KFYA 5L1JA 2FE7A 1LQ9A 4Q8EA 4RW9B 3H5UA 3WC6A 3NGDA 4DR2F 3C14A 4CM2A 3PVXA 3DGVA 2J8RA 2UVUA 3D8PA 4A31A 1FJEB 4PCQA 1B7FA 4CLTA 3PRBA 2E5HA 4MHDA 4NXYA 4J9QA 4N47A 3W9HA 3UD3P 3KJVA 4J9RA 3GR1A 1YMEA 2XSJA 4OHYA 1C1CB 2FXFA 4CGPA 1S9FA 3IFEA 2BOPA 2MKJA 4B14A 2VEZA 1U8WA 1BAVA 1TL1B 4DV3J 2V2KA 2EG2A 2V9KA 2IA0A 3FECA 1MNEA 4DPXA 4CAFA 2DB1A 1FF2A 1EETA 2W7PA 2XCPA 4MIAA 2UV8G 2W9AA 2KXNB 1XC9A 1IM4A 4NX9A 2YNCC 2EK8A 2F3JA 3TP2A 4P7TA 4JYAF 4GKKJ 1S6QA 2J9CA 2R8IA 3T1HJ 4LF5J 3MMCA 2DTJA 1FCAA 3K7RA 2YKOA 3ZZPA 1TK0A 2AMCB 3KR4A 4MY0A 3HO1A 1U1KA 3FZBA 4LBIA 3FJUA 3OHBA 1HWJA 1L3UA 1X9SA 4K50A 5KFMA 2REEA 1HIYA 3EDRB 1T03B 4N8OA 2ZOGA 2WVBA 3FEZA 4MYUA 4M5LA 3S6FA 1H0HB 3AFGA 3NGUA 4ZOSA 2R3VA 1VC0A 4P73A 3CC7S 2L9NA 3LTOA 3B8HA 3NH5A 4IOCQ 5CNPA 5KTCA 5KG4A 4BLGA 5IB9A 3FEXB 1ZO0A 1RK8A 2I79A 1LFWA 3GIMA 4NASA 2ZHAA 1UW9A 5L46A 1S5KA 2IQ6A 1FFSB 1S9GA 2RRBA 2J8NA 4HT7A 3TO9A 1NO8A 2MYFA 2JLFA 3RGIA 2Q6BA 2C2OB 3DLJA 2VXKA 1RO5A 1JLEA 1F2HA 2HNDB 2ZZTA 3DDIA 2CNNB 5E0OA 4ED7A 1HL6A 1JWQA 4MJ8A 2KHDA 3RBEA 3H40A 3M2RB 3QMQA 4UOHA 4MKBA 2OKQA 3W64A 2MZ1A 2DGOA 1JK9B 1PC4A 4BCAA 4HH0A 3CNQP 2PJ5A 3DGPB 5IV3A 4XPDB 2Q7SA 3HHLB 3W2VB 4CS0B 1FDDA 1H3DA 2JVRA 4ECYA 4ZHRA 4CO5A 4HPSA 5KTAA 4W90B 3EICA 1G7CB 3CVKA 1VCTA 4KRWA 2LMIA 2IMWP 4WTOB 4ZCKA 2MPUA 4F8ZA 1HBOA 1C0TA 4FNHA 3T1HF 2UUBJ 2D7SA 3DOLB 5KFKA 2LXIA 3OR2B 2HNZA 1KONA 4PWDB 1CC8A 4NE9C 4F02A 2HPUA 5FLXY 1N5VA 1C1BB 4E8UA 3P8BB 1FY7A 3FB3A 2R1IA 3ZTPA 1SC6A 3SSSA 5G20A 3RYLA 1VK8A 3LWMA 2R7UA 3PKMA 4FF2A 1YJVA 1AUSL 2Q6CA 5K14A 1HWKA 1C1CA 1VQ7S 2XBPA 2K1RB 3I6PA 2M5YA 2NUHA 2GS8A 1YJRA 1YLXA 2IIHA 1ZBTA 2FJAB 4HH1A 3ELHA 4USMA 5F8IA 2EW9A 3DMJA 3FF3A 2DNMA 1KWMA 3KLHA 2R7TA 1RGVA 5CYQB 1MMDA 1VGYA 3QT6A 3H0PA 4WP9A 1B0TA 2CTBA 3HSJA 3GIKA 4HDGA 3Q2TC 4IG0B 3VZHA 3TAPA 5IT9U 4FD5A 4IFYB 2VL1A 2HS4A 4MFBB 2C1CA 1X7VA 2R2TA 4C11B 1IVZA 3M32A 3DXBA 4DUTA 2UVVA 3W66A 2AD9A 2RRAA 2KYXA 2ZPAA 3R7NB 4B02A 5HN0A 1KFSA 2VZZA 5JQ4A 4JI3F 4J91A 2RSQA 3I9SA 1HLWA 1VLYA 1KD1T 2HS3A 3BS9A 5J2NB 3A3OB 2R7RA 5KFTA 2ZUGA 1QSMA 1LV5A 2ZEPA 3T9ZA 1SB6A 5KFJA 1WDTA 1HBMA 3S9MA 4KPCA 2PSWA 4P4JA 4LX9A 1UKUA 4FYVB 2YQ0A 2V63A 2RQ4A 3UO0A 3CJ3A 3LODA 1UWBB 3BBBA 4EK2A 2V67A 5J2QB 4WZQA 4EUVA 3MDFA 3U1NA 1VQNS 5A27A 2AEFA 3HF5A 1WELA 2HHWA 1CQMA 4WTYA 4Q0BA 2KL8A 4QR0A 2FJDB 4AYBD 3T1AA 2BANA 5DS7A 1XNRJ 3G96A 3VR1A 3ET6A 3HT0A 2FY1A 2IVYA 2P8IA 4MMOA 1WG4A 2Q0YA 2K7JA 3MM7A 3PG9A 4WXWA 1Q8IA 3AD8C 2YWKA 1NU4A 2EUIA 4Y00A 3T6JA 2HLUA 1WEYA 2LQ8A 1VRUA 5LJ3Y 4B9VA 1UA0A 4NRUA 5T14A 4I6WA 3PRTA 5KFSA 2NREA 3M2RA 3TEHB 3PW0A 3VQTA 5B08A 4KOWA 4HI2A 4ZVGA 2VPXB 1C4AA 4J9UE 1VQYA 2H4WB 4YMEA 4I2PA 2V34A 3BQ0A 4NLWA 3LWUA 2E5LF 4C11A 1H74A 3MR7A 2CXAA 4R3KA 2IRUA 4YY3F 4FNIA 2XEXA 1VMBA 4ETZA 2IDEA 3QO9B 3GYAA 4K3NA 1VJQA 3NOGA 1FK9A 2WZNA 3DI6A 4ZJLA 4A30A 3GPAA 4LRDA 2G9OA 2D4PA 3KLEA 2VG5B 2FVRA 2Z3KA 4LIWA 4OYZA 4FF1A 4DOZA 1HBOB 1LK5A 2MDAA 3L95X 3MCSA 3LP0A 4KC5A 4DV7F 1M5PC 3VAIA 3FFIA 3TYTA 4Q36A 2YKNA 2W9BA 1UETA 1LWEA 5A76A 2NXCA 2HNZB 2DRBA 1PJ5A 2HS0A 2QO3A 4F26A 2YGWA 5A8WA 3QZ7A 1XMOF 1QAIA 1FESA 2DK2A 3NGRA 3NXZA 1MWYA 4DFMA 3QGPA 1M5KC 5D4LA 4R8UB 1UFKA 2CJQA 4F04B 2I5JA 1U45A 3W5YA 1M4GA 1CPSA 3G87A 2E1MC 2KRRA 1RTIA 3M2UA 2MXYA 1TKZB 2J6SA 5M2RA 2QYGA 2FPHX 2BE2A 4CNZA 2ROPA 5ETPA 2HHTA 5K5MA 2MB0B 1MROB 4LF8F 4K4UA 2B8QA 4LQ6A 3CCVS 1C1BA 1TK8A 3QWPA 5EWGA 4QWAA 4NXMJ 4ZPTR 3NBPB 1TKHA 3CXQA 3VH9A 2F4VF 5G0RB 1Y9WA 4MHZA 3N7ZA 1HQUA 2H9ZA 2FIUA 4ZP6A 1SIZA 3BQ1A 3ZTQA 4PXDA 3GFYA 2D3UA 1ZLIA 1V0CA 3EGZA 3DM2B 4MCRA 3TAQA 3LQVA 1RWUA 4YN3B 5K14B 3AA9A 1U0HB 3IO1A 3WIUA 1JJ4A 4KHRA 4AD6A 2JDCA 2AGQA 5A6WA 3J80U 2B9YA 4X66J 2C2EA 5HQ8A 1TFWA 1WSVA 1VQKS 7FD1A 2CZ4A 2HK2A 3MMBA 1XE4A 2W01A 4H4MB 2ZW4A 2WRMA 1S6PB 4N5SA 4PUOA 1JLQA 5KG3A 3PACA 1BO4A 5F09A 1Z4RA 1ZG8A 4DV2F 1JJ2R 3DLBA 1N56A 4IKAA 2FHOB 3VGSA 2W25A 3GMGA 3QFHA 4F0HA 2LFVA 2MZTA 1MN7A 4KVOE 2MEWA 4OIDA 3WC7A 1RCXB 2DXEA 1HNZJ 1TKZA 3L9ZA 4KHPF 4UY8T 1U2CA 4P4FA 1XMOJ 2A6OA 3HHEA 1KOHA 3HHLD 1CP6A 3LW5C 3OPKA 2EWBA 1RI7A 1YJTA 1B70B 3V81B 3R3TA 1VBXA 1PYOB 4O3RA 4U95A 3M8SA 2ZH7A 4DYOA 1ZAVA 4WP3A 3JAMU 1U49A 2FLOA 4PWDA 2YX4A 2CPDA 3R96A 4Q5VA 2J9DA 4MHNA 5DDRC 3LF0A 4RW8A 1QSTA 1HNIB 4KKOB 2DCUB 2BUEA 2Q04A 1DTQA 1YHQS 3TANA 2ZD1A 5C42B 2BJ7A 3NWGA 4WKYA 4U9ZA 1EHWA 2YNFB 1KLMB 2ZE2A 5H86A 2CQ2A 2DNLA 2Z2YB 3ET6B 3IWXA 2O28A 1IBKJ 4DV1F 2PRBA 4AXVA 5C7PA 3S6EA 3RRKA 4DZ6A 1NB2A 3QATA 3SI0A 3B8GA 3PCOB 2WCXA 1FFGB 2CNMA 2G0CA 2HW3A 3KHRA 2QVPA 3EGNA 3GSDA 1PG5B 1APSA 2FT0A 3PX0A 1RDRA 2MQPA 1RAFB 1Y3JA 3PZPA 2Q79A 4A48A 1MJAA 1M1GA 1BQMB 4L3KA 4WCEQ 2CPHA 4H6ZA 4KOXA 1R0CB 4XAKA 2V9WA 2G3TA 1RTHA 2OU2A 3HXMA 1X4GA 5KG2A 1UVLA 3X3UA 5A8WB 4MFBA 5F46A 3F8KA 3G82A 3EWGA 4RPFA 1T9TA 3MURP 3CCLS 4KZTA 2MJNA 3DRSB 1RWMB 4UBRA 3MFIA 1RT5B 3MEGB 3UDLA 4B5PA 4KO0B 2LECA 1UCNA 3OBIA 4NCGB 2ZBCA 1KDNA 1N4LA 1SUQA 2F4FA 4UF4A 4U6PA 3T41A 4NYOA 2BM0A 3O8WA 2PFDA 2IM2A 1WHYA 3WC0A 4LF4J 1Y7PA 4X5KA 4GVLA 2BKNA 4DR6J 4OJGA 2PI5A 1U6ZA 1OS5A 2OIHA 3BLNA 3FJ2A 3KG1A 4A8KA 4DLGA 3TVYA 2LLZA 1L3VA 2ZNYA 5DM6Q 2E7VA 3FCVA 1U0SA 1IR1A 1NDLA 1TZ0A 4N56A 2ZKUA 4I7FA 2DNQA 2Q7BA 4KORA 5IWAF 4DX8H 4JI6J 2NR0A 1F2OA 4KBIA 3KOAA 4ZIWA 1REGX 2VICA 2G2OA 4X3RA 4FF3A 2CPJA 2CNLB 4Y2IA 2JDDA 2XZDB 7AT1B 2XMAA 1UVMA 3IN5A 3PW4A 2DXFA 2M52A 3THVA 5F0UA 4NCBA 1ICEB 2C3OA 4UCNA 4DSFA 5B0BA 2PIIA 3E01A 1GYTA 2WB4A 3EGVA 2KB2A 5EX0A 5D4NA 4FAIA 1R0AB 2LEPA 1CBXA 3BN4A 1P8GA 4B3TJ 4IQMA 3KK2B 1VBKA 7FDRA 1VHSA 4PK2A 2XGPA 1TKXA 2C6CA 4LQGA 1MW7A 1SC3B 2BJDA 4X2BA 2OSQA 1TTHB 4OIWA 5DG8A 3I0RA 4O3OA 2AYEA 2MLXA 2CQ1A 1KFDA 2WBMA 4J9SA 2HWIA 5I3UB 2C2DA 4XNHB 1U26A 3G4SS 2WSCC 2Y0SD 3A8IA 3ZNJ1 2DY1A 2WSFC 4X4PA 4ED6A 5E3RA 3HFVA 4GM5A 2LQ9A 1S48A 4TYAA 4DQIA 1FKOB 4R8UA 5KT7A 4WWVA 1ELLP 3NCPA 3FK4A 1HNVB 1P9QC 1JLAB 5B09A 3FEDA 1RTJA 1J5EF 2UUCJ 3DRXA 3NS7B 4B10A 3RZAA 1S1WA 4TWEA 1HW9A 2NPFA 3IJ3A 4F9UA 4OC5A 2DNRA 4KSIA 1VDHA 2FHMA 2D3ZA 1RXTA 4OLOA 4OC3A 5KT4A 4DHVA 4J90A 1YBTA 2VG7B 2GMJA 2HFUA 3JTPA 4B9MA 3M8PB 3NMAA 2JBJA 2WPWA 1TQLA 2HWTA 3GCWP 3KMQA 2CQPA 3U1MA 1UEKA 2AT1B 4NMXA 3NMRA 2OHDA 1KLMA 4MIBA 1H8LA 1REVA 1EB0A 4H54A 2VBYA 3L4BC 1R8HA 2L48A 2N4CA 1TELA 3HCXA 3T5KA 4I2QA 4B3OA 2KO1A 2OPSA 2DPJA 3R2CJ 4EYIB 3C6UA 4I0WA 5D77A 1WC0A 3MFHA 3BSAA 3P2FA 3GLJA 4ECSA 2FVQA 2XMWA 4NF1A 4P4EA 4MAKA 4KS9A 1WC1A 4WWSA 1IYLA 4KUAA 1FE4A 1S7LA 3EFAA 3H5YA 1RXOB 1RA7A 3NLCA 2B0GA 1HARA 1SQFA 1N8RT 4JI8J 1LAPA 4NCGA 4C0HA 2BUNA 4Y49C 4CQ1A 1VQSA 3G82B 2NUUG 1R8PA 3PGPA 3TO8A 5J1EA 2BOAA 1OY9A 5IQQA 4B3RJ 2FJBB 2BQ3A 4WYWA 5AG4A 2V2VA 2JEVA 3CDWA 2VONA 3ZTOA 4NCZA 2XS2A 1Y7RA 3OVBA 2DEJA 4DR5J 4ZS6A 2E5GA 2WPXA 1KZFA 1WTBA 3H5ZA 3AODA 1Z2LA 4UCPA 3FSIA 3CO0P 3CWJA 4QWBA 1I5OB 4UY85 3D7SB 2V8VA 3GV7B 3HZGA 2IC3A 4DX7A 4YB5A 4WFNQ 4MHPA 5E33A 2V5HG 1N34J 1N32F 2RC4A 4DWIA 3EVMA 3I55S 1MMNA 3QJPA 5ETVA 1N6QA 2GVZB 3GZ7A 1KQKA 1TUVA 1SVDA 1IKXB 2FIAA 1HNIA 3FRYA 3ILIA 4WIQA 2WONA 4I1TA 1REVB 2DO0A 2VU5A 2LKZA 4AE5A 3N0VA 4KQZA 1HWUA 2QL5B 4XTTA 4TY9A 2Q51A 1BQNB 2BSWA 2MKKA 4JI2J 2QIFA 2XWYA 1IKYA 4GO5X 4CLKA 4ZLLA 3GTYX 3V6JA 3M7VA 4OHZA 2ZEGA 2VJVA