3FIXA

Crystal structure of a putative n-acetyltransferase (ta0374) from thermoplasma acidophilum
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
165
structure length
165
Chain Sequence
YFQSNAMSIEIRKLSIEDLETLIEVARESWKWTYAGIYSEEYIESWIREKYSKEKLLNEIVRSQSNLDILFLGAFADSTLIGFIELKIIANKAELLRLYLKPEYTHKKIGKTLLLEAEKIMKKKGILECRLYVHRQNSVGFSFYYKNGFKVEDTDGSDFIMEKKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N-ACETYLTRANSFERASE
publication title Crystal structure of the novel PaiA N-acetyltransferase from Thermoplasma acidophilum involved in the negative control of sporulation and degradative enzyme production.
pubmed doi rcsb
source organism Thermoplasma acidophilum
total genus 53
structure length 165
sequence length 165
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2008-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3fixA00
2GE3A 4M3SA 2Z0ZA 3WR7A 1S7FA 3I3GA 1I21A 2PRBA 2PQ8A 2R98A 2FS5A 4OADA 3R96A 1Q2CA 2JDDA 4CRZB 4MY0A 1RXTA 4H89A 4CAVA 3E0KA 4RS2A 2BUEA 4R3LA 2J8NA 3P2HA 4R57A 1YREA 5DWMA 5IX3A 4RI1A 1QSMA 3I9SA 3R1KA 2Y0MA 3SXNA 2HQYA 5KTDA 1B6BA 5GCNA 2PSWA 3IGRA 4CAXA 4U9YA 2JLMA 1S7LA 1UFHA 2B58A 2G3AA 2REEA 3C26A 2KCWA 5JQ4A 2OZUA 4AVAA 3TO9A 3CXSA 1IYLA 5HH1A 4NSQA 1MJAA 4AG9A 2ZW6A 3SXOA 4QBJA 1S7KA 2B3VA 4YFJA 4BMHA 4U5YA 2VEZA 3QB8A 4OAEA 2J8MA 3ZJ0A 1B87A 2ARHA 3PZJA 1LRZA 1NSLA 2BEIA 2R1IA 4R9MA 3TTHA 3CXQA 3W6XA 5DWNA 3FIXA 4H6UA 1XIXA 2I00A 1BO4A 3DDDA 3FNCA 4B5OA 3MGDA 3G8WA 4KOYA 2VXKA 1NE9A 2Z10A 2FIWA 1PU9A 1U6MA 3F8KA 3TCVA 3DR8A 4QUSA 3R95A 2VZZA 2GIVA 1VKCA 1YVOA 2PDOA 4HNXB 3GY9A 4NF1A 2B4BA 1Y7RA 1PUAA 3W6SA 2Q0YA 1FY7A 4ONUA 1WK4A 5CNPA 4B5PB 4KOTA 3F0AA 2G0BA 2B5GA 4JJXA 5F48A 3TOBA 4Y49C 2IL4A 1NMTA 2JDCA 3B8GA 1Z4EA 3ZZIA 2R8VA 4L89A 1YR0A 4H6ZA 5EC4A 5JPHA 1R57A 2OZHA 5H86A 4DNCA 3P2FA 1XE4A 4UWIA 3RYOA 3D3SA 2REFA 2P6EA 4QB9A 2AE6A 4AB7A 4HNYB 3GKRA 4PK3A 4AVCA 3DNSA 2B4DB 4UWJA 2GANA 2ATRA 2CNSA 4E8OA 2DXQA 4KVXA 1SQHA 1YVKA 2AJ6A 1S60A 4KOUA 2VBQA 3W91A 1XMTA 4II9A 4ZBGA 4MY3A 1MJBA 1S5KA 2FSRA 2OB0A 3DR6A 4FD5A 4R3KA 4Y49B 2CY2A 3S6HA 3FBUA 4KVME 4JXQA 3TT2A 4LX9A 2G3TA 4ORFA 4QC6A 3SHPA 1YGHA 3EY5A 3T9YA 4KOWA 4GS4A 4UA3A 4I49A 4KVOE 1N71A 3D8PA 4HKFA 1KUXA 2P0WA 3EC4A 1XEBA 3PGPA 4UBRA 1M4IA 3TFYA 2CNMA 2Q7BA 4YGOA 1QSNA 2CNTA 3EFAA 3TOAA 2VZYA 1J4JA 3D2MA 4FD4A 2FXFA 1BOBA 5F46A 4KORA 1OZPA 4KLVA 4JLYA 1YK3A 2VQYA 4NCZA 2JEVA 3IWGA 1Q2YA 4PV6A 4CRYB 3T90A 1V0CA 3G3SA 3TO7A 4PSXA 4KOXA 4U9ZA 2P6FA 3KKWA 2OH1A 2FE7A 1ON0A 4PSWA 1QSOA 2PC1A 5EBVA 2ZW7A 3VWEA 5IB0A 4L8AA 2X7BA 1I1DA 2PR8A 2Z11A 2EUIA 3S6GA 4QVTA 4AVBA 2HUZA 3NE7A 1M4DA 4JXRA 4E2AA 1CJWA 5J8FA 4XPDC 4J3GA 1MJ9A 4AG7A 2ZPAA 3VWDA 2K5TA 1IB1E 4MJ8A 1MK4A 1TIQA 4XPKA 5C82A 3S6KA 5KTAA 4F6AA 3F5BA 3V8IA 3D2PA 1Q2DA 1M4GA 3GYAA 2BSWA 2I79A 1S7NA 4K30A 5H84A 5J8CA 2D4PA 3LD2A 4KZTA 2Q4YA 3EXNA 4LUAA 2WPXA 2FT0A 2C27A 5F47A 4MHDA 5ISVA 2PR1A 1M1DA 2P6GA 2NMTA 3K9UA 2B3UA 2ZW5A 4JD6A 1M44A 2H5MA 1XF8A 2QIRA 2QMLA 4FD7A 2R7HA 3FB3A 4NEXA 5KTCA 4IF5A 3BJ7A 3BLNA 2O28A 3BJ8A 4JWPA 4XPDB 4X5KA 2F5IA 3QAHA 1KUVA 3UY5A 1Z9UA 4F0YA 1KUYA 2OU2A 1IYKA 3FYNA 4KUAA 1L0CA 3TO6A 3FRMA 3R9EA 1Y9WA 4B5PA 2BL1A 4KLWA 4M85A 3DSBA 1I12A 4R87A 2HV2A 5E96A 1Z4RA 3JUWA 2FL4A 1K4JA 1P0HA 3PP9A 2ZW4A 2EVNA 4XPLA 4HNWB 4PK2A 2OZGA 2B5GB 2VI7A 2Q44A 1RO5A 3OWCA 5C88A 4KOSA 3LODA 2B4DA 1GHEA 3R9GA 2J8RA 4CAWA 4YRHA 4MBUA 3S6FA 4XNHC 2Q04A 2FCKA 3TE4A 2WPWA 3JVNA 4OLLA 5HMNA 3H4QA 1VHSA 5I0CA 1YLEA 2Q4VA 2RC4A 3EO4A 3N7ZA 1Y9KA 3R9FA 2A4NA 1S3ZA 1P4NA 5FVJA 1IIDA 4MI4A 2D4OA 1WWZA 1QSTA 2FIAA 4NXYA 5IV0A 4KOVA 4IUSA 4EVYA 4E0AA 3CXPA 4FD6A 3FXTA 1QSRA 1IICA 4KUBA 5F49A 2ZXVA 4CS0B 1CM0A 2QECA 1YX0A 1KZFA 4XNHB
chains in the Genus database with same CATH superfamily
2PJ3A 2GE3A 3H8FA 4M3SA 4UCPA 2ZENA 2BCOA 2Z0ZA 4MHZA 3PB4X 2PIZA 4R6TA 3WR7A 4R7MA 3GB0A 5G1ZA 3HLPA 1PCAA 1S7FA 4W9YA 2QJ8A 3I3GA 1I21A 1KWMA 2PRBA 2PQ8A 5DS0A 1XJOA 3VARA 2R98A 5ELYA 2FS5A 4X8IA 2PE3A 4OADA 3R96A 1Q2CA 2JDDA 2PJBA 3TOBA 3D7HA 2PJ1A 3QAYA 4CRZB 2EO8A 4MY0A 3QNVA 3TX8A 1RXTA 3KR4A 4H89A 1ZG8A 3E0KA 4RS2A 4CAVA 2AFUA 5D29A 2BUEA 4R3LA 3BI1A 2J8NA 3P2HA 1ZLIA 2BO9A 5G22A 4OIWA 4R57A 1YREA 4A38A 4CGMA 4A94A 2PJ6A 4TWEA 4MFQA 5DWMA 2AFZA 2JBJA 5IX3A 4RI1A 5A27A 1QSMA 3I9SA 3R1KA 1TXRA 2ZEEA 2PJCA 2Y0MA 3CT9A 4EMEA 3SXNA 3FEDA 2POKA 2ZEOA 2HQYA 1BAVA 1DTDA 5KTDA 1B6BA 5GCNA 2PSWA 5G20A 1PYTB 3IGRA 4CAXA 4U9YA 3IIBA 4GXHA 2JLMA 1Z8XA 1S7LA 1IY7A 3S9MA 1H8LA 1UFHA 3B3CA 2B58A 4M6IA 2G3AA 2REEA 3C26A 2KCWA 2WYRA 1CBXA 2AFMA 2Z3NA 4B10A 5JQ4A 4NGSA 2OZUA 3A9LA 4P44A 4AVAA 3TO9A 3CXSA 3HUVA 1IYLA 5HH1A 4NSQA 5HVGA 3CZXA 3KHZA 4NGMA 1MJAA 4Q7AA 4AG9A 2C6PA 2ZW6A 3SXOA 3MRUA 4QBJA 4OIDA 3NFZA 1S7KA 1IOIA 4B11A 2B3VA 2AFSA 4P4EA 4RN7A 4NGTA 5K8MA 4YFJA 3IFEA 4BMHA 4U5YA 2Z3KA 2VEZA 3QB8A 4NGPA 4X3RA 4CYOA 4ZY1A 3RBUA 4MXUA 4OAEA 3KGQA 2PJ8A 2J8MA 3ZJ0A 3FH4A 2F8HA 3VH9A 1B87A 2FVGA 2ARHA 3PBEA 4MMOA 3PZJA 1LRZA 4A37A 4YU9A 2EK9A 4B12A 1NSLA 2VL1A 4IK2A 4AXVA 2XEFA 3B3VA 4GM5A 3S9NA 2BEIA 1QMUA 3ISZA 2DPSA 2R1IA 4R9MA 3V38A 3TTHA 3CXQA 3W6XA 4A95A 5DWNA 4Z65A 3LWUA 2AFWA 1R43A 4Q36A 3FIXA 4H6UA 4A31A 4F9UA 2YNEA 1Z8TA 4OC3A 4C7HA 1XIXA 1TF8A 2J9AA 2I00A 3KQXA 4KS9A 1M4LA 1BO4A 3DDDA 3FNCA 5CPAA 4B5OA 1XFOA 3D68A 3DGVA 3G8WA 3MGDA 4KOYA 1NE9A 2VXKA 2NSMA 3SJXA 2Z10A 1LANA 1OBRA 5K8OA 4M6GA 2FIWA 1YW4A 4P10A 1PU9A 1U6MA 3F8KA 3TCVA 2G9DA 4B13A 1LOKA 3PB7X 2GFQA 2Z3LA 3DR8A 3TC8A 4QUSA 1TKJA 3R95A 3CPAA 2GLJA 1ELMP 5IV0A 2VZZA 2GIVA 5LYFA 1AYEA 3D66A 1VKCA 5AG7A 4C2YA 5K8PA 1YVOA 3FMCA 2PDOA 4HNXB 4YWYA 3GY9A 1DE4C 4NF1A 1YMEA 2B4BA 1Y7RA 1PUAA 1Q7LA 3IEHA 4PXEA 3W6SA 1NSAA 1FY7A 2OR4A 2Q0YA 4ONUA 1WK4A 3H8EA 5CNPA 2YNCC 4OC4A 4B5PB 4MFJA 2WUUA 4KOTA 3F0AA 3KL9A 4F0XA 4NGRA 3WC5A 2G0BA 2B5GA 2PJ0A 3PB9X 3PFOA 4JJXA 5F48A 4Y49C 1Y7EA 2IL4A 2IQ6A 1NMTA 1CP6A 3RAMA 4MFLA 2JDCA 3B8GA 4C2ZA 1Z4EA 3ZZIA 2R8VA 4L89A 1YR0A 4H6ZA 4CYPA 4DUKA 5EC4A 2ZEHA 1R57A 2OZHA 5H86A 4DNCA 1HDQA 4UF4A 5JH9A 5JPHA 3P2FA 4JZ0A 2YGWA 5LYDA 1XE4A 2NYQA 5K8NA 4UWIA 1BPMA 3RYOA 4CAEA 5CBMA 4CAFA 2PRQA 7CPAA 3D3SA 1A2ZA 2REFA 4OMEA 2V8HA 2P6EA 2O4HA 4QB9A 2ODFA 5LYIA 2AE6A 4AB7A 4CGNA 4HNYB 2Z3PA 3GKRA 4P6YA 4P4DA 4PK3A 4AVCA 3DNSA 3NE8A 2B4DB 4UWJA 2GANA 2OOTA 2ATRA 2CNSA 4C7IA 4E8OA 2DXQA 5A28A 1LAPA 2Z3OA 4KVXA 1SQHA 1YVKA 3BHXA 4H2KA 4UCMA 5HXDA 2PJ4A 2GLFA 2AJ6A 4KSFA 1S60A 1X12A 4KOUA 2VBQA 3IU1A 3W91A 1XMTA 3JTKA 5LRGA 4II9A 4BBHA 4ZBGA 5LYLA 1FT7A 2ZEFA 4MY3A 1MJBA 1S5KA 2FSRA 2OB0A 3DR6A 3GLJA 3KR5A 4FD5A 4MHNA 4MCRA 2CY2A 4R3KA 4Y49B 4B6ZA 4ZI6A 3S6HA 2CXAA 1EE3P 3FBUA 4JXQA 4KVME 3TT2A 4LX9A 2C6GA 2G3TA 1VHOA 2ZEPA 4KSAA 4ORFA 4QC6A 4UFVA 1LAMA 3SHPA 2PJAA 2ANPA 1YGHA 3EY5A 4MCPA 3T9YA 3CDXA 4KOWA 4GS4A 1Y0RA 4I49A 4UA3A 3VATA 2AFOA 3PB8X 4NFRA 4KVOE 1N71A 4MFZA 4UEZA 4CYNA 3D8PA 4HKFA 1KUXA 2P0WA 4UIBA 4LQ6A 5AGEA 3EC4A 6CPAA 2ZOGA 4R8FA 1XEBA 3PGPA 4ONWA 4UBRA 1M4IA 5IB9A 3TFYA 3KHXA 5THWA 3B3WA 2CNMA 4K3NA 2Q7BA 1VHEA 3N5FA 1QSNA 4YGOA 4UFWA 4OP4A 2V8DA 2Q7SA 2CNTA 2WZNA 3SJFA 3EFAA 4KSIA 3TOAA 2VZYA 2WSAA 1J4JA 2PVWA 3D7GA 3PEIA 5LRKA 3D2MA 4FD4A 3FEEA 2FXFA 1ARMA 1HDUA 1BOBA 4MHPA 4C2XA 5F46A 4KORA 1OZPA 4KLVA 3B2YA 4JLYA 1YK3A 2VQYA 4NCZA 2JEVA 4P4JA 3IWGA 1Q2YA 4OKOA 4PV6A 1QQ9A 4CRYB 3T90A 1V0CA 3G3SA 1R3NA 1XBUA 3L2NA 4PSXA 3TO7A 4F8ZA 4KOXA 2DF5A 3K2KA 4A32A 4U9ZA 2P6FA 3KKWA 1ZG9A 2OH1A 2FE7A 4MCQA 2V77A 4MFPA 4IAVA 1ON0A 1TKFA 2YNCA 2QVPA 3WC7A 2XEIA 4R76A 4PSWA 2RB7A 4LQGA 1QSOA 3KZWA 5F09A 2PC1A 4MFKA 5EBVA 2ZW7A 1AMPA 3VWEA 5IB0A 4CGOA 4C68A 4L8AA 2X7BA 1I1DA 4IHMA 1CPSA 1ELLP 2PR8A 2Z11A 4TNUA 3T8WA 3WABA 4A39A 2F7VA 2PCUA 2EUIA 3B35A 3S6GA 2ZOFA 2DEAA 1CX8A 2ZEMA 4OC0A 1X10A 2HUZA 1ZLHA 3NE7A 1M4DA 4JXRA 4QVTA 4AVBA 1CG2A 4ZY2A 3D7FA 2EWBA 2O53A 4E2AA 1CP7A 1CJWA 5J8FA 2XEJA 4XPDC 4ZYQA 2PJ7A 4J3GA 1MJ9A 4G1PA 4O23A 4AG7A 2ZPAA 2QYVA 1YW6A 3FVLA 3VWDA 2K5TA 1IB1E 4MJ8A 1MK4A 1F57A 2DPTA 4NGQA 1TIQA 4OC1A 4XPKA 3WC6A 4RUHA 5C82A 4UFXA 3NH4A 4A2ZA 3S6KA 3D4UA 4F6AA 2ABZA 3F5BA 3V8IA 1ARLA 4DYOA 1TKHA 1Q2DA 3D2PA 5JGFA 1M4GA 3GYAA 3CPXA 4Q38A 4PXCA 2BSWA 2I79A 1LCPA 1XMBA 1S7NA 4K30A 5H84A 1Y0YA 5J8CA 1YSJA 2D4PA 3LD2A 4KZTA 2EBJA 2IMOA 5KTAA 3SI1A 2Q4YA 3PRTA 2PJ5A 3EXNA 4LUAA 5G21A 2WPXA 2FT0A 2C27A 3IO1A 3PFEA 2C1CA 3K9TA 4WJBA 5F47A 3IJ3A 4MHDA 5ISVA 2ZEDA 2PR1A 4NJRA 1M1DA 3RZAA 2P6GA 2NMTA 3K9UA 2B3UA 2ZW5A 4JD6A 2HB6A 1M44A 2H5MA 1XF8A 2QIRA 2QMLA 1XRYA 4FD7A 2R7HA 2V8VA 3FB3A 3GUXA 4NEXA 5AG6A 5KTCA 4IF5A 4P4IA 3BJ7A 3RO0A 3BLNA 2V8GA 2O28A 2CTCA 3BJ8A 4JWPA 4XPDB 4X5KA 4B14A 3ISXA 4FUUA 4UEFA 2F5IA 3D67A 2PVVA 3H8GA 1KUVA 2EK8A 3PB6X 3QAHA 3H5ZA 3UY5A 1BLLE 1Z8WA 1YLOA 5JM6A 1JQGA 1Z9UA 2GREA 3IWWA 5LRJA 2JBKA 2PIYA 1Z2LA 4F0YA 4UCNA 1KUYA 2OU2A 3LACA 1IYKA 3LMSA 5BWAB 3FYNA 2AFXA 4KUAA 1L0CA 1XOVA 4P4FA 1GYTA 3TO6A 3KQZA 3FRMA 2RFHA 4M6HA 1Y9WA 3R9EA 1ZO0A 2GU2A 4B5PA 4CGPA 2BL1A 4KLWA 1YQEA 1VGYA 4OC5A 4M85A 3DSBA 3PBBA 3IWEA 3DLJA 1I12A 4R87A 4ZX8A 2HV2A 4MCSA 4A30A 2YNDA 3BI0A 5E96A 1Z4RA 2XEGA 3JUWA 2FL4A 1K4JA 1P0HA 3GIUA 3PP9A 1VIXA 4UIAA 1Z8LA 2Q51A 2ZW4A 2HC9A 2EVNA 4XPLA 2ZEGA 4HNWB 5D8NA 1BPNA 4PK2A 2OZGA 1RTQA 2B5GB 3SI0A 1UWYA 2VI7A 1IU8A 1CPXA 1FNOA 2JEWA 3FX6A 3KI9A 2IJZA 2Q44A 1RO5A 3IC1A 4PXDA 4UEEA 1F2OA 3OWCA 5C88A 4KOSA 3B3SA 3LODA 4NJQA 4CYQA 5I4MA 3S9LA 3MN8A 5EMIA 2B4DA 1GHEA 4EWTA 3I1UA 4FWUA 3R9GA 3B3TA 1AUGA 2BOAA 2J8RA 1F2PA 3D7DA 4CAWA 4CPAA 4MRIA 2PJ2A 4YRHA 4FBEA 4MBUA 3S6FA 4XNHC 4PXBA 2Q04A 2CTBA 4CGLA 3B7IA 3SJGA 2CIJA 1JWQA 2FCKA 2WPWA 3NH5A 3TE4A 3JVNA 4OLLA 4MHYA 2I3CA 5HMNA 3NH8A 5J1QA 3SI2A 3FF3A 3H4QA 5AG4A 1VHSA 4P4BA 3SJEA 5I0CA 2ZELA 1YLEA 3BXMA 3NA6A 2C6CA 2Q4VA 2RC4A 4EFDA 5HVFA 4OC2A 3EO4A 3JRUA 3N7ZA 4NGNA 4PQAA 1Y9KA 3R9FA 2A4NA 1S3ZA 1P4NA 2Z3MA 5FVJA 3FECA 5AG5A 4WWVA 1IIDA 4JYWA 4MI4A 2D4OA 1WWZA 1QSTA 2FIAA 2Q43A 1HEEA 4NXYA 3RNZA 3V7ZA 4BD9A 4BINA 4ZY0A 1Z5RA 1TF9A 4KOVA 1LFWA 4IUSA 4DJLA 4EVYA 4E0AA 3CXPA 4FD6A 4HPSA 3FXTA 1IGBA 1QSRA 4FAIA 5HVHA 1IICA 4KUBA 4ZX9A 2Q4ZA 3WT4A 2CF4A 8CPAA 4PPZA 5F49A 2ZXVA 4X2TA 4P45A 4A33A 2PJ9A 1IOFA 1CM0A 3IU2A 1ZG7A 2QECA 3FJUA 4CS0B 1YX0A 4ZGYB 1KZFA 4XNHB 3KASA 4F9VA
chains in the Genus database with same CATH topology
2GE3A 4M3SA 4UCPA 2Z0ZA 3WR7A 5G1ZA 1S7FA 3I3GA 1I21A 2PRBA 2PQ8A 2R98A 2FS5A 4OADA 3R96A 1Q2CA 2JDDA 4CRZB 4MY0A 1RXTA 4H89A 4CAVA 3E0KA 4RS2A 2BUEA 4R3LA 2J8NA 3P2HA 5G22A 4R57A 1YREA 4CGMA 4MFQA 5DWMA 5IX3A 4RI1A 5A27A 1QSMA 3I9SA 3R1KA 2Y0MA 3SXNA 2HQYA 5KTDA 1B6BA 5GCNA 2PSWA 5G20A 3IGRA 4CAXA 4U9YA 2JLMA 1S7LA 1UFHA 2B58A 2G3AA 2REEA 3C26A 2KCWA 2Z3NA 4B10A 5JQ4A 2OZUA 3A9LA 4AVAA 3TO9A 3CXSA 1IYLA 5HH1A 4NSQA 1MJAA 4AG9A 2ZW6A 3SXOA 4QBJA 1S7KA 4B11A 2B3VA 4YFJA 4BMHA 4U5YA 2Z3KA 2VEZA 3QB8A 4CYOA 4OAEA 2J8MA 3ZJ0A 1B87A 2ARHA 3PZJA 1LRZA 4B12A 1NSLA 2BEIA 2DPSA 2R1IA 4R9MA 3TTHA 3CXQA 3W6XA 4A95A 5DWNA 4Q36A 3FIXA 4H6UA 4A31A 2YNEA 4C7HA 1XIXA 2I00A 4KS9A 1BO4A 3DDDA 3FNCA 4B5OA 3MGDA 3G8WA 4KOYA 2VXKA 1NE9A 2Z10A 2FIWA 1PU9A 1U6MA 3F8KA 3TCVA 4B13A 2Z3LA 3DR8A 4QUSA 3R95A 2VZZA 2GIVA 1VKCA 5AG7A 4C2YA 1YVOA 2PDOA 4HNXB 3GY9A 4NF1A 2B4BA 1Y7RA 1PUAA 3W6SA 2Q0YA 1FY7A 4ONUA 1WK4A 5CNPA 2YNCC 4B5PB 4MFJA 2WUUA 4KOTA 3F0AA 4F0XA 2G0BA 2B5GA 4JJXA 5F48A 3TOBA 4Y49C 2IL4A 1NMTA 4MFLA 2JDCA 3B8GA 4C2ZA 1Z4EA 3ZZIA 2R8VA 4L89A 1YR0A 4H6ZA 4CYPA 5EC4A 5JPHA 1R57A 2OZHA 5H86A 4DNCA 3P2FA 2YGWA 1XE4A 4UWIA 3RYOA 4CAEA 4CAFA 3D3SA 2REFA 2P6EA 4QB9A 2AE6A 4AB7A 4CGNA 4HNYB 2Z3PA 3GKRA 4PK3A 4AVCA 3DNSA 2B4DB 4UWJA 2GANA 2ATRA 2CNSA 4C7IA 4E8OA 2DXQA 5A28A 2Z3OA 4KVXA 1SQHA 1YVKA 4UCMA 2AJ6A 4KSFA 1S60A 4KOUA 2VBQA 3IU1A 3W91A 1XMTA 3JTKA 4II9A 4BBHA 4ZBGA 4MY3A 1MJBA 1S5KA 2FSRA 2OB0A 3DR6A 4FD5A 4R3KA 4Y49B 2CY2A 3S6HA 2CXAA 3FBUA 4KVME 4JXQA 3TT2A 4LX9A 4KSAA 2G3TA 4ORFA 4QC6A 4UFVA 3SHPA 1YGHA 3EY5A 3T9YA 4KOWA 4GS4A 4UA3A 4I49A 4KVOE 1N71A 4MFZA 4CYNA 3D8PA 4HKFA 1KUXA 2P0WA 5AGEA 3EC4A 1XEBA 3PGPA 4UBRA 1M4IA 3TFYA 2CNMA 2Q7BA 4YGOA 1QSNA 4UFWA 2CNTA 3EFAA 3TOAA 2VZYA 2WSAA 1J4JA 3D2MA 4FD4A 2FXFA 1BOBA 4C2XA 5F46A 4KORA 1OZPA 4KLVA 4JLYA 1YK3A 2VQYA 4NCZA 2JEVA 3IWGA 1Q2YA 4PV6A 4CRYB 3T90A 1V0CA 3G3SA 3TO7A 4PSXA 4KOXA 4A32A 4U9ZA 2P6FA 3KKWA 2OH1A 2FE7A 4MFPA 1ON0A 2YNCA 4PSWA 1QSOA 2PC1A 4MFKA 5EBVA 2ZW7A 3VWEA 5IB0A 4CGOA 4C68A 4L8AA 2X7BA 1I1DA 2PR8A 2Z11A 2EUIA 3S6GA 4QVTA 4AVBA 2HUZA 3NE7A 1M4DA 4JXRA 4E2AA 1CJWA 5J8FA 4XPDC 4J3GA 1MJ9A 4AG7A 2ZPAA 3VWDA 2K5TA 1IB1E 4MJ8A 1MK4A 2DPTA 1TIQA 4XPKA 5C82A 4UFXA 4A2ZA 3S6KA 5KTAA 4F6AA 3F5BA 3V8IA 3D2PA 1Q2DA 1M4GA 3GYAA 4Q38A 2BSWA 2I79A 1S7NA 4K30A 5H84A 5J8CA 2D4PA 3LD2A 4KZTA 2Q4YA 3EXNA 4LUAA 5G21A 2WPXA 2FT0A 2C27A 5F47A 4MHDA 5ISVA 2PR1A 1M1DA 2P6GA 2NMTA 3K9UA 2B3UA 2ZW5A 4JD6A 1M44A 2H5MA 1XF8A 2QIRA 2QMLA 4FD7A 2R7HA 3FB3A 4NEXA 5AG6A 5KTCA 4IF5A 3BJ7A 3BLNA 2O28A 3BJ8A 4JWPA 4XPDB 4X5KA 4B14A 2F5IA 3QAHA 1KUVA 3H5ZA 3UY5A 1Z9UA 4F0YA 1KUYA 2OU2A 1IYKA 5BWAB 3FYNA 4KUAA 1L0CA 3TO6A 3FRMA 3R9EA 1Y9WA 1ZO0A 4B5PA 4CGPA 2BL1A 4KLWA 4M85A 3DSBA 3IWEA 1I12A 4R87A 4A30A 2HV2A 2YNDA 5E96A 1Z4RA 3JUWA 2FL4A 1K4JA 1P0HA 3PP9A 2ZW4A 2EVNA 4XPLA 4HNWB 4PK2A 2OZGA 2B5GB 2VI7A 4UCNA 2Q44A 1RO5A 3OWCA 5C88A 4KOSA 4CYQA 3LODA 2B4DA 1GHEA 3R9GA 2J8RA 4CAWA 4YRHA 4MBUA 3S6FA 4XNHC 2Q04A 4CGLA 2FCKA 3TE4A 2WPWA 3JVNA 4OLLA 5HMNA 3H4QA 5AG4A 1VHSA 5I0CA 1YLEA 2Q4VA 2RC4A 3EO4A 3N7ZA 1Y9KA 3R9FA 2A4NA 1S3ZA 1P4NA 2Z3MA 5FVJA 5AG5A 1IIDA 4MI4A 2D4OA 1WWZA 1QSTA 2FIAA 4NXYA 5IV0A 4KOVA 4IUSA 4EVYA 4E0AA 3CXPA 4FD6A 3FXTA 1QSRA 1IICA 4KUBA 5F49A 2ZXVA 4A33A 3IU2A 4CS0B 1CM0A 2QECA 1YX0A 4ZGYB 1KZFA 4XNHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GE3 A;  4M3S A;  2Z0Z A;  3WR7 A;  1S7F A;  3I3G A;  1I21 A;  2PRB A;  2PQ8 A;  2R98 A;  2FS5 A;  4OAD A;  3R96 A;  1Q2C A;  2JDD A;  4CRZ B;  4MY0 A;  1RXT A;  4H89 A;  4CAV A;  3E0K A;  4RS2 A;  2BUE A;  4R3L A;  2J8N A;  3P2H A;  4R57 A;  1YRE A;  5DWM A;  5IX3 A;  4RI1 A;  1QSM A;  3I9S A;  3R1K A;  2Y0M A;  3SXN A;  2HQY A;  5KTD A;  1B6B A;  5GCN A;  2PSW A;  3IGR A;  4CAX A;  4U9Y A;  2JLM A;  1S7L A;  1UFH A;  2B58 A;  2G3A A;  2REE A;  3C26 A;  2KCW A;  5JQ4 A;  2OZU A;  4AVA A;  3TO9 A;  3CXS A;  1IYL A;  5HH1 A;  4NSQ A;  1MJA A;  4AG9 A;  2ZW6 A;  3SXO A;  4QBJ A;  1S7K A;  2B3V A;  4YFJ A;  4BMH A;  4U5Y A;  2VEZ A;  3QB8 A;  4OAE A;  2J8M A;  3ZJ0 A;  1B87 A;  2ARH A;  3PZJ A;  1LRZ A;  1NSL A;  2BEI A;  2R1I A;  4R9M A;  3TTH A;  3CXQ A;  3W6X A;  5DWN A;  3FIX A;  4H6U A;  1XIX A;  2I00 A;  1BO4 A;  3DDD A;  3FNC A;  4B5O A;  3MGD A;  3G8W A;  4KOY A;  2VXK A;  1NE9 A;  2Z10 A;  2FIW A;  1PU9 A;  1U6M A;  3F8K A;  3TCV A;  3DR8 A;  4QUS A;  3R95 A;  2VZZ A;  2GIV A;  1VKC A;  1YVO A;  2PDO A;  4HNX B;  3GY9 A;  4NF1 A;  2B4B A;  1Y7R A;  1PUA A;  3W6S A;  2Q0Y A;  1FY7 A;  4ONU A;  1WK4 A;  5CNP A;  4B5P B;  4KOT A;  3F0A A;  2G0B A;  2B5G A;  4JJX A;  5F48 A;  3TOB A;  4Y49 C;  2IL4 A;  1NMT A;  2JDC A;  3B8G A;  1Z4E A;  3ZZI A;  2R8V A;  4L89 A;  1YR0 A;  4H6Z A;  5EC4 A;  5JPH A;  1R57 A;  2OZH A;  5H86 A;  4DNC A;  3P2F A;  1XE4 A;  4UWI A;  3RYO A;  3D3S A;  2REF A;  2P6E A;  4QB9 A;  2AE6 A;  4AB7 A;  4HNY B;  3GKR A;  4PK3 A;  4AVC A;  3DNS A;  2B4D B;  4UWJ A;  2GAN A;  2ATR A;  2CNS A;  4E8O A;  2DXQ A;  4KVX A;  1SQH A;  1YVK A;  2AJ6 A;  1S60 A;  4KOU A;  2VBQ A;  3W91 A;  1XMT A;  4II9 A;  4ZBG A;  4MY3 A;  1MJB A;  1S5K A;  2FSR A;  2OB0 A;  3DR6 A;  4FD5 A;  4R3K A;  4Y49 B;  2CY2 A;  3S6H A;  3FBU A;  4KVM E;  4JXQ A;  3TT2 A;  4LX9 A;  2G3T A;  4ORF A;  4QC6 A;  3SHP A;  1YGH A;  3EY5 A;  3T9Y A;  4KOW A;  4GS4 A;  4UA3 A;  4I49 A;  4KVO E;  1N71 A;  3D8P A;  4HKF A;  1KUX A;  2P0W A;  3EC4 A;  1XEB A;  3PGP A;  4UBR A;  1M4I A;  3TFY A;  2CNM A;  2Q7B A;  4YGO A;  1QSN A;  2CNT A;  3EFA A;  3TOA A;  2VZY A;  1J4J A;  3D2M A;  4FD4 A;  2FXF A;  1BOB A;  5F46 A;  4KOR A;  1OZP A;  4KLV A;  4JLY A;  1YK3 A;  2VQY A;  4NCZ A;  2JEV A;  3IWG A;  1Q2Y A;  4PV6 A;  4CRY B;  3T90 A;  1V0C A;  3G3S A;  3TO7 A;  4PSX A;  4KOX A;  4U9Z A;  2P6F A;  3KKW A;  2OH1 A;  2FE7 A;  1ON0 A;  4PSW A;  1QSO A;  2PC1 A;  5EBV A;  2ZW7 A;  3VWE A;  5IB0 A;  4L8A A;  2X7B A;  1I1D A;  2PR8 A;  2Z11 A;  2EUI A;  3S6G A;  4QVT A;  4AVB A;  2HUZ A;  3NE7 A;  1M4D A;  4JXR A;  4E2A A;  1CJW A;  5J8F A;  4XPD C;  4J3G A;  1MJ9 A;  4AG7 A;  2ZPA A;  3VWD A;  2K5T A;  1IB1 E;  4MJ8 A;  1MK4 A;  1TIQ A;  4XPK A;  5C82 A;  3S6K A;  5KTA A;  4F6A A;  3F5B A;  3V8I A;  3D2P A;  1Q2D A;  1M4G A;  3GYA A;  2BSW A;  2I79 A;  1S7N A;  4K30 A;  5H84 A;  5J8C A;  2D4P A;  3LD2 A;  4KZT A;  2Q4Y A;  3EXN A;  4LUA A;  2WPX A;  2FT0 A;  2C27 A;  5F47 A;  4MHD A;  5ISV A;  2PR1 A;  1M1D A;  2P6G A;  2NMT A;  3K9U A;  2B3U A;  2ZW5 A;  4JD6 A;  1M44 A;  2H5M A;  1XF8 A;  2QIR A;  2QML A;  4FD7 A;  2R7H A;  3FB3 A;  4NEX A;  5KTC A;  4IF5 A;  3BJ7 A;  3BLN A;  2O28 A;  3BJ8 A;  4JWP A;  4XPD B;  4X5K A;  2F5I A;  3QAH A;  1KUV A;  3UY5 A;  1Z9U A;  4F0Y A;  1KUY A;  2OU2 A;  1IYK A;  3FYN A;  4KUA A;  1L0C A;  3TO6 A;  3FRM A;  3R9E A;  1Y9W A;  4B5P A;  2BL1 A;  4KLW A;  4M85 A;  3DSB A;  1I12 A;  4R87 A;  2HV2 A;  5E96 A;  1Z4R A;  3JUW A;  2FL4 A;  1K4J A;  1P0H A;  3PP9 A;  2ZW4 A;  2EVN A;  4XPL A;  4HNW B;  4PK2 A;  2OZG A;  2B5G B;  2VI7 A;  2Q44 A;  1RO5 A;  3OWC A;  5C88 A;  4KOS A;  3LOD A;  2B4D A;  1GHE A;  3R9G A;  2J8R A;  4CAW A;  4YRH A;  4MBU A;  3S6F A;  4XNH C;  2Q04 A;  2FCK A;  3TE4 A;  2WPW A;  3JVN A;  4OLL A;  5HMN A;  3H4Q A;  1VHS A;  5I0C A;  1YLE A;  2Q4V A;  2RC4 A;  3EO4 A;  3N7Z A;  1Y9K A;  3R9F A;  2A4N A;  1S3Z A;  1P4N A;  5FVJ A;  1IID A;  4MI4 A;  2D4O A;  1WWZ A;  1QST A;  2FIA A;  4NXY A;  5IV0 A;  4KOV A;  4IUS A;  4EVY A;  4E0A A;  3CXP A;  4FD6 A;  3FXT A;  1QSR A;  1IIC A;  4KUB A;  5F49 A;  2ZXV A;  4CS0 B;  1CM0 A;  2QEC A;  1YX0 A;  1KZF A;  4XNH B; 
#chains in the Genus database with same CATH topology
 2PJ3 A;  2GE3 A;  3H8F A;  4M3S A;  4UCP A;  2ZEN A;  2BCO A;  2Z0Z A;  4MHZ A;  3PB4 X;  2PIZ A;  4R6T A;  3WR7 A;  4R7M A;  3GB0 A;  5G1Z A;  3HLP A;  1PCA A;  1S7F A;  4W9Y A;  2QJ8 A;  3I3G A;  1I21 A;  1KWM A;  2PRB A;  2PQ8 A;  5DS0 A;  1XJO A;  3VAR A;  2R98 A;  5ELY A;  2FS5 A;  4X8I A;  2PE3 A;  4OAD A;  3R96 A;  1Q2C A;  2JDD A;  2PJB A;  3TOB A;  3D7H A;  2PJ1 A;  3QAY A;  4CRZ B;  2EO8 A;  4MY0 A;  3QNV A;  3TX8 A;  1RXT A;  3KR4 A;  4H89 A;  1ZG8 A;  3E0K A;  4RS2 A;  4CAV A;  2AFU A;  5D29 A;  2BUE A;  4R3L A;  3BI1 A;  2J8N A;  3P2H A;  1ZLI A;  2BO9 A;  5G22 A;  4OIW A;  4R57 A;  1YRE A;  4A38 A;  4CGM A;  4A94 A;  2PJ6 A;  4TWE A;  4MFQ A;  5DWM A;  2AFZ A;  2JBJ A;  5IX3 A;  4RI1 A;  5A27 A;  1QSM A;  3I9S A;  3R1K A;  1TXR A;  2ZEE A;  2PJC A;  2Y0M A;  3CT9 A;  4EME A;  3SXN A;  3FED A;  2POK A;  2ZEO A;  2HQY A;  1BAV A;  1DTD A;  5KTD A;  1B6B A;  5GCN A;  2PSW A;  5G20 A;  1PYT B;  3IGR A;  4CAX A;  4U9Y A;  3IIB A;  4GXH A;  2JLM A;  1Z8X A;  1S7L A;  1IY7 A;  3S9M A;  1H8L A;  1UFH A;  3B3C A;  2B58 A;  4M6I A;  2G3A A;  2REE A;  3C26 A;  2KCW A;  2WYR A;  1CBX A;  2AFM A;  2Z3N A;  4B10 A;  5JQ4 A;  4NGS A;  2OZU A;  3A9L A;  4P44 A;  4AVA A;  3TO9 A;  3CXS A;  3HUV A;  1IYL A;  5HH1 A;  4NSQ A;  5HVG A;  3CZX A;  3KHZ A;  4NGM A;  1MJA A;  4Q7A A;  4AG9 A;  2C6P A;  2ZW6 A;  3SXO A;  3MRU A;  4QBJ A;  4OID A;  3NFZ A;  1S7K A;  1IOI A;  4B11 A;  2B3V A;  2AFS A;  4P4E A;  4RN7 A;  4NGT A;  5K8M A;  4YFJ A;  3IFE A;  4BMH A;  4U5Y A;  2Z3K A;  2VEZ A;  3QB8 A;  4NGP A;  4X3R A;  4CYO A;  4ZY1 A;  3RBU A;  4MXU A;  4OAE A;  3KGQ A;  2PJ8 A;  2J8M A;  3ZJ0 A;  3FH4 A;  2F8H A;  3VH9 A;  1B87 A;  2FVG A;  2ARH A;  3PBE A;  4MMO A;  3PZJ A;  1LRZ A;  4A37 A;  4YU9 A;  2EK9 A;  4B12 A;  1NSL A;  2VL1 A;  4IK2 A;  4AXV A;  2XEF A;  3B3V A;  4GM5 A;  3S9N A;  2BEI A;  1QMU A;  3ISZ A;  2DPS A;  2R1I A;  4R9M A;  3V38 A;  3TTH A;  3CXQ A;  3W6X A;  4A95 A;  5DWN A;  4Z65 A;  3LWU A;  2AFW A;  1R43 A;  4Q36 A;  3FIX A;  4H6U A;  4A31 A;  4F9U A;  2YNE A;  1Z8T A;  4OC3 A;  4C7H A;  1XIX A;  1TF8 A;  2J9A A;  2I00 A;  3KQX A;  4KS9 A;  1M4L A;  1BO4 A;  3DDD A;  3FNC A;  5CPA A;  4B5O A;  1XFO A;  3D68 A;  3DGV A;  3G8W A;  3MGD A;  4KOY A;  1NE9 A;  2VXK A;  2NSM A;  3SJX A;  2Z10 A;  1LAN A;  1OBR A;  5K8O A;  4M6G A;  2FIW A;  1YW4 A;  4P10 A;  1PU9 A;  1U6M A;  3F8K A;  3TCV A;  2G9D A;  4B13 A;  1LOK A;  3PB7 X;  2GFQ A;  2Z3L A;  3DR8 A;  3TC8 A;  4QUS A;  1TKJ A;  3R95 A;  3CPA A;  2GLJ A;  1ELM P;  5IV0 A;  2VZZ A;  2GIV A;  5LYF A;  1AYE A;  3D66 A;  1VKC A;  5AG7 A;  4C2Y A;  5K8P A;  1YVO A;  3FMC A;  2PDO A;  4HNX B;  4YWY A;  3GY9 A;  1DE4 C;  4NF1 A;  1YME A;  2B4B A;  1Y7R A;  1PUA A;  1Q7L A;  3IEH A;  4PXE A;  3W6S A;  1NSA A;  1FY7 A;  2OR4 A;  2Q0Y A;  4ONU A;  1WK4 A;  3H8E A;  5CNP A;  2YNC C;  4OC4 A;  4B5P B;  4MFJ A;  2WUU A;  4KOT A;  3F0A A;  3KL9 A;  4F0X A;  4NGR A;  3WC5 A;  2G0B A;  2B5G A;  2PJ0 A;  3PB9 X;  3PFO A;  4JJX A;  5F48 A;  4Y49 C;  1Y7E A;  2IL4 A;  2IQ6 A;  1NMT A;  1CP6 A;  3RAM A;  4MFL A;  2JDC A;  3B8G A;  4C2Z A;  1Z4E A;  3ZZI A;  2R8V A;  4L89 A;  1YR0 A;  4H6Z A;  4CYP A;  4DUK A;  5EC4 A;  2ZEH A;  1R57 A;  2OZH A;  5H86 A;  4DNC A;  1HDQ A;  4UF4 A;  5JH9 A;  5JPH A;  3P2F A;  4JZ0 A;  2YGW A;  5LYD A;  1XE4 A;  2NYQ A;  5K8N A;  4UWI A;  1BPM A;  3RYO A;  4CAE A;  5CBM A;  4CAF A;  2PRQ A;  7CPA A;  3D3S A;  1A2Z A;  2REF A;  4OME A;  2V8H A;  2P6E A;  2O4H A;  4QB9 A;  2ODF A;  5LYI A;  2AE6 A;  4AB7 A;  4CGN A;  4HNY B;  2Z3P A;  3GKR A;  4P6Y A;  4P4D A;  4PK3 A;  4AVC A;  3DNS A;  3NE8 A;  2B4D B;  4UWJ A;  2GAN A;  2OOT A;  2ATR A;  2CNS A;  4C7I A;  4E8O A;  2DXQ A;  5A28 A;  1LAP A;  2Z3O A;  4KVX A;  1SQH A;  1YVK A;  3BHX A;  4H2K A;  4UCM A;  5HXD A;  2PJ4 A;  2GLF A;  2AJ6 A;  4KSF A;  1S60 A;  1X12 A;  4KOU A;  2VBQ A;  3IU1 A;  3W91 A;  1XMT A;  3JTK A;  5LRG A;  4II9 A;  4BBH A;  4ZBG A;  5LYL A;  1FT7 A;  2ZEF A;  4MY3 A;  1MJB A;  1S5K A;  2FSR A;  2OB0 A;  3DR6 A;  3GLJ A;  3KR5 A;  4FD5 A;  4MHN A;  4MCR A;  2CY2 A;  4R3K A;  4Y49 B;  4B6Z A;  4ZI6 A;  3S6H A;  2CXA A;  1EE3 P;  3FBU A;  4JXQ A;  4KVM E;  3TT2 A;  4LX9 A;  2C6G A;  2G3T A;  1VHO A;  2ZEP A;  4KSA A;  4ORF A;  4QC6 A;  4UFV A;  1LAM A;  3SHP A;  2PJA A;  2ANP A;  1YGH A;  3EY5 A;  4MCP A;  3T9Y A;  3CDX A;  4KOW A;  4GS4 A;  1Y0R A;  4I49 A;  4UA3 A;  3VAT A;  2AFO A;  3PB8 X;  4NFR A;  4KVO E;  1N71 A;  4MFZ A;  4UEZ A;  4CYN A;  3D8P A;  4HKF A;  1KUX A;  2P0W A;  4UIB A;  4LQ6 A;  5AGE A;  3EC4 A;  6CPA A;  2ZOG A;  4R8F A;  1XEB A;  3PGP A;  4ONW A;  4UBR A;  1M4I A;  5IB9 A;  3TFY A;  3KHX A;  5THW A;  3B3W A;  2CNM A;  4K3N A;  2Q7B A;  1VHE A;  3N5F A;  1QSN A;  4YGO A;  4UFW A;  4OP4 A;  2V8D A;  2Q7S A;  2CNT A;  2WZN A;  3SJF A;  3EFA A;  4KSI A;  3TOA A;  2VZY A;  2WSA A;  1J4J A;  2PVW A;  3D7G A;  3PEI A;  5LRK A;  3D2M A;  4FD4 A;  3FEE A;  2FXF A;  1ARM A;  1HDU A;  1BOB A;  4MHP A;  4C2X A;  5F46 A;  4KOR A;  1OZP A;  4KLV A;  3B2Y A;  4JLY A;  1YK3 A;  2VQY A;  4NCZ A;  2JEV A;  4P4J A;  3IWG A;  1Q2Y A;  4OKO A;  4PV6 A;  1QQ9 A;  4CRY B;  3T90 A;  1V0C A;  3G3S A;  1R3N A;  1XBU A;  3L2N A;  4PSX A;  3TO7 A;  4F8Z A;  4KOX A;  2DF5 A;  3K2K A;  4A32 A;  4U9Z A;  2P6F A;  3KKW A;  1ZG9 A;  2OH1 A;  2FE7 A;  4MCQ A;  2V77 A;  4MFP A;  4IAV A;  1ON0 A;  1TKF A;  2YNC A;  2QVP A;  3WC7 A;  2XEI A;  4R76 A;  4PSW A;  2RB7 A;  4LQG A;  1QSO A;  3KZW A;  5F09 A;  2PC1 A;  4MFK A;  5EBV A;  2ZW7 A;  1AMP A;  3VWE A;  5IB0 A;  4CGO A;  4C68 A;  4L8A A;  2X7B A;  1I1D A;  4IHM A;  1CPS A;  1ELL P;  2PR8 A;  2Z11 A;  4TNU A;  3T8W A;  3WAB A;  4A39 A;  2F7V A;  2PCU A;  2EUI A;  3B35 A;  3S6G A;  2ZOF A;  2DEA A;  1CX8 A;  2ZEM A;  4OC0 A;  1X10 A;  2HUZ A;  1ZLH A;  3NE7 A;  1M4D A;  4JXR A;  4QVT A;  4AVB A;  1CG2 A;  4ZY2 A;  3D7F A;  2EWB A;  2O53 A;  4E2A A;  1CP7 A;  1CJW A;  5J8F A;  2XEJ A;  4XPD C;  4ZYQ A;  2PJ7 A;  4J3G A;  1MJ9 A;  4G1P A;  4O23 A;  4AG7 A;  2ZPA A;  2QYV A;  1YW6 A;  3FVL A;  3VWD A;  2K5T A;  1IB1 E;  4MJ8 A;  1MK4 A;  1F57 A;  2DPT A;  4NGQ A;  1TIQ A;  4OC1 A;  4XPK A;  3WC6 A;  4RUH A;  5C82 A;  4UFX A;  3NH4 A;  4A2Z A;  3S6K A;  3D4U A;  4F6A A;  2ABZ A;  3F5B A;  3V8I A;  1ARL A;  4DYO A;  1TKH A;  1Q2D A;  3D2P A;  5JGF A;  1M4G A;  3GYA A;  3CPX A;  4Q38 A;  4PXC A;  2BSW A;  2I79 A;  1LCP A;  1XMB A;  1S7N A;  4K30 A;  5H84 A;  1Y0Y A;  5J8C A;  1YSJ A;  2D4P A;  3LD2 A;  4KZT A;  2EBJ A;  2IMO A;  5KTA A;  3SI1 A;  2Q4Y A;  3PRT A;  2PJ5 A;  3EXN A;  4LUA A;  5G21 A;  2WPX A;  2FT0 A;  2C27 A;  3IO1 A;  3PFE A;  2C1C A;  3K9T A;  4WJB A;  5F47 A;  3IJ3 A;  4MHD A;  5ISV A;  2ZED A;  2PR1 A;  4NJR A;  1M1D A;  3RZA A;  2P6G A;  2NMT A;  3K9U A;  2B3U A;  2ZW5 A;  4JD6 A;  2HB6 A;  1M44 A;  2H5M A;  1XF8 A;  2QIR A;  2QML A;  1XRY A;  4FD7 A;  2R7H A;  2V8V A;  3FB3 A;  3GUX A;  4NEX A;  5AG6 A;  5KTC A;  4IF5 A;  4P4I A;  3BJ7 A;  3RO0 A;  3BLN A;  2V8G A;  2O28 A;  2CTC A;  3BJ8 A;  4JWP A;  4XPD B;  4X5K A;  4B14 A;  3ISX A;  4FUU A;  4UEF A;  2F5I A;  3D67 A;  2PVV A;  3H8G A;  1KUV A;  2EK8 A;  3PB6 X;  3QAH A;  3H5Z A;  3UY5 A;  1BLL E;  1Z8W A;  1YLO A;  5JM6 A;  1JQG A;  1Z9U A;  2GRE A;  3IWW A;  5LRJ A;  2JBK A;  2PIY A;  1Z2L A;  4F0Y A;  4UCN A;  1KUY A;  2OU2 A;  3LAC A;  1IYK A;  3LMS A;  5BWA B;  3FYN A;  2AFX A;  4KUA A;  1L0C A;  1XOV A;  4P4F A;  1GYT A;  3TO6 A;  3KQZ A;  3FRM A;  2RFH A;  4M6H A;  1Y9W A;  3R9E A;  1ZO0 A;  2GU2 A;  4B5P A;  4CGP A;  2BL1 A;  4KLW A;  1YQE A;  1VGY A;  4OC5 A;  4M85 A;  3DSB A;  3PBB A;  3IWE A;  3DLJ A;  1I12 A;  4R87 A;  4ZX8 A;  2HV2 A;  4MCS A;  4A30 A;  2YND A;  3BI0 A;  5E96 A;  1Z4R A;  2XEG A;  3JUW A;  2FL4 A;  1K4J A;  1P0H A;  3GIU A;  3PP9 A;  1VIX A;  4UIA A;  1Z8L A;  2Q51 A;  2ZW4 A;  2HC9 A;  2EVN A;  4XPL A;  2ZEG A;  4HNW B;  5D8N A;  1BPN A;  4PK2 A;  2OZG A;  1RTQ A;  2B5G B;  3SI0 A;  1UWY A;  2VI7 A;  1IU8 A;  1CPX A;  1FNO A;  2JEW A;  3FX6 A;  3KI9 A;  2IJZ A;  2Q44 A;  1RO5 A;  3IC1 A;  4PXD A;  4UEE A;  1F2O A;  3OWC A;  5C88 A;  4KOS A;  3B3S A;  3LOD A;  4NJQ A;  4CYQ A;  5I4M A;  3S9L A;  3MN8 A;  5EMI A;  2B4D A;  1GHE A;  4EWT A;  3I1U A;  4FWU A;  3R9G A;  3B3T A;  1AUG A;  2BOA A;  2J8R A;  1F2P A;  3D7D A;  4CAW A;  4CPA A;  4MRI A;  2PJ2 A;  4YRH A;  4FBE A;  4MBU A;  3S6F A;  4XNH C;  4PXB A;  2Q04 A;  2CTB A;  4CGL A;  3B7I A;  3SJG A;  2CIJ A;  1JWQ A;  2FCK A;  2WPW A;  3NH5 A;  3TE4 A;  3JVN A;  4OLL A;  4MHY A;  2I3C A;  5HMN A;  3NH8 A;  5J1Q A;  3SI2 A;  3FF3 A;  3H4Q A;  5AG4 A;  1VHS A;  4P4B A;  3SJE A;  5I0C A;  2ZEL A;  1YLE A;  3BXM A;  3NA6 A;  2C6C A;  2Q4V A;  2RC4 A;  4EFD A;  5HVF A;  4OC2 A;  3EO4 A;  3JRU A;  3N7Z A;  4NGN A;  4PQA A;  1Y9K A;  3R9F A;  2A4N A;  1S3Z A;  1P4N A;  2Z3M A;  5FVJ A;  3FEC A;  5AG5 A;  4WWV A;  1IID A;  4JYW A;  4MI4 A;  2D4O A;  1WWZ A;  1QST A;  2FIA A;  2Q43 A;  1HEE A;  4NXY A;  3RNZ A;  3V7Z A;  4BD9 A;  4BIN A;  4ZY0 A;  1Z5R A;  1TF9 A;  4KOV A;  1LFW A;  4IUS A;  4DJL A;  4EVY A;  4E0A A;  3CXP A;  4FD6 A;  4HPS A;  3FXT A;  1IGB A;  1QSR A;  4FAI A;  5HVH A;  1IIC A;  4KUB A;  4ZX9 A;  2Q4Z A;  3WT4 A;  2CF4 A;  8CPA A;  4PPZ A;  5F49 A;  2ZXV A;  4X2T A;  4P45 A;  4A33 A;  2PJ9 A;  1IOF A;  1CM0 A;  3IU2 A;  1ZG7 A;  2QEC A;  3FJU A;  4CS0 B;  1YX0 A;  4ZGY B;  1KZF A;  4XNH B;  3KAS A;  4F9V A; 
#chains in the Genus database with same CATH homology
 2GE3 A;  4M3S A;  4UCP A;  2Z0Z A;  3WR7 A;  5G1Z A;  1S7F A;  3I3G A;  1I21 A;  2PRB A;  2PQ8 A;  2R98 A;  2FS5 A;  4OAD A;  3R96 A;  1Q2C A;  2JDD A;  4CRZ B;  4MY0 A;  1RXT A;  4H89 A;  4CAV A;  3E0K A;  4RS2 A;  2BUE A;  4R3L A;  2J8N A;  3P2H A;  5G22 A;  4R57 A;  1YRE A;  4CGM A;  4MFQ A;  5DWM A;  5IX3 A;  4RI1 A;  5A27 A;  1QSM A;  3I9S A;  3R1K A;  2Y0M A;  3SXN A;  2HQY A;  5KTD A;  1B6B A;  5GCN A;  2PSW A;  5G20 A;  3IGR A;  4CAX A;  4U9Y A;  2JLM A;  1S7L A;  1UFH A;  2B58 A;  2G3A A;  2REE A;  3C26 A;  2KCW A;  2Z3N A;  4B10 A;  5JQ4 A;  2OZU A;  3A9L A;  4AVA A;  3TO9 A;  3CXS A;  1IYL A;  5HH1 A;  4NSQ A;  1MJA A;  4AG9 A;  2ZW6 A;  3SXO A;  4QBJ A;  1S7K A;  4B11 A;  2B3V A;  4YFJ A;  4BMH A;  4U5Y A;  2Z3K A;  2VEZ A;  3QB8 A;  4CYO A;  4OAE A;  2J8M A;  3ZJ0 A;  1B87 A;  2ARH A;  3PZJ A;  1LRZ A;  4B12 A;  1NSL A;  2BEI A;  2DPS A;  2R1I A;  4R9M A;  3TTH A;  3CXQ A;  3W6X A;  4A95 A;  5DWN A;  4Q36 A;  3FIX A;  4H6U A;  4A31 A;  2YNE A;  4C7H A;  1XIX A;  2I00 A;  4KS9 A;  1BO4 A;  3DDD A;  3FNC A;  4B5O A;  3MGD A;  3G8W A;  4KOY A;  2VXK A;  1NE9 A;  2Z10 A;  2FIW A;  1PU9 A;  1U6M A;  3F8K A;  3TCV A;  4B13 A;  2Z3L A;  3DR8 A;  4QUS A;  3R95 A;  2VZZ A;  2GIV A;  1VKC A;  5AG7 A;  4C2Y A;  1YVO A;  2PDO A;  4HNX B;  3GY9 A;  4NF1 A;  2B4B A;  1Y7R A;  1PUA A;  3W6S A;  2Q0Y A;  1FY7 A;  4ONU A;  1WK4 A;  5CNP A;  2YNC C;  4B5P B;  4MFJ A;  2WUU A;  4KOT A;  3F0A A;  4F0X A;  2G0B A;  2B5G A;  4JJX A;  5F48 A;  3TOB A;  4Y49 C;  2IL4 A;  1NMT A;  4MFL A;  2JDC A;  3B8G A;  4C2Z A;  1Z4E A;  3ZZI A;  2R8V A;  4L89 A;  1YR0 A;  4H6Z A;  4CYP A;  5EC4 A;  5JPH A;  1R57 A;  2OZH A;  5H86 A;  4DNC A;  3P2F A;  2YGW A;  1XE4 A;  4UWI A;  3RYO A;  4CAE A;  4CAF A;  3D3S A;  2REF A;  2P6E A;  4QB9 A;  2AE6 A;  4AB7 A;  4CGN A;  4HNY B;  2Z3P A;  3GKR A;  4PK3 A;  4AVC A;  3DNS A;  2B4D B;  4UWJ A;  2GAN A;  2ATR A;  2CNS A;  4C7I A;  4E8O A;  2DXQ A;  5A28 A;  2Z3O A;  4KVX A;  1SQH A;  1YVK A;  4UCM A;  2AJ6 A;  4KSF A;  1S60 A;  4KOU A;  2VBQ A;  3IU1 A;  3W91 A;  1XMT A;  3JTK A;  4II9 A;  4BBH A;  4ZBG A;  4MY3 A;  1MJB A;  1S5K A;  2FSR A;  2OB0 A;  3DR6 A;  4FD5 A;  4R3K A;  4Y49 B;  2CY2 A;  3S6H A;  2CXA A;  3FBU A;  4KVM E;  4JXQ A;  3TT2 A;  4LX9 A;  4KSA A;  2G3T A;  4ORF A;  4QC6 A;  4UFV A;  3SHP A;  1YGH A;  3EY5 A;  3T9Y A;  4KOW A;  4GS4 A;  4UA3 A;  4I49 A;  4KVO E;  1N71 A;  4MFZ A;  4CYN A;  3D8P A;  4HKF A;  1KUX A;  2P0W A;  5AGE A;  3EC4 A;  1XEB A;  3PGP A;  4UBR A;  1M4I A;  3TFY A;  2CNM A;  2Q7B A;  4YGO A;  1QSN A;  4UFW A;  2CNT A;  3EFA A;  3TOA A;  2VZY A;  2WSA A;  1J4J A;  3D2M A;  4FD4 A;  2FXF A;  1BOB A;  4C2X A;  5F46 A;  4KOR A;  1OZP A;  4KLV A;  4JLY A;  1YK3 A;  2VQY A;  4NCZ A;  2JEV A;  3IWG A;  1Q2Y A;  4PV6 A;  4CRY B;  3T90 A;  1V0C A;  3G3S A;  3TO7 A;  4PSX A;  4KOX A;  4A32 A;  4U9Z A;  2P6F A;  3KKW A;  2OH1 A;  2FE7 A;  4MFP A;  1ON0 A;  2YNC A;  4PSW A;  1QSO A;  2PC1 A;  4MFK A;  5EBV A;  2ZW7 A;  3VWE A;  5IB0 A;  4CGO A;  4C68 A;  4L8A A;  2X7B A;  1I1D A;  2PR8 A;  2Z11 A;  2EUI A;  3S6G A;  4QVT A;  4AVB A;  2HUZ A;  3NE7 A;  1M4D A;  4JXR A;  4E2A A;  1CJW A;  5J8F A;  4XPD C;  4J3G A;  1MJ9 A;  4AG7 A;  2ZPA A;  3VWD A;  2K5T A;  1IB1 E;  4MJ8 A;  1MK4 A;  2DPT A;  1TIQ A;  4XPK A;  5C82 A;  4UFX A;  4A2Z A;  3S6K A;  5KTA A;  4F6A A;  3F5B A;  3V8I A;  3D2P A;  1Q2D A;  1M4G A;  3GYA A;  4Q38 A;  2BSW A;  2I79 A;  1S7N A;  4K30 A;  5H84 A;  5J8C A;  2D4P A;  3LD2 A;  4KZT A;  2Q4Y A;  3EXN A;  4LUA A;  5G21 A;  2WPX A;  2FT0 A;  2C27 A;  5F47 A;  4MHD A;  5ISV A;  2PR1 A;  1M1D A;  2P6G A;  2NMT A;  3K9U A;  2B3U A;  2ZW5 A;  4JD6 A;  1M44 A;  2H5M A;  1XF8 A;  2QIR A;  2QML A;  4FD7 A;  2R7H A;  3FB3 A;  4NEX A;  5AG6 A;  5KTC A;  4IF5 A;  3BJ7 A;  3BLN A;  2O28 A;  3BJ8 A;  4JWP A;  4XPD B;  4X5K A;  4B14 A;  2F5I A;  3QAH A;  1KUV A;  3H5Z A;  3UY5 A;  1Z9U A;  4F0Y A;  1KUY A;  2OU2 A;  1IYK A;  5BWA B;  3FYN A;  4KUA A;  1L0C A;  3TO6 A;  3FRM A;  3R9E A;  1Y9W A;  1ZO0 A;  4B5P A;  4CGP A;  2BL1 A;  4KLW A;  4M85 A;  3DSB A;  3IWE A;  1I12 A;  4R87 A;  4A30 A;  2HV2 A;  2YND A;  5E96 A;  1Z4R A;  3JUW A;  2FL4 A;  1K4J A;  1P0H A;  3PP9 A;  2ZW4 A;  2EVN A;  4XPL A;  4HNW B;  4PK2 A;  2OZG A;  2B5G B;  2VI7 A;  4UCN A;  2Q44 A;  1RO5 A;  3OWC A;  5C88 A;  4KOS A;  4CYQ A;  3LOD A;  2B4D A;  1GHE A;  3R9G A;  2J8R A;  4CAW A;  4YRH A;  4MBU A;  3S6F A;  4XNH C;  2Q04 A;  4CGL A;  2FCK A;  3TE4 A;  2WPW A;  3JVN A;  4OLL A;  5HMN A;  3H4Q A;  5AG4 A;  1VHS A;  5I0C A;  1YLE A;  2Q4V A;  2RC4 A;  3EO4 A;  3N7Z A;  1Y9K A;  3R9F A;  2A4N A;  1S3Z A;  1P4N A;  2Z3M A;  5FVJ A;  5AG5 A;  1IID A;  4MI4 A;  2D4O A;  1WWZ A;  1QST A;  2FIA A;  4NXY A;  5IV0 A;  4KOV A;  4IUS A;  4EVY A;  4E0A A;  3CXP A;  4FD6 A;  3FXT A;  1QSR A;  1IIC A;  4KUB A;  5F49 A;  2ZXV A;  4A33 A;  3IU2 A;  4CS0 B;  1CM0 A;  2QEC A;  1YX0 A;  4ZGY B;  1KZF A;  4XNH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...