3FIXA

Crystal structure of a putative n-acetyltransferase (ta0374) from thermoplasma acidophilum
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
165
structure length
165
Chain Sequence
YFQSNAMSIEIRKLSIEDLETLIEVARESWKWTYAGIYSEEYIESWIREKYSKEKLLNEIVRSQSNLDILFLGAFADSTLIGFIELKIIANKAELLRLYLKPEYTHKKIGKTLLLEAEKIMKKKGILECRLYVHRQNSVGFSFYYKNGFKVEDTDGSDFIMEKKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACETYLTRANSFERASE
publication title Crystal structure of the novel PaiA N-acetyltransferase from Thermoplasma acidophilum involved in the negative control of sporulation and degradative enzyme production.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Transferase
total genus 53
structure length 165
sequence length 165
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2008-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3fixA00
4M3SA 4AG7A 4XPDB 1B6BA 1KUXA 4KOXA 2P6FA 2CY2A 1P4NA 3EC4A 3TE4A 2HUZA 5GCNA 2PRBA 3W6SA 3TCVA 3BJ7A 1B87A 2NMTA 2B3VA 4U9ZA 1I12A 3TOBA 3EY5A 2IL4A 3SHPA 4PK2A 1Y7RA 1S7LA 2PR1A 2R98A 1SQHA 1XMTA 2F5IA 1CM0A 1WWZA 2P6EA 4J3GA 2QMLA 3F0AA 1YVKA 4HKFA 3NE7A 2K5TA 2PSWA 4OAEA 3FYNA 4ORFA 2O28A 4JD6A 4IF5A 3TOAA 5IX3A 2B3UA 4QB9A 2VEZA 3CXQA 4L8AA 3TFYA 1S60A 3D8PA 1N71A 4GS4A 2J8NA 4PV6A 4KOYA 4B5PA 4E0AA 4XPLA 4KVME 2BSWA 2X7BA 5DWNA 2EUIA 1L0CA 2Q0YA 1IIDA 4XPDC 2HV2A 2OB0A 4OLLA 2VI7A 5KTCA 1VKCA 3SXOA 5H86A 2EVNA 2OU2A 4KOWA 3T9YA 4YRHA 2JDDA 4LUAA 3D3SA 3V8IA 1S7KA 4JXRA 1QSOA 1QSTA 5IV0A 2BEIA 4CS0B 1ON0A 3LODA 4KOVA 3WR7A 3DR8A 5HMNA 4XPKA 2ATRA 4YGOA 3QB8A 1Q2DA 3TO9A 4EVYA 1Y9KA 1XE4A 2P0WA 4QC6A 2OZGA 3G3SA 1Y9WA 3S6GA 3TO7A 3R96A 2P6GA 4JLYA 2GIVA 4KUBA 1YX0A 3UY5A 2DXQA 3W6XA 3W91A 4I49A 2WPXA 4H6UA 2PC1A 2Z0ZA 3FBUA 4HNYB 3EXNA 5JPHA 1Q2YA 2GANA 3FNCA 5DWMA 4UWIA 2WPWA 4B5PB 3N7ZA 5IB0A 3PZJA 4KZTA 4UA3A 2ZW5A 3DSBA 1Z9UA 2FL4A 1IYKA 2ARHA 2OZUA 2PQ8A 1U6MA 3R95A 2Q4VA 4AVBA 4UWJA 3DR6A 1MJBA 5FVJA 1NSLA 4KVOE 2Z11A 3JUWA 4NCZA 4H89A 1OZPA 1VHSA 3PP9A 4PSWA 5ISVA 3CXSA 4MY0A 3GY9A 3MGDA 1YK3A 4NSQA 3F8KA 3LD2A 5C82A 4IUSA 4KLVA 1YVOA 4R3KA 4R57A 2J8RA 2Z10A 2ZXVA 2CNSA 2VZZA 3I3GA 2REEA 4KOTA 3TTHA 1NE9A 3EO4A 2B5GA 2VXKA 1QSRA 3R9FA 1YLEA 3P2HA 2B58A 2G0BA 3RYOA 2H5MA 1Z4EA 3SXNA 3D2PA 1V0CA 5HH1A 3PGPA 3S6HA 4U5YA 1FY7A 2CNTA 3VWDA 5J8FA 1YR0A 3T90A 3FIXA 4E8OA 1S7FA 2VZYA 3G8WA 4RS2A 5F46A 3KKWA 4CAVA 2CNMA 1R57A 4XNHB 4DNCA 3DNSA 3BLNA 3OWCA 3QAHA 4QUSA 1M4IA 1KUVA 4FD4A 2C27A 2JDCA 1M4DA 5J8CA 4UBRA 4OADA 4CAWA 3JVNA 2FIAA 3R1KA 2I79A 4U9YA 1BO4A 4FD7A 1P0HA 2REFA 2I00A 1RO5A 1S3ZA 3FRMA 3P2FA 2QIRA 4RI1A 4F0YA 5C88A 1S7NA 2HQYA 4HNXB 2ZW7A 1QSNA 3R9GA 4JXQA 4L89A 4AG9A 5EC4A 4KVXA 4MY3A 2A4NA 1M1DA 3FXTA 1YGHA 4B5OA 4KORA 3E0KA 1WK4A 4BMHA 1GHEA 4MI4A 1M44A 2Q44A 4Y49B 4E2AA 4JWPA 2JLMA 2FT0A 2B5GB 4JJXA 1RXTA 4PK3A 1M4GA 2Y0MA 1LRZA 3C26A 2OH1A 4AB7A 4II9A 5F47A 2B4DA 1I21A 3FB3A 4KUAA 5I0CA 4HNWB 1PUAA 3S6KA 2RC4A 4FD5A 2D4PA 1XEBA 3ZZIA 4MHDA 4X5KA 1KZFA 2PDOA 3VWEA 2ZW6A 4CRZB 4F6AA 2KCWA 1S5KA 5F49A 3BJ8A 2R8VA 5CNPA 1IB1E 4MJ8A 2BL1A 5EBVA 4XNHC 4AVCA 2R1IA 4M85A 1IYLA 2Q4YA 4QBJA 3DDDA 2FXFA 1PU9A 3S6FA 2Q04A 5E96A 4PSXA 3TT2A 4NF1A 4KLWA 2G3TA 3B8GA 1Z4RA 1BOBA 1IICA 4R87A 4CRYB 3I9SA 3R9EA 2FCKA 2GE3A 3D2MA 2J8MA 4NEXA 4CAXA 3K9UA 1I1DA 4KOUA 3IGRA 5H84A 3EFAA 5F48A 2R7HA 2ZW4A 3IWGA 2OZHA 2G3AA 1NMTA 1MK4A 1MJ9A 4LX9A 2FSRA 1XF8A 3CXPA 2VBQA 1UFHA 5KTDA 2FE7A 4KOSA 4R3LA 3F5BA 5KTAA 1K4JA 4K30A 2Q7BA 3ZJ0A 2ZPAA 2VQYA 2D4OA 1XIXA 4ONUA 4QVTA 3GYAA 3GKRA 4AVAA 4Y49C 1TIQA 2AJ6A 2FIWA 4R9MA 2BUEA 2JEVA 4ZBGA 3H4QA 2FS5A 2B4DB 1QSMA 4YFJA 2PR8A 1MJAA 4H6ZA 1J4JA 2B4BA 1CJWA 4NXYA 1KUYA 1Q2CA 1YREA 3TO6A 2QECA 4FD6A 4MBUA 5JQ4A 2AE6A
chains in the Genus database with same CATH superfamily
4M3SA 4AG7A 2PJ9A 4IAVA 2BO9A 4XPDB 1B6BA 1CBXA 1KUXA 3KHZA 2P6FA 4KOXA 4ZX8A 2CY2A 1P4NA 3DLJA 3ISXA 1Z8TA 3NFZA 3D7GA 4Z65A 3TC8A 3EC4A 1LFWA 5LYDA 2F7VA 3TE4A 2HUZA 4R76A 2HB6A 5GCNA 1YMEA 2PRBA 4O23A 3W6SA 5G22A 4F0XA 4P6YA 1F2OA 2CXAA 3TCVA 2WUUA 3B35A 2CF4A 3JTKA 2EBJA 3BJ7A 1B87A 3IU1A 2PJ4A 2NMTA 4MRIA 2B3VA 1ZLHA 4U9ZA 1I12A 1NSAA 3D4UA 2NYQA 3TOBA 2PJ6A 2YGWA 4P4IA 3KL9A 3EY5A 2IL4A 3SHPA 3KQXA 4PK2A 4UIAA 1Y7RA 1M4LA 1LOKA 4UF4A 1S7LA 2PR1A 2YNDA 2R98A 1SQHA 2EK9A 3PB6X 4OIDA 1XMTA 2V8HA 2F5IA 1CM0A 1WWZA 2P6EA 2PJ3A 4J3GA 4B13A 2ZOGA 2QMLA 3F0AA 3H8GA 2AFXA 2O53A 1YVKA 3GUXA 4A32A 4HKFA 3NE7A 2RB7A 2YNCC 2K5TA 2PSWA 2Z3PA 4OAEA 2EO8A 2Q51A 1R43A 1UWYA 5HVHA 5IB9A 1AYEA 1CP6A 2PJ5A 2Z3KA 3FYNA 4ORFA 2O28A 2POKA 4JD6A 5LRJA 3NE8A 4WJBA 4IF5A 5AG5A 1IY7A 3JRUA 4FWUA 3TOAA 2WYRA 3D7DA 5IX3A 4C2ZA 5AG6A 2B3UA 2CTBA 2QVPA 4QB9A 4X8IA 2VEZA 3CXQA 3FECA 4L8AA 3TFYA 4NGRA 1S60A 1HDUA 4LQGA 3D7HA 4OC0A 1TF8A 2GREA 3B3CA 3D8PA 2PJAA 1N71A 4GS4A 4CGLA 1Z2LA 2QYVA 2J8NA 1Z8XA 4M6GA 4PV6A 3PB9X 4KSAA 4PXCA 1F57A 3T8WA 2DPTA 4KOYA 4CPAA 2AFZA 4B5PA 4E0AA 2PJ2A 4XPLA 4C2YA 5K8NA 4CGPA 3WABA 4KVME 2BSWA 2DF5A 2X7BA 4MFKA 2GU2A 3SI2A 5DWNA 2EUIA 1L0CA 2Q0YA 1IIDA 4XPDC 2HV2A 2OB0A 1ARMA 3HLPA 4OLLA 1AUGA 3FEEA 4Q38A 3IWEA 2VI7A 1CP7A 1LAPA 2XEFA 2ZEEA 1VKCA 3B3TA 4X2TA 3SXOA 5KTCA 5LYFA 5H86A 2EVNA 2OU2A 4X3RA 4KOWA 3T9YA 4UFVA 4MHPA 4YRHA 1CPXA 2JDDA 5G21A 4LUAA 2Q43A 2GFQA 2NSMA 1RTQA 3A9LA 3D3SA 3V8IA 1S7KA 3LMSA 4JXRA 5HVGA 1ELMP 5I4MA 1XMBA 1QSOA 1VIXA 1QSTA 3CT9A 5D29A 5IV0A 4B11A 2BEIA 3KR5A 2G9DA 1XRYA 2AFMA 3H8FA 4PXBA 4CS0B 1ON0A 3NH8A 3NH4A 4ZY2A 2I3CA 3LODA 4MHNA 3SJXA 4C68A 5CBMA 1JWQA 4KOVA 3WR7A 3DR8A 4IHMA 4GXHA 2WSAA 5HMNA 5HVFA 4RN7A 4XPKA 2ATRA 4YGOA 4MCSA 3QB8A 1Q2DA 2AFOA 3TO9A 2PJCA 4EVYA 1Y9KA 3FMCA 1XE4A 2PCUA 3H5ZA 1A2ZA 3BXMA 3SI1A 1KWMA 2P0WA 2O4HA 4QC6A 2OZGA 3G3SA 1Y9WA 4BINA 3S6GA 3WC6A 3B2YA 4CYOA 2EK8A 5LRGA 3PFEA 1XJOA 3TO7A 3R96A 2P6GA 4CAFA 2QJ8A 4JLYA 4PXDA 2GIVA 1CPSA 4KUBA 1YX0A 5AG7A 2DXQA 4YWYA 3UY5A 3W6XA 1LANA 1ZG9A 1R3NA 5HXDA 3IEHA 4UFXA 4I49A 3W91A 4NJQA 4MCQA 4OC3A 1XFOA 2WPXA 4H6UA 4UCMA 2PC1A 4ZY1A 4RUHA 2Z0ZA 3FBUA 4HNYB 3EXNA 5JPHA 3N5FA 1Q2YA 4NGPA 1IGBA 1FNOA 4JZ0A 2GANA 3KASA 3FNCA 1DE4C 4OC5A 4P4FA 4CYPA 2PJ7A 2PJBA 5DWMA 4UWIA 1H8LA 3K9TA 4FUUA 2ZEFA 2XEGA 2WPWA 4B5PB 3FEDA 2PJ1A 3N7ZA 5IB0A 3RBUA 3HUVA 3PZJA 4KZTA 4UA3A 2ZW5A 3GIUA 1TF9A 3DSBA 1Z9UA 2FL4A 1FT7A 5JM6A 4OP4A 3VH9A 4MFJA 1IYKA 2ARHA 2OZUA 2PQ8A 3L2NA 2DEAA 2DPSA 2ZENA 4KSFA 2CTCA 3D67A 5DS0A 1U6MA 5A27A 3PB4X 4OMEA 3IO1A 2AFSA 3R95A 2Q4VA 3PBEA 4AVBA 4UWJA 3DR6A 1MJBA 4MFZA 5FVJA 1NSLA 4KVOE 1YSJA 2Z11A 5K8PA 5CPAA 1Y0RA 2BOAA 3WC7A 2PIZA 3JUWA 3V7ZA 4NCZA 3IIBA 4PXEA 3PEIA 4EWTA 4ZYQA 3FF3A 4H89A 5ELYA 1OZPA 4F9VA 1VHSA 3PP9A 4PSWA 5ISVA 4A33A 3CXSA 4MY0A 3GY9A 1Y0YA 4OC4A 4M6HA 3MGDA 1YK3A 4MXUA 3GB0A 4NSQA 4TWEA 3F8KA 5LYIA 5J1QA 3LD2A 5C82A 4IUSA 4KLVA 2XEJA 4A95A 1YVOA 4R3KA 3K2KA 4A39A 4A30A 2IJZA 4R57A 2J8RA 2C1CA 4OKOA 4K3NA 2Z10A 2ZXVA 4KSIA 2CNSA 2FVGA 2VZZA 5THWA 3I3GA 5K8MA 1IOFA 2REEA 4KOTA 4MMOA 3TTHA 1NE9A 3LWUA 4DJLA 4CGOA 3EO4A 2ABZA 2B5GA 2VXKA 4TNUA 1QSRA 1F2PA 3R9FA 1YLEA 2V8VA 3P2HA 4NEXA 5LRKA 2B58A 3KZWA 4EFDA 4H2KA 2G0BA 3RYOA 2H5MA 2Q4ZA 1JQGA 1YQEA 4YU9A 1Z4EA 3SXNA 1TKJA 1IU8A 3KGQA 4P44A 3D2PA 1V0CA 5HH1A 3PGPA 3S6HA 3FJUA 1FY7A 4U5YA 2CNTA 3VWDA 5J8FA 1YR0A 4C7IA 3T90A 3FIXA 4E8OA 2CIJA 2OR4A 1Z8WA 5EMIA 1S7FA 3ISZA 2VZYA 3G8WA 4RS2A 3FH4A 1Q7LA 1LCPA 4P45A 5F46A 3KKWA 4CAVA 2CNMA 1XOVA 3B3SA 1R57A 2JBKA 3B3WA 4MFLA 3B7IA 4XNHB 3FX6A 2Q7SA 4DNCA 3DNSA 1X10A 3BLNA 3WC5A 3OWCA 3QAHA 4QUSA 4Q7AA 1M4IA 4P4DA 1CG2A 2PE3A 1KUVA 4FD4A 2Z3NA 4F9UA 2C27A 3IFEA 3PFOA 2JDCA 2ZEDA 4BD9A 1M4DA 4B10A 5J8CA 2XEIA 4DUKA 4UBRA 1GYTA 1PCAA 4OADA 2JBJA 4OC2A 3IWWA 4CAWA 3JVNA 2FIAA 3D66A 3SJGA 2JEWA 5K8OA 3CPAA 3R1KA 3S9MA 4FAIA 1Z8LA 3LACA 2I79A 3S9LA 5AGEA 4U9YA 3WT4A 4Q36A 2ZEGA 1BO4A 4FD7A 4UCPA 4MCRA 1P0HA 3CZXA 3RZAA 3SI0A 2REFA 4MHYA 2I00A 3RO0A 1Y7EA 8CPAA 1RO5A 1S3ZA 2ZEPA 3FRMA 2QIRA 3P2FA 4RI1A 4F0YA 5C88A 1S7NA 2HQYA 4HNXB 1BAVA 4PPZA 1VHOA 2ZW7A 1QSNA 2YNCA 3R9GA 5AG4A 4MHZA 4A37A 2ANPA 4JXQA 1TKFA 2ODFA 4L89A 3GLJA 5EC4A 4KVXA 4AG9A 1ELLP 4HPSA 4MY3A 1QQ9A 2A4NA 1M1DA 3FXTA 1YGHA 4UIBA 4B5OA 4KORA 5D8NA 3RNZA 3E0KA 4AXVA 1WK4A 1HDQA 1EE3P 1GHEA 4MI4A 4BMHA 2Z3OA 1CX8A 3CPXA 1M44A 3DGVA 4IK2A 2Q44A 4ZGYB 2HC9A 4Y49B 2PJ0A 2Z3LA 4E2AA 2JLMA 4JWPA 2FT0A 2B5GB 4JJXA 1ZG7A 1RXTA 2V8GA 4ONWA 2GLFA 5G20A 4EMEA 2C6GA 1M4GA 4PK3A 2Y0MA 3H8EA 1LRZA 3C26A 4A38A 2OH1A 4AB7A 4II9A 3PBBA 4LQ6A 2PVWA 4G1PA 1AMPA 4R6TA 3V38A 3TX8A 4R7MA 1ARLA 2B4DA 2V8DA 1I21A 3FB3A 5F47A 4KUAA 5I0CA 4FBEA 3SJEA 3I1UA 4HNWB 1PUAA 4B6ZA 1BPNA 3S6KA 3SJFA 4ZY0A 2RC4A 4FD5A 1Z5RA 2ZEMA 2D4PA 4UEEA 4C2XA 1XEBA 3PB7X 3ZZIA 5G1ZA 2Z3MA 4MHDA 4X5KA 1KZFA 4PQAA 3PRTA 2PDOA 3VWEA 2ZW6A 4CRZB 4F6AA 4B12A 2KCWA 1S5KA 5F49A 3BJ8A 2R8VA 2J9AA 5CNPA 2ZEOA 1IB1E 2F8HA 4WWVA 4MJ8A 2BL1A 5EBVA 4XNHC 4NGMA 4AVCA 2BCOA 1YLOA 2R1IA 2WZNA 4NGQA 4M85A 4P4BA 5F09A 3FVLA 1IYLA 2Q4YA 4UEFA 3DDDA 4QBJA 1QMUA 4NJRA 4A31A 4NGNA 3RAMA 2FXFA 1PU9A 3D68A 3S6FA 2PIYA 2Q04A 5BWAB 5JH9A 5E96A 4OC1A 7CPAA 4PSXA 3TT2A 4NF1A 4NFRA 4KLWA 4ZX9A 1XBUA 2G3TA 2RFHA 3B8GA 1Z4RA 3KI9A 1BOBA 4DYOA 4MFQA 1DTDA 1IICA 4CGMA 1BPMA 4R87A 4CRYB 3S9NA 3I9SA 3R9EA 3IC1A 4UCNA 2FCKA 2GE3A 4P4JA 1YW4A 3D2MA 2J8MA 4CAEA 3KQZA 1TKHA 1ZO0A 1YW6A 2C6PA 1I1DA 1ZLIA 3K9UA 3NH5A 3PB8X 3IGRA 4KOUA 5H84A 3EFAA 3VATA 5F48A 2R7HA 2ZW4A 1OBRA 3IWGA 2OZHA 1ZG8A 2G3AA 3BI1A 4CAXA 1NMTA 1MK4A 6CPAA 4P4EA 3B3VA 1MJ9A 1TXRA 4LX9A 2FSRA 3VARA 2PRQA 3CDXA 1XF8A 3BI0A 3CXPA 2IQ6A 2OOTA 2VBQA 1UFHA 5KTDA 2FE7A 4KOSA 2AFWA 1IOIA 4R3LA 3F5BA 2GLJA 1K4JA 5KTAA 4W9YA 1X12A 3QAYA 4JYWA 4K30A 5LYLA 2PJ8A 2Q7BA 3ZJ0A 2ZPAA 3MRUA 4KS9A 2VQYA 2V77A 2D4OA 4C7HA 3D7FA 4CYNA 1XIXA 4ONUA 1BLLE 4QVTA 4A2ZA 4NGTA 4P10A 3GYAA 4OIWA 3GKRA 4AVAA 4Y49C 4A94A 3IU2A 1TIQA 2ZOFA 3KR4A 2AJ6A 4BBHA 4CYQA 2FIWA 5A28A 3KHXA 4R9MA 2BUEA 2IMOA 4ZI6A 2ZELA 3NA6A 1VGYA 1HEEA 2JEVA 4ZBGA 3H4QA 4UFWA 1PYTB 2VL1A 4GM5A 2FS5A 4MCPA 3BHXA 2B4DB 3MN8A 4B14A 1QSMA 4YFJA 2EWBA 2PR8A 1MJAA 3IJ3A 2AFUA 4H6ZA 2PVVA 1J4JA 2YNEA 2ZEHA 2B4BA 1CJWA 4NXYA 1KUYA 4UEZA 3QNVA 1Q2CA 1YREA 3TO6A 4CGNA 4R8FA 4NGSA 4F8ZA 5JGFA 2QECA 4FD6A 4MBUA 2C6CA 2AE6A 4MFPA 5JQ4A 1VHEA 1LAMA 4M6IA
chains in the Genus database with same CATH topology
4M3SA 4AG7A 4XPDB 1B6BA 1KUXA 4KOXA 2P6FA 2CY2A 1P4NA 3EC4A 3TE4A 2HUZA 5GCNA 2PRBA 3W6SA 5G22A 4F0XA 2CXAA 3TCVA 2WUUA 3JTKA 3BJ7A 3IU1A 1B87A 2NMTA 2B3VA 4U9ZA 1I12A 3TOBA 2YGWA 3EY5A 2IL4A 3SHPA 4PK2A 1Y7RA 1S7LA 2PR1A 2YNDA 2R98A 1SQHA 1XMTA 2F5IA 1CM0A 1WWZA 2P6EA 4J3GA 4B13A 2QMLA 3F0AA 1YVKA 4A32A 4HKFA 3NE7A 2YNCC 2K5TA 2PSWA 2Z3PA 4OAEA 2Z3KA 3FYNA 4ORFA 2O28A 4JD6A 4IF5A 5AG5A 3TOAA 5IX3A 4C2ZA 5AG6A 2B3UA 4QB9A 2VEZA 3CXQA 4L8AA 3TFYA 1S60A 3D8PA 1N71A 4GS4A 4CGLA 2J8NA 4PV6A 4KSAA 2DPTA 4KOYA 4B5PA 4E0AA 4XPLA 4C2YA 4CGPA 4KVME 2BSWA 2X7BA 4MFKA 5DWNA 2EUIA 1L0CA 2Q0YA 1IIDA 4XPDC 2HV2A 2OB0A 4OLLA 4Q38A 3IWEA 2VI7A 5KTCA 1VKCA 3SXOA 5H86A 2EVNA 2OU2A 4KOWA 3T9YA 4UFVA 4YRHA 2JDDA 5G21A 4LUAA 3A9LA 3D3SA 3V8IA 1S7KA 4JXRA 1QSOA 1QSTA 5IV0A 4B11A 2BEIA 4CS0B 1ON0A 3LODA 4C68A 4KOVA 3WR7A 3DR8A 2WSAA 5HMNA 4XPKA 2ATRA 4YGOA 3QB8A 1Q2DA 3TO9A 4EVYA 1Y9KA 1XE4A 3H5ZA 2P0WA 4QC6A 2OZGA 3G3SA 1Y9WA 3S6GA 4CYOA 3TO7A 3R96A 2P6GA 4CAFA 4JLYA 5AG7A 2GIVA 4KUBA 1YX0A 3UY5A 2DXQA 3W6XA 4UFXA 4I49A 3W91A 2WPXA 4H6UA 4UCMA 2PC1A 2Z0ZA 3FBUA 4HNYB 3EXNA 5JPHA 1Q2YA 2GANA 3FNCA 4CYPA 5DWMA 4UWIA 2WPWA 4B5PB 3N7ZA 5IB0A 3PZJA 4KZTA 4UA3A 2ZW5A 3DSBA 1Z9UA 2FL4A 4MFJA 1IYKA 2ARHA 2OZUA 2PQ8A 2DPSA 4KSFA 1U6MA 5A27A 3R95A 2Q4VA 4AVBA 4UWJA 3DR6A 1MJBA 4MFZA 5FVJA 1NSLA 4KVOE 2Z11A 3JUWA 4NCZA 4H89A 1OZPA 1VHSA 3PP9A 4PSWA 5ISVA 4A33A 3CXSA 4MY0A 3GY9A 3MGDA 1YK3A 4NSQA 3F8KA 3LD2A 5C82A 4IUSA 4KLVA 4A95A 1YVOA 4R3KA 4A30A 4R57A 2J8RA 2Z10A 2ZXVA 2CNSA 2VZZA 3I3GA 2REEA 4KOTA 3TTHA 1NE9A 4CGOA 3EO4A 2B5GA 2VXKA 1QSRA 3R9FA 1YLEA 3P2HA 2B58A 2G0BA 3RYOA 2H5MA 1Z4EA 3SXNA 3D2PA 1V0CA 5HH1A 3PGPA 3S6HA 4U5YA 1FY7A 2CNTA 3VWDA 5J8FA 1YR0A 4C7IA 3T90A 3FIXA 4E8OA 1S7FA 2VZYA 3G8WA 4RS2A 5F46A 3KKWA 4CAVA 2CNMA 1R57A 4MFLA 4XNHB 4DNCA 3DNSA 3BLNA 3OWCA 3QAHA 4QUSA 1M4IA 1KUVA 4FD4A 2Z3NA 2C27A 2JDCA 1M4DA 4B10A 5J8CA 4UBRA 4OADA 4CAWA 3JVNA 2FIAA 3R1KA 2I79A 5AGEA 4U9YA 4Q36A 1BO4A 4FD7A 4UCPA 1P0HA 2REFA 2I00A 1RO5A 1S3ZA 3FRMA 3P2FA 2QIRA 4RI1A 4F0YA 5C88A 1S7NA 2HQYA 4HNXB 2ZW7A 1QSNA 2YNCA 3R9GA 5AG4A 4JXQA 4L89A 4AG9A 5EC4A 4KVXA 4MY3A 2A4NA 1M1DA 3FXTA 1YGHA 4B5OA 4KORA 3E0KA 1WK4A 4BMHA 1GHEA 4MI4A 4ZGYB 2Z3OA 1M44A 2Q44A 4Y49B 2Z3LA 4E2AA 4JWPA 2JLMA 2FT0A 2B5GB 4JJXA 1RXTA 5G20A 4PK3A 1M4GA 2Y0MA 1LRZA 3C26A 2OH1A 4AB7A 4II9A 5F47A 2B4DA 1I21A 3FB3A 4KUAA 5I0CA 4HNWB 1PUAA 3S6KA 2RC4A 4FD5A 2D4PA 4C2XA 1XEBA 3ZZIA 5G1ZA 2Z3MA 4MHDA 4X5KA 1KZFA 2PDOA 3VWEA 2ZW6A 4CRZB 4F6AA 4B12A 2KCWA 1S5KA 5F49A 3BJ8A 2R8VA 5CNPA 1IB1E 4MJ8A 2BL1A 5EBVA 4XNHC 4AVCA 2R1IA 4M85A 1IYLA 2Q4YA 4QBJA 3DDDA 4A31A 2FXFA 1PU9A 5BWAB 3S6FA 2Q04A 5E96A 4PSXA 3TT2A 4NF1A 4KLWA 2G3TA 3B8GA 1Z4RA 1BOBA 4MFQA 1IICA 4CGMA 4R87A 4CRYB 3I9SA 3R9EA 4UCNA 2FCKA 2GE3A 3D2MA 2J8MA 4CAEA 4NEXA 1ZO0A 4CAXA 3K9UA 1I1DA 4KOUA 3IGRA 5H84A 3EFAA 5F48A 2R7HA 2ZW4A 3IWGA 2OZHA 2G3AA 1NMTA 1MK4A 1MJ9A 4LX9A 2FSRA 1XF8A 3CXPA 2VBQA 1UFHA 5KTDA 2FE7A 4KOSA 4R3LA 3F5BA 5KTAA 1K4JA 4K30A 2Q7BA 3ZJ0A 2ZPAA 4KS9A 2VQYA 2D4OA 4C7HA 4CYNA 1XIXA 4ONUA 4QVTA 4A2ZA 3GYAA 3GKRA 4AVAA 4Y49C 3IU2A 1TIQA 4CYQA 2AJ6A 4BBHA 2FIWA 5A28A 4R9MA 2BUEA 2JEVA 4ZBGA 3H4QA 4UFWA 2FS5A 2B4DB 4B14A 1QSMA 4YFJA 2PR8A 1MJAA 4H6ZA 1J4JA 2YNEA 2B4BA 1CJWA 4NXYA 1KUYA 4CGNA 1Q2CA 1YREA 3TO6A 2QECA 4FD6A 4MBUA 5JQ4A 2AE6A 4MFPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M3S A;  4AG7 A;  4XPD B;  1B6B A;  1KUX A;  4KOX A;  2P6F A;  2CY2 A;  1P4N A;  3EC4 A;  3TE4 A;  2HUZ A;  5GCN A;  2PRB A;  3W6S A;  3TCV A;  3BJ7 A;  1B87 A;  2NMT A;  2B3V A;  4U9Z A;  1I12 A;  3TOB A;  3EY5 A;  2IL4 A;  3SHP A;  4PK2 A;  1Y7R A;  1S7L A;  2PR1 A;  2R98 A;  1SQH A;  1XMT A;  2F5I A;  1CM0 A;  1WWZ A;  2P6E A;  4J3G A;  2QML A;  3F0A A;  1YVK A;  4HKF A;  3NE7 A;  2K5T A;  2PSW A;  4OAE A;  3FYN A;  4ORF A;  2O28 A;  4JD6 A;  4IF5 A;  3TOA A;  5IX3 A;  2B3U A;  4QB9 A;  2VEZ A;  3CXQ A;  4L8A A;  3TFY A;  1S60 A;  3D8P A;  1N71 A;  4GS4 A;  2J8N A;  4PV6 A;  4KOY A;  4B5P A;  4E0A A;  4XPL A;  4KVM E;  2BSW A;  2X7B A;  5DWN A;  2EUI A;  1L0C A;  2Q0Y A;  1IID A;  4XPD C;  2HV2 A;  2OB0 A;  4OLL A;  2VI7 A;  5KTC A;  1VKC A;  3SXO A;  5H86 A;  2EVN A;  2OU2 A;  4KOW A;  3T9Y A;  4YRH A;  2JDD A;  4LUA A;  3D3S A;  3V8I A;  1S7K A;  4JXR A;  1QSO A;  1QST A;  5IV0 A;  2BEI A;  4CS0 B;  1ON0 A;  3LOD A;  4KOV A;  3WR7 A;  3DR8 A;  5HMN A;  4XPK A;  2ATR A;  4YGO A;  3QB8 A;  1Q2D A;  3TO9 A;  4EVY A;  1Y9K A;  1XE4 A;  2P0W A;  4QC6 A;  2OZG A;  3G3S A;  1Y9W A;  3S6G A;  3TO7 A;  3R96 A;  2P6G A;  4JLY A;  2GIV A;  4KUB A;  1YX0 A;  3UY5 A;  2DXQ A;  3W6X A;  3W91 A;  4I49 A;  2WPX A;  4H6U A;  2PC1 A;  2Z0Z A;  3FBU A;  4HNY B;  3EXN A;  5JPH A;  1Q2Y A;  2GAN A;  3FNC A;  5DWM A;  4UWI A;  2WPW A;  4B5P B;  3N7Z A;  5IB0 A;  3PZJ A;  4KZT A;  4UA3 A;  2ZW5 A;  3DSB A;  1Z9U A;  2FL4 A;  1IYK A;  2ARH A;  2OZU A;  2PQ8 A;  1U6M A;  3R95 A;  2Q4V A;  4AVB A;  4UWJ A;  3DR6 A;  1MJB A;  5FVJ A;  1NSL A;  4KVO E;  2Z11 A;  3JUW A;  4NCZ A;  4H89 A;  1OZP A;  1VHS A;  3PP9 A;  4PSW A;  5ISV A;  3CXS A;  4MY0 A;  3GY9 A;  3MGD A;  1YK3 A;  4NSQ A;  3F8K A;  3LD2 A;  5C82 A;  4IUS A;  4KLV A;  1YVO A;  4R3K A;  4R57 A;  2J8R A;  2Z10 A;  2ZXV A;  2CNS A;  2VZZ A;  3I3G A;  2REE A;  4KOT A;  3TTH A;  1NE9 A;  3EO4 A;  2B5G A;  2VXK A;  1QSR A;  3R9F A;  1YLE A;  3P2H A;  2B58 A;  2G0B A;  3RYO A;  2H5M A;  1Z4E A;  3SXN A;  3D2P A;  1V0C A;  5HH1 A;  3PGP A;  3S6H A;  4U5Y A;  1FY7 A;  2CNT A;  3VWD A;  5J8F A;  1YR0 A;  3T90 A;  3FIX A;  4E8O A;  1S7F A;  2VZY A;  3G8W A;  4RS2 A;  5F46 A;  3KKW A;  4CAV A;  2CNM A;  1R57 A;  4XNH B;  4DNC A;  3DNS A;  3BLN A;  3OWC A;  3QAH A;  4QUS A;  1M4I A;  1KUV A;  4FD4 A;  2C27 A;  2JDC A;  1M4D A;  5J8C A;  4UBR A;  4OAD A;  4CAW A;  3JVN A;  2FIA A;  3R1K A;  2I79 A;  4U9Y A;  1BO4 A;  4FD7 A;  1P0H A;  2REF A;  2I00 A;  1RO5 A;  1S3Z A;  3FRM A;  3P2F A;  2QIR A;  4RI1 A;  4F0Y A;  5C88 A;  1S7N A;  2HQY A;  4HNX B;  2ZW7 A;  1QSN A;  3R9G A;  4JXQ A;  4L89 A;  4AG9 A;  5EC4 A;  4KVX A;  4MY3 A;  2A4N A;  1M1D A;  3FXT A;  1YGH A;  4B5O A;  4KOR A;  3E0K A;  1WK4 A;  4BMH A;  1GHE A;  4MI4 A;  1M44 A;  2Q44 A;  4Y49 B;  4E2A A;  4JWP A;  2JLM A;  2FT0 A;  2B5G B;  4JJX A;  1RXT A;  4PK3 A;  1M4G A;  2Y0M A;  1LRZ A;  3C26 A;  2OH1 A;  4AB7 A;  4II9 A;  5F47 A;  2B4D A;  1I21 A;  3FB3 A;  4KUA A;  5I0C A;  4HNW B;  1PUA A;  3S6K A;  2RC4 A;  4FD5 A;  2D4P A;  1XEB A;  3ZZI A;  4MHD A;  4X5K A;  1KZF A;  2PDO A;  3VWE A;  2ZW6 A;  4CRZ B;  4F6A A;  2KCW A;  1S5K A;  5F49 A;  3BJ8 A;  2R8V A;  5CNP A;  1IB1 E;  4MJ8 A;  2BL1 A;  5EBV A;  4XNH C;  4AVC A;  2R1I A;  4M85 A;  1IYL A;  2Q4Y A;  4QBJ A;  3DDD A;  2FXF A;  1PU9 A;  3S6F A;  2Q04 A;  5E96 A;  4PSX A;  3TT2 A;  4NF1 A;  4KLW A;  2G3T A;  3B8G A;  1Z4R A;  1BOB A;  1IIC A;  4R87 A;  4CRY B;  3I9S A;  3R9E A;  2FCK A;  2GE3 A;  3D2M A;  2J8M A;  4NEX A;  4CAX A;  3K9U A;  1I1D A;  4KOU A;  3IGR A;  5H84 A;  3EFA A;  5F48 A;  2R7H A;  2ZW4 A;  3IWG A;  2OZH A;  2G3A A;  1NMT A;  1MK4 A;  1MJ9 A;  4LX9 A;  2FSR A;  1XF8 A;  3CXP A;  2VBQ A;  1UFH A;  5KTD A;  2FE7 A;  4KOS A;  4R3L A;  3F5B A;  5KTA A;  1K4J A;  4K30 A;  2Q7B A;  3ZJ0 A;  2ZPA A;  2VQY A;  2D4O A;  1XIX A;  4ONU A;  4QVT A;  3GYA A;  3GKR A;  4AVA A;  4Y49 C;  1TIQ A;  2AJ6 A;  2FIW A;  4R9M A;  2BUE A;  2JEV A;  4ZBG A;  3H4Q A;  2FS5 A;  2B4D B;  1QSM A;  4YFJ A;  2PR8 A;  1MJA A;  4H6Z A;  1J4J A;  2B4B A;  1CJW A;  4NXY A;  1KUY A;  1Q2C A;  1YRE A;  3TO6 A;  2QEC A;  4FD6 A;  4MBU A;  5JQ4 A;  2AE6 A; 
#chains in the Genus database with same CATH topology
 4M3S A;  4AG7 A;  2PJ9 A;  4IAV A;  2BO9 A;  4XPD B;  1B6B A;  1CBX A;  1KUX A;  3KHZ A;  2P6F A;  4KOX A;  4ZX8 A;  2CY2 A;  1P4N A;  3DLJ A;  3ISX A;  1Z8T A;  3NFZ A;  3D7G A;  4Z65 A;  3TC8 A;  3EC4 A;  1LFW A;  5LYD A;  2F7V A;  3TE4 A;  2HUZ A;  4R76 A;  2HB6 A;  5GCN A;  1YME A;  2PRB A;  4O23 A;  3W6S A;  5G22 A;  4F0X A;  4P6Y A;  1F2O A;  2CXA A;  3TCV A;  2WUU A;  3B35 A;  2CF4 A;  3JTK A;  2EBJ A;  3BJ7 A;  1B87 A;  3IU1 A;  2PJ4 A;  2NMT A;  4MRI A;  2B3V A;  1ZLH A;  4U9Z A;  1I12 A;  1NSA A;  3D4U A;  2NYQ A;  3TOB A;  2PJ6 A;  2YGW A;  4P4I A;  3KL9 A;  3EY5 A;  2IL4 A;  3SHP A;  3KQX A;  4PK2 A;  4UIA A;  1Y7R A;  1M4L A;  1LOK A;  4UF4 A;  1S7L A;  2PR1 A;  2YND A;  2R98 A;  1SQH A;  2EK9 A;  3PB6 X;  4OID A;  1XMT A;  2V8H A;  2F5I A;  1CM0 A;  1WWZ A;  2P6E A;  2PJ3 A;  4J3G A;  4B13 A;  2ZOG A;  2QML A;  3F0A A;  3H8G A;  2AFX A;  2O53 A;  1YVK A;  3GUX A;  4A32 A;  4HKF A;  3NE7 A;  2RB7 A;  2YNC C;  2K5T A;  2PSW A;  2Z3P A;  4OAE A;  2EO8 A;  2Q51 A;  1R43 A;  1UWY A;  5HVH A;  5IB9 A;  1AYE A;  1CP6 A;  2PJ5 A;  2Z3K A;  3FYN A;  4ORF A;  2O28 A;  2POK A;  4JD6 A;  5LRJ A;  3NE8 A;  4WJB A;  4IF5 A;  5AG5 A;  1IY7 A;  3JRU A;  4FWU A;  3TOA A;  2WYR A;  3D7D A;  5IX3 A;  4C2Z A;  5AG6 A;  2B3U A;  2CTB A;  2QVP A;  4QB9 A;  4X8I A;  2VEZ A;  3CXQ A;  3FEC A;  4L8A A;  3TFY A;  4NGR A;  1S60 A;  1HDU A;  4LQG A;  3D7H A;  4OC0 A;  1TF8 A;  2GRE A;  3B3C A;  3D8P A;  2PJA A;  1N71 A;  4GS4 A;  4CGL A;  1Z2L A;  2QYV A;  2J8N A;  1Z8X A;  4M6G A;  4PV6 A;  3PB9 X;  4KSA A;  4PXC A;  1F57 A;  3T8W A;  2DPT A;  4KOY A;  4CPA A;  2AFZ A;  4B5P A;  4E0A A;  2PJ2 A;  4XPL A;  4C2Y A;  5K8N A;  4CGP A;  3WAB A;  4KVM E;  2BSW A;  2DF5 A;  2X7B A;  4MFK A;  2GU2 A;  3SI2 A;  5DWN A;  2EUI A;  1L0C A;  2Q0Y A;  1IID A;  4XPD C;  2HV2 A;  2OB0 A;  1ARM A;  3HLP A;  4OLL A;  1AUG A;  3FEE A;  4Q38 A;  3IWE A;  2VI7 A;  1CP7 A;  1LAP A;  2XEF A;  2ZEE A;  1VKC A;  3B3T A;  4X2T A;  3SXO A;  5KTC A;  5LYF A;  5H86 A;  2EVN A;  2OU2 A;  4X3R A;  4KOW A;  3T9Y A;  4UFV A;  4MHP A;  4YRH A;  1CPX A;  2JDD A;  5G21 A;  4LUA A;  2Q43 A;  2GFQ A;  2NSM A;  1RTQ A;  3A9L A;  3D3S A;  3V8I A;  1S7K A;  3LMS A;  4JXR A;  5HVG A;  1ELM P;  5I4M A;  1XMB A;  1QSO A;  1VIX A;  1QST A;  3CT9 A;  5D29 A;  5IV0 A;  4B11 A;  2BEI A;  3KR5 A;  2G9D A;  1XRY A;  2AFM A;  3H8F A;  4PXB A;  4CS0 B;  1ON0 A;  3NH8 A;  3NH4 A;  4ZY2 A;  2I3C A;  3LOD A;  4MHN A;  3SJX A;  4C68 A;  5CBM A;  1JWQ A;  4KOV A;  3WR7 A;  3DR8 A;  4IHM A;  4GXH A;  2WSA A;  5HMN A;  5HVF A;  4RN7 A;  4XPK A;  2ATR A;  4YGO A;  4MCS A;  3QB8 A;  1Q2D A;  2AFO A;  3TO9 A;  2PJC A;  4EVY A;  1Y9K A;  3FMC A;  1XE4 A;  2PCU A;  3H5Z A;  1A2Z A;  3BXM A;  3SI1 A;  1KWM A;  2P0W A;  2O4H A;  4QC6 A;  2OZG A;  3G3S A;  1Y9W A;  4BIN A;  3S6G A;  3WC6 A;  3B2Y A;  4CYO A;  2EK8 A;  5LRG A;  3PFE A;  1XJO A;  3TO7 A;  3R96 A;  2P6G A;  4CAF A;  2QJ8 A;  4JLY A;  4PXD A;  2GIV A;  1CPS A;  4KUB A;  1YX0 A;  5AG7 A;  2DXQ A;  4YWY A;  3UY5 A;  3W6X A;  1LAN A;  1ZG9 A;  1R3N A;  5HXD A;  3IEH A;  4UFX A;  4I49 A;  3W91 A;  4NJQ A;  4MCQ A;  4OC3 A;  1XFO A;  2WPX A;  4H6U A;  4UCM A;  2PC1 A;  4ZY1 A;  4RUH A;  2Z0Z A;  3FBU A;  4HNY B;  3EXN A;  5JPH A;  3N5F A;  1Q2Y A;  4NGP A;  1IGB A;  1FNO A;  4JZ0 A;  2GAN A;  3KAS A;  3FNC A;  1DE4 C;  4OC5 A;  4P4F A;  4CYP A;  2PJ7 A;  2PJB A;  5DWM A;  4UWI A;  1H8L A;  3K9T A;  4FUU A;  2ZEF A;  2XEG A;  2WPW A;  4B5P B;  3FED A;  2PJ1 A;  3N7Z A;  5IB0 A;  3RBU A;  3HUV A;  3PZJ A;  4KZT A;  4UA3 A;  2ZW5 A;  3GIU A;  1TF9 A;  3DSB A;  1Z9U A;  2FL4 A;  1FT7 A;  5JM6 A;  4OP4 A;  3VH9 A;  4MFJ A;  1IYK A;  2ARH A;  2OZU A;  2PQ8 A;  3L2N A;  2DEA A;  2DPS A;  2ZEN A;  4KSF A;  2CTC A;  3D67 A;  5DS0 A;  1U6M A;  5A27 A;  3PB4 X;  4OME A;  3IO1 A;  2AFS A;  3R95 A;  2Q4V A;  3PBE A;  4AVB A;  4UWJ A;  3DR6 A;  1MJB A;  4MFZ A;  5FVJ A;  1NSL A;  4KVO E;  1YSJ A;  2Z11 A;  5K8P A;  5CPA A;  1Y0R A;  2BOA A;  3WC7 A;  2PIZ A;  3JUW A;  3V7Z A;  4NCZ A;  3IIB A;  4PXE A;  3PEI A;  4EWT A;  4ZYQ A;  3FF3 A;  4H89 A;  5ELY A;  1OZP A;  4F9V A;  1VHS A;  3PP9 A;  4PSW A;  5ISV A;  4A33 A;  3CXS A;  4MY0 A;  3GY9 A;  1Y0Y A;  4OC4 A;  4M6H A;  3MGD A;  1YK3 A;  4MXU A;  3GB0 A;  4NSQ A;  4TWE A;  3F8K A;  5LYI A;  5J1Q A;  3LD2 A;  5C82 A;  4IUS A;  4KLV A;  2XEJ A;  4A95 A;  1YVO A;  4R3K A;  3K2K A;  4A39 A;  4A30 A;  2IJZ A;  4R57 A;  2J8R A;  2C1C A;  4OKO A;  4K3N A;  2Z10 A;  2ZXV A;  4KSI A;  2CNS A;  2FVG A;  2VZZ A;  5THW A;  3I3G A;  5K8M A;  1IOF A;  2REE A;  4KOT A;  4MMO A;  3TTH A;  1NE9 A;  3LWU A;  4DJL A;  4CGO A;  3EO4 A;  2ABZ A;  2B5G A;  2VXK A;  4TNU A;  1QSR A;  1F2P A;  3R9F A;  1YLE A;  2V8V A;  3P2H A;  4NEX A;  5LRK A;  2B58 A;  3KZW A;  4EFD A;  4H2K A;  2G0B A;  3RYO A;  2H5M A;  2Q4Z A;  1JQG A;  1YQE A;  4YU9 A;  1Z4E A;  3SXN A;  1TKJ A;  1IU8 A;  3KGQ A;  4P44 A;  3D2P A;  1V0C A;  5HH1 A;  3PGP A;  3S6H A;  3FJU A;  1FY7 A;  4U5Y A;  2CNT A;  3VWD A;  5J8F A;  1YR0 A;  4C7I A;  3T90 A;  3FIX A;  4E8O A;  2CIJ A;  2OR4 A;  1Z8W A;  5EMI A;  1S7F A;  3ISZ A;  2VZY A;  3G8W A;  4RS2 A;  3FH4 A;  1Q7L A;  1LCP A;  4P45 A;  5F46 A;  3KKW A;  4CAV A;  2CNM A;  1XOV A;  3B3S A;  1R57 A;  2JBK A;  3B3W A;  4MFL A;  3B7I A;  4XNH B;  3FX6 A;  2Q7S A;  4DNC A;  3DNS A;  1X10 A;  3BLN A;  3WC5 A;  3OWC A;  3QAH A;  4QUS A;  4Q7A A;  1M4I A;  4P4D A;  1CG2 A;  2PE3 A;  1KUV A;  4FD4 A;  2Z3N A;  4F9U A;  2C27 A;  3IFE A;  3PFO A;  2JDC A;  2ZED A;  4BD9 A;  1M4D A;  4B10 A;  5J8C A;  2XEI A;  4DUK A;  4UBR A;  1GYT A;  1PCA A;  4OAD A;  2JBJ A;  4OC2 A;  3IWW A;  4CAW A;  3JVN A;  2FIA A;  3D66 A;  3SJG A;  2JEW A;  5K8O A;  3CPA A;  3R1K A;  3S9M A;  4FAI A;  1Z8L A;  3LAC A;  2I79 A;  3S9L A;  5AGE A;  4U9Y A;  3WT4 A;  4Q36 A;  2ZEG A;  1BO4 A;  4FD7 A;  4UCP A;  4MCR A;  1P0H A;  3CZX A;  3RZA A;  3SI0 A;  2REF A;  4MHY A;  2I00 A;  3RO0 A;  1Y7E A;  8CPA A;  1RO5 A;  1S3Z A;  2ZEP A;  3FRM A;  2QIR A;  3P2F A;  4RI1 A;  4F0Y A;  5C88 A;  1S7N A;  2HQY A;  4HNX B;  1BAV A;  4PPZ A;  1VHO A;  2ZW7 A;  1QSN A;  2YNC A;  3R9G A;  5AG4 A;  4MHZ A;  4A37 A;  2ANP A;  4JXQ A;  1TKF A;  2ODF A;  4L89 A;  3GLJ A;  5EC4 A;  4KVX A;  4AG9 A;  1ELL P;  4HPS A;  4MY3 A;  1QQ9 A;  2A4N A;  1M1D A;  3FXT A;  1YGH A;  4UIB A;  4B5O A;  4KOR A;  5D8N A;  3RNZ A;  3E0K A;  4AXV A;  1WK4 A;  1HDQ A;  1EE3 P;  1GHE A;  4MI4 A;  4BMH A;  2Z3O A;  1CX8 A;  3CPX A;  1M44 A;  3DGV A;  4IK2 A;  2Q44 A;  4ZGY B;  2HC9 A;  4Y49 B;  2PJ0 A;  2Z3L A;  4E2A A;  2JLM A;  4JWP A;  2FT0 A;  2B5G B;  4JJX A;  1ZG7 A;  1RXT A;  2V8G A;  4ONW A;  2GLF A;  5G20 A;  4EME A;  2C6G A;  1M4G A;  4PK3 A;  2Y0M A;  3H8E A;  1LRZ A;  3C26 A;  4A38 A;  2OH1 A;  4AB7 A;  4II9 A;  3PBB A;  4LQ6 A;  2PVW A;  4G1P A;  1AMP A;  4R6T A;  3V38 A;  3TX8 A;  4R7M A;  1ARL A;  2B4D A;  2V8D A;  1I21 A;  3FB3 A;  5F47 A;  4KUA A;  5I0C A;  4FBE A;  3SJE A;  3I1U A;  4HNW B;  1PUA A;  4B6Z A;  1BPN A;  3S6K A;  3SJF A;  4ZY0 A;  2RC4 A;  4FD5 A;  1Z5R A;  2ZEM A;  2D4P A;  4UEE A;  4C2X A;  1XEB A;  3PB7 X;  3ZZI A;  5G1Z A;  2Z3M A;  4MHD A;  4X5K A;  1KZF A;  4PQA A;  3PRT A;  2PDO A;  3VWE A;  2ZW6 A;  4CRZ B;  4F6A A;  4B12 A;  2KCW A;  1S5K A;  5F49 A;  3BJ8 A;  2R8V A;  2J9A A;  5CNP A;  2ZEO A;  1IB1 E;  2F8H A;  4WWV A;  4MJ8 A;  2BL1 A;  5EBV A;  4XNH C;  4NGM A;  4AVC A;  2BCO A;  1YLO A;  2R1I A;  2WZN A;  4NGQ A;  4M85 A;  4P4B A;  5F09 A;  3FVL A;  1IYL A;  2Q4Y A;  4UEF A;  3DDD A;  4QBJ A;  1QMU A;  4NJR A;  4A31 A;  4NGN A;  3RAM A;  2FXF A;  1PU9 A;  3D68 A;  3S6F A;  2PIY A;  2Q04 A;  5BWA B;  5JH9 A;  5E96 A;  4OC1 A;  7CPA A;  4PSX A;  3TT2 A;  4NF1 A;  4NFR A;  4KLW A;  4ZX9 A;  1XBU A;  2G3T A;  2RFH A;  3B8G A;  1Z4R A;  3KI9 A;  1BOB A;  4DYO A;  4MFQ A;  1DTD A;  1IIC A;  4CGM A;  1BPM A;  4R87 A;  4CRY B;  3S9N A;  3I9S A;  3R9E A;  3IC1 A;  4UCN A;  2FCK A;  2GE3 A;  4P4J A;  1YW4 A;  3D2M A;  2J8M A;  4CAE A;  3KQZ A;  1TKH A;  1ZO0 A;  1YW6 A;  2C6P A;  1I1D A;  1ZLI A;  3K9U A;  3NH5 A;  3PB8 X;  3IGR A;  4KOU A;  5H84 A;  3EFA A;  3VAT A;  5F48 A;  2R7H A;  2ZW4 A;  1OBR A;  3IWG A;  2OZH A;  1ZG8 A;  2G3A A;  3BI1 A;  4CAX A;  1NMT A;  1MK4 A;  6CPA A;  4P4E A;  3B3V A;  1MJ9 A;  1TXR A;  4LX9 A;  2FSR A;  3VAR A;  2PRQ A;  3CDX A;  1XF8 A;  3BI0 A;  3CXP A;  2IQ6 A;  2OOT A;  2VBQ A;  1UFH A;  5KTD A;  2FE7 A;  4KOS A;  2AFW A;  1IOI A;  4R3L A;  3F5B A;  2GLJ A;  1K4J A;  5KTA A;  4W9Y A;  1X12 A;  3QAY A;  4JYW A;  4K30 A;  5LYL A;  2PJ8 A;  2Q7B A;  3ZJ0 A;  2ZPA A;  3MRU A;  4KS9 A;  2VQY A;  2V77 A;  2D4O A;  4C7H A;  3D7F A;  4CYN A;  1XIX A;  4ONU A;  1BLL E;  4QVT A;  4A2Z A;  4NGT A;  4P10 A;  3GYA A;  4OIW A;  3GKR A;  4AVA A;  4Y49 C;  4A94 A;  3IU2 A;  1TIQ A;  2ZOF A;  3KR4 A;  2AJ6 A;  4BBH A;  4CYQ A;  2FIW A;  5A28 A;  3KHX A;  4R9M A;  2BUE A;  2IMO A;  4ZI6 A;  2ZEL A;  3NA6 A;  1VGY A;  1HEE A;  2JEV A;  4ZBG A;  3H4Q A;  4UFW A;  1PYT B;  2VL1 A;  4GM5 A;  2FS5 A;  4MCP A;  3BHX A;  2B4D B;  3MN8 A;  4B14 A;  1QSM A;  4YFJ A;  2EWB A;  2PR8 A;  1MJA A;  3IJ3 A;  2AFU A;  4H6Z A;  2PVV A;  1J4J A;  2YNE A;  2ZEH A;  2B4B A;  1CJW A;  4NXY A;  1KUY A;  4UEZ A;  3QNV A;  1Q2C A;  1YRE A;  3TO6 A;  4CGN A;  4R8F A;  4NGS A;  4F8Z A;  5JGF A;  2QEC A;  4FD6 A;  4MBU A;  2C6C A;  2AE6 A;  4MFP A;  5JQ4 A;  1VHE A;  1LAM A;  4M6I A; 
#chains in the Genus database with same CATH homology
 4M3S A;  4AG7 A;  4XPD B;  1B6B A;  1KUX A;  4KOX A;  2P6F A;  2CY2 A;  1P4N A;  3EC4 A;  3TE4 A;  2HUZ A;  5GCN A;  2PRB A;  3W6S A;  5G22 A;  4F0X A;  2CXA A;  3TCV A;  2WUU A;  3JTK A;  3BJ7 A;  3IU1 A;  1B87 A;  2NMT A;  2B3V A;  4U9Z A;  1I12 A;  3TOB A;  2YGW A;  3EY5 A;  2IL4 A;  3SHP A;  4PK2 A;  1Y7R A;  1S7L A;  2PR1 A;  2YND A;  2R98 A;  1SQH A;  1XMT A;  2F5I A;  1CM0 A;  1WWZ A;  2P6E A;  4J3G A;  4B13 A;  2QML A;  3F0A A;  1YVK A;  4A32 A;  4HKF A;  3NE7 A;  2YNC C;  2K5T A;  2PSW A;  2Z3P A;  4OAE A;  2Z3K A;  3FYN A;  4ORF A;  2O28 A;  4JD6 A;  4IF5 A;  5AG5 A;  3TOA A;  5IX3 A;  4C2Z A;  5AG6 A;  2B3U A;  4QB9 A;  2VEZ A;  3CXQ A;  4L8A A;  3TFY A;  1S60 A;  3D8P A;  1N71 A;  4GS4 A;  4CGL A;  2J8N A;  4PV6 A;  4KSA A;  2DPT A;  4KOY A;  4B5P A;  4E0A A;  4XPL A;  4C2Y A;  4CGP A;  4KVM E;  2BSW A;  2X7B A;  4MFK A;  5DWN A;  2EUI A;  1L0C A;  2Q0Y A;  1IID A;  4XPD C;  2HV2 A;  2OB0 A;  4OLL A;  4Q38 A;  3IWE A;  2VI7 A;  5KTC A;  1VKC A;  3SXO A;  5H86 A;  2EVN A;  2OU2 A;  4KOW A;  3T9Y A;  4UFV A;  4YRH A;  2JDD A;  5G21 A;  4LUA A;  3A9L A;  3D3S A;  3V8I A;  1S7K A;  4JXR A;  1QSO A;  1QST A;  5IV0 A;  4B11 A;  2BEI A;  4CS0 B;  1ON0 A;  3LOD A;  4C68 A;  4KOV A;  3WR7 A;  3DR8 A;  2WSA A;  5HMN A;  4XPK A;  2ATR A;  4YGO A;  3QB8 A;  1Q2D A;  3TO9 A;  4EVY A;  1Y9K A;  1XE4 A;  3H5Z A;  2P0W A;  4QC6 A;  2OZG A;  3G3S A;  1Y9W A;  3S6G A;  4CYO A;  3TO7 A;  3R96 A;  2P6G A;  4CAF A;  4JLY A;  5AG7 A;  2GIV A;  4KUB A;  1YX0 A;  3UY5 A;  2DXQ A;  3W6X A;  4UFX A;  4I49 A;  3W91 A;  2WPX A;  4H6U A;  4UCM A;  2PC1 A;  2Z0Z A;  3FBU A;  4HNY B;  3EXN A;  5JPH A;  1Q2Y A;  2GAN A;  3FNC A;  4CYP A;  5DWM A;  4UWI A;  2WPW A;  4B5P B;  3N7Z A;  5IB0 A;  3PZJ A;  4KZT A;  4UA3 A;  2ZW5 A;  3DSB A;  1Z9U A;  2FL4 A;  4MFJ A;  1IYK A;  2ARH A;  2OZU A;  2PQ8 A;  2DPS A;  4KSF A;  1U6M A;  5A27 A;  3R95 A;  2Q4V A;  4AVB A;  4UWJ A;  3DR6 A;  1MJB A;  4MFZ A;  5FVJ A;  1NSL A;  4KVO E;  2Z11 A;  3JUW A;  4NCZ A;  4H89 A;  1OZP A;  1VHS A;  3PP9 A;  4PSW A;  5ISV A;  4A33 A;  3CXS A;  4MY0 A;  3GY9 A;  3MGD A;  1YK3 A;  4NSQ A;  3F8K A;  3LD2 A;  5C82 A;  4IUS A;  4KLV A;  4A95 A;  1YVO A;  4R3K A;  4A30 A;  4R57 A;  2J8R A;  2Z10 A;  2ZXV A;  2CNS A;  2VZZ A;  3I3G A;  2REE A;  4KOT A;  3TTH A;  1NE9 A;  4CGO A;  3EO4 A;  2B5G A;  2VXK A;  1QSR A;  3R9F A;  1YLE A;  3P2H A;  2B58 A;  2G0B A;  3RYO A;  2H5M A;  1Z4E A;  3SXN A;  3D2P A;  1V0C A;  5HH1 A;  3PGP A;  3S6H A;  4U5Y A;  1FY7 A;  2CNT A;  3VWD A;  5J8F A;  1YR0 A;  4C7I A;  3T90 A;  3FIX A;  4E8O A;  1S7F A;  2VZY A;  3G8W A;  4RS2 A;  5F46 A;  3KKW A;  4CAV A;  2CNM A;  1R57 A;  4MFL A;  4XNH B;  4DNC A;  3DNS A;  3BLN A;  3OWC A;  3QAH A;  4QUS A;  1M4I A;  1KUV A;  4FD4 A;  2Z3N A;  2C27 A;  2JDC A;  1M4D A;  4B10 A;  5J8C A;  4UBR A;  4OAD A;  4CAW A;  3JVN A;  2FIA A;  3R1K A;  2I79 A;  5AGE A;  4U9Y A;  4Q36 A;  1BO4 A;  4FD7 A;  4UCP A;  1P0H A;  2REF A;  2I00 A;  1RO5 A;  1S3Z A;  3FRM A;  3P2F A;  2QIR A;  4RI1 A;  4F0Y A;  5C88 A;  1S7N A;  2HQY A;  4HNX B;  2ZW7 A;  1QSN A;  2YNC A;  3R9G A;  5AG4 A;  4JXQ A;  4L89 A;  4AG9 A;  5EC4 A;  4KVX A;  4MY3 A;  2A4N A;  1M1D A;  3FXT A;  1YGH A;  4B5O A;  4KOR A;  3E0K A;  1WK4 A;  4BMH A;  1GHE A;  4MI4 A;  4ZGY B;  2Z3O A;  1M44 A;  2Q44 A;  4Y49 B;  2Z3L A;  4E2A A;  4JWP A;  2JLM A;  2FT0 A;  2B5G B;  4JJX A;  1RXT A;  5G20 A;  4PK3 A;  1M4G A;  2Y0M A;  1LRZ A;  3C26 A;  2OH1 A;  4AB7 A;  4II9 A;  5F47 A;  2B4D A;  1I21 A;  3FB3 A;  4KUA A;  5I0C A;  4HNW B;  1PUA A;  3S6K A;  2RC4 A;  4FD5 A;  2D4P A;  4C2X A;  1XEB A;  3ZZI A;  5G1Z A;  2Z3M A;  4MHD A;  4X5K A;  1KZF A;  2PDO A;  3VWE A;  2ZW6 A;  4CRZ B;  4F6A A;  4B12 A;  2KCW A;  1S5K A;  5F49 A;  3BJ8 A;  2R8V A;  5CNP A;  1IB1 E;  4MJ8 A;  2BL1 A;  5EBV A;  4XNH C;  4AVC A;  2R1I A;  4M85 A;  1IYL A;  2Q4Y A;  4QBJ A;  3DDD A;  4A31 A;  2FXF A;  1PU9 A;  5BWA B;  3S6F A;  2Q04 A;  5E96 A;  4PSX A;  3TT2 A;  4NF1 A;  4KLW A;  2G3T A;  3B8G A;  1Z4R A;  1BOB A;  4MFQ A;  1IIC A;  4CGM A;  4R87 A;  4CRY B;  3I9S A;  3R9E A;  4UCN A;  2FCK A;  2GE3 A;  3D2M A;  2J8M A;  4CAE A;  4NEX A;  1ZO0 A;  4CAX A;  3K9U A;  1I1D A;  4KOU A;  3IGR A;  5H84 A;  3EFA A;  5F48 A;  2R7H A;  2ZW4 A;  3IWG A;  2OZH A;  2G3A A;  1NMT A;  1MK4 A;  1MJ9 A;  4LX9 A;  2FSR A;  1XF8 A;  3CXP A;  2VBQ A;  1UFH A;  5KTD A;  2FE7 A;  4KOS A;  4R3L A;  3F5B A;  5KTA A;  1K4J A;  4K30 A;  2Q7B A;  3ZJ0 A;  2ZPA A;  4KS9 A;  2VQY A;  2D4O A;  4C7H A;  4CYN A;  1XIX A;  4ONU A;  4QVT A;  4A2Z A;  3GYA A;  3GKR A;  4AVA A;  4Y49 C;  3IU2 A;  1TIQ A;  4CYQ A;  2AJ6 A;  4BBH A;  2FIW A;  5A28 A;  4R9M A;  2BUE A;  2JEV A;  4ZBG A;  3H4Q A;  4UFW A;  2FS5 A;  2B4D B;  4B14 A;  1QSM A;  4YFJ A;  2PR8 A;  1MJA A;  4H6Z A;  1J4J A;  2YNE A;  2B4B A;  1CJW A;  4NXY A;  1KUY A;  4CGN A;  1Q2C A;  1YRE A;  3TO6 A;  2QEC A;  4FD6 A;  4MBU A;  5JQ4 A;  2AE6 A;  4MFP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...