1R43A

Crystal structure of beta-alanine synthase from saccharomyces kluyveri (selenomethionine substituted protein)
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
438
structure length
438
Chain Sequence
GTLNLPAAAPLSIASGRLNQTILETGSQFGGVARWGQESHEFGMRRLAGTALDGAMRDWFTNECESLGCKVKVDKIGNMFAVYPGKNGGKPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNYVPNYDVCVVVWFNEEGARFARSCTGSSVWSHDLSLEEAYGLMSVGEDKPESVYDSLKNIGYIGDTPASYKENEIDAHFELHIEQGPILEDENKAIGIVTGVQAYNWQKVTVHGVGAHAGTTPWRLRKDALLMSSKMIVAASEIAQRHNGLFTCGIIDAKPYSVNIIPGEVSFTLDFRHPSDDVLATMLKEAAAEFDRLIKINDGGALSYESETLQVSPAVNFHEVCIECVSRSAFAQFKKDQVRQIWSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPEEIENGFKVLLQAIINYDNYRVIRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords beta-alanine synthase
publication title Yeast beta-Alanine Synthase Shares a Structural Scaffold and Origin with Dizinc-dependent Exopeptidases
pubmed doi rcsb
source organism Lachancea kluyveri
total genus 143
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature ec 3.5.1.6: Beta-ureidopropionase.
pdb deposition date 2003-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r43A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1r43A01
4ZY2A 2Q4ZA 1Q7LA 3FECA 4FUUA 1Y7EA 1NSAA 4NFRA 5LYIA 2V8VA 4P6YA 1CPSA 2EK8A 3B3CA 3FF3A 3NH8A 3PB8X 3WC5A 1TKJA 2FVGA 4P4DA 3NA6A 2AFXA 1OBRA 4FWUA 4NGMA 2EWBA 1EE3P 3B2YA 2O53A 3NFZA 4DJLA 2NYQA 1VHOA 1DE4C 3HLPA 3FX6A 3FJUA 1ELMP 5K8OA 1TXRA 3K9TA 4PXBA 1QMUA 4ZX9A 2VL1A 2HC9A 1F2PA 3RZAA 1BPNA 3SJXA 3S9LA 3WABA 3KGQA 3NH4A 4W9YA 2IQ6A 1ELLP 4NJQA 4P4FA 4P44A 1LOKA 1CP7A 1HDUA 4OKOA 3PEIA 3PBEA 8CPAA 2V77A 1CBXA 2PVWA 3PBBA 1PCAA 2PJAA 1ZLHA 3QNVA 3PB6X 2PJCA 3ISXA 3B3WA 4PQAA 4A37A 1Z2LA 5HVFA 1VGYA 1DTDA 3DGVA 3TX8A 5J1QA 4ONWA 1HEEA 3D7FA 1YMEA 4MMOA 4OC2A 3N5FA 3FEDA 4OC4A 1UWYA 1BLLE 3BI1A 5HXDA 2ZELA 4MRIA 1VIXA 2PJ0A 4EMEA 4GM5A 4PXEA 2PJ9A 3D7GA 2WZNA 1CX8A 2ABZA 2ZEEA 1PYTB 1Z5RA 3SJGA 3KASA 1ZG9A 4UIBA 4P4IA 2ZEPA 1AYEA 2HB6A 2AFMA 3IIBA 4ZX8A 5JM6A 4EWTA 3BXMA 2GLFA 3D7HA 3IWWA 2C6CA 2IMOA 4WJBA 2OOTA 4OC5A 4UIAA 3B35A 3B3TA 5D29A 3D66A 1IY7A 1BPMA 2QVPA 2CIJA 2ZENA 2PJ2A 1ZG8A 4NJRA 1TKFA 2JBJA 4MHYA 1R43A 1H8LA 4OC3A 2IJZA 3H8FA 1YLOA 2WYRA 4OC1A 3B3VA 2PJ4A 4F9UA 1LANA 4A94A 5D8NA 2G9DA 2XEIA 4YWYA 6CPAA 3K2KA 5F09A 3SI2A 4P10A 3CDXA 1RTQA 4MHZA 4CPAA 1VHEA 2AFSA 4H2KA 4JZ0A 1FNOA 4DYOA 2OR4A 3SI0A 1AMPA 2RFHA 4OIWA 4MCSA 4TWEA 3MRUA 3IO1A 2ZOFA 2PIZA 2POKA 2J9AA 4X8IA 3KR4A 3ISZA 2ZEHA 2GLJA 2JEWA 4AXVA 5I4MA 4B6ZA 2CTBA 2XEGA 3WC7A 7CPAA 2PJ6A 3FH4A 2ZEMA 3RAMA 1F57A 1Y0RA 3NH5A 3KHZA 1YW6A 4RUHA 5LRJA 4MHPA 5LYLA 5LRGA 4WWVA 3T8WA 3WC6A 3PRTA 2PE3A 4R7MA 4MCPA 2BO9A 1HDQA 4MHNA 4OC0A 4UF4A 3KHXA 4F9VA 3IJ3A 4A38A 4IAVA 1KWMA 2PRQA 3GB0A 4P4EA 1LFWA 4A39A 2AFUA 3BI0A 4ZYQA 2V8GA 1ARMA 4ZY0A 2CTCA 3L2NA 2RB7A 3VATA 4MCRA 2PJ5A 2CF4A 1M4LA 1LAMA 3KZWA 3CT9A 3IFEA 3IEHA 1XRYA 1TF8A 2Q43A 4BD9A 4PXCA 3KR5A 3D67A 3PB7X 3RBUA 1FT7A 2PIYA 3PFOA 3FVLA 4NGSA 4FAIA 2ZEGA 2PJ3A 4P45A 4MCQA 5HVGA 3SJEA 3SI1A 4ZY1A 5LRKA 1XJOA 2BCOA 2F8HA 3PB4X 3IC1A 1ZG7A 1JQGA 1CPXA 4IK2A 1Y0YA 3D7DA 1LCPA 3BHXA 4UEZA 3B3SA 4Q7AA 1QQ9A 1TF9A 3FEEA 2NSMA 3V7ZA 4R8FA 5K8NA 2GU2A 3S9MA 2ZOGA 2PJ7A 3GLJA 2PJ1A 5JH9A 4EFDA 4OMEA 2JBKA 3FMCA 2AFOA 4P4JA 2ZEOA 4NGNA 4TNUA 1R3NA 2QYVA 3KQXA 4FBEA 3KL9A 2BOAA 2AFWA 3H8GA 1CP6A 3D4UA 1XBUA 4NGQA 2O4HA 5THWA 2XEJA 3PB9X 3V38A 2C6GA 3CPXA 1TKHA 4DUKA 2PJBA 2V8HA 4O23A 2ANPA 4X2TA 5IB9A 1LAPA 4NGPA 3B7IA 3KI9A 4G1PA 1CG2A 4IHMA 4KSIA 3WT4A 1XFOA 2QJ8A 1ZLIA 3DLJA 2PCUA 3GUXA 4JYWA 2GREA 3H8EA 3LWUA 4R76A 4UEEA 5CBMA 2XEFA 1Z8LA 4P4BA 4NGRA 2ZEDA 4MXUA 2PVVA 3TC8A 3VARA 1YSJA 5LYFA 3HUVA 5JGFA 4PXDA 4F8ZA 5DS0A 4OP4A 4ZI6A 2I3CA 4K3NA 3I1UA 3JRUA 1GYTA 3S9NA 2EK9A 2C6PA 4NGTA 2ZEFA 4X3RA 5ELYA 5CPAA 3VH9A 5HVHA 4LQGA 5LYDA 1IGBA 2Q51A 3SJFA 3KQZA 1BAVA 4R6TA 1YW4A 4Z65A 5K8MA 2F7VA 2V8DA 2PJ8A 5K8PA 1ARLA 1XMBA 3MN8A 3D68A 4OIDA 4UEFA 4YU9A 1F2OA 4PPZA 3CPAA 3LMSA 2AFZA 3PFEA 2C1CA 2DEAA
chains in the Genus database with same CATH superfamily
4ZY2A 1NSQA 2CADA 3JQMA 4FUUA 5E41A 1HBOB 3IR6B 2C28A 2QN6B 4ANDA 4GXHA 2OPSA 2HZAA 5HI7A 3Q8SB 4BHQA 4ZCLA 4XTTA 1ZPVA 4LT6A 4A95A 2W8KA 2B5GA 1IWAA 1S76D 4CAEA 4X65F 3VCDA 2CVIA 3CWJA 1ZAWA 2K06A 4I69A 2O53A 2WSEC 4CLPA 2W9CA 3DOLB 3Q8UA 2XMUA 2ZH5A 4DV4J 2HSEB 3QBCA 4L74A 3EO4A 4LF4F 3M05A 1C0UA 3UN5A 1LOKA 2Y0BB 1FTRA 2VFUA 5JVGQ 1LW2A 1RSCA 2AE6A 2PVWA 4JV5F 2JLMA 3AA8A 1Y10A 2VQEF 3MMAB 2LFVA 1XR5A 5A8RA 1V9OA 4IDKB 1UWAA 1WWHA 1DTDA 1EJ7L 1WI8A 4E2AA 4TU7A 5E0OA 2AT1B 4OHWA 1UWYA 3SMZA 3RBZA 3NMAA 1QE1B 3SFGA 2UVVA 1DHMA 2G1DA 1CX8A 1T9YA 4DG1B 1SQGA 1C2PA 3VWDA 2DR9A 1Z8WA 4FD5A 3R2DJ 2E5LF 4QJVA 3BXMA 4M5DB 1R8AA 1YK9A 3QT8A 3QT7A 1RHJB 5B0FA 4GC7A 2FJWA 4DV2F 2AZ3A 3C14A 4I56A 2GMHA 4UY8T 1QSTA 1VRUB 2D7SA 1VI7A 1UFWA 1R43A 3OWCA 2G4BA 4F4WA 3DRPA 5D4LA 2L9DA 3GJRB 5DWNA 4KAIA 1NRKA 2CDRB 2N3OA 3KDOA 2VBQA 3MUMP 4LRCA 4OYIA 4CO4A 1REGX 1MLAA 5LOQA 1K9MT 5C42A 2KT3A 1DLOB 4X64J 4LF6F 4H2KA 3FZ2A 4H54A 1H7WA 3SI0A 2MKCA 4E2FB 4CP5A 4OLPA 2W2QP 4DR1F 1J5EF 4Q8EA 2WONB 1KOOA 5HH1A 4KGKA 4M5LA 4OZ2A 4TU8A 2MLZA 4WKRA 3BF4A 1NXIA 2HPUA 1YW6A 2EKYA 4LRDA 4W90B 5J8CA 2YQ0A 2UVUA 5HMZA 1KR4A 4F25A 4UF4A 4FF3A 4IAVA 2FTRA 1RA6A 4ZPBA 1RKJA 4P4EA 1NSPA 3OQ2A 3FSIA 2A18A 4FYYB 2Z4PA 3EVMA 4ZY0A 3TO6A 3VF0B 2UXDF 5DQHA 3TE4A 3D0GE 2BE2B 3CCUS 5AXLA 2EBGA 2MGZB 4DL0C 2PEBA 4PYDA 1XRYA 5D3GA 2Q66A 2Z2MA 3M8SA 1T02A 3HXMA 2JVOA 2D41A 4MK8A 4XPCA 1LOUA 2CDQA 3THTA 4MCQA 3RNZA 5IT4A 1KNZA 3QO9B 1DTQB 3QSIA 2PDOA 1CPXA 1UEVA 5F8GA 4ALZA 4H6UA 4R8UB 1D3WA 2IRXA 4G1QA 2FJBB 6AT1B 1PG5B 4WFNQ 2H1YA 3AB4B 1S1XB 3KMSA 1TR0A 3PG9A 3I31A 4RWWA 1S1VB 4RW4A 1EZZB 2KVIA 3R7BB 3CCSS 4N8NA 4X4OA 2BVZA 3WIVA 2OTLS 2ZFHA 2AFWA 3DLLQ 1AFJA 2MKIA 2PFDA 1KOHA 2FVCA 2CQGA 1KLNA 2QSFA 4TQRA 3PB9X 5RUBA 5AT1B 3BYRA 1HNXF 3MR5A 2V8HA 5IM0B 2CXEA 2HIQA 1V0CA 3CCQS 4P52A 1LAPA 5B0EA 1FKOA 1CG2A 5CNPA 3MM9B 3GV7B 5GAEU 2FJVA 4ED0A 1TUGB 4U9ZA 2VA2A 1RT7A 4O4RA 1H38A 4GO7X 2KN4A 1Z8LA 1M1HA 2QYGA 3DOMB 4H6ZA 2ZEDA 4MXUA 1NHVA 3T1HJ 3V81B 3ETOA 4WFYA 3VARA 1KTVA 2XQCA 3HP6A 3I1UA 4DOZA 2BJEA 2DCUB 3W2VB 4OLLA 1EKRA 2XMWA 2ZEFA 5KAKA 2MYFA 1YBAA 4NLUA 1T05A 2HHSA 3QGIA 4J9KA 2YX7A 2W1BA 3HVTA 3BV8A 3CC7S 3L09A 1DURA 1XIXA 3OTDA 3PKYA 5K8PA 1S1TB 1X31C 5F8HA 4ECZA 4C7HA 2DGQA 4LUAA 5DO2A 3NE7A 5DDPC 2VF3A 3GE9A 4II9A 4XDCA 3TAQA 3EXCX 3QNWB 1AFIA 1YG0A 2EFPA 2LU1A 3LP1A 7FDRA 1NK0A 4NGMA 3ZZPA 1WI6A 2WBRA 4J90A 3BDEA 3D9BA 1G4CA 2R7XA 4DJLA 4JI3F 1VHOA 4JI6F 4ZHRA 4MKVA 5A28A 3QAHA 2P9GA 2X1BA 1Y5LB 3MR3A 3GFYA 3KLIB 5IQQA 1UEUA 3FBFA 3CJTA 5KFZA 2FSRA 3KLEB 3RAXA 4B12A 1R89A 2HBQB 4HNXB 1IQZA 4PG4A 1FJGF 1P6TA 2MJUA 1S72S 1IVZA 3OJUA 1NK7A 4JB8B 1SV5A 3I9V9 1KFDA 4FXVA 2V68A 2PJCA 2FC9A 3CJQA 2IC3A 4PQAA 2XSJB 1Z2LA 3CXSA 3TX8A 2M88A 2M8HA 1MMDA 1L3SA 1JXVA 2KFNA 2DEIA 1JLFA 4BDPA 2GC8A 1NJWA 3R9FA 1DQ9A 4N7TA 2VV5A 5AJ3J 1FXLA 4RW6A 2W25A 2MY7A 3MTJA 2NXJA 3H8YA 3PW7A 2FVSA 4ZX8A 1HQ2A 3GIUA 1PYOB 2W8LA 3OTOF 3IWEA 5A8WA 1GXLA 3M2VA 4CNYA 2JC1A 3CO9A 1A7GE 2ZH1A 2H9ZA 4WTYA 2EBJA 1MJ9A 1VBKA 3H4DA 2LA4A 1BPMA 1TFYA 3W9HA 5ETVA 2YNDA 4USHA 2C42A 2ZENA 4OFZA 2JBJA 5CYQB 1F9HA 3LAMA 3X3UA 5D8HB 4NXMF 2J8SA 2KDOA 4AL6A 2CZVC 4LMZA 5KT2A 5F9NA 3TUJC 1HBMA 1RE1B 2FLNA 1S6QB 1SC1B 1JLEB 1XN9A 3I0SB 1VR6A 4DL5A 2K3IA 5F09A 1RTDB 3LP0A 5EWFA 1VQ5S 2VH7A 3HSZA 4QU6A 4E8OA 3OL6A 2JSXA 3SFUA 3MHYA 4DPUA 3JSMB 2FHJD 1H3DA 2OFGX 3K5NA 2YTCA 2DHAA 2XMKA 5BR8J 1SKSA 3NGKA 4EU0A 3KK1A 2ZEHA 1SC4B 2KTQA 1RTHA 1IM4A 1BGXT 2BOPA 3F8KA 4J9UE 1TKTB 2Q6BA 3HHLA 1Y9OA 2RS8A 4A2ZA 1Z8TA 3J81j 4XIUA 2UXBJ 2ODFA 4C0OC 4ED1A 1BQMA 3MEKA 4U7CA 4DL4A 3T6JA 5LRGA 2IRYA 3BBCA 3T8WA 2HNZA 4C4WA 2Q79A 1WSRA 2BO9A 2W7OA 3UE2A 2QIRA 4NSQA 4KORA 4A38A 2E9ZA 3RB3A 3TP2A 5IOLA 2AFUA 4ZVOB 2RILA 1H6KX 2E1PA 3DOLA 4JWPA 3UY5A 2CTCA 4JI8J 3G82B 3TJAA 3TAMB 5BJRA 4F0HA 5IC4B 2GQQA 1OO0B 4L3NA 2DPIA 2PJ3A 5LMUF 3BREA 2ZHOA 3AFGA 1XJOA 3I6PA 5J1NA 2DNPA 5CABA 4KVXA 4IK2A 3B8HA 4EO6A 4A8YA 4WXOA 4FNHA 4Q7AA 4JUZA 4R8FA 4PUOB 4Q43A 3GLJA 2EEYA 3GIIA 2ZEOA 2FB0A 4GVBA 5HBMA 5AG5A 2QYVA 3G6YA 1QE1A 3KL9A 3PYGA 1RTJA 1CP6A 3FIXA 3PCOB 2EK6A 4NGQA 1TAQA 4LBIA 2GFQA 2B4PA 3MPWA 3UR0A 1Z2ZA 1FRHA 4H4OA 1YTYA 1QVFR 2HHXA 2HVIA 1WACA 2IA6A 1RJJA 4UEEA 4WP8A 3CF5Q 4DLEA 5L46A 1REVB 2C2EA 1VRUA 2ILYA 4BCAA 1RHKB 1RT1B 3N0VA 1TIQA 2B4BA 3LO3A 3BBFA 3DNCA 2I3CA 2H51B 3EPIA 3NS6A 2J8AA 4FVMA 3GYAA 2DNLA 3ZZRA 3CD6S 1IR0A 2DK2A 3S01A 1VS3A 5LYDA 1VCTA 1XOVA 3IBCB 1F2GA 2CNMA 5U47A 2WRMA 3HMJG 3OR2B 3D3CJ 4OIDA 1F60B 4B5OA 2XULA 4OI3A 4PPZA 4IFVB 4ELVA 2C1CA 1I12A 4BMHA 4WYWA 1C4CA 1AB8A 5C88A 2VDIA 4GVLA 5IT9Y 2WONA 4R5PB 1KLMA 2JHEA 3IU2A 1F5BA 2Z0GA 2IAJA 1N33F 2CQ1A 3F5BA 2G3AA 2NSBA 3BZQA 4KH0B 3HKZD 2VG5B 2VPYB 2F1FA 4YUDA 1TELA 2KU7A 4ZLNA 2A1BA 3DNSA 2HEKA 1SQHA 4WZMA 1TKXB 3CDEA 1RB0A 4TY8A 3K5MA 3K9TA 1YITS 1K0VA 1QSYA 4GRSA 2YBVA 1Y00A 3IG1B 3PYFA 1U0HB 4ZPTR 4HH1A 3RR7A 2Y9HA 2VEZA 1YIJS 4FPRA 2FVRA 2MGZA 2I1RA 2C3UA 1PCAA 1NH7A 4R87A 2JH3A 1XMOF 3QNVA 3CCZA 4OZNA 2FPHX 3A3NB 1WC4A 1AXQA 1YVOA 1M1DA 3DRRB 3TEHB 3VR1A 3RR8A 1XEZA 1KHWA 1UPPA 4OHZA 1IKXA 3ENAA 1YGHA 3TX0A 4CRZB 3BI1A 5HXDA 3J7Z5 5LSRA 4MRIA 2R2SA 1N52B 3W8PA 2QZ8A 2YWHA 5HAOA 3JS9A 4DR3F 1J2VA 4RNHA 1Q82T 3HSDA 2PMZD 4C8KA 4ELTA 4PWWA 1GXUA 2BANB 1NJXA 3KJVB 5LL6d 3FSYA 1GX6A 1JLAB 1ZM9A 4ID5B 2PN6A 2IVFB 4DQPA 4HR2A 2OOTA 3QMQA 3ZXWA 4ECUA 4DL2A 2IM1A 2EI5A 4CLWA 2IBKA 5D29A 1PJ7A 2H48B 4H4KC 4ZIWA 3H5XA 2R7HA 2AZ1A 4YR2A 3CDUA 1N48A 4TKTA 2HHPA 5GAHU 1Q79A 2FCKA 4Q8FA 1HWLA 3TJ8A 3CUNA 4Y0FA 2HHTA 2Y0SD 2G9DA 2YPZA 4OI6A 2LQJA 4MK7A 3BR9A 3W2VA 2HRTA 5HROB 3M8QB 1FESA 2HIYA 3JUWA 4C98A 3CD7A 3S6FA 4AG9A 1KC8T 3B82A 2Q3PA 4OHYA 4AB7A 2B6AB 2HGLA 4DL6A 4CI0B 5C7PA 4K2XA 4ZKAA 1K1QA 3K0JA 2FIUA 2ZBCA 1U8WA 3THVA 4AD6A 1HYSA 3LD2A 3D2PA 3ISZA 3OT9A 1U6FA 4MKBA 2CTBA 4QQBA 4K4YA 3DRYA 2VQYA 1LWEB 1UEKA 3DLEB 4C3MA 1ZM3A 1L0CA 4AXJA 3RRGA 2W4PA 3KXDA 2ACMA 3WC6A 1Q7YT 4C7IA 3GCWP 5A2QY 1HARA 3I0RB 4X2BA 2CKWA 2L9WA 3NNCA 2D3OR 4OC0A 4F9VA 2VBWA 3UQSA 2CAJA 4ZVPB 5J2MB 3D5MA 4FD6A 2YWFA 5F8NA 4K2JA 1ARMA 3KLIA 2CF4A 1C1BB 3ICLA 3MEGA 4FPIA 1OZPA 4F50A 2QLXA 3RBUA 1R57A 2N3LA 2GS8A 3DN9A 1UFKA 4YEAA 4YB1P 1I51B 4X66F 4GKKF 5CYJA 4FD4A 2Z0ZA 5ETNA 1RYRA 2FS5A 3PB4X 2YKAA 1BOBA 3IC1A 1ZG7A 4PV6A 3PRDA 4OI4A 2XSJA 4I6AA 1UCNA 1SJ1A 5A2QU 1HHSA 5I42B 5F49A 2NUHA 2PJ7A 2RD5C 1OQ3A 1YREA 4EFDA 4OMEA 5HMXA 2AFOA 3FMCA 1R0AB 1EIYB 2V34A 3MAAA 3TZXA 3QJJA 2UUBJ 2LA6A 2JZ5A 1BC6A 3UI3A 4DUYJ 3GIJA 4AUKA 2MB0B 4X4PA 4ITSA 4BINA 1RACB 1JLBB 2IY5B 2B9XA 2WPWA 3A3OB 2AJ6A 3MEDB 4CO3A 2XMTA 4OHXA 5H9EJ 1H7XA 3AD8C 1CS4B 4KSIA 4B3MF 4X4VA 2GREA 3GFHA 4ZITA 1TL3A 1KVJA 4YN3B 2XB2D 1T8EA 2RQKA 4PWUA 2KYXA 4ER8A 3QRPA 1SC3B 5JGFA 1WF2A 3QGHA 5DS0A 2MQMA 4OADA 3EZOA 2OLWA 2DTJA 3ZZTA 3JRUA 2ZUAA 3S9NA 1S6QA 3AOBA 2ZC4A 1NKBA 2DGOA 3CJRA 4D3GA 2J8RA 2GAGC 3SJFA 2ZVIA 1RTDA 4R6TA 5IB0A 4EBCA 5KFHA 4YU9A 1Q16B 1NJYA 1WC1A 1NU4A 3PFEA 3RU0A 1IOIA 1RT6A 1FTCA 3MM6B 1TK5A 2J0XA 3DLGB 4P6YA 3BPDA 4HKFA 3G8SA 1PYSB 3NH8A 2BJ1A 3WC5A 1FHTA 2J7KA 4YHHF 2DCLA 3H25A 4P4DA 1UW4A 3KWMA 2DVIA 3NA6A 4KPYA 4WE1B 3T5KA 3LACA 3OXLA 3D28A 1FKPA 4JXRA 4KHMA 3TVYA 1UVKA 3J7ZT 1YBTA 1S0MA 4DFJA 4Q38A 2IRUA 5KFJA 2UUBF 3CSKA 2BL1A 2YKMA 1YVKA 4ZX9A 2PDAA 5LMNF 2VL1A 2LU2A 3EDQB 4L76A 1GHEA 1ITPA 2OMOA 4ZPWR 4LQ6A 4ED3A 4NE9C 5HP1B 2G0CA 5EC4A 1OQ6A 2CPZA 3BR8A 4PQUB 3TAMA 4M5JA 5D0GA 4ZPAA 1K4JA 4QC6A 2BKPA 3GSIA 2RNEA 4UTGA 3LAKA 2QFJA 4LF8J 4TLRA 3B3WA 3HVWA 4FBUA 3IGVA 2DGSA 1SB6A 2VASA 1E6VB 3MWBA 4HDGA 4ECWA 2RT3A 3HI9A 2E44A 5A6PA 3N5FA 5L1IA 4IG3B 4ZIVA 4Q44A 3FEDA 2DISA 2IM0A 4X4UA 3H5SA 2XMMA 4KO0B 2Y1IA 4DR2J 4I2QA 3PJXA 3MAHA 2HRUA 2GA7A 1CQMA 2E7WA 3KDNA 1GX5A 3OUYA 2IDEA 2HB6A 2AX0A 4CWBA 2ROPA 4USJC 2V50A 4MFBB 1RLCL 3M6WA 4I67A 1VQ8S 4KYZA 2RSQA 2XNQA 3V4IB 3T1YJ 5GCNA 4NLQA 2QVPA 1TFWA 2QX0A 1RYSA 2R2UA 1BXNA 2GE3A 2V2QA 4RNMA 4JI0J 1ZPWX 4Y2AA 3VWEA 3CE8A 2VHGA 3EJMA 1N5YB 2QLFB 4AVBA 2B5JB 2PJ4A 5DZ7A 4IR9A 5L8RC 2QA4G 4NXNJ 2R1IA 3BO3A 3U27A 2F40A 1TMJA 4EUVA 2N82B 4DZ6A 1T03B 3CIZA 4DZDA 4DV3J 5KG7A 3EPGA 3LH2S 3I4HX 1N88A 3TVZA 3K7RA 1VRTB 4NLYA 3ZNUA 2ZHAA 4KHPJ 4G6VB 3MRUA 2AGQA 5KFYA 4BS2A 4IFVA 5KG4A 1G2EA 4HKQA 2GLJA 1ZTTA 2R42A 3QIPB 2VPXB 1VK3A 4R5PA 1D1UA 3I96A 2F5IA 1FRLA 1K47A 3ISND 3P4UB 4HTJA 4QW9A 2P6FA 2DB1A 4I0WA 5LRJA 4FKXA 5J8FA 3G6ES 2Y0MA 4NEYA 2ZM6F 3C6TB 2DEJA 5DQIA 4A8XA 2VG5A 1HDQA 4DR2F 3K5OA 3FB3A 3TO8A 5KT7A 3AOCA 4K4SA 1EETB 1I6JA 1LFWA 5KFXA 5CQGA 1XIQA 4A39A 1FDAA 3FMWA 1Y5NB 3VAGA 1B99A 3LF0A 2U1AA 3IG1A 2P9CA 3R5CA 2UUAJ 1UFLA 4USWA 1MU2A 2DR6A 1RWVB 2CQBA 2VOPA 1ZAVA 3GSDA 3B4MA 3MUTP 3CDAA 3D7DA 1N4LA 4OHVA 3PW5A 1X4AA 2YVSA 4P2FA 4UEZA 4XDDA 4D3HA 1KQGB 2B8QA 1UL3A 3NGTA 3A8IA 1EKSA 2MSTA 3UR3C 4J9LA 4LREA 3PJWA 5AXKA 4LRAA 3TRGA 3KLGB 2PA3A 2QA2A 3TUIC 1PGZA 1WD6A 2FLOA 4AL7A 5E2QA 4NA1A 1GMUA 3KJVA 3R9GA 4F2SA 2YKNB 2HFVA 2GVZB 4ID5A 4OZ3A 3IRXA 3T90A 1UP1A 4EFAC 3KLVA 3Q83A 5J2QA 3BO4A 2CQ4A 4NCAA 1J27A 1IKWA 2NYHA 4Y2IA 3ENWA 4U67Q 3PHEA 3HUVA 2CWKA 4ZI6A 2RMLA 3S8SA 1ZZNA 2J9DA 2C6PA 2Z8QA 2AX1A 4J37A 5M2UA 1ACMB 2YGWA 1IBMF 4Q2MA 5KG5A 3KHGA 5HROA 5D0EA 2CNLB 1CJKB 3FEZA 3UFCX 4U5YA 3OD2A 2N7YA 1M5PC 2UXCF 5KTDA 2B9YA 3IR5B 2IBOA 1VLYA 2RAQA 2DEAA 4P72A 3M30B 2FDNA 3LPEA 2HNYA 4MT1A 2VODA 1Y7EA 1KDNA 1NJIT 3NKYA 4KLVA 4CH7A 1AT1B 1F3VA 1S4EA 2AD9A 2QL5B 2O28A 1EX8A 3B6BA 3CB4A 2MPUA 2ZXVA 4ZPVR 2GJIA 4P2MA 5K5MA 3D2WA 1IXKA 3O5TB 2MHEA 2B9WA 2C3YA 3D6MB 4C2ZA 2XLIA 3I0RA 1U4BA 5KFLA 1B64A 1HNZF 2OU2A 3ELHA 1NH8A 4FYWB 5J1EA 1SIWB 5G0RA 3RZAA 3SXNA 3SI8A 4CO5A 5GAEI 1CEZA 2FIAA 2BV3A 4QYRA 2VONA 1K44A 1ELLP 1C1BA 3UCUP 4F4ZA 3PEIA 4FXDA 5KOXA 4JI2F 3MPYA 3MCSA 1YDLA 4PRFA 3W5YA 1T9XA 1HQEB 3ISXA 2QFIA 2HHQA 2B51A 1RBLA 5E3RA 1L5UA 2DNNA 2V2KA 2DXDA 1YMEA 4OC4A 1U47A 3U1MA 5I42A 2RKIB 1Q0NA 4KS9A 2W4DA 2RC4A 4DV5J 3MR7A 1SL1A 1VMBA 1T7PA 3SCIE 2IDLA 5M2RA 3IM8A 3G87A 2HS3A 2ZEPA 4IQXA 4KKOB 2OPQB 4JI1F 1ZM2A 2XZDB 1ZYQA 4DPXA 4LVNP 4ED5A 1JLBA 1VJWA 2YXLA 2KHDA 3MEDA 4DN9A 3D66A 2W2OP 3MFIA 4C11B 4KC5A 5KFBA 4UZBA 1I1DA 3NEKA 2E5GA 3CXPA 2UU9J 4QWDA 4XPDC 1U1RA 3IXQA 4A94A 4CLKA 1FXRA 3I5CA 1EP4B 1RT4A 3GG1A 3KLFB 3NY0A 3TWZA 5CA5A 3Q8RB 3ENQA 3S6KA 4CO0A 2V67A 2WVDA 3RW6A 1JWWA 3M2UA 4ZN1A 1RTQA 2KM8C 4PZVA 4DV1J 1FJCA 5D4NA 2PR8A 2AFSA 4N76A 3I5AA 1QTMA 2E5IA 3OSPA 4PKDB 2Q6CA 1Q1KA 2BZ2A 2GGPA 2E5JA 2F4VJ 2IL4A 1OSDA 4PWDA 1Q7LB 5EDWA 4EYIB 2J9AA 4I2PB 3QB8A 2NXNA 3AXMA 2REEA 5A8KA 3R27A 2CJQA 3MM6A 4IRKA 4B6ZA 3JSYA 2ZNZA 1RWKB 3DLGA 4NLPA 2HGNA 3PW0A 1IBKJ 1OJ4A 4USIA 4RUHA 4USKA 2B4UA 1AROP 2V9WA 4G1IA 4WE1A 1RT2B 2VBYA 2VB6A 2WAQD 4DV5F 4DUZF 1P1LA 2R3VA 2Y1RI 1URRA 5C5JA 4NCGA 3DI6B 2C2RA 3NCPA 2V4JB 2AJ0A 3D67A 5FJ4A 5HP1A 3FVLA 3A4TA 3QRQA 1FVSA 1WG5A 3CJ5A 3SJEA 4LFCF 4LQ9A 1XMQJ 2BCOA 3IMQJ 3TQEA 2OTJS 3R6GB 3NNHA 5B7WA 4USVA 2GHVC 2HFOA 3QQCD 1QQ9A 5F8MA 3TZWA 2DNYA 2ZE2A 4Z7CA 4KO0A 1F5CA 2MQQA 2XYHB 2PIIA 3RJMB 2CNNB 1AA1B 3D3BJ 3VAHA 2C3PA 4KSEB 4USUA 4DL7A 1CJTA 2LQBA 4QIWD 3BLNA 4DJBA 1WC5A 3RTVA 4B9LA 5KFKA 4P7VA 4U6PA 1S7HA 2FZGB 3CO0P 3ONQA 3MTKA 4K59A 3V4IA 3U7JA 2C3MA 2QJ8A 4NPOA 3PV8A 3LWUA 4MFLA 2OH1A 1U1KA 1S6PA 4ZVUB 1R8PA 2QLBB 3H98A 1N0VC 1FRMA 3PW2A 3QWPA 4DSKA 3IA0A 4DFPA 4F0YA 4DCJB 4PXDA 2F63A 4DSJA 1N5YA 1U25A 1QUVA 3TO7A 2B5JA 4O3RA 1YX0A 3CCMS 2OP5A 2Z3NA 2I0XA 4RW9B 2VC0A 3ZFVA 2Q4YA 5HVHA 4KOWA 1HNWF 2JEFA 3GKRA 4K30A 5IFMA 5ETTA 1YW4A 5K8MA 3M8YA 4QR2A 1M0SA 2AJQA 1FJ7A 4FP9A 4OX9J 5LXYA 1DARA 2HRYA 2PQ8A 1F6TA 2YWWA 3LP2B 2AFZA 3W1YC 5BYQA 4QWCA 4H89A 3C15B 1YGYA 2D3O1 4IKAA 5LYIA 4ILMA 3E51A 3G8TA 3QIPA 5HQLA 2EK8A 4LF5F 3PB8X 2CPDA 2FVGA 2C2NA 5KT5A 1SJ3P 2VQFF 5EN1A 5ADZA 4FWUA 4B9UA 2B7BB 4LIWA 3C6TA 3T9YA 1FD2A 2LQ9A 3TQ1A 2H54B 2M4MA 3T9ZA 5B08A 1EETA 3PKMA 4M5HA 3S9LA 2KM8B 1B0PA 5KG2A 5C25B 2VG6A 3EGWB 3QJLA 2VUGA 4YB6A 4ECRA 3AB2B 2OO4A 2IQ6A 3OW2R 2EBEA 2BJ3A 4OYAA 8CPAA 4B9NA 2MKHA 2GNKA 2PJAA 1FK9B 1HWUA 2GCFA 5B0GA 2RHSB 1WORA 4YS2A 3FYNA 2QA4S 2I5JB 2CG8A 2IYIA 3CIMA 1PAEX 2OPSB 5HVFA 4MIBA 1M1GA 1WEXA 1HD1A 5J1QA 5ETMA 4NZ0A 2VBZA 3TR5A 3VGTA 2B5GB 1S6OA 3EUNA 2HQDA 3ITHB 2PJ0A 3CMAS 2ZEJA 1B0VA 3EVOA 2E1CA 2B9EA 3KLGA 2CPXA 1HR0J 2BRKA 3SJGA 4LFBJ 3KASA 1ZG9A 4Q0BA 4TVAB 3Q86A 1LQ9A 2F8MA 2GLFA 4KLWA 5F9LA 3H5UA 2WPXA 3OHBA 4O44A 5B0CA 2IMOA 4WJBA 3ADAC 4UUXA 4Y49C 1LW2B 1SC6A 2BJ9A 2YNHA 3JVNA 4A31A 3T1AA 4ZBGA 2WVFA 2G0BA 5A8RB 4CTAA 3RG6A 4R0EA 2AYBA 4QR0A 1FDDA 3D0HE 3KTQA 5C24A 1YLOA 4LRFA 4DBQA 1S5ZA 2B8PA 4DFKA 2EC2A 1RUSA 2IA0A 5DG8A 1UVIA 2KJVA 3G2XA 3OL7A 1JLCA 1LV5A 4FF4A 5KFSA 3DDNA 2WUUA 1VC5A 5AE3A 3MM5B 2HK3A 4DDFA 4FZVA 2QYCA 3SQOP 3NCQA 4LF9J 2D3ZA 4JI4F 1N32J 5JJBA 2DY9A 5F41A 2J9DE 3BM7A 3C14B 3R3TA 2ZBQA 4OI1A 3R5BA 5T14A 2JEVA 3AAWB 5D0HA 4R3KA 4E0AA 2H4WB 1WJ9A 2ZEMA 3NWRA 4X4QA 4DR6F 3QZ8A 4Y2CA 1U45A 1KRPA 3F0AA 2PE3A 4URQU 4M5NA 2DR5A 3PP9A 1RAAB 5D4OA 2DIVA 1NB7A 1XR6A 1MN7A 2DNMA 2EFNA 2AJ1A 1SKRA 1QSMA 2W9BA 3BJ8A 2L3MA 2AWZA 4LFBF 5C42B 3GZ7A 4CAWA 4ES3A 5DM7Q 4OZJA 1TKZA 3IWGA 1AUDA 1NDPA 4ED6A 4M1KA 4DN0A 2FJAB 5DRKA 3KKWA 1NCLA 2W7AA 2AGOA 3MM7A 2Z3MA 1DRZA 4L75A 4MFPA 5GAHI 1Z4UA 4NWBA 1XK8A 2MKYA 4M85A 5LRKA 2WSFC 1N34J 2F8HA 3Q8QB 2V2VA 1FE4A 2AEFA 4AVAA 4BWMA 4XPLA 2H5IB 3TAPA 1U6BA 3BHXA 1R0BG 4UCNA 2ZW5A 1WF1A 1VDHA 4IUSA 3L3CA 3QATA 3FQLA 2OUGA 1LWXA 4ECTA 4UFVA 2GHPA 4P4JA 3J81Y 2RKIA 4C68A 3GV5B 2W9AA 4DX6A 2BMBA 2AP6A 4KGZB 4CQ1A 3D4UA 1QY7A 4J9RA 2O66A 4WFBQ 3ISNC 5BXIA 4ED8A 4CAXA 2DH7A 5D3GB 4KKOA 2VI7A 2OPQA 3CDBA 3VVUA 5IV4A 1N32F 3KI9A 3RBEA 4LRBA 2M5YA 2GIRA 2J0QD 1QVGR 2RDJA 4P4BA 4C11A 4NLSA 4KVME 3K57A 3WBZA 5L1KA 3J81U 1FXDA 1T0TV 2JEIA 4WKYA 1D8YA 4JD6A 1M5KC 2XEXA 3PTWA 1EP4A 4K50A 4RW4B 1X10A 3EGNA 1GK8A 4NGTA 3KLFA 2VG7A 2XSFA 4KUBA 1VQPS 2NR0A 1PAUB 1EQMA 3V5RA 1BAVA 2P0WA 3VVTA 4RUCA 2CA9A 1NE9A 1FD8A 3UDVA 4QPTA 2K8GA 4JV0A 3CCLS 1Q7LA 3V6KA 1FKOB 2OJ3A 4I2PA 2V8VA 3P96A 3OBIA 3C26A 1CPSA 1RT7B 3KJNB 3HHLC 3SDEA 1K73T 5K9FA 4FKYA 2HQCA 2AFXA 5DWMA 2V5HG 2B3VA 1RHUB 3EMTA 1VJQA 3PEJA 1O5JA 4UQGA 4ERDA 1T05B 3H2UB 3U1NA 1RAGB 4CLFA 5EX3A 1VHFA 4F26A 3UD3P 3HVTB 1W26A 3DI6A 1U1OA 2KT5A 1E6YB 1SJQA 3AQPA 2VC1A 4KQZA 1HL6A 2OZUA 3W6XA 2WOMB 5LJ5Y 2JX2A 4K0KJ 2JVRA 1TL7B 3PVXA 2JC0A 3UN3A 3G8WA 1HEEA 2JRSA 4QWEA 4DS5A 1S6UA 5CYMA 2B3UA 1YK3A 3RBDA 4KOUA 2BACA 2JFDA 1RBAA 1JKHA 3O8WA 2EXUA 2R8JA 3L4BC 1Y7PA 2J76E 2OEMA 1IUJA 2BA9A 1F0XA 4DLGA 5D4PA 1AUGA 3HF5A 3SXLA 1Y3KA 2Y3YA 1VBXA 3CJ4A 4PG8A 4RI1A 5AE2A 3UDEA 2FYXA 1UVMA 4EZ9A 3N5BA 1YHQS 3GIKA 3PIOQ 4IG0A 2NPIA 1S3ZA 4LUBA 3B3TA 4O4GA 2HLUA 2AEMA 3EY5A 1KHVA 2BKNA 2GIVA 3CCRS 2IC3B 2JLFA 3G4SS 1YZ7A 3UVJA 2KZMA 3FVYA 5GMEA 1QSLA 1FEHA 7AT1B 4A8KA 3B3VA 1S48A 3HD1A 3RUBL 2BKOA 3BN7A 4X65J 1JLFB 5H9EK 3FK4A 3UO0A 5CD4H 4YB5A 5DGBA 5D0RA 2EVNA 3EX7B 5EWEA 1TVRA 4CM0A 2FJDB 2RS2A 2KXNB 1DAXA 4RW9A 2Z2LA 2R7TA 5ISVA 5B0DA 4OZ5A 2XHCA 1CBKA 1HD0A 5EBVA 1RAEB 3HHDA 2RFHA 5A8WB 3TO9A 3AJ1A 2JDDA 3UW1A 3TZYA 5E5NA 1OY8A 4JV5J 4MAKA 5GAGU 2VQEJ 7CPAA 3CVKA 4DV7F 3FRZA 1MWYA 3B78A 4WFZA 2ZJRQ 2FJXA 3B54A 3DDDA 1KKHA 3FFIB 3NH5A 3H20A 5B0AA 2DRAA 4I6YA 1Z4RA 1FY7A 2ALYB 1BWVA 2DNZA 2VD3A 4ZVTB 2DHSA 3MUVP 2QG9B 5EHHA 1IN0A 2K2PA 2M9KA 1NLKL 3A8EA 3BGFA 4E98A 2XWYA 2XTJP 4KFBA 4RNNA 3OLBA 3OTBA 3THPA 4ZA1A 2KZZA 2N7CA 3L9ZA 1HPZB 1HI1A 4JI5J 3CJ8A 3VWSA 2ZH6A 5LM7E 1O0PA 3KK1B 4DV2J 3SI1A 4LJMA 1RTHB 4U8VA 1FK9A 1Y11A 1XC9A 4JYAF 1P1TA 4KGVB 2I5JA 4OX6A 3HHLB 5ETRA 1LCPA 1NPKA 1UVJA 2H4YB 2E9RX 2AJFE 2GJFA 4NF1A 5IWAJ 1BQMB 3M9NB 3GR1A 1JB0C 2VFSA 1RA7A 3I56S 2ZOGA 4ZPDA 2PJ1A 5JH9A 2HNZB 5KG1A 2VBXA 2JBKA 4TY9A 1S7NA 3K59A 4P6QA 3ITHA 2HUZA 4OYWA 4ZVQB 4IH7A 4FBEA 4MYTA 2ZVSA 1ZA2B 3MMBB 2RRBA 1SL0A 4N77A 4LF6J 4AQYJ 3V38A 4B11A 2KT2A 3BS9A 2ANPA 4DR1J 4HNWB 1J5EJ 4DX8H 1BD6A 6FD1A 1TTHB 1ZLIA 2BYCA 3UNGC 5CHCB 2HYIB 4MKAA 1MJBA 2E7VA 3E01A 1S1WB 3CCWA 4RW7A 1SJFA 3A9LA 2LDIA 3V8IA 3EGVA 1F1BB 1WHWA 3BJYA 5KFPA 2U2FA 3W62A 3D0IE 3R5DA 4KOYA 2HWHA 2X1AA 2ZKTA 3CZXA 1N54B 4GVBB 5HBMB 2XC9A 4RX6A 5KTAA 2IM3A 1RTJB 4RL1A 1WHYA 2VOOA 4ZJLA 2ASYA 2QA1A 4XPKA 1D9FA 3OXFA 2C2OB 2LMIA 2ZZMA 2UXDJ 4EYHB 3GR0A 5KFTA 1RGVA 4B3TJ 4H4OB 3MM5A 2LEAA 3I5BA 2J0WA 4JI7F 4QWBA 1X4EA 4JI5F 4HEA9 4DQQA 1IOFA 4JV1A 4Y28C 4C8OA 3DU6A 5KFAA 4PR6A 4ED4A 3C16B 3GONA 1GH8A 3UN2A 4DV6F 3PYEA 5KT4A 3DGPA 3W60A 3Q89A 3C66A 5IWAF 2EK1A 3VV2B 4PG5A 2EWBA 2BQRA 3WIUA 4TN2A 2W2MP 4Q36A 2LXFA 2HC9A 5D15A 3KKFA 2A0FB 3TW0A 3WZ0A 3ZTQA 2ILZA 2Q7BA 4CNZA 4IOAQ 3U02A 2C2MB 4W9YA 3H0PA 4AQYF 4P71A 2HQ3A 1GTHA 3VAIA 3LGMA 2BW7A 1HNXJ 1FI4A 3HPOA 3P3DA 3LGNA 1K0TA 1KVKA 5FVJA 1KLMB 3W9IA 4IFYA 1QAIA 3W3SA 2IAJB 4HDHA 4FDFA 4FBTA 4WXWA 1PO6A 4DS4A 3OFHA 3HCXA 1EB0A 2XYPB 1FT8A 2MKKA 1QSSA 3KJFB 4B14A 2CQCA 3SSQA 1X5TA 3SV4A 1S7FA 4WK1A 2PJ9A 4F0MA 3DCAA 3AT1B 2EPIA 2ABZA 1RO5A 3LUYA 4TY8B 3CMQA 4P4IA 4O3QA 2NXCA 4XO0A 1P9YA 3MR2A 2YKQA 4GKJF 4KB7A 4RS2A 5SUHA 4N5SA 4CYUB 1WOOA 4B3TF 1RWWB 4B17A 1M5VC 2QMWA 1Q78A 1G6BA 3UDCA 3OJSA 5ETSA 5KFRA 5KFNA 1SH0A 2CPJA 2EKNA 2W01A 1FERA 4MHYA 1H98A 2DKOB 2CXAA 3A3PB 4BLGA 3K17A 1IKXB 4F9UA 2P6SA 1RI7A 3VALA 1IYKA 3K2KA 4JI3J 1G1XA 1T3OA 4JI6J 3H2LA 3T5HA 3CJ2A 4O3SA 2XO7A 4KRWA 2YNFB 2M0GB 1XE4A 1RDRA 5CCLA 1FJGJ 2E1MC 1DTTB 4ES1A 2DF5A 4EVYA 2POKA 2XZTB 1V6HA 5A6WA 4FS1A 1RHMB 2PR1A 4AXVA 3US5A 4WU2A 5F0UA 1YRUA 2ASDA 3MM8A 4QZVB 3HFZB 5L1JA 2UZAA 4B3OA 5I3QA 4XPEA 4MFZA 5HN0A 3ZZOA 3BQ1A 3R1LA 4DQRA 1GEHA 2KG0A 2VKRA 2MZ1A 2PRQA 3SSRA 1CJVA 4NLGA 5F47A 3JAMY 4QPXA 1KD1T 3G9CA 4LBPA 4GO5X 2V69A 2PJ5A 3DDKA 2GZOA 2DPTA 1RWUA 4LSNA 5A76A 4Z7YA 4BD9A 4QWAA 5CZXA 2CNOB 3M7VA 2XG8A 2UP1A 2AYEA 2PIYA 3KUEA 4FAIA 1E6YA 3OTOJ 3QZ7A 2LQ8A 2Z3KA 2Q4VA 1HYSB 1TU0B 2WOMA 1TL7A 1DJ0A 3H5YA 2QIFA 3FBBA 3R5JB 3OLAA 1YBUA 1RTZA 4NXMJ 1XWLA 4HT5A 1WKLA 5K8NA 2EW9A 3MMJA 4F4AA 3PX0A 3PR4A 3GYGA 3HULA 4AFFA 3HVAA 1CVJA 3DR8A 3JAMU 3TA2A 3HJFA 3UD4P 2BJ7A 3L95X 2DXFA 1Q2YA 1VC0A 2ROGA 3V6DA 1VHIA 2D9PA 2XS5A 3MEGB 3QWUA 3MI7X 2LXUA 3DOKA 3UNYA 1NSLA 3F73A 1TUWA 4TQSA 4UOFA 2L41A 2GMLA 4O23A 4RKUC 1JK9B 2KRBA 4K7QA 1YLXA 2JDJA 4CO2A 1T9TA 2ATLA 2DR8A 2Z56B 3H8EA 4LVOP 3T41A 4WFAQ 1HBUA 1FJEB 5DLFA 2VDHA 8AT1B 2PVVA 3V4MA 2OPRA 3LQVA 2OAUA 1EARA 3M32A 3DMJA 1QD1A 2JLEA 2XY6A 3G86A 5ELYA 3K5LA 3MAAB 4C0BA 2ADCA 1N56A 4CGOA 4RR5A 4M6GA 1XMTA 4B02A 4I4BA 1IKYA 2WZ1A 3BH7B 1P4NA 3D68A 4UEFA 3C46A 4KJIA 4YRHA 4DL3A 1IR2A 2C1EB 4G65A 5DG9A 3JSRA 3BB5A 3K89A 5LMUJ 1NDCA 3D3SA 1NPRA 3MPUB 4A33A 1TL3B 1APSA 2XGPA 3CJKA 2OELA 4DEZA 3FFIA 1OBRA 4ZCMA 1NEEA 2AQ4A 1EE3P 2WSCC 1LFPA 4O0IA 3FX6A 2W2NP 3O3LA 4PXBA 2XLKA 5L38A 3SJXA 1HI8A 3DHWC 2BEIA 3FMBA 3O6QA 3NH4A 4C7QA 2ATRA 4WK3A 3NGSA 2VPWB 4NLTA 2DD8S 1HDUA 4OKOA 2HFNA 1F3FA 1HBNB 2FGCA 1ZZFA 2HHWA 3HX9A 2RRNA 1U1QA 1B7YB 3MFHA 2FQQB 1HPZA 1RT6B 2MZRA 2XLJA 2DHXA 4DR7F 4Y6IA 1U6MA 1S9FA 3LOUA 5I0CA 2GIFA 4ZP6A 1BWEA 4C2MA 1N5SA 1NMEB 4F2RA 1WEZA 4YR3A 2HFUA 1XNQF 4RU2A 2H5EA 2CVEA 3FUYA 4K5SA 2R7RA 3W5XA 1FKPB 4V1Ak 4HI2A 4X4TA 1HQUA 2YKMB 1B3TA 4OX8A 3LALA 2ZHBA 3NBPA 3Q8PB 1IBLF 2LEPA 3MMBA 2YY3A 3IWWA 1YX2A 2F9JA 4J9VA 4W98A 3B35A 1IBCB 3QFHA 2EFQA 3G96A 4A8MP 5A27A 4NJRA 2COLA 3CJ0A 1TKFA 3TEGA 3CD5A 1PUAA 2IJZA 4CH0S 1S1WA 1N33J 4I68A 2GIQA 2HS0A 5CH7B 1KQFB 1RWNB 2L9NA 1VQ7S 4PG7A 5A0YB 5C2GA 1N6QB 1JLGA 4L72B 4PSWA 4ZVRB 4I2QB 4C8MA 3G8QA 3FC9A 2BABA 2JJ4D 3CDXA 5F0WA 2XS2A 4AYBD 3RB6A 3OUYB 1VHEA 4PK3A 2MZSA 3UDLA 2KVQE 5GVQA 2YX4A 4CIOA 1R27B 4RBVA 2MZTA 3IRWP 1C4AA 4MCSA 3FBCA 1X12A 1OYDA 3BSOA 2JWNA 4L89A 4USMA 1VK8A 4HHJA 3EWGA 3TI0A 1V5VA 2RRAA 1ZBTA 2R98A 3CMES 1XMOJ 5FDLA 2XEGA 2XZWA 2FHJA 2O67A 2B3TB 3C16A 3OR1A 3JYTA 2FL4A 4DSFA 4MCPA 2ZH3A 4LR8A 4WBFA 1GAOA 1R8BA 4DR3J 2G0JA 3DDIA 1T9UA 2R7UA 2LEBA 2VXKA 1LWFB 4L8AA 1VQYA 4PABA 4C8ZA 1PBUA 2Z30B 4HI1A 2B4DB 3POTA 2C27A 4B3RJ 4M3SA 2XY5A 1OPIA 4ZY1A 5ETKA 1HA1A 1PJ6A 1JQGA 1Y0YA 1CM0A 2DHHA 4J9SA 3E0KA 4B5PA 3B3SA 3A8KA 3TNVA 4CO1A 3RYOA 3IBFB 1ICEB 5I3UA 2EO8A 2QRRA 3S9MA 2Z2ZA 2DGUA 1KS2A 2ZH7A 1N8RT 4O0NA 2DPSA 1X4DA 2FC8A 2R8IA 4B9SA 4OZLA 3IBWA 4AVCA 4Q45A 2PD1A 1R3NA 2PE8A 1OWXA 3HK2A 4EEYA 3KFWX 3GPAA 3HZGA 2CPEA 5D6GA 1TMMA 5F8IA 2PO4A 2XEJA 3I9SA 3HJVA 4N56A 5CXTA 2C6GA 4CYUA 3MMCA 2OKQA 1S59A 4HHUA 2G9OA 3KUGA 4IYQA 1TQLA 1U2FA 1RISA 1MU2B 3K8VA 3FZBA 1HNVA 2GAHC 3KUHA 1XFOA 1RTIB 4I64A 3PJ9A 1R0CB 2BRLA 1SJ4P 1Q8BA 1YJUA 3TC8A 1V3ZA 4PYAA 4IO1A 2WHOA 1D09B 2Z58B 1LKZA 1YKWA 1RAFB 3KK2B 3IAM9 4X62F 4KTQA 4Z37A 1GYTA 1X7VA 3RB0A 3DRXA 2Z57B 2C2KB 3PW4A 2B4VA 5KFDA 2DITA 1LW0B 2A6MA 3BSNA 1RT5A 3Q8YA 4KOVA 2KYZA 1UW9A 4IQMA 5EX0A 1RT3B 1IIDA 4WP3A 1XMBA 4X4SA 5EUHA 2UUCF 2YNFA 3TZZA 1MNEA 1L3UA 1YLEA 1CULA 3LMSA 2ALZA 2V9KA 4CZCA 3IRXB 3FRYA 1DTTA 4RWXA 3PO4A 1YJ9S 1U1LA 4B3RF 3Q2SC 1AW0A 4RPFA 2J6TA 5J2QB 2KXHA 2I6WA 4X66J 1QM9A 5DM6Q 4GKKJ 2HHHJ 3RBXA 1S1UA 3CCJS 1IKWB 4OYZA 4ED2A 3RW7A 4NRTA 4K4UA 2RH3A 1H74A 3H4BA 4B9VA 3B2YA 2GMJA 4XK8C 3SCKE 3WDOA 2OZHA 1U49A 2I38A 4DQIA 3GJQB 4ED7A 2BM0A 1F2PA 2D4PA 5HANA 3KGQA 1U2RA 3B4DA 4NRUA 1X0FA 3FBUA 2RHQB 2OEKA 5F3TA 5K14A 4NJQA 4QUSA 1A0OB 1FX4A 5EWGA 3N01A 4DPWA 2HNYB 2NMTA 3WHIA 4DR4F 2D74B 2AYMA 4A37A 4B3MJ 2HV2A 3V6HA 2V8PA 2Z11A 4OC2A 3E2EA 4LR7A 3N79A 4OJGA 1RCOB 3VHQA 2A4NA 1SPBP 4YFUA 2K1RB 4AG7A 4EMEA 1IQTA 1VQMS 4A48A 3NMRA 3O44A 3R9LA 1JIHA 2MQOA 3QGPA 4B10A 2IHR1 1M4DA 1RWOB 5J1EB 1X4HA 5G0RB 2DHGA 4DV0F 2LYVA 1Q8IA 1QUPA 4DU7A 4RN7A 3Q8VA 1K8AT 5G20A 5JM6A 4O3NA 3L7PA 2XHWA 4O3OA 3J7YU 3CXQA 1C1CA 5KFQA 1WSVA 2E5HA 2EWHA 3AJDA 3IU1A 5IT0A 5KT6A 1V3RA 2RIJA 2CRLA 2W7PA 1FRIA 3NGRA 2FY8A 3I55S 3UCGA 5E3CA 2PJ2A 1K1SA 2HHHF 3VQSA 2FXFA 2H5MA 4QIVA 3BBBA 4MJ8A 2WYRA 2W24A 1S79A 2OGUA 4YHHJ 1RP5A 5DZ6A 1LANA 3DM2B 2E1AA 3KOAA 1T9VA 2VU5A 1WG4A 4F3MA 1QSOA 3JQJA 2FE7A 4NZ6A 4P10A 2W4CA 1TV6B 5LMNJ 4JZ0A 4F3QA 2G3TA 4FF2A 4RZRA 2OR4A 1NMTA 2XM3A 3DC2A 4CM2A 5JQ4A 1L3TA 3GIRA 1Z8XA 4X84A 1VOMA 3MECA 2QEXS 3W61A 3H90A 1HNIA 2XS7A 3BGLA 1QDUB 2WB4A 3G3SA 1U02A 2BR0A 1M4GA 1GNKA 1HHTP 4WWVA 3PRTA 1D9DA 4KZTA 2ROEA 2V94A 3EGZA 1RT4B 4MHNA 2I8EA 1Q5YA 3KHXA 3PYDA 5J2PA 1CSJA 3BI0A 1Q4RA 3M2UB 3LGHA 4DCOB 3KHLA 4MCRA 2DXEA 3V2UC 1M4LA 1LAMA 2BBEA 3DFEA 3E3XA 2GGPB 4M6HA 1VQLS 4PWDB 4ECYA 1U6ZA 1WTFA 4MH8A 4F8RA 2KO1A 1HBNA 2XBPA 3NWGA 4R0JA 4ECVA 4DPYA 2HZVA 2ZH9A 2DY1A 4CLTA 5A8KB 2OZGA 1XQIA 1SH3A 2RU3A 4J9NA 1ZETA 3OTCA 2HHVA 3MEEB 4CLLA 4CLYA 5GADU 2CQ2A 4Y3CA 4YFJA 2BQ3A 2LXIA 2Z3LA 1OPZA 2FD2A 1VHSA 4ETZA 3ZO7A 4DV4F 2KB2A 4NCGB 4J91A 1XBUA 5G22A 3R2CJ 2VZYA 1RAOA 1VQSA 5D78A 3CXCR 5GAGI 4MY0A 1QJHA 4DQSA 4MK9A 4K4VA 1QSRA 1TKHA 4DUKA 3T19A 2GJ2A 2ZW6A 1SIZA 4G1PA 4B08A 2PRBA 5HJXA 3BGRA 5FLXY 3GUXA 3HHKA 1I94J 4NGRA 1MW7A 4M8LA 4MIAA 1B87A 4B9TA 3PX4A 3EICA 5D77A 1TZ0A 5ETQA 5HJYA 1WKJA 4HTIA 4P73A 1TAUA 4F7VA 3AXKA 4NL5A 2ZE2B 1WHVA 1X4CA 2ZOMA 1PC5A 2ZM6J 4LQ3A 2V4QA 5A0YA 5ETOA 1N6QA 4URGA 5JUMA 4OYMA 2IPOB 5KFMA 1SH2A 2HAIA 5E3PA 2DXQA 2V8DA 1CJTB 1IB1E 3NL0A 1JLQA 1FKAF 3R1HA 2OI2A 3D4JA 4DPOA 2ZBIA 4IF5A 5FLXU 1C0TA 4I7FB 4DU8A 4RW8B 4MBUA 1TL1A 1JMTA 2ERRA 4ECSA 3DU5A 1GMWA 3C6UA 2I9SA 2HMIA 3JTOA 1S6PB 1X9WA 1RBOB 1UWBB 2YWKA 2DGVA 5KG3A 3FCVA 1LXNA 1CJUA 1DE4C 2HG4A 1RHRB 2ZH2A 3MCOA 1RABB 1H72C 2Q04A 1OS5A 1O6XA 3JTKA 4X64F 1YJWS 4USTA 1BO4A 2R2RA 4X4NA 4M94A 3VGSA 3ZZUA 4UQTA 3GQCA 1N36J 3NAHA 1LWFA 2NPFA 1MSWD 4JV2A 1ZA1B 4ZMMA 5IZHA 2WVCA 2NREA 1H0HB 3SSSA 1MWZA 2B4DA 3PB6X 5IQ6A 4PPDA 2IVYA 1UETA 5EMIA 1HW8A 2KG1A 4EMDA 2N4CA 5AG6A 2XGQA 1I94F 4WTOB 4N41A 1VGYA 1T3NA 2KJWA 2V2ZA 2YNIA 4KE5A 4MMOA 1FWKA 3N9UC 2CPHA 2HVZA 4WIQA 3FBEA 3L7UA 1T9WA 4UT4A 3GP9A 1HIYA 1W7WA 1LNQA 2X3GA 2ASJA 3MZIA 3DXBA 5DG7A 2ZEEA 2ZW4A 1WC6A 2WVBA 4UIBA 3FXTA 2BDPA 2DR7A 2AFMA 2VG6B 1IBMJ 3C2PA 2V63A 3D7HA 2L08A 4CLZA 1WKKA 4CYQA 4AT1B 2FHOB 3D6HB 3ULHA 3MURP 2UXCJ 5F48A 4EGLA 1FF2A 3TA1A 2HBZB 4ZK7M 2IIHA 2CIJA 3QAUA 1RTIA 4A8QA 4C3KA 4OC3A 2V6AA 4AL5A 3PZJA 2HZCA 1BUXA 2VFRA 3FGVA 4WWSA 5ITHA 1A6LA 1U24A 1L3KA 3S6HA 2MQPA 2AGPA 3HZEA 1BMQB 4I49A 6CPAA 3KK2A 3BO2A 3EFAA 4RO0A 1CC7A 1VQ6S 3SI2A 1LW0A 1M90T 4HT7A 1HNZJ 2BSWA 4Q0BB 4LSLA 3LPYA 3QT5A 3HHEA 3HHLD 3E8OA 1N36F 3BGUA 3TVKA 1IKVA 1RT3A 4NEXA 1JJCB 4O44B 4YB7A 4OIWA 4CT8A 2J9CA 2PIZA 3KK3A 2YNHB 4PCQA 3VAJA 4ICLB 4JI2J 4UZCA 1XBWA 3OL9A 1VQKS 1S0VA 3WC7A 4CTAB 3T1HF 4ZLLA 2JLGA 3RAMA 2PA8D 1Y0RA 5C24B 3EM1A 2XCAA 4OV1A 1MROA 2F65A 1JXEA 4CGNA 2G2OA 4ZLPA 1KWMA 1OYEA 3GB0A 3OL8A 2CJXB 4ENOA 1JLCB 3H42A 2V8GA 2DGTA 3W2WA 2LQ5A 2JNJA 3K9UA 2B58A 4OX7A 2Q43A 2GV1A 3PB7X 2LLZA 4JI1J 4J5OA 3M9MB 3Q22A 4OIXA 2EG2A 2EC0A 2FY1A 5HLFB 2X7BA 4LBHA 5J2NA 2MZJA 4CYNA 4HHHA 1M4IA 5KFOA 1RAIB 3JSBA 4OL8A 2CJ9A 2ZPAA 1BQXA 2D69A 3DRSB 4ECXA 2NSMA 3KLHB 4IUFA 1FX2A 1HWJA 4P2XA 3DR6A 2DYAA 3D7SB 3ZZZA 1WG1A 2K1RA 3OHAA 4DSLA 2GO9A 1EQ0A 3D6FB 1RWMB 3MAQA 1QTNB 4QBJA 2CIMA 2VPZB 1PJ5A 2W9BB 1KVIA 1HWKA 1FO1A 2DBBA 4HYKA 4MI4A 3A13A 2Q44A 4NEZA 5BWAB 2HFZA 4B9MA 3B8GA 4R57A 2GVDB 1TKZB 2ZW7A 4LSZB 4NYOA 3MM7B 1FFSB 4LF2A 1NDLA 5AE1A 4EK2A 1FRJA 1NKEA 1HBOA 4PEOA 1NB2A 4ELUA 4JYWA 4A47A 2CYYA 1HLWA 3W66A 3JTPA 4A30A 1AZSB 2D1CA 5H9FJ 2OMLA 3NOCA 2DPJA 4ZCKA 1UKUA 3DM2A 5AJ3F 2OD4A 2DGWA 4NCZA 4UFWA 3WQPA 5IC6B 4F67A 4DUZJ 4LQGA 1BE4A 4QIGA 4UW2A 3MD3A 3HFVA 1MG7A 4LF1A 4HLBA 3GG0A 5ETLA 1A9NB 3BYPA 1TV6A 3IWNC 3MN8A 5E3QA 3K58A 4C8YA 4JXQA 2YKPA 2RQ4A 3Q0AA 3MMAA 1D0EA 4ZGYB 4TLQA 4IDKA 4LFCJ 4GMKA 7FD1A 4JOUA 2IJRA 3PY8A 2NQPA 1VBYA 4GC6A 4UBRA 4DF4A 3NLCA 3QT6A 3DYAB 3PDNA 3MGDA 4PK2A 3MOJB 2R8HA 4YOEA 2QMLA 2DRDA 4DG1A 5K8OA 2VG7B 4NLWA 1TL5A 2ABYA 4YMEA 1PIEA 3M6UA 4ZP9A 5I3PA 4YR0A 2MMYA 5KOWA 4M5DA 1XNRJ 4UFXA 2E1RA 5BR8F 2MY8A 3JTNA 4V19X 2F8EX 2WK4A 1JWQA 3NCRA 4UOGA 1B4SA 1WC3A 1S60A 1IICA 1YRXA 4P9SA 3MCMA 1RXTA 2YH0A 1N71A 2VJUA 3M2RB 4DR5J 1JJ2R 2UXBF 4PG6A 1Z4EA 4RNFA 1M44A 3N6NA 3DXSX 4ONWA 3SDEB 2VFTA 4LFAJ 3MEEA 1VIXA 3CD0A 2C2ZB 1GT8A 2J6UA 4PXEA 2MXYA 2HS4A 2DNGA 3WC0A 2FGOA 3QGGA 3D1OA 4C2XA 4I6WA 1Z5RA 3MOZA 4JI8F 1DLOA 1WF0A 1X4FA 1HNWJ 2G13A 5AXMA 3IIBA 3PHTA 3SIPB 4OYXA 3VZIA 2YNCA 2CJYB 1WNEA 1RXOB 2HWTA 4CYPA 2UUWA 5F8JA 4RJVA 3H2VE 4K8RA 4Z2XA 4UIAA 1ROFA 1PC4A 3BKUA 3LWMA 1S49A 2AJ4A 2YKOA 4KOTA 3CJ3A 1FDBA 2QL7B 4UUWA 3MPDA 3ENVA 1M5SA 3M6VA 4LF5J 1MMLA 2ZITA 3OPKA 2VQFJ 2MKSA 5D8NA 5CYMB 4U7UK 3NS5A 3GILA 4YDXA 4J9OA 2FIWA 1JKHB 2CNTA 3J7A1 1S57A 3PZPA 1S9GB 2BE2A 5H1SV 1FNOA 4DYOA 2JOQA 1XNRF 5IT9U 2CWXA 3LANA 2QLWA 4MTPA 2UV8A 5B09A 3CC4S 4ILLA 1I21A 2NSCA 2JL9A 4AE5A 4IG0B 4I7FA 4O4GB 4RW8A 1TUVA 3QO9A 1DTQA 1WDTA 4CGMA 2QMUB 4DR5F 1M5OC 1RLDA 4R8UA 3UVJB 2LECA 3A8JA 1ULRA 4OI2A 1A2ZA 1DBDA 5E7OB 4F36A 5KFGA 1S1XA 3BSCA 2RQMA 4LFAF 2N4DA 1UWBA 1S1VA 2CJBA 5KTQA 1LWCB 2B0GA 2FLLA 1SUQB 4U95A 1TVRB 3C19A 4ZYQA 3AD7C 3IGNA 3L2NA 3VATA 2GQ2A 3IFEA 1U0SA 3PFOA 2VA3A 5IM0A 4FD7A 5C82A 4HH0A 1S9EB 1QLNA 3HT0A 5HVGA 3MM9A 1KUXA 1GXTA 2IM2A 2Y8WA 3BKFA 3DLKB 2R8GA 3BJ7A 3GFXA 3OVSA 2OB0A 3DOMA 1IR1A 3V81A 1KQSR 2QV6A 4FXWA 3QAYA 3NAIA 5CZVA 4F4YA 1X4GA 5ETPA 2QO3A 2GU2A 2UV8G 3RGIA 3EVWA 1SI9A 2B56A 3KMQA 5AG7A 2F9DA 3QFWA 3KG1A 1NHUA 4DSIA 1VQOS 4TNUA 3KQXA 4UA3A 3GFZA 1Q53A 4L3KA 1JXLA 3A1YG 3GJTB 2R7OA 1Y3JA 2A2DA 1RAJA 1S1TA 4KSAA 5KFUA 4KFBB 2ZNYA 1U26A 1L3VA 4FVCA 2EUIA 3KG4A 4KOXA 3M6XA 3P8BB 1MN9A 4C3LA 3FCWA 2AIRB 4JI4J 4IRDA 2YQ3A 2PMHA 3ZTRA 1ZTWA 3WT4A 5JPHA 4KUAA 2ATCB 5CBMA 4CCHA 2MQ8A 3AD9C 4F3OA 4EI2A 1O51A 2YH1A 2BE9B 2DNRA 1U1NA 3HD2A 2CZ9A 4OP4A 1XJWB 4DR6J 1VIOA 4RUBA 3P49B 2HQFA 3QIDA 2VKZG 3M8PB 4U9RA 4OI0A 2IYGA 4X3RA 4HPSA 5KFIA 1NO8A 4RUAA 1IGBA 1CPZA 3KQZA 3QRRA 3KLEA 3W7BA 3IGRA 1LK5A 3EZUA 3GYXB 2JEJA 1F2OA 2OEJA 4C48A 1RZMA 2C2DA 3UD5A 2RU9A 2FZCB 1DZ5A 4X5KA 3RRKA 3TOQA 1NK6A 1BHNA 2ZUGA 2DNKA 3M1VB 4CGLA 4ICLA 5DJBA 4ZJQA 4IR1A 4BBYA 5LSLA 1N5QA 3E01B 4X4RA 5DQGA 2V4RA 3GMGA 3Q23A 3AHPA 3SCJE 3FDSA 4OMFG 1GMVA 4RW7B 4M5IA 5HSPA 4CLSA 1NPPA 3ET6B 2F3JA 3BN4A 3KNAA 3W63A 3RAQA 4QYZJ 4S0MA 3HLPA 2RF2B 1RQ0A 2EFOA 3R96A 2AU0A 2ZJQQ 3WABA 2CNSA 2DH9A 2BEFA 2PMWA 2D3UA 3NE8A 5L1LA 4PAAA 5E33A 1XEBA 5FIIA 4WFXA 4P44A 2PI4A 3QJPA 1CP7A 3JB9k 4OJ1A 1R8CA 3OFGA 3PBBA 1R8HA 2AF6A 1J5OB 4NA2A 5HLFA 4ZCIA 4OQJA 5CYQA 1Q8KA 3VQTA 3ZNJ1 2KCWA 4ZVGA 1B70B 2M8DB 3DGPB 4K4WA 3DRSA 3KLHA 2WBMA 1PKUA 1U2CA 2OSQA 1JLEA 2P6TA 3TTHA 1HW9A 3I0SA 3PRBA 5G4DA 5T41A 1GMWD 1YJ7A 5LT5A 3HLUA 1P27B 2D9OA 2MSSA 2D4OA 2PEHA 2L48A 3JSMA 4EWTA 3FEYB 1JJHA 4KT0C 4M95A 4WF9Q 3S6EA 3V6JA 2BM1A 4TXSA 2GVDA 5DGAA 1W25A 2F5GA 3ZZ0A 1BY9A 2ZJPQ 5K20B 3WX4A 4KIAA 1VBZA 4R25A 1TKTA 2AYGA 4OAEA 4IFYB 4M5MA 1I3OB 2BXJA 3H7HB 4TYBA 1QSNA 4OC1A 2OHDA 1KEKA 1HHQA 1X8DA 3PX6A 4RBTA 1AZSA 2HKEA 1U09A 4DX7A 3S6GA 3KNGA 3ZC4A 4KV8B 2HQYA 3R8YA 2PI5A 4YWYA 3PIPQ 2J8MA 4OYBA 2J5AA 2DJWA 4DUYF 4Y2MA 2A2CA 3FEXB 3GYNA 4HACB 1YRTA 4MHZA 4ZPCA 1RWPB 3T9NA 4CPAA 1NNDA 4CLUA 2X1FA 3BEGB 3G82A 4A32A 2FHMA 2R7QA 3ZJ0A 3GWCA 4ZVFA 2P8IA 1VISA 3PXGa 4RLEA 1YZ6A 2X7IA 1I1GA 4A8SA 2CPIA 4TWEA 4R3LA 3EXNA 4X8IA 4Y65A 1UVLA 4MFJA 3ILLA 2J0SD 1QAYA 4KHRA 5I4MA 3EE3A 4NMXA 1TP7A 4WIIA 2PC6A 3BKTA 4IO9Q 3FQKA 1QAJA 1KP6A 4F4KA 3VGVA 4UWIA 1WDDA 5IX3A 4B3SJ 4PUOA 1KZFA 4M5GA 4U96A 3FJ2A 1S97A 4R7MA 2Z10A 2HVDA 4KVOE 5LXRA 1GTEA 3DYAA 2ZBRA 3ILIA 3J80Y 4U9YA 4DX5A 3IM9A 2EFVA 3J7YI 4F02A 2GX8A 4P75A 3TUPA 2AKWB 3HHNB 1UZHA 5F3ZA 5HL7Q 4J7CA 1SXLA 4CYOA 3SHPA 2NS1B 4NMLA 2M70A 4QCLA 3P2HA 5IXUA 1UTAA 4ZN3A 4ZVEA 3KR5A 1FCAA 4F6AA 4NGSA 1S99A 2ZDOA 2REFA 1HWIA 2C22A 3T5LA 3F44A 4DF8A 2GW8A 4ETXA 4YDDB 2WW4A 3W9JA 3PRVA 4KSFA 5AXNA 1REVA 3M2RA 4YP3A 1RT1A 3W5ZA 3MM8B 4A46A 1TF9A 3FEEA 4B3OB 1Z1ZA 3J80U 2WSAA 2YWGA 3P45B 5HMNA 3R6LB 3DSBA 3G6VA 2MHNA 3CCES 1AUSL 1FA0A 1VQ4S 1SKUB 3N6MA 2IVMA 1CJVB 3DKDA 3CCVS 2UVWA 5C2CA 2HFSA 1UZDA 2Z3PA 4A8FA 2O4HA 2HK2A 2ZWPA 4L73A 4LSNB 5THWA 3OR2A 1T11A 2HHUA 2AV5A 3CPXA 2HGMA 3W64A 2PJBA 3GU0A 4X2TA 2K7JA 5IB9A 4LF8F 2FUG9 2LKZA 4R76A 2J9EA 3ETMA 3IWLA 5L9NA 1X9SA 5G1ZA 3MF5A 2OD6A 3LW5C 4DV7J 1W2IA 4NYPA 2F4FA 1YSJA 4Y00A 1NK5A 4B3SF 2VICA 2HQGA 3BQ0A 1WWZA 4A8WA 3NOGA 4F8ZA 4ZP8A 2QJ3A 1HI0P 1F2HA 3QLHB 1KONA 1OSCA 2FHKA 2ASLA 1TKXA 1IJFB 2HNDB 3GJSB 1J4JA 5CPAA 2WVEA 3R5AA 5LSOA 3HVRA 2I2YA 1ZH5A 3CW2C 1U0HA 1X5OA 3V6DB 4CGPA 1S9GA 4Q2LA 3DOKB 3T1YF 5T7LB 2BUEA 5KFVA 1S77D 1WTBA 2ZD1B 4W4MA 2Q4ZA 4G3IA 3FECA 1RKIA 1LK7A 4JI0F 3DRRA 5GADI 4C8LA 1HBUB 1KQKA 1U1PA 4JYAJ 1B7FA 2PT0A 1PSDA 1NHKL 2XMVA 2KI2A 3BSAA 4NXNF 2OPRB 4DCPB 1P0HA 3SYZA 3M32B 3DMJB 3DHXA 2P6EA 2NYQA 2P6GA 4DV3F 5MAOA 1ELMP 3OSNA 1LWCA 1VQ9S 2BANA 4K5RA 2KL8A 4HVZA 1SUQA 4WZQA 2E66A 2DNHA 1BPNA 1VFJA 5G21A 1JLAA 1CLFA 3W91A 1IKYB 2C3OA 2GANA 3QSYB 4KHPF 4BC9A 1X0PA 2BE7D 3RO0A 2CNKB 3EC4A 5KG0A 1UA1A 4ZDNA 2V77A 2R7WA 4M63A 2R8VA 2G0IA 2CPYA 2R8KA 5MLCV 1H2VZ 4ILRA 1ZM4A 5DETA 1N0UA 4QIEA 1CJWA 1S9EA 1HMVB 1UA0A 4J9QA 3DLKA 4QIFA 9RUBA 1IYLA 3K5PA 2I00A 1OMSA 2IFXA 3IWXA 3ZTOA 2VZ9A 3CJKB 2XMJA 3IN5A 4QU7A 5BYRA 4MJKA 1VQNS 2X1GA 3SCLE 4GM5A 1IJEB 4KPCA 3TOAA 3D7GA 2WB1D 4M6IA 3M8QA 2QSWA 2JEGA 2APOA 1Q8LA 1AYEA 4NASA 2B6AA 4U7UD 1Q81T 2C6CA 2UUAF 4DPTA 2NXEA 4JI7J 1FRKA 2CJKA 1IY7A 1S0NA 5GMKa 4NI2B 1LWEA 2B7CB 1TK8A 3DLEA 1H8LA 2MDAA 1CC8A 3R97A 3UCZP 3H8FA 2GO8A 1X4BA 3N4WA 2H3EB 4DV6J 4YY3J 3R9EA 3NXZA 2R4FA 2NCKL 2XEIA 1FEEA 2DNOA 2CG4A 2B4OA 3BQ2A 4OLOA 1PILA 3CTRA 3M8PA 5J2MA 5H84A 3TA0A 4EBEA 1HQUB 4YGOA 4CS0B 3NBPB 3GTYX 1D9AA 1X5SA 1MK4A 1AMPA 5H86A 3AOAA 1Q5VA 4CAFA 3IO1A 1NK4A 2CPFA 3QYYA 4ZVHA 1V5IB 3KR4A 3HKWA 2XO6A 2JEWA 4QB9A 4FYDA 1UVNA 2VFVA 3M1VA 1KFSA 2PJ6A 1WOSA 3SBMA 3F0NA 1GQEA 4NYZA 4PSXA 4FYVB 1YJNS 3SEOA 4O3PA 3PO5A 3PACA 1TL4A 5JMNA 2DGXA 3JXOA 2BJ8A 1IU8A 1WEYA 1G3OA 1KUVA 1R0AA 3F56A 3IJ3A 3ET6A 3BGOP 1JLGB 1PU9A 3CCTA 4Y34A 2RUSA 2RF2A 1NJZA 4HNYB 3U1LA 4BBHA 1R6YA 2RB7A 1XERA 3KZWA 3CT9A 2Q7SA 1NM2A 4K4XA 4ZP7A 1B6BA 4GKJJ 1M5HA 1S7KA 3KJQB 2ZEGA 3KHRA 3NNAA 2H65B 2O01C 5DLGA 1S0OA 1CS4A 4RBUA 1MMNA 2BQUA 1J5OA 2RJZA 1DQ8A 1SBRA 5L9XA 2QTWA 5FDLB 1SL2A 2XWXA 2AJ2A 4CDIA 1VYAA 2ADBA 2J8NA 1U7LA 1X9MA 3N6LA 4EZ6A 3QAEA 4YY3F 3OR1B 3JYTB 4OV6A 4ANEA 3AJ2A 4H4MB 3AA9A 2KH9A 4E0DA 4C2YA 3S7RA 1I5OB 3OFFA 3LODA 2PGCA 3MD1A 1KN6A 4TNOA 2IMWP 3JQKA 1HFEL 1Y9KA 2O5DA 4HL9A 3MGJA 2JFKA 3MCNA 1P8GA 1WUUA 3B7IA 2WCXA 3POTB 5L39A 2E29A 1FVQA 4H4KA 4WCEQ 2IJFA 2HURA 4KY3A 2ARHA 4LX9A 1BLUA 3G6XA 2RUGA 4GS4A 2NLWA 3X1LB 4B5PB 1F9EB 5I3UB 3CPWR 4EO8A 2A10A 1FNMA 4UCPA 4Q5VA 2HVEA 4WP9A 4KV8A 2OPPB 4ORFA 1YI2S 2CQHA 4DWIA 1UPMB 4CAVA 3O2IA 3SQGB 3HSGA 4HACA 2H5JB 1R31A 3KYLA 2Z3OA 3H5ZA 1ZO0A 1H2TZ 2DIUA 4PQUA 4WU3A 1FNXH 3MMCB 1RHQB 3ZZIA 9ATCB 3M8RA 2BW2A 4W92B 5FD1A 1BQNB 4NFRA 3IS9B 1HNVB 1T95A 2AEJA 3RYLA 2M7SA 1E6VA 2UU9F 1FDNA 4IG3A 2A6OA 1Y4ZB 2HVHA 5HQMA 1F5AA 3I3GA 1RCXB 2PFFB 1KSPA 2KXFA 1VRQC 4DV1F 1XF8A 1QMUA 4OYOA 1JX4A 1RT5B 3KHHA 1OY9A 3BDPA 3VGUA 2F4VF 4MFBA 1W2BR 4DI6A 4KGXB 2CQDA 4C9DA 1CULB 1V3SA 3PBEA 4NLXA 1CBXA 2CZ4A 2P2CB 4ATNA 1YR0A 2PSZA 4IRCA 4R9MA 1IBKF 1S1UB 2G2ZA 3DGVA 4C8NA 5HO4A 4YQWA 1RU2A 3D7FA 2CFXA 3I87A 2ZWOA 1SQFA 1VKCA 1BLLE 1RWXB 3ZTPA 4RU9A 3NP5A 3HM9A 4V19J 1P9QC 2CY2A 1T03A 3MXHP 2WZNA 1Q95G 4DMZA 1GFWB 1PYTB 4DXLA 4ONUA 1IWGA 1VLOA 1VRTA 4TU9A 2YNGB 5K14B 4KOSA 4OC5A 1Q86T 2VJVA 5CAAA 5BYSA 3FSXA 4XAKA 2HWIA 1NDKA 1XMQF 2CQIA 2MTLA 3OVBA 1EAYC 1FRXA 3R7SB 4NOHA 2YQ1A 3NGDA 2YWEA 3M4XA 4XPDB 4OZ0A 2LVWA 3D6TB 2NYIA 1KUYA 5KFCA 4ES2A 1SJRA 1QAXA 1UJ6A 2VIHA 4ZVSB 1Q2DA 2QL9B 3VTIA 2ZBPA 2B43A 4C97A 4AXIA 3R95A 3QLHA 2ZH4A 5IV3A 2XI2A 2HNDA 1H2UX 2FT0A 1MJAA 2BJDA 5SZTA 3PEHA 4K4ZA 3W6SA 3S1TA 5KFFA 2MKJA 2HLTA 5B0BA 3W8GA 5H9FK 1C1CB 5T7LA 1Y9WA 3VAFA 3J7AN 3WR7A 1YQEA 2ZD1A 2YNEA 2VZZA 1DQAA 4DR7J 1FWPA 3D8PA 5M2PA 2DNQA 2J6SA 1U48A 5HMYA 3AODA 4DUTA 2I79A 4MHDA 2P9EA 3SZ2A 4F04B 1XNQJ 1OY6A 3FRMA 1EHWA 2A3JA 5HMWA 2W9CB 3EZ5A 1RU1A 2J7WA 2OH2A 5F8LA 1JNRB 4P7TA 1NK8A 4FNIA 3ILOA 1XR7A 1WELA 4FN5A 2GFFA 2Y8YA 4OX9F 1C0UB 2YKNA 1IBLJ 2GVZA 3IEHA 1TF8A 3SXOA 5E3AA 4PXCA 1LRZA 3AH6A 1FT7A 2E9TA 3C8YA 4IOBA 3NRBA 2W2PP 3MECB 4P45A 3CGIA 1Z9UA 3CDWA 3PNIA 1HNIB 2K3KA 4WPAA 2LDYA 2CQ0A 3TYTA 3HFKA 3M8ZA 1HMVA 3T5JA 4NCBA 2WW8A 3P5TL 3GY9A 1NAQA 3NG8A 3TARA 1S7IA 3O1LA 3HO1A 3M9OB 2DT9A 3WC2A 1Y5IB 4XNHC 2HW3A 1KTQA 5EGYA 4MFKA 4NGNA 5LJ3Y 2KKHA 2ZH8A 5J2PB 2MEWA 5DS7A 3GIMA 3ILJA 3TOBA 3H8GA 5CD4A 1O8BA 1CJKA 2ZKUA 3SV3A 4DNCA 3I32A 3QPIA 3OFEA 4E8UA 3CEDA 3C3LA 2UUTA 2OIHA 3K2YA 3M30A 4NGPA 1WK4A 4P74A 2ACYA 2AHOB 3DLJA 2PCUA 4P2SA 3AY0A 2XEFA 2X51A 2NUUG 1X60A 3DRPB 3TANA 3DLBA 4NI2A 2G2YA 4KBIA 3I9ZA 3KG0A 1FWLA 1T94A 3G71S 4UWJA 1RAHB 2XNRA 5J1PA 2QGFB 4K3NA 1SCJB 2RQCA 3LA0A 3N28A 4DFMA 2ZC3A 3I82A 1NBEB 2SXLA 1HR0F 2EK9A 3LWLA 4F4XA 3NS7B 4ECQA 1TKDA 1NUEA 2QLJB 3VAKA 3VH9A 4DSEA 2KRRA 4RNOA 2PSWA 2R9LA 2O3DA 2R7VA 4BWJA 2DO0A 2PJ8A 4NXYA 5KG6A 1Q2CA 3FCHA 4EBDA 2EVZA 4A4JA 1FE0A 3HDSA 3F41A 4Y2KA 2RVJA 3TFYA 4J3GA 2EFGA 2Y1LB 1UJ5A 1ON0A 1HQEA 3VAMA 1NSAA 2RDDA 3BGRB 2HQIA 1S5KA 3B3CA 5AG4A 3FF3A 1U1MA 4JBCA 1TKJA 4NA3A 2X3DA 1OIAA 1U8SA 3IAS9 4F0KA 4JJXA 4J9PA 1ZS6A 2YX1A 5IS2A 2O1PA 1LEOA 3NFZA 1RADB 1JJ4A 3WX8A 3FJUA 1TXRA 2BUNA 3IR7B 3R5GA 3MPVA 5GMDA 2NZ4A 4J9MA 3TT2A 2K7KA 1URNA 3T3FA 4QVTA 1UMJA 1JLQB 5DDRC 4LF9F 2XMAA 4P4FA 8ATCB 3CC2S 1YQHA 3BPSP 2QT7A 1WHXA 3EDRB 4JLYA 1C0TB 4ZS6A 4NX9A 1ZLHA 4KR0B 1TL1B 4FS2A 2MQLA 5KFEA 2DRBA 2AMCB 1D8ZA 3C6UB 2HMIB 4G1QB 5E96A 5F46A 4N47A 1TK0A 2PC1A 2ZELA 1S10A 2QMXA 1SKWA 2HAFA 2K5TA 2OSRA 2BX6A 1CJUB 3H59A 4X62J 4C6AA 1RK8A 2M2BA 3M8WA 4TYAA 4LF7J 4H4MA 1ZAXA 2ZZNA 3CULA 4B13A 4Y49B 2CQPA 4NLRA 4OJ3A 4ZJOA 2M3DA 5KTCA 4UOHA 4ZOSA 2WTFA 2UUCJ 2XCPA 1ZOTA 2MLXA 3D1HA 1N5TA 1N34F 1H73A 5JXSA 5DDQC 4C0HA 4CH1A 4KGMA 3UPFA 4IOCQ 1ZG8A 3NGUA 2RE1A 5AGEA 1KBRA 2G1HA 1ELOA 3K8WA 1NKCA 5HATA 3CJSA 3P5BP 2E7XA 2YNIB 2OFHX 1R7IA 1Y7RA 3H4QA 4BC7A 4QBUA 2XI3A 3EYZA 3FNCA 3R7NB 1RT2A 4XNHB 4URSA 2KFZA 1G7CB 2OPPA 2DO4A 1FFWB 2MLYA 4NLVA 3CNQP 3MDFA 3SQGA 2V4JA 3ZZYA 1NK9A 3P6YC 4N8OA 1YJVA 2RDIA 2LCWA 1VC6A 2HBRB 4UY85 2ZOFA 1UFHA 2M52A 2R2TA 3VZHA 4K4TA 4A8OA 2FVPA 1BQNA 4MYUA 4KH1B 2FJEB 1PBAA 3IS9A 3FH4A 2KFYA 4QR1A 1NZAA 4DR4J 1NZ8A 4CRJA 4QOTA 3LP1B 3TUZC 2Z2YB 1F57A 4QW8A 4LR9A 3HT3A 3KHZA 5CCMA 4MHPA 3EXYA 5LYLA 3T6BA 1FFGB 3PGPA 2GQCA 1SQEA 4ZHRB 1UAWA 2R7SA 3D54A 2QECA 2J7UA 2UVRA 2CUYA 2DH8A 3A12A 4OYPA 1DY3A 3OTEA 4CT9A 2MJNA 3RRHA 3GCXP 1LXJA 2IJNA 1X5PA 4DHVA 4LF7F 3OV7A 3PR5B 1F9FA 3I4PA 4NLDA 1JNZB 4LSLB 1S12A 2Y1JA 5KFWA 4DV0J 3RB4A 2P5VA 3HSJA 4MIWA 2NZCA 2AW0A 1IKVB 1IM6A 5JVHQ 1YJRA 3TJ9A 4JP8A 4MY3A 3TCVA 1SV5B 4FYXB 6FDRA 3KK3B 3P2FA 4M5KA 4QYZK 1CQNA 1WOPA 2MQNA 2ZZTA 3OVAA 4UCMA 4ANCA 4NZ7A 3ZTSA 2XY7A 4NLOA 5KT3A 1MWQA 3V7ZA 4F0XA 1Y0HA 2GHWA 1M1KT 2CJAA 2XYGB 3N7ZA 3LTOA 1MROB 3D1QA 3GV8B 2YPYA 4FF1A 1NSKL 4RW6B 2LP4A 5IV0A 1S4FA 4OJHA 4ID8A 2BOAA 2JDCA 4IH6A 4I1TA 1PYTA 3UWTA 3W2WB 2Q0YA 1YWXA 3L7OA 1DFDA 1R6VA 4LF4J 4OZ1A 2QE5A 2CQ3A 3OXGA 1N5VA 1HKAA 3M2VB 1XTZA 1S7LA 3LP2A 4MKYA 2YNCC 2YNGA 3R1KA 3C15A 2EG1A 2HBYB 4K0KF 5J2NB 3IP0A 4IHMA 2Q1LA 3Q24A 8RUCA 2NXUA 3H40A 1UJ4A 4MFQA 2FVQA 4L6V3 3Q2TC 1WC0A 3D2MA 3BH6B 2QC3A 1HBMB 4IH5A 5LYFA 3AQOA 2FZKB 4CRYB 3W65A 5HK4A 3PM9A 4LIRA 5HQ8A 1SVDA 3LP0B 2KHCA 4UOCA 1B0TA