3FIXA

Crystal structure of a putative n-acetyltransferase (ta0374) from thermoplasma acidophilum
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
165
structure length
165
Chain Sequence
YFQSNAMSIEIRKLSIEDLETLIEVARESWKWTYAGIYSEEYIESWIREKYSKEKLLNEIVRSQSNLDILFLGAFADSTLIGFIELKIIANKAELLRLYLKPEYTHKKIGKTLLLEAEKIMKKKGILECRLYVHRQNSVGFSFYYKNGFKVEDTDGSDFIMEKKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the novel PaiA N-acetyltransferase from Thermoplasma acidophilum involved in the negative control of sporulation and degradative enzyme production.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Transferase
molecule keywords N-ACETYLTRANSFERASE
total genus 53
structure length 165
sequence length 165
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2008-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3fixA00
4MJ8A 3TOBA 2VZZA 3F5BA 2FIWA 4HNXB 1I21A 1YGHA 1U6MA 4U9ZA 1YVKA 1QSRA 4ORFA 2JLMA 2D4OA 3TTHA 1MJAA 3R9GA 1XIXA 2GIVA 4QB9A 4KZTA 3V8IA 3NE7A 5DWMA 4KOWA 4KUAA 4H89A 3BLNA 2VZYA 1YREA 4KVOE 4CRYB 2K5TA 1OZPA 3ZZIA 4JXRA 2BUEA 3WR7A 1S7FA 2Q44A 2QECA 3F0AA 1TIQA 2FXFA 5KTCA 1J4JA 2HUZA 2J8RA 2DXQA 1RXTA 1M4GA 2ZW7A 3SHPA 5CNPA 1K4JA 2FS5A 3P2FA 1CM0A 3IGRA 4MI4A 3TOAA 4QVTA 4QC6A 3OWCA 1VHSA 1YX0A 3C26A 4KVXA 1SQHA 3DSBA 4F6AA 4PK3A 3G8WA 4QUSA 4FD4A 2CNTA 3FBUA 1MJ9A 5EBVA 1Y9WA 5E96A 5GCNA 2BEIA 4IUSA 3GY9A 2OH1A 4KOSA 3VWDA 4PV6A 4AG9A 2B4BA 1Z4EA 3CXPA 1S7LA 1M44A 1NMTA 3TFYA 3DDDA 4AB7A 3D2PA 3R95A 2ZPAA 4GS4A 2REEA 1R57A 1GHEA 2Y0MA 4LX9A 4KOUA 2Z0ZA 1P4NA 1IYLA 2H5MA 2PDOA 2HQYA 2R8VA 1I12A 1S60A 5HH1A 1YVOA 3K9UA 5J8CA 2ZXVA 5C88A 4OLLA 1M4DA 3IWGA 2GANA 3JVNA 3R9EA 4IF5A 2F5IA 2PR1A 4JD6A 2WPWA 4X5KA 4CAVA 5F49A 1XF8A 3FRMA 3CXQA 5IB0A 5JPHA 1YLEA 4YGOA 1WK4A 1IB1E 1Q2YA 4MHDA 2REFA 4NCZA 2D4PA 1S7KA 3N7ZA 3TE4A 3MGDA 2B3VA 2BSWA 3W6XA 3FXTA 4AVBA 2B3UA 4MY3A 2ZW6A 2AJ6A 4R87A 2RC4A 2IL4A 3W91A 2OU2A 4UWIA 4JWPA 4HNWB 3R9FA 3FB3A 3S6KA 4CS0B 2CNMA 4HKFA 1KUVA 3FNCA 4MY0A 3PP9A 2PR8A 4OADA 2JEVA 4NSQA 2Q4YA 4RI1A 5F48A 2JDDA 2G3AA 3JUWA 2PRBA 4U5YA 5FVJA 3H4QA 4HNYB 4XPKA 1Y7RA 3F8KA 5F46A 2FIAA 4XPDC 3SXOA 4OAEA 4AVAA 1QSMA 3FIXA 3G3SA 3DR8A 2EVNA 4E0AA 4JJXA 2B4DA 1IIDA 4JXQA 1PUAA 1B87A 4B5PA 1QSOA 4B5OA 1BO4A 3PGPA 2ATRA 4XPDB 2A4NA 3EFAA 2FL4A 1Y9KA 3UY5A 1VKCA 3GKRA 1V0CA 2QIRA 1Z4RA 2VBQA 4QBJA 2B5GB 2Z11A 3BJ7A 2QMLA 1I1DA 3D3SA 3I9SA 1S3ZA 4ZBGA 4H6UA 2Z10A 3TO9A 2PC1A 2OZUA 4XPLA 3GYAA 3TO7A 2CY2A 3CXSA 4CRZB 2OZHA 1NE9A 1ON0A 2G0BA 3P2HA 4L8AA 2VQYA 4NF1A 1WWZA 3R1KA 3D2MA 2Q04A 4NEXA 5H84A 4B5PB 1QSNA 1NSLA 4AVCA 2GE3A 3TCVA 3T9YA 4AG7A 1KUXA 3S6HA 4R9MA 3VWEA 4I49A 1YK3A 3T90A 4E2AA 5IV0A 1Z9UA 4XNHB 4YFJA 4M3SA 1FY7A 4UA3A 5HMNA 2CNSA 3DNSA 4PSXA 5IX3A 3EXNA 2PSWA 1IYKA 1KZFA 4R3KA 5ISVA 1P0HA 3KKWA 3QB8A 2FT0A 2FE7A 4EVYA 5I0CA 4FD5A 4MBUA 4U9YA 3RYOA 5KTDA 2VI7A 2ZW5A 3FYNA 2B5GA 3R96A 2P0WA 3LD2A 2Q0YA 3DR6A 3TO6A 2FSRA 2R1IA 4KOXA 1BOBA 1XMTA 4CAWA 1YR0A 1XE4A 3EY5A 3B8GA 4JLYA 4H6ZA 2B4DB 1B6BA 3S6FA 2P6FA 1S5KA 2O28A 2VXKA 2PQ8A 3D8PA 4PSWA 3W6SA 4RS2A 2HV2A 4Y49B 1KUYA 2J8NA 4UBRA 5J8FA 2C27A 4KOVA 2KCWA 4Y49C 1QSTA 1MJBA 3EO4A 5H86A 4M85A 5EC4A 1CJWA 1M4IA 2VEZA 4UWJA 4KOTA 4II9A 4CAXA 2Q7BA 5JQ4A 5DWNA 1RO5A 3QAHA 3LODA 3I3GA 4E8OA 2OB0A 4DNCA 3TT2A 1MK4A 2WPXA 3BJ8A 3E0KA 2ZW4A 3ZJ0A 2B58A 3SXNA 4L89A 2J8MA 3PZJA 2OZGA 4FD7A 4KORA 1N71A 1Q2DA 4PK2A 2JDCA 1PU9A 4YRHA 1L0CA 2AE6A 2EUIA 2Q4VA 2P6GA 3EC4A 1LRZA 4R57A 2I00A 5C82A 4NXYA 4KVME 5KTAA 1M1DA 5F47A 2X7BA 4K30A 4KLVA 4XNHC 1IICA 4KOYA 4J3GA 4ONUA 2I79A 4LUAA 4KLWA 1UFHA 2R98A 4F0YA 1S7NA 4R3LA 4FD6A 2R7HA 1Q2CA 2ARHA 2G3TA 4BMHA 4KUBA 2BL1A 3S6GA 2P6EA 2FCKA 2NMTA 1XEBA
chains in the Genus database with same CATH superfamily
4MJ8A 3TOBA 3WT4A 2BCOA 2AFXA 2VZZA 3F5BA 4IHMA 2FIWA 4HNXB 3V38A 4UF4A 4MRIA 3IWWA 3WC5A 1IOIA 1I21A 5JM6A 5K8PA 2XEFA 4DJLA 4B12A 4ZYQA 4WJBA 2EK9A 1YGHA 3SJXA 4CGNA 4KSAA 1U6MA 4U9ZA 1YVKA 1QSRA 4ORFA 2JLMA 4B13A 2D4OA 4A39A 4A30A 3TTHA 1MJAA 4Q38A 1Z5RA 3R9GA 1XIXA 4MFLA 2GIVA 5LRJA 3KI9A 5G1ZA 4QB9A 4KZTA 1CBXA 2GFQA 3IJ3A 5G22A 3V8IA 2PJ5A 3NE7A 5DWMA 3VATA 1LANA 1XOVA 4F9UA 4KOWA 4KUAA 4H89A 2PVVA 3BLNA 4X3RA 4WWVA 3PFEA 2VZYA 2PIYA 4PPZA 1YREA 2V8VA 1CP7A 4KVOE 4CRYB 2K5TA 1OZPA 4NGMA 3ZZIA 4JXRA 4MXUA 2BUEA 1H8LA 2YNCA 3WR7A 1S7FA 2Q44A 2PJ7A 5AG5A 2QECA 2PVWA 3F0AA 1TIQA 2FXFA 1R3NA 2ABZA 5KTCA 1J4JA 4MCQA 2RB7A 2HUZA 2J8RA 4R8FA 5THWA 4PXBA 1PCAA 2DXQA 4X2TA 1RXTA 1M4GA 2ZW7A 3SI1A 3SHPA 4P4EA 3H8FA 5CNPA 4CGMA 1XBUA 1K4JA 3B3CA 2FS5A 3P2FA 1CM0A 3IGRA 4EWTA 4CYOA 4MI4A 3TOAA 4QVTA 1YMEA 3CPAA 4QC6A 3OWCA 3D68A 4NGNA 2PJ0A 2PJAA 1VHSA 1YX0A 2DPTA 4NGQA 1IOFA 1NSAA 5AG4A 7CPAA 3C26A 2CF4A 4KVXA 2Q4ZA 3PBEA 2VL1A 1ZO0A 1SQHA 3DSBA 3RO0A 4MFQA 4F6AA 1CG2A 4PK3A 3G8WA 1LAPA 2F7VA 3H5ZA 4YU9A 4CGLA 4FD4A 4QUSA 2CNTA 3FBUA 2BOAA 3IEHA 1VHEA 3K9TA 1CPXA 1MJ9A 4P4FA 1HDUA 2Z3NA 3MRUA 5EBVA 4A37A 1Y9WA 4C7IA 4A95A 5E96A 1TXRA 1Y7EA 3PBBA 5LRKA 1VGYA 3CT9A 3BI0A 5GCNA 1JQGA 2BEIA 4IUSA 5G20A 5CBMA 5J1QA 3GY9A 4P45A 4UIAA 4OKOA 3LWUA 2EK8A 2OH1A 4KOSA 2C6GA 4EMEA 3KQZA 2PJ9A 4ZY1A 1QMUA 3VWDA 4MCSA 4PV6A 3KQXA 1HDQA 2B4BA 1Z4EA 4AG9A 3IIBA 3IU2A 3CXPA 4OP4A 1S7LA 2AFUA 1M44A 1NMTA 3TFYA 5DS0A 3DDDA 1OBRA 3IWEA 4R76A 2PJ1A 3PB6X 4AB7A 5JGFA 1Z8LA 3D2PA 3PB8X 1XFOA 3R95A 1QQ9A 2ZPAA 4GS4A 2JEWA 1TKHA 3B3SA 4MHPA 2REEA 3KGQA 4MFZA 5LYFA 2CIJA 1R57A 3D66A 2EBJA 3ISXA 1GHEA 2Y0MA 1CPSA 3BHXA 4LX9A 4MHYA 4KOUA 4DYOA 2Z0ZA 1P4NA 2Z3LA 4OC4A 1IYLA 2H5MA 2PDOA 3KHZA 2HQYA 2R8VA 2GU2A 5AG6A 1I12A 1S60A 5HH1A 1YVOA 2C1CA 2OR4A 3D7GA 3K9UA 4NGTA 1DE4C 1YQEA 5J8CA 2ZXVA 5C88A 4ZX8A 3LACA 1IY7A 4UFWA 1VHOA 4OLLA 1M4DA 4OC3A 3IWGA 4MCPA 2AFZA 3S9NA 2GANA 3JVNA 4RN7A 3R9EA 4IF5A 2ZEEA 3FJUA 2F5IA 2PR1A 4JD6A 4O23A 2WPWA 4X5KA 2O4HA 5G21A 3GIUA 3T8WA 4F0XA 1LCPA 5AG7A 2C6PA 5F49A 4CAVA 5LRGA 1Y0YA 1XF8A 3FRMA 3CXQA 5IB0A 5JPHA 1YLEA 2PJ3A 4YGOA 1WK4A 3FMCA 1PYTB 1Z8XA 4OC5A 1IB1E 1Q2YA 1LOKA 4M6IA 4MHDA 2OOTA 5HXDA 2V77A 4NJQA 2REFA 4NCZA 2D4PA 1S7KA 3B3WA 1CP6A 3K2KA 4MHNA 3N7ZA 3FVLA 1AMPA 3H8EA 1Q7LA 3D7FA 3TE4A 1ZLHA 3MGDA 2B3VA 1ZG9A 2BSWA 3W6XA 3FXTA 4AVBA 2B3UA 2HC9A 4MY3A 3B2YA 1CX8A 2ZW6A 4ZGYB 2AJ6A 2V8HA 1TF8A 1XJOA 2IL4A 2RC4A 4R87A 2OU2A 4NGPA 4Q36A 4UWIA 3W91A 4JWPA 4HNWB 4A2ZA 4PXEA 1TF9A 3R9FA 3FB3A 3S6KA 4CS0B 2CNMA 4HKFA 1KUVA 3FNCA 2EWBA 4MY0A 3PP9A 3FEEA 2XEJA 2PR8A 1ZG7A 4OADA 5LYDA 5BWAB 2ZENA 4MFPA 3L2NA 1XMBA 2JEVA 2EO8A 4NSQA 2Q4YA 2IQ6A 4RI1A 4RUHA 4CAFA 4PQAA 4C2YA 1HEEA 2JDDA 5F48A 3TX8A 2G3AA 3JUWA 2PRBA 4U5YA 2ANPA 2DPSA 2WSAA 5FVJA 4CYPA 3H4QA 1F2OA 4HNYB 4XPKA 4Z65A 2GLJA 3PB7X 4ONWA 5K8NA 1Y7RA 1F57A 1ZG8A 3F8KA 4NGRA 2FIAA 5F46A 4XPDC 2Z3PA 3SXOA 3IU1A 3NH4A 4OAEA 4AVAA 1YLOA 1QSMA 2PJ6A 3KHXA 4NJRA 2YNCC 4IAVA 2IJZA 3FIXA 3G3SA 4A31A 3DR8A 2EVNA 3ISZA 4FAIA 4E0AA 3PEIA 4JJXA 1ARMA 2ZEDA 2B4DA 1IIDA 2BO9A 4JXQA 1PUAA 1B87A 4B5PA 1QSOA 3QAYA 3CZXA 1X12A 2PJ2A 2WUUA 1BO4A 4B5OA 3RZAA 3B3VA 3PGPA 2ATRA 4GXHA 1Z8WA 4XPDB 2A4NA 3EFAA 5ELYA 2HB6A 2FL4A 4C68A 4UEEA 4BD9A 1Y9KA 3KR5A 1VKCA 1UWYA 3GKRA 3UY5A 2ZEHA 1V0CA 4UCPA 1FNOA 2QIRA 2CTBA 5EMIA 1Z4RA 2VBQA 4QBJA 2ZEMA 3D4UA 2POKA 2V8DA 2Q43A 2B5GB 2Z11A 3B3TA 3BJ7A 3KASA 2QMLA 1I1DA 2GREA 2PIZA 3D3SA 4UEZA 3I9SA 1S3ZA 3PB9X 4H6UA 4ZBGA 2Z10A 2QVPA 2ZEPA 4MHZA 3SI0A 4K3NA 2ZELA 1ELLP 5LYIA 4KSIA 3TO9A 3WABA 4ZY0A 5IB9A 2PC1A 2OZUA 4XPLA 3GYAA 3TO7A 2CY2A 3CXSA 4CRZB 2OZHA 1NE9A 1AYEA 1JWQA 1ON0A 2G0BA 3P2HA 3RBUA 3DLJA 2VQYA 4L8AA 3JRUA 4NF1A 1WWZA 3R1KA 3D2MA 3WC6A 2JBKA 1LFWA 2O53A 3FECA 2Q04A 4R7MA 3MN8A 4LQ6A 4NEXA 4TNUA 5H84A 4B5PB 1QSNA 6CPAA 1Z2LA 2ZEGA 4H2KA 4JYWA 2V8GA 1NSLA 2ZOGA 2RFHA 4AVCA 2GE3A 1ARLA 3S9LA 3TCVA 4FBEA 3T9YA 4AG7A 2PJ4A 5A28A 1KUXA 3S6HA 2CXAA 3QNVA 4R9MA 3VWEA 4P4JA 1YSJA 3JTKA 2AFMA 3LMSA 4OIDA 4UEFA 4I49A 1YK3A 2AFWA 4ZX9A 4BBHA 4CGPA 3PRTA 3T90A 4CYNA 4E2AA 5IV0A 4KS9A 2NSMA 1Z9UA 2ZOFA 4XNHB 1R43A 4YFJA 4M3SA 1FY7A 1XRYA 2J9AA 4KSFA 4UA3A 5HMNA 2CNSA 3DNSA 4PSXA 2PJ8A 5IX3A 3EXNA 2PSWA 2YNDA 1IYKA 1Z8TA 1KZFA 2GLFA 5D29A 4R3KA 5ISVA 1P0HA 2I3CA 3KKWA 3QB8A 4A94A 2FT0A 2FE7A 3BI1A 4F8ZA 5K8OA 4YWYA 4EVYA 5I0CA 4FD5A 3IC1A 4MBUA 4UCNA 4OC2A 4U9YA 3RYOA 3RAMA 1IGBA 4NGSA 3TC8A 5KTDA 2VI7A 1IU8A 4W9YA 4FUUA 1TKFA 2ZW5A 3FYNA 2B5GA 5CPAA 4B10A 2Q51A 5I4MA 3N5FA 1TKJA 4OIWA 2PJCA 3V7ZA 3R96A 2P0WA 1GYTA 3LD2A 3KR4A 2PE3A 4HPSA 5K8MA 2DF5A 2Q0YA 5A27A 3NH5A 4C2ZA 4GM5A 2F8HA 4MCRA 4OC0A 3DR6A 5D8NA 2QYVA 2ZEOA 2FSRA 4M6HA 3TO6A 2XEGA 2R1IA 4KOXA 2CTCA 1BOBA 1XMTA 1M4LA 2DEAA 4A33A 4CAWA 1YR0A 4MMOA 4M6GA 1XE4A 3EY5A 3B8GA 4JLYA 4H6ZA 2B4DB 4B14A 5F09A 3PB4X 1Y0RA 1BPNA 3VARA 1B6BA 2C6CA 4LQGA 5HVHA 4A32A 3S6FA 3GUXA 4UIBA 3A9LA 2P6FA 1S5KA 2Z3KA 2O28A 3S9MA 3B7IA 2VXKA 2YNEA 4TWEA 3FF3A 2PQ8A 3D8PA 4P4BA 4PSWA 3W6SA 4EFDA 1ZLIA 4RS2A 2HV2A 2FVGA 3SJGA 4Y49B 4PXCA 1KUYA 2J8NA 4P44A 3SJFA 4UBRA 3I1UA 2ODFA 5J8FA 2C27A 2XEIA 4KOVA 5JH9A 4P6YA 2KCWA 2PCUA 4Y49C 1QSTA 1MJBA 2NYQA 3EO4A 2Z3MA 4G1PA 3HLPA 3NFZA 4M85A 5H86A 5EC4A 1CJWA 1M4IA 3BXMA 2VEZA 3FEDA 3PFOA 4UWJA 4CYQA 4KOTA 1A2ZA 2WYRA 3SI2A 4CAXA 2Q7BA 4BINA 1DTDA 4II9A 5JQ4A 3D7HA 1LAMA 1VIXA 5DWNA 1RO5A 3CDXA 3QAHA 3LODA 5HVGA 3IFEA 4PXDA 3DGVA 3I3GA 4UFVA 4E8OA 2OB0A 4DNCA 3NA6A 3GB0A 4P4DA 4UCMA 2PRQA 4P4IA 3TT2A 2Z3OA 3D7DA 4AXVA 1MK4A 2WPXA 1ELMP 3BJ8A 3D67A 3E0KA 3SJEA 2ZW4A 3ZJ0A 4Q7AA 4B6ZA 2B58A 3SXNA 4ZI6A 2QJ8A 4L89A 2J8MA 3PZJA 2OZGA 4P10A 4FD7A 4DUKA 5LYLA 1BLLE 4MFKA 4IK2A 4KORA 1N71A 1BPMA 1Q2DA 2AFSA 4PK2A 2YGWA 2JDCA 1PU9A 4YRHA 4FWUA 4CAEA 8CPAA 4X8IA 1L0CA 2AE6A 2EUIA 2Q4VA 2G9DA 2P6GA 4MFJA 1YW4A 5AGEA 2JBJA 4C2XA 4CPAA 5HVFA 1YW6A 2WZNA 2AFOA 3EC4A 1LRZA 2I00A 4JZ0A 4R57A 1FT7A 4OC1A 3WC7A 5C82A 4NXYA 4KVME 4ZY2A 5KTAA 1M1DA 5F47A 1F2PA 2X7BA 4K30A 4KLVA 3FH4A 3NH8A 3VH9A 4A38A 4XNHC 4F9VA 1IICA 3KL9A 2Q7SA 3NE8A 1RTQA 4KOYA 1BAVA 4J3GA 4ONUA 3KZWA 2PJBA 4UFXA 2I79A 4LUAA 4KLWA 3CPXA 1UFHA 1AUGA 2R98A 2IMOA 4F0YA 4R6TA 1S7NA 3B35A 3RNZA 3GLJA 4NFRA 4CGOA 4R3LA 3HUVA 2R7HA 1Q2CA 4FD6A 1EE3P 2ARHA 1X10A 2G3TA 4B11A 4BMHA 4KUBA 2BL1A 3S6GA 3FX6A 4OMEA 1KWMA 2P6EA 3IO1A 4C7HA 2FCKA 2NMTA 3H8GA 1XEBA 2ZEFA
chains in the Genus database with same CATH topology
4MJ8A 3TOBA 2VZZA 3F5BA 2FIWA 4HNXB 1I21A 4B12A 1YGHA 4CGNA 4KSAA 1U6MA 4U9ZA 1YVKA 1QSRA 4ORFA 2JLMA 4B13A 2D4OA 4A30A 3TTHA 1MJAA 4Q38A 3R9GA 1XIXA 4MFLA 2GIVA 5G1ZA 4QB9A 4KZTA 5G22A 3V8IA 3NE7A 5DWMA 4KOWA 4KUAA 4H89A 3BLNA 2VZYA 1YREA 4KVOE 4CRYB 2K5TA 1OZPA 3ZZIA 4JXRA 2BUEA 2YNCA 3WR7A 1S7FA 2Q44A 5AG5A 2QECA 3F0AA 1TIQA 2FXFA 5KTCA 1J4JA 2HUZA 2J8RA 2DXQA 1RXTA 1M4GA 2ZW7A 3SHPA 5CNPA 4CGMA 1K4JA 2FS5A 3P2FA 1CM0A 3IGRA 4CYOA 4MI4A 3TOAA 4QVTA 4QC6A 3OWCA 1VHSA 1YX0A 2DPTA 5AG4A 3C26A 4KVXA 1ZO0A 1SQHA 3DSBA 4MFQA 4F6AA 4PK3A 3G8WA 3H5ZA 4CGLA 4FD4A 4QUSA 2CNTA 3FBUA 1MJ9A 2Z3NA 5EBVA 1Y9WA 4C7IA 4A95A 5E96A 5GCNA 2BEIA 4IUSA 5G20A 3GY9A 2OH1A 4KOSA 3VWDA 4PV6A 4AG9A 2B4BA 1Z4EA 3IU2A 3CXPA 1S7LA 1M44A 1NMTA 3TFYA 3DDDA 3IWEA 4AB7A 3D2PA 3R95A 2ZPAA 4GS4A 2REEA 4MFZA 1R57A 1GHEA 2Y0MA 4LX9A 4KOUA 2Z0ZA 1P4NA 2Z3LA 1IYLA 2H5MA 2PDOA 2HQYA 2R8VA 5AG6A 1I12A 1S60A 5HH1A 1YVOA 3K9UA 5J8CA 2ZXVA 5C88A 4UFWA 4OLLA 1M4DA 3IWGA 2GANA 3JVNA 3R9EA 4IF5A 2F5IA 2PR1A 4JD6A 2WPWA 4X5KA 5G21A 4F0XA 5AG7A 4CAVA 5F49A 1XF8A 3FRMA 3CXQA 5IB0A 5JPHA 1YLEA 4YGOA 1WK4A 1IB1E 1Q2YA 4MHDA 2REFA 4NCZA 2D4PA 1S7KA 3N7ZA 3TE4A 3MGDA 2B3VA 2BSWA 3W6XA 3FXTA 4AVBA 2B3UA 4MY3A 4ZGYB 2ZW6A 2AJ6A 4R87A 2RC4A 2IL4A 3W91A 2OU2A 4Q36A 4UWIA 4JWPA 4HNWB 4A2ZA 3R9FA 3FB3A 3S6KA 4CS0B 2CNMA 4HKFA 1KUVA 3FNCA 4MY0A 3PP9A 5BWAB 2PR8A 4OADA 4MFPA 2JEVA 4NSQA 2Q4YA 4RI1A 4CAFA 4C2YA 5F48A 2JDDA 2G3AA 3JUWA 2PRBA 4U5YA 2DPSA 2WSAA 5FVJA 4CYPA 3H4QA 4HNYB 4XPKA 1Y7RA 3F8KA 5F46A 2FIAA 4XPDC 2Z3PA 3SXOA 3IU1A 4OAEA 4AVAA 1QSMA 2YNCC 3FIXA 3G3SA 4A31A 3DR8A 2EVNA 4E0AA 4JJXA 2B4DA 1IIDA 4JXQA 1PUAA 1B87A 4B5PA 1QSOA 2WUUA 4B5OA 1BO4A 3PGPA 2ATRA 4XPDB 2A4NA 3EFAA 2FL4A 4C68A 1Y9KA 3UY5A 1VKCA 3GKRA 1V0CA 4UCPA 2QIRA 1Z4RA 2VBQA 4QBJA 2B5GB 2Z11A 3BJ7A 2QMLA 1I1DA 3D3SA 3I9SA 1S3ZA 4ZBGA 4H6UA 2Z10A 3TO9A 2PC1A 2OZUA 4XPLA 3GYAA 3TO7A 2CY2A 3CXSA 4CRZB 2OZHA 1NE9A 1ON0A 2G0BA 3P2HA 4L8AA 2VQYA 4NF1A 1WWZA 3R1KA 3D2MA 2Q04A 4NEXA 5H84A 4B5PB 1QSNA 1NSLA 4AVCA 2GE3A 3TCVA 3T9YA 4AG7A 5A28A 1KUXA 3S6HA 2CXAA 4R9MA 3VWEA 3JTKA 4I49A 1YK3A 4BBHA 4CGPA 3T90A 4CYNA 4E2AA 5IV0A 4KS9A 1Z9UA 4XNHB 4YFJA 4M3SA 1FY7A 4KSFA 4UA3A 5HMNA 2CNSA 3DNSA 4PSXA 5IX3A 3EXNA 2PSWA 2YNDA 1IYKA 1KZFA 4R3KA 5ISVA 1P0HA 3KKWA 3QB8A 2FT0A 2FE7A 4EVYA 5I0CA 4FD5A 4MBUA 4UCNA 4U9YA 3RYOA 5KTDA 2VI7A 2ZW5A 3FYNA 2B5GA 4B10A 3R96A 2P0WA 3LD2A 2Q0YA 5A27A 4C2ZA 3DR6A 3TO6A 2FSRA 2R1IA 4KOXA 1BOBA 1XMTA 4A33A 4CAWA 1YR0A 1XE4A 3EY5A 3B8GA 4JLYA 4H6ZA 2B4DB 4B14A 1B6BA 4A32A 3S6FA 3A9LA 2P6FA 1S5KA 2Z3KA 2O28A 2VXKA 2YNEA 2PQ8A 3D8PA 4PSWA 3W6SA 4RS2A 2HV2A 4Y49B 1KUYA 2J8NA 4UBRA 5J8FA 2C27A 4KOVA 2KCWA 4Y49C 1QSTA 1MJBA 3EO4A 2Z3MA 5H86A 4M85A 5EC4A 1CJWA 1M4IA 4CYQA 2VEZA 4UWJA 4KOTA 4II9A 4CAXA 2Q7BA 5JQ4A 5DWNA 1RO5A 3QAHA 3LODA 3I3GA 4UFVA 4E8OA 2OB0A 4DNCA 4UCMA 3TT2A 2Z3OA 1MK4A 2WPXA 3BJ8A 3E0KA 2ZW4A 3ZJ0A 2B58A 3SXNA 4L89A 2J8MA 3PZJA 2OZGA 4FD7A 4MFKA 4KORA 1N71A 1Q2DA 4PK2A 2YGWA 2JDCA 1PU9A 4YRHA 4CAEA 1L0CA 2AE6A 2EUIA 2Q4VA 2P6GA 4MFJA 5AGEA 4C2XA 3EC4A 1LRZA 2I00A 4R57A 5C82A 4NXYA 4KVME 5KTAA 1M1DA 5F47A 2X7BA 4K30A 4KLVA 4XNHC 1IICA 4KOYA 4J3GA 4ONUA 4UFXA 2I79A 4LUAA 4KLWA 1UFHA 2R98A 4F0YA 1S7NA 4CGOA 4R3LA 4FD6A 2R7HA 1Q2CA 2ARHA 2G3TA 4B11A 4BMHA 4KUBA 2BL1A 3S6GA 2P6EA 4C7HA 2FCKA 2NMTA 1XEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MJ8 A;  3TOB A;  2VZZ A;  3F5B A;  2FIW A;  4HNX B;  1I21 A;  1YGH A;  1U6M A;  4U9Z A;  1YVK A;  1QSR A;  4ORF A;  2JLM A;  2D4O A;  3TTH A;  1MJA A;  3R9G A;  1XIX A;  2GIV A;  4QB9 A;  4KZT A;  3V8I A;  3NE7 A;  5DWM A;  4KOW A;  4KUA A;  4H89 A;  3BLN A;  2VZY A;  1YRE A;  4KVO E;  4CRY B;  2K5T A;  1OZP A;  3ZZI A;  4JXR A;  2BUE A;  3WR7 A;  1S7F A;  2Q44 A;  2QEC A;  3F0A A;  1TIQ A;  2FXF A;  5KTC A;  1J4J A;  2HUZ A;  2J8R A;  2DXQ A;  1RXT A;  1M4G A;  2ZW7 A;  3SHP A;  5CNP A;  1K4J A;  2FS5 A;  3P2F A;  1CM0 A;  3IGR A;  4MI4 A;  3TOA A;  4QVT A;  4QC6 A;  3OWC A;  1VHS A;  1YX0 A;  3C26 A;  4KVX A;  1SQH A;  3DSB A;  4F6A A;  4PK3 A;  3G8W A;  4QUS A;  4FD4 A;  2CNT A;  3FBU A;  1MJ9 A;  5EBV A;  1Y9W A;  5E96 A;  5GCN A;  2BEI A;  4IUS A;  3GY9 A;  2OH1 A;  4KOS A;  3VWD A;  4PV6 A;  4AG9 A;  2B4B A;  1Z4E A;  3CXP A;  1S7L A;  1M44 A;  1NMT A;  3TFY A;  3DDD A;  4AB7 A;  3D2P A;  3R95 A;  2ZPA A;  4GS4 A;  2REE A;  1R57 A;  1GHE A;  2Y0M A;  4LX9 A;  4KOU A;  2Z0Z A;  1P4N A;  1IYL A;  2H5M A;  2PDO A;  2HQY A;  2R8V A;  1I12 A;  1S60 A;  5HH1 A;  1YVO A;  3K9U A;  5J8C A;  2ZXV A;  5C88 A;  4OLL A;  1M4D A;  3IWG A;  2GAN A;  3JVN A;  3R9E A;  4IF5 A;  2F5I A;  2PR1 A;  4JD6 A;  2WPW A;  4X5K A;  4CAV A;  5F49 A;  1XF8 A;  3FRM A;  3CXQ A;  5IB0 A;  5JPH A;  1YLE A;  4YGO A;  1WK4 A;  1IB1 E;  1Q2Y A;  4MHD A;  2REF A;  4NCZ A;  2D4P A;  1S7K A;  3N7Z A;  3TE4 A;  3MGD A;  2B3V A;  2BSW A;  3W6X A;  3FXT A;  4AVB A;  2B3U A;  4MY3 A;  2ZW6 A;  2AJ6 A;  4R87 A;  2RC4 A;  2IL4 A;  3W91 A;  2OU2 A;  4UWI A;  4JWP A;  4HNW B;  3R9F A;  3FB3 A;  3S6K A;  4CS0 B;  2CNM A;  4HKF A;  1KUV A;  3FNC A;  4MY0 A;  3PP9 A;  2PR8 A;  4OAD A;  2JEV A;  4NSQ A;  2Q4Y A;  4RI1 A;  5F48 A;  2JDD A;  2G3A A;  3JUW A;  2PRB A;  4U5Y A;  5FVJ A;  3H4Q A;  4HNY B;  4XPK A;  1Y7R A;  3F8K A;  5F46 A;  2FIA A;  4XPD C;  3SXO A;  4OAE A;  4AVA A;  1QSM A;  3FIX A;  3G3S A;  3DR8 A;  2EVN A;  4E0A A;  4JJX A;  2B4D A;  1IID A;  4JXQ A;  1PUA A;  1B87 A;  4B5P A;  1QSO A;  4B5O A;  1BO4 A;  3PGP A;  2ATR A;  4XPD B;  2A4N A;  3EFA A;  2FL4 A;  1Y9K A;  3UY5 A;  1VKC A;  3GKR A;  1V0C A;  2QIR A;  1Z4R A;  2VBQ A;  4QBJ A;  2B5G B;  2Z11 A;  3BJ7 A;  2QML A;  1I1D A;  3D3S A;  3I9S A;  1S3Z A;  4ZBG A;  4H6U A;  2Z10 A;  3TO9 A;  2PC1 A;  2OZU A;  4XPL A;  3GYA A;  3TO7 A;  2CY2 A;  3CXS A;  4CRZ B;  2OZH A;  1NE9 A;  1ON0 A;  2G0B A;  3P2H A;  4L8A A;  2VQY A;  4NF1 A;  1WWZ A;  3R1K A;  3D2M A;  2Q04 A;  4NEX A;  5H84 A;  4B5P B;  1QSN A;  1NSL A;  4AVC A;  2GE3 A;  3TCV A;  3T9Y A;  4AG7 A;  1KUX A;  3S6H A;  4R9M A;  3VWE A;  4I49 A;  1YK3 A;  3T90 A;  4E2A A;  5IV0 A;  1Z9U A;  4XNH B;  4YFJ A;  4M3S A;  1FY7 A;  4UA3 A;  5HMN A;  2CNS A;  3DNS A;  4PSX A;  5IX3 A;  3EXN A;  2PSW A;  1IYK A;  1KZF A;  4R3K A;  5ISV A;  1P0H A;  3KKW A;  3QB8 A;  2FT0 A;  2FE7 A;  4EVY A;  5I0C A;  4FD5 A;  4MBU A;  4U9Y A;  3RYO A;  5KTD A;  2VI7 A;  2ZW5 A;  3FYN A;  2B5G A;  3R96 A;  2P0W A;  3LD2 A;  2Q0Y A;  3DR6 A;  3TO6 A;  2FSR A;  2R1I A;  4KOX A;  1BOB A;  1XMT A;  4CAW A;  1YR0 A;  1XE4 A;  3EY5 A;  3B8G A;  4JLY A;  4H6Z A;  2B4D B;  1B6B A;  3S6F A;  2P6F A;  1S5K A;  2O28 A;  2VXK A;  2PQ8 A;  3D8P A;  4PSW A;  3W6S A;  4RS2 A;  2HV2 A;  4Y49 B;  1KUY A;  2J8N A;  4UBR A;  5J8F A;  2C27 A;  4KOV A;  2KCW A;  4Y49 C;  1QST A;  1MJB A;  3EO4 A;  5H86 A;  4M85 A;  5EC4 A;  1CJW A;  1M4I A;  2VEZ A;  4UWJ A;  4KOT A;  4II9 A;  4CAX A;  2Q7B A;  5JQ4 A;  5DWN A;  1RO5 A;  3QAH A;  3LOD A;  3I3G A;  4E8O A;  2OB0 A;  4DNC A;  3TT2 A;  1MK4 A;  2WPX A;  3BJ8 A;  3E0K A;  2ZW4 A;  3ZJ0 A;  2B58 A;  3SXN A;  4L89 A;  2J8M A;  3PZJ A;  2OZG A;  4FD7 A;  4KOR A;  1N71 A;  1Q2D A;  4PK2 A;  2JDC A;  1PU9 A;  4YRH A;  1L0C A;  2AE6 A;  2EUI A;  2Q4V A;  2P6G A;  3EC4 A;  1LRZ A;  4R57 A;  2I00 A;  5C82 A;  4NXY A;  4KVM E;  5KTA A;  1M1D A;  5F47 A;  2X7B A;  4K30 A;  4KLV A;  4XNH C;  1IIC A;  4KOY A;  4J3G A;  4ONU A;  2I79 A;  4LUA A;  4KLW A;  1UFH A;  2R98 A;  4F0Y A;  1S7N A;  4R3L A;  4FD6 A;  2R7H A;  1Q2C A;  2ARH A;  2G3T A;  4BMH A;  4KUB A;  2BL1 A;  3S6G A;  2P6E A;  2FCK A;  2NMT A;  1XEB A; 
#chains in the Genus database with same CATH topology
 4MJ8 A;  3TOB A;  3WT4 A;  2BCO A;  2AFX A;  2VZZ A;  3F5B A;  4IHM A;  2FIW A;  4HNX B;  3V38 A;  4UF4 A;  4MRI A;  3IWW A;  3WC5 A;  1IOI A;  1I21 A;  5JM6 A;  5K8P A;  2XEF A;  4DJL A;  4B12 A;  4ZYQ A;  4WJB A;  2EK9 A;  1YGH A;  3SJX A;  4CGN A;  4KSA A;  1U6M A;  4U9Z A;  1YVK A;  1QSR A;  4ORF A;  2JLM A;  4B13 A;  2D4O A;  4A39 A;  4A30 A;  3TTH A;  1MJA A;  4Q38 A;  1Z5R A;  3R9G A;  1XIX A;  4MFL A;  2GIV A;  5LRJ A;  3KI9 A;  5G1Z A;  4QB9 A;  4KZT A;  1CBX A;  2GFQ A;  3IJ3 A;  5G22 A;  3V8I A;  2PJ5 A;  3NE7 A;  5DWM A;  3VAT A;  1LAN A;  1XOV A;  4F9U A;  4KOW A;  4KUA A;  4H89 A;  2PVV A;  3BLN A;  4X3R A;  4WWV A;  3PFE A;  2VZY A;  2PIY A;  4PPZ A;  1YRE A;  2V8V A;  1CP7 A;  4KVO E;  4CRY B;  2K5T A;  1OZP A;  4NGM A;  3ZZI A;  4JXR A;  4MXU A;  2BUE A;  1H8L A;  2YNC A;  3WR7 A;  1S7F A;  2Q44 A;  2PJ7 A;  5AG5 A;  2QEC A;  2PVW A;  3F0A A;  1TIQ A;  2FXF A;  1R3N A;  2ABZ A;  5KTC A;  1J4J A;  4MCQ A;  2RB7 A;  2HUZ A;  2J8R A;  4R8F A;  5THW A;  4PXB A;  1PCA A;  2DXQ A;  4X2T A;  1RXT A;  1M4G A;  2ZW7 A;  3SI1 A;  3SHP A;  4P4E A;  3H8F A;  5CNP A;  4CGM A;  1XBU A;  1K4J A;  3B3C A;  2FS5 A;  3P2F A;  1CM0 A;  3IGR A;  4EWT A;  4CYO A;  4MI4 A;  3TOA A;  4QVT A;  1YME A;  3CPA A;  4QC6 A;  3OWC A;  3D68 A;  4NGN A;  2PJ0 A;  2PJA A;  1VHS A;  1YX0 A;  2DPT A;  4NGQ A;  1IOF A;  1NSA A;  5AG4 A;  7CPA A;  3C26 A;  2CF4 A;  4KVX A;  2Q4Z A;  3PBE A;  2VL1 A;  1ZO0 A;  1SQH A;  3DSB A;  3RO0 A;  4MFQ A;  4F6A A;  1CG2 A;  4PK3 A;  3G8W A;  1LAP A;  2F7V A;  3H5Z A;  4YU9 A;  4CGL A;  4FD4 A;  4QUS A;  2CNT A;  3FBU A;  2BOA A;  3IEH A;  1VHE A;  3K9T A;  1CPX A;  1MJ9 A;  4P4F A;  1HDU A;  2Z3N A;  3MRU A;  5EBV A;  4A37 A;  1Y9W A;  4C7I A;  4A95 A;  5E96 A;  1TXR A;  1Y7E A;  3PBB A;  5LRK A;  1VGY A;  3CT9 A;  3BI0 A;  5GCN A;  1JQG A;  2BEI A;  4IUS A;  5G20 A;  5CBM A;  5J1Q A;  3GY9 A;  4P45 A;  4UIA A;  4OKO A;  3LWU A;  2EK8 A;  2OH1 A;  4KOS A;  2C6G A;  4EME A;  3KQZ A;  2PJ9 A;  4ZY1 A;  1QMU A;  3VWD A;  4MCS A;  4PV6 A;  3KQX A;  1HDQ A;  2B4B A;  1Z4E A;  4AG9 A;  3IIB A;  3IU2 A;  3CXP A;  4OP4 A;  1S7L A;  2AFU A;  1M44 A;  1NMT A;  3TFY A;  5DS0 A;  3DDD A;  1OBR A;  3IWE A;  4R76 A;  2PJ1 A;  3PB6 X;  4AB7 A;  5JGF A;  1Z8L A;  3D2P A;  3PB8 X;  1XFO A;  3R95 A;  1QQ9 A;  2ZPA A;  4GS4 A;  2JEW A;  1TKH A;  3B3S A;  4MHP A;  2REE A;  3KGQ A;  4MFZ A;  5LYF A;  2CIJ A;  1R57 A;  3D66 A;  2EBJ A;  3ISX A;  1GHE A;  2Y0M A;  1CPS A;  3BHX A;  4LX9 A;  4MHY A;  4KOU A;  4DYO A;  2Z0Z A;  1P4N A;  2Z3L A;  4OC4 A;  1IYL A;  2H5M A;  2PDO A;  3KHZ A;  2HQY A;  2R8V A;  2GU2 A;  5AG6 A;  1I12 A;  1S60 A;  5HH1 A;  1YVO A;  2C1C A;  2OR4 A;  3D7G A;  3K9U A;  4NGT A;  1DE4 C;  1YQE A;  5J8C A;  2ZXV A;  5C88 A;  4ZX8 A;  3LAC A;  1IY7 A;  4UFW A;  1VHO A;  4OLL A;  1M4D A;  4OC3 A;  3IWG A;  4MCP A;  2AFZ A;  3S9N A;  2GAN A;  3JVN A;  4RN7 A;  3R9E A;  4IF5 A;  2ZEE A;  3FJU A;  2F5I A;  2PR1 A;  4JD6 A;  4O23 A;  2WPW A;  4X5K A;  2O4H A;  5G21 A;  3GIU A;  3T8W A;  4F0X A;  1LCP A;  5AG7 A;  2C6P A;  5F49 A;  4CAV A;  5LRG A;  1Y0Y A;  1XF8 A;  3FRM A;  3CXQ A;  5IB0 A;  5JPH A;  1YLE A;  2PJ3 A;  4YGO A;  1WK4 A;  3FMC A;  1PYT B;  1Z8X A;  4OC5 A;  1IB1 E;  1Q2Y A;  1LOK A;  4M6I A;  4MHD A;  2OOT A;  5HXD A;  2V77 A;  4NJQ A;  2REF A;  4NCZ A;  2D4P A;  1S7K A;  3B3W A;  1CP6 A;  3K2K A;  4MHN A;  3N7Z A;  3FVL A;  1AMP A;  3H8E A;  1Q7L A;  3D7F A;  3TE4 A;  1ZLH A;  3MGD A;  2B3V A;  1ZG9 A;  2BSW A;  3W6X A;  3FXT A;  4AVB A;  2B3U A;  2HC9 A;  4MY3 A;  3B2Y A;  1CX8 A;  2ZW6 A;  4ZGY B;  2AJ6 A;  2V8H A;  1TF8 A;  1XJO A;  2IL4 A;  2RC4 A;  4R87 A;  2OU2 A;  4NGP A;  4Q36 A;  4UWI A;  3W91 A;  4JWP A;  4HNW B;  4A2Z A;  4PXE A;  1TF9 A;  3R9F A;  3FB3 A;  3S6K A;  4CS0 B;  2CNM A;  4HKF A;  1KUV A;  3FNC A;  2EWB A;  4MY0 A;  3PP9 A;  3FEE A;  2XEJ A;  2PR8 A;  1ZG7 A;  4OAD A;  5LYD A;  5BWA B;  2ZEN A;  4MFP A;  3L2N A;  1XMB A;  2JEV A;  2EO8 A;  4NSQ A;  2Q4Y A;  2IQ6 A;  4RI1 A;  4RUH A;  4CAF A;  4PQA A;  4C2Y A;  1HEE A;  2JDD A;  5F48 A;  3TX8 A;  2G3A A;  3JUW A;  2PRB A;  4U5Y A;  2ANP A;  2DPS A;  2WSA A;  5FVJ A;  4CYP A;  3H4Q A;  1F2O A;  4HNY B;  4XPK A;  4Z65 A;  2GLJ A;  3PB7 X;  4ONW A;  5K8N A;  1Y7R A;  1F57 A;  1ZG8 A;  3F8K A;  4NGR A;  2FIA A;  5F46 A;  4XPD C;  2Z3P A;  3SXO A;  3IU1 A;  3NH4 A;  4OAE A;  4AVA A;  1YLO A;  1QSM A;  2PJ6 A;  3KHX A;  4NJR A;  2YNC C;  4IAV A;  2IJZ A;  3FIX A;  3G3S A;  4A31 A;  3DR8 A;  2EVN A;  3ISZ A;  4FAI A;  4E0A A;  3PEI A;  4JJX A;  1ARM A;  2ZED A;  2B4D A;  1IID A;  2BO9 A;  4JXQ A;  1PUA A;  1B87 A;  4B5P A;  1QSO A;  3QAY A;  3CZX A;  1X12 A;  2PJ2 A;  2WUU A;  1BO4 A;  4B5O A;  3RZA A;  3B3V A;  3PGP A;  2ATR A;  4GXH A;  1Z8W A;  4XPD B;  2A4N A;  3EFA A;  5ELY A;  2HB6 A;  2FL4 A;  4C68 A;  4UEE A;  4BD9 A;  1Y9K A;  3KR5 A;  1VKC A;  1UWY A;  3GKR A;  3UY5 A;  2ZEH A;  1V0C A;  4UCP A;  1FNO A;  2QIR A;  2CTB A;  5EMI A;  1Z4R A;  2VBQ A;  4QBJ A;  2ZEM A;  3D4U A;  2POK A;  2V8D A;  2Q43 A;  2B5G B;  2Z11 A;  3B3T A;  3BJ7 A;  3KAS A;  2QML A;  1I1D A;  2GRE A;  2PIZ A;  3D3S A;  4UEZ A;  3I9S A;  1S3Z A;  3PB9 X;  4H6U A;  4ZBG A;  2Z10 A;  2QVP A;  2ZEP A;  4MHZ A;  3SI0 A;  4K3N A;  2ZEL A;  1ELL P;  5LYI A;  4KSI A;  3TO9 A;  3WAB A;  4ZY0 A;  5IB9 A;  2PC1 A;  2OZU A;  4XPL A;  3GYA A;  3TO7 A;  2CY2 A;  3CXS A;  4CRZ B;  2OZH A;  1NE9 A;  1AYE A;  1JWQ A;  1ON0 A;  2G0B A;  3P2H A;  3RBU A;  3DLJ A;  2VQY A;  4L8A A;  3JRU A;  4NF1 A;  1WWZ A;  3R1K A;  3D2M A;  3WC6 A;  2JBK A;  1LFW A;  2O53 A;  3FEC A;  2Q04 A;  4R7M A;  3MN8 A;  4LQ6 A;  4NEX A;  4TNU A;  5H84 A;  4B5P B;  1QSN A;  6CPA A;  1Z2L A;  2ZEG A;  4H2K A;  4JYW A;  2V8G A;  1NSL A;  2ZOG A;  2RFH A;  4AVC A;  2GE3 A;  1ARL A;  3S9L A;  3TCV A;  4FBE A;  3T9Y A;  4AG7 A;  2PJ4 A;  5A28 A;  1KUX A;  3S6H A;  2CXA A;  3QNV A;  4R9M A;  3VWE A;  4P4J A;  1YSJ A;  3JTK A;  2AFM A;  3LMS A;  4OID A;  4UEF A;  4I49 A;  1YK3 A;  2AFW A;  4ZX9 A;  4BBH A;  4CGP A;  3PRT A;  3T90 A;  4CYN A;  4E2A A;  5IV0 A;  4KS9 A;  2NSM A;  1Z9U A;  2ZOF A;  4XNH B;  1R43 A;  4YFJ A;  4M3S A;  1FY7 A;  1XRY A;  2J9A A;  4KSF A;  4UA3 A;  5HMN A;  2CNS A;  3DNS A;  4PSX A;  2PJ8 A;  5IX3 A;  3EXN A;  2PSW A;  2YND A;  1IYK A;  1Z8T A;  1KZF A;  2GLF A;  5D29 A;  4R3K A;  5ISV A;  1P0H A;  2I3C A;  3KKW A;  3QB8 A;  4A94 A;  2FT0 A;  2FE7 A;  3BI1 A;  4F8Z A;  5K8O A;  4YWY A;  4EVY A;  5I0C A;  4FD5 A;  3IC1 A;  4MBU A;  4UCN A;  4OC2 A;  4U9Y A;  3RYO A;  3RAM A;  1IGB A;  4NGS A;  3TC8 A;  5KTD A;  2VI7 A;  1IU8 A;  4W9Y A;  4FUU A;  1TKF A;  2ZW5 A;  3FYN A;  2B5G A;  5CPA A;  4B10 A;  2Q51 A;  5I4M A;  3N5F A;  1TKJ A;  4OIW A;  2PJC A;  3V7Z A;  3R96 A;  2P0W A;  1GYT A;  3LD2 A;  3KR4 A;  2PE3 A;  4HPS A;  5K8M A;  2DF5 A;  2Q0Y A;  5A27 A;  3NH5 A;  4C2Z A;  4GM5 A;  2F8H A;  4MCR A;  4OC0 A;  3DR6 A;  5D8N A;  2QYV A;  2ZEO A;  2FSR A;  4M6H A;  3TO6 A;  2XEG A;  2R1I A;  4KOX A;  2CTC A;  1BOB A;  1XMT A;  1M4L A;  2DEA A;  4A33 A;  4CAW A;  1YR0 A;  4MMO A;  4M6G A;  1XE4 A;  3EY5 A;  3B8G A;  4JLY A;  4H6Z A;  2B4D B;  4B14 A;  5F09 A;  3PB4 X;  1Y0R A;  1BPN A;  3VAR A;  1B6B A;  2C6C A;  4LQG A;  5HVH A;  4A32 A;  3S6F A;  3GUX A;  4UIB A;  3A9L A;  2P6F A;  1S5K A;  2Z3K A;  2O28 A;  3S9M A;  3B7I A;  2VXK A;  2YNE A;  4TWE A;  3FF3 A;  2PQ8 A;  3D8P A;  4P4B A;  4PSW A;  3W6S A;  4EFD A;  1ZLI A;  4RS2 A;  2HV2 A;  2FVG A;  3SJG A;  4Y49 B;  4PXC A;  1KUY A;  2J8N A;  4P44 A;  3SJF A;  4UBR A;  3I1U A;  2ODF A;  5J8F A;  2C27 A;  2XEI A;  4KOV A;  5JH9 A;  4P6Y A;  2KCW A;  2PCU A;  4Y49 C;  1QST A;  1MJB A;  2NYQ A;  3EO4 A;  2Z3M A;  4G1P A;  3HLP A;  3NFZ A;  4M85 A;  5H86 A;  5EC4 A;  1CJW A;  1M4I A;  3BXM A;  2VEZ A;  3FED A;  3PFO A;  4UWJ A;  4CYQ A;  4KOT A;  1A2Z A;  2WYR A;  3SI2 A;  4CAX A;  2Q7B A;  4BIN A;  1DTD A;  4II9 A;  5JQ4 A;  3D7H A;  1LAM A;  1VIX A;  5DWN A;  1RO5 A;  3CDX A;  3QAH A;  3LOD A;  5HVG A;  3IFE A;  4PXD A;  3DGV A;  3I3G A;  4UFV A;  4E8O A;  2OB0 A;  4DNC A;  3NA6 A;  3GB0 A;  4P4D A;  4UCM A;  2PRQ A;  4P4I A;  3TT2 A;  2Z3O A;  3D7D A;  4AXV A;  1MK4 A;  2WPX A;  1ELM P;  3BJ8 A;  3D67 A;  3E0K A;  3SJE A;  2ZW4 A;  3ZJ0 A;  4Q7A A;  4B6Z A;  2B58 A;  3SXN A;  4ZI6 A;  2QJ8 A;  4L89 A;  2J8M A;  3PZJ A;  2OZG A;  4P10 A;  4FD7 A;  4DUK A;  5LYL A;  1BLL E;  4MFK A;  4IK2 A;  4KOR A;  1N71 A;  1BPM A;  1Q2D A;  2AFS A;  4PK2 A;  2YGW A;  2JDC A;  1PU9 A;  4YRH A;  4FWU A;  4CAE A;  8CPA A;  4X8I A;  1L0C A;  2AE6 A;  2EUI A;  2Q4V A;  2G9D A;  2P6G A;  4MFJ A;  1YW4 A;  5AGE A;  2JBJ A;  4C2X A;  4CPA A;  5HVF A;  1YW6 A;  2WZN A;  2AFO A;  3EC4 A;  1LRZ A;  2I00 A;  4JZ0 A;  4R57 A;  1FT7 A;  4OC1 A;  3WC7 A;  5C82 A;  4NXY A;  4KVM E;  4ZY2 A;  5KTA A;  1M1D A;  5F47 A;  1F2P A;  2X7B A;  4K30 A;  4KLV A;  3FH4 A;  3NH8 A;  3VH9 A;  4A38 A;  4XNH C;  4F9V A;  1IIC A;  3KL9 A;  2Q7S A;  3NE8 A;  1RTQ A;  4KOY A;  1BAV A;  4J3G A;  4ONU A;  3KZW A;  2PJB A;  4UFX A;  2I79 A;  4LUA A;  4KLW A;  3CPX A;  1UFH A;  1AUG A;  2R98 A;  2IMO A;  4F0Y A;  4R6T A;  1S7N A;  3B35 A;  3RNZ A;  3GLJ A;  4NFR A;  4CGO A;  4R3L A;  3HUV A;  2R7H A;  1Q2C A;  4FD6 A;  1EE3 P;  2ARH A;  1X10 A;  2G3T A;  4B11 A;  4BMH A;  4KUB A;  2BL1 A;  3S6G A;  3FX6 A;  4OME A;  1KWM A;  2P6E A;  3IO1 A;  4C7H A;  2FCK A;  2NMT A;  3H8G A;  1XEB A;  2ZEF A; 
#chains in the Genus database with same CATH homology
 4MJ8 A;  3TOB A;  2VZZ A;  3F5B A;  2FIW A;  4HNX B;  1I21 A;  4B12 A;  1YGH A;  4CGN A;  4KSA A;  1U6M A;  4U9Z A;  1YVK A;  1QSR A;  4ORF A;  2JLM A;  4B13 A;  2D4O A;  4A30 A;  3TTH A;  1MJA A;  4Q38 A;  3R9G A;  1XIX A;  4MFL A;  2GIV A;  5G1Z A;  4QB9 A;  4KZT A;  5G22 A;  3V8I A;  3NE7 A;  5DWM A;  4KOW A;  4KUA A;  4H89 A;  3BLN A;  2VZY A;  1YRE A;  4KVO E;  4CRY B;  2K5T A;  1OZP A;  3ZZI A;  4JXR A;  2BUE A;  2YNC A;  3WR7 A;  1S7F A;  2Q44 A;  5AG5 A;  2QEC A;  3F0A A;  1TIQ A;  2FXF A;  5KTC A;  1J4J A;  2HUZ A;  2J8R A;  2DXQ A;  1RXT A;  1M4G A;  2ZW7 A;  3SHP A;  5CNP A;  4CGM A;  1K4J A;  2FS5 A;  3P2F A;  1CM0 A;  3IGR A;  4CYO A;  4MI4 A;  3TOA A;  4QVT A;  4QC6 A;  3OWC A;  1VHS A;  1YX0 A;  2DPT A;  5AG4 A;  3C26 A;  4KVX A;  1ZO0 A;  1SQH A;  3DSB A;  4MFQ A;  4F6A A;  4PK3 A;  3G8W A;  3H5Z A;  4CGL A;  4FD4 A;  4QUS A;  2CNT A;  3FBU A;  1MJ9 A;  2Z3N A;  5EBV A;  1Y9W A;  4C7I A;  4A95 A;  5E96 A;  5GCN A;  2BEI A;  4IUS A;  5G20 A;  3GY9 A;  2OH1 A;  4KOS A;  3VWD A;  4PV6 A;  4AG9 A;  2B4B A;  1Z4E A;  3IU2 A;  3CXP A;  1S7L A;  1M44 A;  1NMT A;  3TFY A;  3DDD A;  3IWE A;  4AB7 A;  3D2P A;  3R95 A;  2ZPA A;  4GS4 A;  2REE A;  4MFZ A;  1R57 A;  1GHE A;  2Y0M A;  4LX9 A;  4KOU A;  2Z0Z A;  1P4N A;  2Z3L A;  1IYL A;  2H5M A;  2PDO A;  2HQY A;  2R8V A;  5AG6 A;  1I12 A;  1S60 A;  5HH1 A;  1YVO A;  3K9U A;  5J8C A;  2ZXV A;  5C88 A;  4UFW A;  4OLL A;  1M4D A;  3IWG A;  2GAN A;  3JVN A;  3R9E A;  4IF5 A;  2F5I A;  2PR1 A;  4JD6 A;  2WPW A;  4X5K A;  5G21 A;  4F0X A;  5AG7 A;  4CAV A;  5F49 A;  1XF8 A;  3FRM A;  3CXQ A;  5IB0 A;  5JPH A;  1YLE A;  4YGO A;  1WK4 A;  1IB1 E;  1Q2Y A;  4MHD A;  2REF A;  4NCZ A;  2D4P A;  1S7K A;  3N7Z A;  3TE4 A;  3MGD A;  2B3V A;  2BSW A;  3W6X A;  3FXT A;  4AVB A;  2B3U A;  4MY3 A;  4ZGY B;  2ZW6 A;  2AJ6 A;  4R87 A;  2RC4 A;  2IL4 A;  3W91 A;  2OU2 A;  4Q36 A;  4UWI A;  4JWP A;  4HNW B;  4A2Z A;  3R9F A;  3FB3 A;  3S6K A;  4CS0 B;  2CNM A;  4HKF A;  1KUV A;  3FNC A;  4MY0 A;  3PP9 A;  5BWA B;  2PR8 A;  4OAD A;  4MFP A;  2JEV A;  4NSQ A;  2Q4Y A;  4RI1 A;  4CAF A;  4C2Y A;  5F48 A;  2JDD A;  2G3A A;  3JUW A;  2PRB A;  4U5Y A;  2DPS A;  2WSA A;  5FVJ A;  4CYP A;  3H4Q A;  4HNY B;  4XPK A;  1Y7R A;  3F8K A;  5F46 A;  2FIA A;  4XPD C;  2Z3P A;  3SXO A;  3IU1 A;  4OAE A;  4AVA A;  1QSM A;  2YNC C;  3FIX A;  3G3S A;  4A31 A;  3DR8 A;  2EVN A;  4E0A A;  4JJX A;  2B4D A;  1IID A;  4JXQ A;  1PUA A;  1B87 A;  4B5P A;  1QSO A;  2WUU A;  4B5O A;  1BO4 A;  3PGP A;  2ATR A;  4XPD B;  2A4N A;  3EFA A;  2FL4 A;  4C68 A;  1Y9K A;  3UY5 A;  1VKC A;  3GKR A;  1V0C A;  4UCP A;  2QIR A;  1Z4R A;  2VBQ A;  4QBJ A;  2B5G B;  2Z11 A;  3BJ7 A;  2QML A;  1I1D A;  3D3S A;  3I9S A;  1S3Z A;  4ZBG A;  4H6U A;  2Z10 A;  3TO9 A;  2PC1 A;  2OZU A;  4XPL A;  3GYA A;  3TO7 A;  2CY2 A;  3CXS A;  4CRZ B;  2OZH A;  1NE9 A;  1ON0 A;  2G0B A;  3P2H A;  4L8A A;  2VQY A;  4NF1 A;  1WWZ A;  3R1K A;  3D2M A;  2Q04 A;  4NEX A;  5H84 A;  4B5P B;  1QSN A;  1NSL A;  4AVC A;  2GE3 A;  3TCV A;  3T9Y A;  4AG7 A;  5A28 A;  1KUX A;  3S6H A;  2CXA A;  4R9M A;  3VWE A;  3JTK A;  4I49 A;  1YK3 A;  4BBH A;  4CGP A;  3T90 A;  4CYN A;  4E2A A;  5IV0 A;  4KS9 A;  1Z9U A;  4XNH B;  4YFJ A;  4M3S A;  1FY7 A;  4KSF A;  4UA3 A;  5HMN A;  2CNS A;  3DNS A;  4PSX A;  5IX3 A;  3EXN A;  2PSW A;  2YND A;  1IYK A;  1KZF A;  4R3K A;  5ISV A;  1P0H A;  3KKW A;  3QB8 A;  2FT0 A;  2FE7 A;  4EVY A;  5I0C A;  4FD5 A;  4MBU A;  4UCN A;  4U9Y A;  3RYO A;  5KTD A;  2VI7 A;  2ZW5 A;  3FYN A;  2B5G A;  4B10 A;  3R96 A;  2P0W A;  3LD2 A;  2Q0Y A;  5A27 A;  4C2Z A;  3DR6 A;  3TO6 A;  2FSR A;  2R1I A;  4KOX A;  1BOB A;  1XMT A;  4A33 A;  4CAW A;  1YR0 A;  1XE4 A;  3EY5 A;  3B8G A;  4JLY A;  4H6Z A;  2B4D B;  4B14 A;  1B6B A;  4A32 A;  3S6F A;  3A9L A;  2P6F A;  1S5K A;  2Z3K A;  2O28 A;  2VXK A;  2YNE A;  2PQ8 A;  3D8P A;  4PSW A;  3W6S A;  4RS2 A;  2HV2 A;  4Y49 B;  1KUY A;  2J8N A;  4UBR A;  5J8F A;  2C27 A;  4KOV A;  2KCW A;  4Y49 C;  1QST A;  1MJB A;  3EO4 A;  2Z3M A;  5H86 A;  4M85 A;  5EC4 A;  1CJW A;  1M4I A;  4CYQ A;  2VEZ A;  4UWJ A;  4KOT A;  4II9 A;  4CAX A;  2Q7B A;  5JQ4 A;  5DWN A;  1RO5 A;  3QAH A;  3LOD A;  3I3G A;  4UFV A;  4E8O A;  2OB0 A;  4DNC A;  4UCM A;  3TT2 A;  2Z3O A;  1MK4 A;  2WPX A;  3BJ8 A;  3E0K A;  2ZW4 A;  3ZJ0 A;  2B58 A;  3SXN A;  4L89 A;  2J8M A;  3PZJ A;  2OZG A;  4FD7 A;  4MFK A;  4KOR A;  1N71 A;  1Q2D A;  4PK2 A;  2YGW A;  2JDC A;  1PU9 A;  4YRH A;  4CAE A;  1L0C A;  2AE6 A;  2EUI A;  2Q4V A;  2P6G A;  4MFJ A;  5AGE A;  4C2X A;  3EC4 A;  1LRZ A;  2I00 A;  4R57 A;  5C82 A;  4NXY A;  4KVM E;  5KTA A;  1M1D A;  5F47 A;  2X7B A;  4K30 A;  4KLV A;  4XNH C;  1IIC A;  4KOY A;  4J3G A;  4ONU A;  4UFX A;  2I79 A;  4LUA A;  4KLW A;  1UFH A;  2R98 A;  4F0Y A;  1S7N A;  4CGO A;  4R3L A;  4FD6 A;  2R7H A;  1Q2C A;  2ARH A;  2G3T A;  4B11 A;  4BMH A;  4KUB A;  2BL1 A;  3S6G A;  2P6E A;  4C7H A;  2FCK A;  2NMT A;  1XEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...