1R43A

Crystal structure of beta-alanine synthase from saccharomyces kluyveri (selenomethionine substituted protein)
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
438
structure length
438
Chain Sequence
b'GTLNLPAAAPLSIASGRLNQTILETGSQFGGVARWGQESHEFGMRRLAGTALDGAMRDWFTNECESLGCKVKVDKIGNMFAVYPGKNGGKPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNYVPNYDVCVVVWFNEEGARFARSCTGSSVWSHDLSLEEAYGLMSVGEDKPESVYDSLKNIGYIGDTPASYKENEIDAHFELHIEQGPILEDENKAIGIVTGVQAYNWQKVTVHGVGAHAGTTPWRLRKDALLMSSKMIVAASEIAQRHNGLFTCGIIDAKPYSVNIIPGEVSFTLDFRHPSDDVLATMLKEAAAEFDRLIKINDGGALSYESETLQVSPAVNFHEVCIECVSRSAFAQFKKDQVRQIWSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPEEIENGFKVLLQAIINYDNYRVIRGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-alanine synthase
publication title Yeast beta-Alanine Synthase Shares a Structural Scaffold and Origin with Dizinc-dependent Exopeptidases
pubmed doi rcsb
source organism Lachancea kluyveri
molecule tags Hydrolase
total genus 143
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature ec 3.5.1.6: Beta-ureidopropionase.
pdb deposition date 2003-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r43A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1r43A01
1YW4A 3PB7X 3NFZA 1AYEA 2PJ2A 5D29A 2ZEOA 3LWUA 1GYTA 3FEEA 3B2YA 1Z5RA 3PB4X 3PEIA 5HVHA 1BPNA 2ZEHA 4NJRA 2C1CA 5K8MA 5I4MA 1Z8LA 4F9VA 2EK9A 5IB9A 3FVLA 4OP4A 4A38A 5J1QA 4WWVA 4AXVA 4RUHA 2JEWA 2PJ8A 2AFUA 2IMOA 4OC2A 3WC6A 3S9MA 3SJXA 2CF4A 3KGQA 3D7GA 2Q4ZA 3BI0A 2PE3A 2NSMA 3IWWA 1HDQA 4NGSA 3RZAA 4EWTA 4P6YA 4UIAA 4WJBA 4G1PA 4X2TA 3SJFA 2AFWA 4MHZA 4P4EA 3SJGA 4ZX9A 4MCRA 2Q51A 4FBEA 1QMUA 3B35A 3FEDA 1PYTB 3H8GA 2V8VA 2O53A 1ZLIA 4NGMA 1NSAA 2QVPA 1F57A 5JH9A 3CPXA 4JYWA 4TNUA 2BOAA 2ABZA 3CT9A 2I3CA 4P4IA 4PXBA 3KQZA 4IK2A 4UEFA 4F8ZA 4PPZA 2C6PA 2EWBA 1HDUA 4ZY1A 4TWEA 3D68A 3IC1A 2PCUA 3D4UA 3WC7A 2PJ1A 4MHNA 1LOKA 2ZEMA 2VL1A 3DLJA 1TKHA 3IIBA 4DUKA 2ZEFA 2OOTA 4CPAA 2ZENA 3V7ZA 1OBRA 4UIBA 3VH9A 5LRKA 4H2KA 1CPSA 1XMBA 2XEGA 1FNOA 4R6TA 1VIXA 4P4JA 1JQGA 3ISXA 3I1UA 2V8GA 2PJ6A 2ANPA 1F2OA 2AFOA 1LANA 1ZG7A 1YSJA 2PJ3A 2PJ4A 3GUXA 2RFHA 5CPAA 3WC5A 2ZELA 3S9LA 5JM6A 4B6ZA 1TKFA 2PVWA 1HEEA 4MCPA 1IGBA 3RAMA 2PJ7A 2O4HA 3FMCA 5JGFA 5HXDA 3PFOA 1CP7A 3PBEA 3KASA 4OC1A 4MHPA 1ZG8A 1ARLA 1LAPA 3PB8X 3FECA 3ISZA 4OC5A 2ZEGA 2PVVA 1ZLHA 5HVGA 4EMEA 3DGVA 3V38A 3FX6A 1TF8A 2AFMA 2PJAA 2BO9A 2CIJA 4FUUA 4P4FA 1XFOA 2PIYA 1PCAA 2CTBA 3NH4A 3BHXA 4ZI6A 1DTDA 4YWYA 4P4BA 2F8HA 4P44A 4R7MA 3LMSA 3MN8A 2PRQA 3T8WA 1CPXA 1TKJA 2J9AA 3KHXA 5DS0A 5HVFA 3PB6X 2HB6A 2NYQA 4PQAA 4PXEA 4K3NA 4F9UA 5LYFA 3NH5A 3D7HA 4LQGA 3TX8A 2AFXA 2HC9A 4MCSA 3NH8A 5LYLA 4EFDA 3D7FA 1ELMP 4DJLA 2AFZA 2CTCA 3JRUA 4NGNA 1Z2LA 4FAIA 2PJCA 3D7DA 1TXRA 3GLJA 3WABA 2C6CA 2WZNA 2PJ9A 3HLPA 4X8IA 1R3NA 4MHYA 2GLJA 5K8PA 1M4LA 2GREA 1QQ9A 3KI9A 1CG2A 1F2PA 4Z65A 2C6GA 4ZY2A 4OC4A 3HUVA 6CPAA 3IJ3A 2V8DA 1BPMA 3D67A 4IAVA 3GB0A 3KR5A 4UEEA 3IO1A 5LYIA 3CPAA 1Y0RA 3PBBA 3PRTA 4MRIA 3B3SA 1ZG9A 3VATA 2ZEPA 1Y0YA 3B7IA 5D8NA 1XBUA 1FT7A 4MXUA 2GU2A 1YLOA 1CBXA 4OC0A 2PIZA 2XEJA 2POKA 4W9YA 5LYDA 1LCPA 3TC8A 2Q43A 3B3TA 2XEIA 4NFRA 2QYVA 2JBJA 2DEAA 2RB7A 1VGYA 1VHOA 2PJ5A 2AFSA 1AMPA 2IJZA 3CDXA 4R76A 2ZEDA 3MRUA 3SI0A 4A94A 3KZWA 1RTQA 4BD9A 1Q7LA 3H8EA 2EK8A 3D66A 2PJ0A 4YU9A 3FF3A 3L2NA 4ZYQA 4PXDA 3KL9A 1EE3P 1TF9A 4NGTA 3PB9X 4NGRA 5THWA 3B3VA 1ELLP 4JZ0A 1Y7EA 3KQXA 1H8LA 1VHEA 3IFEA 4UEZA 3VARA 4A39A 3K9TA 3BXMA 1YMEA 2GLFA 1LFWA 4O23A 4IHMA 4ZX8A 4NGPA 3KHZA 3IEHA 1XJOA 2V8HA 2JBKA 4ONWA 5CBMA 2PJBA 1BAVA 4MCQA 3BI1A 1IY7A 2WYRA 5K8OA 4DYOA 2ZEEA 3S9NA 5LRJA 1KWMA 3N5FA 1UWYA 4NJQA 4UF4A 3FJUA 4OIDA 4OC3A 1DE4C 2G9DA 3KR4A 4P45A 2ZOFA 4P4DA 3H8FA 2QJ8A 1LAMA 5K8NA 3WT4A 2V77A 4FWUA 1YW6A 5ELYA 4P10A 2IQ6A 2XEFA 3B3CA 2F7VA 1CP6A 3RBUA 4OIWA 1R43A 4KSIA 4X3RA 1ARMA 3NA6A 4GM5A 3B3WA 3K2KA 4MMOA 2FVGA 3QNVA 3SJEA 2OR4A 4OKOA 4ZY0A 4PXCA 3SI1A 2BCOA 4A37A 5LRGA 4NGQA 7CPAA 4Q7AA 3FH4A 3PFEA 4R8FA 1CX8A 4OMEA 5F09A 3SI2A 8CPAA 1BLLE 1XRYA 2ZOGA
chains in the Genus database with same CATH superfamily
3ADAC 3PB7X 4R25A 2DY1A 2OAUA 4HHJA 3HSGA 5A0YB 4F7VA 5HROA 2OD4A 2Q04A 5H9EJ 2JL9A 3D8PA 1PYOB 2XTJP 3EJMA 3FBEA 4NJRA 2AJ6A 4CM2A 1YG0A 2BM1A 3IP0A 3QZ7A 2E5IA 3RO0A 3K5MA 4OP4A 4IFVB 3GIKA 2GJIA 2V5HG 4QR0A 4II9A 1IBKJ 2IVMA 1UA1A 1PAUB 1RU1A 4AFFA 2Q4ZA 1LV5A 2GJFA 1JLCB 3MGDA 4BLGA 4J9OA 2PA8D 1TL5A 4DUTA 2KVIA 3W62A 5D4NA 4X2TA 1SJ3P 1S9EB 4NCBA 4DSFA 4U96A 4FBEA 2UU9J 4B3RF 1C1BA 3F0AA 1R0AB 3LF0A 1RHKB 3ZJ0A 2XS2A 3HFVA 4ILMA 2OEJA 4UUWA 3H4QA 1VQOS 1HBUB 4KYZA 3JQJA 2G1HA 4LFBF 1GNKA 3T41A 1PUAA 2PA3A 2QA2A 2P6FA 3WC7A 2PJ1A 1VYAA 2WBMA 4YOEA 2IM0A 2VQFJ 1NDLA 5ADZA 3GR1A 1TKHA 1WSVA 4K5RA 3DXSX 1QDUB 2H5IB 4LT6A 1WHYA 4KLVA 1UA0A 3CCWA 4M5DA 3DGPB 1Q78A 1ZM4A 1UVJA 5HANA 1JNZB 5KFJA 3PJ9A 5CYJA 2N7YA 4GRSA 4ZCIA 4WBFA 4IDKB 3AD8C 2IM3A 3CJ0A 2PJ4A 1Q86T 2YKMB 4DSIA 1RISA 1D09B 4UCPA 2NLWA 1LWEB 3IN5A 1TKFA 3A8EA 1RAEB 3RB0A 1VQ7S 1N4LA 1WDDA 4F0KA 2R7XA 7FDRA 4B12A 4M3SA 5DG9A 3H4BA 4DUYF 1CULA 2HBRB 3P5TL 3FECA 3MPDA 4WKRA 4ECRA 3LD2A 4CZCA 1NSQA 2ZNYA 2VICA 3M2UA 4FZVA 1WD6A 4B9SA 4C8ZA 2NSCA 4V1Ak 4FXDA 3UNYA 4NLGA 4B5PA 4B11A 2ZEJA 2MXYA 1AUDA 1PCAA 1GX5A 4B3SF 3N01A 3QIPB 4C2MA 2QV6A 4OYXA 2GVDB 2GC8A 2NZ4A 4X4SA 4KR0B 5LYFA 3D3BJ 3KXDA 3TAMA 2EKYA 2D4PA 3JS9A 3PV8A 4K7QA 1OMSA 1BMQB 3QAUA 3JTNA 2WRMA 3RW7A 4WXWA 5L1LA 3D7DA 2HHXA 2PN6A 2Q4YA 3DRSB 2J76E 1IBLJ 4ZHRB 2R7UA 2CQGA 3G8QA 5F41A 4Q5VA 1S1XA 2XWYA 4MHYA 1NCLA 2NZCA 1GMWA 3GFYA 4Z65A 4AE5A 1WF2A 4YUDA 2B5GB 8AT1B 3AD7C 3E01A 3KR5A 3QAEA 2E5JA 4RNMA 5H9FK 3DR6A 2LMIA 3FEYB 5A6PA 3CPAA 1FRJA 4DV2F 5AE1A 2EBEA 1DHMA 4YHHJ 1YZ6A 1BC6A 1HBNB 3EGWB 1JLEA 1T95A 3A3PB 2K3KA 4UY85 1P6TA 4HLBA 1CM0A 1LCPA 4B10A 1FFGB 3M8WA 3E3XA 1HR0F 4NFRA 1VBZA 3M2RB 2F4VJ 2ZBCA 4PUOA 1AMPA 3HVWA 1FKOB 4B14A 5DZ7A 3K5PA 2ZEDA 2C2MB 4CO1A 3M2VA 2VI7A 5ETPA 3P45B 4TN2A 2IRUA 1S6PB 2L48A 1SPBP 1XNQF 3L2NA 4ZYQA 3KJNB 4AQYF 4KH1B 2CQ4A 1ELLP 1N34J 3P6YC 4DS5A 2XMKA 1B7YB 5KG0A 1U1NA 4UEZA 3VARA 2CPXA 4ZPCA 1A0OB 4A39A 4KGKA 3D3CJ 1S59A 1Q4RA 4NL5A 4L8AA 2P9GA 1NK4A 3IEHA 1MG7A 1ZS6A 3EVWA 3M32B 4MCQA 1CJUA 5B08A 4RW9A 1X5OA 3N5FA 1VQ5S 2HHPA 4KOTA 4HR2A 3BDPA 3IA0A 4ED1A 2Y8WA 2Q79A 2HQ3A 2ROGA 2GGPB 1BWVA 3PW7A 2DH7A 1GXLA 1LAMA 4YY3F 5HATA 4ZPVR 3NAHA 2BEFA 4M85A 3HO1A 2EK6A 1JLAA 4F25A 4NXMF 1WJ9A 3MEGB 2P6SA 2V2VA 4FKYA 3BJYA 4U9RA 4UCNA 1N36F 3K2KA 1REVA 1N32J 4MMOA 2Q4VA 3QB8A 4FYXB 2E9TA 2C27A 3MM5A 2UVWA 4DPOA 4JI5F 2DO4A 5L9NA 1OPZA 4UQTA 1SH0A 3KK1B 3DRRB 4Q7AA 4ER8A 1YJWS 5CABA 4DLGA 4LR9A 4CNYA 1FA0A 3LUYA 3HT0A 1RWMB 2F1FA 4OX8A 5AE3A 2REEA 2R8JA 1IUJA 4EEYA 3U02A 1AYEA 2PJ2A 1OSDA 4DX8H 4NXNF 3V5RA 4OI3A 4TKTA 3TUPA 3TTHA 2HFUA 2ZEHA 1S60A 2G4BA 1RT3B 1TIQA 1LWFB 2VKZG 2HVHA 2F63A 3C14A 2JLGA 3ZTPA 5J1QA 2JX2A 2AFUA 1XMQJ 1U6FA 3HI9A 2VFUA 3S9MA 5GADI 3JSBA 4G65A 4UZBA 1MWYA 3FCHA 3EGVA 3KLIB 2F5GA 1NM2A 4NEZA 3MURP 2OP5A 1TFWA 5LL6d 2E7XA 2YX1A 3SSRA 4C97A 1S99A 4ZPAA 3H8GA 3QQCD 1HBOA 4OLLA 3QIDA 2H3EB 5JPHA 2GNKA 1Z4RA 3DOLB 2X1BA 2VJVA 1I94F 2OFHX 1P9YA 2JVOA 1RAHB 1FD8A 1HARA 1FRMA 1V3RA 3SCIE 2ZM6J 2MZTA 1KTVA 3R5GA 1CC8A 3Q8UA 4RW7A 2DR5A 4FNHA 2Q3PA 3QAYA 2PR1A 2D9OA 2V4JA 3ETMA 5FLXU 2DGWA 4DPWA 4H6UA 3DRPA 1WG5A 2IAJB 3BN7A 5HBMA 2QMLA 1O0PA 2GMJA 2BE9B 2NUHA 5CD4H 3PHEA 2DT9A 4NLRA 4QWAA 4QB9A 2AJ2A 4DZDA 1UTAA 4EYIB 1BXNA 2RQKA 3CJQA 2GIQA 4QU6A 1JLBA 3BF4A 2CQPA 4WP8A 3A4TA 4RNHA 1IKXB 4PQUB 2J8RA 1V3SA 2G13A 2QTWA 4O44A 4GS4A 4Y49C 3GIJA 2H65B 2Y1LB 1NK0A 3R7BB 1GHEA 3FEXB 1RA6A 3CNQP 3FMWA 1ARLA 2M3DA 1JLGA 1LAPA 2GQCA 1ZM3A 5KG7A 2IPOB 4RW4A 1TL1A 4OC5A 2WOMA 3G3SA 3FX6A 2DHAA 1R8AA 3HHLC 2EXUA 4QWCA 3A9LA 3I5BA 2J6SA 2BE7D 1X4BA 1YX0A 2FIUA 2KXFA 2VBXA 4K4UA 4CGMA 4ZI6A 1GX6A 4DR7J 4IRKA 1X9MA 3TEHB 9ATCB 1TV6A 1MROA 4Y2MA 3FRZA 1WKLA 4ES1A 3DLHA 3PY8A 3VQSA 4JYAJ 4H4KA 1APSA 3C66A 4P2FA 3KLFA 1IM4A 4EBCA 1KLNA 4UOHA 4DXLA 1S77D 1KP6A 2PMHA 1KBRA 3NH8A 3AHPA 5L46A 2R2UA 3LP0B 3PYEA 4OADA 4AB7A 4ED5A 1VQMS 4X66F 3UD3P 3MEKA 4DJLA 4Q0BB 3JRUA 1YBTA 5KFSA 3PG9A 4L3KA 1KQGB 1URNA 2EFPA 2IM1A 3WABA 3HLPA 4LX9A 1OIAA 5E7OB 4JI4J 1U6MA 5J2PA 1GXUA 1SJ4P 1U1LA 3TFYA 3KLGB 1QQ9A 4RW6A 3J7YI 4V19J 3UNGC 3EVOA 1F5BA 4LUBA 3IBWA 5E41A 4ZVEA 4ES3A 1KUYA 1ZG9A 1S0NA 1KN6A 2VB6A 3PRDA 3TRGA 2POKA 1Y9OA 3FZBA 1VBXA 1D8ZA 2QG9B 2MQPA 2XEIA 3R5AA 3HHLB 1SC4B 2JBJA 3KG0A 4KPYA 2DEAA 1KKHA 2W4DA 4HNYB 2DBBA 1V9OA 1SL2A 2CYYA 2EKNA 1P0HA 5IFMA 1HWUA 5F3ZA 5HK4A 2RDDA 2AV5A 2L9NA 3KZWA 1RTQA 3TVKA 3CDEA 1S1VA 1Q7LA 5IXUA 5ITHA 3R27A 2AEFA 2CA9A 3HVAA 3PB9X 1JLQB 3CMAS 1D8YA 1NO8A 1QLNA 2R7TA 3KLHB 1CJWA 3LGHA 5F47A 5L1JA 1QAXA 1G7CB 1LFWA 3PO5A 4ZN1A 3PR5B 1TL3A 2J8SA 2FJDB 4TXSA 4P2XA 4UZCA 4D3GA 3SYZA 1RLCL 4X64J 5GAHI 1S1TB 3UY5A 2VG7A 1WEXA 2GO9A 1HPZB 3RUBL 2MKHA 4MYUA 4DOZA 2C2EA 2DR8A 2XLJA 1ON0A 5C2GA 4DV7J 4P4DA 4KOUA 4CGPA 2E66A 4CO4A 2FB0A 2LEPA 1IN0A 4QIFA 3D1QA 3HHEA 5HMZA 2XULA 4EMDA 5KG4A 3WDOA 4AXIA 3TO6A 1WHVA 2ZC3A 2BSWA 2GHWA 4ECYA 2WB1D 3FMBA 2B5JA 4X4OA 2COLA 4DV0F 3OSPA 2I2YA 5B0AA 1JXEA 4RU9A 3GYGA 1LWXA 1KQFB 5CAAA 2RAQA 5D78A 2DNZA 1ICEB 3VR1A 3GFZA 1HYSB 3TNVA 3UE2A 2DKOB 4J9MA 4ZY0A 2ROPA 4LF9J 1MU2B 3I5CA 5A0YA 4DL7A 1SIWB 2WHOA 2DGSA 3HZGA 2H48B 5H9EK 2D3UA 4NRUA 4RWWA 2HQCA 4IFVA 5E3PA 2XLKA 2HNZB 2KDOA 1VQKS 2HV2A 5E3AA 3F5BA 3Q22A 4LF5F 1KD1T 3LA0A 1QD1A 1JLCA 4LF7J 1F60B 1M90T 1D9FA 1SI9A 4C0HA 1S9EA 4WFBQ 1B0TA 4RX6A 1I21A 3KJFB 2PDAA 3W6SA 2YPZA 3PW0A 3HK2A 3EYZA 2HHUA 1M4GA 1AZSB 2ILYA 1HBUA 2PC6A 3FDSA 2ROEA 3UO0A 2V2QA 4NYPA 2XO7A 4J9PA 3B35A 3CUNA 1FERA 1KFSA 2DH8A 5JQ4A 1VC5A 4DSJA 1S4EA 4YN3B 3NG8A 4ANDA 2JDCA 3DKDA 3KHLA 3CT9A 3OJSA 2I3CA 2WVDA 4E2AA 1VRTB 5E2QA 3DGPA 4OV6A 3TZWA 1VQSA 2HRUA 3WX4A 2W01A 3DRXA 2ZBQA 4IRCA 5ETRA 2YNIB 2KYXA 3CD5A 4IDKA 2R7VA 3RJMB 5LSOA 5ETSA 2IY5B 1N5QA 3V4IA 2JH3A 3QGHA 3V7ZA 2YKMA 2E5LF 1OBRA 4Z7YA 3KLVA 1LWEA 2JWNA 2FQQB 3D9BA 2G0JA 1YSJA 2OLWA 2WZ1A 4QVTA 2PJ3A 4ELUA 4IOAQ 3H4DA 5HH1A 4K2XA 2CNLB 4MIWA 2MMYA 2J9CA 1T9UA 1BWEA 3E2EA 3M6XA 3NXZA 2CQ1A 3W2VB 5C7PA 4XPEA 2X3DA 5A8WB 2NXNA 4NYZA 3BJ7A 1Y4ZB 4O3QA 1X0FA 2OMOA 3QIPA 4CAEA 2GVDA 2M52A 2AGQA 1XEBA 3GIRA 2VIHA 2M9KA 3S6HA 3J81Y 4MFPA 3DRYA 3VHQA 5KAKA 2MLZA 3HXMA 1G2EA 3H0PA 4R7MA 2CDQA 4NLWA 3MN8A 3KHXA 1U49A 2BABA 2HBYB 4NLUA 5L38A 2HNYB 1WG1A 5M2RA 3DDIA 4CYPA 1EP4B 1F6TA 2MLYA 4ZHRA 2HC9A 4MCSA 2FGOA 1Z9UA 1J5EF 1UZHA 2BDPA 2DH9A 3LODA 1FFWB 2A0FB 1OY9A 4NLQA 2B5GA 2OJ3A 3A12A 5K5MA 2DNKA 4TU9A 4ATNA 2FLLA 3L7PA 1NUEA 2UUAJ 4ZLNA 4XK8C 5LT5A 1TUWA 2VU5A 2NXCA 1JJ2R 2ZVSA 4ZJLA 2KM8C 5K9FA 1HBNA 1WOPA 4HNWB 5KFLA 3SV4A 4ZY2A 3TUJC 3NOCA 4K4WA 4JI6F 3BSNA 2BJEA 4UEEA 2O5DA 3M2RA 3S8SA 2UP1A 2YTCA 1Y0YA 1FKOA 2LKZA 4OJ3A 2HW3A 4K4VA 3HHDA 3WIVA 2D1CA 1VR6A 2MZ1A 1U1RA 1S6PA 2A6OA 3RBDA 3MD3A 3TZXA 3J7AN 2J8AA 3R2DJ 4UQGA 2PJ5A 4RBVA 1FWKA 1HNXF 2FJWA 2KXHA 4DFPA 2OPQB 2VD3A 3H8EA 2DGXA 5IC4B 1SL1A 3CO9A 3CCLS 3FNNA 2Z58B 2DYAA 1ZOTA 3L9ZA 4A2ZA 1HNZJ 4JI8J 1K4JA 3GKRA 2A10A 3QGGA 3CXQA 2G1DA 2LLZA 2GLFA 3WIUA 2HBQB 5LJ3Y 4ELVA 2V9KA 1UKUA 2B7BB 1RT6B 4JV2A 3FRMA 3I4HX 2GGPA 4MJ8A 2DVIA 5FJ4A 1UJ5A 1SKUB 3NE8A 3K59A 2BEIA 2QIFA 3UR3C 4HI1A 1P8GA 1RABB 2ZW6A 2GAGC 3LP2B 5GMEA 2KM8B 4F4ZA 4OC3A 2GCFA 4JI1J 3MEGA 2FL4A 4GO5X 5FIIA 3C6UB 2J0QD 3JTKA 4CT8A 2VV5A 3B82A 3ZZYA 3MEDB 4CNZA 4I2PB 3KK1A 3DRRA 5CA5A 4KBIA 4KOWA 5EWGA 4DV6F 1CLFA 3RG6A 1H72C 1JXVA 1JLFB 4KB7A 5H1SV 3B3WA 2IIHA 3QNVA 4A48A 3CIMA 3V6JA 2RS8A 3DHXA 4KGXB 1RT3A 2FVSA 1LWFA 1JMTA 2J0WA 4OMEA 3EGZA 3BN4A 4KFBB 1OZPA 5B0EA 1RDRA 2Z3NA 1L3SA 3NNHA 1RWKB 4LR8A 3RRHA 2HWHA 4J9RA 2PMWA 4S0MA 3I0SB 4OZ3A 5IWAJ 1X60A 2FHMA 3LO3A 2W7PA 2PI4A 4RUHA 2QEXS 1V6HA 3NGRA 3LAMA 4I0WA 5L39A 3FNCA 4KVOE 1DAXA 5L8RC 3GP9A 1FNXH 3ZXWA 3Q0AA 1LQ9A 2NSMA 3DOLA 3R1LA 5HO4A 1JX4A 1TUGB 3IWEA 1WELA 2YNDA 4F0YA 4USJC 3SJFA 5U47A 3ZFVA 1H2VZ 2CZ9A 1IBKF 4QC6A 2IBOA 5LJ5Y 5BWAB 3PJXA 4JYWA 2IAJA 4TNUA 4DN0A 2J9DA 4O0IA 3PNIA 4PXBA 5HI7A 4F8ZA 1HDUA 3TA2A 1SJFA 2UU9F 1S7KA 3K0JA 2OPSB 4UWIA 3IGRA 3PIPQ 1DARA 1VJWA 1WKJA 3IIBA 2Q6CA 5C82A 1IKXA 5BJRA 3CVKA 4TLQA 2DIUA 3MPVA 1IR2A 3PM9A 3IU2A 2Q66A 2PQ8A 3EGNA 4X4VA 3BQ2A 1JQGA 1LOUA 3AJDA 3CJ5A 2ANPA 1Z8WA 2VQFF 1NJIT 3EM1A 1P27B 2UXBJ 2MKCA 1KC8T 1B70B 2B43A 2ZELA 1OQ3A 3DLGA 3AODA 2R7WA 1QAIA 2M0GB 3RR8A 2DPIA 2XCAA 1TVRB 3QT6A 4ZLJA 4DX7A 4YDXA 2IYIA 4WWSA 2HRTA 3QRPA 3ZZ0A 3CPWR 2B8QA 4DCOB 4QZVB 2H1YA 5HVGA 2E1CA 3DGVA 2DTJA 1TF8A 2DRBA 2VFSA 4DR1J 3TO7A 4A8WA 2LDIA 1Q5VA 1HD1A 4H6ZA 4WKYA 1DTDA 3Q83A 5ETMA 4P4BA 1RHQB 1M4IA 1NEEA 3LP0A 1T9YA 1X8DA 2Y9HA 4FBTA 4Q0BA 1FJGJ 2QFIA 2KT2A 3QWUA 3D7HA 2FY8A 4EBEA 1U0HB 4ZPBA 3GSIA 2ZH5A 2Q6BA 3PEHA 1KS2A 3KLGA 1Z2LA 1SQHA 4FAIA 2IBKA 2VDHA 1H7XA 1NK6A 1IOFA 2B56A 2BQ3A 4DSLA 3TJ9A 4WK1A 4QR1A 3M30B 1Q1KA 2MKIA 5KFVA 3GFHA 2YX7A 3BO3A 5E0OA 2MQLA 1IBLF 4NYOA 3HHLA 2CADA 3ONQA 3R7NB 1VRUB 5D8HB 1FJEB 5B0BA 5HMYA 2M5YA 3B7IA 2EW9A 5G22A 3OUYB 1EQMA 1VDHA 3TX0A 4QBUA 4RUBA 2WONB 4CH7A 1XR6A 1S1WB 3A1YG 2XZWA 1YIJS 5F8LA 3GG0A 2ZPAA 1JLQA 3C16B 4F4XA 5DS7A 2R1IA 4YHHF 3KLHA 5DLGA 3TW0A 5D6GA 1WF0A 3CIZA 1YRXA 2EBGA 3DFEA 3D66A 2EK8A 2PSZA 2M7SA 2N3LA 4YDDB 1ZO0A 2F4VF 4B3TJ 1DQAA 3JAMU 4RR5A 1TELA 1WC6A 1DQ9A 2VUGA 1S1TA 3MR2A 2IVFB 3CD0A 4LFCJ 1HPZA 3BXMA 1YMEA 2VFVA 1S49A 4NX9A 1N0UA 4X5KA 2CXAA 2CVIA 2WYRA 3OVBA 3ENAA 1N34F 2ZEEA 4TNOA 3RRGA 2PRBA 3LQVA 2ZBRA 3JVNA 3HM9A 4WFNQ 4GC7A 1PGZA 4DZ6A 5LSRA 4NEYA 4KOYA 2CPEA 4P45A 5T14A 3M8ZA 3MTJA 3SQOP 2AU0A 4AL6A 5AXMA 3AQPA 3N0VA 4QIWD 3SIPB 4Q2LA 1HYSA 2CQIA 1J27A 1U1QA 2B7CB 2PIIA 4URSA 1TL4A 1HL6A 1UFLA 1MU2A 4XPDB 5HQMA 3ZC4A 4HH1A 2Y3YA 3B54A 4WTOB 3DLBA 2QLFB 2LXIA 3D2PA 2E5HA 2HNZA 4ECXA 4OKOA 1SVDA 5IB0A 1IKVB 2DK2A 2VONA 2MQNA 2KTQA 3SI1A 4OYMA 1N6QB 3KG1A 3FH4A 2FLPA 2K7KA 1RTZA 4DV5J 2YNCC 4LVOP 4LJMA 3SCKE 5HJYA 3AD9C 5IQ6A 2XMUA 1VC6A 1UFKA 2XMWA 2BW7A 2YNEA 3NY0A 1DFDA 4U6PA 4J5OA 3SI8A 3H5XA 4A38A 4JI0J 4USWA 1F2HA 3G87A 1AZSA 1Y3KA 4U95A 2LYVA 3H98A 1QJHA 5F9NA 3JQKA 2PE3A 3OHBA 3IWWA 4AVCA 3CWJA 4P7TA 1NBEB 4MKVA 1S7HA 3NNCA 4X65F 5KFTA 5AG6A 4MHZA 1XMQF 3TUIC 4MCRA 2RQMA 2AYMA 3JTOA 1SQEA 2ZXVA 1Y0HA 2W2QP 5JH9A 4P52A 2YNIA 2VG6B 2H5JB 5HMWA 2JLMA 3QT8A 4USIA 1F0XA 2ZW5A 3KOAA 4DQQA 4O3PA 3K5LA 4CYUA 2Z3OA 2KHDA 4AXJA 3MECB 2L08A 4DR4J 2REFA 2HNDB 1RSCA 2UZAA 1B87A 3AFGA 5C25B 2ZM6F 3VAGA 3Q8QB 3B8GA 4WZQA 2XEGA 3UCGA 6FDRA 2RQCA 3BM7A 4DG1B 4LF4J 3R8YA 1SQGA 2V8GA 3BYPA 5KG3A 3HFZB 2EG1A 1ZG7A 5A8WA 2XS5A 1WF1A 1R57A 2CUYA 1FDBA 1VBKA 3R9FA 1NZAA 3S9LA 2FPHX 3F44A 1OY6A 1U1KA 2WVEA 5K14B 1HEEA 3Q2SC 5GADU 2HQDA 3FMCA 1L3KA 1FXRA 3JXOA 1S10A 1RYRA 4CO3A 4OYBA 1S3ZA 3AJ2A 3F0NA 3VWDA 2QFJA 4LF1A 1NJYA 4A32A 1W26A 5ETQA 1JJ4A 1LFPA 2PFDA 2MDAA 2HNYA 1Y5NB 1CVJA 1XFOA 3D28A 1EP4A 4PSXA 1VHSA 4ZCLA 4KZTA 4OLOA 4P44A 1T9XA 1GFWB 2WBRA 5B0DA 2J9AA 3OL8A 2Z3LA 3U1MA 4HVZA 3AB2B 4FXWA 4EVYA 4DR7F 3QWPA 2DNMA 4QWBA 4L6V3 2ZH7A 2F3JA 2ADCA 3GJQB 2WVCA 1ELMP 1RXOB 1HNVB 3O44A 4MYTA 4EO8A 5KFNA 1S6UA 1TXRA 4TU7A 1AW0A 2XMVA 4AD6A 3PVXA 4FNIA 1KONA 1ZAVA 4IRDA 1U6BA 2ZH3A 2BOPA 5FDLB 3S7RA 1M4LA 3DNCA 2CNSA 1F2PA 1T3OA 4RJVA 1S57A 5E3CA 4OC4A 1MWQA 4LRCA 4HHUA 2PEBA 1Q79A 5AG5A 2DNGA 3PRTA 2HFSA 4DLEA 2RF2B 4PK3A 4JI4F 2ZEPA 3EVMA 4K4SA 3KYLA 3CC2S 2MQ8A 3IG1B 1RTDB 1LW2B 2AT1B 2OPQA 3VWSA 1R6YA 4OHYA 2FVQA 4XO0A 3BV8A 2WCXA 1EKSA 2APOA 4ID8A 3VVTA 1DBDA 2IMWP 2Y1JA 3HLUA 2E5GA 3C46A 1SC1B 3T5KA 3FBBA 1G3OA 1RT6A 3KL9A 2C3YA 4UOCA 2CNKB 3NKYA 3HVTA 3EUNA 3LWMA 5DDOC 3HJVA 1SL0A 4KORA 3OWCA 4DU7A 1V3ZA 4A30A 2CJ9A 5KTAA 3G8SA 3TA1A 3BQ0A 3LP2A 4DX5A 2G9OA 2IRXA 3KHZA 1S7FA 4USMA 4IF5A 2DPJA 1HHQA 3D1HA 3AQOA 2RU3A 3C6UA 1UMJA 2P8IA 3BI1A 3LOUA 3IWNC 2AQ4A 2ZC4A 2K5TA 3MEDA 3WR7A 3J7YU 4V19X 3UD4P 1D0EA 4I2PA 5HQLA 2AWZA 3W8PA 4C8NA 1H38A 4JXRA 4QIGA 1JLFA 4LIWA 4M8LA 3GIMA 1Q8BA 3I56S 2N3OA 3H25A 2K1RB 3DOKB 4X64F 5AXLA 2CJBA 4FN5A 3V6DB 2ZD1B 3HMJG 1YW6A 2AHOB 1RGVA 3GR0A 2RE1A 1MJ9A 2HHHJ 4KFBA 5AXNA 2FVGA 2J9DE 2MY7A 2LA6A 3H8YA 1BLUA 5KFCA 3EZ5A 3THVA 2AIRB 4M5NA 3I0SA 1RE1B 3NGUA 4B9NA 3SI2A 3L3CA 2YPYA 4WXOA 3OR2B 1YQEA 2DPTA 5A27A 4TYAA 2SXLA 1ZZFA 3EZOA 3JTPA 3LWUA 4Y6IA 2OZHA 4LF9F 1BQMB 2FC9A 2ZOMA 4WIQA 1KUVA 5J2NB 5HMXA 4OZ0A 5KFBA 3DN9A 4P72A 1RAJA 2CPZA 2R9LA 1ACMB 4DV1J 3R3TA 3IWGA 1RBOB 5GAHU 4XDDA 3SSSA 5IT0A 1ZPVA 3MCSA 5D4OA 4LBHA 2RD5C 2AYEA 3JB9k 3N6MA 1IJFB 2BRLA 1S5ZA 4J7CA 4LF7F 1Y10A 1X12A 2J8NA 1Q7YT 3IWXA 2FCKA 2FTRA 1ZM2A 3KJQB 3F41A 2OPSA 2OGUA 4L72B 4NGMA 4I2QB 2QVPA 4KSFA 3TOQA 4ECSA 1KSPA 3DDKA 4KUAA 3OXFA 3KQZA 2C6PA 1Z8XA 3CJ3A 3VZHA 4FF3A 3K8WA 5F8IA 3PXGa 3I9V9 1B0VA 2DGTA 3IR7B 3MGJA 2OEKA 2OHDA 3IAM9 3ISND 4DUKA 4QWEA 1FI4A 2B4UA 5AE2A 2KG0A 2E9ZA 3SXOA 5LOQA 1KOHA 5DDQC 2VXKA 4W4MA 4KSEB 4I68A 3G6YA 2YQ3A 2AMCB 4U9YA 4BC7A 4OIXA 1F2OA 1A6LA 4ED2A 5ETVA 1TVRA 3GUXA 5KG1A 3HF5A 2KYZA 1SJ1A 4CAWA 1I12A 1RAAB 1M5OC 3HZEA 3I0RB 3AT1B 3FC9A 2YWHA 2ALYB 4BINA 3H90A 2ERRA 4FF2A 2CG8A 4IUSA 4MHPA 2MLXA 1XF8A 4X84A 4CLUA 2CJYB 2N4DA 3W8GA 2OUGA 4EMEA 3NS6A 3CULA 2IYGA 4C8KA 2DY9A 2DNQA 3T1AA 2PIYA 5JVHQ 3MCOA 4HL9A 4CYOA 3MUVP 1U0HA 5IM0B 2XSJB 3LMSA 1FVSA 1ZTTA 4DCPB 2EI5A 1HNIB 3ILLA 1G1XA 4ZP6A 1GMUA 1Q16B 2ZH6A 3D2MA 3QNWB 3NH5A 4ZS6A 2QMUB 2AFXA 4KY3A 2NPFA 1VQ9S 2HS0A 1MW7A 5AG7A 2EFOA 3M30A 4KT0C 1M5VC 3K7RA 2YWGA 2EG2A 1CBKA 2PSWA 2BA9A 1VRUA 2GLJA 1FDDA 2CJAA 2GREA 3I96A 3OUYA 3ETOA 2XMAA 4N77A 2DHHA 4ZLLA 3HUVA 1JIHA 1X4AA 2WONA 3T3FA 1TR0A 3D6HB 3SXLA 4K59A 1OQ6A 1S1WA 4M5MA 4DFMA 2R2RA 3N79A 1Y0RA 4WF9Q 2ASJA 1CQNA 2MKSA 3OTEA 1I1GA 5KFDA 3C16A 3ZZIA 5KT6A 1S0VA 4W9YA 1CC7A 5FD1A 1WOSA 3SCJE 4ZPWR 4EUVA 2RB7A 3NGKA 2B58A 1VHOA 1DY3A 4TY8B 2HMIB 2HZCA 2ZE2B 1GTHA 1IWAA 3O5TB 1RHJB 4X4QA 1EJ7L 3O2IA 5L1IA 2HYIB 1H0HB 2P5VA 5KTDA 4QJVA 1S9FA 1U26A 5A8RB 2OPPB 5E3RA 1MJAA 4DR3J 2E7WA 1VRQC 4HH0A 3KQXA 3R5BA 3ILIA 4ZP7A 3MR5A 4LQ3A 4FD6A 5J8FA 1YWXA 2AX0A 2HUZA 3I3GA 2PT0A 3H5YA 2BYCA 3TYTA 4CLFA 2JBKA 2VG5B 2KH9A 2GO8A 1XBWA 2N7CA 3FSYA 1U48A 1MN9A 4C2XA 3S9NA 1HNZF 4JI8F 1V5IB 3UCZP 1RA7A 4NJQA 4RNFA 4OYWA 2KL8A 4TYBA 4ZVUB 5T41A 2GIRA 4JI7J 4R0EA 2AF6A 2IVYA 1ZAXA 2J9EA 3JSMB 2QJ8A 2E29A 3C2PA 4A8XA 1IKVA 2KO1A 3LP1B 4O3RA 4BMHA 1N5YB 3HVRA 1N6QA 1PBAA 1RTJB 1RWUA 2C2OB 1TAUA 2MYFA 3MHYA 3RBUA 2V6AA 2RMLA 4TQRA 2P6TA 3VF0B 2EBJA 2VBWA 1IQTA 2MQQA 4PXCA 3FIXA 2FZCB 3BB5A 2V9WA 1BHNA 2IFXA 3BEGB 5LMNJ 4B9MA 2CWKA 1N8RT 1RT4B 1X7VA 4TLRA 3ZZZA 1YW4A 2NYIA 3EE3A 1HWKA 4DQPA 2O66A 2MSSA 1WWZA 2Y0BB 3M6WA 1RP5A 4YB6A 4XDCA 2XYPB 3V81B 1KNZA 1J5OB 4LSNB 5I4MA 2DITA 2O01C 1HNWJ 2CY2A 4YP3A 3C15B 1FJ7A 3W66A 4CTAB 3G4SS 2YKQA 3ISNC 3KKFA 3R6LB 2Z4PA 3HX9A 3R2CJ 1H3DA 4FYWB 2G0IA 1OO0B 2KFYA 2ASYA 2P2CB 5IWAF 2VG6A 4ZVRB 4UIAA 2KG1A 3SJGA 3M7VA 3ZNJ1 4QPXA 1AFIA 2O53A 4ZP8A 2WPXA 2HNDA 4B9UA 2YWFA 1O6XA 2YWEA 5C25A 4KHRA 2OH1A 4M5IA 2YNCA 3ITHB 4LRFA 3B4MA 4TWEA 2ZITA 3IC1A 2W4CA 1HW9A 2VZZA 4DG1A 3DNSA 3D6MB 4ED7A 3CTRA 1BD6A 3RB3A 4CLKA 4YS2A 2CJQA 2ZENA 3PYDA 3AXKA 1HI0P 3QO9B 2D7SA 5H84A 5K14A 4U8VA 3M8RA 3R9GA 1LANA 4IYQA 2GQ2A 3HULA 2R8KA 4F02A 1NKCA 2YH0A 3T5HA 4FF4A 4KIAA 3CDWA 3VAMA 2CNNB 2W7AA 5GAGI 1UWAA 1HQ2A 2YX4A 3GJRB 4PV6A 1IGBA 2DISA 4A8FA 2ZUGA 3RAMA 3F8KA 5D15A 2PJ7A 3U7JA 4W90B 4USTA 2VBYA 2KRRA 3TZYA 2UXBF 3R97A 1UPMB 3ISZA 2Y8YA 3CE8A 3LGMA 4B3RJ 2WSFC 5T7LB 3D0HE 3V6HA 2AFMA 3GJTB 2Y1IA 3KTQA 3OLAA 2OD6A 3KLEB 2B9EA 4ONUA 2Z10A 3KK3B 1YK9A 1Y9WA 1Z2ZA 1CPXA 5DS0A 1RT1B 2F40A 3PB6X 2DO0A 3T9NA 1RAOA 5ETKA 2V8PA 2VFTA 2CVEA 2D3OR 3MM7B 1RACB 4YFJA 2J5AA 2Z2MA 4I7FB 1A2ZA 2HIYA 4JV5F 4JXQA 2F8EX 5FDLA 3SMZA 5DM7Q 4KRWA 3O3LA 1TAQA 4NGNA 4HACB 1FJGF 3HKZD 5HQ8A 4WE1B 1BOBA 1VHFA 1XIXA 3UN3A 4CAXA 3I32A 1SKSA 2NS1B 4OZ5A 2PJ9A 2GJ2A 3QSIA 2ZW7A 4X8IA 1TTHB 2RILA 2RF2A 2FHOB 4L75A 1PU9A 3TA0A 3MCMA 1VQNS 2R98A 3IG1A 1RTDA 1LW2A 1BGXT 3I6PA 2LECA 2UVVA 1Y3JA 2FHJA 2DNRA 3IJ3A 1U24A 1AXQA 3GB0A 1V0CA 4J9KA 1S79A 4UFXA 1P4NA 3LWLA 3GYNA 3VATA 1RADB 1U2CA 1FT7A 4MXUA 1IQZA 2FJAB 2NUUG 4MFZA 3TVYA 1NMTA 2XG8A 4C2ZA 3AXMA 1KQKA 1RKJA 3D0GE 1VK3A 4UCMA 4Y28C 3T9YA 1C0UB 2P9CA 1I3OB 1EIYB 3N6LA 4PXDA 4EU0A 1URRA 1TF9A 4NGTA 3BH6B 3J7Z5 4QOTA 4Y2AA 4ZPDA 4EZ6A 5CXTA 4KGZB 1UEKA 2DCLA 4OFZA 1UW9A 4E2FB 1XNRJ 2BKNA 2AGPA 3NBPB 4IHMA 3TO8A 2UUWA 3JSYA 3I31A 2ARHA 5J8CA 1S5KA 4DFKA 4FF1A 2WW4A 4RBTA 4B3TF 3RW6A 5K20B 5IV0A 3D3SA 2K1RA 3DOKA 3M9NB 1NJXA 1SUQB 1T94A 1FDNA 4LFCF 3P8BB 3V6DA 1WUUA 2ZD1A 4G1QB 1M0SA 1GMWD 5KFKA 4FYVB 1JKHB 1S7NA 2OELA 4DNCA 1HQEB 2D4OA 3M9OB 2AGOA 4JI3J 3P3DA 4FWUA 1N71A 5FLXY 1NDKA 1RTIB 2K8GA 5JXSA 4YMEA 4R8UB 3OR2A 1KHVA 2LEAA 5D3GB 3MM9B 1LEOA 3CCUS 2M88A 4IOCQ 1BQMA 1XNQJ 2AZ3A 1NHUA 3C3LA 4NLPA 5J2NA 5F09A 1TKXB 3V4IB 4OHZA 3OVAA 1XRYA 5E5NA 1N88A 5CCMA 3W60A 3GYXB 4OI6A 3VAIA 3VGTA 1H7WA 3TJAA 2HQFA 1J2VA 3PACA 3OXLA 1VLOA 2AJ0A 2V63A 1GEHA 4OZ1A 4DV5F 2ZZNA 4MAKA 4DL6A 2VA2A 5KFAA 2PJ8A 4OC2A 3WC6A 3ZNUA 4ZJQA 3BSAA 3HFKA 1N5TA 3BI0A 2BBEA 1NLKL 3A8JA 2A4NA 4I2QA 1FXDA 2DXEA 5G1ZA 4JI0F 4MT1A 1B64A 2VH7A 2Q51A 5AJ3J 1QMUA 1RTHB 2V8VA 4K0KJ 2YWWA 4O4GB 4NXMJ 4FD7A 5DDRC 4EYHB 4LR7A 2C28A 2J0XA 2JEGA 5IC6B 2EWHA 3LALA 4HKQA 2ABZA 4CYNA 1T8EA 4USHA 4O0NA 4ZVGA 1MWZA 4ZVOB 1RUSA 3W2WB 4DPXA 1LW0B 1X4DA 3R95A 1R89A 3DLJA 3RYOA 3MM6B 1F9FA 4UOGA 4E8OA 2FZKB 1Q53A 4E8UA 2W8KA 1S7LA 3PDNA 4H54A 4WZMA 2YKAA 3DDNA 3T19A 4CLYA 3I0RA 4R3LA 2XMMA 2Z8QA 1U8WA 2Q7SA 5JJBA 2AFOA 4RW8B 4DR4F 4XPLA 2GV1A 3A3NB 4M6GA 1H2TZ 3WC5A 1JXLA 4CLWA 2Z2LA 4MFKA 2JLEA 1U8SA 3EXCX 1FESA 4Z37A 2Z3PA 4B9VA 1CJTB 3Q8VA 4MY3A 1WDTA 1QSMA 5GAEI 1WHWA 4HDHA 3EFAA 2ZVIA 4LF4F 3M05A 2XC9A 3I87A 5D77A 4CGOA 3EDQB 3KKWA 2RHQB 5KFMA 4NSQA 5D0RA 3GV5B 5IM0A 2XSJA 1YQHA 4F4AA 2BRKA 4QIVA 1HNIA 4PYAA 3V38A 4ED3A 2YY3A 5DQGA 1I94J 2CWXA 2RU9A 1VJQA 2ZWOA 2FZGB 4NLYA 3OT9A 3H42A 1JJCB 2EC0A 3T8WA 1M1KT 1TKJA 1YBUA 3MI7X 3OTOJ 3OR1B 4HEA9 3MEEB 3TQ1A 4PR6A 4LUAA 4W92B 1Q5YA 2N82B 1PC4A 4C3MA 2RDJA 3V8IA 4O3SA 1PYSB 3Q8SB 1XK8A 2LFVA 4KOVA 5D0GA 3Q24A 2ALZA 4Y2KA 3N5BA 4CO0A 3W9IA 1B6BA 5JVGQ 1TZ0A 4AL5A 1NXIA 4KVME 4R3KA 3CJ8A 2DNOA 2KVQE 3D54A 2OB0A 3W65A 3W9JA 2MGZB 1G4CA 2IRYA 2R2SA 3CJKB 4DQIA 1BUXA 1I1DA 4KAIA 4MIBA 2DB1A 2C22A 1XMOJ 2C2KB 5GCNA 2VODA 4EFAC 3I4PA 3F56A 2MQOA 4UW2A 3TT2A 3E8OA 5HL7Q 1AT1B 4TY8A 1RAFB 3EO4A 1HI1A 1NPRA 2HMIA 2ZE2A 1Q8LA 2VC0A 4CAVA 4OC0A 4LF6J 4ZN3A 3QJJA 2ZWPA 2VDIA 1U6ZA 3OV7A 4FYDA 3KJVB 4JBCA 4OHVA 1E6VB 4G6VB 2IA6A 3A3OB 4OYOA 3CD7A 5A8RA 2OPPA 3PKMA 1VI7A 2IJZA 3NS5A 3S01A 3UQSA 3MRUA 4ZBGA 5KFPA 5J2MA 2PC1A 4C8LA 2JVRA 1LWCB 4YU9A 1NE9A 3M6UA 2RUSA 4NZ7A 5THWA 2KRBA 3G96A 2VG5A 4Y2IA 4K4TA 3MWBA 1NHVA 4KHPJ 4BDPA 3NLCA 1FE0A 2EO8A 1I51B 2B9YA 1DJ0A 3HHNB 2W2PP 2V8HA 4ONWA 3JSMA 5DQIA 1RWNB 7FD1A 2RH3A 3LP1A 2WVFA 4JOUA 1N5YA 1RTJA 1H74A 1WI6A 2ZOFA 1F2GA 1BQNB 3BR9A 5I3QA 3B8HA 4DFJA 5KFOA 3MAAB 5RUBA 4GKJF 5AXKA 4DF8A 2HGLA 2GHVC 2ZZTA 1Z8TA 1RT2B 4MKYA 1M5KC 3FBUA 2MZRA 3S1TA 2IQ6A 4QIEA 1MMLA 4LVNP 2OFGX 1RT4A 4DN9A 2KT5A 3QJLA 4N8NA 1IYLA 5DZ6A 1SKRA 1L3TA 2A18A 1IBMJ 3D2WA 2HZAA 2QLXA 3V81A 3PEJA 1J5OA 4LSNA 2W2MP 3T9ZA 3GCXP 1BLLE 3C15A 1MK4A 2B6AB 4R9MA 3TP2A 1YVFA 4DDFA 3CCJS 1YR0A 3Q89A 4CTAA 2HHQA 1FCAA 5DQHA 2BL1A 1UFHA 5F49A 5HAOA 4B08A 1KFDA 1NMEB 3DLGB 4PK2A 1SJRA 2JEWA 2BUNA 3ILOA 3SJXA 1WG4A 4ICLB 1K1QA 3O8WA 4DR6F 3GG1A 2VA3A 1SC3B 3IMQJ 2O1PA 2M8HA 1IBCB 3PHTA 1EAYC 4DV1F 1YGYA 2XYHB 3ITHA 4ZK7M 1PYTB 3TAQA 3BGRB 2HK2A 2E44A 4OMFG 1ZLIA 3CF5Q 5M2PA 3WZ0A 2V4QA 3Q2TC 1WC0A 4DV0J 2C3MA 4USUA 2XMTA 1D1UA 3QO9A 2EWBA 5EX3A 4O4RA 1Q2YA 2MZSA 3MDFA 5F0WA 1VK8A 2OOTA 5KOXA 4CPAA 2W24A 4UIBA 2B9XA 2X51A 2DXDA 1FKPB 3M9MB 2EEYA 5DGBA 4Y49B 4CDIA 1NB7A 1W25A 1MNEA 1X5SA 3BQ1A 3VTIA 4MJKA 2QECA 3AAWB 4P73A 3HHKA 1S1UB 2D69A 4ZVPB 5IT9U 2I5JB 3IR5B 1EKRA 3RNZA 4QU7A 3SV3A 3W91A 5A8KB 1D3WA 5T7LA 2W9AA 1FDAA 1X9WA 3ICLA 3VZIA 5KFQA 4FD5A 3GJSB 2N4CA 4OC1A 4MKAA 3KLEA 3GIUA 2C42A 4MFLA 3KK3A 3A13A 2HEKA 1DTQB 2ASDA 1RT1A 4J9LA 2Z30B 3MM7A 4DEZA 1L5UA 3MAQA 3IXQA 2XB2D 4I7FA 3MR7A 1T7PA 4MY0A 2P0WA 4JI2J 2UVRA 4RNNA 3KK2B 3AB4B 5B0GA 2LU1A 3DXBA 4ZJOA 3WQPA 4HACA 4IUFA 2D74B 2Z2ZA 4WE1A 2JHEA 4BCAA 4DL0C 3H7HB 4Y34A 1FRHA 1M1DA 1HBMB 1W7WA 4LQGA 1YREA 2FJXA 9RUBA 4NMXA 2ASLA 2I1RA 1YJNS 4QYZJ 2AYGA 2KB2A 1PKUA 2IC3B 2YNHB 1TMJA 2R7HA 3DLKB 3SCLE 5CD4A 2DR7A 2UV8G 2X7IA 1H6KX 3D4JA 1NK7A 4MK7A 1QVGR 1FRIA 4LMZA 4NI2B 6CPAA 4LF8J 4N41A 3FUYA 3OPKA 2ZZMA 3MM8B 4R87A 1FO1A 3CCTA 4XIUA 4DF4A 3IWLA 1RCOB 4PWDB 3TANA 3R5JB 5G0RA 2OZUA 3QAHA 2PIZA 2F9JA 3FQKA 1C0UA 3K89A 2BQRA 5LYDA 3TC8A 1WTBA 3CCQS 5D4PA 4KQZA 2J6UA 1PJ7A 1K0VA 2AP6A 1U09A 1QSOA 4DX6A 1WI8A 2B51A 1YI2S 1NU4A 1YK3A 4L73A 3CDXA 1TK5A 5I42B 2DGVA 6FD1A 4KJIA 3NBPA 1FHTA 4FS2A 4B13A 3NS7B 1UJ6A 4CI0B 3TWZA 3BSCA 3SQGB 1Y7EA 3IFEA 4OX6A 1SB6A 3K9TA 2QYCA 2VOPA 4DHVA 3BKTA 1SUQA 4NWBA 3Q23A 2LXFA 4AVAA 3EPGA 4G1QA 3GFXA 3CDUA 3BGLA 2JDJA 1XJOA 2ILZA 1JKHA 1BAVA 1IY7A 4NF1A 3CXSA 3P5BP 4DR3F 1HQEA 4NOHA 4JP8A 1PJ5A 4X4NA 5CYMB 2O28A 2X1AA 1S0MA 2Y0MA 4OZ2A 1NK5A 2W2OP 3BLNA 3Q8PB 5DJBA 3L4BC 4OHXA 1RTIA 2CXEA 4KUBA 3FCVA 1K47A 2M70A 4OZJA 4IQMA 4R8UA 5FVJA 5JMNA 5K8NA 5D3GA 4OI0A 1TKTB 4NCZA 1VKCA 3MM9A 4FP9A 3PIOQ 2QA4G 4MFQA 5EWEA 1WSRA 4KOSA 4JI7F 4MI4A 4XAKA 4KSIA 3W9HA 1TKXA 2XSFA 1FK9B 3ZTQA 2KJWA 3CMQA 2BE2B 1TFYA 4CYUB 4A37A 1WC3A 4PEOA 2ZBIA 2JEJA 4Y2CA 3LH2S 4ID5B 2UVUA 2O67A 2UUCJ 2H4YB 2PMZD 3BBFA 3LW5C 2RKIB 5DG8A 3BBCA 3PZPA 1WC4A 4YEAA 4MFJA 5LMNF 1EHWA 2EK9A 1MSWD 3CC4S 4M95A 1PG5B 3WX8A 1FE4A 3H5SA 4RUAA 3N9UC 3FZ2A 1U47A 4DU8A 3KGQA 1UVKA 1RTHA 2JC0A 2FHKA 4O4GA 3SFUA 1EARA 1HNWF 4NGSA 2Q7BA 3S6KA 4EWTA 2GVZB 4ZIVA 3SHPA 1YHQS 4GO7X 4J9NA 3QRRA 1X9SA 3FFIB 2WUUA 3W2WA 1NSAA 2XHCA 3MUMP 1LW0A 3EDRB 2CPJA 2VPZB 1YRUA 2IDEA 3IR6B 3MM6A 3W7BA 4PPZA 4ZKAA 2HAFA 4ECTA 3G71S 1YKWA 4HHHA 2XEXA 3VGSA 3CCRS 4MHNA 5C5JA 4Y65A 4ED6A 1C0TB 4RW8A 3M8PB 1S9GB 5HSPA 2C1EB 2DRAA 4DR5J 1CJTA 2B4DB 2JSXA 1B99A 5HP1B 4N8OA 2MKJA 1M5SA 1AUSL 4B6ZA 2CNOB 1FWPA 4L76A 2GMHA 3K57A 4USVA 4DQRA 3V2UC 5HXDA 3W6XA 3KASA 4PWWA 3GILA 3PR4A 1T03B 4F6AA 2M8DB 2DGUA 1S72S 4CO2A 1XR5A 3MXHP 3LPYA 1RBLA 3OR1A 2AE6A 3MEEA 1ZLHA 4PYDA 2PJAA 1YJ9S 4FUUA 1QSLA 1ROFA 3SSQA 4A46A 4IKAA 3JAMY 4KE5A 1SCJB 5J1EB 2IHR1 3DOMB 5HVFA 3NEKA 1VHIA 1D9DA 3UVJB 4PQAA 4PXEA 3M8YA 1YRTA 4FYYB 3HVTB 1XTZA 1Y5LB 2MGZA 1KHWA 2UUTA 1Q95G 3G86A 3CJKA 2RRAA 1EETA 1Y9KA 3FSXA 2UXDJ 1UJ4A 3BJ8A 3UN5A 2L41A 4AT1B 3VQTA 2JEVA 1I5OB 3P2FA 4KSAA 3K5NA 5K8PA 3J80U 3M8QB 4Y0FA 2MSTA 3ZTOA 5GAGU 3P2HA 2QL5B 2VQEF 2JRSA 5IZHA 4OZLA 3VCDA 2A2DA 4IAVA 3KJVA 3BGUA 4WIIA 5DDPC 1X0PA 1E6VA 2HVIA 1H98A 4B3MJ 1VC0A 3CJSA 4C8OA 3GV8B 2XI3A 3THTA 2R8VA 1F5AA 2XHWA 2NYHA 2XEJA 1Y00A 1XN9A 1U2FA 3BS9A 1LWCA 1YZ7A 1O8BA 1VGYA 2EPIA 1PAEX 2FUG9 2LVWA 2F4FA 4A94A 2OTLS 4M5LA 2YBVA 1QSTA 4ETZA 2MZJA 4QWDA 1KEKA 2CKWA 4NEXA 4JZ0A 3NMAA 4IH6A 2MEWA 1ZPWX 3UI3A 2GE3A 2FIAA 1LRZA 2ABYA 2G3AA 4ZVSB 3BSOA 3KUHA 4F36A 5E33A 1BQNA 1FFSB 2CJXB 2HRYA 2Q1LA 2CQ2A 3NGDA 3EMTA 1U4BA 1R8PA 2IA0A 4UF4A 3MAAA 2AX1A 2A2CA 4A8MP 3DLLQ 1TK8A 4H89A 1NK9A 3QLHB 3R5DA 4ZVQB 3OFHA 3AJ1A 1XNRF 1RT2A 2AYBA 3BH7B 1PILA 1R0CB 3FKBA 2QLJB 2XMJA 1Q81T 3HHLD 2DNHA 4KO0B 4KV8B 5DETA 1RHMB 6AT1B 4U7UD 1RYSA 2F7VA 2I6WA 2V2ZA 2JNJA 4ZOSA 3A8IA 4DMZA 1SXLA 4GM5A 2DRDA 2B6AA 2XWXA 4BWJA 2H4WB 1T9TA 4JI3F 5JUMA 4L3NA 3JYTB 3CD6S 5DWMA 3MPYA 4J37A 4ILRA 2R2TA 1ZH5A 2HVZA 4LQ9A 5F9LA 1VQLS 5KFZA 1HLWA 4OI4A 4NLDA 3NFZA 5KTCA 3FEEA 4AUKA 4ICLA 4F8RA 3GMGA 1DLOB 1RHUB 1IICA 2C3UA 4U8YA 2ZKTA 1ZTWA 1IB1E 2F65A 3FVLA 2B4OA 1AROP 3OVSA 1S6QB 1LK5A 5BYSA 5KFIA 5DLFA 1DZ5A 4G3IA 1X5TA 3H5UA 1PYTA 2HWIA 2XY5A 3BGRA 3H2LA 1FY7A 3J81j 4I67A 3G9CA 2AJFE 3C6TB 3FSIA 4CRJA 4WJBA 1YVOA 2B3VA 4CGLA 1JNRB 2QX0A 3UDCA 3I82A 4YR0A 2E1MC 1N48A 1FEEA 3GONA 3CCZA 5B0FA 4F3MA 3SDEB 4JLYA 2MPUA 4OX9J 3TEGA 3AOAA 2BOAA 3MMAB 4ETXA 1WTFA 2P6EA 2K2PA 1FKPA 3VWEA 3RRKA 3RYLA 5AJ3F 3D68A 4JV1A 2RNEA 4K0KF 2GS8A 3EY5A 4ZLPA 3W5YA 2RHSB 4AYBD 4J9SA 1N56A 1S1UA 4C11B 2GFFA 4A8YA 1HQUB 2I5JA 2R7QA 3KUGA 1CS4B 2CQDA 1SV5B 4OYZA 4ES2A 1ZM9A 4ED0A 4OZNA 5A8KA 2MY8A 2OIHA 4ZITA 4JJXA 4LIRA 5IV3A 2R7RA 1NH8A 3ILJA 4ED8A 2JLFA 5KFXA 1U2RA 2QLWA 1K0TA 1DTQA 1F3VA 2V2KA 5LXRA 1M1HA 3E51A 2O4HA 3OTDA 4O3OA 2CPHA 1K44A 4CRZB 2WW8A 2U1AA 4IG3A 4DPYA 4X65J 3IBCB 3TAPA 3PB8X 2DJWA 4IG0B 3KMSA 5SUHA 1T05B 4DSEA 3KK2A 3IS9B 5ETTA 1NSPA 2CIJA 4FVCA 5CZXA 4ZGYB 1HBMA 4ZP9A 3BHXA 4ILLA 3ENQA 3HSZA 4P71A 2FDNA 3I9ZA 4B17A 2F8MA 3RB6A 2PI5A 3LPEA 5I3UB 1FVQA 4QYZK 2IC3A 1Z1ZA 1UEVA 2JFKA 2R42A 2RS2A 3IBFB 2YNHA 1W2BR 4A31A 4IH5A 3DLKA 3HCXA 1KLMB 2DPSA 1OY8A 2CTCA 3OTOF 1P9QC 4QPTA 2KKHA 3MZIA 3HKWA 4NI2A 4O3NA 1RB0A 3MR6A 5CQGA 3SFGA 3T1HJ 2VBZA 3MM8A 4N76A 4PPDA 1VISA 2VOOA 3O1LA 4URQU 1RHRB 3MMCB 3KI9A 4K30A 4PWDA 3RTVA 1F1BB 2QA4S 5GAEU 2W9BB 4BWMA 3D67A 3ZZPA 4F2RA 3DSBA 1RWVB 4ECQA 2PO4A 2W2NP 3NP5A 3B3SA 2EK1A 2E7VA 3N28A 3BBBA 2QJ3A 3DC2A 1RXTA 1WC5A 1CBXA 5I42A 2M4MA 3V6KA 4DL4A 3B3TA 1XMOF 1IKWB 3S6GA 3DCAA 4PAAA 2FVPA 3EZUA 1HFEL 4Y3CA 4BBYA 2DF5A 1N32F 1YTYA 5EGYA 3P4UB 3SQGA 4LRAA 1HMVB 1AB8A 3AOCA 3SI0A 4LF6F 2J6TA 2XLIA 2PJ0A 4QQBA 4UWJA 1XR7A 4IR9A 2V68A 3GY9A 5DG7A 5HMNA 2P9EA 2OTJS 4DJBA 2B8PA 4YFUA 4OYPA 1VFJA 3R1KA 4C7HA 1M4DA 2RDIA 4DV3J 5CYMA 2Q0YA 3GTYX 1N33J 3L7UA 3BO2A 3GWCA 4PG7A 4F4KA 3OLBA 3HDSA 1HWLA 1NH7A 2K06A 4OYAA 3S6EA 3OFGA 5G21A 3POTB 1ZETA 1KWMA 1QAYA 4K4ZA 2WTFA 1TKTA 4CH1A 1X4EA 4RL1A 4KHPF 1M1GA 2PDOA 2E1RA 3KNGA 4CIOA 2BJ8A 2X7BA 2G9DA 4WYLA 1NDPA 4K5SA 2PR8A 3MF5A 2LCWA 3OL7A 3CSKA 2FLNA 3H8FA 3NRBA 1FK9A 1IKYB 2KFNA 4ANCA 1HHSA 1U1OA 2BE2A 4F0XA 1K9MT 2FC8A 2IL4A 1FTRA 4RN7A 4MFBB 8ATCB 1HKAA 3M4XA 2WSEC 4DWIA 2HPUA 4CRYB 1NPKA 4ID5A 2XY6A 1IR1A 2B0GA 5A28A 2V69A 2RKIA 2AKWB 7CPAA 3RBEA 2X1FA 1U25A 2WB4A 3C19A 4CT9A 1YJ7A 4F26A 4C9DA 2GHPA 2YKNB 4E0AA 3FEZA 2EFQA 2HHVA 4ENOA 3LANA 4I4BA 1QAJA 3QSYB 3PEIA 1IBMF 2DEJA 2C1CA 4RI1A 3TOAA 4N5SA 3TJ8A 4M6IA 5HN0A 2XM3A 2QIRA 1CJKB 4WWVA 4AXVA 4KC5A 4ECWA 2GVZA 3LACA 2QSWA 5HLFB 2NR0A 2ZH8A 3FFIA 4FPIA 1AA1B 2MQMA 3M6VA 1FWLA 2W8LA 1PC5A 3ET6B 4C3LA 4G1PA 1MMDA 2AFWA 4P4EA 3HT3A 2Z3KA 5B7WA 4BBHA 4Z7CA 3MD1A 2YNGB 3NE7A 1WC1A 2RQ4A 1YJUA 5CZVA 1C0TA 3M8PA 1QVFR 2H54B 1S9GA 3PX4A 5DM6Q 3PW2A 3CB4A 4W98A 2KN4A 4UEFA 3CJ2A 4MH8A 1UVIA 3IGVA 5DO2A 1GH8A 1JJHA 3BPSP 3KHRA 4JYAF 2PCUA 1HA1A 3N7ZA 2B4DA 4PWUA 2YGWA 4AG9A 4BS2A 4N7TA 5HP1A 4WCEQ 3OFFA 4F4WA 4GKKJ 2FE7A 3VH9A 2E9RX 1XMBA 3AH6A 1FNOA 3H59A 1NAQA 1TL7B 4KVXA 3I1UA 3AA8A 5MAOA 2W1BA 2RFHA 3A8KA 4NA1A 3CEDA 2YQ1A 1T03A 1B3TA 3G6VA 2C3OA 3CZXA 4QBJA 1RLDA 4K8RA 5DGAA 1O5JA 5EDWA 2PVWA 4CCHA 5KOWA 3B4DA 2DEIA 1J4JA 3CW2C 3IRWP 4C48A 3D6FB 4AL7A 3OBIA 5J1EA 4UBRA 4KGVB 1VLYA 3DOMA 1XERA 1M44A 1R0AA 3UVJA 3QMQA 5EWFA 1ZZNA 3ULHA 3HP6A 4YWYA 5F8JA 1HW8A 3RB4A 2B4VA 2FVCA 3GE9A 2VKRA 1OYEA 2HGMA 2HB6A 2W25A 5DWNA 2GW8A 2KJVA 2LA4A 5B09A 2FVRA 4JV0A 4QYRA 4YRHA 1RCXB 3M8QA 5LYLA 3UR0A 4JI2F 2B4BA 4EFDA 3D7FA 2VF3A 4CLSA 3HD2A 3TVZA 3QJPA 3I55S 1OYDA 1RQ0A 1T0TV 2UUBJ 5F8NA 2AEMA 1CQMA 3SBMA 1AFJA 4QUSA 4OAEA 2HFVA 1QY7A 4HT7A 5LSLA 1UL3A 3IGNA 2BKOA 2LQBA 3N6NA 3CJ4A 4CWBA 1PJ6A 1UPPA 5B0CA 2OPRB 3NCPA 4AVBA 4DV7F 3FBCA 3PBBA 1KRPA 4MRIA 4B3OB 3PGPA 3DYAB 5M2UA 1AUGA 5D8NA 1XBUA 1CSJA 2KU7A 2GU2A 3FJ2A 3I9SA 4L74A 1CPZA 2BJDA 1VMBA 2Q43A 2UXCJ 2QYVA 4LF8F 4CAFA 2BQUA 4PABA 2C2DA 2OSRA 2WSCC 2ZNZA 5DRKA 2BW2A 4CLTA 2RT3A 3Q8RB 4R76A 2VFRA 5I0CA 2BR0A 2R7SA 4UFWA 4BD9A 5KFWA 2FJVA 4BC9A 2DR9A 2VQYA 5C42B 1S76D 3RR7A 1RZMA 3K58A 1VHEA 3VAJA 4NLTA 4XPCA 2EFVA 1KDNA 3QLHA 2R8HA 3EX7B 2R7OA 4DBQA 4OJGA 3DRSA 2LP4A 4LBIA 5AG4A 4C98A 4RPFA 3GQCA 2HIQA 1C2PA 2J7UA 1CEZA 3IU1A 2OO4A 1U1MA 4KO0A 2WVBA 4KV8A 4OJ1A 2MB0B 2UV8A 1DE4C 3KR4A 2BX6A 4H4MB 5C2CA 3BO4A 2U2FA 2VZYA 1ZA2B 2BXJA 3EC4A 2VPWB 1I6JA 1L0CA 1QUPA 3JYTA 4DUZJ 4C68A 4CYQA 2XEFA 2I8EA 3QGIA 1RWWB 4P74A 1PO6A 1ARMA 3NA6A 2K3IA 4IOBA 5ETOA 1P1LA 1SQFA 3OTBA 2PEHA 5KT4A 1A7GE 4WP9A 4WU3A 1S0OA 1DLOA 1VQ6S 1VIOA 4NA3A 4R8FA 2BANB 3NOGA 1WKKA 2W9CB 1TU0B 3RBXA 4CLLA 5IOLA 2YVSA 3R9LA 3PW5A 2ZOGA 1S6QA 2QC3A 5D29A 1M5HA 4DPTA 1V5VA 3DI6B 3B2YA 3PB4X 5EX0A 4XPKA 4FBUA 1B4SA 4OV1A 2DNYA 1BPNA 4CLZA 1NPPA 3MMBB 3C6TA 1NSKL 4U5YA 4HKFA 2H51B 1A9NB 2ATLA 3H20A 3M32A 4C6AA 1FT8A 2UUCF 4G1IA 2B4PA 5I3PA 1BO4A 2BVZA 3QT7A 3D7GA 2KFZA 1NB2A 1REGX 2XI2A 4I1TA 3SDEA 4M63A 1RK8A 4QCLA 2FD2A 3MMAA 3BPDA 3O6QA 1Q2CA 3TZZA 3GSDA 4GVLA 3PW4A 3NL0A 4HNXB 3FEDA 1IM6A 4X4TA 2HQIA 3CMES 5MLCV 3NNAA 4Z2XA 1IOIA 1EB0A 1FRLA 1F57A 3CPXA 2Z2YB 4P7VA 1C4AA 2B9WA 5IT4A 1Q0NA 4P4IA 3FVYA 4C11A 3ENVA 2A3JA 4X62J 4F67A 2YNFB 1HQUA 1L3UA 3K2YA 4Q2MA 1CS4A 2HHTA 1SV5A 4EI2A 2ATCB 2RRNA 3G6XA 3GZ7A 1GQEA 3WHIA 2ZEMA 2F5IA 1X31C 4UA3A 4CQ1A 2CQCA 2HS4A 4M5HA 1OPIA 1SC6A 4NPOA 3K5OA 4M6HA 1XE4A 4H2KA 1F9HA 4FVMA 1QSYA 4R6TA 5F8MA 3W3SA 3HSJA 3ISXA 3OL9A 1VQPS 2HFNA 1T02A 2PJ6A 1R8BA 2VZ9A 4C7IA 2QSFA 2UUAF 2WK4A 3NGTA 2CPDA 3HPOA 4IG0A 2LQ8A 3BKFA 5G20A 4DR5F 1T05A 3IS9A 2JJ4D 5JGFA 3G2XA 1R8CA 1CP7A 4QW8A 2V0NA 2HFZA 4IH7A 2V67A 3CCSS 3KLIA 3ZTSA 5BR8J 4F50A 1M5PC 2I38A 5KG6A 1N54B 2FGCA 5LMUJ 2M2BA 1H73A 2GMLA 2XNQA 5I3UA 1F9EB 1YITS 1R0BG 5KT5A 2NQPA 1WACA 3NH4A 1FEHA 3PTWA 1YLEA 4NXYA 2XCPA 2DCUB 1KLMA 5C88A 5J2MB 1X4HA 2YWKA 3LAKA 1HI8A 1FX4A 5J1PA 5IX3A 1GK8A 3PJWA 3F73A 1PBUA 5A76A 2JDDA 4P75A 3QRQA 2D41A 4X2BA 4OL8A 3Q8YA 2AFZA 3MMCA 5C24B 3MPUB 1WNEA 3QGPA 1SKWA 3GLJA 1KOOA 1CJVB 2BKPA 3JQMA 1XJWB 2V94A 2W9BA 4CM0A 4WK3A 3UFCX 4F04B 2GX8A 3DLEB 4ITSA 1QTNB 4PQUA 2JEIA 2HURA 4YR3A 1NJWA 5IQQA 4LQ6A 4R0JA 4J9QA 2JOQA 1Y11A 1F3FA 2C6GA 5J2QB 1VQ4S 4MKBA 2UXDF 3T5LA 3KDNA 2ACYA 4JI1F 4ZDNA 1IKWA 4ALZA 2F9DA 2H5MA 5LYIA 2YXLA 1JWWA 4KOXA 3R96A 4OI2A 4KS9A 1SH2A 2Z3MA 2DGQA 1HD0A 1YLOA 1HMVA 5F3TA 1YLXA 3KHHA 4FD4A 4ZMMA 3UDLA 3QFWA 4LRBA 2D3O1 1NRKA 3V4MA 3IRXB 3P49B 2HSEB 5F8GA 4B3MF 1K73T 2Z0GA 2AW0A 4LFAJ 4YR2A 2DGOA 4LBPA 4OQJA 3M1VB 2I00A 2CG4A 1U1PA 4RBUA 3P96A 3J81U 4DL5A 3DMJB 1UVNA 1C1CB 4RZRA 8RUCA 5ETLA 4JV5J 3GCWP 4DI6A 3CXCR 3T6BA 3CJRA 2DNNA 4DPUA 3US5A 3POTA 3R6GB 3ELHA 4PG8A 2WSAA 4DV4J 1OWXA 5CHCB 1KZFA 4NGPA 4IFYB 1UW4A 2MJUA 3QATA 4NZ0A 2Z57B 4DYOA 2CAJA 4M94A 3MFIA 4DL2A 1IKYA 1ELOA 3R7SB 4HI2A 1ZA1B 3CC7S 4UOFA 4DR2J 3DDDA 1U7LA 4MFBA 5ISVA 2FHJD 2ZW4A 3VAKA 3T1YJ 4U7CA 3WT4A 2OI2A 3RGIA 3W61A 1DTTB 2CFXA 4IQXA 5ELYA 4P10A 1WHXA 2HG4A 5EUHA 1IJEB 3UD5A 2HQGA 2VBQA 1VCTA 2YKNA 4C8MA 3FRYA 5KG5A 3H5ZA 4FKXA 3DR8A 1UWBB 4XPDC 4Q44A 1TKZB 3PFEA 2G0CA 1CX8A 4A95A 2NMTA 2W4PA 2MZQA 4F0HA 3ZZTA 8CPAA 2KHCA 4HDGA 5SZTA 2VASA 1CJKA 2X3GA 4WFYA 1T11A 1ZYQA 2XGQA 5BYRA 2EUIA 2CJKA 1Z5RA 4TY9A 5HLFA 2RC4A 1MJBA 2FJEB 2HKEA 3PYFA 1X4GA 2D9PA 4J90A 3AOBA 2BJ3A 2CZ4A 2QE5A 3ET6A 4OX7A 1MMNA 2L9WA 4R57A 3SZ2A 1R6VA 3PCOB 3KHGA 2CF4A 4Q38A 3BKUA 3CDBA 3UDVA 2BUEA 1RBAA 2YNGA 1E6YB 3MR3A 1QE1B 4P6YA 2HVEA 4LFBJ 2FLOA 4ZX9A 2J0SD 3D6TB 2CPFA 2JC1A 1T9VA 2FT0A 1NHKL 4DR1F 4LSLB 4F3OA 2A1BA 2NPIA 2QRRA 2QL9B 2H9ZA 1TMMA 3TQEA 4B5OA 4NA2A 2EFNA 4B9TA 3D4UA 4M5KA 1TL7A 4WTYA 4A4JA 4P6QA 5LXYA 4PSWA 5EN1A 1QSRA 1LOKA 4OX9F 3UDEA 3TE4A 2ZEFA 2QLBB 2BV3A 1FKAF 4I49A 2XS7A 5KFFA 2HQYA 2HAIA 3ZZOA 3TCVA 1VIXA 4TQSA 4Q43A 4J3GA 5KFHA 2VEZA 3OFEA 3MPWA 2IJRA 1DRZA 2BJ1A 2BZ2A 1YGHA 1KVJA 1NDCA 3RBZA 2ADBA 4DUYJ 4C0OC 2LQ9A 2G3TA 4JB8B 2ACMA 3CCES 4C4WA 1C4CA 2LU2A 1IU8A 1QUVA 4I6YA 3E0KA 1H2UX 1YJTA 3PFOA 1BQXA 4ZVTB 4TVAB 2AJ4A 2IJNA 3R9EA 2RVJA 4B3SJ 1ZG8A 3BZQA 4LF2A 1YX2A 2HHWA 5CNPA 2Z56B 3WC2A 4D3HA 5G0RB 2Q44A 4EO6A 2ZEGA 1R27B 1TK0A 2DNLA 4WFXA 2W7OA 2BO9A 4I69A 1HIYA 3J7A1 4P4FA 4Q8FA 2V34A 2QMWA 2CTBA 5CYQB 3K9UA 3FBFA 1RWOB 3DHWC 4NZ6A 1HWIA 3RAXA 5L1KA 4DCJB 2DHSA 2OKQA 1VRTA 1T3NA 3G8TA 5BXIA 2KCWA 4K3NA 2DNPA 5BYQA 3BDEA 3G82B 4E0DA 2RIJA 3DU5A 5J1NA 3KMQA 1B7FA 2EC2A 3C8YA 3PZJA 1ULRA 4HTJA 2HVDA 3L95X 2OPRA 2MKYA 2V50A 4DV2J 3NCQA 4FDFA 4B3OA 3DYAA 2YKPA 4MTPA 2K7JA 1SIZA 2GZOA 4ECUA 2XBPA 2IDLA 4B02A 3W2VA 1Y5IB 3OL6A 4U7UK 3MOZA 1HR0J 2NREA 4M5JA 4IO9Q 3IO1A 2G0BA 3T1HF 4CS0B 5F48A 3DU6A 4DQSA 3G6ES 1RT5B 2Y1RI 4M1KA 2GFQA 3K17A 4IR1A 4ED4A 2GA7A 4I64A 1XQIA 5KG2A 4YB7A 3CXPA 2ZUAA 5C42A 4AQYJ 5KT2A 2WPWA 5GMKa 3Q86A 3C26A 4AG7A 3AA9A 2HLUA 3S6FA 1S7IA 4H4OB 1KTQA 3KDOA 4CH0S 3MAHA 2GIVA 3SXNA 3FF3A 4R5PB 4NLOA 2CIMA 3FYNA 4K50A 1EE3P 4NCGB 2R8GA 3QT5A 3B3VA 2MHEA 4WU2A 2OEMA 2XYGB 1B0PA 4NLSA 1U02A 4F2SA 3PO4A 1ITPA 4K4XA 4ZX8A 2I9SA 2I79A 2KT3A 2LQJA 2KZMA 2PGCA 4H4MA 2ZH4A 1Y7RA 3U27A 2PJBA 1GXTA 1R8HA 2LQ5A 4RKUC 4YY3J 4J91A 2Z11A 4GMKA 5LRJA 1LXNA 1UWYA 4DV3F 2LEBA 5D4LA 4A8QA 1N33F 1P1TA 4K4YA 1RI7A 4YB1P 3WC0A 2ZHBA 1N36J 3H2UB 1GMVA 5KFUA 4P2SA 4GVBB 4PG5A 5D0HA 4JI5J 4CO5A 3GIIA 2BANA 3QFHA 2W9CA 1RT7B 5EMIA 4X3RA 2FY1A 4WFAQ 2VPXB 4NLXA 1SBRA 3VGUA 1YVKA 4NXNJ 2CPIA 2RJZA 3DI6A 2C2ZB 1JK9B 4NGQA 4YGOA 3NWRA 3DM2B 2HBZB 4UUXA 2J8MA 5F46A 3MMBA 1FTCA 5IT9Y 3ENWA 4ORFA 4ZVFA 2DXFA 2ZEOA 4U9ZA 1GYTA 1U45A 2O3DA 3PRBA 1X4FA 3QBCA 3GYAA 3J7ZT 3KG4A 4KKOB 3NAIA 1IWGA 2ZHAA 1Z8LA 5IB9A 3OSNA 3M8SA 1RU2A 5CH7B 3AY0A 3PX6A 4X4PA 3GV7B 5HJXA 4ANEA 5A6WA 5G4DA 5HROB 2XGPA 4UTGA 4F4YA 4Q36A 1NKBA 2B3UA 1HDQA 1FNMA 2ZH9A 4FPRA 4RS2A 3RZAA 4OLPA 4N47A 2ZDPA 1YBAA 2QMXA 2RUGA 3L09A 3BYRA 4GKJJ 4CLPA 4E98A 2YNFA 2G2YA 4C8YA 3OD2A 2FS5A 1W2IA 3NGSA 4RU2A 3CCMS 1C1BB 2FSRA 5KFRA 1UCNA 3L7OA 3TR5A 4NLVA 2NXUA 3W64A 2BMBA 2VL1A 2VC1A 2AJQA 4ERDA 3QYYA 3NMRA 3FK4A 2JZ5A 2FIWA 4BHQA 5LRKA 1EETB 4P4JA 3CO0P 2XQCA 3UN2A 2HLTA 2NSBA 1VOMA 4KGMA 2QT7A 5CPAA 7AT1B 4GKKF 4ZCMA 2NCKL 4M5DB 4KTQA 1KVKA 4NMLA 4B9LA 3FGVA 2BJ9A 3MUTP 1QSSA 1VS3A 4MCPA 2A6MA 4DR6J 1N52B 1SJQA 1TUVA 2MTLA 1UVLA 1S97A 1LNQA 4ZVHA 3PYGA 2YKOA 1R7IA 1Q8IA 2MKKA 5EC4A 1LKZA 2AD9A 1RAGB 2ZBPA 3VAFA 4A33A 2KZZA 1CULB 2F8HA 3T6JA 5AT1B 2PRQA 4X66J 1NKEA 3VGVA 1JWQA 3CCVS 1TP7A 4HYKA 3M2UB 5C24A 2QA1A 1Q8KA 4A47A 3ZZRA 4FXVA 1DQ8A 2EFGA 4B5PB 1CJVA 1NJZA 2AEJA 3W5ZA 4WPAA 2G2OA 3TX8A 3KUEA 3DLEA 3B78A 2J7WA 2EVZA 3R1HA 1F5CA 1G6BA 4WFZA 1N5SA 5J2QA 3TAMB 1T9WA 4YB5A 3I5AA 2IJFA 2C6CA 1EX8A 1XC9A 3VAHA 4ZCKA 3EICA 3LGNA 1R3NA 4YQWA 2QGFB 1GAOA 2LXUA 2ODFA 1HHTP 5F0UA 1Z4UA 1X5PA 1BPMA 2UUBF 1GTEA 1S1XB 4PG6A 4UY8T 3NCRA 1IYKA 2R3VA 3IRXA 2CPYA 2ZJPQ 3EXNA 1RWXB 2HGNA 5ETNA 3M1VA 1OSCA 5H9FJ 3WBZA 3X3UA 1VQYA 3E01B 4P2MA 1X4CA 2L3MA 2CQBA 3DMJA 5GMDA 1C1CA 3GPAA 3D0IE 2HHHF 3EXYA 4M5GA 3FCWA 1XIQA 4P9SA 1Q2DA 1JLEB 4RO0A 4KPCA 4IO1A 3X1LB 3T5JA 2UXCF 1FRXA 2E1AA 2ZKUA 1UZDA 4IFYA 3BREA 4PUOB 1UP1A 1RAIB 2HK3A 3M2VB 3N4WA 3RU0A 5E3QA 4O23A 1HWJA 3D7SB 2C2RA 4C0BA 2YH1A 2ZFHA 1FXLA 4EZ9A 3CJTA 4L89A 4PCQA 2HHSA 3BGOP 1X10A 2R8IA 5GVQA 4OJHA 2WAQD 3PKYA 1L3VA 1IXKA 1Q82T 4OIDA 1MN7A 1DTTA 5AGEA 2RSQA 4RUCA 1KR4A 1QSNA 1S12A 5A2QY 1XEZA 2CZVC 1CJUB 4QW9A 4RW9B 3VALA 3BR8A 4I6WA 1GT8A 4MK9A 2DD8S 1UWBA 2CNTA 2CQ0A 1MLAA 4HT5A 1TKZA 4WYWA 4OIWA 1R43A 4Q8EA 1Y7PA 3ZTRA 3HJFA 4PG4A 3IM9A 4JUZA 1LK7A 4UFVA 2OR4A 1RKIA 4JD6A 4LF5J 3EWGA 1JLAB 1VQ8S 2BM0A 4DUZF 2OH2A 2VPYB 2P6GA 4A8SA 2AZ1A 1REVB 2QN6B 2DHGA 2CDRB 3MM5B 2PE8A 1WWHA 4OI1A 3OW2R 2XO6A 4EBDA 3W1YC 5HVHA 4QR2A 4CP5A 2Y0SD 5K8MA 1E6YA 4F9VA 3FQLA 1ZBTA 4URGA 4HTIA 3OJUA 1QE1A 3SEOA 1R31A 1IIDA 1BY9A 4JWPA 2IMOA 4OYIA 2E1PA 3D5MA 1FX2A 2FXFA 1UAWA 2D3ZA 1TKDA 4MIAA 4ZIWA 4Q45A 4NE9C 3C14B 3GU0A 4LSLA 4DSKA 4IG3B 5IS2A 1QM9A 1QTMA 1XMTA 3MCNA 1IR0A 3TUZC 4I6AA 2AJ1A 2QO3A 5KT3A 2CQ3A 4WP3A 3FB3A 2XZDB 1Z4EA 1EQ0A 1S48A 4XNHC 4NRTA 2FJBB 4UT4A 1D9AA 3QZ8A 2JEFA 2CQHA 2ZH2A 2E5LJ 1KVIA 4C2YA 4IK2A 3JSRA 5KFEA 1VBYA 4F3QA 5L9XA 2IM2A 4ZY1A 1HBOB 1UETA 4MHDA 3THPA 2L9DA 4PZVA 1EZZB 1RO5A 5E96A 3H40A 1WORA 2VJUA 5D0EA 4KHMA 4N56A 5KT7A 3J80Y 4H4KC 3OQ2A 1CPSA 4RW7B 2RRBA 4X62F 2OU2A 2BJ7A 2V4JB 1LXJA 2HFOA 4J9UE 3MFHA 3CGIA 1FF2A 3DRPB 4K2JA 2R4FA 4LRDA 5HBMB 1IVZA 2ZDOA 4ZPTR 2VHGA 3MOJB 5JM6A 4J9VA 2PD1A 2Z0ZA 1JLBB 3W5XA 1RJJA 3K8VA 1N0VC 2G2ZA 5KFGA 4MK8A 3W63A 3PBEA 4C3KA 5CYQA 4ECVA 3ZO7A 3OHAA 1FD2A 2J7KA 4PKDB 4O44B 3JUWA 2QYGA 1XOVA 2PVVA 2PFFB 4HPSA 5F8HA 3R5CA 3KFWX 2GQQA 5EBVA 4KLWA 4FS1A 1OS5A 2JFDA 4OHWA 4NASA 4XNHB 1JLGB 3G82A 5BR8F 2DHXA 4RW4B 1TL1B 4NCAA 2WOMB 5LMUF 3KNAA 1J5EJ 3TO9A 2XY7A 2NYQA 3FXTA 1WEYA 3QPIA 3G8WA 4F9UA 2XNRA 5CCLA 3MECA 1WEZA 1TV6B 1NSLA 1MROB 5KTQA 1NZ8A 1RWPB 1WOOA 1WK4A 1UFWA 1UEUA 1YDLA 1K8AT 2OSQA 2DXQA 3KWMA 3TOBA 4A8KA 2PJCA 3EPIA 1SH3A 3KLFB 3U1LA 4JI6J 4ZA1A 3BGFA 2WZNA 3MTKA 3HD1A 3IAS9 5LM7E 3NWGA 4MBUA 4C7QA 1RT5A 3MMJA 1CG2A 4A8OA 2ZHOA 2I0XA 2H5EA 1PSDA 4DL3A 3OXGA 1ZAWA 2V8DA 1PIEA 4EGLA 3PP9A 3U1NA 2HZVA 1UVMA 2GIFA 5J2PB 3D1OA 1HNXJ 4RW6B 2C2NA 1S6OA 1N5VA 4H4OA 3LTOA 3HSDA 4EK2A 4I56A 4KH0B 4Y00A 4R5PA 2CNMA 1JB0C 2QZ8A 3UCUP 4NCGA 1NK8A 2V4RA 2GAHC 3UWTA 2EVNA 2LDYA 3IM8A 2AFSA 1OJ4A 2XZTB 4PRFA 4GC6A 1O51A 3RAQA 2MJNA 4XTTA 2HS3A 1S4FA 3PX0A 4NGRA 1YJVA 3VV2B 1H8LA 3TARA 1DURA 4LFAF 2YQ0A 1S1VB 1Q7LB 3OTCA 2ZJQQ 1HNVA 2NXJA 1K1SA 3H2VE 1U0SA 5KFYA 4LSZB 2DIVA 5EHHA 2CRLA 5CBMA 1KQSR 2BACA 5K8OA 1TQLA 4GVBA 4ECZA 4F0MA 1FJCA 3FJUA 2ZH1A 2B3TB 4U67Q 2ATRA 1BE4A 4DV4F 2KI2A 4X4RA 2VQEJ 4DV6J 3PRVA 5IV4A 5A2QU 3UW1A 1TL3B 2GANA 2OZGA 1RT7A 4CGNA 4GXHA 3B6BA 2OMLA 4USKA 2VG7B 2C3PA 2ZJRQ 4ELTA 2V77A 4RLEA 2HWTA 3ZZUA 3T90A 5H86A 1NNDA 3B3CA 2KXNB 3DM2A 1KUXA 4DR2F 1CP6A 2FYXA 4DS4A 1XWLA 2QL7B