1R43A

Crystal structure of beta-alanine synthase from saccharomyces kluyveri (selenomethionine substituted protein)
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
438
structure length
438
Chain Sequence
GTLNLPAAAPLSIASGRLNQTILETGSQFGGVARWGQESHEFGMRRLAGTALDGAMRDWFTNECESLGCKVKVDKIGNMFAVYPGKNGGKPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNYVPNYDVCVVVWFNEEGARFARSCTGSSVWSHDLSLEEAYGLMSVGEDKPESVYDSLKNIGYIGDTPASYKENEIDAHFELHIEQGPILEDENKAIGIVTGVQAYNWQKVTVHGVGAHAGTTPWRLRKDALLMSSKMIVAASEIAQRHNGLFTCGIIDAKPYSVNIIPGEVSFTLDFRHPSDDVLATMLKEAAAEFDRLIKINDGGALSYESETLQVSPAVNFHEVCIECVSRSAFAQFKKDQVRQIWSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPEEIENGFKVLLQAIINYDNYRVIRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Yeast beta-Alanine Synthase Shares a Structural Scaffold and Origin with Dizinc-dependent Exopeptidases
pubmed doi rcsb
source organism Lachancea kluyveri
molecule tags Hydrolase
molecule keywords beta-alanine synthase
total genus 143
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature ec 3.5.1.6: Beta-ureidopropionase.
pdb deposition date 2003-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r43A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1r43A01
4YU9A 5LRJA 1TF8A 4UEEA 2PJBA 2EK9A 3GLJA 1RTQA 1Z8LA 2PJ4A 3SJXA 3KHZA 3NFZA 2PJ8A 3I1UA 4IHMA 4EMEA 1EE3P 1XRYA 1ELLP 2POKA 5JH9A 1QQ9A 4OC4A 3PB9X 2BCOA 1Q7LA 4A38A 4A94A 1YW4A 3BI0A 2PJ6A 2ZOGA 2PJ7A 3D67A 3S9LA 3PBEA 4EFDA 4BD9A 1Y0YA 5JM6A 4TWEA 1TXRA 4OIWA 1M4LA 3DLJA 4Q7AA 2XEFA 4OC5A 1ZG9A 3FEEA 3QNVA 1Y7EA 2XEGA 1VGYA 2PJAA 2RFHA 2PJ0A 4ZY1A 1NSAA 2PCUA 4O23A 4CPAA 3K9TA 2ZENA 4FBEA 3KI9A 2PVVA 4K3NA 2CTBA 1ARLA 3SI0A 5HVFA 5THWA 3D7GA 3IWWA 4R6TA 4W9YA 3SJEA 5LYLA 3FF3A 3CDXA 3FMCA 4P4BA 5LYFA 3DGVA 5D8NA 1OBRA 3PFEA 4MMOA 4UIBA 2ZEPA 2PRQA 4TNUA 1Z5RA 3KQXA 3K2KA 1CBXA 1CP6A 2NYQA 2PE3A 3PRTA 1IY7A 1CG2A 4NFRA 4PXCA 4P6YA 3V7ZA 6CPAA 4ZX8A 5K8NA 1TF9A 1AYEA 2IJZA 2EK8A 2CF4A 5K8PA 5J1QA 1XBUA 3D7HA 3KASA 3H8EA 3B2YA 3KQZA 1Z2LA 3D68A 2PJ1A 3B3WA 4ZYQA 1BPMA 2ZEOA 1AMPA 1CX8A 1YW6A 1CPSA 3BHXA 4G1PA 1UWYA 2PJ5A 2Q51A 3V38A 3VARA 3FVLA 2GREA 1CPXA 4PXDA 3IJ3A 2ZOFA 3NA6A 5JGFA 5K8MA 2C6CA 2C6GA 2AFXA 2ZEDA 3L2NA 1IGBA 4YWYA 1VHOA 3CPXA 1HEEA 1BAVA 4LQGA 1ZLHA 3GUXA 4MHPA 4NJRA 2V77A 1KWMA 3RZAA 4JZ0A 4F9UA 3D7DA 3H8FA 3S9NA 1GYTA 3TX8A 2QYVA 2Q4ZA 5HVGA 1R43A 4OC2A 3FJUA 4MCRA 2C6PA 3PBBA 1ZG7A 1LAPA 2F8HA 4P10A 1LFWA 2QVPA 3B3SA 4UIAA 3ISZA 4OC0A 3GB0A 3FX6A 1LOKA 3KR4A 2CTCA 2ANPA 5CBMA 2PJ3A 4OC1A 3B3CA 3RBUA 2O53A 4X3RA 3S9MA 2C1CA 3NH8A 1F57A 4DJLA 2AFOA 2DEAA 2PIZA 3KGQA 3PB4X 4FAIA 4MCSA 4WJBA 3VATA 2O4HA 2HB6A 4NGNA 2WYRA 2BOAA 3ISXA 5K8OA 3KL9A 1FNOA 1HDUA 2ZELA 4F8ZA 1DE4C 2V8DA 1QMUA 3FECA 4P44A 4X8IA 1YLOA 4FUUA 4JYWA 3PB6X 4NGSA 4WWVA 1ZG8A 4R8FA 3FEDA 1XFOA 4ZY2A 1Y0RA 3D4UA 4Z65A 3CPAA 2IMOA 3PB7X 1PCAA 2GLFA 4OMEA 1BPNA 2HC9A 5D29A 1CP7A 1LCPA 2I3CA 4P4JA 4P4DA 1TKFA 1ELMP 4EWTA 3MRUA 4OKOA 2CIJA 2PJ9A 4ZX9A 2EWBA 2V8HA 2OOTA 3B35A 3KHXA 2AFUA 4MHNA 2ZEHA 2V8GA 5LYIA 2F7VA 4FWUA 4MCPA 3N5FA 5CPAA 3TC8A 3D66A 4F9VA 2ZEEA 4KSIA 4MCQA 2AFZA 4PXEA 4A39A 4P4IA 3LMSA 2PVWA 3LWUA 4P45A 4OIDA 1LAMA 7CPAA 2ZEFA 4MHYA 4NGRA 4PPZA 4NJQA 3RAMA 4MHZA 3SI1A 3WT4A 2ZEGA 3PB8X 3HUVA 2JBJA 1ZLIA 4P4EA 3WC6A 3SJGA 3JRUA 4IK2A 3VH9A 8CPAA 3NH4A 4OC3A 5F09A 4X2TA 2GU2A 1JQGA 2ZEMA 3FH4A 3KZWA 2GLJA 4NGQA 5LRKA 2PIYA 1VHEA 2NSMA 1BLLE 3SJFA 1TKJA 3D7FA 4ZY0A 3KR5A 1DTDA 1YMEA 4MRIA 3IEHA 2VL1A 3WC5A 3WC7A 2XEJA 3WABA 3PFOA 2JEWA 4NGTA 4R76A 1XMBA 2AFMA 5DS0A 4B6ZA 1YSJA 2FVGA 3IC1A 2J9AA 4GM5A 4PQAA 5I4MA 1PYTB 4P4FA 3CT9A 2AFWA 2AFSA 4UEFA 2PJCA 2BO9A 2IQ6A 4ONWA 2V8VA 2XEIA 2RB7A 5HVHA 4IAVA 4PXBA 3BI1A 1H8LA 4R7MA 3BXMA 1XJOA 1R3NA 5IB9A 3HLPA 4ZI6A 5HXDA 2QJ8A 2ABZA 4OP4A 1LANA 5LYDA 1ARMA 1TKHA 4AXVA 3MN8A 3IFEA 4DYOA 3B3VA 2PJ2A 4RUHA 4NGMA 2G9DA 3PEIA 3T8WA 4MXUA 2Q43A 4NGPA 1VIXA 3IO1A 3B3TA 1F2PA 3H8GA 4A37A 3NH5A 1FT7A 1HDQA 1F2OA 4UEZA 4UF4A 2OR4A 5ELYA 2JBKA 4H2KA 4DUKA 2WZNA 5LRGA 3SI2A 3IIBA 3B7IA
chains in the Genus database with same CATH superfamily
4I2PB 2MQLA 4ZVHA 2RRBA 2H1YA 3GLJA 1X8DA 2EKNA 1GXUA 2PA8D 2WAQD 3DI6B 4RO0A 4DFPA 1CLFA 3DRRA 4CYPA 3HVTB 2ZVSA 3G6VA 4C7IA 5FDLB 3Q2TC 4QOTA 1M1HA 3SCKE 1VC6A 2NSBA 2CQ3A 5KFDA 2G2YA 3S9LA 4Y28C 3E2EA 4ED1A 3M6WA 1KS2A 1I12A 2HWIA 3IM8A 1RWOB 2AKWB 3G96A 1SQFA 5C25B 1S10A 2IVFB 2W4CA 5I3UB 4Q0BB 2RFHA 4O23A 2JDJA 1BQNA 5CCLA 3DRYA 2ATCB 4RX6A 3SI0A 3SV3A 3NGDA 1VIOA 2XULA 4QQBA 1HR0J 2Z30B 3KNAA 4NF1A 5KFVA 2W7PA 1KQKA 2Z2ZA 1A0OB 4OLLA 4I6WA 2W2QP 3GCWP 1RP5A 4LF7J 4MI4A 3TA2A 2HV2A 1CBXA 2B0GA 3CDUA 1G7CB 3SXLA 3L95X 1NK0A 3D7SB 3VAGA 1QM9A 3TZWA 1S60A 1N34J 2FHKA 3OT9A 3T5JA 3D7HA 4DV7F 2YKOA 2BKNA 1QSSA 2AJFE 2R7VA 4NA2A 3POTA 2B4BA 2KJWA 1WHYA 3E01B 1YVFA 4ED8A 3RRKA 2HFOA 1V3RA 1Q7YT 2C6CA 1TKXB 4MYTA 3Q8SB 2RQCA 2WVEA 2OTLS 3CJQA 1FI4A 3QAUA 2HBQB 5AXKA 2V77A 3BF4A 2DH7A 1AB8A 1FDAA 1QSRA 3U1NA 4ED3A 5HVGA 4EEYA 2AW0A 5F47A 4JI5J 2XLKA 1ZG7A 3UNGC 1YJ7A 1KQFB 4TYAA 2C3MA 1WWHA 2A2CA 3FX6A 3TI0A 3EO4A 2JC0A 3I6PA 2JX2A 5ETQA 4JV1A 4CLUA 4IKAA 3PRDA 1PAUB 1U02A 2Z56B 3QSYB 1TKTB 1AZSA 4B3RF 4PR6A 2YX7A 3GFXA 4KAIA 1IYKA 5K8OA 3AD9C 1YTYA 2W8KA 2E29A 1HA1A 3MWBA 1NMTA 4ANDA 1QSMA 2Y1LB 1GFWB 1U2RA 4WFZA 3R9LA 4ICLB 4ZJOA 4JI0F 2C2DA 1S0NA 4R8FA 1WKKA 3QZ8A 2H54B 2ZWPA 2U2FA 2GCFA 3M6UA 2F9JA 4CQ1A 2ADBA 1RT2B 3A3PB 2E44A 5GAHU 2F4VJ 1U0SA 2KT3A 4A48A 2CIJA 2B8QA 1U8SA 1PC5A 4GO7X 3RAQA 5L1KA 1FWKA 3B35A 2B51A 3HLUA 1KLMA 1YRUA 4P52A 1IU8A 3EGWB 4IR9A 2MKYA 2ZW7A 1FY7A 4B3TF 2GVZA 2HRYA 2R8GA 3KK2B 3SSQA 4LF4F 3TC8A 4MKBA 3GIIA 3ICLA 2ALZA 3EMTA 1F2HA 1HHSA 4MY3A 5A8WA 2BV3A 2GVDB 4Y6IA 2K7KA 1YLXA 2DNOA 3PNIA 2OD6A 4MHZA 2ZEGA 1IKXA 1BLUA 1QAYA 4OHXA 2FHJD 3S8SA 1LEOA 1SJ3P 3VWEA 4Z2XA 3EDRB 3GMGA 2XTJP 5H9FJ 1Q82T 2HIQA 4XPEA 3CCUS 5B0BA 2CPFA 3KR5A 2PDOA 2C22A 1YMEA 4ZPDA 1RABB 2B9EA 2OELA 4LQ9A 3K58A 4F2RA 1CJUB 4JBCA 2E1RA 4KZTA 2F5IA 2AHOB 3K8WA 2YNCA 3EJMA 1TMJA 2ZH6A 2HS0A 4M6GA 2QO3A 4JV5J 3MM8A 1S49A 1F9HA 3MAQA 4ZLJA 3CXCR 2KU7A 4IAVA 1Z4UA 3HVWA 1XJOA 2RD5C 4NLUA 2CQ2A 3QYYA 5KFWA 1YRXA 3U02A 4R8UB 3MM5A 1TFYA 3MCSA 1TELA 4GS4A 1KBRA 4DX5A 2XBPA 5A76A 4CO1A 2X1AA 3MM9B 4FP9A 2RUGA 4NL5A 4NCZA 5IT0A 4UF4A 1U1KA 1T94A 2CDQA 3RB6A 3AA8A 4USMA 4OJ1A 2VBXA 4DX8H 3A13A 5DJBA 3J7Z5 4YU9A 3MM6B 5KFFA 4BINA 1TF8A 2B9XA 2P9EA 1YVOA 2R7UA 1QVGR 3QJPA 1U6FA 3QFWA 4RKUC 1M0SA 4B9SA 4J91A 3SJXA 3QQCD 4CLZA 3JQJA 4DV4J 2EVNA 4CCHA 4ECTA 3M30A 4OC4A 2YXLA 3PHEA 1U6BA 5KFIA 3GJQB 4NMLA 2LECA 3RO0A 1NDKA 3CUNA 4MK9A 3HMJG 3B82A 3F56A 2F5GA 4OYBA 3FIXA 3PM9A 3HHLC 5GAEU 2XEFA 2XEGA 1KOOA 2OPSB 2XYPB 2PJ0A 4RUBA 4FBEA 3I31A 3H2LA 4B3MF 4H6ZA 3A3NB 4XK8C 1F9FA 4K3NA 2F63A 2X51A 4PWDB 3T9ZA 1FXRA 4Z7CA 1X9SA 1U1QA 1PKUA 2DCUB 2HEKA 2DF5A 3U1LA 3CDXA 4P4BA 4DV0J 4LMZA 1QAIA 2PD1A 2ZH2A 4C48A 4HI1A 4NLPA 4RNOA 4UIBA 3NGRA 2ZH8A 4OYPA 5KFPA 4URSA 1P1TA 3FRMA 3QGHA 4FYDA 3G86A 2M3DA 1PILA 4LX9A 2JH3A 1R8AA 3B8HA 2ZC3A 3T1HF 3DU5A 2I9SA 3CDWA 3JYTB 5M2RA 1AMPA 4DG1A 4IRCA 1HIYA 1YW6A 3OTDA 2RC4A 2YWWA 3SBMA 2AWZA 5BR8J 3V38A 1L3KA 1WTBA 1FE4A 4JI3F 4OZ3A 2B3TB 4ZPWR 3TWZA 3CIZA 3DMJA 3MCOA 2OH1A 1N5QA 2KRBA 2MGZB 4CAEA 3TAQA 3I5AA 4X4NA 4LIWA 3T6BA 3U1MA 4MFLA 3GY9A 3D9BA 4L75A 2ZUAA 4KSEB 1Z9UA 4MIAA 1YRTA 2PO4A 3B3CA 4C4WA 4X5KA 3T5HA 5KT7A 4B02A 2F4FA 1XNRF 5GCNA 3ZZIA 1OO0B 1LK7A 3VATA 3MFIA 3QIPA 2DO0A 2WYRA 4DV2F 2EK6A 2B5JA 3JVNA 1JLAB 1FNOA 1A6LA 5GMKa 1CJTB 3HM9A 2VH7A 1U1OA 2O67A 3HT0A 2RDJA 3ITHA 3KUGA 4DR2F 2OPQB 4M5DA 2IM1A 4ZY2A 2BUEA 2MYFA 3KLEB 3MTJA 2GLFA 2GFQA 4U7UK 3TFYA 1K73T 4ZVRB 1ELMP 5LL6d 1U1RA 2XY7A 4OKOA 3AD8C 3FRYA 1HYSB 4B13A 4ELVA 2QFIA 5BYQA 4K4WA 4JP8A 3TQEA 2VV5A 6FDRA 4AVCA 4F6AA 1F1BB 1S5KA 2DNGA 2P9CA 1N33J 4XDDA 3F73A 4S0MA 3W61A 2FHMA 1OPZA 4WBFA 1V0CA 1JLCA 2VEZA 4NEYA 3LP2B 1A2ZA 1RWWB 2Z0GA 3H90A 1VQ5S 3BBFA 4AFFA 1LFPA 3WC2A 1JWWA 4PPZA 3S6KA 2NXJA 2LLZA 3RW6A 1PC4A 2OPRA 4CNYA 4Y3CA 3PB8X 2LVWA 1YK3A 3DGPA 1RISA 2ZNYA 1H38A 3JRUA 4ELUA 3HD2A 4LF9F 2GU2A 3BSNA 3SCIE 4DUTA 3UN5A 3G3SA 2BQRA 5DZ7A 3TT2A 4CGOA 3NP5A 1YJTA 5A2QU 3D7FA 4ECZA 1LV5A 2E5JA 2BM0A 3W91A 5HQLA 3RR7A 2ROGA 2DTJA 2KT5A 2MKIA 3HO1A 2LXFA 4UQTA 3K5MA 4LF6F 4P4FA 2C3YA 3CD6S 2AFSA 4IQXA 1HBNA 2IQ6A 1F2GA 1SQEA 2M88A 2QMLA 2VKZG 1VQNS 1Z8XA 1K0VA 3QZ7A 1RWUA 3NNAA 2D3ZA 4TQRA 1KHVA 5DWMA 4K2XA 4AE5A 4I1TA 2IYGA 2FC9A 3ZNUA 4IOAQ 2WHOA 5CXTA 4CAWA 4GVBA 4AXIA 3HF5A 1V3SA 2IDEA 2W9BB 5IX3A 5D77A 5IFMA 4U7CA 4YB1P 2CWKA 4I0WA 1JNRB 3BGUA 2VD3A 4IDKA 3HSZA 3EGNA 3DOKB 4DV3J 3NNHA 2HLUA 3TOAA 1HW8A 2RT3A 5E3QA 1KR4A 2ZH9A 5HP1B 5HMZA 2LDIA 3PXGa 1GX6A 4ZPVR 3L3CA 4TN2A 5BR8F 1RYSA 1HWUA 2PJ4A 3E0KA 2ZKTA 3CCSS 1KKHA 3CJ0A 4UQGA 1HD0A 4KHPF 3Q24A 1XBWA 1T02A 2HRTA 3LP0A 2BANB 4NASA 5AT1B 1NJYA 3GFYA 4XDCA 3FMBA 4ZVPB 3K5OA 1P9YA 4F4YA 3QGIA 1KD1T 2V9WA 4KJIA 1UP1A 4G1IA 4OQJA 3EPGA 3DDDA 3ENAA 4C7HA 3NWRA 2XGPA 1IR2A 3GKRA 4WXWA 4LF6J 2H65B 4FVCA 4UWIA 4Q7AA 5DO2A 3S6EA 2GQQA 2YY3A 1SKRA 1S0MA 2HZVA 5FD1A 4NYZA 3OJSA 2JDDA 3IN5A 2CJAA 1WDDA 4DR7J 3FBCA 4BC7A 5LOQA 2IHR1 1UEUA 2UVVA 1BMQB 5AXLA 1KUYA 1T05B 5IZHA 4ECRA 2CPHA 1JXLA 2DEIA 3QRRA 3P96A 3PFEA 1WHXA 5D0RA 3DLKA 5HSPA 2G1HA 3K2KA 3IGNA 1ZBTA 1HNIB 2VG5B 4CH1A 4DX7A 3I5BA 1AYEA 5HH1A 1GH8A 1M1KT 4CGLA 4ZYQA 2OB0A 2MY7A 1QLNA 3DLHA 1F5BA 4DUYJ 1N33F 3CMAS 4H4KA 1S6OA 1Q8LA 4EYIB 5JGFA 5HLFA 5K8MA 3OHAA 4YWYA 1NH7A 1NDLA 1FRHA 3DLGA 3GUXA 3ZZTA 3IBFB 2QYVA 2Q4ZA 4BDPA 1HPZB 2VJVA 3I96A 4EZ9A 4MCRA 4U9RA 2KVQE 4XPCA 2AT1B 2G0BA 4DDFA 2ZZTA 3RB3A 3CJ8A 3TUIC 2R3VA 4OC0A 2R1IA 5EX0A 4TU9A 5I0CA 5D4OA 2O53A 3QJLA 1VLOA 1SJRA 4XPLA 1KHWA 2U1AA 5E41A 2DEAA 2HHHJ 2VBQA 1OY6A 4OX6A 4K2JA 3U27A 4E0AA 1HWIA 3J7ZT 1K47A 3R3TA 3ZTPA 4ZJLA 1NPKA 2HHQA 3TZYA 4OL8A 4F8ZA 5LSLA 2LA6A 3I0SB 1RLCL 3CD0A 2VG7A 1TIQA 1Q78A 3OL9A 2VODA 1T9YA 1TAQA 1TP7A 2AX1A 5AG6A 2C1EB 3D0HE 2B4DA 1BPNA 4V19J 2AJ1A 3MCNA 5KFHA 2QSFA 2ZNZA 4ZHRA 4Y2CA 4EWTA 2CQDA 2D9PA 4JV0A 1J5EF 4JI2F 3GJRB 3MPUB 1RACB 4TLQA 1IKWB 1N5SA 1MMNA 3IS9A 4C2YA 1RT7B 1UWBA 5DDOC 2QFJA 4YFJA 4ZVEA 3GYXB 3UR0A 4M5HA 3TP2A 4PEOA 1G4CA 3UPFA 4P4IA 2GFFA 2DHSA 2DNPA 1GK8A 5JMNA 5CD4H 3TYTA 2N4CA 3F0AA 1P1LA 1MU2A 1T9UA 4K0KJ 1FKOB 2Z58B 1S1WA 2Z4PA 2RAQA 1WF0A 4ZCIA 1C0UA 1J5EJ 1CJUA 2F65A 4EYHB 1UVMA 1PJ7A 1JQGA 2ZEMA 4DF4A 1R27B 3H5XA 3S7RA 1BLLE 1V5IB 1DTDA 3AJDA 2VHGA 4KOVA 4X84A 5KFJA 1I94J 4B3MJ 3QFHA 2YNHA 1ZYQA 2B5GB 4M8LA 2F40A 1R7IA 1IKYA 2GGPB 2AZ1A 1UWBB 5HO4A 1QVFR 1IKXB 4YRHA 3N79A 1WSVA 2OP5A 4BWMA 3KK1B 2YBVA 2EC0A 3M2RB 2FZCB 4IRDA 3KG1A 4MAKA 4LSZB 3PEHA 2GVDA 1RKJA 4PXBA 2PN6A 1MWZA 1KNZA 3BXMA 2ZM6F 4I49A 4ID5A 3T3FA 4RNHA 5J2PA 2MGZA 1LW2A 3KTQA 4QWEA 1FD8A 1IIDA 4KS9A 2JEFA 1NJXA 4LF8F 3IFEA 2HBYB 1X4DA 5D4NA 2C2MB 5A8RB 1N36J 1VIXA 3PX0A 1M5HA 4DSJA 4Q0BA 2W01A 3DRPB 2KFYA 3NH5A 1Q7LB 3M8YA 1YDLA 1VQ4S 4PYAA 1BE4A 4QU6A 1NZ8A 5ETOA 4C8YA 4H2KA 2RHSB 2IM0A 3V6KA 3EX7B 3LPYA 4CLSA 2P8IA 3EVWA 1Y3JA 3AT1B 1AXQA 2HGNA 3LW5C 3MEDA 3BJ7A 3OXGA 4P71A 1TL7A 2MMYA 1Z8LA 2GO9A 4ZA1A 2CJBA 1FD2A 3EM1A 1H72C 3NFZA 2CVEA 3MM7B 1H2TZ 2JEVA 4CAXA 2AP6A 1NK8A 3CJ3A 1UPPA 2G3AA 2FE7A 4QCLA 2JSXA 1YIJS 4HHJA 4ZLLA 4DR4J 1I21A 3MMJA 1YW4A 4DS5A 3MM5B 2PJ7A 4FYWB 5KT4A 2CADA 3GR0A 2B4VA 3IA0A 2H9ZA 2R7TA 2JEIA 1E6YB 2KZZA 1VQMS 9ATCB 3W2VB 1RA6A 2IJFA 1N5YA 3FQKA 3D1OA 3MI7X 1UVKA 3GJSB 2B43A 2V94A 1FJGJ 5I3PA 5BWAB 1T9XA 1EARA 1TK0A 1YJRA 4ONUA 4WIQA 1VQ6S 1YBTA 2PVVA 2AX0A 1NSQA 5G0RB 3QIPB 4IOBA 4Y2AA 4UTGA 4NXYA 4C0OC 2IVMA 1W25A 5KFTA 4XTTA 2WVCA 4OHZA 5LYFA 2OHDA 3RAXA 4FS2A 1NUEA 4RR5A 4MFQA 2UZAA 5KFNA 5T41A 2OPQA 2H4YB 4RNMA 3EXYA 1OY8A 4ECYA 5AE1A 3V81B 2JNJA 1DURA 4PG7A 3QAHA 4U8VA 5HI7A 1XBUA 2HWHA 4YQWA 1F3VA 1ZM4A 5RUBA 1BPMA 2B58A 4OZ1A 1NK6A 2DR5A 2NCKL 4ECVA 3H2UB 4M85A 5K14A 2HAIA 3HVAA 4B9TA 4JI8F 3VARA 4U9YA 1JXVA 2NS1B 1WJ9A 3DOLA 3MPVA 1L3VA 1IGBA 3SQGB 1VHOA 2FVRA 4LQGA 1NM2A 1KQSR 4WKRA 5CYJA 5KG2A 3EXNA 1Q53A 3FDSA 3BSAA 2FJAB 4YY3J 3W2WA 4EBEA 1TL7B 3QB8A 3VHQA 1RHUB 2C3PA 4P10A 1FJGF 3ISZA 4USKA 2DNQA 3TX0A 1G2EA 4RNNA 2DPSA 2FC8A 5E0OA 3W9JA 1LWCA 4MIBA 3IS9B 5F8JA 2E9RX 5EMIA 1WSRA 5IWAJ 4ETZA 3KK3A 2ZVIA 1IBKF 8AT1B 1LWXA 4DG1B 2YNGB 4JV2A 4DQPA 2J7KA 3HFVA 2OD4A 5HAOA 2UV8A 3B54A 4KH1B 1N0VC 2WPWA 4AL5A 3PP9A 4O0NA 1O51A 1PU9A 4XAKA 1HBUB 4DPUA 2BJ8A 1WEXA 3MR7A 1MK4A 1E6VB 4F3QA 3PB7X 1WF1A 3T1YF 5CYMB 2MZTA 4P4JA 2BEIA 5B0AA 1XN9A 4DLEA 2J6SA 2HQYA 4J9OA 3LP2A 3I32A 4RW9A 1RADB 4WZQA 4A8YA 1QE1A 4CAVA 2DGWA 4LT6A 2ZEHA 4LFCJ 1K1SA 5BXIA 1SIWB 5F3ZA 4LVOP 1EETA 2CQBA 2MLXA 3OFEA 4LREA 1FO1A 3G9CA 1MJBA 1XIQA 2MEWA 4OYWA 2YWGA 4JI0J 5F49A 4F0XA 5GAGI 2OJ3A 3LWUA 4LFAF 4KGZB 1Y9OA 3LANA 1Y7RA 1LAMA 3N9UC 2M5YA 3D8PA 1SL2A 2EFGA 3QT8A 1WELA 1NCLA 3NGKA 3KLHB 4II9A 4PKDB 2VPXB 3EDQB 4KH0B 2LQ8A 2MKJA 1MSWD 5A8KA 4ZP9A 2N4DA 2FHJA 2BANA 3R2CJ 3PW4A 3FFIB 4DI6A 4OZJA 1NU4A 3UR3C 1R6VA 3DR6A 2QZ8A 3NLCA 3OTBA 5CYQA 4DV4F 4KLWA 2R2SA 1NSPA 3ET6A 1N56A 5FLXY 4P73A 3IEHA 4X64F 4JI1F 1GMVA 2EFVA 3AQPA 3G8SA 4QWCA 1FWLA 4CH0S 4Y0FA 1VQKS 1UZHA 3TVKA 1GMWA 3NY0A 3DYAA 5DWNA 4WCEQ 3QT7A 2R8IA 1NJIT 2XMJA 4MIWA 3LPEA 4RLEA 3RNZA 2I1RA 2FD2A 1WF2A 4I4BA 1KLNA 1S99A 4ZI6A 2HQCA 2DKOB 4DR4F 3N6NA 2EFNA 3THPA 1RYRA 2DK2A 1QD1A 3MCMA 2H5EA 3MFHA 2VQEJ 3ISND 4X4UA 3CWJA 3MF5A 3MD3A 3CXQA 4N8NA 2J8AA 3O5TB 1VQPS 3TO6A 2HNDA 2DGXA 3M9OB 4A37A 2ZW6A 4XNHC 4UEZA 4PSWA 1SPBP 3LP0B 4X2BA 2QA2A 4C8ZA 3ZTOA 4ETXA 2ZDPA 4IG0A 4OZ5A 4P72A 4AVBA 5IQQA 3B7IA 3SYZA 2KM8C 1HKAA 1P9QC 1IOFA 3LACA 5AG5A 2DHXA 2W9CA 5CABA 2EK9A 3C2PA 1GTEA 1OQ6A 1AT1B 1Q5VA 1M5SA 4IFVA 1IVZA 2MQ8A 3S6FA 1Y00A 2DY9A 3N6MA 3OW2R 4G65A 4C3MA 4KUAA 1T9TA 3HFZB 2M8DB 3W9IA 1U6ZA 1FX4A 5ETKA 1CBKA 4X64J 1YK9A 2ZOGA 3D67A 1FDBA 2V8PA 2HK3A 4UA3A 2QGFB 2VB6A 3AOAA 3LALA 2PC1A 1UETA 3OFFA 4OMFG 3SHPA 4ZGYB 2FUG9 2QYCA 1M4LA 3PRVA 1UVJA 2HPUA 1ICEB 4UZBA 1JXEA 1O6XA 4OX8A 4M5NA 3FZ2A 2GMJA 3LTOA 2DHAA 4ZY1A 5I3UA 3K9TA 4MFPA 3DNSA 1Q2DA 1DY3A 3NBPB 2HMIA 4IG0B 4AD6A 2KRRA 3H59A 2M0GB 3ILOA 2PR8A 4AVAA 3W9HA 5D4LA 4K5SA 5J8CA 1X0FA 2UXCF 2Z10A 4FKYA 4J7CA 2EFOA 1DFDA 5LMUF 1S6QB 4DLGA 2VG7B 4DXLA 3R9EA 4ZLNA 3ZZZA 1JK9B 5C88A 1VFJA 2XSFA 2ILZA 2GO8A 5K5MA 4F0KA 4ZX8A 1GMUA 3ZXWA 3W60A 2DH8A 3KASA 4XIUA 3D68A 3PACA 2PJ1A 3QMQA 4KGXB 2D74B 2V2QA 2YKMA 1CPSA 4I69A 4H89A 3CC2S 2WB4A 2HFVA 3Q8PB 1HNXF 5E2QA 3FNNA 3PHTA 3E01A 2ZOFA 4NXNF 4DEZA 3P2HA 4WTOB 1FDDA 4L3NA 4DS4A 3T1AA 2HK2A 3S9NA 3V4IA 3MM6A 4ERDA 3EZUA 5JUMA 3HVRA 4IFYA 3FJUA 2CYYA 2OPPA 1OYEA 2J6UA 2GIFA 1ZO0A 1VRTA 4JI5F 2Q1LA 2AU0A 3M9NB 1RAGB 2Q04A 1AFIA 1FTRA 1R31A 3UDLA 1VS3A 1MMLA 3B78A 2PIIA 1HL6A 2NUHA 1EB0A 3BSCA 4OHVA 1S1UB 1ZPVA 2GW8A 4JI3J 1EETB 1RTHA 1S9FA 1VBKA 2QE5A 3AJ1A 3ISXA 2B7BB 1HDUA 5LMUJ 4M95A 2CJKA 2UXBF 1B64A 3MR5A 2Y8YA 2AIRB 5A0YB 4N7TA 1YJVA 1ZG8A 2AD9A 3ZTQA 3AOBA 2M9KA 4U5YA 1FRLA 1XFOA 4YB7A 3CCQS 4QB9A 1LCPA 2QECA 5LXYA 4OHYA 4GKKF 1LWFB 3VZIA 3F44A 2DH9A 4ZX9A 1DTQA 3WIVA 3C15B 2HYIB 3MUVP 5EUHA 4ZIVA 2ZKUA 2RDDA 4EBCA 1XMTA 4KIAA 2D69A 2QLBB 1T0TV 3HHLA 2A6MA 3HHEA 4MCPA 4B3OB 3C26A 4CGPA 1J5OA 1H0HB 1U24A 3D66A 3KK2A 4MCQA 4E8UA 2AFZA 3H40A 2FYXA 2DIUA 2HVEA 1X10A 2YKMB 3R7SB 3GV7B 1BGXT 4MHYA 1Y5LB 4AL6A 4NGRA 4DL5A 4B9LA 2CKWA 1ZS6A 2DISA 5KG6A 5JJBA 3PVXA 3VH9A 1LNQA 3PYEA 2PMWA 3MUMP 5IT9Y 4K4VA 2HNZB 2ZDOA 1VHEA 5IC6B 4CIOA 4QWBA 4V19X 4KQZA 4GO5X 2DJWA 4MRIA 1ZZFA 4ZCKA 3THTA 1DTQB 1VK8A 5AGEA 2JHEA 1OSCA 2XI3A 1T3NA 4B6ZA 5D6GA 3I82A 4CTAB 2ACYA 1RBAA 1ZAXA 2A0FB 2B7CB 2LYVA 2HFZA 1TKXA 1QDUB 4MH8A 2AFWA 3ENVA 2R2TA 4QUSA 1JLBB 1NHUA 1PGZA 5KOXA 1F6TA 2IVYA 1RHJB 4FXVA 1RT3A 3ZO7A 2ABZA 3MD1A 4ED2A 4KFBA 1RTDA 1WG4A 4LSNA 3SZ2A 1U0HA 1FERA 2G9DA 1IBMJ 1X4BA 4NGPA 2KH9A 4OYIA 3IO1A 3C6UB 2HFUA 4ZLPA 2NREA 2W2MP 4X4PA 4ZVQB 1X5PA 1HQUA 1CS4B 3PTWA 2P6TA 4L76A 2Q3PA 3IXQA 2L9NA 4FD7A 2AMCB 4OHWA 4HKQA 2VONA 1JJ2R 3DOMB 3W7BA 3VAMA 1RWKB 1N48A 4CT8A 4DV1J 4AB7A 5HMNA 3DCAA 2CXEA 1PJ6A 1HBNB 1S6QA 2KHDA 4J9RA 4EK2A 1JB0C 1NKCA 4C8MA 4FF2A 2WVFA 4UBRA 3VQTA 4O3OA 5JM6A 2D41A 1H7XA 4GKJJ 3BPDA 4USJC 2AEMA 2MPUA 4NXMF 4A46A 4NYPA 3R96A 2N3LA 3D5MA 3A8JA 2PJAA 4RW7A 2C2OB 4YY3F 3M8QB 2ZBIA 3OD2A 4LRAA 1CS4A 3P45B 2X1FA 4MK8A 2WW4A 4WFAQ 4RJVA 5HVFA 4IYQA 2VI7A 4KGMA 3LAMA 1T05A 2QJ3A 4KOYA 3NKYA 3HSGA 1Y0HA 3SEOA 4JYAF 4LRCA 4MMOA 2AEJA 3UW1A 4BWJA 3KHHA 3NWGA 3RTVA 3PRTA 1IY7A 1S1XA 5FIIA 4P6YA 3RW7A 3NGTA 1REVA 5AE2A 1DQ9A 2IJZA 1M4IA 4MTPA 3KFWX 1JLFB 2HHSA 1YQHA 4HTIA 2YNCC 2AJ0A 4ZBGA 1H98A 3W2WB 2B5JB 3KHLA 3FB3A 3PZPA 3V6DA 2KN4A 1N0UA 4A8QA 1IQZA 2JFDA 3DYAB 3FVLA 1CPXA 2VFSA 4ZPTR 5DLGA 1LWEA 2BW2A 1S9EB 3CD5A 2B4DB 2ZEDA 3IG1A 2VIHA 4KUBA 3O44A 4MHPA 4M3SA 1Q5YA 2KDOA 2OMLA 4R8UA 2UU9F 1L3TA 3SQOP 4F26A 4B3SJ 4GKKJ 3D0IE 1TUGB 2E7WA 4DU8A 4NI2B 2LFVA 2PJ3A 2VASA 3AHPA 2HRUA 1UTAA 2G0JA 4A33A 4DWIA 3CJ5A 2C1CA 1AUGA 3PB4X 2N82B 2HBRB 3MM9A 4PUOB 4UFWA 3MAHA 5DG8A 4IFYB 3BYPA 1RSCA 1NAQA 2RIJA 2XCAA 1WD6A 2BSWA 4OFZA 4OI1A 2ZHOA 4X8IA 1AUDA 4CO2A 4OYZA 3K5PA 4DUZJ 1CQNA 2DCLA 4X4OA 4QIWD 5A27A 1M5PC 3Q23A 1S9EA 4ZP6A 4OI2A 2GS8A 1PCAA 4H54A 1XMQJ 1WHWA 5L1IA 2XZDB 2CPXA 2IJRA 1IR0A 4ES2A 2G2OA 2J9DA 3KLGA 1JLGB 5KFXA 2EWBA 1ZOTA 2V8HA 2ZM6J 5D3GB 2QIRA 4UFXA 1UEKA 3LGMA 3H2VE 2Q6CA 4DQIA 4HI2A 5G4DA 2KFNA 3LA0A 3H5ZA 3M9MB 1U09A 4NEZA 4ZCMA 2HNZA 3P4UB 2WBMA 4JXQA 2ZEEA 1RT4B 2M2BA 4OIDA 4AL7A 2PMZD 1J2VA 2ZEFA 1S72S 2I5JB 4J90A 1YJNS 4TVAB 3M32B 2BQUA 4OLPA 2AEFA 1YBUA 4QIFA 1MMDA 2DNNA 2F8EX 1ZLIA 1RTZA 2I6WA 1U1NA 2PI4A 4ZVOB 5F09A 2QLJB 3KYLA 4LF9J 2Y1IA 4YB5A 1FEEA 2NUUG 1LRZA 2PIYA 2VZZA 4KSFA 4DPYA 4ZY0A 5DETA 4RN7A 2DNLA 1S76D 2YNHB 2VL1A 3DOKA 3WC7A 3CIMA 2XEJA 4NX9A 3CCZA 3MURP 2AFMA 4JI7J 5KG7A 2IBKA 3UDEA 5I4MA 4KRWA 5DG7A 1CM0A 3H8YA 3OL6A 2E5GA 1F60B 3PYDA 1RE1B 1YHQS 2N7YA 2MZRA 1JLQA 2XYHB 2HWTA 4CT9A 5KFSA 4OP4A 1SJFA 4JYAJ 2MLZA 3CCVS 2J7WA 5KFLA 2FZGB 2G0IA 2GAGC 4RW8A 1RT6A 3MN8A 4QZVB 4ENOA 3BV8A 2XLIA 5HQMA 4F0YA 1Q1KA 4ZCLA 1SL0A 3GIRA 4LBHA 3JAMU 4A30A 2K3IA 3GSDA 5J2NB 1M5OC 3RU0A 1VQ9S 2D3OR 3FEXB 5AJ3F 4KTQA 3AODA 2KO1A 4NCGA 2QA4S 3J7YI 1RWPB 3NE7A 3JAMY 3MEDB 4LF1A 3D6FB 4GVBB 2FGOA 1SI9A 1WG5A 4LR8A 4DCOB 2RU3A 1T9WA 3BSOA 1UW9A 2DR7A 1C4CA 3HSJA 4AXJA 5F3TA 3FBFA 1HI1A 1Y9WA 2Y0MA 4K30A 2DNZA 4L8AA 2R8KA 4O44A 2QMUB 2IC3A 1QY7A 3UVJA 2G9OA 1B0PA 3NL0A 1L3UA 5F0WA 4OX9J 4YUDA 2GJFA 5HQ8A 3D54A 1XOVA 3D1HA 3HDSA 1ZG9A 1S77D 5DS7A 3NS7B 1S6PB 2KXHA 3PG9A 2XC9A 2CAJA 4FXDA 2CRLA 4CPAA 2V34A 3BO2A 2VOOA 2MJUA 3QPIA 4F25A 1VOMA 1JJ4A 4F4KA 3HZGA 1XIXA 3CPWR 3PW5A 3UCUP 2J0XA 3LAKA 4O4RA 4R6TA 2ZHBA 1X31C 3R27A 2K06A 1NK7A 1OBRA 2NXCA 2IM3A 3MM7A 2QC3A 5HROA 1IUJA 3R6LB 2DEJA 3PO5A 5SUHA 3QWPA 2ZH4A 2PE3A 3B4DA 2HQIA 4HDHA 2LDYA 2R7OA 1HNIA 2NXEA 2VQYA 2RUSA 2EK8A 5K8PA 2E9ZA 3B2YA 3GIMA 2VA3A 1T03B 4YR2A 3HHNB 1CX8A 2XCPA 1IBLF 1SC4B 3V8IA 3H5YA 5H86A 5T7LB 1VBXA 1VRQC 2PJ5A 4J3GA 4R87A 1G3OA 4RW4A 3UD5A 3VGVA 4CDIA 2V4JA 3BN4A 2ZZMA 5KG5A 4IF5A 3FSYA 3HPOA 1NHVA 3TO9A 1X5SA 4QR0A 4F9UA 4MFBA 3FMWA 1WK4A 2V69A 1FFGB 1TL3A 3L09A 1VBYA 1YZ7A 2DRAA 2PEHA 3NOGA 2F8HA 3G82B 5B0FA 3VTIA 4C0BA 3IWLA 3GB0A 1B0TA 5ETMA 3IR6B 1B87A 1OSDA 2SXLA 3R5AA 2OIHA 2DGVA 2J8RA 2Q66A 1NDPA 3C14A 2CPEA 4NA3A 2AFOA 1KONA 4QBUA 3T1HJ 3HCXA 1RT5B 1VK3A 5L1LA 1UVIA 2J9EA 2REEA 1Q8BA 2EG1A 1FA0A 4RU2A 3DDNA 1KQGB 3EYZA 3KL9A 3R5CA 3JSBA 2E5HA 2VDHA 2GZOA 3OPKA 1TL1B 5A8KB 4J9SA 1HHTP 3D4UA 4KVOE 4M63A 2YKAA 2QYGA 2HC9A 2DPIA 4NLQA 2AGOA 3AAWB 2A1BA 4CLYA 1TKFA 4BBYA 4P74A 3JSMA 4CYQA 4DZDA 3MRUA 4E2AA 2CZ9A 2I5JA 3FBBA 4KR0B 1ON0A 3U7JA 2DNKA 3D2MA 4EVYA 2OO4A 4MHNA 3PIOQ 4LBIA 1S5ZA 2MQQA 3LGNA 1QSNA 1RHMB 2RMLA 8RUCA 1YKWA 2NXNA 3MM8B 3QT5A 3A8KA 3UNYA 2LEPA 1ULRA 4ZVSB 1P0HA 2KCWA 3TEGA 4M6HA 2BUNA 4IDKB 2UUAF 2AF6A 1IBCB 2UXBJ 2MKSA 3F8KA 3JSYA 1HI0P 2WONB 3FCHA 2KZMA 3ISNC 2UVUA 3AXKA 2LQBA 2A18A 3LH2S 3HUVA 1UEVA 4K0KF 3H98A 4P4EA 4PK3A 3SXOA 1XJWB 4OJHA 4WYWA 4X2TA 3FGVA 2FVQA 4M5IA 2OEMA 1REVB 5G20A 1M5VC 1JLQB 5AE3A 3MOJB 1IN0A 3Q86A 5KFEA 4HACB 4N77A 3CXPA 3DSBA 3LO3A 2LA4A 1CJTA 4CYNA 1LK5A 4B9UA 3EC4A 2VOPA 4KOXA 2JJ4D 1SKUB 1J5OB 3IBWA 4RBUA 2J9CA 4NE9C 2EBJA 3DRRB 2RB7A 1MW7A 1YITS 3R1HA 5EHHA 2XHWA 5F41A 1H8LA 2A4NA 2FLNA 1R3NA 4FD6A 3DM2A 1N5VA 3TUZC 5GADI 3WDOA 2WCXA 4LF5F 2BL1A 2YWKA 2L9DA 2ZOMA 1U45A 4J9MA 4EUVA 3A12A 1D9DA 3C8YA 5BJRA 3PEIA 3E51A 4DHVA 5F0UA 1E6VA 2Z3OA 2BOPA 3LD2A 4CLPA 1KOHA 1HARA 4TU8A 2HAFA 4EI2A 2FLPA 2ZE2A 2ASDA 1R0CB 1WOOA 2JBKA 1RGVA 3UO0A 5LRGA 3IIBA 2VG6B 4Y49B 3KWMA 1QE1B 2RU9A 1C1CB 5C24A 4C0HA 1VC0A 3GWCA 2WBRA 4A4JA 4Z37A 2Q0YA 3KKWA 8ATCB 1D09B 4LF5J 3DNCA 1H7WA 3D6TB 4IHMA 4LIRA 2E1PA 3W5ZA 5IV4A 5H9FK 3CJRA 5K9FA 4Y65A 1HBOA 3SIPB 1R8CA 5H9EK 2VFTA 3TAMA 3UN2A 3NE8A 1NPRA 1NJWA 3MPWA 1Y0YA 2KB2A 3KLHA 4NZ0A 4R5PB 5EN1A 2HUZA 2XQCA 3OTOF 3DLJA 2FJWA 4JI4J 1TKZB 2XI2A 3D3SA 2WW8A 2WSAA 1WC0A 5H9EJ 2XYGB 1T95A 1NSAA 1KSPA 2PCUA 3DMJB 4Q5VA 1GX5A 3UVJB 1E6YA 4URGA 4A31A 4PSXA 4KGKA 5THWA 4YGOA 3QRQA 3PCOB 2KJVA 1C0UB 5HK4A 4N5SA 3D3BJ 1ZETA 4R0EA 3G87A 2PFFB 3QBCA 1ITPA 3FKBA 4M5KA 1S79A 1YJ9S 1UJ6A 2OSQA 4BC9A 4B9MA 1B0VA 1MJAA 1IBMF 1WC4A 3OL7A 4RWWA 2V2VA 5K8NA 3RB4A 1XERA 4QW9A 4ZK7M 4OZ2A 5HP1A 5J1QA 2BVZA 3KQZA 3UI3A 5A8WB 1FJCA 1JKHA 4PYDA 4CO4A 2MZJA 2EO8A 4G1PA 1NKEA 4ZITA 2GNKA 3FCVA 2FL4A 2DNHA 1DTTB 3MEGB 4PG5A 2FSRA 1APSA 4ATNA 2Q4YA 4FD5A 2VZYA 3AQOA 2DBBA 5A6WA 3JQKA 3T5KA 1X9MA 1VLYA 1EHWA 2ILYA 1KWMA 4KGVB 2CPDA 1QUPA 1R43A 1XC9A 1Z8WA 3NEKA 1W26A 2NLWA 1TVRB 3P2FA 1LFWA 2BRLA 1VISA 2QL9B 4F36A 1XNQJ 1SIZA 3EVMA 3KR4A 1PYOB 5MLCV 2C3OA 1UZDA 4DL6A 2AYEA 5J2NA 3LUYA 3EGZA 5HLFB 3IMQJ 3KGQA 4IR1A 2PIZA 2YQ3A 2CPYA 1TR0A 1H74A 4E2FB 4WJBA 3EVOA 1TL3B 5H84A 2R7QA 2O4HA 4YP3A 3T9NA 5DM6Q 5CZVA 2W7OA 4USHA 3M2UB 3BPSP 1H3DA 1RA7A 4OX7A 4NA1A 4FUUA 1TL5A 3CO0P 3K9UA 4AQYF 4W92B 3UFCX 4E0DA 2E66A 4HL9A 3FEDA 2E5LF 2GQCA 2IMOA 3A8IA 1PO6A 2I3CA 3UD3P 3C46A 1GXTA 4C11B 3G8TA 2C27A 3UD4P 5IC4B 2ZD1A 4O44B 1RT4A 2ATRA 1YJUA 1EX8A 2UV8G 3JXOA 1SKSA 2AFUA 2V4QA 5HBMB 5KT3A 2BRKA 1R8BA 2VPYB 2MY8A 3GG1A 3KJFB 1Y5IB 1RKIA 1SH0A 1YREA 5L9NA 5JQ4A 2OZGA 4B3OA 4KSIA 2HHTA 4G1QA 4A39A 4TYBA 2O1PA 4P45A 2IA6A 4ZVFA 1TUVA 2GAHC 1KVIA 2ZEJA 2RE1A 4WIIA 1EZZB 1ZM3A 5F8IA 3KUEA 3UWTA 2FJXA 4KE5A 4P2FA 1RTJB 1B3TA 1U49A 1NBEB 2ROEA 4K4UA 1URNA 1WC5A 4CGMA 3JTOA 4OC3A 3KZWA 5B08A 4NGQA 2EXUA 4XPKA 1B99A 1C0TB 1VHFA 2GQ2A 4DR7F 1VQOS 3BBCA 2ZE2B 3RB0A 3KLVA 4X62F 3CCLS 1Y10A 4DL4A 2DXEA 3D4JA 3OSPA 1HNVA 1HW9A 2N3OA 2X7IA 4OYXA 3PX6A 1KUVA 3OUYB 1AFJA 1FDNA 2MKHA 5ETTA 1UJ4A 1S7IA 2ZC4A 5DLFA 4NRUA 3SQGA 2BJ3A 3LQVA 2B6AB 5LYDA 5L8RC 1ARMA 4UOHA 3H0PA 2OFGX 3W8GA 1RT7A 3IRWP 1FK9A 3K59A 4F4ZA 4F0MA 2Q43A 3OVSA 4WPAA 4BMHA 4AG9A 4WE1A 3AY0A 3D6MB 1FE0A 3TZZA 4EZ6A 2W4PA 2DITA 3M8QA 3BLNA 1WORA 5LXRA 1NH8A 4M94A 4FNIA 4J9LA 2WUUA 2EVZA 2DGOA 2D3UA 2IDLA 1SUQB 3I4PA 1P4NA 1O0PA 1NKBA 2R2UA 3UN3A 5KTQA 4X4TA 1Q79A 2KYXA 2GMHA 4O3PA 1Q7LA 3K7RA 3BI0A 1WKLA 2DHHA 3OQ2A 4GC7A 3CSKA 3I0RA 4MYUA 1IWAA 3THVA 1CSJA 3WX4A 2A6OA 3CE8A 3S6HA 1TXRA 3OLBA 1IKVA 2ZBQA 3AB2B 5J2QB 3SI8A 1M1GA 3UDVA 4FXWA 2LQ5A 2DGQA 1GQEA 1TV6B 3HI9A 3VALA 1SL1A 1WEYA 2OUGA 2BZ2A 3W62A 5AXNA 2KG1A 4Y49C 2NXUA 3TVZA 3TQ1A 1QJHA 4MY0A 4QWAA 1SQHA 4YS2A 1NSKL 4U95A 1F3FA 3SJEA 1X60A 1HNVB 3E8OA 4M1KA 2NR0A 5A8RA 2FIWA 2CPJA 5T7LA 3QO9B 2LKZA 1HBUA 2J8NA 3LWMA 2QRRA 2W2OP 4IH7A 4KHRA 5FLXU 2C2NA 3CDAA 2DR6A 3K0JA 2BABA 3QSIA 2EBGA 1P6TA 2HQGA 2KFZA 5IB0A 4CO3A 1GNKA 4C2MA 2GHPA 2BJ9A 1UVNA 2OU2A 2Y1RI 3IWNC 2GVZB 3MECA 2W1BA 1BAVA 3IGVA 4PK2A 3SV4A 3KJVB 4R57A 3H8FA 4ER8A 5DDQC 3M2UA 3R1LA 2HHXA 3OR2A 1LAPA 2XLJA 3CXSA 1RDRA 1HYSA 2CNOB 1FXLA 3MOZA 2J0SD 4QR1A 3K8VA 2BMBA 4URQU 1GT8A 4USWA 4D3HA 2PC6A 1YG0A 3BDPA 2XHCA 3BM7A 5KFQA 2QA1A 2F9DA 4WFBQ 3FECA 2VZ9A 3IAM9 2OH2A 4PQUA 2P6GA 4L89A 1NPPA 3CGIA 1RAOA 4EU0A 1S1UA 4K4SA 2XSJA 2I38A 2DRBA 1VRUB 5C5JA 2CPZA 3BN7A 2EBEA 1HNZJ 3BH6B 3T19A 2NYIA 1CP7A 4P4DA 2DNRA 4OLOA 3FK4A 4USUA 1WKJA 2IAJA 2CQ0A 3PJXA 5HJYA 1S48A 4DL0C 3FNCA 2FGCA 1RCOB 3FCWA 3GCXP 1PYTA 3CNQP 4KOSA 4P2SA 1RT5A 1R8PA 3T6JA 3K5NA 2ZBCA 5AG4A 4F9VA 3Q8YA 1QSTA 1BC6A 1TU0B 2PE8A 1H73A 2EEYA 1QAXA 4EO6A 4C68A 2B6AA 1RBLA 1MJ9A 3FQLA 2F8MA 4U8YA 3MPYA 3CDBA 2GLJA 2W2NP 5B0GA 2CDRB 4QVTA 1PUAA 1IWGA 2FY1A 1DJ0A 4O3SA 1TKJA 5C42B 5EX3A 3VVTA 4DNCA 1YLEA 4P7VA 5LJ5Y 1HQ2A 3PR4A 2WONA 4MFKA 1YSJA 2QLFB 2LU1A 2J9AA 2JFKA 1JKHB 3ILJA 4PQAA 4L6V3 1PYTB 4XNHB 3TUPA 4LVNP 4X65F 3GE9A 1K8AT 1OJ4A 3CT9A 2XO7A 3KKFA 1VJWA 3BGLA 3RUBL 2N7CA 2C28A 4U6PA 1SQGA 5CNPA 2E9TA 5IB9A 3IU1A 1KFSA 5E96A 3I0SA 1RT6B 4G6VB 4YOEA 2GJIA 2NQPA 4DSLA 3BGRB 1Z4RA 2PJ2A 1N5YB 3T8WA 5DQIA 4F4WA 4A8OA 3F41A 2J7UA 3CMQA 3B3TA 1S6PA 3M30B 2DHGA 4ZVUB 2LP4A 4WK1A 3QT6A 5C42A 2YX1A 4Y2IA 1GTHA 4RI1A 3AOCA 2H4WB 4FPIA 2KXNB 2O28A 1LXNA 4AT1B 9RUBA 1SJQA 3QRPA 3J7A1 3DRSA 4F3MA 4FD4A 4DUYF 1X7VA 4A8FA 4Q44A 1RLDA 4KB7A 5JXSA 4CLFA 3EPIA 3MUTP 1UA1A 4UY8T 3MDFA 3UDCA 1WNEA 3H5UA 1N34F 3Q83A 1HHQA 1KFDA 2BCOA 1XR7A 2L9WA 2XY5A 2IM2A 3DM2B 4FYVB 3JB9k 4DQQA 4LFBF 1ZH5A 3M4XA 1NK5A 4HH1A 3G8WA 1JNZB 1CJVA 5IV0A 2DD8S 3PY8A 2R8HA 1VQ7S 5F9LA 4I6YA 3LODA 5HANA 4OJGA 1C1CA 3OXFA 1M4DA 2IFXA 4HDGA 4LF2A 3M6VA 3PGPA 2CIMA 1Y7EA 2DNMA 4A47A 4OYAA 2P0WA 2FXFA 5KFOA 4DV5F 4ILRA 3M2VB 5EGYA 3I56S 4XPDC 3PYGA 4ZPBA 1UJ5A 1UFKA 4ZHRB 2ZJQQ 5IM0A 3V5RA 1XQIA 1RAHB 5H1SV 3GIUA 3FF3A 4NXMJ 3IU2A 3HVTA 3R1KA 4OYMA 4MKAA 5F8HA 3R5DA 4KSAA 1CJKB 1EP4B 3DXBA 3AB4B 2ACMA 3KQXA 4QPTA 5KFKA 1Z5RA 1YX2A 1T9VA 3MEGA 3PDNA 4NLVA 4C3LA 4B11A 2Q7SA 2ABYA 2NPFA 2OZUA 4ECXA 5G21A 4DV7J 2PI5A 4DSKA 2DPTA 1GXLA 4AG7A 2I8EA 4BLGA 4NLSA 2HQDA 4USVA 2XB2D 1MU2B 1TVRA 4NLRA 1S1TB 2GREA 2IY5B 2M70A 5DQGA 2V63A 5J2MA 1S3ZA 2KYZA 2HS3A 2R42A 2AFXA 5BYSA 4JV5F 1VR6A 4GRSA 1HEEA 2MHNA 1FRJA 3OTEA 2X3DA 3IR7B 4N8OA 2B4UA 1RTIA 1S7FA 3WIUA 4K4XA 1NB2A 4M5LA 2XMMA 3UQSA 4MJKA 3OXLA 3DC2A 4OJ3A 2P6EA 2K5TA 1LOKA 4Q43A 3IR5B 3MAAB 1WI6A 4DV5J 4WP9A 2DPJA 2VQEF 3BR9A 4X3RA 1N8RT 3D3CJ 1NRKA 2K2PA 1V5VA 3GYAA 2JLFA 2CQIA 3H42A 1IICA 1C0TA 4FPRA 1RCXB 1S97A 1YQEA 3SXNA 2C3UA 2JRSA 1RU1A 4O4GB 3V4IB 4DSIA 3WHIA 4WTYA 2JWNA 2F1FA 3Q22A 3DXSX 4ZOSA 1HR0F 2X3GA 1JIHA 1Z2ZA 4YDDB 4JD6A 4B3TJ 1JLCB 3M8WA 3R7BB 4JI6J 1RK8A 1XR6A 2DNYA 4CP5A 4F3OA 2PJ9A 1Y9KA 4FF1A 2HNYB 3RYOA 4WF9Q 2WSCC 3CD7A 2YKNA 5GVQA 2R8JA 2QLWA 3J80U 1KVKA 3EY5A 3TUJC 2K7JA 3QAYA 4PG6A 5J2QA 4I2QB 2C2EA 2X1GA 2K8GA 1NLKL 2HW3A 4H6UA 2MQMA 1GHEA 5KTCA 1X4EA 5D0GA 1PJ5A 3FZBA 2CZVC 2PVWA 4QPXA 5D3GA 5L1JA 4NSQA 3POTB 4LUAA 2HBZB 2VF3A 1HQEB 1IB1E 3DDIA 3PEJA 2JBJA 1DARA 5HBMA 3WC6A 4FVMA 1TQLA 2MLYA 1HLWA 5HJXA 3HKZD 3TTHA 4A8KA 2B9WA 4A32A 2A3JA 4OYOA 3DR8A 3M32A 2XO6A 4KKOB 4DR3J 4NRTA 1ZAVA 4FYYB 2Z8QA 3HSDA 2QMXA 2BXJA 1LWCB 1IKYB 1FHTA 1GEHA 1W2BR 2CQHA 4Y2MA 1SC1B 2YNGA 1VDHA 2GC8A 3QIDA 1YX0A 4C97A 1S57A 2QMWA 1BHNA 2Q4VA 5HXDA 3C15A 4CI0B 1H2UX 1VJQA 2F4VF 2DXQA 2B3VA 4OI3A 2GGPA 3GZ7A 1BXNA 1TKHA 4FKXA 3AD7C 3TJ8A 5KFMA 3M8ZA 4WWSA 1SUQA 3LGHA 1NK9A 2HNDB 4NEXA 4MXUA 1U26A 2CNKB 4KOWA 3NXZA 5KFYA 3GU0A 3MMCA 3B4MA 2CNMA 1HDQA 3R5JB 5KG3A 4MK7A 1FKPA 2OR4A 2DRDA 2WZNA 3L9ZA 1RI7A 1NSLA 5C24B 4RW8B 3P49B 1KLMB 4WU3A 2D4PA 4DU7A 2HGMA 2E1MC 2BJ1A 2XEXA 3ULHA 2KG0A 4IH6A 4OZLA 1HFEL 3UCZP 3QWUA 3V6JA 4P2XA 3DI6A 2WOMB 1M4GA 1Z4EA 1XRYA 2POKA 2ZH5A 4UW2A 2H5IB 2MQOA 1EP4A 4WXOA 1HBOB 1TUWA 4NLDA 3S1TA 1MWQA 4X4QA 1YJWS 4KHPJ 4MFZA 2C2ZB 2XM3A 4H4OB 5KT6A 4B12A 1YZ6A 2QV6A 1RWVB 5ETRA 2BDPA 1MN9A 5KFBA 3IBCB 1Y4ZB 3WZ0A 3PZJA 2R8VA 2YNIA 4EFAC 4ED0A 4CYUA 1B7FA 1MG7A 2HHPA 4QBJA 4LRBA 2AYBA 4LUBA 3PJ9A 4ZVTB 2R7HA 1NE9A 4NLWA 2VICA 1OY9A 2LCWA 5E3CA 4RW4B 2FTRA 3GSIA 1WG1A 1ARLA 4ZJQA 2QIFA 5ETPA 1R6YA 5GAGU 1OYDA 5CAAA 3D7GA 3FRZA 2Q6BA 1ZTWA 1BOBA 3TRGA 2BKPA 2O5DA 2HQ3A 3OFHA 2UVRA 4L3KA 2EUIA 3FMCA 1U7LA 4KLVA 1CULB 2JEGA 3RBEA 5CQGA 4RZRA 2AJQA 2PRQA 2VFVA 3P6YC 5J1NA 1LW0A 1HNWF 3FVYA 3N5BA 2MTLA 2P6FA 1LXJA 1XEZA 2HKEA 3V7ZA 2LEBA 5KAKA 2V4RA 3NOCA 5KOWA 4C8NA 2ZEOA 4JJXA 3OBIA 2DO4A 2CJQA 2R4FA 1KRPA 1JLEA 4GMKA 1A9NB 3BR8A 5HROB 2Q51A 1V3ZA 4ELTA 1B7YB 2OLWA 3TJ9A 1U2CA 3EUNA 3TO8A 2FVSA 2J0WA 3GIKA 3RBXA 4UOFA 2AYMA 2EC2A 1WOPA 1BUXA 1RXTA 1DBDA 3RZAA 4KYZA 1EAYC 5E3RA 5E7OB 3ONQA 4AUKA 3I9V9 4RUCA 2CQPA 3HD1A 3SMZA 2QVPA 2Z3MA 1Y11A 1CQMA 2PDAA 1EKRA 2IBOA 3VF0B 1C1BA 4HTJA 2Y0BB 4OC1A 3RBUA 2FJDB 1FESA 5E3AA 4CZCA 3ITHB 1F57A 2ZPAA 3FSIA 2VPWB 1O8BA 2IMWP 1RU2A 3RR8A 2IYIA 3GFHA 1WOSA 4MJ8A 4IO9Q 2WZ1A 5I42A 1R0BG 2CVIA 1IM6A 1I1GA 2FJVA 4CRYB 3HK2A 1KDNA 2E7VA 5LM7E 1QMUA 2GMLA 1WI8A 1U48A 4K7QA 4D3GA 3C16A 4OAEA 4I2QA 4IOCQ 4NGSA 4NLOA 4F8RA 4X62J 3EZ5A 3DLKB 1YVKA 2AJ6A 4KOTA 3QAEA 1IXKA 2E7XA 4LRDA 3PKMA 3PKYA 3TZXA 2BEFA 2M8HA 2MJNA 4ZKAA 2YNFB 3DLEB 1BD6A 2NYHA 3KHXA 2HSEB 1HWKA 2KHCA 3W6XA 2OZHA 1XF8A 3KMQA 3IWGA 4QIEA 3ZZRA 5KG0A 3TR5A 1LWEB 2L41A 3FBUA 2XNQA 2HG4A 4OI6A 3CCTA 3B8GA 4B5PB 1KP6A 1RWXB 4R0JA 5KT2A 4PPDA 1FFWB 3JYTA 4PXEA 2NPIA 4RW9B 1WACA 1S7HA 3X3UA 4DV6F 2YH1A 1RTJA 3WQPA 3BKUA 4CLKA 1RUSA 4M5DB 4RS2A 5JPHA 4LR9A 2B8PA 4LSNB 2AGPA 5FVJA 3VGUA 2IL4A 3MEKA 4TNOA 2MQPA 2FJBB 3J7YU 3BO3A 2HIYA 3JQMA 4DPXA 1W7WA 3BQ0A 5AJ3J 5I3QA 4HEA9 1Q4RA 4CGNA 1HD1A 2BM1A 4DV0F 3GFZA 2HURA 1QAJA 1K4JA 1UVLA 2RKIB 4DV1F 2XNRA 1LW2B 1HNXJ 1MLAA 3J7AN 2UVWA 1VC5A 2EPIA 4NGTA 4R76A 1FRIA 3T90A 1CJVB 2BBEA 4AQYJ 2Z3NA 5DS0A 2VG6A 1YBAA 3ZTSA 1TAUA 1PAEX 3AFGA 1FKOA 2CJXB 1X4CA 4ZMMA 2V4JB 2BKOA 4X4RA 3R9FA 2HLTA 2V8VA 1IJFB 5M2UA 2WOMA 2Y0SD 2L08A 4UUWA 3OLAA 1RHQB 3W5XA 2D7SA 3W8PA 1XEBA 1B6BA 1YI2S 1VQYA 2DIVA 3KJQB 4K8RA 2BE7D 4GC6A 4OI0A 3KNGA 1FT7A 4C2ZA 1F2OA 3LP1A 1G1XA 2UU9J 1R8HA 4RW6A 2DGTA 4HR2A 5F8LA 5LJ3Y 1IYLA 2VKRA 4CO5A 5F48A 2OTJS 4UEEA 3C3LA 4UOGA 2W9CB 1N32J 1VYAA 1FX2A 4CLTA 2UUTA 1X12A 3MGJA 2O66A 1X5OA 3I1UA 3KMSA 4RBVA 5MAOA 4OV1A 2KKHA 4DCPB 2CQGA 3GJTB 2MB0B 2JVOA 3KLIB 3HJVA 4KO0B 3KLFA 2GANA 3K17A 2PMHA 4QU7A 2EKYA 1DHMA 2ODFA 1XTZA 2VBYA 2RSQA 3IM9A 3I87A 4DZ6A 3G71S 2FB0A 4RL1A 4MBUA 1ZA1B 4GVLA 1U2FA 2Z3PA 4HNWB 1N6QB 1RHRB 3G6ES 2K1RB 4PZVA 1TKZA 1HNZF 1O5JA 4LF4J 4C3KA 1CJKA 2CNLB 3N0VA 2ZENA 3C19A 4H4OA 3EE3A 3ENWA 1X4FA 2MZSA 4WFXA 2I79A 2CTBA 4G3IA 4DBQA 3TEHB 3VVUA 2G3TA 4U7UD 1K1QA 4ZPCA 3HULA 4JI4F 1XWLA 3W6SA 2RJZA 2NZCA 2HVIA 5IS2A 4DR5J 4TNUA 4TLRA 2XWYA 2R7RA 4LFBJ 1D9AA 3R8YA 5ITHA 5DG9A 1QSLA 3WX8A 4NCGB 5M2PA 5EBVA 4DJBA 3LOUA 2CF4A 1RT1B 1XR5A 3JS9A 4BBHA 4QYZK 4ECUA 1Z2LA 2ZHAA 1FFSB 2I0XA 4K50A 3D0GE 3KG4A 4HH0A 3UY5A 1RTIB 1S12A 5CHCB 3JTPA 3W3SA 1C1BB 1F9EB 2M4MA 3KJNB 1IM4A 1RJJA 4U9ZA 4PG4A 3GV5B 4DR1F 3LWLA 5D4PA 4JUZA 3IG1B 1DTTA 3ETMA 3MAAA 2C6GA 1VRUA 3V81A 5HL7Q 4N56A 1I5OB 4NJRA 2ASYA 2E1CA 4PWDA 1FCAA 2VJUA 4F7VA 4CAFA 1BWEA 3IGRA 2MSSA 1LWFA 4Q45A 4LSLA 2Z3KA 1UA0A 5DRKA 4UIAA 5IXUA 5C25A 5CBMA 5K14B 3US5A 3I9SA 2FLLA 2GIQA 4CO0A 3VWDA 2H51B 2FIUA 4FBUA 4TY8B 4MCSA 3OR1A 4PWWA 2W24A 1FKPB 2L3MA 2Z2YB 2ZELA 1VRTB 2VC1A 3RYLA 4DQRA 5E33A 3MR2A 4P44A 3T9YA 5LSOA 4WP3A 5IT4A 3BGFA 4WWVA 4FF4A 4O0IA 1WUUA 1WTFA 2ROPA 1Y0RA 4EBDA 4OMEA 3NGUA 3EXCX 5D29A 4JOUA 5LT5A 3ZFVA 3KJVA 2CG8A 2V50A 1S1VB 3CJKB 3HXMA 3DHXA 1SCJB 2K3KA 2ZBRA 2LXUA 5A0YA 2GHWA 2I00A 4ECWA 3DOMA 4RWXA 4B9VA 4WYLA 3ZZYA 2JC1A 4J37A 3TA1A 3CJ2A 2DB1A 4MFJA 5AG7A 4KORA 3MMAA 4LFAJ 3W63A 2IRXA 5L46A 3HFKA 1U1MA 4CYUB 3HHLB 5CPAA 3R5BA 2LMIA 4KPCA 1DZ5A 2YWEA 3GP9A 4UCNA 4RPFA 3KG0A 7CPAA 4I67A 2FT0A 3DRXA 4I64A 1CULA 3CCMS 4HNXB 2HVZA 3OJUA 3NCRA 3R7NB 5DDRC 3SJGA 2VU5A 3DGPB 3BKFA 4KFBB 1RTDB 3HZEA 4DN0A 1UMJA 2PT0A 3O2IA 1Z1ZA 4Q36A 3NCPA 1I3OB 4EMDA 5FJ4A 3FYNA 2EK1A 1IKWA 3SSRA 3KXDA 1X0PA 5KG4A 3WABA 2KL8A 2JEWA 2DR9A 2CY2A 3IC1A 2WPXA 2ZXVA 2HFSA 4Q8EA 1FNMA 3SFUA 4ONWA 4PUOA 1DAXA 5CYMA 3GIJA 2CQ1A 1JLBA 2DT9A 2XEIA 4CYOA 4M5GA 4JB8B 2B56A 1DLOA 3NBPA 3CJ4A 3OTCA 1S0OA 5L39A 3KOAA 1SB6A 1YR0A 2AZ3A 4YDXA 3NAHA 1JLFA 4RNFA 2PFDA 4LQ6A 4OADA 2AJ2A 3KDNA 4AXVA 2O3DA 5F46A 1IR1A 4NGMA 2R7WA 3L4BC 3FJ2A 1Q2YA 4M6IA 2BE2B 4IRKA 5LMNF 3NMRA 3NMAA 4CS0B 1F5AA 4CRZB 3KLIA 4ES3A 5A2QY 1S1VA 4FYXB 2Y1JA 3SI2A 4U96A 4C8LA 1S9GA 1JJHA 2PJBA 5D15A 4AYBD 1S4FA 1MROA 1RTQA 2UXDJ 4O3RA 3W64A 3M1VB 3FXTA 2CZ4A 3BEGB 1S6UA 2VFUA 1UL3A 2LU2A 2AV5A 3VR1A 2PJ8A 4P9SA 1IBLJ 3W2VA 2AJ4A 3LF0A 2JLMA 3CMES 4UY85 1QQ9A 2J5AA 2EG2A 1CVJA 2RQMA 4R25A 3K5LA 2V9KA 2FY8A 4NWBA 4EFDA 4DFJA 3CZXA 4BD9A 2HHUA 1SV5A 2UUWA 2DXDA 3V2UC 4YR0A 2YWFA 3M7VA 3NS5A 2WSFC 3VWSA 4ED6A 4K5RA 1TL4A 1T8EA 1HWLA 2R2RA 3I0RB 4OIXA 1OWXA 7AT1B 5DQHA 3S6GA 5F8MA 2C2KB 3OFGA 2O01C 3N4WA 2VXKA 2VQFJ 2CA9A 1S7KA 5LYLA 2FVPA 3P5TL 4RU9A 3K89A 2CQ4A 3DGVA 3NG8A 1SH2A 2ADCA 3C16B 2YWHA 5KFAA 3PO4A 2F3JA 4B3RJ 4QIVA 2DXFA 4LRFA 1CP6A 2EFPA 1D8ZA 4UCMA 4PXCA 3MR6A 4WFNQ 1XNRJ 1TF9A 1V6HA 1SC3B 4ZS6A 1FXDA 2JOQA 3SDEB 1NNDA 2IRYA 4QWDA 2YNFA 4JI6F 3TJAA 4ZP8A 5KFZA 3BHXA 5L9XA 2H3EB 2WK4A 5J1EA 1T7PA 2E5LJ 1RB0A 4J9NA 5J2MB 3IWXA 1I94F 2CG4A 1BQXA 4ECQA 3IJ3A 2UUBJ 4IQMA 5KG1A 3IRXB 2WTFA 3L2NA 4BCAA 2Z3LA 2JZ5A 3KK3B 4DR3F 5GADU 2MZQA 1GYTA 4F4AA 4HPSA 4UFVA 2Z11A 3N7ZA 2WVBA 4ZVGA 4B9NA 1N36F 2L48A 1HPZA 5B0DA 4ZDNA 1OS5A 3ZC4A 2PEBA 3N28A 2ANPA 4J9VA 2BACA 1SVDA 1M5KC 2G4BA 1OMSA 2Y9HA 3Q0AA 4DJLA 1XNQF 5HMYA 3MMAB 3BREA 2HMIB 2HB6A 2BJDA 2Y8WA 2BOAA 2HS4A 3QJJA 4J9UE 2W7AA 3TARA 3N01A 4QIGA 4DPOA 5GAHI 3H5SA 1Z8TA 1KUXA 4JYWA 3PB6X 1WC3A 2XZWA 1K44A 4A8SA 1ZAWA 4USIA 4Z65A 3A8EA 1U1LA 3ZZUA 3WBZA 4LQ3A 2WVDA 4C8OA 1CC7A 3BO4A 2MQNA 2YQ0A 1RTHB 4WU2A 3BB5A 2V2KA 4HACA 3RJMB 1M1DA 1LOUA 3X1LB 5ADZA 1ACMB 1JLGA 3KDOA 1L5UA 1R0AB 2X1BA 4ED5A 3NRBA 3D28A 3D2WA 4CRJA 5IV3A 1UFWA 4ES1A 4K4YA 5F9NA 4N41A 4TKTA 2P2CB 1VHIA 3VAHA 3TANA 4C11A 4RBTA 4QJVA 3MR3A 3TA0A 2GIVA 5B09A 2VUGA 3DLLQ 2VBWA 2RNEA 3MHYA 5D0HA 1IOIA 4NJQA 3KUHA 4PWUA 1D0EA 2CNSA 4IK2A 3NH4A 3QGPA 1OZPA 2ZFHA 1SJ4P 1D8YA 2J0QD 4C98A 2JEJA 1X5TA 2PSWA 4IG3A 4Y2KA 1DLOB 5LMNJ 3R5GA 3DLEA 5CZXA 2CNNB 4ILLA 3TOBA 1U47A 4JI1J 4C9DA 4KT0C 4EGLA 2FPHX 5G22A 3PFOA 2YKNB 5D8HB 1LQ9A 3UE2A 2VC0A 2CJ9A 2FVGA 1NK4A 3JSRA 2CPIA 1BO4A 1NDCA 3CJTA 4HT5A 2ZH3A 3IWEA 4BS2A 2BE2A 3G8QA 7FD1A 3OTOJ 2XZTB 1NO8A 5F8GA 1VHSA 4FZVA 4R7MA 2HHHF 2JLGA 5D0EA 3TAMB 3OHBA 3SSSA 1D9FA 2QA4G 4UT4A 2DGUA 3DKDA 2XS7A 3PW7A 2EW9A 1N71A 4NOHA 4NCAA 2XMUA 1TKDA 4RUHA 3S01A 5J8FA 2RVJA 1Y7PA 3I55S 1QSOA 1UFHA 4Y00A 4LFCF 3C6TB 1KN6A 2VG5A 4JXRA 1GMWD 2R98A 1X9WA 4UZCA 4DUKA 2UXCJ 1RAEB 1FRKA 3VQSA 2BW7A 2YNEA 3NS6A 4OI4A 2Z2LA 1HMVA 1FRXA 2RS2A 5EWFA 4J5OA 2W2PP 4DV6J 2UUBF 4R3LA 3G82A 3KHZA 3T1YJ 3CDEA 4WK3A 3H4DA 2PR1A 4K4TA 1Q95G 2GV1A 3M8SA 4PCQA 1ELLP 4F02A 5JH9A 3VAJA 4UOCA 3KLEA 2FJEB 3PV8A 2A2DA 4GKJF 2YH0A 2IAJB 4CWBA 1WEZA 5DGAA 2JL9A 3PBEA 1L0CA 1ZZNA 4F4XA 2BYCA 1YGHA 4OIWA 3JTKA 4X66J 4IUSA 4LR7A 1JX4A 2HHVA 1NXIA 4X4VA 4OC5A 7FDRA 3FEEA 2ZJPQ 2C42A 4YMEA 3HHKA 3CULA 1CJWA 2W8LA 4K59A 2E5IA 4A8WA 5DM7Q 2Z0ZA 3P3DA 5BYRA 1PYSB 3KI9A 1HI8A 3M6XA 2CJYB 2QL7B 4TXSA 4LF8J 2E1AA 2COLA 3QNWB 3CCRS 2XS5A 3O3LA 4UCPA 4W9YA 3I9ZA 2QSWA 4ECSA 1U8WA 1FKAF 3Q89A 4NLGA 3V6DB 4ALZA 5D8NA 1QTNB 2BE9B 2ZEPA 4ZP7A 2K1RA 1RO5A 2GE3A 2XSJB 2GX8A 4I6AA 4NFRA 3DU6A 3W66A 4DX6A 4Z7YA 5IM0B 2RF2B 3H8EA 1NZAA 3UCGA 3GG0A 1UWYA 4JWPA 3A3OB 1FRMA 4HYKA 3ZNJ1 4NCBA 3ILIA 1C2PA 1S59A 3NA6A 4ANCA 1RAAB 2FIAA 1T3OA 1I6JA 3BBBA 1PBAA 3DOLB 3CPXA 3T41A 1BQNB 1X4AA 1RT2A 2B4PA 5CCMA 2V0NA 5C2GA 4ZPAA 4OC2A 3ET6B 3CB4A 2W4DA 5ETSA 1ZA2B 2NZ4A 1S0VA 2W25A 3H4QA 4DFKA 3HHLD 1PSDA 2FCKA 4R9MA 2NSCA 2HVDA 1TFWA 4KY3A 2ZITA 2J8MA 3NH8A 2APOA 3JTNA 1PG5B 1S4EA 3C14B 3ELHA 1S9GB 4DV2J 4FAIA 3FSXA 1BQMB 5C82A 4O3NA 5EC4A 4XO0A 1EQ0A 1UPMB 1AUSL 4ILMA 2XS2A 3FBEA 2PRBA 5HATA 4LSLB 2FQQB 4PV6A 1R0AA 2BQ3A 3CJSA 3D1QA 2OEKA 3GTYX 2ALYB 1HWJA 3TVYA 1YGYA 1F5CA 1RQ0A 1S1XB 4KVME 1Y5NB 3PRBA 2MZ1A 1CEZA 4JI2J 4KC5A 3I4HX 2KTQA 1ROFA 3N6LA 2XY6A 2ZW4A 2ATLA 6AT1B 4A95A 4QYRA 1PIEA 1SBRA 2D4OA 4KKOA 2KT2A 4MHDA 3BJ8A 3BGRA 3KHGA 3HJFA 1J27A 1Q81T 3PW2A 5LYIA 4PG8A 3GPAA 3J81Y 5AXMA 1W2IA 3ZTRA 2NMTA 2LQ9A 3OR1B 3N5FA 5L38A 1BWVA 2GA7A 2RH3A 1L3SA 1JLAA 1AW0A 4TY9A 2KI2A 3A4TA 5I42B 2QX0A 3G6YA 1KTVA 3CJKA 2XMTA 3PIPQ 6FD1A 5C7PA 3KLGB 5ISVA 1AA1B 2B5GA 1ZTTA 3RAMA 3SI1A 1TZ0A 3BQ1A 3PJWA 2IA0A 3PYFA 2G1DA 1NJZA 4FDFA 4CTAA 3AH6A 3ZJ0A 3FH4A 4DSEA 2M7SA 2OKQA 3HT3A 5LRKA 5HMWA 4RW6B 2V68A 4NLYA 5JVGQ 5J2PB 1FT8A 2KM8B 2XMAA 1Q0NA 3R97A 2UXDF 4YEAA 3WC5A 1RT3B 1SC6A 1SXLA 3F5BA 2ZH7A 1DQ8A 4NYOA 4WFYA 2PQ8A 1FVQA 3CTRA 1SH3A 1OPIA 2BO9A 1Q86T 3TCVA 3MMBA 4CH7A 4E8OA 3G2XA 3C6UA 1JJCB 3T5LA 1N54B 3H20A 3MGDA 3QATA 4OV6A 5GMDA 4B5OA 1QSYA 3BI1A 2OEJA 3EFAA 4P75A 3M8PB 1IBKJ 1RAIB 1Y3KA 3P8BB 1HMVB 3E3XA 4X4SA 3TE4A 2UUAJ 3OVAA 3GQCA 3K57A 2QL5B 2PA3A 2V6AA 2P9GA 1EIYB 3OSNA 1TV6A 2H48B 4K4ZA 4DL2A 1DRZA 1UCNA 2RKIA 2MHEA 1VQSA 5CYQB 4KV8A 5F8NA 3KHRA 4M5MA 2VQFF 4N76A 1JWQA 2XWXA 2ZBPA 4O4GA 3FEZA 2MKCA 4CNZA 2V67A 5IQ6A 3VAIA 2PGCA 2DGSA 2MXYA 3GV8B 4EMEA 1EE3P 3R95A 1U1PA 1BY9A 1NEEA 3PB9X 2LXIA 3CEDA 4PAAA 4YN3B 2PJ6A 4I2PA 3W65A 4OX9F 3HHDA 1F0XA 4F0HA 1IKVB 4KBIA 4Q8FA 3NCQA 4LBPA 4IO1A 2YPYA 1QUVA 2WRMA 3FUYA 4RW7B 3RRGA 2LEAA 1VI7A 2HVHA 2FDNA 3MZIA 1QTMA 1SJ1A 4ID5B 3AJ2A 4Q2MA 3SCJE 3F0NA 2RILA 2RHQB 4B08A 4I7FB 4W98A 3IWWA 3CVKA 1S1WB 2ZD1B 5A28A 2ERRA 1NHKL 2JVRA 3EGVA 1U25A 4L73A 2YGWA 4OZNA 5SZTA 4DMZA 2V5HG 4UWJA 4MT1A 2NYQA 2GJ2A 1CG2A 2KVIA 1CPZA 3IP0A 1EKSA 5IWAF 3PR5B 2HQFA 4RUAA 4F50A 4L74A 3DRSB 2ZZNA 3B3WA 2IJNA 1MN7A 3DHWC 4DFMA 2B9YA 4V1Ak 4B3SF 1HBMB 4Q38A 3FEYB 1H2VZ 4C2XA 1R89A 3M2RA 1HNWJ 5IOLA 5FDLA 5KT5A 4H4KC 3A9LA 3QLHA 1EJ7L 1BQMA 4HT7A 4P6QA 2R7XA 5B0EA 5KFUA 5DZ6A 3D7DA 1TK5A 3OR2B 4C7QA 1LKZA 2C6PA 4ORFA 2VPZB 1T03A 1A7GE 1REGX 4NZ6A 1VQLS 1K9MT 3B3SA 2OPPB 4NI2A 3D6HB 2REFA 3IAS9 2YKPA 3W1YC 4LJMA 3MMCB 5DDPC 2ASJA 3S9MA 4B10A 4DUZF 2VDIA 1D3WA 2QN6B 2OAUA 4KO0A 4YHHJ 3KLFB 4TY8A 3SDEA 4DR1J 3ZZPA 3BJYA 2BA9A 3JSMB 2M52A 1WDTA 3GR1A 1WC1A 4NGNA 3PW0A 1S7LA 1N88A 4DR6J 1UKUA 1H6KX 2IRUA 1WWZA 2V8DA 4PQUB 1VQ8S 4HNYB 5KFGA 2EFQA 4DL7A 3RRHA 3EICA 2B4OA 1T11A 2Y3YA 4MKYA 2Q79A 4ITSA 2YVSA 2X7BA 3QLHB 4IUFA 2D3O1 2D1CA 3V6HA 5C2CA 3J80Y 3JUWA 3MEEB 2RQ4A 5T14A 3ETOA 3BH7B 4MKVA 4CM2A 4C8KA 5D78A 3H4BA 5ETLA 1OIAA 1UW4A 1RWNB 4DPWA 4NXNJ 5CA5A 2CWXA 3Q8RB 4ED7A 1S1TA 4WKYA 2V8GA 2YPZA 4A2ZA 3MPDA 2RQKA 4DQSA 1RZMA 3OUYA 1Q8KA 3WC0A 5CD4A 2FLOA 4TQSA 1K0TA 5B7WA 3BYRA 4OZ0A 5ETVA 4CLLA 4ZN3A 3SFGA 3C66A 2XMWA 3M8PA 2P5VA 2Z57B 5A6PA 3CCJS 4J9QA 2W9BA 4IFVB 3BDEA 4UUXA 4YHHF 4B5PA 5E5NA 3MECB 1UAWA 5U47A 2QEXS 4P7TA 4TU7A 3NAIA 2RF2A 3TO7A 3SJFA 4YR3A 3MEEA 1KTQA 2Q44A 4I56A 3RBDA 4DN9A 3RGIA 1X4HA 4CM0A 1XMBA 3VCDA 1D1UA 1HQEA 3CW2C 4R5PA 2EI5A 3G4SS 3TW0A 1N5TA 4CLWA 4ICLA 3RG6A 2PJCA 4DV3F 3MTKA 5KTAA 1M44A 3D2PA 2MDAA 2AYGA 2OI2A 4IG3B 1VBZA 3R2DJ 4USTA 2QJ8A 1MNEA 1LANA 1NB7A 2ARHA 4FF3A 1DQAA 2AGQA 1ZPWX 1VMBA 4DYOA 3B3VA 5EDWA 3DRPA 2CFXA 2XMKA 4NZ7A 3H8GA 2UUCJ 1AZSB 2RS8A 2HZAA 4NLTA 4NMXA 4H4MA 2LQJA 3HKWA 3O6QA 3DLGB 4XPDB 2V2ZA 1PBUA 2C2RA 1FF2A 2H5JB 2R7SA 1WC6A 2H5MA 1FJEB 2ZWOA 3WR7A 4B14A 5LRJA 3CCWA 3M1VA 4GXHA 1FVSA 1P8GA 1UFLA 3GYNA 5LSRA 5EWEA 2XGQA 1XMQF 4O3QA 2MKKA 1U6MA 5K20B 3LP1B 2VFRA 1RAFB 3H25A 2BJ7A 1CC8A 3I5CA 3QO9A 3DN9A 3R9GA 4A38A 2FVCA 3C6TA 5E3PA 4A94A 3VGTA 1TMMA 3P5BP 2PSZA 2AE6A 3OL8A 4I7FA 3M8RA 3FC9A 1GAOA 4PABA 2YKQA 4ID8A 1G6BA 5DGBA 3TAPA 4QYZJ 5G0RA 1AROP 1RHKB 3L7UA 4TWEA 1B70B 4QW8A 2IPOB 3M05A 2FS5A 4DOZA 5J1EB 1U0HB 1ZM2A 4HHUA 2DYAA 1HBMA 3QNVA 1VGYA 1N6QA 4F04B 5J1PA 1ZM9A 3IRXA 4HLBA 3OWCA 4ZIWA 3ENQA 1Q2CA 3Q8QB 3CCES 1I1DA 5KFCA 2WB1D 2XMVA 3TNVA 1XK8A 3CO9A 4DR2J 1JMTA 4WP8A 3HP6A 2WSEC 3DDKA 2RDIA 4W4MA 4ANEA 5ETNA 4QC6A 2B3UA 3BKTA 2A10A 4B17A 3J81j 1EQMA 4JI8J 2CQCA 3NGSA 2IC3B 3W5YA 1RXOB 6CPAA 3R6GB 3G6XA 2J9DE 4JI7F 4M5JA 1ELOA 3CF5Q 4FN5A 5EWGA 4HVZA 1FWPA 3SCLE 2AQ4A 2QLXA 2ZJRQ 4FS1A 3QGGA 1UWAA 4YB6A 4DR6F 4JLYA 1N52B 4FBTA 2W9AA 3H7HB 3MMBB 4Y34A 4PXDA 2YX4A 2J76E 4YFUA 3GILA 1ZLHA 2HGLA 4X65J 4JZ0A 3VAFA 1FEHA 3TX8A 3Q8VA 2RRAA 4BHQA 3EZOA 1MWYA 2HNYA 3L7OA 5HMXA 1MROB 3PBBA 3CC7S 3V4MA 1TTHB 1KZFA 1XMOF 2CTCA 1YWXA 2VA2A 3BQ2A 3ILLA 5IT9U 2FHOB 1RBOB 1FTCA 1B4SA 4W90B 2HFNA 1KVJA 4Q2LA 4DF8A 4DR5F 2QG9B 1J4JA 1SKWA 4HHHA 2QT7A 4I68A 2MSTA 1VCTA 2JDCA 2HZCA 2EWHA 1DE4C 1I51B 2QTWA 4KVXA 1RAJA 1RWMB 1YLOA 2BX6A 4J9PA 2XG8A 2DVIA 4WZMA 1VKCA 2I2YA 2GHVC 1FJ7A 2CXAA 1P27B 2OPRB 3VGSA 2YTCA 1LW0B 2CNTA 3CPAA 4MFBB 1Q8IA 3EWGA 4LF7F 3RBZA 2VBZA 2IIHA 1TKTA 3OV7A 2UP1A 3BGOP 4C6AA 2J6TA 5GMEA 4N47A 3AXMA 3A1YG 1X4GA 1S7NA 2Q7BA 3VV2B 4ZN1A 3GONA 4DPTA 2BJEA 4QR2A 2ZH1A 1FNXH 2DY1A 1U4BA 4HKFA 2OFHX 2OOTA 3B6BA 1JLEB 2CUYA 4IH5A 3VZHA 1FK9B 2OPSA 2G0CA 3KK1A 2F7VA 1V9OA 4FWUA 1R57A 5CH7B 4KOUA 4KPYA 4P2MA 5HN0A 1HQUB 3LMSA 3BZQA 3ZZOA 1IJEB 3MXHP 4A8XA 1TL1A 3O8WA 1IQTA 1XMOJ 4X66F 5KTDA 3BS9A 5KFRA 1M90T 3CC4S 3WT4A 1KC8T 2P6SA 4L72B 2R9LA 8CPAA 2OSRA 2Z2MA 2GIRA 4KHMA 3FFIA 1N4LA 2ASLA 2D9OA 2NSMA 4F67A 2UUCF 5GAEI 2ZUGA 5G1ZA 4H4MB 2FZKB 2J8SA 2OGUA 1N32F 3NNCA 3DLBA 4E98A 1RT1A 3ADAC 2BR0A 1TK8A 4GM5A 4DCJB 2JLEA 2G13A 3ZZ0A 4WE1B 2HHWA 4FNHA 1OQ3A 3DFEA 1XE4A 4UEFA 4U67Q 2RRNA 2YQ1A 4NPOA 3PX4A 3Q8UA 3K2YA 3L7PA 5HVHA 3TOQA 2OMOA 1WHVA 3HLPA 4KV8B 2DR8A 1Q16B 2KXFA 4J9KA 1KEKA 4NLXA 4EO8A 2G2ZA 5JVHQ 3O1LA 3I3GA 4F2SA 3VAKA 3Q2SC 5B0CA 2YNIB