3FIXA

Crystal structure of a putative n-acetyltransferase (ta0374) from thermoplasma acidophilum
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
165
structure length
165
Chain Sequence
YFQSNAMSIEIRKLSIEDLETLIEVARESWKWTYAGIYSEEYIESWIREKYSKEKLLNEIVRSQSNLDILFLGAFADSTLIGFIELKIIANKAELLRLYLKPEYTHKKIGKTLLLEAEKIMKKKGILECRLYVHRQNSVGFSFYYKNGFKVEDTDGSDFIMEKKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the novel PaiA N-acetyltransferase from Thermoplasma acidophilum involved in the negative control of sporulation and degradative enzyme production.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Transferase
molecule keywords N-ACETYLTRANSFERASE
total genus 53
structure length 165
sequence length 165
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2008-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3fixA00
2VI7A 4H6ZA 1RXTA 2OZUA 3CXQA 1MJ9A 5H84A 3JUWA 4Y49B 3E0KA 5KTAA 4H6UA 3V8IA 4E2AA 2A4NA 3FB3A 2VZZA 4R57A 4KOVA 1PU9A 4KUBA 2Q04A 4E0AA 1Q2DA 5FVJA 4RI1A 2PR1A 4LX9A 4AG7A 2ZW7A 1XMTA 3EY5A 1QSRA 2BUEA 2B58A 4PSXA 1YVOA 2ARHA 2FSRA 4KVOE 1M4IA 2I00A 2REEA 2FL4A 1NMTA 4CRYB 1M1DA 1Q2CA 1OZPA 2O28A 4KLVA 4LUAA 4JD6A 2FCKA 3G8WA 3I9SA 3DSBA 3SHPA 1Y9KA 4DNCA 4RS2A 2Q44A 1M44A 5I0CA 5DWMA 3TO7A 4IF5A 4NSQA 1YREA 3R95A 1P4NA 2ATRA 1P0HA 2REFA 4KOXA 2FS5A 1S7KA 2B4DB 4JLYA 2Q0YA 1MJAA 1IYKA 4FD6A 1N71A 4MHDA 3EC4A 1K4JA 3CXSA 4KOYA 1KUYA 2Z0ZA 3D3SA 2JDCA 4PV6A 4QB9A 5HH1A 3B8GA 2Q4VA 3GYAA 3W91A 4R87A 1S7LA 1RO5A 2P6FA 3G3SA 1Z4EA 1Z4RA 4R3LA 1MK4A 2HV2A 4K30A 2G3AA 1XF8A 2B5GB 5GCNA 1ON0A 4XPDB 2IL4A 2VBQA 4KUAA 1GHEA 5IV0A 2HUZA 2OZHA 2P6EA 3EFAA 3T9YA 3TFYA 1M4DA 4F0YA 4OLLA 3KKWA 3R96A 2Q7BA 1YR0A 2VQYA 4KZTA 1YK3A 4UA3A 1VKCA 1NSLA 4XPKA 4J3GA 1UFHA 2G3TA 2I79A 4KOWA 1S7NA 3PZJA 2OU2A 3F0AA 3S6GA 4JXQA 3UY5A 5ISVA 2R8VA 4AB7A 5JPHA 3BJ8A 2WPWA 4L8AA 1TIQA 2BL1A 2ZPAA 2BSWA 4FD4A 4CS0B 1IICA 3S6HA 2PR8A 1NE9A 1CM0A 2VZYA 4NF1A 1XEBA 4U9ZA 3GKRA 3LD2A 4AVBA 2D4OA 4NCZA 1S3ZA 4UBRA 2F5IA 3DR6A 3D2PA 3TOAA 2CNSA 2BEIA 1IYLA 2AE6A 4CAXA 3TT2A 2VEZA 4JWPA 3SXNA 2J8NA 4EVYA 4PK3A 3C26A 2B4DA 4QC6A 4GS4A 2JDDA 3S6KA 4MBUA 1QSNA 4PSWA 1S5KA 4R3KA 5DWNA 2WPXA 4QUSA 2J8RA 4E8OA 3LODA 3JVNA 4OAEA 2PQ8A 3T90A 1SQHA 4XNHC 2Z11A 3NE7A 2B3UA 3VWDA 3FRMA 1B87A 2FE7A 3IWGA 2EUIA 2OZGA 3P2HA 1WK4A 1PUAA 4ORFA 3TOBA 4HKFA 2JEVA 2K5TA 3R9GA 4XNHB 3TE4A 2QIRA 1MJBA 1I12A 3FNCA 3D2MA 4B5PB 2G0BA 5E96A 5IX3A 1YLEA 3QB8A 3MGDA 4ZBGA 4M3SA 3TTHA 3BJ7A 2B5GA 1CJWA 3OWCA 2CY2A 2ZW6A 1BOBA 3IGRA 3TCVA 2GIVA 1J4JA 1KUXA 3EXNA 5F47A 1R57A 1QSMA 2PSWA 4KOUA 2ZXVA 4QBJA 3D8PA 4BMHA 4H89A 4KORA 5HMNA 4FD7A 2KCWA 3K9UA 1XE4A 3WR7A 2X7BA 1B6BA 2R98A 4KOTA 3ZZIA 3P2FA 4I49A 5EC4A 4UWJA 4X5KA 5CNPA 1Y7RA 4KVME 1VHSA 5F49A 4JXRA 4YFJA 1FY7A 3W6SA 4CAVA 2HQYA 1QSOA 2VXKA 3SXOA 4CRZB 2ZW5A 3F8KA 5C88A 3TO9A 2FIAA 2DXQA 3N7ZA 4R9MA 2PDOA 2GE3A 4CAWA 5F48A 4MI4A 1L0CA 2Q4YA 1BO4A 1YVKA 2FXFA 4IUSA 5J8CA 5C82A 2PRBA 4OADA 4XPDC 1YGHA 3ZJ0A 3FBUA 1I21A 4B5OA 4MY0A 2CNMA 2B3VA 4UWIA 5J8FA 3QAHA 1KUVA 2R7HA 2PC1A 4L89A 3GY9A 4U5YA 4MJ8A 1YX0A 1S60A 4HNXB 1M4GA 1WWZA 2NMTA 3DR8A 5KTDA 2CNTA 3R9EA 4MY3A 5IB0A 4KOSA 1Z9UA 2J8MA 3DNSA 1QSTA 5KTCA 3R9FA 3R1KA 2P0WA 2P6GA 4Y49C 3DDDA 3H4QA 3I3GA 4HNYB 3CXPA 4PK2A 4KVXA 5H86A 3S6FA 4JJXA 1LRZA 2Y0MA 1I1DA 4XPLA 4YGOA 2AJ6A 4M85A 1Y9WA 4NEXA 2JLMA 1U6MA 4ONUA 2OB0A 3BLNA 3F5BA 2C27A 1V0CA 4AVAA 4B5PA 3VWEA 3RYOA 4HNWB 4F6AA 5F46A 3PGPA 2B4BA 4AG9A 3FIXA 2EVNA 4AVCA 4NXYA 2RC4A 2QECA 2FT0A 2GANA 3FYNA 5EBVA 3PP9A 1IB1E 1IIDA 1S7FA 2H5MA 3W6XA 4QVTA 2D4PA 4II9A 3FXTA 2R1IA 2QMLA 1XIXA 3EO4A 3TO6A 4YRHA 1Q2YA 1KZFA 2OH1A 4FD5A 4U9YA 4KLWA 2Z10A 2FIWA 5JQ4A 2ZW4A
chains in the Genus database with same CATH superfamily
1ZO0A 2VI7A 3IFEA 3WT4A 4H6ZA 1RXTA 2NYQA 2OZUA 2XEJA 3CXQA 1MJ9A 4MCQA 3FEDA 1HEEA 2ZELA 5H84A 3JUWA 3NFZA 4Y49B 1YLOA 4G1PA 2XEGA 3E0KA 5KTAA 4H6UA 1XFOA 4NFRA 3FJUA 3FX6A 1Z8XA 4UCMA 3V8IA 2I3CA 4E2AA 4UEEA 1XMBA 2PJ9A 2A4NA 3FB3A 2VZZA 4TNUA 4R57A 2ANPA 4KOVA 1PU9A 4MCRA 4KUBA 3B3VA 3FVLA 2Q04A 2ZOFA 1HDUA 1Q2DA 4MHNA 5FVJA 4BINA 4C7HA 4E0AA 2BCOA 5JGFA 1TKJA 4RI1A 2YNEA 2PR1A 4LX9A 4AG7A 4C2ZA 2ZW7A 3KQXA 5G20A 1XMTA 3EY5A 1QSRA 2PIYA 2BUEA 2GLFA 2DF5A 1PYTB 2B58A 2WYRA 1YVOA 2ARHA 2FSRA 3IU2A 4PSXA 5BWAB 3KASA 4KVOE 1M4IA 1RTQA 2JEWA 2GU2A 2I00A 2REEA 4CGNA 3B35A 2FL4A 3PBEA 1NMTA 5K8MA 4CRYB 1M1DA 1Q2CA 1JWQA 4OP4A 1OZPA 2O28A 5D29A 4PQAA 3SJXA 2C6PA 1VIXA 4KLVA 4LUAA 4JD6A 1LAMA 2FCKA 3G8WA 2PJ0A 3DSBA 3I9SA 1Y9KA 4PXEA 3SHPA 1X10A 4DNCA 1Y0RA 2NSMA 3PFOA 4K3NA 4PPZA 4RS2A 2Q44A 1CP6A 4UIAA 1M44A 5I0CA 5DWMA 3WC6A 3TO7A 4IF5A 4NSQA 3PB4X 1YREA 1H8LA 3SJGA 5IB9A 3IO1A 1P4NA 2Z3PA 3R95A 4DYOA 3H8EA 4NGQA 1VGYA 2ATRA 1P0HA 2GREA 3TX8A 2REFA 5J8FA 2V8GA 4KOXA 5CPAA 1X12A 2FS5A 3SI0A 1S7KA 2B4DB 4JLYA 1BPNA 1Q7LA 2Q0YA 4OC4A 1MJAA 3L2NA 4C2XA 2AFXA 4P4BA 1IYKA 4FD6A 3S9MA 4CAEA 1N71A 1ZG8A 4MHDA 3EC4A 1K4JA 3CXSA 5D8NA 4KOYA 5LYDA 1KUYA 2Z0ZA 2PJ8A 3D3SA 5ELYA 4UFWA 4KSIA 3S9NA 2JDCA 4PV6A 1DE4C 2OR4A 4QB9A 1QMUA 3RBUA 4ZGYB 5HH1A 3B8GA 2Q4VA 1DTDA 4MFQA 3GYAA 5CBMA 3B2YA 5K8OA 3W91A 4R87A 1S7LA 1GYTA 1RO5A 2Q43A 2P6FA 3D67A 3IEHA 3G3SA 3QNVA 1Z4EA 1Z4RA 3WC5A 4MCPA 4R3LA 1MK4A 3LWUA 4MFKA 2HV2A 4K30A 5LRKA 1BAVA 2G3AA 2PJ7A 1ZG7A 1XF8A 4UEFA 4UCNA 3RZAA 2B5GB 2QVPA 5GCNA 3V38A 1LCPA 1ON0A 2C6CA 4XPDB 1F2PA 3PB9X 5EMIA 2IL4A 2VBQA 3LACA 4KUAA 1XBUA 5A28A 1GHEA 5AG7A 1YSJA 2PRQA 5JH9A 3PB6X 4GM5A 3IU1A 4DJLA 1IGBA 5IV0A 2HUZA 2OZHA 2P6EA 3EFAA 3HLPA 1ELMP 2EK8A 3T9YA 4BD9A 5AG6A 3TFYA 1M4DA 1R43A 4F0YA 4OLLA 4A94A 2ZEMA 3KKWA 3R96A 2Q7BA 4MRIA 1TF9A 2F8HA 3VATA 1F57A 1YR0A 2VQYA 4KZTA 1ZLHA 4F0XA 2ZEPA 3KZWA 1TKHA 1YK3A 1UWYA 2C6GA 4UA3A 1LAPA 1IOFA 1VKCA 1Z2LA 4M6GA 1NSLA 4XPKA 4B14A 4J3GA 4TWEA 2CXAA 1UFHA 2G3TA 2I79A 2AFZA 1CBXA 4KOWA 2EWBA 1S7NA 4A38A 3PZJA 1BPMA 1M4LA 1FNOA 3RO0A 2OU2A 2PVWA 3F0AA 3S6GA 4R7MA 2PJCA 4NGMA 4JXQA 3UY5A 5ISVA 2R8VA 4AB7A 3PFEA 4R8FA 2O4HA 3A9LA 4KSFA 2PCUA 5JPHA 3BJ8A 2EBJA 2WPWA 4L8AA 8CPAA 4P4FA 4Q36A 1CG2A 1TIQA 2BL1A 4M6HA 2ZPAA 2BSWA 3D4UA 1AMPA 3D66A 4FD4A 2CTBA 4NJRA 4Q7AA 4CS0B 1IICA 4UFXA 3S6HA 2PR8A 1NE9A 3I1UA 1CM0A 3GIUA 2VZYA 4WWVA 4NF1A 2RB7A 1XEBA 4U9ZA 4X8IA 5J1QA 1ARMA 2PJAA 3K2KA 4FUUA 3GKRA 3LD2A 4MHZA 4AVBA 4C7IA 5K8PA 2D4OA 4NCZA 4WJBA 2Q51A 1S3ZA 4UBRA 2F5IA 1AUGA 3GLJA 4OIDA 3DR6A 3D2PA 3B3WA 3TOAA 2CNSA 4JZ0A 2BEIA 3KHXA 1IYLA 3KI9A 2AFMA 2PJ4A 1YW4A 3BI1A 2AE6A 4H2KA 5LRJA 4CAXA 1R3NA 3B3TA 3TT2A 2BOAA 1XJOA 2VEZA 4JWPA 3SXNA 5LYIA 1Z8WA 2J8NA 4EVYA 4PK3A 4RN7A 3C26A 2IQ6A 2B4DA 4QC6A 4GS4A 3RNZA 3D7GA 3CPXA 2JDDA 3S6KA 4MBUA 1QSNA 1TXRA 4ZY0A 4PSWA 3WABA 1S5KA 3RAMA 1Z8LA 4R3KA 2WPXA 4QUSA 2J8RA 5DWNA 4E8OA 3LODA 1QQ9A 2DPSA 3JVNA 4IHMA 4OAEA 4HPSA 2PQ8A 3T90A 4A30A 5DS0A 4P4EA 4P4DA 3PBBA 4UFVA 1PCAA 1SQHA 2DPTA 1BLLE 4P4IA 4XNHC 1LANA 3PEIA 2Z11A 3NE7A 2B3UA 3KR4A 5G21A 3VWDA 3DLJA 4YWYA 3FRMA 1B87A 6CPAA 2FE7A 4ZX9A 1NSAA 2Q7SA 3IWGA 4NGRA 2EUIA 2OZGA 1Z5RA 3P2HA 1WK4A 1PUAA 4ORFA 1Z8TA 2VL1A 2GLJA 2YGWA 3WC7A 3TOBA 4HKFA 1IOIA 2JEVA 2K5TA 3R9GA 4C2YA 4XNHB 4ZX8A 4IAVA 1Y0YA 3TE4A 2CIJA 4LQGA 2QIRA 4A95A 5HVGA 2OOTA 1MJBA 7CPAA 1I12A 1IU8A 2PE3A 3D2MA 3FNCA 4B5PB 4P44A 4BBHA 4Z65A 2G0BA 1OBRA 2AFUA 3K9TA 5E96A 2PJ3A 4MHPA 1YMEA 5IX3A 4Q38A 1CPSA 4OMEA 1LFWA 1YLEA 2O53A 2V77A 3QB8A 2JBKA 2CF4A 3MGDA 4ZBGA 3KHZA 4B12A 4UIBA 2V8DA 4M3SA 2IMOA 4UF4A 1IY7A 3TTHA 5K8NA 3BJ7A 3MRUA 2B5GA 4R76A 1CX8A 5LYLA 1CJWA 4IK2A 4EWTA 3S9LA 4OC5A 1FT7A 2CY2A 3OWCA 4ZYQA 1Y7EA 2ZW6A 1BOBA 3IGRA 3TCVA 2GIVA 1J4JA 3KQZA 2FVGA 1KUXA 3EXNA 2GFQA 5F47A 1R57A 1QSMA 2PSWA 4KOUA 4P10A 3H8GA 4AXVA 2ZXVA 3N5FA 4OC2A 4A31A 4QBJA 3D8PA 4CPAA 1YW6A 3VARA 3VH9A 4NGNA 4BMHA 4CYQA 2C1CA 2ZENA 4H89A 3FEEA 4KORA 5LRGA 5HXDA 4MXUA 3H5ZA 3PB8X 3ISXA 5HMNA 2F7VA 4M6IA 2XEIA 3LMSA 4B6ZA 5A27A 5G1ZA 1XRYA 2YNCC 3JTKA 4FD7A 2KCWA 4W9YA 2G9DA 3K9UA 3NE8A 1XE4A 3WR7A 2X7BA 2YNCA 2AFSA 1B6BA 2HB6A 2R98A 3PB7X 4KOTA 3ZZIA 3GUXA 3P2FA 4I49A 5EC4A 4UWJA 3FF3A 4X5KA 4F9VA 5CNPA 1Y7RA 4DUKA 2Z3OA 4KVME 1VHSA 4MFZA 3CZXA 3PRTA 5F49A 4JXRA 4YFJA 4GXHA 2PJ2A 1FY7A 2ZEDA 2ZEEA 3IC1A 2V8HA 3W6SA 3JRUA 4CAVA 2HQYA 4ZI6A 1A2ZA 4KSAA 1QSOA 3BXMA 2VXKA 2ZEHA 3SXOA 4CRZB 1CP7A 3SI2A 1KWMA 2ZW5A 3F8KA 3D68A 4F8ZA 5C88A 1ARLA 2ABZA 2BO9A 5F09A 5AGEA 3TO9A 2DEAA 2FIAA 4ZY2A 2DXQA 2EK9A 2QJ8A 3N7ZA 1TF8A 4OC0A 2PDOA 2GE3A 3NA6A 4R9MA 5F48A 4CAWA 2XEFA 1L0CA 4MI4A 2Q4YA 4RUHA 1BO4A 1JQGA 4NGSA 3NH8A 4OC3A 5HVFA 4PXDA 4X3RA 1YVKA 2FXFA 4IUSA 5J8CA 2PIZA 4NGPA 5C82A 2PRBA 3FECA 4OADA 1YGHA 4XPDC 5THWA 3IWWA 3FBUA 1I21A 3ZJ0A 2Z3LA 3IWEA 4B5OA 4CGMA 1XOVA 4LQ6A 3QAYA 4MY0A 3D7FA 4CYOA 3DGVA 4CYNA 2CNMA 2B3VA 4MHYA 2PJ6A 2RFHA 2ZEFA 1KUVA 2R7HA 1AYEA 2PC1A 3NH5A 3QAHA 4EMEA 2PJBA 3FMCA 3GB0A 3GY9A 4L89A 4MFJA 3B3CA 4U5YA 3D7HA 4MJ8A 1YX0A 1S60A 4P45A 4A32A 4X2TA 2WUUA 4HNXB 4CGOA 1M4GA 1F2OA 1WWZA 5AG5A 1ZLIA 2Z3KA 4P4JA 4CGLA 2NMTA 3DR8A 5KTDA 4EFDA 1HDQA 2CNTA 4MY3A 3R9EA 2ZEOA 4R6TA 4KOSA 1Z9UA 2JBJA 4CGPA 5IB0A 3KGQA 2J8MA 3DNSA 2IJZA 5I4MA 2ZOGA 3D7DA 1QSTA 3SJEA 4C68A 5KTCA 3R9FA 4UCPA 3R1KA 5G22A 3B3SA 4CAFA 4MCSA 2P0WA 2P6GA 4Y49C 3DDDA 5JM6A 3H4QA 3I3GA 4HNYB 4MMOA 2Q4ZA 2YNDA 3CXPA 4PK2A 4B11A 4KVXA 5H86A 3S6FA 4JJXA 1LRZA 4F9UA 2PVVA 1YQEA 4ONWA 2Y0MA 3FH4A 1I1DA 1VHEA 4PXCA 4XPLA 3SJFA 4A2ZA 4A37A 4NGTA 4B10A 4A39A 3BI0A 4YGOA 3H8FA 4O23A 1ELLP 2AJ6A 2AFOA 4M85A 1Y9WA 4UEZA 4NEXA 2JLMA 2WSAA 3SI1A 1U6MA 2V8VA 4ONUA 2OB0A 2Z3NA 3BLNA 3B7IA 3F5BA 1CPXA 1TKFA 2C27A 2CTCA 2ODFA 1V0CA 2PJ1A 2WZNA 2POKA 4AVAA 4B5PA 3VWEA 3RYOA 3CDXA 4HNWB 4JYWA 4F6AA 3HUVA 4NJQA 5F46A 3KR5A 3PGPA 2B4BA 2QYVA 4FAIA 4AG9A 3FIXA 2EVNA 4MFPA 4AVCA 4FBEA 3BHXA 3CPAA 2AFWA 4NXYA 1ZG9A 1EE3P 2QECA 2RC4A 2FT0A 2Z3MA 2GANA 1VHOA 3FYNA 5EBVA 3TC8A 4YU9A 2PJ5A 2J9AA 4FWUA 3PP9A 1IB1E 3IIBA 4OC1A 4PXBA 4A33A 1IIDA 2ZEGA 3MN8A 1S7FA 2H5MA 3NH4A 3W6XA 4QVTA 2D4PA 4P6YA 3CT9A 4II9A 3FXTA 2R1IA 3ISZA 4OKOA 5AG4A 4OIWA 2QMLA 1XIXA 5LYFA 3EO4A 4UWIA 3TO6A 4YRHA 1Q2YA 4KS9A 1KZFA 2EO8A 3V7ZA 2OH1A 4CYPA 3KL9A 4FD5A 3IJ3A 4U9YA 4KLWA 2HC9A 3T8WA 2Z10A 2FIWA 4MFLA 4ZY1A 5JQ4A 2ZW4A 5HVHA 1LOKA 4B13A
chains in the Genus database with same CATH topology
1ZO0A 2VI7A 4H6ZA 1RXTA 2OZUA 3CXQA 1MJ9A 5H84A 3JUWA 4Y49B 3E0KA 5KTAA 4H6UA 4UCMA 3V8IA 4E2AA 2A4NA 3FB3A 2VZZA 4R57A 4KOVA 1PU9A 4KUBA 2Q04A 4E0AA 1Q2DA 4C7HA 5FVJA 4RI1A 2YNEA 2PR1A 4LX9A 4AG7A 4C2ZA 2ZW7A 5G20A 1XMTA 3EY5A 1QSRA 2BUEA 3IU2A 2B58A 4PSXA 1YVOA 2ARHA 2FSRA 5BWAB 4KVOE 1M4IA 2I00A 2REEA 4CGNA 2FL4A 1NMTA 4CRYB 1M1DA 1Q2CA 1OZPA 2O28A 4KLVA 4LUAA 4JD6A 2FCKA 3G8WA 3I9SA 3DSBA 3SHPA 1Y9KA 4DNCA 4RS2A 2Q44A 1M44A 5I0CA 5DWMA 3TO7A 4IF5A 4NSQA 1YREA 3R95A 1P4NA 2Z3PA 2ATRA 1P0HA 2REFA 4KOXA 2FS5A 1S7KA 2B4DB 4JLYA 2Q0YA 1MJAA 4C2XA 1IYKA 4FD6A 4CAEA 1N71A 4MHDA 3EC4A 1K4JA 3CXSA 4KOYA 1KUYA 2Z0ZA 3D3SA 4UFWA 2JDCA 4PV6A 4QB9A 4ZGYB 5HH1A 3B8GA 2Q4VA 4MFQA 3GYAA 3W91A 4R87A 1S7LA 1RO5A 2P6FA 3G3SA 1Z4EA 1Z4RA 4R3LA 1MK4A 4MFKA 2HV2A 4K30A 2G3AA 1XF8A 4UCNA 2B5GB 5GCNA 1ON0A 4XPDB 2IL4A 2VBQA 4KUAA 5A28A 1GHEA 5AG7A 3IU1A 5IV0A 2HUZA 2OZHA 2P6EA 3EFAA 3T9YA 5AG6A 3TFYA 1M4DA 4F0YA 4OLLA 3KKWA 3R96A 2Q7BA 1YR0A 2VQYA 4KZTA 4F0XA 1YK3A 4UA3A 1VKCA 1NSLA 4XPKA 4B14A 4J3GA 2CXAA 1UFHA 2G3TA 2I79A 4KOWA 1S7NA 3PZJA 2OU2A 3F0AA 3S6GA 4JXQA 3UY5A 5ISVA 2R8VA 4AB7A 3A9LA 4KSFA 5JPHA 3BJ8A 2WPWA 4L8AA 4Q36A 1TIQA 2BL1A 2ZPAA 2BSWA 4FD4A 4CS0B 1IICA 4UFXA 3S6HA 2PR8A 1NE9A 1CM0A 2VZYA 4NF1A 1XEBA 4U9ZA 3GKRA 3LD2A 4AVBA 4C7IA 2D4OA 4NCZA 1S3ZA 4UBRA 2F5IA 3DR6A 3D2PA 3TOAA 2CNSA 2BEIA 1IYLA 2AE6A 4CAXA 3TT2A 2VEZA 4JWPA 3SXNA 2J8NA 4EVYA 4PK3A 3C26A 2B4DA 4QC6A 4GS4A 2JDDA 3S6KA 4MBUA 1QSNA 4PSWA 1S5KA 4R3KA 5DWNA 2WPXA 4QUSA 2J8RA 4E8OA 3LODA 3JVNA 2DPSA 4OAEA 2PQ8A 3T90A 4A30A 4UFVA 1SQHA 2DPTA 4XNHC 5G21A 2Z11A 3NE7A 2B3UA 3VWDA 3FRMA 1B87A 2FE7A 3IWGA 2EUIA 2OZGA 3P2HA 1WK4A 1PUAA 4ORFA 2YGWA 3TOBA 4HKFA 2JEVA 2K5TA 3R9GA 4C2YA 4XNHB 3TE4A 4A95A 2QIRA 1MJBA 1I12A 3FNCA 3D2MA 4B5PB 4BBHA 2G0BA 5E96A 5IX3A 4Q38A 1YLEA 3QB8A 3MGDA 4ZBGA 4B12A 4M3SA 3TTHA 3BJ7A 2B5GA 1CJWA 3OWCA 2CY2A 2ZW6A 1BOBA 3IGRA 3TCVA 2GIVA 1J4JA 1KUXA 3EXNA 5F47A 1R57A 1QSMA 2PSWA 4KOUA 2ZXVA 4A31A 4QBJA 3D8PA 4BMHA 4CYQA 4H89A 4KORA 3H5ZA 5HMNA 5A27A 5G1ZA 2YNCC 4FD7A 3JTKA 2KCWA 3K9UA 1XE4A 3WR7A 2X7BA 2YNCA 1B6BA 2R98A 4KOTA 3ZZIA 3P2FA 4I49A 5EC4A 4UWJA 4X5KA 5CNPA 1Y7RA 2Z3OA 4KVME 1VHSA 4MFZA 5F49A 4JXRA 4YFJA 1FY7A 3W6SA 4CAVA 2HQYA 4KSAA 1QSOA 2VXKA 3SXOA 4CRZB 2ZW5A 3F8KA 5C88A 5AGEA 3TO9A 2FIAA 2DXQA 3N7ZA 4R9MA 2PDOA 2GE3A 4CAWA 5F48A 1L0CA 4MI4A 2Q4YA 1BO4A 1YVKA 2FXFA 4IUSA 5J8CA 5C82A 2PRBA 4OADA 4XPDC 1YGHA 3ZJ0A 3FBUA 1I21A 2Z3LA 3IWEA 4B5OA 4CGMA 4MY0A 4CYOA 4CYNA 2CNMA 2B3VA 4UWIA 5J8FA 3QAHA 1KUVA 2R7HA 2PC1A 4MFJA 4L89A 3GY9A 4U5YA 4MJ8A 1YX0A 1S60A 4A32A 2WUUA 4HNXB 4CGOA 1M4GA 5AG5A 1WWZA 2Z3KA 4CGLA 2NMTA 3DR8A 5KTDA 2CNTA 3R9EA 4MY3A 5IB0A 4KOSA 1Z9UA 4CGPA 2J8MA 3DNSA 1QSTA 4C68A 5KTCA 3R9FA 4UCPA 3R1KA 5G22A 4CAFA 2P0WA 2P6GA 4Y49C 3DDDA 3H4QA 3I3GA 4HNYB 2YNDA 3CXPA 4PK2A 4B11A 4KVXA 5H86A 3S6FA 4JJXA 1LRZA 2Y0MA 1I1DA 4XPLA 4A2ZA 4B10A 4YGOA 2AJ6A 4M85A 1Y9WA 4NEXA 2JLMA 2WSAA 1U6MA 4ONUA 2OB0A 2Z3NA 3BLNA 3F5BA 2C27A 1V0CA 4AVAA 4B5PA 3VWEA 3RYOA 4HNWB 4F6AA 5F46A 3PGPA 2B4BA 4AG9A 3FIXA 2EVNA 4MFPA 4AVCA 4NXYA 2RC4A 2QECA 2FT0A 2Z3MA 2GANA 3FYNA 5EBVA 3PP9A 1IB1E 4A33A 1IIDA 1S7FA 2H5MA 3W6XA 4QVTA 2D4PA 4II9A 3FXTA 2R1IA 5AG4A 2QMLA 1XIXA 3EO4A 3TO6A 4YRHA 1Q2YA 4KS9A 1KZFA 2OH1A 4CYPA 4FD5A 4U9YA 4KLWA 2Z10A 2FIWA 4MFLA 5JQ4A 2ZW4A 4B13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VI7 A;  4H6Z A;  1RXT A;  2OZU A;  3CXQ A;  1MJ9 A;  5H84 A;  3JUW A;  4Y49 B;  3E0K A;  5KTA A;  4H6U A;  3V8I A;  4E2A A;  2A4N A;  3FB3 A;  2VZZ A;  4R57 A;  4KOV A;  1PU9 A;  4KUB A;  2Q04 A;  4E0A A;  1Q2D A;  5FVJ A;  4RI1 A;  2PR1 A;  4LX9 A;  4AG7 A;  2ZW7 A;  1XMT A;  3EY5 A;  1QSR A;  2BUE A;  2B58 A;  4PSX A;  1YVO A;  2ARH A;  2FSR A;  4KVO E;  1M4I A;  2I00 A;  2REE A;  2FL4 A;  1NMT A;  4CRY B;  1M1D A;  1Q2C A;  1OZP A;  2O28 A;  4KLV A;  4LUA A;  4JD6 A;  2FCK A;  3G8W A;  3I9S A;  3DSB A;  3SHP A;  1Y9K A;  4DNC A;  4RS2 A;  2Q44 A;  1M44 A;  5I0C A;  5DWM A;  3TO7 A;  4IF5 A;  4NSQ A;  1YRE A;  3R95 A;  1P4N A;  2ATR A;  1P0H A;  2REF A;  4KOX A;  2FS5 A;  1S7K A;  2B4D B;  4JLY A;  2Q0Y A;  1MJA A;  1IYK A;  4FD6 A;  1N71 A;  4MHD A;  3EC4 A;  1K4J A;  3CXS A;  4KOY A;  1KUY A;  2Z0Z A;  3D3S A;  2JDC A;  4PV6 A;  4QB9 A;  5HH1 A;  3B8G A;  2Q4V A;  3GYA A;  3W91 A;  4R87 A;  1S7L A;  1RO5 A;  2P6F A;  3G3S A;  1Z4E A;  1Z4R A;  4R3L A;  1MK4 A;  2HV2 A;  4K30 A;  2G3A A;  1XF8 A;  2B5G B;  5GCN A;  1ON0 A;  4XPD B;  2IL4 A;  2VBQ A;  4KUA A;  1GHE A;  5IV0 A;  2HUZ A;  2OZH A;  2P6E A;  3EFA A;  3T9Y A;  3TFY A;  1M4D A;  4F0Y A;  4OLL A;  3KKW A;  3R96 A;  2Q7B A;  1YR0 A;  2VQY A;  4KZT A;  1YK3 A;  4UA3 A;  1VKC A;  1NSL A;  4XPK A;  4J3G A;  1UFH A;  2G3T A;  2I79 A;  4KOW A;  1S7N A;  3PZJ A;  2OU2 A;  3F0A A;  3S6G A;  4JXQ A;  3UY5 A;  5ISV A;  2R8V A;  4AB7 A;  5JPH A;  3BJ8 A;  2WPW A;  4L8A A;  1TIQ A;  2BL1 A;  2ZPA A;  2BSW A;  4FD4 A;  4CS0 B;  1IIC A;  3S6H A;  2PR8 A;  1NE9 A;  1CM0 A;  2VZY A;  4NF1 A;  1XEB A;  4U9Z A;  3GKR A;  3LD2 A;  4AVB A;  2D4O A;  4NCZ A;  1S3Z A;  4UBR A;  2F5I A;  3DR6 A;  3D2P A;  3TOA A;  2CNS A;  2BEI A;  1IYL A;  2AE6 A;  4CAX A;  3TT2 A;  2VEZ A;  4JWP A;  3SXN A;  2J8N A;  4EVY A;  4PK3 A;  3C26 A;  2B4D A;  4QC6 A;  4GS4 A;  2JDD A;  3S6K A;  4MBU A;  1QSN A;  4PSW A;  1S5K A;  4R3K A;  5DWN A;  2WPX A;  4QUS A;  2J8R A;  4E8O A;  3LOD A;  3JVN A;  4OAE A;  2PQ8 A;  3T90 A;  1SQH A;  4XNH C;  2Z11 A;  3NE7 A;  2B3U A;  3VWD A;  3FRM A;  1B87 A;  2FE7 A;  3IWG A;  2EUI A;  2OZG A;  3P2H A;  1WK4 A;  1PUA A;  4ORF A;  3TOB A;  4HKF A;  2JEV A;  2K5T A;  3R9G A;  4XNH B;  3TE4 A;  2QIR A;  1MJB A;  1I12 A;  3FNC A;  3D2M A;  4B5P B;  2G0B A;  5E96 A;  5IX3 A;  1YLE A;  3QB8 A;  3MGD A;  4ZBG A;  4M3S A;  3TTH A;  3BJ7 A;  2B5G A;  1CJW A;  3OWC A;  2CY2 A;  2ZW6 A;  1BOB A;  3IGR A;  3TCV A;  2GIV A;  1J4J A;  1KUX A;  3EXN A;  5F47 A;  1R57 A;  1QSM A;  2PSW A;  4KOU A;  2ZXV A;  4QBJ A;  3D8P A;  4BMH A;  4H89 A;  4KOR A;  5HMN A;  4FD7 A;  2KCW A;  3K9U A;  1XE4 A;  3WR7 A;  2X7B A;  1B6B A;  2R98 A;  4KOT A;  3ZZI A;  3P2F A;  4I49 A;  5EC4 A;  4UWJ A;  4X5K A;  5CNP A;  1Y7R A;  4KVM E;  1VHS A;  5F49 A;  4JXR A;  4YFJ A;  1FY7 A;  3W6S A;  4CAV A;  2HQY A;  1QSO A;  2VXK A;  3SXO A;  4CRZ B;  2ZW5 A;  3F8K A;  5C88 A;  3TO9 A;  2FIA A;  2DXQ A;  3N7Z A;  4R9M A;  2PDO A;  2GE3 A;  4CAW A;  5F48 A;  4MI4 A;  1L0C A;  2Q4Y A;  1BO4 A;  1YVK A;  2FXF A;  4IUS A;  5J8C A;  5C82 A;  2PRB A;  4OAD A;  4XPD C;  1YGH A;  3ZJ0 A;  3FBU A;  1I21 A;  4B5O A;  4MY0 A;  2CNM A;  2B3V A;  4UWI A;  5J8F A;  3QAH A;  1KUV A;  2R7H A;  2PC1 A;  4L89 A;  3GY9 A;  4U5Y A;  4MJ8 A;  1YX0 A;  1S60 A;  4HNX B;  1M4G A;  1WWZ A;  2NMT A;  3DR8 A;  5KTD A;  2CNT A;  3R9E A;  4MY3 A;  5IB0 A;  4KOS A;  1Z9U A;  2J8M A;  3DNS A;  1QST A;  5KTC A;  3R9F A;  3R1K A;  2P0W A;  2P6G A;  4Y49 C;  3DDD A;  3H4Q A;  3I3G A;  4HNY B;  3CXP A;  4PK2 A;  4KVX A;  5H86 A;  3S6F A;  4JJX A;  1LRZ A;  2Y0M A;  1I1D A;  4XPL A;  4YGO A;  2AJ6 A;  4M85 A;  1Y9W A;  4NEX A;  2JLM A;  1U6M A;  4ONU A;  2OB0 A;  3BLN A;  3F5B A;  2C27 A;  1V0C A;  4AVA A;  4B5P A;  3VWE A;  3RYO A;  4HNW B;  4F6A A;  5F46 A;  3PGP A;  2B4B A;  4AG9 A;  3FIX A;  2EVN A;  4AVC A;  4NXY A;  2RC4 A;  2QEC A;  2FT0 A;  2GAN A;  3FYN A;  5EBV A;  3PP9 A;  1IB1 E;  1IID A;  1S7F A;  2H5M A;  3W6X A;  4QVT A;  2D4P A;  4II9 A;  3FXT A;  2R1I A;  2QML A;  1XIX A;  3EO4 A;  3TO6 A;  4YRH A;  1Q2Y A;  1KZF A;  2OH1 A;  4FD5 A;  4U9Y A;  4KLW A;  2Z10 A;  2FIW A;  5JQ4 A;  2ZW4 A; 
#chains in the Genus database with same CATH topology
 1ZO0 A;  2VI7 A;  3IFE A;  3WT4 A;  4H6Z A;  1RXT A;  2NYQ A;  2OZU A;  2XEJ A;  3CXQ A;  1MJ9 A;  4MCQ A;  3FED A;  1HEE A;  2ZEL A;  5H84 A;  3JUW A;  3NFZ A;  4Y49 B;  1YLO A;  4G1P A;  2XEG A;  3E0K A;  5KTA A;  4H6U A;  1XFO A;  4NFR A;  3FJU A;  3FX6 A;  1Z8X A;  4UCM A;  3V8I A;  2I3C A;  4E2A A;  4UEE A;  1XMB A;  2PJ9 A;  2A4N A;  3FB3 A;  2VZZ A;  4TNU A;  4R57 A;  2ANP A;  4KOV A;  1PU9 A;  4MCR A;  4KUB A;  3B3V A;  3FVL A;  2Q04 A;  2ZOF A;  1HDU A;  1Q2D A;  4MHN A;  5FVJ A;  4BIN A;  4C7H A;  4E0A A;  2BCO A;  5JGF A;  1TKJ A;  4RI1 A;  2YNE A;  2PR1 A;  4LX9 A;  4AG7 A;  4C2Z A;  2ZW7 A;  3KQX A;  5G20 A;  1XMT A;  3EY5 A;  1QSR A;  2PIY A;  2BUE A;  2GLF A;  2DF5 A;  1PYT B;  2B58 A;  2WYR A;  1YVO A;  2ARH A;  2FSR A;  3IU2 A;  4PSX A;  5BWA B;  3KAS A;  4KVO E;  1M4I A;  1RTQ A;  2JEW A;  2GU2 A;  2I00 A;  2REE A;  4CGN A;  3B35 A;  2FL4 A;  3PBE A;  1NMT A;  5K8M A;  4CRY B;  1M1D A;  1Q2C A;  1JWQ A;  4OP4 A;  1OZP A;  2O28 A;  5D29 A;  4PQA A;  3SJX A;  2C6P A;  1VIX A;  4KLV A;  4LUA A;  4JD6 A;  1LAM A;  2FCK A;  3G8W A;  2PJ0 A;  3DSB A;  3I9S A;  1Y9K A;  4PXE A;  3SHP A;  1X10 A;  4DNC A;  1Y0R A;  2NSM A;  3PFO A;  4K3N A;  4PPZ A;  4RS2 A;  2Q44 A;  1CP6 A;  4UIA A;  1M44 A;  5I0C A;  5DWM A;  3WC6 A;  3TO7 A;  4IF5 A;  4NSQ A;  3PB4 X;  1YRE A;  1H8L A;  3SJG A;  5IB9 A;  3IO1 A;  1P4N A;  2Z3P A;  3R95 A;  4DYO A;  3H8E A;  4NGQ A;  1VGY A;  2ATR A;  1P0H A;  2GRE A;  3TX8 A;  2REF A;  5J8F A;  2V8G A;  4KOX A;  5CPA A;  1X12 A;  2FS5 A;  3SI0 A;  1S7K A;  2B4D B;  4JLY A;  1BPN A;  1Q7L A;  2Q0Y A;  4OC4 A;  1MJA A;  3L2N A;  4C2X A;  2AFX A;  4P4B A;  1IYK A;  4FD6 A;  3S9M A;  4CAE A;  1N71 A;  1ZG8 A;  4MHD A;  3EC4 A;  1K4J A;  3CXS A;  5D8N A;  4KOY A;  5LYD A;  1KUY A;  2Z0Z A;  2PJ8 A;  3D3S A;  5ELY A;  4UFW A;  4KSI A;  3S9N A;  2JDC A;  4PV6 A;  1DE4 C;  2OR4 A;  4QB9 A;  1QMU A;  3RBU A;  4ZGY B;  5HH1 A;  3B8G A;  2Q4V A;  1DTD A;  4MFQ A;  3GYA A;  5CBM A;  3B2Y A;  5K8O A;  3W91 A;  4R87 A;  1S7L A;  1GYT A;  1RO5 A;  2Q43 A;  2P6F A;  3D67 A;  3IEH A;  3G3S A;  3QNV A;  1Z4E A;  1Z4R A;  3WC5 A;  4MCP A;  4R3L A;  1MK4 A;  3LWU A;  4MFK A;  2HV2 A;  4K30 A;  5LRK A;  1BAV A;  2G3A A;  2PJ7 A;  1ZG7 A;  1XF8 A;  4UEF A;  4UCN A;  3RZA A;  2B5G B;  2QVP A;  5GCN A;  3V38 A;  1LCP A;  1ON0 A;  2C6C A;  4XPD B;  1F2P A;  3PB9 X;  5EMI A;  2IL4 A;  2VBQ A;  3LAC A;  4KUA A;  1XBU A;  5A28 A;  1GHE A;  5AG7 A;  1YSJ A;  2PRQ A;  5JH9 A;  3PB6 X;  4GM5 A;  3IU1 A;  4DJL A;  1IGB A;  5IV0 A;  2HUZ A;  2OZH A;  2P6E A;  3EFA A;  3HLP A;  1ELM P;  2EK8 A;  3T9Y A;  4BD9 A;  5AG6 A;  3TFY A;  1M4D A;  1R43 A;  4F0Y A;  4OLL A;  4A94 A;  2ZEM A;  3KKW A;  3R96 A;  2Q7B A;  4MRI A;  1TF9 A;  2F8H A;  3VAT A;  1F57 A;  1YR0 A;  2VQY A;  4KZT A;  1ZLH A;  4F0X A;  2ZEP A;  3KZW A;  1TKH A;  1YK3 A;  1UWY A;  2C6G A;  4UA3 A;  1LAP A;  1IOF A;  1VKC A;  1Z2L A;  4M6G A;  1NSL A;  4XPK A;  4B14 A;  4J3G A;  4TWE A;  2CXA A;  1UFH A;  2G3T A;  2I79 A;  2AFZ A;  1CBX A;  4KOW A;  2EWB A;  1S7N A;  4A38 A;  3PZJ A;  1BPM A;  1M4L A;  1FNO A;  3RO0 A;  2OU2 A;  2PVW A;  3F0A A;  3S6G A;  4R7M A;  2PJC A;  4NGM A;  4JXQ A;  3UY5 A;  5ISV A;  2R8V A;  4AB7 A;  3PFE A;  4R8F A;  2O4H A;  3A9L A;  4KSF A;  2PCU A;  5JPH A;  3BJ8 A;  2EBJ A;  2WPW A;  4L8A A;  8CPA A;  4P4F A;  4Q36 A;  1CG2 A;  1TIQ A;  2BL1 A;  4M6H A;  2ZPA A;  2BSW A;  3D4U A;  1AMP A;  3D66 A;  4FD4 A;  2CTB A;  4NJR A;  4Q7A A;  4CS0 B;  1IIC A;  4UFX A;  3S6H A;  2PR8 A;  1NE9 A;  3I1U A;  1CM0 A;  3GIU A;  2VZY A;  4WWV A;  4NF1 A;  2RB7 A;  1XEB A;  4U9Z A;  4X8I A;  5J1Q A;  1ARM A;  2PJA A;  3K2K A;  4FUU A;  3GKR A;  3LD2 A;  4MHZ A;  4AVB A;  4C7I A;  5K8P A;  2D4O A;  4NCZ A;  4WJB A;  2Q51 A;  1S3Z A;  4UBR A;  2F5I A;  1AUG A;  3GLJ A;  4OID A;  3DR6 A;  3D2P A;  3B3W A;  3TOA A;  2CNS A;  4JZ0 A;  2BEI A;  3KHX A;  1IYL A;  3KI9 A;  2AFM A;  2PJ4 A;  1YW4 A;  3BI1 A;  2AE6 A;  4H2K A;  5LRJ A;  4CAX A;  1R3N A;  3B3T A;  3TT2 A;  2BOA A;  1XJO A;  2VEZ A;  4JWP A;  3SXN A;  5LYI A;  1Z8W A;  2J8N A;  4EVY A;  4PK3 A;  4RN7 A;  3C26 A;  2IQ6 A;  2B4D A;  4QC6 A;  4GS4 A;  3RNZ A;  3D7G A;  3CPX A;  2JDD A;  3S6K A;  4MBU A;  1QSN A;  1TXR A;  4ZY0 A;  4PSW A;  3WAB A;  1S5K A;  3RAM A;  1Z8L A;  4R3K A;  2WPX A;  4QUS A;  2J8R A;  5DWN A;  4E8O A;  3LOD A;  1QQ9 A;  2DPS A;  3JVN A;  4IHM A;  4OAE A;  4HPS A;  2PQ8 A;  3T90 A;  4A30 A;  5DS0 A;  4P4E A;  4P4D A;  3PBB A;  4UFV A;  1PCA A;  1SQH A;  2DPT A;  1BLL E;  4P4I A;  4XNH C;  1LAN A;  3PEI A;  2Z11 A;  3NE7 A;  2B3U A;  3KR4 A;  5G21 A;  3VWD A;  3DLJ A;  4YWY A;  3FRM A;  1B87 A;  6CPA A;  2FE7 A;  4ZX9 A;  1NSA A;  2Q7S A;  3IWG A;  4NGR A;  2EUI A;  2OZG A;  1Z5R A;  3P2H A;  1WK4 A;  1PUA A;  4ORF A;  1Z8T A;  2VL1 A;  2GLJ A;  2YGW A;  3WC7 A;  3TOB A;  4HKF A;  1IOI A;  2JEV A;  2K5T A;  3R9G A;  4C2Y A;  4XNH B;  4ZX8 A;  4IAV A;  1Y0Y A;  3TE4 A;  2CIJ A;  4LQG A;  2QIR A;  4A95 A;  5HVG A;  2OOT A;  1MJB A;  7CPA A;  1I12 A;  1IU8 A;  2PE3 A;  3D2M A;  3FNC A;  4B5P B;  4P44 A;  4BBH A;  4Z65 A;  2G0B A;  1OBR A;  2AFU A;  3K9T A;  5E96 A;  2PJ3 A;  4MHP A;  1YME A;  5IX3 A;  4Q38 A;  1CPS A;  4OME A;  1LFW A;  1YLE A;  2O53 A;  2V77 A;  3QB8 A;  2JBK A;  2CF4 A;  3MGD A;  4ZBG A;  3KHZ A;  4B12 A;  4UIB A;  2V8D A;  4M3S A;  2IMO A;  4UF4 A;  1IY7 A;  3TTH A;  5K8N A;  3BJ7 A;  3MRU A;  2B5G A;  4R76 A;  1CX8 A;  5LYL A;  1CJW A;  4IK2 A;  4EWT A;  3S9L A;  4OC5 A;  1FT7 A;  2CY2 A;  3OWC A;  4ZYQ A;  1Y7E A;  2ZW6 A;  1BOB A;  3IGR A;  3TCV A;  2GIV A;  1J4J A;  3KQZ A;  2FVG A;  1KUX A;  3EXN A;  2GFQ A;  5F47 A;  1R57 A;  1QSM A;  2PSW A;  4KOU A;  4P10 A;  3H8G A;  4AXV A;  2ZXV A;  3N5F A;  4OC2 A;  4A31 A;  4QBJ A;  3D8P A;  4CPA A;  1YW6 A;  3VAR A;  3VH9 A;  4NGN A;  4BMH A;  4CYQ A;  2C1C A;  2ZEN A;  4H89 A;  3FEE A;  4KOR A;  5LRG A;  5HXD A;  4MXU A;  3H5Z A;  3PB8 X;  3ISX A;  5HMN A;  2F7V A;  4M6I A;  2XEI A;  3LMS A;  4B6Z A;  5A27 A;  5G1Z A;  1XRY A;  2YNC C;  3JTK A;  4FD7 A;  2KCW A;  4W9Y A;  2G9D A;  3K9U A;  3NE8 A;  1XE4 A;  3WR7 A;  2X7B A;  2YNC A;  2AFS A;  1B6B A;  2HB6 A;  2R98 A;  3PB7 X;  4KOT A;  3ZZI A;  3GUX A;  3P2F A;  4I49 A;  5EC4 A;  4UWJ A;  3FF3 A;  4X5K A;  4F9V A;  5CNP A;  1Y7R A;  4DUK A;  2Z3O A;  4KVM E;  1VHS A;  4MFZ A;  3CZX A;  3PRT A;  5F49 A;  4JXR A;  4YFJ A;  4GXH A;  2PJ2 A;  1FY7 A;  2ZED A;  2ZEE A;  3IC1 A;  2V8H A;  3W6S A;  3JRU A;  4CAV A;  2HQY A;  4ZI6 A;  1A2Z A;  4KSA A;  1QSO A;  3BXM A;  2VXK A;  2ZEH A;  3SXO A;  4CRZ B;  1CP7 A;  3SI2 A;  1KWM A;  2ZW5 A;  3F8K A;  3D68 A;  4F8Z A;  5C88 A;  1ARL A;  2ABZ A;  2BO9 A;  5F09 A;  5AGE A;  3TO9 A;  2DEA A;  2FIA A;  4ZY2 A;  2DXQ A;  2EK9 A;  2QJ8 A;  3N7Z A;  1TF8 A;  4OC0 A;  2PDO A;  2GE3 A;  3NA6 A;  4R9M A;  5F48 A;  4CAW A;  2XEF A;  1L0C A;  4MI4 A;  2Q4Y A;  4RUH A;  1BO4 A;  1JQG A;  4NGS A;  3NH8 A;  4OC3 A;  5HVF A;  4PXD A;  4X3R A;  1YVK A;  2FXF A;  4IUS A;  5J8C A;  2PIZ A;  4NGP A;  5C82 A;  2PRB A;  3FEC A;  4OAD A;  1YGH A;  4XPD C;  5THW A;  3IWW A;  3FBU A;  1I21 A;  3ZJ0 A;  2Z3L A;  3IWE A;  4B5O A;  4CGM A;  1XOV A;  4LQ6 A;  3QAY A;  4MY0 A;  3D7F A;  4CYO A;  3DGV A;  4CYN A;  2CNM A;  2B3V A;  4MHY A;  2PJ6 A;  2RFH A;  2ZEF A;  1KUV A;  2R7H A;  1AYE A;  2PC1 A;  3NH5 A;  3QAH A;  4EME A;  2PJB A;  3FMC A;  3GB0 A;  3GY9 A;  4L89 A;  4MFJ A;  3B3C A;  4U5Y A;  3D7H A;  4MJ8 A;  1YX0 A;  1S60 A;  4P45 A;  4A32 A;  4X2T A;  2WUU A;  4HNX B;  4CGO A;  1M4G A;  1F2O A;  1WWZ A;  5AG5 A;  1ZLI A;  2Z3K A;  4P4J A;  4CGL A;  2NMT A;  3DR8 A;  5KTD A;  4EFD A;  1HDQ A;  2CNT A;  4MY3 A;  3R9E A;  2ZEO A;  4R6T A;  4KOS A;  1Z9U A;  2JBJ A;  4CGP A;  5IB0 A;  3KGQ A;  2J8M A;  3DNS A;  2IJZ A;  5I4M A;  2ZOG A;  3D7D A;  1QST A;  3SJE A;  4C68 A;  5KTC A;  3R9F A;  4UCP A;  3R1K A;  5G22 A;  3B3S A;  4CAF A;  4MCS A;  2P0W A;  2P6G A;  4Y49 C;  3DDD A;  5JM6 A;  3H4Q A;  3I3G A;  4HNY B;  4MMO A;  2Q4Z A;  2YND A;  3CXP A;  4PK2 A;  4B11 A;  4KVX A;  5H86 A;  3S6F A;  4JJX A;  1LRZ A;  4F9U A;  2PVV A;  1YQE A;  4ONW A;  2Y0M A;  3FH4 A;  1I1D A;  1VHE A;  4PXC A;  4XPL A;  3SJF A;  4A2Z A;  4A37 A;  4NGT A;  4B10 A;  4A39 A;  3BI0 A;  4YGO A;  3H8F A;  4O23 A;  1ELL P;  2AJ6 A;  2AFO A;  4M85 A;  1Y9W A;  4UEZ A;  4NEX A;  2JLM A;  2WSA A;  3SI1 A;  1U6M A;  2V8V A;  4ONU A;  2OB0 A;  2Z3N A;  3BLN A;  3B7I A;  3F5B A;  1CPX A;  1TKF A;  2C27 A;  2CTC A;  2ODF A;  1V0C A;  2PJ1 A;  2WZN A;  2POK A;  4AVA A;  4B5P A;  3VWE A;  3RYO A;  3CDX A;  4HNW B;  4JYW A;  4F6A A;  3HUV A;  4NJQ A;  5F46 A;  3KR5 A;  3PGP A;  2B4B A;  2QYV A;  4FAI A;  4AG9 A;  3FIX A;  2EVN A;  4MFP A;  4AVC A;  4FBE A;  3BHX A;  3CPA A;  2AFW A;  4NXY A;  1ZG9 A;  1EE3 P;  2QEC A;  2RC4 A;  2FT0 A;  2Z3M A;  2GAN A;  1VHO A;  3FYN A;  5EBV A;  3TC8 A;  4YU9 A;  2PJ5 A;  2J9A A;  4FWU A;  3PP9 A;  1IB1 E;  3IIB A;  4OC1 A;  4PXB A;  4A33 A;  1IID A;  2ZEG A;  3MN8 A;  1S7F A;  2H5M A;  3NH4 A;  3W6X A;  4QVT A;  2D4P A;  4P6Y A;  3CT9 A;  4II9 A;  3FXT A;  2R1I A;  3ISZ A;  4OKO A;  5AG4 A;  4OIW A;  2QML A;  1XIX A;  5LYF A;  3EO4 A;  4UWI A;  3TO6 A;  4YRH A;  1Q2Y A;  4KS9 A;  1KZF A;  2EO8 A;  3V7Z A;  2OH1 A;  4CYP A;  3KL9 A;  4FD5 A;  3IJ3 A;  4U9Y A;  4KLW A;  2HC9 A;  3T8W A;  2Z10 A;  2FIW A;  4MFL A;  4ZY1 A;  5JQ4 A;  2ZW4 A;  5HVH A;  1LOK A;  4B13 A; 
#chains in the Genus database with same CATH homology
 1ZO0 A;  2VI7 A;  4H6Z A;  1RXT A;  2OZU A;  3CXQ A;  1MJ9 A;  5H84 A;  3JUW A;  4Y49 B;  3E0K A;  5KTA A;  4H6U A;  4UCM A;  3V8I A;  4E2A A;  2A4N A;  3FB3 A;  2VZZ A;  4R57 A;  4KOV A;  1PU9 A;  4KUB A;  2Q04 A;  4E0A A;  1Q2D A;  4C7H A;  5FVJ A;  4RI1 A;  2YNE A;  2PR1 A;  4LX9 A;  4AG7 A;  4C2Z A;  2ZW7 A;  5G20 A;  1XMT A;  3EY5 A;  1QSR A;  2BUE A;  3IU2 A;  2B58 A;  4PSX A;  1YVO A;  2ARH A;  2FSR A;  5BWA B;  4KVO E;  1M4I A;  2I00 A;  2REE A;  4CGN A;  2FL4 A;  1NMT A;  4CRY B;  1M1D A;  1Q2C A;  1OZP A;  2O28 A;  4KLV A;  4LUA A;  4JD6 A;  2FCK A;  3G8W A;  3I9S A;  3DSB A;  3SHP A;  1Y9K A;  4DNC A;  4RS2 A;  2Q44 A;  1M44 A;  5I0C A;  5DWM A;  3TO7 A;  4IF5 A;  4NSQ A;  1YRE A;  3R95 A;  1P4N A;  2Z3P A;  2ATR A;  1P0H A;  2REF A;  4KOX A;  2FS5 A;  1S7K A;  2B4D B;  4JLY A;  2Q0Y A;  1MJA A;  4C2X A;  1IYK A;  4FD6 A;  4CAE A;  1N71 A;  4MHD A;  3EC4 A;  1K4J A;  3CXS A;  4KOY A;  1KUY A;  2Z0Z A;  3D3S A;  4UFW A;  2JDC A;  4PV6 A;  4QB9 A;  4ZGY B;  5HH1 A;  3B8G A;  2Q4V A;  4MFQ A;  3GYA A;  3W91 A;  4R87 A;  1S7L A;  1RO5 A;  2P6F A;  3G3S A;  1Z4E A;  1Z4R A;  4R3L A;  1MK4 A;  4MFK A;  2HV2 A;  4K30 A;  2G3A A;  1XF8 A;  4UCN A;  2B5G B;  5GCN A;  1ON0 A;  4XPD B;  2IL4 A;  2VBQ A;  4KUA A;  5A28 A;  1GHE A;  5AG7 A;  3IU1 A;  5IV0 A;  2HUZ A;  2OZH A;  2P6E A;  3EFA A;  3T9Y A;  5AG6 A;  3TFY A;  1M4D A;  4F0Y A;  4OLL A;  3KKW A;  3R96 A;  2Q7B A;  1YR0 A;  2VQY A;  4KZT A;  4F0X A;  1YK3 A;  4UA3 A;  1VKC A;  1NSL A;  4XPK A;  4B14 A;  4J3G A;  2CXA A;  1UFH A;  2G3T A;  2I79 A;  4KOW A;  1S7N A;  3PZJ A;  2OU2 A;  3F0A A;  3S6G A;  4JXQ A;  3UY5 A;  5ISV A;  2R8V A;  4AB7 A;  3A9L A;  4KSF A;  5JPH A;  3BJ8 A;  2WPW A;  4L8A A;  4Q36 A;  1TIQ A;  2BL1 A;  2ZPA A;  2BSW A;  4FD4 A;  4CS0 B;  1IIC A;  4UFX A;  3S6H A;  2PR8 A;  1NE9 A;  1CM0 A;  2VZY A;  4NF1 A;  1XEB A;  4U9Z A;  3GKR A;  3LD2 A;  4AVB A;  4C7I A;  2D4O A;  4NCZ A;  1S3Z A;  4UBR A;  2F5I A;  3DR6 A;  3D2P A;  3TOA A;  2CNS A;  2BEI A;  1IYL A;  2AE6 A;  4CAX A;  3TT2 A;  2VEZ A;  4JWP A;  3SXN A;  2J8N A;  4EVY A;  4PK3 A;  3C26 A;  2B4D A;  4QC6 A;  4GS4 A;  2JDD A;  3S6K A;  4MBU A;  1QSN A;  4PSW A;  1S5K A;  4R3K A;  5DWN A;  2WPX A;  4QUS A;  2J8R A;  4E8O A;  3LOD A;  3JVN A;  2DPS A;  4OAE A;  2PQ8 A;  3T90 A;  4A30 A;  4UFV A;  1SQH A;  2DPT A;  4XNH C;  5G21 A;  2Z11 A;  3NE7 A;  2B3U A;  3VWD A;  3FRM A;  1B87 A;  2FE7 A;  3IWG A;  2EUI A;  2OZG A;  3P2H A;  1WK4 A;  1PUA A;  4ORF A;  2YGW A;  3TOB A;  4HKF A;  2JEV A;  2K5T A;  3R9G A;  4C2Y A;  4XNH B;  3TE4 A;  4A95 A;  2QIR A;  1MJB A;  1I12 A;  3FNC A;  3D2M A;  4B5P B;  4BBH A;  2G0B A;  5E96 A;  5IX3 A;  4Q38 A;  1YLE A;  3QB8 A;  3MGD A;  4ZBG A;  4B12 A;  4M3S A;  3TTH A;  3BJ7 A;  2B5G A;  1CJW A;  3OWC A;  2CY2 A;  2ZW6 A;  1BOB A;  3IGR A;  3TCV A;  2GIV A;  1J4J A;  1KUX A;  3EXN A;  5F47 A;  1R57 A;  1QSM A;  2PSW A;  4KOU A;  2ZXV A;  4A31 A;  4QBJ A;  3D8P A;  4BMH A;  4CYQ A;  4H89 A;  4KOR A;  3H5Z A;  5HMN A;  5A27 A;  5G1Z A;  2YNC C;  4FD7 A;  3JTK A;  2KCW A;  3K9U A;  1XE4 A;  3WR7 A;  2X7B A;  2YNC A;  1B6B A;  2R98 A;  4KOT A;  3ZZI A;  3P2F A;  4I49 A;  5EC4 A;  4UWJ A;  4X5K A;  5CNP A;  1Y7R A;  2Z3O A;  4KVM E;  1VHS A;  4MFZ A;  5F49 A;  4JXR A;  4YFJ A;  1FY7 A;  3W6S A;  4CAV A;  2HQY A;  4KSA A;  1QSO A;  2VXK A;  3SXO A;  4CRZ B;  2ZW5 A;  3F8K A;  5C88 A;  5AGE A;  3TO9 A;  2FIA A;  2DXQ A;  3N7Z A;  4R9M A;  2PDO A;  2GE3 A;  4CAW A;  5F48 A;  1L0C A;  4MI4 A;  2Q4Y A;  1BO4 A;  1YVK A;  2FXF A;  4IUS A;  5J8C A;  5C82 A;  2PRB A;  4OAD A;  4XPD C;  1YGH A;  3ZJ0 A;  3FBU A;  1I21 A;  2Z3L A;  3IWE A;  4B5O A;  4CGM A;  4MY0 A;  4CYO A;  4CYN A;  2CNM A;  2B3V A;  4UWI A;  5J8F A;  3QAH A;  1KUV A;  2R7H A;  2PC1 A;  4MFJ A;  4L89 A;  3GY9 A;  4U5Y A;  4MJ8 A;  1YX0 A;  1S60 A;  4A32 A;  2WUU A;  4HNX B;  4CGO A;  1M4G A;  5AG5 A;  1WWZ A;  2Z3K A;  4CGL A;  2NMT A;  3DR8 A;  5KTD A;  2CNT A;  3R9E A;  4MY3 A;  5IB0 A;  4KOS A;  1Z9U A;  4CGP A;  2J8M A;  3DNS A;  1QST A;  4C68 A;  5KTC A;  3R9F A;  4UCP A;  3R1K A;  5G22 A;  4CAF A;  2P0W A;  2P6G A;  4Y49 C;  3DDD A;  3H4Q A;  3I3G A;  4HNY B;  2YND A;  3CXP A;  4PK2 A;  4B11 A;  4KVX A;  5H86 A;  3S6F A;  4JJX A;  1LRZ A;  2Y0M A;  1I1D A;  4XPL A;  4A2Z A;  4B10 A;  4YGO A;  2AJ6 A;  4M85 A;  1Y9W A;  4NEX A;  2JLM A;  2WSA A;  1U6M A;  4ONU A;  2OB0 A;  2Z3N A;  3BLN A;  3F5B A;  2C27 A;  1V0C A;  4AVA A;  4B5P A;  3VWE A;  3RYO A;  4HNW B;  4F6A A;  5F46 A;  3PGP A;  2B4B A;  4AG9 A;  3FIX A;  2EVN A;  4MFP A;  4AVC A;  4NXY A;  2RC4 A;  2QEC A;  2FT0 A;  2Z3M A;  2GAN A;  3FYN A;  5EBV A;  3PP9 A;  1IB1 E;  4A33 A;  1IID A;  1S7F A;  2H5M A;  3W6X A;  4QVT A;  2D4P A;  4II9 A;  3FXT A;  2R1I A;  5AG4 A;  2QML A;  1XIX A;  3EO4 A;  3TO6 A;  4YRH A;  1Q2Y A;  4KS9 A;  1KZF A;  2OH1 A;  4CYP A;  4FD5 A;  4U9Y A;  4KLW A;  2Z10 A;  2FIW A;  4MFL A;  5JQ4 A;  2ZW4 A;  4B13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...