3FIXA

Crystal structure of a putative n-acetyltransferase (ta0374) from thermoplasma acidophilum
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
165
structure length
165
Chain Sequence
b'YFQSNAMSIEIRKLSIEDLETLIEVARESWKWTYAGIYSEEYIESWIREKYSKEKLLNEIVRSQSNLDILFLGAFADSTLIGFIELKIIANKAELLRLYLKPEYTHKKIGKTLLLEAEKIMKKKGILECRLYVHRQNSVGFSFYYKNGFKVEDTDGSDFIMEKKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACETYLTRANSFERASE
publication title Crystal structure of the novel PaiA N-acetyltransferase from Thermoplasma acidophilum involved in the negative control of sporulation and degradative enzyme production.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Transferase
total genus 53
structure length 165
sequence length 165
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2008-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3fixA00
5IV0A 1BO4A 4NEXA 2B4DB 4MHDA 4B5PB 3DSBA 2BSWA 4R87A 3T9YA 4NSQA 1Y7RA 4B5PA 2ZW4A 4NCZA 1P4NA 3IWGA 3F0AA 4QVTA 1MJBA 3TFYA 2X7BA 1XE4A 3EO4A 2JDCA 2PRBA 3JUWA 1S5KA 4M3SA 5FVJA 4JXRA 4I49A 4MJ8A 2ZW7A 4QBJA 4PK2A 2EUIA 2OH1A 3DR6A 5EC4A 1QSRA 3F5BA 3GKRA 3F8KA 3TOBA 3TE4A 1Z4RA 2G0BA 4XNHC 1S7FA 4RI1A 3DNSA 1ON0A 2OZHA 4KORA 1IYKA 4UBRA 3R1KA 2R8VA 4YRHA 2OZGA 2Y0MA 3R96A 3BJ7A 4M85A 2OB0A 3TO6A 1BOBA 2BUEA 4CAWA 4UA3A 5C88A 2F5IA 3LD2A 3DR8A 3W6SA 4KUBA 4KLVA 3S6KA 3G3SA 3D8PA 3CXPA 2Q44A 4AB7A 5J8FA 1XF8A 2J8MA 2D4PA 1CM0A 5DWMA 3FYNA 2FCKA 5KTAA 2AE6A 4AVCA 1IICA 4JWPA 4QB9A 1YX0A 3BLNA 2FXFA 3R9FA 3TO7A 1YREA 2Q4VA 1M4GA 2VZZA 3EXNA 4AG7A 3PGPA 2FL4A 5F48A 2D4OA 3T90A 2R1IA 3NE7A 4IF5A 5IB0A 1S7NA 2I00A 2JLMA 1I21A 2BEIA 1Q2YA 4K30A 4EVYA 4JJXA 4MY0A 4X5KA 1YK3A 5GCNA 2QIRA 3D2MA 2BL1A 2Z11A 2K5TA 4BMHA 2R98A 4H6ZA 4MY3A 2A4NA 3IGRA 3I9SA 4DNCA 1XEBA 2ATRA 4OLLA 2ZW5A 1XIXA 2HV2A 4XPDB 4XNHB 1IIDA 3R95A 5HMNA 2P6EA 4HNYB 4KZTA 3P2FA 4PV6A 1Y9KA 2FIAA 1Q2DA 5IX3A 1IB1E 1S60A 5J8CA 3PP9A 2PDOA 3TT2A 5JPHA 2PR8A 3W6XA 3TCVA 2OU2A 2FE7A 4KVME 2P6FA 3OWCA 2JEVA 1J4JA 2C27A 3VWDA 4F6AA 3N7ZA 1NSLA 3S6HA 4AVBA 2O28A 3R9EA 5EBVA 4HNXB 1QSTA 4ONUA 1M1DA 2VZYA 1LRZA 3BJ8A 4YGOA 3B8GA 3V8IA 1N71A 2WPXA 2Q0YA 1M4DA 1MJ9A 4XPKA 4KOVA 5KTDA 2ARHA 1QSOA 4NF1A 1KUXA 5F46A 2CY2A 4J3GA 4AG9A 1YVKA 1PU9A 1M44A 3FB3A 1FY7A 3TOAA 3CXQA 2FIWA 3DDDA 4AVAA 4R3KA 3SXNA 4PSWA 4JLYA 4E0AA 3FRMA 3MGDA 2OZUA 1KUVA 1I1DA 4HKFA 1Q2CA 4RS2A 4LX9A 3QB8A 4PSXA 3VWEA 5C82A 2EVNA 3EFAA 1UFHA 2P0WA 5F49A 1GHEA 4KLWA 1PUAA 2CNMA 5CNPA 3D2PA 3P2HA 1R57A 2REFA 4FD6A 4L8AA 3C26A 2WPWA 4ORFA 2DXQA 2PC1A 2Z0ZA 5E96A 1RXTA 1OZPA 4H89A 1VKCA 4MI4A 2ZXVA 3KKWA 2VXKA 4Y49C 1B6BA 4KOUA 2B3VA 2Z10A 3R9GA 1QSNA 4NXYA 2QECA 2R7HA 1CJWA 2B3UA 1IYLA 1K4JA 1Y9WA 1QSMA 1S7LA 3JVNA 1MK4A 1RO5A 5DWNA 1L0CA 2B5GB 4CAXA 5F47A 2NMTA 4YFJA 3RYOA 1YR0A 5HH1A 2B4DA 3PZJA 2B5GA 1S7KA 1YVOA 4E8OA 3E0KA 4FD7A 1MJAA 2B58A 3GY9A 4LUAA 3WR7A 4OADA 2GANA 3UY5A 3EY5A 4XPLA 4CAVA 1TIQA 4KVOE 3EC4A 2J8NA 2G3AA 4UWJA 2HUZA 4ZBGA 4JXQA 2ZW6A 4CRZB 1NE9A 4XPDC 4H6UA 4OAEA 3SXOA 2GIVA 4FD5A 2Q7BA 3FNCA 4JD6A 4KOSA 1P0HA 1S3ZA 2CNSA 1I12A 5H86A 3TTHA 1YGHA 3W91A 4U9YA 4F0YA 5KTCA 1Z9UA 2VQYA 2G3TA 3FXTA 3I3GA 2P6GA 4IUSA 2KCWA 3CXSA 2VBQA 2FT0A 1XMTA 2HQYA 3QAHA 2PSWA 4R9MA 1B87A 4L89A 3LODA 4U5YA 2JDDA 1NMTA 5JQ4A 1WWZA 4R57A 1KUYA 5I0CA 5H84A 1U6MA 1V0CA 2RC4A 4KOTA 2QMLA 4QC6A 2I79A 3G8WA 4MBUA 3S6FA 4KOYA 1M4IA 2VEZA 4GS4A 1VHSA 2J8RA 2Q04A 4R3LA 3FBUA 2CNTA 2PR1A 4Y49B 2H5MA 2FSRA 2ZPAA 3ZZIA 1Z4EA 4CRYB 3FIXA 2Q4YA 4QUSA 3S6GA 1SQHA 2GE3A 3K9UA 4FD4A 4U9ZA 4PK3A 2PQ8A 4KOXA 4E2AA 1KZFA 3D3SA 2B4BA 2REEA 3GYAA 4KUAA 2IL4A 3SHPA 2FS5A 4KOWA 4II9A 4HNWB 3TO9A 3ZJ0A 4UWIA 1WK4A 5ISVA 4CS0B 2VI7A 2AJ6A 4B5OA 1YLEA 4KVXA 3H4QA
chains in the Genus database with same CATH superfamily
5IV0A 1BO4A 4FUUA 4A33A 4NEXA 2B4DB 4MHDA 5K8OA 4B5PB 3ISZA 4MFQA 3DSBA 4MCPA 3NA6A 2BSWA 3I1UA 3KR5A 1VIXA 3PBBA 3SJXA 1A2ZA 4R87A 4OIDA 3PEIA 3T9YA 2ABZA 3CZXA 4NSQA 4NGTA 3V7ZA 5CPAA 1Y7RA 3B35A 3SI0A 4B5PA 2AFUA 2NSMA 2ZW4A 3B3SA 4NJQA 4ZY1A 4NCZA 1P4NA 4UIAA 2WSAA 1LCPA 2F8HA 3F0AA 3IWGA 2DEAA 1MJBA 4QVTA 4B5OA 3TFYA 2GLFA 2X7BA 1XE4A 3EO4A 2JDCA 2PRBA 2ZEEA 3FECA 2PJAA 4ZX9A 4C7HA 5LYFA 3JRUA 4MMOA 3JUWA 1S5KA 2YNDA 4M3SA 1R43A 3LWUA 5FVJA 1LFWA 4JXRA 1ELLP 4B11A 1DTDA 4I49A 3PB4X 5G21A 4MJ8A 3D68A 1M4LA 2ZW7A 5G20A 4G1PA 3QNVA 1ZLIA 3B2YA 4QBJA 4PK2A 1CG2A 2G9DA 5DS0A 2EUIA 2OH1A 3DR6A 5EC4A 5THWA 4UEFA 1QSRA 2PJ8A 1ZG8A 1LAMA 3F5BA 3F8KA 3GKRA 4P4JA 3TOBA 2V8DA 3TE4A 1Z4RA 2G0BA 4XNHC 1S7FA 3D66A 4OKOA 5D8NA 3VATA 1Z8WA 4RI1A 1F2PA 3DNSA 3KHZA 1ON0A 2OZHA 4PXEA 4KORA 2ZOFA 1IYKA 4H2KA 3B3TA 4UBRA 4IHMA 1Z5RA 3R1KA 4MHZA 2Z3PA 2R8VA 3D7DA 5LRKA 4YRHA 2OZGA 1HDUA 2Y0MA 3NH5A 3R96A 3BJ7A 4M85A 2OB0A 2ODFA 3TO6A 1BOBA 2BUEA 2PJ1A 1LAPA 2QJ8A 4UA3A 4UCPA 4CAWA 2F5IA 3LD2A 1X12A 5BWAB 5C88A 2EWBA 1AYEA 4CYNA 3DR8A 3GIUA 5AG7A 4KUBA 4KLVA 3W6SA 4M6HA 5AG4A 2ZOGA 3S6KA 3WC6A 1TF8A 4P45A 3FMCA 3G3SA 3D8PA 4YWYA 5JGFA 3CXPA 4C2YA 4P10A 2C6PA 2Q44A 2POKA 4AB7A 1ZLHA 4OC3A 5J8FA 3D4UA 1GYTA 1XF8A 2J8MA 2D4PA 4ZI6A 1CM0A 5DWMA 2PJCA 3FYNA 2GFQA 3K9TA 3IEHA 4CYQA 1JWQA 2FCKA 5KTAA 1BAVA 2AE6A 4UFXA 4AVCA 1BLLE 1IICA 4JWPA 2Q43A 3NH4A 3VARA 5G22A 4QB9A 4A2ZA 1YX0A 4PQAA 2EBJA 2PVVA 2PCUA 2V8GA 3BLNA 4CGOA 4KS9A 2FXFA 2ZEDA 2XEGA 3R9FA 4C7IA 3TO7A 1YREA 2JBKA 2Z3KA 2ZEHA 2Q4VA 2RB7A 4Q38A 1M4GA 2VZZA 3EXNA 4MFPA 4AG7A 4DJLA 3PGPA 4ZY2A 7CPAA 2FL4A 5F48A 5G1ZA 3D7FA 2D4OA 1IY7A 4DYOA 2C1CA 1YLOA 3H5ZA 2R1IA 3NE7A 4UCMA 3T90A 3S9LA 3CDXA 4IF5A 4PXBA 5IB0A 1XBUA 4NGRA 1TKFA 1S7NA 1XMBA 2I00A 2JLMA 1I21A 2BEIA 3L2NA 1Q2YA 4K30A 4X3RA 3SI1A 4EVYA 2C6GA 3D7GA 4RN7A 4JJXA 4MY0A 3WABA 1YW6A 3N5FA 4X5KA 5AG6A 5HVGA 2YNEA 2AFXA 2CIJA 4OC2A 1YK3A 4M6GA 5GCNA 2QIRA 4MRIA 3D2MA 4CGMA 3PRTA 1EE3P 2BL1A 2Z11A 5LRJA 2K5TA 3IIBA 2R98A 3PB8X 4H6ZA 4BMHA 4MY3A 2GREA 2A4NA 3IGRA 2WYRA 1VGYA 5IB9A 3I9SA 1XRYA 4DNCA 2PJ2A 4UFWA 1XEBA 2ATRA 4A94A 4OLLA 2ZW5A 1YSJA 1XIXA 1LOKA 2HV2A 2AFSA 2PVWA 4XPDB 1H8LA 4XNHB 1IIDA 3R95A 5HMNA 4JYWA 3D67A 2P6EA 4HNYB 4NGPA 4KZTA 3P2FA 4RUHA 4PV6A 2AFOA 1Y9KA 5HVFA 4MHNA 4IK2A 2PRQA 2AFWA 4BD9A 4OMEA 2WZNA 4F0XA 2FIAA 3VH9A 1Q2DA 1CP7A 5IX3A 1IB1E 1S60A 4MFKA 2C6CA 3SJEA 4X8IA 3FH4A 5J8CA 3PP9A 2PDOA 1CPSA 5AG5A 1DE4C 3TT2A 4CGNA 1ELMP 3HUVA 4OP4A 1PCAA 3NH8A 5JPHA 2PR8A 4MXUA 3RZAA 4F9VA 3K2KA 1CBXA 4NFRA 3W6XA 8CPAA 3KGQA 3TCVA 2Z3LA 4A31A 1ZG9A 2OU2A 2FE7A 3PB6X 5K8NA 1VHEA 4KVME 4YU9A 4MCSA 3KL9A 4UEZA 2OR4A 1JQGA 3CT9A 2DPTA 2P6FA 3OWCA 2PIYA 2PJBA 2RFHA 3S9MA 2JEVA 4ONWA 3V38A 1CPXA 1J4JA 3CPAA 3HLPA 4B10A 4B13A 4P4EA 4A39A 2C27A 1NSAA 4KSAA 3VWDA 4F6AA 3N7ZA 1NSLA 3S6HA 4AVBA 2O28A 3R9EA 5EBVA 4HNXB 1HEEA 2BCOA 1QSTA 4IAVA 5D29A 4EFDA 4ONUA 5ELYA 3JTKA 1M1DA 5A27A 2VZYA 5A28A 3RAMA 1LRZA 2PJ7A 4OC1A 3BJ8A 4MHYA 4YGOA 5K8MA 3B8GA 1XOVA 3V8IA 1N71A 3B3CA 4P4BA 2WPXA 1QMUA 1M4DA 1MJ9A 2AFMA 2Q0YA 4XPKA 4KOVA 1AUGA 5KTDA 2ARHA 1QSOA 4MFJA 4NF1A 1KUXA 4WWVA 2GU2A 3SJGA 5F46A 1XJOA 2CY2A 4J3GA 4AG9A 4OIWA 1YVKA 1PU9A 2ZENA 4TNUA 4P4DA 1M44A 3FB3A 2DPSA 1FY7A 1F2OA 2YNCC 3BHXA 4MFLA 4UIBA 3IC1A 3TOAA 4MHPA 4ZGYB 5I4MA 1LANA 4LQGA 1BPMA 3CXQA 2FIWA 3DDDA 4AVAA 4BINA 4MCQA 4R3KA 5K8PA 4P44A 4PSWA 3SXNA 4UCNA 4B14A 4JLYA 4E0AA 3FRMA 3MGDA 1YQEA 3RNZA 5LYLA 2OZUA 1KUVA 4CGPA 2J9AA 1I1DA 4HKFA 2Z3NA 3WC7A 1Q2CA 4RS2A 4CGLA 4LX9A 3QB8A 2VL1A 4PSXA 3VWEA 2ZEPA 2PIZA 5C82A 2EVNA 3EFAA 1UFHA 3KASA 2P0WA 2BO9A 4NGMA 5F49A 1GHEA 3BI0A 4KLWA 1PUAA 2CNMA 3D7HA 3NFZA 1Z8XA 5CNPA 3D2PA 3S9NA 4PXCA 1Z8TA 4UFVA 3IJ3A 3P2HA 1R57A 4B6ZA 4Z65A 2IMOA 4HPSA 1YMEA 2REFA 2GLJA 2ZEFA 3PFOA 3C26A 2WPWA 4FD6A 4L8AA 4ORFA 4CAFA 2DXQA 1RTQA 3PB9X 2Q4ZA 3RBUA 2IQ6A 2XEFA 4W9YA 2PC1A 3TC8A 2Z0ZA 2QVPA 3KQZA 5E96A 1RXTA 1OZPA 4H89A 2OOTA 3B7IA 1VKCA 2YGWA 4MI4A 3PB7X 4F9UA 3T8WA 2ANPA 2CTCA 4A37A 1OBRA 1Q7LA 2ZXVA 3KKWA 2WUUA 2VXKA 4Y49C 1R3NA 3CPXA 1B6BA 4R6TA 2I3CA 4K3NA 4KOUA 3B3WA 2B3VA 3IO1A 2Z10A 1IOIA 1QSNA 3FX6A 3KQXA 2PJ6A 4NXYA 3R9GA 4FBEA 2QECA 2R7HA 4EWTA 1CJWA 4X2TA 2V8HA 2B3UA 5CBMA 4R76A 1IYLA 2BOAA 1K4JA 1Y9WA 4R7MA 6CPAA 1QSMA 3B3VA 1S7LA 2PJ4A 3JVNA 4C68A 4PPZA 1MK4A 1QQ9A 1RO5A 1L0CA 4MCRA 4NGNA 5DWNA 1Y0RA 2B5GB 1IU8A 3LMSA 4CAXA 4FAIA 5F47A 2EK8A 2NMTA 4YFJA 2JEWA 2Q7SA 3RYOA 1YR0A 5HH1A 1VHOA 2B4DA 3PZJA 3BI1A 2B5GA 4TWEA 1S7KA 1AMPA 1YVOA 4E8OA 2PE3A 3E0KA 4FD7A 4P4FA 1MJAA 3IWEA 4UEEA 1Z8LA 2B58A 2EO8A 2PJ5A 2ZELA 3GY9A 4LUAA 2IJZA 3WR7A 4OADA 2GANA 4DUKA 3UY5A 3FEDA 3EY5A 4XPLA 1FNOA 4CAVA 3QAYA 4A95A 3MN8A 4CYPA 1TIQA 4KVOE 3EC4A 2J8NA 5HVHA 2ZEOA 1ZO0A 2G3AA 4UWJA 4ZY0A 4C2ZA 2HUZA 4ZYQA 1CP6A 4ZBGA 4O23A 4AXVA 4JXQA 5LYDA 3H8EA 2Z3OA 2ZW6A 4CRZB 1NE9A 4XPDC 4H6UA 3FVLA 4OAEA 3SXOA 2GIVA 2O4HA 4FD5A 3FNCA 1ARLA 2Q7BA 3KI9A 4JD6A 4KOSA 3ISXA 4R8FA 1ARMA 1KWMA 1P0HA 1S3ZA 2CNSA 1I12A 4LQ6A 5H86A 3TTHA 2Z3MA 1TF9A 1YGHA 2AFZA 3SI2A 4BBHA 3W91A 4U9YA 4F0YA 3FF3A 2YNCA 4NGQA 5KTCA 1Z9UA 2VQYA 2G3TA 4A32A 3FXTA 3I3GA 2P6GA 4IUSA 2KCWA 3CXSA 5LRGA 5JH9A 2PJ0A 2VBQA 2PJ9A 2FT0A 3GUXA 3DLJA 1XMTA 2HQYA 1XFOA 3QAHA 2PSWA 1TXRA 4R9MA 2Q51A 4JZ0A 4M6IA 1B87A 4L89A 3IU1A 5F09A 4OC5A 3LODA 2ZEMA 4OC0A 1HDQA 5LYIA 4A38A 2V8VA 4U5YA 3BXMA 2JDDA 1NMTA 4PXDA 1F57A 5JQ4A 3SJFA 2XEIA 1BPNA 4CYOA 1WWZA 2FVGA 4R57A 1KUYA 3IU2A 3IWWA 5I0CA 3H8GA 5H84A 1Y0YA 4Q36A 1U6MA 1V0CA 3KR4A 1TKJA 2RC4A 4KOTA 2QMLA 2HB6A 4QC6A 4C2XA 2I79A 3G8WA 4MBUA 3S6FA 4KOYA 1M4IA 2VEZA 3FEEA 2CTBA 4GS4A 1UWYA 2F7VA 1VHSA 2J8RA 2XEJA 4F8ZA 1X10A 2PJ3A 1Z2LA 2Q04A 1CX8A 3FBUA 4R3LA 4ZX8A 4CAEA 2CNTA 4NGSA 2PR1A 4Y49B 4GM5A 4FWUA 4B12A 2H5MA 2FSRA 4WJBA 2ZPAA 3ZZIA 1ZG7A 5EMIA 4KSIA 3NE8A 3FJUA 1Z4EA 4CRYB 3FIXA 3A9LA 2Q4YA 4UF4A 4QUSA 2CF4A 2DF5A 1SQHA 3S6GA 4Q7AA 3PBEA 2GE3A 3GB0A 4P6YA 4OC4A 3K9UA 5HXDA 3WC5A 2V77A 3H8FA 3TX8A 2QYVA 4FD4A 4U9ZA 3RO0A 3WT4A 4PK3A 4GXHA 2PQ8A 4KOXA 3KHXA 4E2AA 5J1QA 1KZFA 1YW4A 2NYQA 1IOFA 4A30A 2ZEGA 3D3SA 2EK9A 2B4BA 2O53A 3GLJA 2REEA 3PFEA 2CXAA 3DGVA 3GYAA 3KZWA 3LACA 3MRUA 4KUAA 2IL4A 3SHPA 2FS5A 4KOWA 4P4IA 4EMEA 4NJRA 1FT7A 4II9A 3IFEA 4HNWB 3TO9A 3ZJ0A 1IGBA 2HC9A 4UWIA 1WK4A 1Y7EA 4KSFA 1TKHA 4CPAA 5JM6A 5ISVA 5AGEA 2JBJA 1PYTB 4CS0B 2VI7A 2AJ6A 4MFZA 1YLEA 4KVXA 3H4QA
chains in the Genus database with same CATH topology
5IV0A 1BO4A 4A33A 4NEXA 2B4DB 4MHDA 4B5PB 4MFQA 3DSBA 2BSWA 4R87A 3T9YA 4NSQA 1Y7RA 4B5PA 2ZW4A 4NCZA 1P4NA 2WSAA 3IWGA 3F0AA 4QVTA 1MJBA 4B5OA 3TFYA 2X7BA 1XE4A 3EO4A 2JDCA 2PRBA 4C7HA 3JUWA 1S5KA 2YNDA 4M3SA 5FVJA 4JXRA 4B11A 4I49A 5G21A 4MJ8A 2ZW7A 5G20A 4QBJA 4PK2A 2EUIA 2OH1A 3DR6A 5EC4A 1QSRA 3F5BA 3GKRA 3F8KA 3TOBA 3TE4A 1Z4RA 2G0BA 4XNHC 1S7FA 4RI1A 3DNSA 1ON0A 2OZHA 4KORA 1IYKA 4UBRA 3R1KA 2Z3PA 2R8VA 4YRHA 2OZGA 2Y0MA 3R96A 3BJ7A 4M85A 2OB0A 3TO6A 1BOBA 2BUEA 4CAWA 4UA3A 4UCPA 5BWAB 2F5IA 3LD2A 5C88A 4CYNA 3DR8A 5AG7A 4KUBA 4KLVA 3W6SA 5AG4A 3S6KA 3G3SA 3D8PA 3CXPA 4C2YA 2Q44A 4AB7A 5J8FA 1XF8A 2J8MA 2D4PA 1CM0A 5DWMA 3FYNA 4CYQA 2FCKA 5KTAA 2AE6A 4UFXA 4AVCA 1IICA 4JWPA 5G22A 4QB9A 4A2ZA 1YX0A 3BLNA 4CGOA 4KS9A 2FXFA 3R9FA 4C7IA 3TO7A 1YREA 2Z3KA 2Q4VA 4Q38A 1M4GA 2VZZA 3EXNA 4MFPA 4AG7A 3PGPA 2FL4A 5F48A 5G1ZA 2D4OA 3T90A 3H5ZA 2R1IA 3NE7A 4UCMA 4IF5A 5IB0A 1S7NA 2I00A 2JLMA 1I21A 2BEIA 1Q2YA 4K30A 4EVYA 4JJXA 4MY0A 4X5KA 5AG6A 2YNEA 1YK3A 5GCNA 2QIRA 3D2MA 4CGMA 2BL1A 2Z11A 2K5TA 4BMHA 2R98A 4H6ZA 4MY3A 2A4NA 3IGRA 3I9SA 4DNCA 4UFWA 1XEBA 2ATRA 4OLLA 2ZW5A 1XIXA 2HV2A 4XPDB 4XNHB 1IIDA 3R95A 5HMNA 2P6EA 4HNYB 4KZTA 3P2FA 4PV6A 1Y9KA 4F0XA 2FIAA 1Q2DA 5IX3A 1IB1E 1S60A 4MFKA 5J8CA 3PP9A 2PDOA 5AG5A 3TT2A 4CGNA 5JPHA 2PR8A 3W6XA 3TCVA 2Z3LA 4A31A 2OU2A 2FE7A 4KVME 2DPTA 2P6FA 3OWCA 2JEVA 1J4JA 4B13A 4B10A 2C27A 4KSAA 3VWDA 4F6AA 3N7ZA 1NSLA 3S6HA 4AVBA 2O28A 3R9EA 5EBVA 4HNXB 1QSTA 4ONUA 3JTKA 1M1DA 5A27A 2VZYA 5A28A 1LRZA 3BJ8A 4YGOA 3B8GA 3V8IA 1N71A 2WPXA 2Q0YA 1M4DA 1MJ9A 4XPKA 4KOVA 5KTDA 2ARHA 1QSOA 4MFJA 4NF1A 1KUXA 5F46A 2CY2A 4J3GA 4AG9A 1YVKA 1PU9A 1M44A 3FB3A 2DPSA 1FY7A 2YNCC 4MFLA 3TOAA 3CXQA 2FIWA 3DDDA 4AVAA 4R3KA 3SXNA 4PSWA 4B14A 4UCNA 4JLYA 4E0AA 3FRMA 3MGDA 2OZUA 1KUVA 4CGPA 1I1DA 4HKFA 2Z3NA 1Q2CA 4RS2A 4CGLA 4LX9A 3QB8A 4PSXA 3VWEA 5C82A 2EVNA 3EFAA 1UFHA 2P0WA 5F49A 1GHEA 4KLWA 1PUAA 2CNMA 5CNPA 3D2PA 4UFVA 3P2HA 1R57A 2REFA 4FD6A 4L8AA 3C26A 2WPWA 4ORFA 4CAFA 2DXQA 2PC1A 2Z0ZA 5E96A 1RXTA 1OZPA 4H89A 1VKCA 2YGWA 4MI4A 2ZXVA 3KKWA 2WUUA 2VXKA 4Y49C 1B6BA 4KOUA 2B3VA 2Z10A 3R9GA 1QSNA 4NXYA 2QECA 2R7HA 1CJWA 2B3UA 1IYLA 1K4JA 1Y9WA 1QSMA 1S7LA 3JVNA 4C68A 1MK4A 1RO5A 5DWNA 1L0CA 4ZGYB 2B5GB 4CAXA 5F47A 2NMTA 4YFJA 3RYOA 1YR0A 5HH1A 2B4DA 3PZJA 2B5GA 1S7KA 1YVOA 4E8OA 3E0KA 4FD7A 1MJAA 3IWEA 2B58A 3GY9A 4LUAA 3WR7A 4OADA 2GANA 3UY5A 3EY5A 4XPLA 4CAVA 4A95A 4CYPA 1TIQA 4KVOE 3EC4A 2J8NA 1ZO0A 2G3AA 4UWJA 4C2ZA 2HUZA 4ZBGA 4JXQA 2Z3OA 2ZW6A 4CRZB 1NE9A 4XPDC 4H6UA 4OAEA 3SXOA 2GIVA 4FD5A 2Q7BA 3FNCA 4JD6A 4KOSA 1P0HA 1S3ZA 2CNSA 1I12A 5H86A 3TTHA 4BBHA 2Z3MA 1YGHA 3W91A 4U9YA 4F0YA 2YNCA 5KTCA 1Z9UA 2VQYA 2G3TA 4A32A 3FXTA 3I3GA 2P6GA 4IUSA 2KCWA 3CXSA 2VBQA 2FT0A 1XMTA 2HQYA 3QAHA 2PSWA 4R9MA 1B87A 4L89A 3IU1A 3LODA 4U5YA 2JDDA 1NMTA 5JQ4A 4CYOA 1WWZA 4R57A 1KUYA 3IU2A 5I0CA 5H84A 4Q36A 1U6MA 1V0CA 2RC4A 4KOTA 2QMLA 4QC6A 4C2XA 2I79A 3G8WA 4MBUA 3S6FA 4KOYA 1M4IA 2VEZA 4GS4A 1VHSA 2J8RA 2Q04A 4R3LA 3FBUA 4CAEA 2CNTA 2PR1A 4Y49B 4B12A 2H5MA 2FSRA 2ZPAA 3ZZIA 1Z4EA 4CRYB 3FIXA 3A9LA 2Q4YA 4QUSA 3S6GA 1SQHA 2GE3A 3K9UA 4FD4A 4U9ZA 4PK3A 2PQ8A 4KOXA 4E2AA 1KZFA 4A30A 3D3SA 2B4BA 2REEA 2CXAA 3GYAA 4KUAA 2IL4A 3SHPA 2FS5A 4KOWA 4II9A 4HNWB 3TO9A 3ZJ0A 4UWIA 1WK4A 5ISVA 4KSFA 5AGEA 4CS0B 2VI7A 2AJ6A 4MFZA 1YLEA 4KVXA 3H4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IV0 A;  1BO4 A;  4NEX A;  2B4D B;  4MHD A;  4B5P B;  3DSB A;  2BSW A;  4R87 A;  3T9Y A;  4NSQ A;  1Y7R A;  4B5P A;  2ZW4 A;  4NCZ A;  1P4N A;  3IWG A;  3F0A A;  4QVT A;  1MJB A;  3TFY A;  2X7B A;  1XE4 A;  3EO4 A;  2JDC A;  2PRB A;  3JUW A;  1S5K A;  4M3S A;  5FVJ A;  4JXR A;  4I49 A;  4MJ8 A;  2ZW7 A;  4QBJ A;  4PK2 A;  2EUI A;  2OH1 A;  3DR6 A;  5EC4 A;  1QSR A;  3F5B A;  3GKR A;  3F8K A;  3TOB A;  3TE4 A;  1Z4R A;  2G0B A;  4XNH C;  1S7F A;  4RI1 A;  3DNS A;  1ON0 A;  2OZH A;  4KOR A;  1IYK A;  4UBR A;  3R1K A;  2R8V A;  4YRH A;  2OZG A;  2Y0M A;  3R96 A;  3BJ7 A;  4M85 A;  2OB0 A;  3TO6 A;  1BOB A;  2BUE A;  4CAW A;  4UA3 A;  5C88 A;  2F5I A;  3LD2 A;  3DR8 A;  3W6S A;  4KUB A;  4KLV A;  3S6K A;  3G3S A;  3D8P A;  3CXP A;  2Q44 A;  4AB7 A;  5J8F A;  1XF8 A;  2J8M A;  2D4P A;  1CM0 A;  5DWM A;  3FYN A;  2FCK A;  5KTA A;  2AE6 A;  4AVC A;  1IIC A;  4JWP A;  4QB9 A;  1YX0 A;  3BLN A;  2FXF A;  3R9F A;  3TO7 A;  1YRE A;  2Q4V A;  1M4G A;  2VZZ A;  3EXN A;  4AG7 A;  3PGP A;  2FL4 A;  5F48 A;  2D4O A;  3T90 A;  2R1I A;  3NE7 A;  4IF5 A;  5IB0 A;  1S7N A;  2I00 A;  2JLM A;  1I21 A;  2BEI A;  1Q2Y A;  4K30 A;  4EVY A;  4JJX A;  4MY0 A;  4X5K A;  1YK3 A;  5GCN A;  2QIR A;  3D2M A;  2BL1 A;  2Z11 A;  2K5T A;  4BMH A;  2R98 A;  4H6Z A;  4MY3 A;  2A4N A;  3IGR A;  3I9S A;  4DNC A;  1XEB A;  2ATR A;  4OLL A;  2ZW5 A;  1XIX A;  2HV2 A;  4XPD B;  4XNH B;  1IID A;  3R95 A;  5HMN A;  2P6E A;  4HNY B;  4KZT A;  3P2F A;  4PV6 A;  1Y9K A;  2FIA A;  1Q2D A;  5IX3 A;  1IB1 E;  1S60 A;  5J8C A;  3PP9 A;  2PDO A;  3TT2 A;  5JPH A;  2PR8 A;  3W6X A;  3TCV A;  2OU2 A;  2FE7 A;  4KVM E;  2P6F A;  3OWC A;  2JEV A;  1J4J A;  2C27 A;  3VWD A;  4F6A A;  3N7Z A;  1NSL A;  3S6H A;  4AVB A;  2O28 A;  3R9E A;  5EBV A;  4HNX B;  1QST A;  4ONU A;  1M1D A;  2VZY A;  1LRZ A;  3BJ8 A;  4YGO A;  3B8G A;  3V8I A;  1N71 A;  2WPX A;  2Q0Y A;  1M4D A;  1MJ9 A;  4XPK A;  4KOV A;  5KTD A;  2ARH A;  1QSO A;  4NF1 A;  1KUX A;  5F46 A;  2CY2 A;  4J3G A;  4AG9 A;  1YVK A;  1PU9 A;  1M44 A;  3FB3 A;  1FY7 A;  3TOA A;  3CXQ A;  2FIW A;  3DDD A;  4AVA A;  4R3K A;  3SXN A;  4PSW A;  4JLY A;  4E0A A;  3FRM A;  3MGD A;  2OZU A;  1KUV A;  1I1D A;  4HKF A;  1Q2C A;  4RS2 A;  4LX9 A;  3QB8 A;  4PSX A;  3VWE A;  5C82 A;  2EVN A;  3EFA A;  1UFH A;  2P0W A;  5F49 A;  1GHE A;  4KLW A;  1PUA A;  2CNM A;  5CNP A;  3D2P A;  3P2H A;  1R57 A;  2REF A;  4FD6 A;  4L8A A;  3C26 A;  2WPW A;  4ORF A;  2DXQ A;  2PC1 A;  2Z0Z A;  5E96 A;  1RXT A;  1OZP A;  4H89 A;  1VKC A;  4MI4 A;  2ZXV A;  3KKW A;  2VXK A;  4Y49 C;  1B6B A;  4KOU A;  2B3V A;  2Z10 A;  3R9G A;  1QSN A;  4NXY A;  2QEC A;  2R7H A;  1CJW A;  2B3U A;  1IYL A;  1K4J A;  1Y9W A;  1QSM A;  1S7L A;  3JVN A;  1MK4 A;  1RO5 A;  5DWN A;  1L0C A;  2B5G B;  4CAX A;  5F47 A;  2NMT A;  4YFJ A;  3RYO A;  1YR0 A;  5HH1 A;  2B4D A;  3PZJ A;  2B5G A;  1S7K A;  1YVO A;  4E8O A;  3E0K A;  4FD7 A;  1MJA A;  2B58 A;  3GY9 A;  4LUA A;  3WR7 A;  4OAD A;  2GAN A;  3UY5 A;  3EY5 A;  4XPL A;  4CAV A;  1TIQ A;  4KVO E;  3EC4 A;  2J8N A;  2G3A A;  4UWJ A;  2HUZ A;  4ZBG A;  4JXQ A;  2ZW6 A;  4CRZ B;  1NE9 A;  4XPD C;  4H6U A;  4OAE A;  3SXO A;  2GIV A;  4FD5 A;  2Q7B A;  3FNC A;  4JD6 A;  4KOS A;  1P0H A;  1S3Z A;  2CNS A;  1I12 A;  5H86 A;  3TTH A;  1YGH A;  3W91 A;  4U9Y A;  4F0Y A;  5KTC A;  1Z9U A;  2VQY A;  2G3T A;  3FXT A;  3I3G A;  2P6G A;  4IUS A;  2KCW A;  3CXS A;  2VBQ A;  2FT0 A;  1XMT A;  2HQY A;  3QAH A;  2PSW A;  4R9M A;  1B87 A;  4L89 A;  3LOD A;  4U5Y A;  2JDD A;  1NMT A;  5JQ4 A;  1WWZ A;  4R57 A;  1KUY A;  5I0C A;  5H84 A;  1U6M A;  1V0C A;  2RC4 A;  4KOT A;  2QML A;  4QC6 A;  2I79 A;  3G8W A;  4MBU A;  3S6F A;  4KOY A;  1M4I A;  2VEZ A;  4GS4 A;  1VHS A;  2J8R A;  2Q04 A;  4R3L A;  3FBU A;  2CNT A;  2PR1 A;  4Y49 B;  2H5M A;  2FSR A;  2ZPA A;  3ZZI A;  1Z4E A;  4CRY B;  3FIX A;  2Q4Y A;  4QUS A;  3S6G A;  1SQH A;  2GE3 A;  3K9U A;  4FD4 A;  4U9Z A;  4PK3 A;  2PQ8 A;  4KOX A;  4E2A A;  1KZF A;  3D3S A;  2B4B A;  2REE A;  3GYA A;  4KUA A;  2IL4 A;  3SHP A;  2FS5 A;  4KOW A;  4II9 A;  4HNW B;  3TO9 A;  3ZJ0 A;  4UWI A;  1WK4 A;  5ISV A;  4CS0 B;  2VI7 A;  2AJ6 A;  4B5O A;  1YLE A;  4KVX A;  3H4Q A; 
#chains in the Genus database with same CATH topology
 5IV0 A;  1BO4 A;  4FUU A;  4A33 A;  4NEX A;  2B4D B;  4MHD A;  5K8O A;  4B5P B;  3ISZ A;  4MFQ A;  3DSB A;  4MCP A;  3NA6 A;  2BSW A;  3I1U A;  3KR5 A;  1VIX A;  3PBB A;  3SJX A;  1A2Z A;  4R87 A;  4OID A;  3PEI A;  3T9Y A;  2ABZ A;  3CZX A;  4NSQ A;  4NGT A;  3V7Z A;  5CPA A;  1Y7R A;  3B35 A;  3SI0 A;  4B5P A;  2AFU A;  2NSM A;  2ZW4 A;  3B3S A;  4NJQ A;  4ZY1 A;  4NCZ A;  1P4N A;  4UIA A;  2WSA A;  1LCP A;  2F8H A;  3F0A A;  3IWG A;  2DEA A;  1MJB A;  4QVT A;  4B5O A;  3TFY A;  2GLF A;  2X7B A;  1XE4 A;  3EO4 A;  2JDC A;  2PRB A;  2ZEE A;  3FEC A;  2PJA A;  4ZX9 A;  4C7H A;  5LYF A;  3JRU A;  4MMO A;  3JUW A;  1S5K A;  2YND A;  4M3S A;  1R43 A;  3LWU A;  5FVJ A;  1LFW A;  4JXR A;  1ELL P;  4B11 A;  1DTD A;  4I49 A;  3PB4 X;  5G21 A;  4MJ8 A;  3D68 A;  1M4L A;  2ZW7 A;  5G20 A;  4G1P A;  3QNV A;  1ZLI A;  3B2Y A;  4QBJ A;  4PK2 A;  1CG2 A;  2G9D A;  5DS0 A;  2EUI A;  2OH1 A;  3DR6 A;  5EC4 A;  5THW A;  4UEF A;  1QSR A;  2PJ8 A;  1ZG8 A;  1LAM A;  3F5B A;  3F8K A;  3GKR A;  4P4J A;  3TOB A;  2V8D A;  3TE4 A;  1Z4R A;  2G0B A;  4XNH C;  1S7F A;  3D66 A;  4OKO A;  5D8N A;  3VAT A;  1Z8W A;  4RI1 A;  1F2P A;  3DNS A;  3KHZ A;  1ON0 A;  2OZH A;  4PXE A;  4KOR A;  2ZOF A;  1IYK A;  4H2K A;  3B3T A;  4UBR A;  4IHM A;  1Z5R A;  3R1K A;  4MHZ A;  2Z3P A;  2R8V A;  3D7D A;  5LRK A;  4YRH A;  2OZG A;  1HDU A;  2Y0M A;  3NH5 A;  3R96 A;  3BJ7 A;  4M85 A;  2OB0 A;  2ODF A;  3TO6 A;  1BOB A;  2BUE A;  2PJ1 A;  1LAP A;  2QJ8 A;  4UA3 A;  4UCP A;  4CAW A;  2F5I A;  3LD2 A;  1X12 A;  5BWA B;  5C88 A;  2EWB A;  1AYE A;  4CYN A;  3DR8 A;  3GIU A;  5AG7 A;  4KUB A;  4KLV A;  3W6S A;  4M6H A;  5AG4 A;  2ZOG A;  3S6K A;  3WC6 A;  1TF8 A;  4P45 A;  3FMC A;  3G3S A;  3D8P A;  4YWY A;  5JGF A;  3CXP A;  4C2Y A;  4P10 A;  2C6P A;  2Q44 A;  2POK A;  4AB7 A;  1ZLH A;  4OC3 A;  5J8F A;  3D4U A;  1GYT A;  1XF8 A;  2J8M A;  2D4P A;  4ZI6 A;  1CM0 A;  5DWM A;  2PJC A;  3FYN A;  2GFQ A;  3K9T A;  3IEH A;  4CYQ A;  1JWQ A;  2FCK A;  5KTA A;  1BAV A;  2AE6 A;  4UFX A;  4AVC A;  1BLL E;  1IIC A;  4JWP A;  2Q43 A;  3NH4 A;  3VAR A;  5G22 A;  4QB9 A;  4A2Z A;  1YX0 A;  4PQA A;  2EBJ A;  2PVV A;  2PCU A;  2V8G A;  3BLN A;  4CGO A;  4KS9 A;  2FXF A;  2ZED A;  2XEG A;  3R9F A;  4C7I A;  3TO7 A;  1YRE A;  2JBK A;  2Z3K A;  2ZEH A;  2Q4V A;  2RB7 A;  4Q38 A;  1M4G A;  2VZZ A;  3EXN A;  4MFP A;  4AG7 A;  4DJL A;  3PGP A;  4ZY2 A;  7CPA A;  2FL4 A;  5F48 A;  5G1Z A;  3D7F A;  2D4O A;  1IY7 A;  4DYO A;  2C1C A;  1YLO A;  3H5Z A;  2R1I A;  3NE7 A;  4UCM A;  3T90 A;  3S9L A;  3CDX A;  4IF5 A;  4PXB A;  5IB0 A;  1XBU A;  4NGR A;  1TKF A;  1S7N A;  1XMB A;  2I00 A;  2JLM A;  1I21 A;  2BEI A;  3L2N A;  1Q2Y A;  4K30 A;  4X3R A;  3SI1 A;  4EVY A;  2C6G A;  3D7G A;  4RN7 A;  4JJX A;  4MY0 A;  3WAB A;  1YW6 A;  3N5F A;  4X5K A;  5AG6 A;  5HVG A;  2YNE A;  2AFX A;  2CIJ A;  4OC2 A;  1YK3 A;  4M6G A;  5GCN A;  2QIR A;  4MRI A;  3D2M A;  4CGM A;  3PRT A;  1EE3 P;  2BL1 A;  2Z11 A;  5LRJ A;  2K5T A;  3IIB A;  2R98 A;  3PB8 X;  4H6Z A;  4BMH A;  4MY3 A;  2GRE A;  2A4N A;  3IGR A;  2WYR A;  1VGY A;  5IB9 A;  3I9S A;  1XRY A;  4DNC A;  2PJ2 A;  4UFW A;  1XEB A;  2ATR A;  4A94 A;  4OLL A;  2ZW5 A;  1YSJ A;  1XIX A;  1LOK A;  2HV2 A;  2AFS A;  2PVW A;  4XPD B;  1H8L A;  4XNH B;  1IID A;  3R95 A;  5HMN A;  4JYW A;  3D67 A;  2P6E A;  4HNY B;  4NGP A;  4KZT A;  3P2F A;  4RUH A;  4PV6 A;  2AFO A;  1Y9K A;  5HVF A;  4MHN A;  4IK2 A;  2PRQ A;  2AFW A;  4BD9 A;  4OME A;  2WZN A;  4F0X A;  2FIA A;  3VH9 A;  1Q2D A;  1CP7 A;  5IX3 A;  1IB1 E;  1S60 A;  4MFK A;  2C6C A;  3SJE A;  4X8I A;  3FH4 A;  5J8C A;  3PP9 A;  2PDO A;  1CPS A;  5AG5 A;  1DE4 C;  3TT2 A;  4CGN A;  1ELM P;  3HUV A;  4OP4 A;  1PCA A;  3NH8 A;  5JPH A;  2PR8 A;  4MXU A;  3RZA A;  4F9V A;  3K2K A;  1CBX A;  4NFR A;  3W6X A;  8CPA A;  3KGQ A;  3TCV A;  2Z3L A;  4A31 A;  1ZG9 A;  2OU2 A;  2FE7 A;  3PB6 X;  5K8N A;  1VHE A;  4KVM E;  4YU9 A;  4MCS A;  3KL9 A;  4UEZ A;  2OR4 A;  1JQG A;  3CT9 A;  2DPT A;  2P6F A;  3OWC A;  2PIY A;  2PJB A;  2RFH A;  3S9M A;  2JEV A;  4ONW A;  3V38 A;  1CPX A;  1J4J A;  3CPA A;  3HLP A;  4B10 A;  4B13 A;  4P4E A;  4A39 A;  2C27 A;  1NSA A;  4KSA A;  3VWD A;  4F6A A;  3N7Z A;  1NSL A;  3S6H A;  4AVB A;  2O28 A;  3R9E A;  5EBV A;  4HNX B;  1HEE A;  2BCO A;  1QST A;  4IAV A;  5D29 A;  4EFD A;  4ONU A;  5ELY A;  3JTK A;  1M1D A;  5A27 A;  2VZY A;  5A28 A;  3RAM A;  1LRZ A;  2PJ7 A;  4OC1 A;  3BJ8 A;  4MHY A;  4YGO A;  5K8M A;  3B8G A;  1XOV A;  3V8I A;  1N71 A;  3B3C A;  4P4B A;  2WPX A;  1QMU A;  1M4D A;  1MJ9 A;  2AFM A;  2Q0Y A;  4XPK A;  4KOV A;  1AUG A;  5KTD A;  2ARH A;  1QSO A;  4MFJ A;  4NF1 A;  1KUX A;  4WWV A;  2GU2 A;  3SJG A;  5F46 A;  1XJO A;  2CY2 A;  4J3G A;  4AG9 A;  4OIW A;  1YVK A;  1PU9 A;  2ZEN A;  4TNU A;  4P4D A;  1M44 A;  3FB3 A;  2DPS A;  1FY7 A;  1F2O A;  2YNC C;  3BHX A;  4MFL A;  4UIB A;  3IC1 A;  3TOA A;  4MHP A;  4ZGY B;  5I4M A;  1LAN A;  4LQG A;  1BPM A;  3CXQ A;  2FIW A;  3DDD A;  4AVA A;  4BIN A;  4MCQ A;  4R3K A;  5K8P A;  4P44 A;  4PSW A;  3SXN A;  4UCN A;  4B14 A;  4JLY A;  4E0A A;  3FRM A;  3MGD A;  1YQE A;  3RNZ A;  5LYL A;  2OZU A;  1KUV A;  4CGP A;  2J9A A;  1I1D A;  4HKF A;  2Z3N A;  3WC7 A;  1Q2C A;  4RS2 A;  4CGL A;  4LX9 A;  3QB8 A;  2VL1 A;  4PSX A;  3VWE A;  2ZEP A;  2PIZ A;  5C82 A;  2EVN A;  3EFA A;  1UFH A;  3KAS A;  2P0W A;  2BO9 A;  4NGM A;  5F49 A;  1GHE A;  3BI0 A;  4KLW A;  1PUA A;  2CNM A;  3D7H A;  3NFZ A;  1Z8X A;  5CNP A;  3D2P A;  3S9N A;  4PXC A;  1Z8T A;  4UFV A;  3IJ3 A;  3P2H A;  1R57 A;  4B6Z A;  4Z65 A;  2IMO A;  4HPS A;  1YME A;  2REF A;  2GLJ A;  2ZEF A;  3PFO A;  3C26 A;  2WPW A;  4FD6 A;  4L8A A;  4ORF A;  4CAF A;  2DXQ A;  1RTQ A;  3PB9 X;  2Q4Z A;  3RBU A;  2IQ6 A;  2XEF A;  4W9Y A;  2PC1 A;  3TC8 A;  2Z0Z A;  2QVP A;  3KQZ A;  5E96 A;  1RXT A;  1OZP A;  4H89 A;  2OOT A;  3B7I A;  1VKC A;  2YGW A;  4MI4 A;  3PB7 X;  4F9U A;  3T8W A;  2ANP A;  2CTC A;  4A37 A;  1OBR A;  1Q7L A;  2ZXV A;  3KKW A;  2WUU A;  2VXK A;  4Y49 C;  1R3N A;  3CPX A;  1B6B A;  4R6T A;  2I3C A;  4K3N A;  4KOU A;  3B3W A;  2B3V A;  3IO1 A;  2Z10 A;  1IOI A;  1QSN A;  3FX6 A;  3KQX A;  2PJ6 A;  4NXY A;  3R9G A;  4FBE A;  2QEC A;  2R7H A;  4EWT A;  1CJW A;  4X2T A;  2V8H A;  2B3U A;  5CBM A;  4R76 A;  1IYL A;  2BOA A;  1K4J A;  1Y9W A;  4R7M A;  6CPA A;  1QSM A;  3B3V A;  1S7L A;  2PJ4 A;  3JVN A;  4C68 A;  4PPZ A;  1MK4 A;  1QQ9 A;  1RO5 A;  1L0C A;  4MCR A;  4NGN A;  5DWN A;  1Y0R A;  2B5G B;  1IU8 A;  3LMS A;  4CAX A;  4FAI A;  5F47 A;  2EK8 A;  2NMT A;  4YFJ A;  2JEW A;  2Q7S A;  3RYO A;  1YR0 A;  5HH1 A;  1VHO A;  2B4D A;  3PZJ A;  3BI1 A;  2B5G A;  4TWE A;  1S7K A;  1AMP A;  1YVO A;  4E8O A;  2PE3 A;  3E0K A;  4FD7 A;  4P4F A;  1MJA A;  3IWE A;  4UEE A;  1Z8L A;  2B58 A;  2EO8 A;  2PJ5 A;  2ZEL A;  3GY9 A;  4LUA A;  2IJZ A;  3WR7 A;  4OAD A;  2GAN A;  4DUK A;  3UY5 A;  3FED A;  3EY5 A;  4XPL A;  1FNO A;  4CAV A;  3QAY A;  4A95 A;  3MN8 A;  4CYP A;  1TIQ A;  4KVO E;  3EC4 A;  2J8N A;  5HVH A;  2ZEO A;  1ZO0 A;  2G3A A;  4UWJ A;  4ZY0 A;  4C2Z A;  2HUZ A;  4ZYQ A;  1CP6 A;  4ZBG A;  4O23 A;  4AXV A;  4JXQ A;  5LYD A;  3H8E A;  2Z3O A;  2ZW6 A;  4CRZ B;  1NE9 A;  4XPD C;  4H6U A;  3FVL A;  4OAE A;  3SXO A;  2GIV A;  2O4H A;  4FD5 A;  3FNC A;  1ARL A;  2Q7B A;  3KI9 A;  4JD6 A;  4KOS A;  3ISX A;  4R8F A;  1ARM A;  1KWM A;  1P0H A;  1S3Z A;  2CNS A;  1I12 A;  4LQ6 A;  5H86 A;  3TTH A;  2Z3M A;  1TF9 A;  1YGH A;  2AFZ A;  3SI2 A;  4BBH A;  3W91 A;  4U9Y A;  4F0Y A;  3FF3 A;  2YNC A;  4NGQ A;  5KTC A;  1Z9U A;  2VQY A;  2G3T A;  4A32 A;  3FXT A;  3I3G A;  2P6G A;  4IUS A;  2KCW A;  3CXS A;  5LRG A;  5JH9 A;  2PJ0 A;  2VBQ A;  2PJ9 A;  2FT0 A;  3GUX A;  3DLJ A;  1XMT A;  2HQY A;  1XFO A;  3QAH A;  2PSW A;  1TXR A;  4R9M A;  2Q51 A;  4JZ0 A;  4M6I A;  1B87 A;  4L89 A;  3IU1 A;  5F09 A;  4OC5 A;  3LOD A;  2ZEM A;  4OC0 A;  1HDQ A;  5LYI A;  4A38 A;  2V8V A;  4U5Y A;  3BXM A;  2JDD A;  1NMT A;  4PXD A;  1F57 A;  5JQ4 A;  3SJF A;  2XEI A;  1BPN A;  4CYO A;  1WWZ A;  2FVG A;  4R57 A;  1KUY A;  3IU2 A;  3IWW A;  5I0C A;  3H8G A;  5H84 A;  1Y0Y A;  4Q36 A;  1U6M A;  1V0C A;  3KR4 A;  1TKJ A;  2RC4 A;  4KOT A;  2QML A;  2HB6 A;  4QC6 A;  4C2X A;  2I79 A;  3G8W A;  4MBU A;  3S6F A;  4KOY A;  1M4I A;  2VEZ A;  3FEE A;  2CTB A;  4GS4 A;  1UWY A;  2F7V A;  1VHS A;  2J8R A;  2XEJ A;  4F8Z A;  1X10 A;  2PJ3 A;  1Z2L A;  2Q04 A;  1CX8 A;  3FBU A;  4R3L A;  4ZX8 A;  4CAE A;  2CNT A;  4NGS A;  2PR1 A;  4Y49 B;  4GM5 A;  4FWU A;  4B12 A;  2H5M A;  2FSR A;  4WJB A;  2ZPA A;  3ZZI A;  1ZG7 A;  5EMI A;  4KSI A;  3NE8 A;  3FJU A;  1Z4E A;  4CRY B;  3FIX A;  3A9L A;  2Q4Y A;  4UF4 A;  4QUS A;  2CF4 A;  2DF5 A;  1SQH A;  3S6G A;  4Q7A A;  3PBE A;  2GE3 A;  3GB0 A;  4P6Y A;  4OC4 A;  3K9U A;  5HXD A;  3WC5 A;  2V77 A;  3H8F A;  3TX8 A;  2QYV A;  4FD4 A;  4U9Z A;  3RO0 A;  3WT4 A;  4PK3 A;  4GXH A;  2PQ8 A;  4KOX A;  3KHX A;  4E2A A;  5J1Q A;  1KZF A;  1YW4 A;  2NYQ A;  1IOF A;  4A30 A;  2ZEG A;  3D3S A;  2EK9 A;  2B4B A;  2O53 A;  3GLJ A;  2REE A;  3PFE A;  2CXA A;  3DGV A;  3GYA A;  3KZW A;  3LAC A;  3MRU A;  4KUA A;  2IL4 A;  3SHP A;  2FS5 A;  4KOW A;  4P4I A;  4EME A;  4NJR A;  1FT7 A;  4II9 A;  3IFE A;  4HNW B;  3TO9 A;  3ZJ0 A;  1IGB A;  2HC9 A;  4UWI A;  1WK4 A;  1Y7E A;  4KSF A;  1TKH A;  4CPA A;  5JM6 A;  5ISV A;  5AGE A;  2JBJ A;  1PYT B;  4CS0 B;  2VI7 A;  2AJ6 A;  4MFZ A;  1YLE A;  4KVX A;  3H4Q A; 
#chains in the Genus database with same CATH homology
 5IV0 A;  1BO4 A;  4A33 A;  4NEX A;  2B4D B;  4MHD A;  4B5P B;  4MFQ A;  3DSB A;  2BSW A;  4R87 A;  3T9Y A;  4NSQ A;  1Y7R A;  4B5P A;  2ZW4 A;  4NCZ A;  1P4N A;  2WSA A;  3IWG A;  3F0A A;  4QVT A;  1MJB A;  4B5O A;  3TFY A;  2X7B A;  1XE4 A;  3EO4 A;  2JDC A;  2PRB A;  4C7H A;  3JUW A;  1S5K A;  2YND A;  4M3S A;  5FVJ A;  4JXR A;  4B11 A;  4I49 A;  5G21 A;  4MJ8 A;  2ZW7 A;  5G20 A;  4QBJ A;  4PK2 A;  2EUI A;  2OH1 A;  3DR6 A;  5EC4 A;  1QSR A;  3F5B A;  3GKR A;  3F8K A;  3TOB A;  3TE4 A;  1Z4R A;  2G0B A;  4XNH C;  1S7F A;  4RI1 A;  3DNS A;  1ON0 A;  2OZH A;  4KOR A;  1IYK A;  4UBR A;  3R1K A;  2Z3P A;  2R8V A;  4YRH A;  2OZG A;  2Y0M A;  3R96 A;  3BJ7 A;  4M85 A;  2OB0 A;  3TO6 A;  1BOB A;  2BUE A;  4CAW A;  4UA3 A;  4UCP A;  5BWA B;  2F5I A;  3LD2 A;  5C88 A;  4CYN A;  3DR8 A;  5AG7 A;  4KUB A;  4KLV A;  3W6S A;  5AG4 A;  3S6K A;  3G3S A;  3D8P A;  3CXP A;  4C2Y A;  2Q44 A;  4AB7 A;  5J8F A;  1XF8 A;  2J8M A;  2D4P A;  1CM0 A;  5DWM A;  3FYN A;  4CYQ A;  2FCK A;  5KTA A;  2AE6 A;  4UFX A;  4AVC A;  1IIC A;  4JWP A;  5G22 A;  4QB9 A;  4A2Z A;  1YX0 A;  3BLN A;  4CGO A;  4KS9 A;  2FXF A;  3R9F A;  4C7I A;  3TO7 A;  1YRE A;  2Z3K A;  2Q4V A;  4Q38 A;  1M4G A;  2VZZ A;  3EXN A;  4MFP A;  4AG7 A;  3PGP A;  2FL4 A;  5F48 A;  5G1Z A;  2D4O A;  3T90 A;  3H5Z A;  2R1I A;  3NE7 A;  4UCM A;  4IF5 A;  5IB0 A;  1S7N A;  2I00 A;  2JLM A;  1I21 A;  2BEI A;  1Q2Y A;  4K30 A;  4EVY A;  4JJX A;  4MY0 A;  4X5K A;  5AG6 A;  2YNE A;  1YK3 A;  5GCN A;  2QIR A;  3D2M A;  4CGM A;  2BL1 A;  2Z11 A;  2K5T A;  4BMH A;  2R98 A;  4H6Z A;  4MY3 A;  2A4N A;  3IGR A;  3I9S A;  4DNC A;  4UFW A;  1XEB A;  2ATR A;  4OLL A;  2ZW5 A;  1XIX A;  2HV2 A;  4XPD B;  4XNH B;  1IID A;  3R95 A;  5HMN A;  2P6E A;  4HNY B;  4KZT A;  3P2F A;  4PV6 A;  1Y9K A;  4F0X A;  2FIA A;  1Q2D A;  5IX3 A;  1IB1 E;  1S60 A;  4MFK A;  5J8C A;  3PP9 A;  2PDO A;  5AG5 A;  3TT2 A;  4CGN A;  5JPH A;  2PR8 A;  3W6X A;  3TCV A;  2Z3L A;  4A31 A;  2OU2 A;  2FE7 A;  4KVM E;  2DPT A;  2P6F A;  3OWC A;  2JEV A;  1J4J A;  4B13 A;  4B10 A;  2C27 A;  4KSA A;  3VWD A;  4F6A A;  3N7Z A;  1NSL A;  3S6H A;  4AVB A;  2O28 A;  3R9E A;  5EBV A;  4HNX B;  1QST A;  4ONU A;  3JTK A;  1M1D A;  5A27 A;  2VZY A;  5A28 A;  1LRZ A;  3BJ8 A;  4YGO A;  3B8G A;  3V8I A;  1N71 A;  2WPX A;  2Q0Y A;  1M4D A;  1MJ9 A;  4XPK A;  4KOV A;  5KTD A;  2ARH A;  1QSO A;  4MFJ A;  4NF1 A;  1KUX A;  5F46 A;  2CY2 A;  4J3G A;  4AG9 A;  1YVK A;  1PU9 A;  1M44 A;  3FB3 A;  2DPS A;  1FY7 A;  2YNC C;  4MFL A;  3TOA A;  3CXQ A;  2FIW A;  3DDD A;  4AVA A;  4R3K A;  3SXN A;  4PSW A;  4B14 A;  4UCN A;  4JLY A;  4E0A A;  3FRM A;  3MGD A;  2OZU A;  1KUV A;  4CGP A;  1I1D A;  4HKF A;  2Z3N A;  1Q2C A;  4RS2 A;  4CGL A;  4LX9 A;  3QB8 A;  4PSX A;  3VWE A;  5C82 A;  2EVN A;  3EFA A;  1UFH A;  2P0W A;  5F49 A;  1GHE A;  4KLW A;  1PUA A;  2CNM A;  5CNP A;  3D2P A;  4UFV A;  3P2H A;  1R57 A;  2REF A;  4FD6 A;  4L8A A;  3C26 A;  2WPW A;  4ORF A;  4CAF A;  2DXQ A;  2PC1 A;  2Z0Z A;  5E96 A;  1RXT A;  1OZP A;  4H89 A;  1VKC A;  2YGW A;  4MI4 A;  2ZXV A;  3KKW A;  2WUU A;  2VXK A;  4Y49 C;  1B6B A;  4KOU A;  2B3V A;  2Z10 A;  3R9G A;  1QSN A;  4NXY A;  2QEC A;  2R7H A;  1CJW A;  2B3U A;  1IYL A;  1K4J A;  1Y9W A;  1QSM A;  1S7L A;  3JVN A;  4C68 A;  1MK4 A;  1RO5 A;  5DWN A;  1L0C A;  4ZGY B;  2B5G B;  4CAX A;  5F47 A;  2NMT A;  4YFJ A;  3RYO A;  1YR0 A;  5HH1 A;  2B4D A;  3PZJ A;  2B5G A;  1S7K A;  1YVO A;  4E8O A;  3E0K A;  4FD7 A;  1MJA A;  3IWE A;  2B58 A;  3GY9 A;  4LUA A;  3WR7 A;  4OAD A;  2GAN A;  3UY5 A;  3EY5 A;  4XPL A;  4CAV A;  4A95 A;  4CYP A;  1TIQ A;  4KVO E;  3EC4 A;  2J8N A;  1ZO0 A;  2G3A A;  4UWJ A;  4C2Z A;  2HUZ A;  4ZBG A;  4JXQ A;  2Z3O A;  2ZW6 A;  4CRZ B;  1NE9 A;  4XPD C;  4H6U A;  4OAE A;  3SXO A;  2GIV A;  4FD5 A;  2Q7B A;  3FNC A;  4JD6 A;  4KOS A;  1P0H A;  1S3Z A;  2CNS A;  1I12 A;  5H86 A;  3TTH A;  4BBH A;  2Z3M A;  1YGH A;  3W91 A;  4U9Y A;  4F0Y A;  2YNC A;  5KTC A;  1Z9U A;  2VQY A;  2G3T A;  4A32 A;  3FXT A;  3I3G A;  2P6G A;  4IUS A;  2KCW A;  3CXS A;  2VBQ A;  2FT0 A;  1XMT A;  2HQY A;  3QAH A;  2PSW A;  4R9M A;  1B87 A;  4L89 A;  3IU1 A;  3LOD A;  4U5Y A;  2JDD A;  1NMT A;  5JQ4 A;  4CYO A;  1WWZ A;  4R57 A;  1KUY A;  3IU2 A;  5I0C A;  5H84 A;  4Q36 A;  1U6M A;  1V0C A;  2RC4 A;  4KOT A;  2QML A;  4QC6 A;  4C2X A;  2I79 A;  3G8W A;  4MBU A;  3S6F A;  4KOY A;  1M4I A;  2VEZ A;  4GS4 A;  1VHS A;  2J8R A;  2Q04 A;  4R3L A;  3FBU A;  4CAE A;  2CNT A;  2PR1 A;  4Y49 B;  4B12 A;  2H5M A;  2FSR A;  2ZPA A;  3ZZI A;  1Z4E A;  4CRY B;  3FIX A;  3A9L A;  2Q4Y A;  4QUS A;  3S6G A;  1SQH A;  2GE3 A;  3K9U A;  4FD4 A;  4U9Z A;  4PK3 A;  2PQ8 A;  4KOX A;  4E2A A;  1KZF A;  4A30 A;  3D3S A;  2B4B A;  2REE A;  2CXA A;  3GYA A;  4KUA A;  2IL4 A;  3SHP A;  2FS5 A;  4KOW A;  4II9 A;  4HNW B;  3TO9 A;  3ZJ0 A;  4UWI A;  1WK4 A;  5ISV A;  4KSF A;  5AGE A;  4CS0 B;  2VI7 A;  2AJ6 A;  4MFZ A;  1YLE A;  4KVX A;  3H4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...