4M3SA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with hepes
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
160
structure length
160
Chain Sequence
MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a GNAT superfamily acetyltransferase PA4794 in complex with HEPES
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
molecule keywords Uncharacterized protein
total genus 39
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4m3sA00
1VKCA 5ISVA 1KUXA 2PQ8A 5F47A 4FD5A 3FYNA 1IYLA 3D2MA 1QSNA 3TO7A 2QIRA 2AE6A 3TFYA 4E2AA 4PSWA 4QUSA 2VZYA 3EC4A 1IIDA 3ZZIA 1YLEA 3F0AA 2GE3A 4KVXA 3PGPA 4U9ZA 3G8WA 4PK3A 3SXNA 4UBRA 2PR8A 2VBQA 4KOWA 1OZPA 3QB8A 4CAXA 1YX0A 2PDOA 1K4JA 1Z4EA 3TE4A 4AG9A 3E0KA 4ONUA 1FY7A 1MJBA 1Q2YA 4MJ8A 3GYAA 3FNCA 1BO4A 4KOYA 2J8RA 2Z10A 1NE9A 1WK4A 4KZTA 4CAVA 3DDDA 4B5OA 3PZJA 3BJ7A 3KKWA 1PUAA 4JLYA 4M85A 1S7NA 3DR8A 4EVYA 2G3AA 4CS0B 3I3GA 4E0AA 2VQYA 3FBUA 2Q04A 4CRZB 2FL4A 3JUWA 4QBJA 2CNTA 1XIXA 2VXKA 4AVBA 5J8CA 1B6BA 4KOVA 2FE7A 2G3TA 4IUSA 1J4JA 2VZZA 4KUBA 4KLVA 2Q4VA 3C26A 4NCZA 3R96A 3TT2A 3TOAA 4LUAA 1QSOA 3TCVA 3MGDA 2QECA 3FXTA 4XPDB 5HH1A 1IB1E 4HNYB 3W91A 4R87A 2FIAA 3H4QA 4HNXB 4JD6A 5IB0A 2GANA 4DNCA 4XNHB 1Y9WA 2O28A 3T90A 3GKRA 3TOBA 4R57A 3EY5A 1MJAA 2Q4YA 2P0WA 2FCKA 3K9UA 1YVOA 1S3ZA 3D2PA 1N71A 1S5KA 4BMHA 1VHSA 4RS2A 3R95A 3UY5A 1P4NA 5I0CA 4KOSA 2ZPAA 2B4DB 2BL1A 4KVOE 3DR6A 1M44A 2NMTA 3R1KA 3OWCA 4ZBGA 2PRBA 2ATRA 1QSMA 3EFAA 4UWIA 1IICA 2OZUA 1KUYA 5JPHA 2A4NA 1S7KA 3VWEA 2PC1A 1B87A 4QC6A 4QVTA 5KTAA 3RYOA 3F8KA 4MHDA 4YGOA 2JLMA 5HMNA 1S60A 2FXFA 4J3GA 3SHPA 2HUZA 2Q0YA 3S6HA 4Y49B 4AVCA 4KORA 4OADA 4HNWB 4R3LA 1QSRA 4UWJA 2AJ6A 2VEZA 3IGRA 3S6GA 1YK3A 2OU2A 3R9GA 4LX9A 4FD4A 5FVJA 2BUEA 1QSTA 4KOXA 1L0CA 2P6FA 2D4OA 3BJ8A 4NEXA 1NMTA 2B3UA 2ZW4A 2B4DA 4I49A 2REFA 2B5GB 3B8GA 2H5MA 1I12A 2OZGA 2Q44A 3I9SA 4JWPA 1WWZA 3V8IA 2I79A 3S6FA 4XPLA 2B3VA 1P0HA 2RC4A 4U9YA 3T9YA 1R57A 3W6XA 3TTHA 5JQ4A 4UA3A 2R7HA 5DWNA 1ON0A 4H89A 5J8FA 1YR0A 5KTDA 1Y7RA 1S7FA 3LD2A 1BOBA 3JVNA 4FD6A 5F46A 4L89A 2CNMA 3S6KA 5C88A 4MI4A 2IL4A 2Q7BA 3EO4A 4AVAA 3W6SA 3D3SA 4U5YA 5KTCA 4R9MA 2J8NA 1S7LA 3VWDA 4Y49C 4YFJA 2ZW5A 1PU9A 1NSLA 1UFHA 3P2FA 5IX3A 3PP9A 5F48A 2OH1A 4XNHC 3SXOA 1XF8A 5DWMA 1Y9KA 4F0YA 3GY9A 1V0CA 4QB9A 2DXQA 4GS4A 2BEIA 1Z9UA 2ZW7A 4R3KA 1I1DA 1U6MA 3LODA 1Z4RA 5EC4A 4F6AA 4E8OA 3G3SA 3FRMA 4KOTA 4NSQA 2P6EA 4X5KA 4NXYA 2HV2A 1KZFA 1YVKA 2X7BA 2OZHA 5E96A 1M4DA 4PK2A 2R98A 4FD7A 3P2HA 2B58A 3FB3A 2R1IA 4K30A 3DNSA 5EBVA 3R9EA 4B5PB 2CY2A 4KLWA 4IF5A 2KCWA 2K5TA 2C27A 5IV0A 4NF1A 4CAWA 1KUVA 2WPWA 1Q2DA 2CNSA 1CM0A 1TIQA 2PSWA 2P6GA 4B5PA 4KVME 2WPXA 4CRYB 4MY3A 1IYKA 4HKFA 3QAHA 4AG7A 2HQYA 3BLNA 2D4PA 5H86A 2JDDA 4II9A 1RXTA 2FS5A 4MBUA 1MJ9A 2EUIA 2J8MA 2JEVA 1SQHA 3TO9A 3DSBA 2ZW6A 3CXSA 3IWGA 4KOUA 4PSXA 2Y0MA 2I00A 3EXNA 5CNPA 2VI7A 3TO6A 2R8VA 1I21A 4MY0A 5H84A 1GHEA 4ORFA 3CXQA 3CXPA 5C82A 4AB7A 2EVNA 2FSRA 3F5BA 1MK4A 1Q2CA 5F49A 1XE4A 2JDCA 4XPKA 2Z0ZA 4OLLA 2BSWA 2GIVA 3D8PA 1RO5A 4OAEA 2ZXVA 1YGHA 2ARHA 1M4GA 1XMTA 1YREA 2F5IA 4JXRA 1M4IA 4H6ZA 4XPDC 2PR1A 2FT0A 4JXQA 1CJWA 5GCNA 3R9FA 4M3SA 3WR7A 2G0BA 3N7ZA 1LRZA 3ZJ0A 2Z11A 3NE7A 1M1DA 2FIWA 4KUAA 2B5GA 3FIXA 4L8AA 4JJXA 4PV6A 2OB0A 1XEBA 4RI1A 4H6UA 2QMLA 2B4BA 4YRHA 2REEA
chains in the Genus database with same CATH superfamily
1F2PA 4GXHA 4CGPA 4IHMA 1VKCA 5ISVA 2GU2A 2DPTA 3HLPA 2ZEHA 1KUXA 1CX8A 2PQ8A 3FMCA 1QMUA 4R76A 5F47A 3B7IA 3D7FA 3D68A 2Z3MA 4X2TA 3NH4A 4FD5A 4MCQA 3B2YA 1IGBA 3H5ZA 3FYNA 1IYLA 3D2MA 4MHPA 4C7HA 1QSNA 3TO7A 2QIRA 2AE6A 2F7VA 3FJUA 4OC3A 3TFYA 4E2AA 4PSWA 4QUSA 2VZYA 3EC4A 4BD9A 1IIDA 3ZZIA 1RTQA 3CPXA 4A32A 1YLEA 3F0AA 2GE3A 3WC5A 4KVXA 3PGPA 1R43A 3NA6A 1ARLA 1DTDA 5JPHA 3V7ZA 3BHXA 4U9ZA 1Z8LA 3G8WA 4PK3A 3SXNA 4UBRA 2PR8A 2DEAA 2VBQA 3FX6A 3H8GA 2PVVA 4KOWA 2XEIA 1OZPA 3GIUA 3KQXA 3QB8A 1XRYA 4CAXA 1YX0A 2PDOA 1TKFA 4UEEA 1Y0RA 4EWTA 2AFOA 5K8OA 7CPAA 3PRTA 1K4JA 4F9UA 1Z4EA 4UCNA 4P45A 3TE4A 4AG9A 2Q7SA 5JH9A 3E0KA 4ONUA 1TF9A 1FY7A 1MJBA 2HB6A 2WSAA 2PJ8A 2WYRA 2BCOA 1Q2YA 4MJ8A 5CPAA 3GYAA 2PCUA 2JEWA 4B11A 3FNCA 4CYOA 1BO4A 4KOYA 1IU8A 3LACA 4A95A 2POKA 2V77A 1Z2LA 2J8RA 1ZG8A 2Z10A 2EK8A 5LRKA 5THWA 1HDUA 1NE9A 1WK4A 4MFZA 4YU9A 3WT4A 4KZTA 5CBMA 4CAVA 3DDDA 4ZX9A 1ZG7A 4B5OA 3PZJA 3BXMA 3BJ7A 3KKWA 4TNUA 1LCPA 1CBXA 1PUAA 1AMPA 4JLYA 4MFPA 4M85A 2PJ5A 3RNZA 1S7NA 5K8MA 2PJ2A 3DR8A 4KSAA 3VARA 4EVYA 2QVPA 2BOAA 2G3AA 4CS0B 3I3GA 4E0AA 2VQYA 1CG2A 3N5FA 1YMEA 3FBUA 2Q04A 1FNOA 1YSJA 3IU2A 4A94A 4CRZB 4KS9A 4FUUA 4PPZA 2FL4A 1FT7A 4CPAA 3JUWA 1JWQA 4OC0A 4QBJA 2CF4A 2EK9A 2CNTA 4R6TA 4B6ZA 1OBRA 1HDQA 1JQGA 1XIXA 3GB0A 3IWWA 4ZYQA 4PXDA 5HVHA 2VXKA 4AVBA 5J8CA 3D7HA 1B6BA 4KOVA 5EMIA 2FE7A 2G3TA 4IUSA 1J4JA 2VZZA 4KUBA 1Z8TA 4OC2A 4KLVA 4C7IA 2C1CA 2Q4VA 4P4JA 5LRGA 3C26A 4NCZA 3R96A 3TT2A 3TOAA 4LUAA 3B3WA 2BO9A 1QSOA 3TCVA 3MGDA 1Z8WA 4NGNA 2QECA 3FXTA 4XPDB 5HH1A 2PJAA 4B14A 1IB1E 4HNYB 3W91A 1LAMA 2V8GA 3B3TA 4R87A 2YNDA 3PB7X 2AFWA 2FIAA 3H4QA 4HNXB 4ZY2A 4OP4A 4JD6A 4W9YA 1Z5RA 3SI1A 1VGYA 2GANA 5IB0A 3KASA 4M6IA 4LQ6A 2ZEPA 2F8HA 4TWEA 4DNCA 3KL9A 1A2ZA 4XNHB 1Y9WA 2O28A 1KWMA 3PB6X 3T90A 3GKRA 3TOBA 4R57A 3EY5A 4R8FA 1MJAA 2Q4YA 4IK2A 5DS0A 2P0WA 2FCKA 4KSFA 3L2NA 3K9UA 1YVOA 2GREA 4X8IA 1S3ZA 2WUUA 3D2PA 1N71A 1S5KA 4BMHA 5F46A 4NFRA 3A9LA 1VHSA 4LQGA 3S9NA 3D7DA 2JBKA 1DE4C 4RS2A 3R95A 3UY5A 3S9LA 3IC1A 1P4NA 5I0CA 4KOSA 4NJQA 2ZPAA 2B4DB 2BL1A 1LAPA 4KVOE 3DR6A 4OC1A 3JTKA 1M44A 4PXCA 2NMTA 4MMOA 4DYOA 1CPSA 3R1KA 3FH4A 3ISXA 1Q7LA 3OWCA 1H8LA 4ZBGA 2PRBA 3GUXA 2ATRA 3CZXA 4H2KA 1QSMA 3EFAA 3BI0A 1IICA 4UWIA 2OZUA 3QAYA 1KUYA 1IOIA 2AFUA 2A4NA 1HEEA 1S7KA 3VH9A 2PJCA 2PC1A 1B87A 1Z8XA 4QC6A 4QVTA 3VWEA 5KTAA 3RYOA 4P4FA 3F8KA 4MHDA 4OC5A 4YGOA 3RO0A 2JLMA 5LRJA 5HMNA 1S60A 2FXFA 3PB8X 4NGTA 4UEZA 4J3GA 4CYNA 3SHPA 2HUZA 4P44A 2Q0YA 3D66A 3S6HA 4MFLA 4Y49B 1X12A 4AVCA 4KORA 4OADA 1LOKA 5G20A 4HNWB 2QJ8A 5A28A 4R3LA 1QSRA 4UWJA 2AJ6A 4JYWA 2FVGA 4CAFA 2VEZA 4CYQA 2GFQA 2G9DA 3IGRA 3S6GA 2XEFA 1YK3A 2OU2A 5D8NA 3R9GA 4LX9A 4FD4A 5FVJA 4BINA 2BUEA 1QSTA 4KOXA 1L0CA 2P6FA 4NGSA 3GLJA 2CXAA 2D4OA 2ABZA 4PXBA 3BJ8A 4NEXA 2RB7A 2O53A 1NMTA 4GM5A 3MRUA 2B3UA 4UEFA 2PJ6A 2ZW4A 4A37A 2B4DA 4I49A 2REFA 2B5GB 2V8HA 2H5MA 1VIXA 3B8GA 4F9VA 1I12A 1ZO0A 4WWVA 2OZGA 4DJLA 2Q44A 1XJOA 2NYQA 3I9SA 1WWZA 4JWPA 5ELYA 2I79A 3S6FA 3V8IA 4XPLA 3B3CA 3CDXA 3PB4X 2B3VA 2EBJA 1P0HA 2ODFA 2RC4A 4U9YA 3T9YA 1R57A 3W6XA 3TTHA 3QNVA 1LANA 4A39A 4RN7A 2XEJA 5JQ4A 4UA3A 4EMEA 1ZLIA 2R7HA 5DWNA 3PFEA 1ON0A 4H89A 4UIAA 5J8FA 2ANPA 1YR0A 2CTCA 3H8EA 2WZNA 5KTDA 3KI9A 1ARMA 1Y7RA 4CAEA 1S7FA 2O4HA 3LD2A 1ELLP 1XBUA 4A38A 1BOBA 3CPAA 3JVNA 4B12A 4MHZA 4RUHA 4ZY1A 4FD6A 6CPAA 1Y0YA 2CIJA 4C68A 4L89A 2CNMA 2ZEOA 3PEIA 4G1PA 4O23A 1CP6A 3S6KA 4C2ZA 4C2XA 5C88A 2OR4A 3KHZA 5F09A 4MI4A 2IL4A 2ZEFA 3K2KA 3EO4A 4NGRA 2Q7BA 4AVAA 4FAIA 2ZEEA 3W6SA 3D3SA 4P4IA 5BWAB 4U5YA 4MCSA 1AUGA 5KTCA 2VL1A 2C6CA 4R9MA 2J8NA 1S7LA 3VWDA 2IMOA 4Y49C 2GLJA 4YFJA 4MHNA 2PJBA 2ZEGA 2ZW5A 3JRUA 4A33A 2CTBA 3KR4A 1PU9A 2AFMA 1NSLA 2ZELA 1UFHA 3P2FA 3KZWA 5IX3A 4OIDA 3KHXA 3PP9A 5F48A 2OH1A 2ZEDA 4UFWA 4XNHC 3SXOA 3IJ3A 1CPXA 4MFJA 3FECA 1NSAA 4ZI6A 5LYFA 2PIYA 4OMEA 1XF8A 5K8PA 3NH8A 5DWMA 3FVLA 1Y9KA 4F0YA 2PJ9A 2JBJA 2XEGA 3GY9A 5LYLA 2Z3NA 1V0CA 3FEEA 2Z3LA 4QB9A 2DXQA 4YWYA 3FEDA 2ZENA 2BEIA 4GS4A 1Z9UA 2ZW7A 4R3KA 1I1DA 2RFHA 3HUVA 3D67A 1U6MA 2PE3A 4MXUA 3IU1A 3LODA 1Z4RA 5EC4A 4F6AA 3V38A 2DPSA 4NGQA 4B13A 4E8OA 4DUKA 3G3SA 3PB9X 4ZX8A 2Z3OA 3FRMA 4UCMA 4R7MA 3D7GA 4MHYA 2EO8A 4KOTA 2YNCC 3FF3A 4NSQA 4MRIA 4BBHA 4M6HA 1IY7A 2P6EA 1ELMP 4X5KA 4WJBA 4NXYA 2HV2A 5HVGA 1KZFA 1YVKA 2PJ1A 1X10A 2OZHA 2PVWA 2X7BA 5E96A 3RAMA 4Q38A 4PQAA 3KQZA 1M4DA 1VHOA 1QQ9A 4PK2A 5HVFA 2R98A 3D4UA 4FD7A 3IFEA 3P2HA 5A27A 1XFOA 2B58A 4OKOA 3FB3A 2R1IA 1F57A 4K30A 3SI2A 4B10A 3DNSA 2QYVA 5EBVA 1AYEA 2Q51A 3WC6A 1M4LA 4IAVA 2HC9A 3SJEA 3R9EA 4B5PB 2CY2A 4NJRA 3NE8A 4KLWA 4F8ZA 4IF5A 1F2OA 2KCWA 4UIBA 2K5TA 5D29A 2C27A 5IV0A 4NF1A 8CPAA 4CAWA 3ISZA 4KSIA 3TC8A 1KUVA 2WPWA 2ZEMA 4X3RA 1Q2DA 3WC7A 2CNSA 2PJ3A 1CM0A 3RZAA 4A2ZA 1YLOA 3PBEA 1TIQA 5G1ZA 2YNCA 4AXVA 4C2YA 2PSWA 2P6GA 2OOTA 3RBUA 4KVME 2WPXA 1PCAA 4B5PA 3DLJA 4CYPA 5I4MA 4CRYB 4UFVA 4MY3A 1BPMA 4Q7AA 3TX8A 3CT9A 1IYKA 4HKFA 3QAHA 4AG7A 4Z65A 1CP7A 2HQYA 3BLNA 2D4PA 3DGVA 4P4BA 4F0XA 1ZLHA 5H86A 2PJ7A 3VATA 2DF5A 4UCPA 5LYIA 5AG4A 2JDDA 4II9A 4FWUA 1RXTA 5AGEA 2Q4ZA 1TKJA 4CGNA 2FS5A 3MN8A 4MBUA 4CGLA 1GYTA 1MJ9A 2EUIA 4MCRA 1BAVA 2C6PA 2J8MA 3NH5A 5JGFA 2V8VA 2JEVA 4P4EA 1TF8A 1YW4A 2YGWA 1SQHA 3BI1A 2NSMA 3NFZA 2IQ6A 1LFWA 1XOVA 2PJ4A 3DSBA 1R3NA 3S9MA 3TO9A 2ZW6A 1BLLE 3KGQA 3CXSA 3KR5A 3IWGA 4KOUA 4PSXA 5AG5A 2Y0MA 2I00A 4K3NA 4UFXA 3EXNA 3PFOA 3IIBA 5CNPA 2VI7A 1YW6A 2R8VA 3TO6A 4UF4A 1I21A 2Q43A 3B3VA 1GHEA 4MY0A 5H84A 4CGOA 4ORFA 5JM6A 1EE3P 4ONWA 5HXDA 2GLFA 3CXQA 2AFXA 3CXPA 5C82A 4NGPA 4P10A 2PIZA 2AFSA 5G21A 3IWEA 1Y7EA 3SJGA 4AB7A 4OC4A 3SI0A 4MFKA 2EVNA 2FSRA 3F5BA 1MK4A 1Q2CA 5F49A 1XE4A 2JDCA 3WABA 2Z3PA 2AFZA 2PRQA 4XPKA 5G22A 3SJFA 2Z0ZA 2BSWA 4OLLA 2GIVA 4NGMA 5J1QA 3D8PA 4PXEA 1RO5A 4OIWA 3K9TA 4OAEA 2ZXVA 3H8FA 1PYTB 1YGHA 2V8DA 3LMSA 3PBBA 2ARHA 4HPSA 3T8WA 1M4GA 1XMTA 4P6YA 1YREA 1VHEA 2F5IA 3SJXA 4JXRA 1M4IA 1YQEA 2C6GA 3IO1A 1IOFA 4H6ZA 4XPDC 2PR1A 2FT0A 4JXQA 1CJWA 5GCNA 2ZOGA 1ZG9A 3I1UA 3R9FA 4M3SA 2YNEA 4P4DA 3WR7A 4ZY0A 2Z3KA 2G0BA 2IJZA 4A30A 4CGMA 2J9AA 4FBEA 3N7ZA 1LRZA 4JZ0A 3ZJ0A 1TKHA 5AG7A 2Z11A 3NE7A 4ZGYB 1M1DA 2EWBA 2FIWA 4KUAA 2B5GA 1BPNA 1UWYA 3B3SA 3FIXA 4L8AA 4JJXA 3IEHA 4MCPA 4Q36A 5AG6A 3LWUA 4PV6A 2OB0A 1XEBA 5K8NA 1XMBA 4RI1A 4H6UA 3B35A 2QMLA 2I3CA 4M6GA 1TXRA 4A31A 4EFDA 2B4BA 2PJ0A 4YRHA 5LYDA 2REEA 5IB9A 2ZOFA 4MFQA
chains in the Genus database with same CATH topology
1VKCA 5ISVA 2DPTA 1KUXA 2PQ8A 5F47A 2Z3MA 4FD5A 3H5ZA 3FYNA 1IYLA 3D2MA 4C7HA 1QSNA 3TO7A 2QIRA 2AE6A 3TFYA 4E2AA 4PSWA 4QUSA 2VZYA 3EC4A 1IIDA 3ZZIA 4A32A 1YLEA 3F0AA 2GE3A 4KVXA 3PGPA 4U9ZA 3G8WA 4PK3A 3SXNA 4UBRA 2PR8A 2VBQA 4KOWA 1OZPA 3QB8A 4CAXA 1YX0A 2PDOA 1K4JA 1Z4EA 4UCNA 3TE4A 4AG9A 3E0KA 4ONUA 1FY7A 1MJBA 2WSAA 1Q2YA 4MJ8A 3GYAA 4B11A 4CYOA 3FNCA 1BO4A 4KOYA 4A95A 2J8RA 2Z10A 1NE9A 1WK4A 4MFZA 4KZTA 4CAVA 3DDDA 4B5OA 3PZJA 3BJ7A 3KKWA 1PUAA 4JLYA 4MFPA 4M85A 1S7NA 3DR8A 4KSAA 4EVYA 2G3AA 4CS0B 3I3GA 4E0AA 2VQYA 3FBUA 2Q04A 3IU2A 4CRZB 4KS9A 2FL4A 3JUWA 4QBJA 2CNTA 1XIXA 2VXKA 4AVBA 5J8CA 1B6BA 4KOVA 2FE7A 2G3TA 4IUSA 1J4JA 2VZZA 4KUBA 4KLVA 4C7IA 2Q4VA 3C26A 4NCZA 3R96A 3TT2A 3TOAA 4LUAA 1QSOA 3TCVA 3MGDA 2QECA 3FXTA 4XPDB 5HH1A 4B14A 1IB1E 4HNYB 3W91A 4R87A 2YNDA 2FIAA 3H4QA 4HNXB 4JD6A 5IB0A 2GANA 4DNCA 4XNHB 1Y9WA 2O28A 3T90A 3GKRA 3TOBA 4R57A 3EY5A 1MJAA 2Q4YA 2P0WA 2FCKA 4KSFA 3K9UA 1YVOA 1S3ZA 2WUUA 3D2PA 1N71A 1S5KA 4BMHA 3A9LA 1VHSA 4RS2A 3R95A 3UY5A 1P4NA 5I0CA 4KOSA 2ZPAA 2B4DB 2BL1A 4KVOE 3DR6A 3JTKA 1M44A 2NMTA 3R1KA 3OWCA 4ZBGA 2PRBA 2ATRA 1QSMA 3EFAA 4UWIA 1IICA 2OZUA 1KUYA 5JPHA 2A4NA 1S7KA 3VWEA 2PC1A 1B87A 4QC6A 4QVTA 5KTAA 3RYOA 3F8KA 4MHDA 4YGOA 2JLMA 5HMNA 1S60A 2FXFA 4J3GA 4CYNA 3SHPA 2HUZA 2Q0YA 3S6HA 4MFLA 4Y49B 4AVCA 4KORA 4OADA 5G20A 4HNWB 5A28A 4R3LA 1QSRA 4UWJA 2AJ6A 4CAFA 2VEZA 4CYQA 3IGRA 3S6GA 1YK3A 2OU2A 3R9GA 4LX9A 4FD4A 5FVJA 2BUEA 1QSTA 4KOXA 1L0CA 2P6FA 2CXAA 2D4OA 3BJ8A 4NEXA 1NMTA 2B3UA 2ZW4A 2B4DA 4I49A 2REFA 2B5GB 3B8GA 2H5MA 1I12A 1ZO0A 2OZGA 2Q44A 3I9SA 4JWPA 1WWZA 3V8IA 2I79A 3S6FA 4XPLA 2B3VA 1P0HA 2RC4A 4U9YA 3T9YA 1R57A 3W6XA 3TTHA 5JQ4A 4UA3A 2R7HA 5DWNA 1ON0A 4H89A 5J8FA 1YR0A 5KTDA 1Y7RA 4CAEA 1S7FA 3LD2A 1BOBA 3JVNA 4B12A 4FD6A 5F46A 4C68A 4L89A 2CNMA 4C2XA 4C2ZA 3S6KA 5C88A 4MI4A 2IL4A 2Q7BA 3EO4A 4AVAA 3W6SA 3D3SA 5BWAB 4U5YA 5KTCA 4R9MA 2J8NA 1S7LA 3VWDA 4Y49C 4YFJA 4A33A 2ZW5A 1PU9A 1NSLA 1UFHA 3P2FA 5IX3A 3PP9A 5F48A 2OH1A 4UFWA 4XNHC 3SXOA 4MFJA 1XF8A 5DWMA 1Y9KA 4F0YA 3GY9A 2Z3NA 1V0CA 2Z3LA 4QB9A 2DXQA 4GS4A 2BEIA 1Z9UA 2ZW7A 4R3KA 1I1DA 1U6MA 3IU1A 3LODA 1Z4RA 5EC4A 4F6AA 2DPSA 4B13A 4E8OA 3G3SA 2Z3OA 3FRMA 4UCMA 4KOTA 2YNCC 4NSQA 4BBHA 2P6EA 4X5KA 4NXYA 2HV2A 1KZFA 1YVKA 2X7BA 2OZHA 5E96A 4Q38A 1M4DA 4PK2A 2R98A 4FD7A 3P2HA 5A27A 2B58A 3FB3A 2R1IA 4K30A 4B10A 3DNSA 5EBVA 3R9EA 4B5PB 2CY2A 4KLWA 4IF5A 2KCWA 2K5TA 2C27A 5IV0A 4NF1A 4CAWA 1KUVA 2WPWA 1Q2DA 2CNSA 1CM0A 4A2ZA 1TIQA 5G1ZA 2YNCA 4C2YA 2PSWA 2P6GA 4B5PA 4CYPA 4KVME 2WPXA 4CRYB 4UFVA 4MY3A 1IYKA 4HKFA 3QAHA 4AG7A 2HQYA 3BLNA 2D4PA 4F0XA 5H86A 4UCPA 5AG4A 2JDDA 4II9A 1RXTA 5AGEA 4CGNA 2FS5A 4MBUA 4CGLA 1MJ9A 2EUIA 2J8MA 2JEVA 2YGWA 1SQHA 3TO9A 3DSBA 2ZW6A 3CXSA 3IWGA 4KOUA 4PSXA 5AG5A 2Y0MA 2I00A 4UFXA 3EXNA 5CNPA 2VI7A 3TO6A 2R8VA 1I21A 4MY0A 5H84A 1GHEA 4CGOA 4ORFA 3CXQA 3CXPA 5C82A 5G21A 3IWEA 4AB7A 4MFKA 2EVNA 2FSRA 3F5BA 1MK4A 1Q2CA 5F49A 1XE4A 2JDCA 2Z3PA 4XPKA 5G22A 2Z0ZA 2BSWA 4OLLA 2GIVA 3D8PA 1RO5A 4OAEA 2ZXVA 1YGHA 2ARHA 1M4GA 1XMTA 1YREA 2F5IA 4JXRA 1M4IA 4H6ZA 4XPDC 2PR1A 2FT0A 4JXQA 1CJWA 5GCNA 3R9FA 4M3SA 2YNEA 3WR7A 2Z3KA 2G0BA 4A30A 4CGMA 3N7ZA 1LRZA 3ZJ0A 5AG7A 2Z11A 3NE7A 4ZGYB 1M1DA 2FIWA 4KUAA 2B5GA 3FIXA 4L8AA 4CGPA 4JJXA 4Q36A 5AG6A 4PV6A 2OB0A 1XEBA 4RI1A 4H6UA 2QMLA 4A31A 2B4BA 4YRHA 2REEA 4MFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VKC A;  5ISV A;  1KUX A;  2PQ8 A;  5F47 A;  4FD5 A;  3FYN A;  1IYL A;  3D2M A;  1QSN A;  3TO7 A;  2QIR A;  2AE6 A;  3TFY A;  4E2A A;  4PSW A;  4QUS A;  2VZY A;  3EC4 A;  1IID A;  3ZZI A;  1YLE A;  3F0A A;  2GE3 A;  4KVX A;  3PGP A;  4U9Z A;  3G8W A;  4PK3 A;  3SXN A;  4UBR A;  2PR8 A;  2VBQ A;  4KOW A;  1OZP A;  3QB8 A;  4CAX A;  1YX0 A;  2PDO A;  1K4J A;  1Z4E A;  3TE4 A;  4AG9 A;  3E0K A;  4ONU A;  1FY7 A;  1MJB A;  1Q2Y A;  4MJ8 A;  3GYA A;  3FNC A;  1BO4 A;  4KOY A;  2J8R A;  2Z10 A;  1NE9 A;  1WK4 A;  4KZT A;  4CAV A;  3DDD A;  4B5O A;  3PZJ A;  3BJ7 A;  3KKW A;  1PUA A;  4JLY A;  4M85 A;  1S7N A;  3DR8 A;  4EVY A;  2G3A A;  4CS0 B;  3I3G A;  4E0A A;  2VQY A;  3FBU A;  2Q04 A;  4CRZ B;  2FL4 A;  3JUW A;  4QBJ A;  2CNT A;  1XIX A;  2VXK A;  4AVB A;  5J8C A;  1B6B A;  4KOV A;  2FE7 A;  2G3T A;  4IUS A;  1J4J A;  2VZZ A;  4KUB A;  4KLV A;  2Q4V A;  3C26 A;  4NCZ A;  3R96 A;  3TT2 A;  3TOA A;  4LUA A;  1QSO A;  3TCV A;  3MGD A;  2QEC A;  3FXT A;  4XPD B;  5HH1 A;  1IB1 E;  4HNY B;  3W91 A;  4R87 A;  2FIA A;  3H4Q A;  4HNX B;  4JD6 A;  5IB0 A;  2GAN A;  4DNC A;  4XNH B;  1Y9W A;  2O28 A;  3T90 A;  3GKR A;  3TOB A;  4R57 A;  3EY5 A;  1MJA A;  2Q4Y A;  2P0W A;  2FCK A;  3K9U A;  1YVO A;  1S3Z A;  3D2P A;  1N71 A;  1S5K A;  4BMH A;  1VHS A;  4RS2 A;  3R95 A;  3UY5 A;  1P4N A;  5I0C A;  4KOS A;  2ZPA A;  2B4D B;  2BL1 A;  4KVO E;  3DR6 A;  1M44 A;  2NMT A;  3R1K A;  3OWC A;  4ZBG A;  2PRB A;  2ATR A;  1QSM A;  3EFA A;  4UWI A;  1IIC A;  2OZU A;  1KUY A;  5JPH A;  2A4N A;  1S7K A;  3VWE A;  2PC1 A;  1B87 A;  4QC6 A;  4QVT A;  5KTA A;  3RYO A;  3F8K A;  4MHD A;  4YGO A;  2JLM A;  5HMN A;  1S60 A;  2FXF A;  4J3G A;  3SHP A;  2HUZ A;  2Q0Y A;  3S6H A;  4Y49 B;  4AVC A;  4KOR A;  4OAD A;  4HNW B;  4R3L A;  1QSR A;  4UWJ A;  2AJ6 A;  2VEZ A;  3IGR A;  3S6G A;  1YK3 A;  2OU2 A;  3R9G A;  4LX9 A;  4FD4 A;  5FVJ A;  2BUE A;  1QST A;  4KOX A;  1L0C A;  2P6F A;  2D4O A;  3BJ8 A;  4NEX A;  1NMT A;  2B3U A;  2ZW4 A;  2B4D A;  4I49 A;  2REF A;  2B5G B;  3B8G A;  2H5M A;  1I12 A;  2OZG A;  2Q44 A;  3I9S A;  4JWP A;  1WWZ A;  3V8I A;  2I79 A;  3S6F A;  4XPL A;  2B3V A;  1P0H A;  2RC4 A;  4U9Y A;  3T9Y A;  1R57 A;  3W6X A;  3TTH A;  5JQ4 A;  4UA3 A;  2R7H A;  5DWN A;  1ON0 A;  4H89 A;  5J8F A;  1YR0 A;  5KTD A;  1Y7R A;  1S7F A;  3LD2 A;  1BOB A;  3JVN A;  4FD6 A;  5F46 A;  4L89 A;  2CNM A;  3S6K A;  5C88 A;  4MI4 A;  2IL4 A;  2Q7B A;  3EO4 A;  4AVA A;  3W6S A;  3D3S A;  4U5Y A;  5KTC A;  4R9M A;  2J8N A;  1S7L A;  3VWD A;  4Y49 C;  4YFJ A;  2ZW5 A;  1PU9 A;  1NSL A;  1UFH A;  3P2F A;  5IX3 A;  3PP9 A;  5F48 A;  2OH1 A;  4XNH C;  3SXO A;  1XF8 A;  5DWM A;  1Y9K A;  4F0Y A;  3GY9 A;  1V0C A;  4QB9 A;  2DXQ A;  4GS4 A;  2BEI A;  1Z9U A;  2ZW7 A;  4R3K A;  1I1D A;  1U6M A;  3LOD A;  1Z4R A;  5EC4 A;  4F6A A;  4E8O A;  3G3S A;  3FRM A;  4KOT A;  4NSQ A;  2P6E A;  4X5K A;  4NXY A;  2HV2 A;  1KZF A;  1YVK A;  2X7B A;  2OZH A;  5E96 A;  1M4D A;  4PK2 A;  2R98 A;  4FD7 A;  3P2H A;  2B58 A;  3FB3 A;  2R1I A;  4K30 A;  3DNS A;  5EBV A;  3R9E A;  4B5P B;  2CY2 A;  4KLW A;  4IF5 A;  2KCW A;  2K5T A;  2C27 A;  5IV0 A;  4NF1 A;  4CAW A;  1KUV A;  2WPW A;  1Q2D A;  2CNS A;  1CM0 A;  1TIQ A;  2PSW A;  2P6G A;  4B5P A;  4KVM E;  2WPX A;  4CRY B;  4MY3 A;  1IYK A;  4HKF A;  3QAH A;  4AG7 A;  2HQY A;  3BLN A;  2D4P A;  5H86 A;  2JDD A;  4II9 A;  1RXT A;  2FS5 A;  4MBU A;  1MJ9 A;  2EUI A;  2J8M A;  2JEV A;  1SQH A;  3TO9 A;  3DSB A;  2ZW6 A;  3CXS A;  3IWG A;  4KOU A;  4PSX A;  2Y0M A;  2I00 A;  3EXN A;  5CNP A;  2VI7 A;  3TO6 A;  2R8V A;  1I21 A;  4MY0 A;  5H84 A;  1GHE A;  4ORF A;  3CXQ A;  3CXP A;  5C82 A;  4AB7 A;  2EVN A;  2FSR A;  3F5B A;  1MK4 A;  1Q2C A;  5F49 A;  1XE4 A;  2JDC A;  4XPK A;  2Z0Z A;  4OLL A;  2BSW A;  2GIV A;  3D8P A;  1RO5 A;  4OAE A;  2ZXV A;  1YGH A;  2ARH A;  1M4G A;  1XMT A;  1YRE A;  2F5I A;  4JXR A;  1M4I A;  4H6Z A;  4XPD C;  2PR1 A;  2FT0 A;  4JXQ A;  1CJW A;  5GCN A;  3R9F A;  4M3S A;  3WR7 A;  2G0B A;  3N7Z A;  1LRZ A;  3ZJ0 A;  2Z11 A;  3NE7 A;  1M1D A;  2FIW A;  4KUA A;  2B5G A;  3FIX A;  4L8A A;  4JJX A;  4PV6 A;  2OB0 A;  1XEB A;  4RI1 A;  4H6U A;  2QML A;  2B4B A;  4YRH A;  2REE A; 
#chains in the Genus database with same CATH topology
 1F2P A;  4GXH A;  4CGP A;  4IHM A;  1VKC A;  5ISV A;  2GU2 A;  2DPT A;  3HLP A;  2ZEH A;  1KUX A;  1CX8 A;  2PQ8 A;  3FMC A;  1QMU A;  4R76 A;  5F47 A;  3B7I A;  3D7F A;  3D68 A;  2Z3M A;  4X2T A;  3NH4 A;  4FD5 A;  4MCQ A;  3B2Y A;  1IGB A;  3H5Z A;  3FYN A;  1IYL A;  3D2M A;  4MHP A;  4C7H A;  1QSN A;  3TO7 A;  2QIR A;  2AE6 A;  2F7V A;  3FJU A;  4OC3 A;  3TFY A;  4E2A A;  4PSW A;  4QUS A;  2VZY A;  3EC4 A;  4BD9 A;  1IID A;  3ZZI A;  1RTQ A;  3CPX A;  4A32 A;  1YLE A;  3F0A A;  2GE3 A;  3WC5 A;  4KVX A;  3PGP A;  1R43 A;  3NA6 A;  1ARL A;  1DTD A;  5JPH A;  3V7Z A;  3BHX A;  4U9Z A;  1Z8L A;  3G8W A;  4PK3 A;  3SXN A;  4UBR A;  2PR8 A;  2DEA A;  2VBQ A;  3FX6 A;  3H8G A;  2PVV A;  4KOW A;  2XEI A;  1OZP A;  3GIU A;  3KQX A;  3QB8 A;  1XRY A;  4CAX A;  1YX0 A;  2PDO A;  1TKF A;  4UEE A;  1Y0R A;  4EWT A;  2AFO A;  5K8O A;  7CPA A;  3PRT A;  1K4J A;  4F9U A;  1Z4E A;  4UCN A;  4P45 A;  3TE4 A;  4AG9 A;  2Q7S A;  5JH9 A;  3E0K A;  4ONU A;  1TF9 A;  1FY7 A;  1MJB A;  2HB6 A;  2WSA A;  2PJ8 A;  2WYR A;  2BCO A;  1Q2Y A;  4MJ8 A;  5CPA A;  3GYA A;  2PCU A;  2JEW A;  4B11 A;  3FNC A;  4CYO A;  1BO4 A;  4KOY A;  1IU8 A;  3LAC A;  4A95 A;  2POK A;  2V77 A;  1Z2L A;  2J8R A;  1ZG8 A;  2Z10 A;  2EK8 A;  5LRK A;  5THW A;  1HDU A;  1NE9 A;  1WK4 A;  4MFZ A;  4YU9 A;  3WT4 A;  4KZT A;  5CBM A;  4CAV A;  3DDD A;  4ZX9 A;  1ZG7 A;  4B5O A;  3PZJ A;  3BXM A;  3BJ7 A;  3KKW A;  4TNU A;  1LCP A;  1CBX A;  1PUA A;  1AMP A;  4JLY A;  4MFP A;  4M85 A;  2PJ5 A;  3RNZ A;  1S7N A;  5K8M A;  2PJ2 A;  3DR8 A;  4KSA A;  3VAR A;  4EVY A;  2QVP A;  2BOA A;  2G3A A;  4CS0 B;  3I3G A;  4E0A A;  2VQY A;  1CG2 A;  3N5F A;  1YME A;  3FBU A;  2Q04 A;  1FNO A;  1YSJ A;  3IU2 A;  4A94 A;  4CRZ B;  4KS9 A;  4FUU A;  4PPZ A;  2FL4 A;  1FT7 A;  4CPA A;  3JUW A;  1JWQ A;  4OC0 A;  4QBJ A;  2CF4 A;  2EK9 A;  2CNT A;  4R6T A;  4B6Z A;  1OBR A;  1HDQ A;  1JQG A;  1XIX A;  3GB0 A;  3IWW A;  4ZYQ A;  4PXD A;  5HVH A;  2VXK A;  4AVB A;  5J8C A;  3D7H A;  1B6B A;  4KOV A;  5EMI A;  2FE7 A;  2G3T A;  4IUS A;  1J4J A;  2VZZ A;  4KUB A;  1Z8T A;  4OC2 A;  4KLV A;  4C7I A;  2C1C A;  2Q4V A;  4P4J A;  5LRG A;  3C26 A;  4NCZ A;  3R96 A;  3TT2 A;  3TOA A;  4LUA A;  3B3W A;  2BO9 A;  1QSO A;  3TCV A;  3MGD A;  1Z8W A;  4NGN A;  2QEC A;  3FXT A;  4XPD B;  5HH1 A;  2PJA A;  4B14 A;  1IB1 E;  4HNY B;  3W91 A;  1LAM A;  2V8G A;  3B3T A;  4R87 A;  2YND A;  3PB7 X;  2AFW A;  2FIA A;  3H4Q A;  4HNX B;  4ZY2 A;  4OP4 A;  4JD6 A;  4W9Y A;  1Z5R A;  3SI1 A;  1VGY A;  2GAN A;  5IB0 A;  3KAS A;  4M6I A;  4LQ6 A;  2ZEP A;  2F8H A;  4TWE A;  4DNC A;  3KL9 A;  1A2Z A;  4XNH B;  1Y9W A;  2O28 A;  1KWM A;  3PB6 X;  3T90 A;  3GKR A;  3TOB A;  4R57 A;  3EY5 A;  4R8F A;  1MJA A;  2Q4Y A;  4IK2 A;  5DS0 A;  2P0W A;  2FCK A;  4KSF A;  3L2N A;  3K9U A;  1YVO A;  2GRE A;  4X8I A;  1S3Z A;  2WUU A;  3D2P A;  1N71 A;  1S5K A;  4BMH A;  5F46 A;  4NFR A;  3A9L A;  1VHS A;  4LQG A;  3S9N A;  3D7D A;  2JBK A;  1DE4 C;  4RS2 A;  3R95 A;  3UY5 A;  3S9L A;  3IC1 A;  1P4N A;  5I0C A;  4KOS A;  4NJQ A;  2ZPA A;  2B4D B;  2BL1 A;  1LAP A;  4KVO E;  3DR6 A;  4OC1 A;  3JTK A;  1M44 A;  4PXC A;  2NMT A;  4MMO A;  4DYO A;  1CPS A;  3R1K A;  3FH4 A;  3ISX A;  1Q7L A;  3OWC A;  1H8L A;  4ZBG A;  2PRB A;  3GUX A;  2ATR A;  3CZX A;  4H2K A;  1QSM A;  3EFA A;  3BI0 A;  1IIC A;  4UWI A;  2OZU A;  3QAY A;  1KUY A;  1IOI A;  2AFU A;  2A4N A;  1HEE A;  1S7K A;  3VH9 A;  2PJC A;  2PC1 A;  1B87 A;  1Z8X A;  4QC6 A;  4QVT A;  3VWE A;  5KTA A;  3RYO A;  4P4F A;  3F8K A;  4MHD A;  4OC5 A;  4YGO A;  3RO0 A;  2JLM A;  5LRJ A;  5HMN A;  1S60 A;  2FXF A;  3PB8 X;  4NGT A;  4UEZ A;  4J3G A;  4CYN A;  3SHP A;  2HUZ A;  4P44 A;  2Q0Y A;  3D66 A;  3S6H A;  4MFL A;  4Y49 B;  1X12 A;  4AVC A;  4KOR A;  4OAD A;  1LOK A;  5G20 A;  4HNW B;  2QJ8 A;  5A28 A;  4R3L A;  1QSR A;  4UWJ A;  2AJ6 A;  4JYW A;  2FVG A;  4CAF A;  2VEZ A;  4CYQ A;  2GFQ A;  2G9D A;  3IGR A;  3S6G A;  2XEF A;  1YK3 A;  2OU2 A;  5D8N A;  3R9G A;  4LX9 A;  4FD4 A;  5FVJ A;  4BIN A;  2BUE A;  1QST A;  4KOX A;  1L0C A;  2P6F A;  4NGS A;  3GLJ A;  2CXA A;  2D4O A;  2ABZ A;  4PXB A;  3BJ8 A;  4NEX A;  2RB7 A;  2O53 A;  1NMT A;  4GM5 A;  3MRU A;  2B3U A;  4UEF A;  2PJ6 A;  2ZW4 A;  4A37 A;  2B4D A;  4I49 A;  2REF A;  2B5G B;  2V8H A;  2H5M A;  1VIX A;  3B8G A;  4F9V A;  1I12 A;  1ZO0 A;  4WWV A;  2OZG A;  4DJL A;  2Q44 A;  1XJO A;  2NYQ A;  3I9S A;  1WWZ A;  4JWP A;  5ELY A;  2I79 A;  3S6F A;  3V8I A;  4XPL A;  3B3C A;  3CDX A;  3PB4 X;  2B3V A;  2EBJ A;  1P0H A;  2ODF A;  2RC4 A;  4U9Y A;  3T9Y A;  1R57 A;  3W6X A;  3TTH A;  3QNV A;  1LAN A;  4A39 A;  4RN7 A;  2XEJ A;  5JQ4 A;  4UA3 A;  4EME A;  1ZLI A;  2R7H A;  5DWN A;  3PFE A;  1ON0 A;  4H89 A;  4UIA A;  5J8F A;  2ANP A;  1YR0 A;  2CTC A;  3H8E A;  2WZN A;  5KTD A;  3KI9 A;  1ARM A;  1Y7R A;  4CAE A;  1S7F A;  2O4H A;  3LD2 A;  1ELL P;  1XBU A;  4A38 A;  1BOB A;  3CPA A;  3JVN A;  4B12 A;  4MHZ A;  4RUH A;  4ZY1 A;  4FD6 A;  6CPA A;  1Y0Y A;  2CIJ A;  4C68 A;  4L89 A;  2CNM A;  2ZEO A;  3PEI A;  4G1P A;  4O23 A;  1CP6 A;  3S6K A;  4C2Z A;  4C2X A;  5C88 A;  2OR4 A;  3KHZ A;  5F09 A;  4MI4 A;  2IL4 A;  2ZEF A;  3K2K A;  3EO4 A;  4NGR A;  2Q7B A;  4AVA A;  4FAI A;  2ZEE A;  3W6S A;  3D3S A;  4P4I A;  5BWA B;  4U5Y A;  4MCS A;  1AUG A;  5KTC A;  2VL1 A;  2C6C A;  4R9M A;  2J8N A;  1S7L A;  3VWD A;  2IMO A;  4Y49 C;  2GLJ A;  4YFJ A;  4MHN A;  2PJB A;  2ZEG A;  2ZW5 A;  3JRU A;  4A33 A;  2CTB A;  3KR4 A;  1PU9 A;  2AFM A;  1NSL A;  2ZEL A;  1UFH A;  3P2F A;  3KZW A;  5IX3 A;  4OID A;  3KHX A;  3PP9 A;  5F48 A;  2OH1 A;  2ZED A;  4UFW A;  4XNH C;  3SXO A;  3IJ3 A;  1CPX A;  4MFJ A;  3FEC A;  1NSA A;  4ZI6 A;  5LYF A;  2PIY A;  4OME A;  1XF8 A;  5K8P A;  3NH8 A;  5DWM A;  3FVL A;  1Y9K A;  4F0Y A;  2PJ9 A;  2JBJ A;  2XEG A;  3GY9 A;  5LYL A;  2Z3N A;  1V0C A;  3FEE A;  2Z3L A;  4QB9 A;  2DXQ A;  4YWY A;  3FED A;  2ZEN A;  2BEI A;  4GS4 A;  1Z9U A;  2ZW7 A;  4R3K A;  1I1D A;  2RFH A;  3HUV A;  3D67 A;  1U6M A;  2PE3 A;  4MXU A;  3IU1 A;  3LOD A;  1Z4R A;  5EC4 A;  4F6A A;  3V38 A;  2DPS A;  4NGQ A;  4B13 A;  4E8O A;  4DUK A;  3G3S A;  3PB9 X;  4ZX8 A;  2Z3O A;  3FRM A;  4UCM A;  4R7M A;  3D7G A;  4MHY A;  2EO8 A;  4KOT A;  2YNC C;  3FF3 A;  4NSQ A;  4MRI A;  4BBH A;  4M6H A;  1IY7 A;  2P6E A;  1ELM P;  4X5K A;  4WJB A;  4NXY A;  2HV2 A;  5HVG A;  1KZF A;  1YVK A;  2PJ1 A;  1X10 A;  2OZH A;  2PVW A;  2X7B A;  5E96 A;  3RAM A;  4Q38 A;  4PQA A;  3KQZ A;  1M4D A;  1VHO A;  1QQ9 A;  4PK2 A;  5HVF A;  2R98 A;  3D4U A;  4FD7 A;  3IFE A;  3P2H A;  5A27 A;  1XFO A;  2B58 A;  4OKO A;  3FB3 A;  2R1I A;  1F57 A;  4K30 A;  3SI2 A;  4B10 A;  3DNS A;  2QYV A;  5EBV A;  1AYE A;  2Q51 A;  3WC6 A;  1M4L A;  4IAV A;  2HC9 A;  3SJE A;  3R9E A;  4B5P B;  2CY2 A;  4NJR A;  3NE8 A;  4KLW A;  4F8Z A;  4IF5 A;  1F2O A;  2KCW A;  4UIB A;  2K5T A;  5D29 A;  2C27 A;  5IV0 A;  4NF1 A;  8CPA A;  4CAW A;  3ISZ A;  4KSI A;  3TC8 A;  1KUV A;  2WPW A;  2ZEM A;  4X3R A;  1Q2D A;  3WC7 A;  2CNS A;  2PJ3 A;  1CM0 A;  3RZA A;  4A2Z A;  1YLO A;  3PBE A;  1TIQ A;  5G1Z A;  2YNC A;  4AXV A;  4C2Y A;  2PSW A;  2P6G A;  2OOT A;  3RBU A;  4KVM E;  2WPX A;  1PCA A;  4B5P A;  3DLJ A;  4CYP A;  5I4M A;  4CRY B;  4UFV A;  4MY3 A;  1BPM A;  4Q7A A;  3TX8 A;  3CT9 A;  1IYK A;  4HKF A;  3QAH A;  4AG7 A;  4Z65 A;  1CP7 A;  2HQY A;  3BLN A;  2D4P A;  3DGV A;  4P4B A;  4F0X A;  1ZLH A;  5H86 A;  2PJ7 A;  3VAT A;  2DF5 A;  4UCP A;  5LYI A;  5AG4 A;  2JDD A;  4II9 A;  4FWU A;  1RXT A;  5AGE A;  2Q4Z A;  1TKJ A;  4CGN A;  2FS5 A;  3MN8 A;  4MBU A;  4CGL A;  1GYT A;  1MJ9 A;  2EUI A;  4MCR A;  1BAV A;  2C6P A;  2J8M A;  3NH5 A;  5JGF A;  2V8V A;  2JEV A;  4P4E A;  1TF8 A;  1YW4 A;  2YGW A;  1SQH A;  3BI1 A;  2NSM A;  3NFZ A;  2IQ6 A;  1LFW A;  1XOV A;  2PJ4 A;  3DSB A;  1R3N A;  3S9M A;  3TO9 A;  2ZW6 A;  1BLL E;  3KGQ A;  3CXS A;  3KR5 A;  3IWG A;  4KOU A;  4PSX A;  5AG5 A;  2Y0M A;  2I00 A;  4K3N A;  4UFX A;  3EXN A;  3PFO A;  3IIB A;  5CNP A;  2VI7 A;  1YW6 A;  2R8V A;  3TO6 A;  4UF4 A;  1I21 A;  2Q43 A;  3B3V A;  1GHE A;  4MY0 A;  5H84 A;  4CGO A;  4ORF A;  5JM6 A;  1EE3 P;  4ONW A;  5HXD A;  2GLF A;  3CXQ A;  2AFX A;  3CXP A;  5C82 A;  4NGP A;  4P10 A;  2PIZ A;  2AFS A;  5G21 A;  3IWE A;  1Y7E A;  3SJG A;  4AB7 A;  4OC4 A;  3SI0 A;  4MFK A;  2EVN A;  2FSR A;  3F5B A;  1MK4 A;  1Q2C A;  5F49 A;  1XE4 A;  2JDC A;  3WAB A;  2Z3P A;  2AFZ A;  2PRQ A;  4XPK A;  5G22 A;  3SJF A;  2Z0Z A;  2BSW A;  4OLL A;  2GIV A;  4NGM A;  5J1Q A;  3D8P A;  4PXE A;  1RO5 A;  4OIW A;  3K9T A;  4OAE A;  2ZXV A;  3H8F A;  1PYT B;  1YGH A;  2V8D A;  3LMS A;  3PBB A;  2ARH A;  4HPS A;  3T8W A;  1M4G A;  1XMT A;  4P6Y A;  1YRE A;  1VHE A;  2F5I A;  3SJX A;  4JXR A;  1M4I A;  1YQE A;  2C6G A;  3IO1 A;  1IOF A;  4H6Z A;  4XPD C;  2PR1 A;  2FT0 A;  4JXQ A;  1CJW A;  5GCN A;  2ZOG A;  1ZG9 A;  3I1U A;  3R9F A;  4M3S A;  2YNE A;  4P4D A;  3WR7 A;  4ZY0 A;  2Z3K A;  2G0B A;  2IJZ A;  4A30 A;  4CGM A;  2J9A A;  4FBE A;  3N7Z A;  1LRZ A;  4JZ0 A;  3ZJ0 A;  1TKH A;  5AG7 A;  2Z11 A;  3NE7 A;  4ZGY B;  1M1D A;  2EWB A;  2FIW A;  4KUA A;  2B5G A;  1BPN A;  1UWY A;  3B3S A;  3FIX A;  4L8A A;  4JJX A;  3IEH A;  4MCP A;  4Q36 A;  5AG6 A;  3LWU A;  4PV6 A;  2OB0 A;  1XEB A;  5K8N A;  1XMB A;  4RI1 A;  4H6U A;  3B35 A;  2QML A;  2I3C A;  4M6G A;  1TXR A;  4A31 A;  4EFD A;  2B4B A;  2PJ0 A;  4YRH A;  5LYD A;  2REE A;  5IB9 A;  2ZOF A;  4MFQ A; 
#chains in the Genus database with same CATH homology
 1VKC A;  5ISV A;  2DPT A;  1KUX A;  2PQ8 A;  5F47 A;  2Z3M A;  4FD5 A;  3H5Z A;  3FYN A;  1IYL A;  3D2M A;  4C7H A;  1QSN A;  3TO7 A;  2QIR A;  2AE6 A;  3TFY A;  4E2A A;  4PSW A;  4QUS A;  2VZY A;  3EC4 A;  1IID A;  3ZZI A;  4A32 A;  1YLE A;  3F0A A;  2GE3 A;  4KVX A;  3PGP A;  4U9Z A;  3G8W A;  4PK3 A;  3SXN A;  4UBR A;  2PR8 A;  2VBQ A;  4KOW A;  1OZP A;  3QB8 A;  4CAX A;  1YX0 A;  2PDO A;  1K4J A;  1Z4E A;  4UCN A;  3TE4 A;  4AG9 A;  3E0K A;  4ONU A;  1FY7 A;  1MJB A;  2WSA A;  1Q2Y A;  4MJ8 A;  3GYA A;  4B11 A;  4CYO A;  3FNC A;  1BO4 A;  4KOY A;  4A95 A;  2J8R A;  2Z10 A;  1NE9 A;  1WK4 A;  4MFZ A;  4KZT A;  4CAV A;  3DDD A;  4B5O A;  3PZJ A;  3BJ7 A;  3KKW A;  1PUA A;  4JLY A;  4MFP A;  4M85 A;  1S7N A;  3DR8 A;  4KSA A;  4EVY A;  2G3A A;  4CS0 B;  3I3G A;  4E0A A;  2VQY A;  3FBU A;  2Q04 A;  3IU2 A;  4CRZ B;  4KS9 A;  2FL4 A;  3JUW A;  4QBJ A;  2CNT A;  1XIX A;  2VXK A;  4AVB A;  5J8C A;  1B6B A;  4KOV A;  2FE7 A;  2G3T A;  4IUS A;  1J4J A;  2VZZ A;  4KUB A;  4KLV A;  4C7I A;  2Q4V A;  3C26 A;  4NCZ A;  3R96 A;  3TT2 A;  3TOA A;  4LUA A;  1QSO A;  3TCV A;  3MGD A;  2QEC A;  3FXT A;  4XPD B;  5HH1 A;  4B14 A;  1IB1 E;  4HNY B;  3W91 A;  4R87 A;  2YND A;  2FIA A;  3H4Q A;  4HNX B;  4JD6 A;  5IB0 A;  2GAN A;  4DNC A;  4XNH B;  1Y9W A;  2O28 A;  3T90 A;  3GKR A;  3TOB A;  4R57 A;  3EY5 A;  1MJA A;  2Q4Y A;  2P0W A;  2FCK A;  4KSF A;  3K9U A;  1YVO A;  1S3Z A;  2WUU A;  3D2P A;  1N71 A;  1S5K A;  4BMH A;  3A9L A;  1VHS A;  4RS2 A;  3R95 A;  3UY5 A;  1P4N A;  5I0C A;  4KOS A;  2ZPA A;  2B4D B;  2BL1 A;  4KVO E;  3DR6 A;  3JTK A;  1M44 A;  2NMT A;  3R1K A;  3OWC A;  4ZBG A;  2PRB A;  2ATR A;  1QSM A;  3EFA A;  4UWI A;  1IIC A;  2OZU A;  1KUY A;  5JPH A;  2A4N A;  1S7K A;  3VWE A;  2PC1 A;  1B87 A;  4QC6 A;  4QVT A;  5KTA A;  3RYO A;  3F8K A;  4MHD A;  4YGO A;  2JLM A;  5HMN A;  1S60 A;  2FXF A;  4J3G A;  4CYN A;  3SHP A;  2HUZ A;  2Q0Y A;  3S6H A;  4MFL A;  4Y49 B;  4AVC A;  4KOR A;  4OAD A;  5G20 A;  4HNW B;  5A28 A;  4R3L A;  1QSR A;  4UWJ A;  2AJ6 A;  4CAF A;  2VEZ A;  4CYQ A;  3IGR A;  3S6G A;  1YK3 A;  2OU2 A;  3R9G A;  4LX9 A;  4FD4 A;  5FVJ A;  2BUE A;  1QST A;  4KOX A;  1L0C A;  2P6F A;  2CXA A;  2D4O A;  3BJ8 A;  4NEX A;  1NMT A;  2B3U A;  2ZW4 A;  2B4D A;  4I49 A;  2REF A;  2B5G B;  3B8G A;  2H5M A;  1I12 A;  1ZO0 A;  2OZG A;  2Q44 A;  3I9S A;  4JWP A;  1WWZ A;  3V8I A;  2I79 A;  3S6F A;  4XPL A;  2B3V A;  1P0H A;  2RC4 A;  4U9Y A;  3T9Y A;  1R57 A;  3W6X A;  3TTH A;  5JQ4 A;  4UA3 A;  2R7H A;  5DWN A;  1ON0 A;  4H89 A;  5J8F A;  1YR0 A;  5KTD A;  1Y7R A;  4CAE A;  1S7F A;  3LD2 A;  1BOB A;  3JVN A;  4B12 A;  4FD6 A;  5F46 A;  4C68 A;  4L89 A;  2CNM A;  4C2X A;  4C2Z A;  3S6K A;  5C88 A;  4MI4 A;  2IL4 A;  2Q7B A;  3EO4 A;  4AVA A;  3W6S A;  3D3S A;  5BWA B;  4U5Y A;  5KTC A;  4R9M A;  2J8N A;  1S7L A;  3VWD A;  4Y49 C;  4YFJ A;  4A33 A;  2ZW5 A;  1PU9 A;  1NSL A;  1UFH A;  3P2F A;  5IX3 A;  3PP9 A;  5F48 A;  2OH1 A;  4UFW A;  4XNH C;  3SXO A;  4MFJ A;  1XF8 A;  5DWM A;  1Y9K A;  4F0Y A;  3GY9 A;  2Z3N A;  1V0C A;  2Z3L A;  4QB9 A;  2DXQ A;  4GS4 A;  2BEI A;  1Z9U A;  2ZW7 A;  4R3K A;  1I1D A;  1U6M A;  3IU1 A;  3LOD A;  1Z4R A;  5EC4 A;  4F6A A;  2DPS A;  4B13 A;  4E8O A;  3G3S A;  2Z3O A;  3FRM A;  4UCM A;  4KOT A;  2YNC C;  4NSQ A;  4BBH A;  2P6E A;  4X5K A;  4NXY A;  2HV2 A;  1KZF A;  1YVK A;  2X7B A;  2OZH A;  5E96 A;  4Q38 A;  1M4D A;  4PK2 A;  2R98 A;  4FD7 A;  3P2H A;  5A27 A;  2B58 A;  3FB3 A;  2R1I A;  4K30 A;  4B10 A;  3DNS A;  5EBV A;  3R9E A;  4B5P B;  2CY2 A;  4KLW A;  4IF5 A;  2KCW A;  2K5T A;  2C27 A;  5IV0 A;  4NF1 A;  4CAW A;  1KUV A;  2WPW A;  1Q2D A;  2CNS A;  1CM0 A;  4A2Z A;  1TIQ A;  5G1Z A;  2YNC A;  4C2Y A;  2PSW A;  2P6G A;  4B5P A;  4CYP A;  4KVM E;  2WPX A;  4CRY B;  4UFV A;  4MY3 A;  1IYK A;  4HKF A;  3QAH A;  4AG7 A;  2HQY A;  3BLN A;  2D4P A;  4F0X A;  5H86 A;  4UCP A;  5AG4 A;  2JDD A;  4II9 A;  1RXT A;  5AGE A;  4CGN A;  2FS5 A;  4MBU A;  4CGL A;  1MJ9 A;  2EUI A;  2J8M A;  2JEV A;  2YGW A;  1SQH A;  3TO9 A;  3DSB A;  2ZW6 A;  3CXS A;  3IWG A;  4KOU A;  4PSX A;  5AG5 A;  2Y0M A;  2I00 A;  4UFX A;  3EXN A;  5CNP A;  2VI7 A;  3TO6 A;  2R8V A;  1I21 A;  4MY0 A;  5H84 A;  1GHE A;  4CGO A;  4ORF A;  3CXQ A;  3CXP A;  5C82 A;  5G21 A;  3IWE A;  4AB7 A;  4MFK A;  2EVN A;  2FSR A;  3F5B A;  1MK4 A;  1Q2C A;  5F49 A;  1XE4 A;  2JDC A;  2Z3P A;  4XPK A;  5G22 A;  2Z0Z A;  2BSW A;  4OLL A;  2GIV A;  3D8P A;  1RO5 A;  4OAE A;  2ZXV A;  1YGH A;  2ARH A;  1M4G A;  1XMT A;  1YRE A;  2F5I A;  4JXR A;  1M4I A;  4H6Z A;  4XPD C;  2PR1 A;  2FT0 A;  4JXQ A;  1CJW A;  5GCN A;  3R9F A;  4M3S A;  2YNE A;  3WR7 A;  2Z3K A;  2G0B A;  4A30 A;  4CGM A;  3N7Z A;  1LRZ A;  3ZJ0 A;  5AG7 A;  2Z11 A;  3NE7 A;  4ZGY B;  1M1D A;  2FIW A;  4KUA A;  2B5G A;  3FIX A;  4L8A A;  4CGP A;  4JJX A;  4Q36 A;  5AG6 A;  4PV6 A;  2OB0 A;  1XEB A;  4RI1 A;  4H6U A;  2QML A;  4A31 A;  2B4B A;  4YRH A;  2REE A;  4MFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...