4CYOA

Leishmania major n-myristoyltransferase in complex with a hybrid inhibitor (compound 21).
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Structure-Based Design of Potent and Selective Leishmania N- Myristoyltransferase Inhibitors.
pubmed doi rcsb
source organism Leishmania major
total genus 118
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cyoA00
4UCMA 5AGEA 4B13A 4B14A 4UCPA 4CYQA 2WSAA 4UCNA 4A32A 5A27A 4B12A 4A33A 4CYPA 2WUUA 4BBHA 5AG5A 4CGOA 4C7HA 4UFWA 5AG6A 3H5ZA 4CAFA 4C2ZA 3IU1A 4A31A 4C7IA 5AG4A 2YNCC 3IU2A 4C2YA 5G22A 4CAEA 3IWEA 4B11A 5G21A 4A2ZA 5A28A 2YNEA 4UFVA 4B10A 4CYOA 5G20A 4CYNA 4CGMA 5AG7A 4C68A 4CGPA 4CGLA 2YNDA 4A95A 4UFXA 5G1ZA 4A30A 2YNCA 3JTKA 4CGNA 4C2XA
chains in the Genus database with same CATH superfamily
3IWWA 4KSIA 2OU2A 4NF1A 2B3UA 1IYKA 2P0WA 1XFOA 1S7KA 4R9MA 1S7LA 2QVPA 4RS2A 4IF5A 5CPAA 4UCNA 4EFDA 2QYVA 2QECA 4U5YA 2I3CA 4MHZA 2QJ8A 4PSXA 2I00A 1Z5RA 4OADA 2EWBA 3H8EA 4CS0B 4F6AA 1I12A 2DEAA 5F09A 1IOFA 4JYWA 2Z3KA 3D68A 3GY9A 2ODFA 4HNXB 1PCAA 4CYNA 4EMEA 3B3TA 3EFAA 4C68A 2REEA 1ZG9A 4AG9A 1IY7A 4NGSA 2K5TA 3FYNA 4J3GA 2WZNA 5LYFA 2CTBA 4FD5A 1Y0RA 1Y7EA 4MFQA 1YVOA 1R3NA 4UCMA 1F2PA 4XPDC 4B13A 3KR4A 1Q2YA 4DJLA 2ZPAA 2Z10A 1FT7A 2V77A 5H86A 2PJ8A 3WABA 1YVKA 1Z9UA 2OZHA 2ZOFA 4C7HA 2PC1A 3PP9A 2P6EA 3QB8A 4YGOA 2XEGA 1XE4A 1ARMA 4F0YA 3IU2A 3LD2A 4BD9A 4MCRA 1B6BA 1J4JA 4AVCA 4KORA 2V8HA 1QSRA 3B3SA 3SHPA 2HC9A 1CPSA 1OBRA 4MFJA 1ZO0A 3T9YA 4A95A 4ZYQA 2AFMA 4ZGYB 3RAMA 3CXPA 4PPZA 4A30A 4MHYA 4PXDA 2EK9A 1LAPA 2Z3NA 2QMLA 3BI1A 2JBJA 4LQGA 4UWIA 2CNSA 2PJ4A 2PRBA 2HV2A 4KOVA 3SJGA 1QMUA 2AE6A 5F47A 5IX3A 3I1UA 1ON0A 1U6MA 2ZEMA 5THWA 4MHPA 2CY2A 2R98A 4IK2A 2R1IA 5LYLA 1P4NA 1MJBA 4A33A 1LOKA 2REFA 5I4MA 1GYTA 5HMNA 4P4JA 2F5IA 2RB7A 1HEEA 1CBXA 3DNSA 2AFXA 3FEDA 3ISZA 4NGTA 4UEFA 4KZTA 3K9TA 3QAYA 4OC1A 3D67A 1MK4A 3CPXA 1CX8A 3PB9X 4OC3A 4CYOA 3IC1A 3FIXA 3SJXA 6CPAA 1FNOA 3D4UA 3R9EA 4YFJA 2VBQA 3NH8A 1Z8XA 4BINA 1VKCA 3W91A 4DNCA 1UWYA 3JTKA 2GU2A 4CAWA 1Y7RA 4NEXA 3WC7A 2JBKA 2R8VA 2Z11A 1LRZA 4KOSA 4NXYA 4MCPA 2POKA 4MI4A 4BBHA 1ARLA 4XPKA 3KQZA 5HVGA 4YU9A 4PK2A 2YGWA 1B87A 3CXSA 3KHZA 2BEIA 3KQXA 1TF8A 2OB0A 4P6YA 2A4NA 4UBRA 3R95A 4CAEA 3KGQA 4B11A 4CGMA 4CRYB 4OLLA 4L89A 1P0HA 2F8HA 2V8VA 5GCNA 4E2AA 2JEVA 3S9LA 2Q0YA 1Z8WA 4KLWA 2CXAA 3H4QA 4P45A 1MJ9A 1JQGA 3K9UA 3VH9A 4K3NA 4U9YA 3TO6A 4E0AA 4FBEA 4RUHA 4UEEA 5EMIA 4UIBA 4H6ZA 3VATA 4NGRA 5J1QA 3V8IA 4MFPA 4K30A 3NH5A 4B12A 2DPTA 2XEJA 3IEHA 3B3VA 4OIDA 2ABZA 2QIRA 4O23A 4DUKA 2ZOGA 4WJBA 8CPAA 4P4IA 1ELMP 2PIZA 4P4DA 2H5MA 4C7IA 3HUVA 2NYQA 1YLEA 5A28A 4B10A 3F5BA 4JWPA 3IGRA 3CPAA 3D7GA 4MY3A 4XNHB 4CGPA 1I21A 1VHOA 2VXKA 2ZW7A 4QB9A 4ZY1A 4X8IA 3PBEA 4CAVA 5C88A 2GIVA 3D7DA 4RI1A 2JDDA 3FF3A 4OC0A 2AFOA 3RZAA 4TNUA 1EE3P 1JWQA 3D7HA 4CYQA 2G3TA 4DYOA 3MRUA 2AFWA 1LAMA 1IU8A 2C6CA 3KI9A 3NFZA 3OWCA 5A27A 2B5GB 2WPWA 4GXHA 3KASA 4JZ0A 2PVWA 4QVTA 1BAVA 3B3CA 4CAXA 1RXTA 1Y9WA 1VGYA 2FCKA 1VHSA 4MXUA 1TIQA 2PJBA 2ZEHA 5JPHA 4FUUA 4W9YA 5HVFA 2O53A 5K8NA 4YWYA 2PJ9A 5G22A 3WC5A 1M4IA 4LUAA 5DWNA 3EC4A 1VIXA 1H8LA 2ZEEA 1F2OA 1YREA 2IQ6A 4AB7A 5ISVA 1M4GA 2Q7BA 4XPLA 1NSAA 1IIDA 2HB6A 2J8MA 1AUGA 4M6GA 3QAHA 1ZLIA 3EY5A 1QSOA 2PJ0A 1XIXA 3PGPA 2PIYA 4FD7A 2D4PA 3ZZIA 3TCVA 1CJWA 1KZFA 3GIUA 1MJAA 3DGVA 3SI2A 3KKWA 4NJQA 2PE3A 1F57A 4G1PA 4Y49B 5LRGA 2GLJA 5F48A 3N5FA 3MGDA 4KLVA 4OC2A 2G3AA 3IU1A 4OC5A 4QC6A 1NSLA 3ZJ0A 4LX9A 4A94A 1FY7A 4HPSA 5G20A 4M6HA 3PBBA 4OAEA 3FECA 1DE4C 2KCWA 4ONUA 2CNMA 4NFRA 3BLNA 4MFLA 5LYIA 4OIWA 4NSQA 1S5KA 3GLJA 4B6ZA 4F0XA 4R7MA 3S6KA 5KTDA 2GFQA 2O28A 4A39A 2JDCA 4Q7AA 4MJ8A 2ZW4A 3B35A 4NGNA 2PQ8A 4R3LA 5IB9A 1Y0YA 2Z3MA 4HNWB 3RO0A 2FIWA 3PFOA 2PJCA 2DF5A 3GYAA 5FVJA 3VWDA 1UFHA 2IMOA 4KOXA 5E96A 3DSBA 1OZPA 2BL1A 2PSWA 3SXNA 3S6GA 4JD6A 2AFZA 4NGMA 2PJ5A 2JEWA 2HQYA 3NA6A 4B5PA 2Q4ZA 1WWZA 2I79A 4JLYA 7CPAA 4UIAA 5JH9A 3DDDA 4Q38A 1KWMA 1YQEA 3TX8A 1YSJA 4A37A 4CPAA 4B14A 4UCPA 2PJ3A 3TC8A 3BHXA 2B4DA 3BJ8A 3D3SA 3W6SA 3LODA 1LFWA 5F46A 2BO9A 3B2YA 3PB4X 1M4LA 4MBUA 4X5KA 2Q4VA 4CGOA 5LRKA 3JUWA 4CAFA 1XRYA 5DS0A 4P4FA 4ZY2A 3NH4A 3S9NA 2Y0MA 2OR4A 2AFUA 2Z3PA 3V7ZA 1XEBA 4KUAA 3FXTA 4ZI6A 4CRZB 2FVGA 1XBUA 1A2ZA 4AVAA 1QSMA 2PR1A 4XPDB 2FSRA 1RTQA 3S6HA 4CGLA 4I49A 3GB0A 1L0CA 3WT4A 3B3WA 4KVME 4PXCA 4WWVA 2PRQA 4F9VA 1TF9A 5IV0A 1PYTB 1QQ9A 2F7VA 1XF8A 3PB6X 5CBMA 3C26A 3JRUA 4KSAA 3S9MA 2WSAA 3LACA 2B3VA 5HXDA 2FIAA 2GE3A 4PSWA 3NE7A 1Q2CA 3H8GA 4FD4A 3FX6A 5AG5A 2HUZA 2BOAA 1RO5A 2ZW6A 4YRHA 1IICA 3H8FA 4GM5A 4C2ZA 1LCPA 2YNCC 1M44A 4M85A 2FE7A 3PZJA 2GLFA 3D66A 1Z8TA 1BLLE 3IWEA 2C1CA 2CF4A 2PJ1A 1Q7LA 1XMBA 2DPSA 4KOTA 1CM0A 4UFVA 4A2ZA 5HVHA 5J8FA 1R43A 1S7FA 5HH1A 3R9FA 1S60A 3PEIA 2Q4YA 3KHXA 1CP7A 4X3RA 4ZY0A 2VL1A 3F8KA 2JLMA 3NE8A 5EC4A 1YGHA 4H6UA 4ONWA 4NGPA 3KR5A 1I1DA 1KUXA 4NJRA 4C2YA 3EXNA 3K2KA 3VWEA 4QBJA 4B5PB 2EUIA 4C2XA 3R96A 1XOVA 5F49A 3TE4A 2PJ6A 1CPXA 3RBUA 2J8NA 2FL4A 2PJ7A 4FAIA 1QSTA 3BJ7A 2B4DB 3D8PA 4KUBA 4Z65A 3HLPA 3SJEA 3WR7A 1YR0A 4U9ZA 1ZLHA 1ZG7A 3SI1A 2PDOA 3VARA 1V0CA 4MMOA 2Z3LA 4PQAA 5K8MA 2Z3OA 2WYRA 3T8WA 1HDQA 3DLJA 1Q2DA 2ZEPA 3B7IA 1TXRA 1AYEA 2ZEDA 3F0AA 5G1ZA 3TO9A 2AJ6A 3S6FA 1BPMA 2FT0A 4LQ6A 4MHNA 3SI0A 2BSWA 2FXFA 2ZW5A 5IB0A 1GHEA 2V8GA 3P2FA 4ZBGA 1NE9A 2VZZA 3P2HA 4P10A 2OZGA 1IYLA 1S3ZA 2X7BA 2BUEA 3PB7X 1BOBA 4X2TA 4OKOA 2NMTA 1AMPA 2FS5A 2IJZA 3FBUA 4M6IA 5CNPA 5EBVA 1X12A 4P44A 2VI7A 2WUUA 3LMSA 3CDXA 3GKRA 4KS9A 3CZXA 4UFWA 5D29A 3JVNA 3MN8A 2RC4A 4HKFA 4R76A 4OMEA 4HNYB 4A31A 3A9LA 2VQYA 3ISXA 2CNTA 4ORFA 1Y9KA 2C27A 5G21A 4R6TA 4JJXA 2AFSA 2ZENA 2Q43A 1TKFA 4ZX8A 2BCOA 1CG2A 2YNDA 4R3KA 3PRTA 3DR8A 4NCZA 4UFXA 3RNZA 4AVBA 2C6PA 4MCQA 1Z4RA 4OC4A 4JXQA 5LYDA 4M3SA 4MFZA 4EVYA 3WC6A 5JQ4A 2Q44A 2J9AA 3GUXA 2Q7SA 1BPNA 4MY0A 1YW6A 2PJAA 4UWJA 4BMHA 1HDUA 3R9GA 3UY5A 3N7ZA 5K8PA 2XEFA 1R57A 3FRMA 4PXEA 4CYPA 5H84A 3W6XA 3PFEA 3SJFA 3KL9A 1XMTA 2PR8A 3TO7A 3D2PA 3TOBA 1QSNA 2RFHA 4H2KA 3V38A 1ELLP 1KUYA 4EWTA 3FEEA 1M4DA 2YNEA 5KTAA 3I9SA 3FNCA 2DXQA 4PV6A 4A38A 2J8RA 2P6GA 3SXOA 2XEIA 2B58A 3D2MA 3FB3A 1YX0A 2G0BA 3G8WA 1N71A 1Z8LA 1X10A 2G9DA 3FVLA 3IJ3A 4CGNA 4E8OA 1DTDA 5AGEA 4JXRA 5I0CA 4XNHC 2IL4A 3CXQA 3FJUA 3PB8X 2O4HA 4IUSA 1M1DA 3TFYA 2VZYA 4B5OA 2PCUA 2Q04A 2OZUA 5LRJA 5JM6A 4F8ZA 5AG6A 1S7NA 3EO4A 1CP6A 4KVXA 5KTCA 2B4BA 5BWAB 4P4BA 2ARHA 2EO8A 3D7FA 1YK3A 4QUSA 5C82A 4II9A 4OP4A 4MCSA 1YW4A 2C6GA 4F9UA 4FD6A 2D4OA 2ZXVA 1BO4A 4AXVA 1VHEA 4MRIA 1PU9A 1TKHA 4UF4A 4TWEA 4AG7A 2Q51A 2OH1A 3QNVA 1NMTA 2EVNA 1Z4EA 4FWUA 2VEZA 1IGBA 2B5GA 1XJOA 3IO1A 3BXMA 4MHDA 5JGFA 4R57A 4MFKA 4UA3A 4A32A 2GREA 3TOAA 3H5ZA 3R1KA 1SQHA 4PXBA 4IAVA 4IHMA 1K4JA 4KOWA 2ZEGA 5ELYA 4KOYA 3RYOA 2ZEOA 1Z2LA 1PUAA 2P6FA 2ANPA 5AG7A 4Y49C 3FH4A 2NSMA 4H89A 1WK4A 3IWGA 4R87A 2ZEFA 2EK8A 5DWMA 3TTHA 4KVOE 2Z0ZA 2EBJA 3CT9A 5D8NA 4L8AA 2YNCA 4Q36A 2ZELA 2PJ2A 4NGQA 4KSFA 1TKJA 1ZG8A 4R8FA 1YMEA 2R7HA 3L2NA 2PVVA 1IOIA 3BI0A 3G3SA 3B8GA 4UEZA 4RN7A 2CTCA 2OOTA 3I3GA 3IIBA 4GS4A 3FMCA 4ZX9A 4KOUA 3E0KA 3T90A 3LWUA 4P4EA 3KZWA 5J8CA 5AG4A 2ATRA 3DR6A 1KUVA 2V8DA 1LANA 2CIJA 3TT2A 1IB1E 1YLOA 2GANA 3IFEA 2WPXA 5K8OA 4PK3A
chains in the Genus database with same CATH topology
2OU2A 4NF1A 2B3UA 1IYKA 2P0WA 4RS2A 1S7KA 4R9MA 1S7LA 4IF5A 4UCNA 2QECA 4U5YA 4PSXA 2I00A 4OADA 4CS0B 4F6AA 1I12A 2Z3KA 3GY9A 4HNXB 4CYNA 3EFAA 4C68A 2REEA 4AG9A 2K5TA 3FYNA 4J3GA 4FD5A 4MFQA 1YVOA 4UCMA 4XPDC 4B13A 1Q2YA 2ZPAA 2Z10A 5H86A 1YVKA 1Z9UA 2OZHA 4C7HA 2PC1A 3PP9A 2P6EA 3QB8A 4YGOA 1XE4A 4F0YA 3IU2A 3LD2A 1B6BA 1J4JA 4AVCA 4KORA 1QSRA 3SHPA 4MFJA 1ZO0A 3T9YA 4A95A 3CXPA 4A30A 2Z3NA 2QMLA 4UWIA 2CNSA 2PRBA 2HV2A 4KOVA 2AE6A 5F47A 5IX3A 1ON0A 1U6MA 2CY2A 2R98A 2R1IA 1P4NA 1MJBA 4A33A 2REFA 5HMNA 2F5IA 3DNSA 4KZTA 1MK4A 4CYOA 3FIXA 3R9EA 4YFJA 2VBQA 1VKCA 3W91A 4DNCA 3JTKA 4CAWA 1Y7RA 4NEXA 2R8VA 2Z11A 1LRZA 4KOSA 4NXYA 4MI4A 4BBHA 4XPKA 4PK2A 2YGWA 1B87A 3CXSA 2BEIA 4UBRA 3R95A 2OB0A 2A4NA 4CAEA 4B11A 4CGMA 4CRYB 4OLLA 4L89A 1P0HA 5GCNA 4E2AA 2JEVA 2Q0YA 4KLWA 2CXAA 3H4QA 3K9UA 1MJ9A 4E0AA 4U9YA 3TO6A 4H6ZA 3V8IA 4MFPA 4K30A 4B12A 2DPTA 2QIRA 4C7IA 2H5MA 1YLEA 5A28A 4B10A 3F5BA 4JWPA 3IGRA 4XNHB 4MY3A 4CGPA 1I21A 2VXKA 2ZW7A 4QB9A 4CAVA 5C88A 2GIVA 4RI1A 2JDDA 4CYQA 2G3TA 3OWCA 5A27A 2B5GB 2WPWA 4QVTA 1Y9WA 1RXTA 5JPHA 2FCKA 1VHSA 1TIQA 5G22A 1M4IA 4LUAA 5DWNA 3EC4A 5ISVA 1YREA 4AB7A 1M4GA 2Q7BA 4XPLA 1IIDA 2J8MA 3QAHA 3EY5A 1QSOA 3PGPA 1XIXA 4FD7A 2D4PA 3ZZIA 3TCVA 1CJWA 1KZFA 1MJAA 3KKWA 4Y49B 5F48A 3MGDA 4KLVA 2G3AA 3IU1A 4QC6A 1NSLA 3ZJ0A 4LX9A 1FY7A 5G20A 4OAEA 4ONUA 2KCWA 2CNMA 3BLNA 4MFLA 4NSQA 1S5KA 4F0XA 5KTDA 3S6KA 2O28A 2JDCA 4MJ8A 2ZW4A 2PQ8A 4R3LA 2Z3MA 4HNWB 2FIWA 5FVJA 3GYAA 3VWDA 1UFHA 4KOXA 5E96A 3DSBA 1OZPA 2BL1A 2PSWA 3SXNA 3S6GA 4JD6A 2HQYA 4B5PA 1WWZA 2I79A 4JLYA 3DDDA 4Q38A 4B14A 4UCPA 2B4DA 3BJ8A 3D3SA 3W6SA 3LODA 5F46A 4X5KA 4MBUA 2Q4VA 4CGOA 3JUWA 4CAFA 2Y0MA 2Z3PA 1XEBA 4KUAA 3FXTA 4CRZB 4AVAA 1QSMA 2PR1A 4XPDB 2FSRA 3S6HA 4CGLA 4I49A 1L0CA 4KVME 5IV0A 1XF8A 3C26A 4KSAA 2WSAA 2B3VA 2FIAA 2GE3A 4PSWA 3NE7A 1Q2CA 4FD4A 5AG5A 2HUZA 1RO5A 2ZW6A 4YRHA 1IICA 4C2ZA 2YNCC 1M44A 4M85A 2FE7A 3PZJA 3IWEA 4KOTA 4A2ZA 2DPSA 4UFVA 1CM0A 5J8FA 1S7FA 5HH1A 3R9FA 1S60A 2Q4YA 3F8KA 2JLMA 5EC4A 1YGHA 4H6UA 1I1DA 1KUXA 4C2YA 3EXNA 3VWEA 4QBJA 4B5PB 2EUIA 4C2XA 3R96A 5F49A 3TE4A 2J8NA 2FL4A 1QSTA 3BJ7A 2B4DB 3D8PA 4KUBA 3WR7A 1YR0A 4U9ZA 2PDOA 1V0CA 2Z3LA 2Z3OA 1Q2DA 3F0AA 3TO9A 5G1ZA 2AJ6A 3S6FA 2FT0A 2BSWA 2FXFA 2ZW5A 5IB0A 1GHEA 3P2FA 4ZBGA 1NE9A 3P2HA 2VZZA 4CAXA 2OZGA 1IYLA 1S3ZA 2X7BA 2BUEA 4ZGYB 1BOBA 2NMTA 2FS5A 3FBUA 5CNPA 5EBVA 2VI7A 2WUUA 4KS9A 3GKRA 4UFWA 3JVNA 2RC4A 4HKFA 4A31A 4HNYB 3A9LA 2VQYA 2CNTA 4ORFA 1Y9KA 2C27A 5G21A 4JJXA 2YNDA 4R3KA 4NCZA 3DR8A 4UFXA 4AVBA 1Z4RA 4JXQA 4M3SA 4MFZA 4EVYA 5JQ4A 2Q44A 4MY0A 4UWJA 4BMHA 3R9GA 3UY5A 3N7ZA 3FRMA 1R57A 4CYPA 5H84A 3W6XA 1XMTA 2PR8A 3TO7A 3D2PA 3TOBA 1QSNA 1KUYA 5KTAA 1M4DA 2YNEA 3I9SA 3FNCA 2DXQA 4PV6A 2J8RA 2P6GA 3SXOA 2B58A 3D2MA 3FB3A 1YX0A 2G0BA 3G8WA 1N71A 4CGNA 5I0CA 4E8OA 5AGEA 4JXRA 4XNHC 2IL4A 3CXQA 4IUSA 3TFYA 1M1DA 2VZYA 4B5OA 2Q04A 2OZUA 5AG6A 1S7NA 3EO4A 4KVXA 5KTCA 2B4BA 5BWAB 2ARHA 4II9A 1YK3A 4QUSA 5C82A 4FD6A 2D4OA 2ZXVA 1BO4A 1PU9A 4AG7A 2OH1A 1NMTA 2EVNA 1Z4EA 2VEZA 2B5GA 4MHDA 4R57A 4MFKA 4UA3A 4A32A 3TOAA 3H5ZA 3R1KA 1SQHA 1K4JA 4KOWA 3RYOA 4KOYA 1PUAA 2P6FA 5AG7A 4Y49C 4H89A 1WK4A 3IWGA 4R87A 5DWMA 3TTHA 4KVOE 2Z0ZA 4L8AA 2YNCA 4Q36A 4KSFA 2R7HA 3G3SA 3B8GA 3I3GA 4GS4A 4KOUA 3E0KA 3T90A 5J8CA 5AG4A 2ATRA 3DR6A 1KUVA 3TT2A 1IB1E 2GANA 2WPXA 4PK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UCM A;  5AGE A;  4B13 A;  4B14 A;  4UCP A;  4CYQ A;  2WSA A;  4UCN A;  4A32 A;  5A27 A;  4B12 A;  4A33 A;  4CYP A;  2WUU A;  4BBH A;  5AG5 A;  4CGO A;  4C7H A;  4UFW A;  5AG6 A;  3H5Z A;  4CAF A;  4C2Z A;  3IU1 A;  4A31 A;  4C7I A;  5AG4 A;  2YNC C;  3IU2 A;  4C2Y A;  5G22 A;  4CAE A;  3IWE A;  4B11 A;  5G21 A;  4A2Z A;  5A28 A;  2YNE A;  4UFV A;  4B10 A;  4CYO A;  5G20 A;  4CYN A;  4CGM A;  5AG7 A;  4C68 A;  4CGP A;  4CGL A;  2YND A;  4A95 A;  4UFX A;  5G1Z A;  4A30 A;  2YNC A;  3JTK A;  4CGN A;  4C2X A; 
#chains in the Genus database with same CATH topology
 3IWW A;  4KSI A;  2OU2 A;  4NF1 A;  2B3U A;  1IYK A;  2P0W A;  1XFO A;  1S7K A;  4R9M A;  1S7L A;  2QVP A;  4RS2 A;  4IF5 A;  5CPA A;  4UCN A;  4EFD A;  2QYV A;  2QEC A;  4U5Y A;  2I3C A;  4MHZ A;  2QJ8 A;  4PSX A;  2I00 A;  1Z5R A;  4OAD A;  2EWB A;  3H8E A;  4CS0 B;  4F6A A;  1I12 A;  2DEA A;  5F09 A;  1IOF A;  4JYW A;  2Z3K A;  3D68 A;  3GY9 A;  2ODF A;  4HNX B;  1PCA A;  4CYN A;  4EME A;  3B3T A;  3EFA A;  4C68 A;  2REE A;  1ZG9 A;  4AG9 A;  1IY7 A;  4NGS A;  2K5T A;  3FYN A;  4J3G A;  2WZN A;  5LYF A;  2CTB A;  4FD5 A;  1Y0R A;  1Y7E A;  4MFQ A;  1YVO A;  1R3N A;  4UCM A;  1F2P A;  4XPD C;  4B13 A;  3KR4 A;  1Q2Y A;  4DJL A;  2ZPA A;  2Z10 A;  1FT7 A;  2V77 A;  5H86 A;  2PJ8 A;  3WAB A;  1YVK A;  1Z9U A;  2OZH A;  2ZOF A;  4C7H A;  2PC1 A;  3PP9 A;  2P6E A;  3QB8 A;  4YGO A;  2XEG A;  1XE4 A;  1ARM A;  4F0Y A;  3IU2 A;  3LD2 A;  4BD9 A;  4MCR A;  1B6B A;  1J4J A;  4AVC A;  4KOR A;  2V8H A;  1QSR A;  3B3S A;  3SHP A;  2HC9 A;  1CPS A;  1OBR A;  4MFJ A;  1ZO0 A;  3T9Y A;  4A95 A;  4ZYQ A;  2AFM A;  4ZGY B;  3RAM A;  3CXP A;  4PPZ A;  4A30 A;  4MHY A;  4PXD A;  2EK9 A;  1LAP A;  2Z3N A;  2QML A;  3BI1 A;  2JBJ A;  4LQG A;  4UWI A;  2CNS A;  2PJ4 A;  2PRB A;  2HV2 A;  4KOV A;  3SJG A;  1QMU A;  2AE6 A;  5F47 A;  5IX3 A;  3I1U A;  1ON0 A;  1U6M A;  2ZEM A;  5THW A;  4MHP A;  2CY2 A;  2R98 A;  4IK2 A;  2R1I A;  5LYL A;  1P4N A;  1MJB A;  4A33 A;  1LOK A;  2REF A;  5I4M A;  1GYT A;  5HMN A;  4P4J A;  2F5I A;  2RB7 A;  1HEE A;  1CBX A;  3DNS A;  2AFX A;  3FED A;  3ISZ A;  4NGT A;  4UEF A;  4KZT A;  3K9T A;  3QAY A;  4OC1 A;  3D67 A;  1MK4 A;  3CPX A;  1CX8 A;  3PB9 X;  4OC3 A;  4CYO A;  3IC1 A;  3FIX A;  3SJX A;  6CPA A;  1FNO A;  3D4U A;  3R9E A;  4YFJ A;  2VBQ A;  3NH8 A;  1Z8X A;  4BIN A;  1VKC A;  3W91 A;  4DNC A;  1UWY A;  3JTK A;  2GU2 A;  4CAW A;  1Y7R A;  4NEX A;  3WC7 A;  2JBK A;  2R8V A;  2Z11 A;  1LRZ A;  4KOS A;  4NXY A;  4MCP A;  2POK A;  4MI4 A;  4BBH A;  1ARL A;  4XPK A;  3KQZ A;  5HVG A;  4YU9 A;  4PK2 A;  2YGW A;  1B87 A;  3CXS A;  3KHZ A;  2BEI A;  3KQX A;  1TF8 A;  2OB0 A;  4P6Y A;  2A4N A;  4UBR A;  3R95 A;  4CAE A;  3KGQ A;  4B11 A;  4CGM A;  4CRY B;  4OLL A;  4L89 A;  1P0H A;  2F8H A;  2V8V A;  5GCN A;  4E2A A;  2JEV A;  3S9L A;  2Q0Y A;  1Z8W A;  4KLW A;  2CXA A;  3H4Q A;  4P45 A;  1MJ9 A;  1JQG A;  3K9U A;  3VH9 A;  4K3N A;  4U9Y A;  3TO6 A;  4E0A A;  4FBE A;  4RUH A;  4UEE A;  5EMI A;  4UIB A;  4H6Z A;  3VAT A;  4NGR A;  5J1Q A;  3V8I A;  4MFP A;  4K30 A;  3NH5 A;  4B12 A;  2DPT A;  2XEJ A;  3IEH A;  3B3V A;  4OID A;  2ABZ A;  2QIR A;  4O23 A;  4DUK A;  2ZOG A;  4WJB A;  8CPA A;  4P4I A;  1ELM P;  2PIZ A;  4P4D A;  2H5M A;  4C7I A;  3HUV A;  2NYQ A;  1YLE A;  5A28 A;  4B10 A;  3F5B A;  4JWP A;  3IGR A;  3CPA A;  3D7G A;  4MY3 A;  4XNH B;  4CGP A;  1I21 A;  1VHO A;  2VXK A;  2ZW7 A;  4QB9 A;  4ZY1 A;  4X8I A;  3PBE A;  4CAV A;  5C88 A;  2GIV A;  3D7D A;  4RI1 A;  2JDD A;  3FF3 A;  4OC0 A;  2AFO A;  3RZA A;  4TNU A;  1EE3 P;  1JWQ A;  3D7H A;  4CYQ A;  2G3T A;  4DYO A;  3MRU A;  2AFW A;  1LAM A;  1IU8 A;  2C6C A;  3KI9 A;  3NFZ A;  3OWC A;  5A27 A;  2B5G B;  2WPW A;  4GXH A;  3KAS A;  4JZ0 A;  2PVW A;  4QVT A;  1BAV A;  3B3C A;  4CAX A;  1RXT A;  1Y9W A;  1VGY A;  2FCK A;  1VHS A;  4MXU A;  1TIQ A;  2PJB A;  2ZEH A;  5JPH A;  4FUU A;  4W9Y A;  5HVF A;  2O53 A;  5K8N A;  4YWY A;  2PJ9 A;  5G22 A;  3WC5 A;  1M4I A;  4LUA A;  5DWN A;  3EC4 A;  1VIX A;  1H8L A;  2ZEE A;  1F2O A;  1YRE A;  2IQ6 A;  4AB7 A;  5ISV A;  1M4G A;  2Q7B A;  4XPL A;  1NSA A;  1IID A;  2HB6 A;  2J8M A;  1AUG A;  4M6G A;  3QAH A;  1ZLI A;  3EY5 A;  1QSO A;  2PJ0 A;  1XIX A;  3PGP A;  2PIY A;  4FD7 A;  2D4P A;  3ZZI A;  3TCV A;  1CJW A;  1KZF A;  3GIU A;  1MJA A;  3DGV A;  3SI2 A;  3KKW A;  4NJQ A;  2PE3 A;  1F57 A;  4G1P A;  4Y49 B;  5LRG A;  2GLJ A;  5F48 A;  3N5F A;  3MGD A;  4KLV A;  4OC2 A;  2G3A A;  3IU1 A;  4OC5 A;  4QC6 A;  1NSL A;  3ZJ0 A;  4LX9 A;  4A94 A;  1FY7 A;  4HPS A;  5G20 A;  4M6H A;  3PBB A;  4OAE A;  3FEC A;  1DE4 C;  2KCW A;  4ONU A;  2CNM A;  4NFR A;  3BLN A;  4MFL A;  5LYI A;  4OIW A;  4NSQ A;  1S5K A;  3GLJ A;  4B6Z A;  4F0X A;  4R7M A;  3S6K A;  5KTD A;  2GFQ A;  2O28 A;  4A39 A;  2JDC A;  4Q7A A;  4MJ8 A;  2ZW4 A;  3B35 A;  4NGN A;  2PQ8 A;  4R3L A;  5IB9 A;  1Y0Y A;  2Z3M A;  4HNW B;  3RO0 A;  2FIW A;  3PFO A;  2PJC A;  2DF5 A;  3GYA A;  5FVJ A;  3VWD A;  1UFH A;  2IMO A;  4KOX A;  5E96 A;  3DSB A;  1OZP A;  2BL1 A;  2PSW A;  3SXN A;  3S6G A;  4JD6 A;  2AFZ A;  4NGM A;  2PJ5 A;  2JEW A;  2HQY A;  3NA6 A;  4B5P A;  2Q4Z A;  1WWZ A;  2I79 A;  4JLY A;  7CPA A;  4UIA A;  5JH9 A;  3DDD A;  4Q38 A;  1KWM A;  1YQE A;  3TX8 A;  1YSJ A;  4A37 A;  4CPA A;  4B14 A;  4UCP A;  2PJ3 A;  3TC8 A;  3BHX A;  2B4D A;  3BJ8 A;  3D3S A;  3W6S A;  3LOD A;  1LFW A;  5F46 A;  2BO9 A;  3B2Y A;  3PB4 X;  1M4L A;  4MBU A;  4X5K A;  2Q4V A;  4CGO A;  5LRK A;  3JUW A;  4CAF A;  1XRY A;  5DS0 A;  4P4F A;  4ZY2 A;  3NH4 A;  3S9N A;  2Y0M A;  2OR4 A;  2AFU A;  2Z3P A;  3V7Z A;  1XEB A;  4KUA A;  3FXT A;  4ZI6 A;  4CRZ B;  2FVG A;  1XBU A;  1A2Z A;  4AVA A;  1QSM A;  2PR1 A;  4XPD B;  2FSR A;  1RTQ A;  3S6H A;  4CGL A;  4I49 A;  3GB0 A;  1L0C A;  3WT4 A;  3B3W A;  4KVM E;  4PXC A;  4WWV A;  2PRQ A;  4F9V A;  1TF9 A;  5IV0 A;  1PYT B;  1QQ9 A;  2F7V A;  1XF8 A;  3PB6 X;  5CBM A;  3C26 A;  3JRU A;  4KSA A;  3S9M A;  2WSA A;  3LAC A;  2B3V A;  5HXD A;  2FIA A;  2GE3 A;  4PSW A;  3NE7 A;  1Q2C A;  3H8G A;  4FD4 A;  3FX6 A;  5AG5 A;  2HUZ A;  2BOA A;  1RO5 A;  2ZW6 A;  4YRH A;  1IIC A;  3H8F A;  4GM5 A;  4C2Z A;  1LCP A;  2YNC C;  1M44 A;  4M85 A;  2FE7 A;  3PZJ A;  2GLF A;  3D66 A;  1Z8T A;  1BLL E;  3IWE A;  2C1C A;  2CF4 A;  2PJ1 A;  1Q7L A;  1XMB A;  2DPS A;  4KOT A;  1CM0 A;  4UFV A;  4A2Z A;  5HVH A;  5J8F A;  1R43 A;  1S7F A;  5HH1 A;  3R9F A;  1S60 A;  3PEI A;  2Q4Y A;  3KHX A;  1CP7 A;  4X3R A;  4ZY0 A;  2VL1 A;  3F8K A;  2JLM A;  3NE8 A;  5EC4 A;  1YGH A;  4H6U A;  4ONW A;  4NGP A;  3KR5 A;  1I1D A;  1KUX A;  4NJR A;  4C2Y A;  3EXN A;  3K2K A;  3VWE A;  4QBJ A;  4B5P B;  2EUI A;  4C2X A;  3R96 A;  1XOV A;  5F49 A;  3TE4 A;  2PJ6 A;  1CPX A;  3RBU A;  2J8N A;  2FL4 A;  2PJ7 A;  4FAI A;  1QST A;  3BJ7 A;  2B4D B;  3D8P A;  4KUB A;  4Z65 A;  3HLP A;  3SJE A;  3WR7 A;  1YR0 A;  4U9Z A;  1ZLH A;  1ZG7 A;  3SI1 A;  2PDO A;  3VAR A;  1V0C A;  4MMO A;  2Z3L A;  4PQA A;  5K8M A;  2Z3O A;  2WYR A;  3T8W A;  1HDQ A;  3DLJ A;  1Q2D A;  2ZEP A;  3B7I A;  1TXR A;  1AYE A;  2ZED A;  3F0A A;  5G1Z A;  3TO9 A;  2AJ6 A;  3S6F A;  1BPM A;  2FT0 A;  4LQ6 A;  4MHN A;  3SI0 A;  2BSW A;  2FXF A;  2ZW5 A;  5IB0 A;  1GHE A;  2V8G A;  3P2F A;  4ZBG A;  1NE9 A;  2VZZ A;  3P2H A;  4P10 A;  2OZG A;  1IYL A;  1S3Z A;  2X7B A;  2BUE A;  3PB7 X;  1BOB A;  4X2T A;  4OKO A;  2NMT A;  1AMP A;  2FS5 A;  2IJZ A;  3FBU A;  4M6I A;  5CNP A;  5EBV A;  1X12 A;  4P44 A;  2VI7 A;  2WUU A;  3LMS A;  3CDX A;  3GKR A;  4KS9 A;  3CZX A;  4UFW A;  5D29 A;  3JVN A;  3MN8 A;  2RC4 A;  4HKF A;  4R76 A;  4OME A;  4HNY B;  4A31 A;  3A9L A;  2VQY A;  3ISX A;  2CNT A;  4ORF A;  1Y9K A;  2C27 A;  5G21 A;  4R6T A;  4JJX A;  2AFS A;  2ZEN A;  2Q43 A;  1TKF A;  4ZX8 A;  2BCO A;  1CG2 A;  2YND A;  4R3K A;  3PRT A;  3DR8 A;  4NCZ A;  4UFX A;  3RNZ A;  4AVB A;  2C6P A;  4MCQ A;  1Z4R A;  4OC4 A;  4JXQ A;  5LYD A;  4M3S A;  4MFZ A;  4EVY A;  3WC6 A;  5JQ4 A;  2Q44 A;  2J9A A;  3GUX A;  2Q7S A;  1BPN A;  4MY0 A;  1YW6 A;  2PJA A;  4UWJ A;  4BMH A;  1HDU A;  3R9G A;  3UY5 A;  3N7Z A;  5K8P A;  2XEF A;  1R57 A;  3FRM A;  4PXE A;  4CYP A;  5H84 A;  3W6X A;  3PFE A;  3SJF A;  3KL9 A;  1XMT A;  2PR8 A;  3TO7 A;  3D2P A;  3TOB A;  1QSN A;  2RFH A;  4H2K A;  3V38 A;  1ELL P;  1KUY A;  4EWT A;  3FEE A;  1M4D A;  2YNE A;  5KTA A;  3I9S A;  3FNC A;  2DXQ A;  4PV6 A;  4A38 A;  2J8R A;  2P6G A;  3SXO A;  2XEI A;  2B58 A;  3D2M A;  3FB3 A;  1YX0 A;  2G0B A;  3G8W A;  1N71 A;  1Z8L A;  1X10 A;  2G9D A;  3FVL A;  3IJ3 A;  4CGN A;  4E8O A;  1DTD A;  5AGE A;  4JXR A;  5I0C A;  4XNH C;  2IL4 A;  3CXQ A;  3FJU A;  3PB8 X;  2O4H A;  4IUS A;  1M1D A;  3TFY A;  2VZY A;  4B5O A;  2PCU A;  2Q04 A;  2OZU A;  5LRJ A;  5JM6 A;  4F8Z A;  5AG6 A;  1S7N A;  3EO4 A;  1CP6 A;  4KVX A;  5KTC A;  2B4B A;  5BWA B;  4P4B A;  2ARH A;  2EO8 A;  3D7F A;  1YK3 A;  4QUS A;  5C82 A;  4II9 A;  4OP4 A;  4MCS A;  1YW4 A;  2C6G A;  4F9U A;  4FD6 A;  2D4O A;  2ZXV A;  1BO4 A;  4AXV A;  1VHE A;  4MRI A;  1PU9 A;  1TKH A;  4UF4 A;  4TWE A;  4AG7 A;  2Q51 A;  2OH1 A;  3QNV A;  1NMT A;  2EVN A;  1Z4E A;  4FWU A;  2VEZ A;  1IGB A;  2B5G A;  1XJO A;  3IO1 A;  3BXM A;  4MHD A;  5JGF A;  4R57 A;  4MFK A;  4UA3 A;  4A32 A;  2GRE A;  3TOA A;  3H5Z A;  3R1K A;  1SQH A;  4PXB A;  4IAV A;  4IHM A;  1K4J A;  4KOW A;  2ZEG A;  5ELY A;  4KOY A;  3RYO A;  2ZEO A;  1Z2L A;  1PUA A;  2P6F A;  2ANP A;  5AG7 A;  4Y49 C;  3FH4 A;  2NSM A;  4H89 A;  1WK4 A;  3IWG A;  4R87 A;  2ZEF A;  2EK8 A;  5DWM A;  3TTH A;  4KVO E;  2Z0Z A;  2EBJ A;  3CT9 A;  5D8N A;  4L8A A;  2YNC A;  4Q36 A;  2ZEL A;  2PJ2 A;  4NGQ A;  4KSF A;  1TKJ A;  1ZG8 A;  4R8F A;  1YME A;  2R7H A;  3L2N A;  2PVV A;  1IOI A;  3BI0 A;  3G3S A;  3B8G A;  4UEZ A;  4RN7 A;  2CTC A;  2OOT A;  3I3G A;  3IIB A;  4GS4 A;  3FMC A;  4ZX9 A;  4KOU A;  3E0K A;  3T90 A;  3LWU A;  4P4E A;  3KZW A;  5J8C A;  5AG4 A;  2ATR A;  3DR6 A;  1KUV A;  2V8D A;  1LAN A;  2CIJ A;  3TT2 A;  1IB1 E;  1YLO A;  2GAN A;  3IFE A;  2WPX A;  5K8O A;  4PK3 A; 
#chains in the Genus database with same CATH homology
 2OU2 A;  4NF1 A;  2B3U A;  1IYK A;  2P0W A;  4RS2 A;  1S7K A;  4R9M A;  1S7L A;  4IF5 A;  4UCN A;  2QEC A;  4U5Y A;  4PSX A;  2I00 A;  4OAD A;  4CS0 B;  4F6A A;  1I12 A;  2Z3K A;  3GY9 A;  4HNX B;  4CYN A;  3EFA A;  4C68 A;  2REE A;  4AG9 A;  2K5T A;  3FYN A;  4J3G A;  4FD5 A;  4MFQ A;  1YVO A;  4UCM A;  4XPD C;  4B13 A;  1Q2Y A;  2ZPA A;  2Z10 A;  5H86 A;  1YVK A;  1Z9U A;  2OZH A;  4C7H A;  2PC1 A;  3PP9 A;  2P6E A;  3QB8 A;  4YGO A;  1XE4 A;  4F0Y A;  3IU2 A;  3LD2 A;  1B6B A;  1J4J A;  4AVC A;  4KOR A;  1QSR A;  3SHP A;  4MFJ A;  1ZO0 A;  3T9Y A;  4A95 A;  3CXP A;  4A30 A;  2Z3N A;  2QML A;  4UWI A;  2CNS A;  2PRB A;  2HV2 A;  4KOV A;  2AE6 A;  5F47 A;  5IX3 A;  1ON0 A;  1U6M A;  2CY2 A;  2R98 A;  2R1I A;  1P4N A;  1MJB A;  4A33 A;  2REF A;  5HMN A;  2F5I A;  3DNS A;  4KZT A;  1MK4 A;  4CYO A;  3FIX A;  3R9E A;  4YFJ A;  2VBQ A;  1VKC A;  3W91 A;  4DNC A;  3JTK A;  4CAW A;  1Y7R A;  4NEX A;  2R8V A;  2Z11 A;  1LRZ A;  4KOS A;  4NXY A;  4MI4 A;  4BBH A;  4XPK A;  4PK2 A;  2YGW A;  1B87 A;  3CXS A;  2BEI A;  4UBR A;  3R95 A;  2OB0 A;  2A4N A;  4CAE A;  4B11 A;  4CGM A;  4CRY B;  4OLL A;  4L89 A;  1P0H A;  5GCN A;  4E2A A;  2JEV A;  2Q0Y A;  4KLW A;  2CXA A;  3H4Q A;  3K9U A;  1MJ9 A;  4E0A A;  4U9Y A;  3TO6 A;  4H6Z A;  3V8I A;  4MFP A;  4K30 A;  4B12 A;  2DPT A;  2QIR A;  4C7I A;  2H5M A;  1YLE A;  5A28 A;  4B10 A;  3F5B A;  4JWP A;  3IGR A;  4XNH B;  4MY3 A;  4CGP A;  1I21 A;  2VXK A;  2ZW7 A;  4QB9 A;  4CAV A;  5C88 A;  2GIV A;  4RI1 A;  2JDD A;  4CYQ A;  2G3T A;  3OWC A;  5A27 A;  2B5G B;  2WPW A;  4QVT A;  1Y9W A;  1RXT A;  5JPH A;  2FCK A;  1VHS A;  1TIQ A;  5G22 A;  1M4I A;  4LUA A;  5DWN A;  3EC4 A;  5ISV A;  1YRE A;  4AB7 A;  1M4G A;  2Q7B A;  4XPL A;  1IID A;  2J8M A;  3QAH A;  3EY5 A;  1QSO A;  3PGP A;  1XIX A;  4FD7 A;  2D4P A;  3ZZI A;  3TCV A;  1CJW A;  1KZF A;  1MJA A;  3KKW A;  4Y49 B;  5F48 A;  3MGD A;  4KLV A;  2G3A A;  3IU1 A;  4QC6 A;  1NSL A;  3ZJ0 A;  4LX9 A;  1FY7 A;  5G20 A;  4OAE A;  4ONU A;  2KCW A;  2CNM A;  3BLN A;  4MFL A;  4NSQ A;  1S5K A;  4F0X A;  5KTD A;  3S6K A;  2O28 A;  2JDC A;  4MJ8 A;  2ZW4 A;  2PQ8 A;  4R3L A;  2Z3M A;  4HNW B;  2FIW A;  5FVJ A;  3GYA A;  3VWD A;  1UFH A;  4KOX A;  5E96 A;  3DSB A;  1OZP A;  2BL1 A;  2PSW A;  3SXN A;  3S6G A;  4JD6 A;  2HQY A;  4B5P A;  1WWZ A;  2I79 A;  4JLY A;  3DDD A;  4Q38 A;  4B14 A;  4UCP A;  2B4D A;  3BJ8 A;  3D3S A;  3W6S A;  3LOD A;  5F46 A;  4X5K A;  4MBU A;  2Q4V A;  4CGO A;  3JUW A;  4CAF A;  2Y0M A;  2Z3P A;  1XEB A;  4KUA A;  3FXT A;  4CRZ B;  4AVA A;  1QSM A;  2PR1 A;  4XPD B;  2FSR A;  3S6H A;  4CGL A;  4I49 A;  1L0C A;  4KVM E;  5IV0 A;  1XF8 A;  3C26 A;  4KSA A;  2WSA A;  2B3V A;  2FIA A;  2GE3 A;  4PSW A;  3NE7 A;  1Q2C A;  4FD4 A;  5AG5 A;  2HUZ A;  1RO5 A;  2ZW6 A;  4YRH A;  1IIC A;  4C2Z A;  2YNC C;  1M44 A;  4M85 A;  2FE7 A;  3PZJ A;  3IWE A;  4KOT A;  4A2Z A;  2DPS A;  4UFV A;  1CM0 A;  5J8F A;  1S7F A;  5HH1 A;  3R9F A;  1S60 A;  2Q4Y A;  3F8K A;  2JLM A;  5EC4 A;  1YGH A;  4H6U A;  1I1D A;  1KUX A;  4C2Y A;  3EXN A;  3VWE A;  4QBJ A;  4B5P B;  2EUI A;  4C2X A;  3R96 A;  5F49 A;  3TE4 A;  2J8N A;  2FL4 A;  1QST A;  3BJ7 A;  2B4D B;  3D8P A;  4KUB A;  3WR7 A;  1YR0 A;  4U9Z A;  2PDO A;  1V0C A;  2Z3L A;  2Z3O A;  1Q2D A;  3F0A A;  3TO9 A;  5G1Z A;  2AJ6 A;  3S6F A;  2FT0 A;  2BSW A;  2FXF A;  2ZW5 A;  5IB0 A;  1GHE A;  3P2F A;  4ZBG A;  1NE9 A;  3P2H A;  2VZZ A;  4CAX A;  2OZG A;  1IYL A;  1S3Z A;  2X7B A;  2BUE A;  4ZGY B;  1BOB A;  2NMT A;  2FS5 A;  3FBU A;  5CNP A;  5EBV A;  2VI7 A;  2WUU A;  4KS9 A;  3GKR A;  4UFW A;  3JVN A;  2RC4 A;  4HKF A;  4A31 A;  4HNY B;  3A9L A;  2VQY A;  2CNT A;  4ORF A;  1Y9K A;  2C27 A;  5G21 A;  4JJX A;  2YND A;  4R3K A;  4NCZ A;  3DR8 A;  4UFX A;  4AVB A;  1Z4R A;  4JXQ A;  4M3S A;  4MFZ A;  4EVY A;  5JQ4 A;  2Q44 A;  4MY0 A;  4UWJ A;  4BMH A;  3R9G A;  3UY5 A;  3N7Z A;  3FRM A;  1R57 A;  4CYP A;  5H84 A;  3W6X A;  1XMT A;  2PR8 A;  3TO7 A;  3D2P A;  3TOB A;  1QSN A;  1KUY A;  5KTA A;  1M4D A;  2YNE A;  3I9S A;  3FNC A;  2DXQ A;  4PV6 A;  2J8R A;  2P6G A;  3SXO A;  2B58 A;  3D2M A;  3FB3 A;  1YX0 A;  2G0B A;  3G8W A;  1N71 A;  4CGN A;  5I0C A;  4E8O A;  5AGE A;  4JXR A;  4XNH C;  2IL4 A;  3CXQ A;  4IUS A;  3TFY A;  1M1D A;  2VZY A;  4B5O A;  2Q04 A;  2OZU A;  5AG6 A;  1S7N A;  3EO4 A;  4KVX A;  5KTC A;  2B4B A;  5BWA B;  2ARH A;  4II9 A;  1YK3 A;  4QUS A;  5C82 A;  4FD6 A;  2D4O A;  2ZXV A;  1BO4 A;  1PU9 A;  4AG7 A;  2OH1 A;  1NMT A;  2EVN A;  1Z4E A;  2VEZ A;  2B5G A;  4MHD A;  4R57 A;  4MFK A;  4UA3 A;  4A32 A;  3TOA A;  3H5Z A;  3R1K A;  1SQH A;  1K4J A;  4KOW A;  3RYO A;  4KOY A;  1PUA A;  2P6F A;  5AG7 A;  4Y49 C;  4H89 A;  1WK4 A;  3IWG A;  4R87 A;  5DWM A;  3TTH A;  4KVO E;  2Z0Z A;  4L8A A;  2YNC A;  4Q36 A;  4KSF A;  2R7H A;  3G3S A;  3B8G A;  3I3G A;  4GS4 A;  4KOU A;  3E0K A;  3T90 A;  5J8C A;  5AG4 A;  2ATR A;  3DR6 A;  1KUV A;  3TT2 A;  1IB1 E;  2GAN A;  2WPX A;  4PK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...