4CYOA

Leishmania major n-myristoyltransferase in complex with a hybrid inhibitor (compound 21).
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design of Potent and Selective Leishmania N- Myristoyltransferase Inhibitors.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
total genus 118
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cyoA00
5AG6A 5G21A 2WUUA 4C2YA 2YNCA 5A27A 4B11A 2YNCC 5AG4A 5G22A 4UCMA 4A30A 4B10A 4C2XA 4UCPA 5AG5A 4C7HA 4CGPA 4CYNA 4CGNA 4UFXA 4A32A 4CYPA 2YNDA 4C2ZA 4BBHA 4CAFA 3IU2A 3IU1A 4UFVA 4B12A 3IWEA 4UFWA 5G1ZA 4B13A 5A28A 4CGLA 5AGEA 4A33A 4CGMA 4CGOA 4C7IA 5AG7A 4A95A 4A2ZA 4CAEA 4CYQA 3JTKA 2WSAA 4CYOA 4A31A 4C68A 4UCNA 2YNEA 5G20A 3H5ZA 4B14A
chains in the Genus database with same CATH superfamily
1MK4A 1AMPA 1KUYA 2P6GA 1CX8A 5F49A 3VH9A 2FIWA 4JWPA 4JJXA 2XEGA 4A30A 1P4NA 2PVVA 2CXAA 2ZENA 3NH5A 4H89A 5CNPA 3IFEA 1IIDA 3LACA 3PB6X 4PXBA 3TT2A 4C7HA 4KOWA 3BJ8A 4PXDA 1A2ZA 1QMUA 4LUAA 3A9LA 4LQ6A 2EWBA 1IOIA 4OMEA 4U9YA 4II9A 1VHEA 1ZLIA 1YK3A 2R98A 1Z4RA 3PFOA 1WWZA 3KZWA 3PP9A 4X8IA 4CGOA 4EFDA 2OU2A 3EXNA 4FD5A 3TO9A 3S9LA 2ZEDA 4JYWA 2RFHA 3IWWA 1Y7RA 4MCPA 2PJCA 2C6CA 2PJ2A 1BPMA 2HUZA 2ZEOA 3KI9A 4IK2A 4C68A 1CBXA 4MCSA 4KOYA 1S60A 3SJEA 3SJXA 1VKCA 2PIYA 2PR8A 3R95A 3ZJ0A 2ZEEA 4ZI6A 2YNCA 3MGDA 4NEXA 4NF1A 1IYKA 3I1UA 4MHDA 5DS0A 3TO6A 2NYQA 2V77A 2JDDA 2PJAA 4UCPA 4U9ZA 3R9FA 4CYNA 1TF9A 3K9TA 4KSFA 1K4JA 4UFXA 5CPAA 2GLJA 1MJ9A 2Q4VA 3B3TA 1Y0YA 2XEJA 3I9SA 2J8MA 1R3NA 1F57A 5IV0A 3EFAA 3SI1A 3GLJA 4NGPA 3SXNA 4K3NA 4MFPA 4A33A 4R9MA 2PJBA 3PZJA 4MJ8A 5ISVA 2FE7A 3GUXA 4P44A 2AFUA 2QECA 3KHZA 3I3GA 4UEZA 4CYQA 3B35A 2ODFA 2PE3A 4EMEA 3D7DA 4A37A 3FBUA 3H5ZA 2C1CA 5JQ4A 2OB0A 2V8GA 4KUBA 4GS4A 3SXOA 3ISZA 1FNOA 7CPAA 1B87A 1M44A 4FD6A 2O4HA 3H8FA 1EE3P 3KL9A 1DTDA 1PUAA 2PR1A 4AB7A 2EBJA 4F8ZA 2ZPAA 3EY5A 4ZYQA 5LYDA 3IU2A 3B7IA 1XMTA 4OLLA 4U5YA 4FUUA 5D8NA 2GU2A 2IQ6A 3B2YA 4PXCA 3PGPA 4M6HA 5C88A 1F2PA 4OP4A 3WC6A 4Y49C 3KGQA 2DF5A 3IEHA 4H6UA 4JD6A 1BO4A 2EUIA 4OC5A 4BD9A 1YLEA 3PBBA 4PSWA 1ARLA 1SQHA 2B5GA 3D8PA 4X5KA 3W6XA 2POKA 4IF5A 4F9VA 1IY7A 4R7MA 2V8DA 3SHPA 3V38A 3LD2A 4MY3A 4MHZA 4QB9A 1XFOA 5A27A 1X10A 4AVAA 4OIDA 1BOBA 4UEFA 3QB8A 4JZ0A 1XE4A 2GE3A 2ATRA 3RZAA 2QIRA 3WABA 2G3AA 4MFZA 3VATA 3UY5A 1HDQA 1HEEA 2QMLA 1Y9KA 2H5MA 2Q7BA 3MN8A 1Y7EA 4MCQA 4ZGYB 4Y49B 2JEVA 2HC9A 2OZGA 2REEA 4NGTA 1KUVA 1ON0A 1LFWA 3H8GA 2CTCA 1ZO0A 2BOAA 2ZELA 1VHSA 1CP7A 3FXTA 4NSQA 4UCNA 4PK3A 3CXSA 4B5PB 4B14A 1R57A 4FBEA 2ZW5A 4LX9A 2FIAA 1XEBA 1ELLP 3IC1A 2XEFA 1JWQA 3OWCA 3V7ZA 5AG5A 4C2XA 1XOVA 3FIXA 2HB6A 2NMTA 2YGWA 2PJ0A 2GIVA 2CNMA 3S6FA 3TOAA 1BPNA 1XJOA 3EO4A 4F0XA 2DPSA 3WT4A 1XF8A 3D3SA 4P4EA 1R43A 1Z4EA 5BWAB 3S9MA 4ZY0A 4LQGA 4UA3A 1MJBA 3B3CA 3F5BA 4R76A 2PQ8A 4WWVA 4M6IA 2P6EA 2AFWA 4NFRA 1Q7LA 1Z8TA 1LOKA 1M4DA 3D68A 3H8EA 3NH8A 1LCPA 1IOFA 5DWNA 3P2FA 5LRGA 2ZOFA 4KZTA 4R87A 2Z3LA 3BHXA 2WUUA 3CXPA 2ZEFA 4I49A 1YLOA 3FH4A 4MRIA 5HMNA 3D2MA 4IHMA 3KHXA 4PQAA 1GYTA 1L0CA 3D7GA 4M6GA 2V8HA 1FY7A 1CG2A 4OC0A 2PJ6A 3FRMA 3F0AA 2GREA 2EK9A 2REFA 2DEAA 3NH4A 4E2AA 5IB9A 3TFYA 2OOTA 2ZW7A 4FD7A 2GANA 3FMCA 4UWJA 3PBEA 2Z3MA 2Y0MA 3K2KA 3IWGA 1LAPA 3ISXA 5ELYA 4NGQA 5THWA 2F8HA 1BAVA 4A31A 4KVXA 5F09A 1TKHA 2B58A 4BMHA 2Q4ZA 5G20A 2I00A 2BO9A 2G3TA 5AG4A 2RB7A 5JPHA 2WPXA 3BI1A 4RS2A 5HXDA 4CAFA 2IJZA 3KASA 4FWUA 1ZG8A 4MFJA 2PCUA 4ONWA 2Q04A 2CNTA 5HVFA 4KOVA 4R8FA 5A28A 3HUVA 3PB8X 5AGEA 3CZXA 3C26A 2OZUA 5GCNA 3R9EA 4KVOE 4YWYA 1LANA 1M1DA 3SI0A 4BINA 5JM6A 5LYLA 3S6HA 4HPSA 5J8CA 1QSMA 3T90A 4F6AA 1Z8XA 4NGNA 4CYOA 5JH9A 2HQYA 4WJBA 4QUSA 4QVTA 2I3CA 2Z10A 4TNUA 2B5GB 2NSMA 1OZPA 1F2OA 3BI0A 3TOBA 4CS0B 5EMIA 3GYAA 4MHPA 4CGPA 4P4BA 5I4MA 1I12A 1TKFA 2FT0A 1YSJA 1ZG9A 2PJ8A 3GB0A 4UCMA 4CAWA 5HVHA 4XPLA 2Z0ZA 2WZNA 4CRZB 2A4NA 3NA6A 3NE7A 4Q36A 2P6FA 4C2ZA 1BLLE 1Z2LA 2ZEGA 4UFWA 1I1DA 4YU9A 4P6YA 5KTCA 1QSRA 3B3SA 3DGVA 1V0CA 1Z9UA 4R3LA 3P2HA 3BJ7A 4AXVA 1JQGA 5KTAA 5HVGA 2Z3KA 2QYVA 4OKOA 1NSLA 4L89A 4M3SA 5LYFA 1LRZA 2IMOA 2PJ3A 3KQXA 4XNHC 4NGSA 3DDDA 4DUKA 3NFZA 3VWEA 4ZY1A 2VXKA 4KLVA 3DLJA 3FB3A 4NGRA 4ZY2A 2VQYA 1QSNA 2R7HA 3R9GA 2FXFA 4PXEA 2O53A 2VZZA 2B4DB 1TKJA 1TF8A 4MMOA 2PRQA 4MY0A 3B3VA 3N5FA 2PVWA 4OADA 3W6SA 3V8IA 3SI2A 3WC5A 1Q2DA 2EVNA 2ZOGA 4W9YA 4ZX8A 2CIJA 3GY9A 3K9UA 1XRYA 4UIBA 4MFQA 3T9YA 2ANPA 1PYTB 4P4IA 4DJLA 1VHOA 3N7ZA 4P45A 1IYLA 3JUWA 2O28A 3JTKA 3CPXA 2CNSA 3FX6A 1CPXA 2PJ1A 2ZEMA 3TTHA 4B5OA 1Z8LA 1Z5RA 2JDCA 2J9AA 2PSWA 5H86A 2FVGA 4NJRA 2VL1A 2ZEPA 4PK2A 2Q44A 2YNCC 4M85A 3NE8A 1KUXA 3D67A 3G3SA 4TWEA 4NGMA 3VARA 3HLPA 2Q4YA 3QAYA 2FSRA 4H2KA 2ABZA 4UEEA 1YVOA 4ONUA 4HNXB 3BLNA 1IGBA 8CPAA 3D7FA 4CGLA 1Y9WA 2AE6A 4IUSA 5LRJA 4KVME 4C7IA 2K5TA 4GXHA 1IU8A 2AJ6A 3DR6A 2CTBA 1QQ9A 4O23A 3TC8A 4AG7A 2XEIA 4P4DA 4PPZA 2F5IA 4JXRA 2ZEHA 4MXUA 2PJ4A 4UIAA 4KOTA 4P4FA 2J8NA 3JVNA 1MJAA 2PDOA 1LAMA 5G22A 1M4IA 2OH1A 2BCOA 4F9UA 1ZLHA 3EC4A 4FAIA 3RNZA 3FEDA 3MRUA 1YW6A 1P0HA 2FCKA 3IWEA 2C27A 3BXMA 5F47A 2F7VA 5G1ZA 2OZHA 2GLFA 1M4GA 4MI4A 4DYOA 3TO7A 2ZW6A 1CJWA 2KCWA 2QJ8A 3KR5A 3RAMA 1XBUA 1KWMA 3CXQA 4A94A 3DSBA 4P4JA 2R1IA 1Y0RA 2DXQA 4H6ZA 2VEZA 2AFZA 2X7BA 4R57A 4IAVA 3PB4X 1Q2CA 2Z11A 3DR8A 3FF3A 4CAVA 5KTDA 3DNSA 4B10A 1NMTA 1XIXA 3W91A 3PFEA 2AFSA 1PU9A 4X2TA 4XPKA 2AFXA 5JGFA 3RO0A 2B4DA 2BSWA 4PSXA 2D4OA 1NE9A 2HV2A 3G8WA 1XMBA 4GM5A 4R3KA 4UFVA 5FVJA 5K8PA 2EK8A 4CRYB 2VBQA 5CBMA 2B4BA 1M4LA 4AG9A 4CGMA 3CPAA 2ARHA 2Q51A 2Q7SA 5LYIA 1RO5A 4OIWA 4NCZA 3WC7A 4RUHA 1YW4A 1ARMA 4HNYB 3TX8A 2WPWA 1KZFA 3KR4A 3GKRA 4YGOA 2YNEA 4CAXA 3R1KA 4QBJA 1RXTA 4XPDB 2PJ9A 2CY2A 3IGRA 2Z3OA 1N71A 2AFMA 2Q0YA 3FNCA 4PV6A 5K8MA 3T8WA 3B3WA 1U6MA 2GFQA 4KOXA 2YNDA 3F8KA 2PC1A 3SJGA 3S9NA 4B12A 3IO1A 3FECA 4ORFA 5H84A 4MHYA 4EWTA 2G0BA 1Q2YA 1YGHA 4KSIA 4A39A 5IB0A 4KLWA 5AG7A 4HNWB 5I0CA 5F48A 1PCAA 2ZW4A 1UFHA 3JRUA 4XPDC 3S6GA 3ZZIA 2D4PA 3PRTA 1TIQA 2WYRA 1HDUA 5LRKA 3TE4A 3WR7A 2B3VA 2PJ5A 3KQZA 5AG6A 5G21A 4ZBGA 2C6GA 2I79A 1NSAA 4E0AA 1TXRA 3R96A 2ZXVA 5K8OA 4NJQA 4Z65A 1YQEA 2P0WA 4A32A 3D4UA 4B6ZA 2JBKA 3D2PA 5EBVA 3IJ3A 1YREA 1S7NA 4AVBA 3IU1A 2JBJA 3SJFA 4B13A 3S6KA 1Z8WA 4CYPA 3PB9X 5EC4A 4J3GA 1AYEA 2DPTA 2BL1A 3FEEA 1YVKA 2CF4A 4YFJA 3FJUA 4ZX9A 5J1QA 2BEIA 4A95A 4FD4A 3CDXA 1I21A 4R6TA 1J4JA 1CPSA 3PEIA 3B8GA 4DNCA 4L8AA 4CPAA 4UWIA 4MBUA 3L2NA 2PRBA 5D29A 2B3UA 5IX3A 5J8FA 1IB1E 1YR0A 2PIZA 4KSAA 2V8VA 4OC4A 1YX0A 4A38A 3QNVA 1S7FA 3H4QA 1WK4A 2R8VA 4OC3A 1B6BA 1FT7A 4BBHA 1S7KA 1QSTA 4YRHA 2J8RA 2EO8A 3E0KA 5DWMA 2VZYA 3D7HA 3LODA 3QAHA 3TCVA 2FL4A 4UBRA 4QC6A 4AVCA 2FS5A 4JLYA 4KOSA 3IIBA 3CT9A 4A2ZA 4CAEA 5K8NA 2WSAA 4G1PA 3VWDA 3D66A 4MHNA 1S7LA 3PB7X 1QSOA 4E8OA 5HH1A 4K30A 4OC1A 4EVYA 4Q7AA 2IL4A 4OAEA 1VIXA 2BUEA 4OC2A 2Z3PA 4B11A 1YMEA 4C2YA 4RN7A 1S5KA 4B5PA 1VGYA 5F46A 4KUAA 2RC4A 2JLMA 3LWUA 4MFKA 4Q38A 4JXQA 4KORA 1RTQA 4CGNA 1ZG7A 1H8LA 2Z3NA 4F0YA 1IICA 1AUGA 3LMSA 4KOUA 6CPAA 2VI7A 2JEWA 5E96A 4UF4A 1X12A 2G9DA 3FYNA 4HKFA 4MCRA 1ELMP 2Q43A 1CP6A 4NXYA 4X3RA 4P10A 3RBUA 3FVLA 2C6PA 2OR4A 2QVPA 1DE4C 1GHEA 4MFLA 2AFOA 2PJ7A 4RI1A 3KKWA 3RYOA 1S3ZA 4KS9A 1OBRA 1CM0A 1UWYA 3GIUA 5C82A 4XNHB
chains in the Genus database with same CATH topology
1MK4A 1KUYA 2P6GA 5F49A 2FIWA 4JWPA 4JJXA 4A30A 1P4NA 5CNPA 2CXAA 4H89A 4C7HA 1IIDA 3TT2A 4KOWA 3BJ8A 4LUAA 3A9LA 4U9YA 4II9A 2R98A 1YK3A 1Z4RA 1WWZA 3PP9A 4CGOA 2OU2A 3EXNA 4FD5A 3TO9A 1Y7RA 2HUZA 4C68A 4KOYA 1S60A 1VKCA 2PR8A 3R95A 3ZJ0A 2YNCA 3MGDA 4NEXA 4NF1A 1IYKA 4MHDA 3TO6A 4UCPA 2JDDA 4CYNA 4U9ZA 3R9FA 4KSFA 1K4JA 4UFXA 3I9SA 1MJ9A 2Q4VA 4CYPA 2J8MA 5IV0A 3EFAA 3SXNA 4MFPA 4A33A 4R9MA 3PZJA 4MJ8A 5ISVA 2FE7A 2QECA 3I3GA 4CYQA 3FBUA 3H5ZA 5JQ4A 2OB0A 4KUBA 3SXOA 4GS4A 1B87A 1M44A 4FD6A 4AB7A 1PUAA 2PR1A 2ZPAA 3EY5A 3IU2A 4OLLA 1XMTA 4U5YA 3PGPA 5C88A 4Y49C 4JD6A 4H6UA 1BO4A 2EUIA 1YLEA 4PSWA 1SQHA 2B5GA 3D8PA 4X5KA 3W6XA 4IF5A 3SHPA 3LD2A 4MY3A 4QB9A 4AVAA 1BOBA 3QB8A 1XE4A 2GE3A 2ATRA 2QIRA 2G3AA 4MFZA 3UY5A 2QMLA 1Y9KA 2H5MA 2Q7BA 4ZGYB 4Y49B 2JEVA 2OZGA 2REEA 1KUVA 1ON0A 1ZO0A 4NSQA 1VHSA 3FXTA 4UCNA 4PK3A 3CXSA 4B5PB 4B14A 1R57A 2ZW5A 4LX9A 2FIAA 1XEBA 3OWCA 4C2XA 5AG5A 3FIXA 2NMTA 2YGWA 2GIVA 2CNMA 3S6FA 3TOAA 4F0XA 3EO4A 2DPSA 1XF8A 3D3SA 1Z4EA 5BWAB 4UA3A 1MJBA 3F5BA 2PQ8A 2P6EA 1M4DA 5DWNA 3P2FA 4KZTA 4R87A 2Z3LA 2WUUA 3CXPA 4I49A 5HMNA 3D2MA 1L0CA 1FY7A 3FRMA 3F0AA 3TFYA 2REFA 4E2AA 2ZW7A 4FD7A 2GANA 4UWJA 2Z3MA 2Y0MA 3IWGA 4A31A 4KVXA 2B58A 4BMHA 5G20A 2I00A 2G3TA 5AG4A 5JPHA 2WPXA 4RS2A 4CAFA 4MFJA 2Q04A 2CNTA 4KOVA 5A28A 5AGEA 3C26A 2OZUA 5GCNA 3R9EA 4KVOE 1M1DA 3S6HA 5J8CA 1QSMA 3T90A 4F6AA 4CYOA 2HQYA 4QUSA 4QVTA 2Z10A 2B5GB 1OZPA 3TOBA 4CS0B 3GYAA 4CGPA 1I12A 2FT0A 4UCMA 4CAWA 4XPLA 2Z0ZA 4CRZB 2A4NA 4Q36A 3NE7A 4C2ZA 2P6FA 4UFWA 1I1DA 5KTCA 1QSRA 1V0CA 1Z9UA 4R3LA 3P2HA 3BJ7A 5KTAA 2Z3KA 1NSLA 4L89A 4M3SA 1LRZA 4XNHC 3DDDA 3VWEA 2VXKA 4KLVA 3FB3A 2VQYA 1QSNA 2R7HA 3R9GA 2FXFA 2VZZA 2B4DB 4MY0A 4OADA 3W6SA 3V8IA 1Q2DA 2EVNA 3GY9A 3K9UA 4MFQA 3T9YA 3N7ZA 1IYLA 3JUWA 2O28A 3JTKA 2CNSA 3TTHA 4B5OA 2JDCA 2PSWA 5H86A 4PK2A 2Q44A 2YNCC 4M85A 1KUXA 3G3SA 2Q4YA 2FSRA 1YVOA 4ONUA 4HNXB 3BLNA 4CGLA 1Y9WA 2AE6A 4IUSA 4KVME 4C7IA 2K5TA 2AJ6A 3DR6A 4AG7A 2F5IA 4JXRA 4KOTA 2J8NA 3JVNA 1MJAA 2PDOA 5G22A 1M4IA 2OH1A 3EC4A 2FCKA 1P0HA 5F47A 3IWEA 2C27A 5G1ZA 2OZHA 1M4GA 4MI4A 3TO7A 2ZW6A 1CJWA 2KCWA 3CXQA 3DSBA 2R1IA 4H6ZA 2DXQA 2VEZA 2X7BA 4R57A 1Q2CA 2Z11A 3DR8A 4CAVA 5KTDA 3DNSA 4B10A 1NMTA 1XIXA 3W91A 1PU9A 4XPKA 2B4DA 2BSWA 4PSXA 2D4OA 1NE9A 2HV2A 3G8WA 4UFVA 4R3KA 5FVJA 4CRYB 2VBQA 2B4BA 4AG9A 4CGMA 2ARHA 1RO5A 4NCZA 4HNYB 2WPWA 1KZFA 3GKRA 4YGOA 2YNEA 4CAXA 3R1KA 4QBJA 1RXTA 4XPDB 2CY2A 3IGRA 2Z3OA 1N71A 3FNCA 2Q0YA 4PV6A 1U6MA 4KOXA 2YNDA 3F8KA 2PC1A 4B12A 4ORFA 5H84A 2G0BA 1Q2YA 1YGHA 5IB0A 4KLWA 5AG7A 4HNWB 5I0CA 5F48A 2ZW4A 1UFHA 4XPDC 3S6GA 3ZZIA 2D4PA 1TIQA 3TE4A 3WR7A 2B3VA 5AG6A 5G21A 4ZBGA 2I79A 4E0AA 3R96A 2ZXVA 2P0WA 4A32A 3D2PA 5EBVA 4AVBA 1YREA 1S7NA 3IU1A 4B13A 3S6KA 5EC4A 4J3GA 2DPTA 2BL1A 1YVKA 2BEIA 4A95A 4FD4A 1I21A 1J4JA 3B8GA 4DNCA 4L8AA 4UWIA 4MBUA 2PRBA 2B3UA 5IX3A 5J8FA 1IB1E 1YR0A 4KSAA 1YX0A 1S7FA 3H4QA 1WK4A 2R8VA 4BBHA 1B6BA 1S7KA 1QSTA 4YRHA 2J8RA 3E0KA 5DWMA 2VZYA 3LODA 3QAHA 3TCVA 2FL4A 4UBRA 4QC6A 4AVCA 2FS5A 4JLYA 4KOSA 4A2ZA 4CAEA 2WSAA 3VWDA 1S7LA 1QSOA 4E8OA 5HH1A 4K30A 4EVYA 4C2YA 2IL4A 4OAEA 2BUEA 4B11A 4YFJA 2Z3PA 5A27A 5F46A 4B5PA 1S5KA 4KUAA 2RC4A 2JLMA 4MFKA 4Q38A 4JXQA 4KORA 4CGNA 2Z3NA 4F0YA 1IICA 4KOUA 2VI7A 5E96A 3FYNA 4HKFA 4NXYA 1GHEA 4MFLA 4RI1A 3KKWA 3RYOA 1S3ZA 4KS9A 1CM0A 5C82A 4XNHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AG6 A;  5G21 A;  2WUU A;  4C2Y A;  2YNC A;  5A27 A;  4B11 A;  2YNC C;  5AG4 A;  5G22 A;  4UCM A;  4A30 A;  4B10 A;  4C2X A;  4UCP A;  5AG5 A;  4C7H A;  4CGP A;  4CYN A;  4CGN A;  4UFX A;  4A32 A;  4CYP A;  2YND A;  4C2Z A;  4BBH A;  4CAF A;  3IU2 A;  3IU1 A;  4UFV A;  4B12 A;  3IWE A;  4UFW A;  5G1Z A;  4B13 A;  5A28 A;  4CGL A;  5AGE A;  4A33 A;  4CGM A;  4CGO A;  4C7I A;  5AG7 A;  4A95 A;  4A2Z A;  4CAE A;  4CYQ A;  3JTK A;  2WSA A;  4CYO A;  4A31 A;  4C68 A;  4UCN A;  2YNE A;  5G20 A;  3H5Z A;  4B14 A; 
#chains in the Genus database with same CATH topology
 1MK4 A;  1AMP A;  1KUY A;  2P6G A;  1CX8 A;  5F49 A;  3VH9 A;  2FIW A;  4JWP A;  4JJX A;  2XEG A;  4A30 A;  1P4N A;  2PVV A;  2CXA A;  2ZEN A;  3NH5 A;  4H89 A;  5CNP A;  3IFE A;  1IID A;  3LAC A;  3PB6 X;  4PXB A;  3TT2 A;  4C7H A;  4KOW A;  3BJ8 A;  4PXD A;  1A2Z A;  1QMU A;  4LUA A;  3A9L A;  4LQ6 A;  2EWB A;  1IOI A;  4OME A;  4U9Y A;  4II9 A;  1VHE A;  1ZLI A;  1YK3 A;  2R98 A;  1Z4R A;  3PFO A;  1WWZ A;  3KZW A;  3PP9 A;  4X8I A;  4CGO A;  4EFD A;  2OU2 A;  3EXN A;  4FD5 A;  3TO9 A;  3S9L A;  2ZED A;  4JYW A;  2RFH A;  3IWW A;  1Y7R A;  4MCP A;  2PJC A;  2C6C A;  2PJ2 A;  1BPM A;  2HUZ A;  2ZEO A;  3KI9 A;  4IK2 A;  4C68 A;  1CBX A;  4MCS A;  4KOY A;  1S60 A;  3SJE A;  3SJX A;  1VKC A;  2PIY A;  2PR8 A;  3R95 A;  3ZJ0 A;  2ZEE A;  4ZI6 A;  2YNC A;  3MGD A;  4NEX A;  4NF1 A;  1IYK A;  3I1U A;  4MHD A;  5DS0 A;  3TO6 A;  2NYQ A;  2V77 A;  2JDD A;  2PJA A;  4UCP A;  4U9Z A;  3R9F A;  4CYN A;  1TF9 A;  3K9T A;  4KSF A;  1K4J A;  4UFX A;  5CPA A;  2GLJ A;  1MJ9 A;  2Q4V A;  3B3T A;  1Y0Y A;  2XEJ A;  3I9S A;  2J8M A;  1R3N A;  1F57 A;  5IV0 A;  3EFA A;  3SI1 A;  3GLJ A;  4NGP A;  3SXN A;  4K3N A;  4MFP A;  4A33 A;  4R9M A;  2PJB A;  3PZJ A;  4MJ8 A;  5ISV A;  2FE7 A;  3GUX A;  4P44 A;  2AFU A;  2QEC A;  3KHZ A;  3I3G A;  4UEZ A;  4CYQ A;  3B35 A;  2ODF A;  2PE3 A;  4EME A;  3D7D A;  4A37 A;  3FBU A;  3H5Z A;  2C1C A;  5JQ4 A;  2OB0 A;  2V8G A;  4KUB A;  4GS4 A;  3SXO A;  3ISZ A;  1FNO A;  7CPA A;  1B87 A;  1M44 A;  4FD6 A;  2O4H A;  3H8F A;  1EE3 P;  3KL9 A;  1DTD A;  1PUA A;  2PR1 A;  4AB7 A;  2EBJ A;  4F8Z A;  2ZPA A;  3EY5 A;  4ZYQ A;  5LYD A;  3IU2 A;  3B7I A;  1XMT A;  4OLL A;  4U5Y A;  4FUU A;  5D8N A;  2GU2 A;  2IQ6 A;  3B2Y A;  4PXC A;  3PGP A;  4M6H A;  5C88 A;  1F2P A;  4OP4 A;  3WC6 A;  4Y49 C;  3KGQ A;  2DF5 A;  3IEH A;  4H6U A;  4JD6 A;  1BO4 A;  2EUI A;  4OC5 A;  4BD9 A;  1YLE A;  3PBB A;  4PSW A;  1ARL A;  1SQH A;  2B5G A;  3D8P A;  4X5K A;  3W6X A;  2POK A;  4IF5 A;  4F9V A;  1IY7 A;  4R7M A;  2V8D A;  3SHP A;  3V38 A;  3LD2 A;  4MY3 A;  4MHZ A;  4QB9 A;  1XFO A;  5A27 A;  1X10 A;  4AVA A;  4OID A;  1BOB A;  4UEF A;  3QB8 A;  4JZ0 A;  1XE4 A;  2GE3 A;  2ATR A;  3RZA A;  2QIR A;  3WAB A;  2G3A A;  4MFZ A;  3VAT A;  3UY5 A;  1HDQ A;  1HEE A;  2QML A;  1Y9K A;  2H5M A;  2Q7B A;  3MN8 A;  1Y7E A;  4MCQ A;  4ZGY B;  4Y49 B;  2JEV A;  2HC9 A;  2OZG A;  2REE A;  4NGT A;  1KUV A;  1ON0 A;  1LFW A;  3H8G A;  2CTC A;  1ZO0 A;  2BOA A;  2ZEL A;  1VHS A;  1CP7 A;  3FXT A;  4NSQ A;  4UCN A;  4PK3 A;  3CXS A;  4B5P B;  4B14 A;  1R57 A;  4FBE A;  2ZW5 A;  4LX9 A;  2FIA A;  1XEB A;  1ELL P;  3IC1 A;  2XEF A;  1JWQ A;  3OWC A;  3V7Z A;  5AG5 A;  4C2X A;  1XOV A;  3FIX A;  2HB6 A;  2NMT A;  2YGW A;  2PJ0 A;  2GIV A;  2CNM A;  3S6F A;  3TOA A;  1BPN A;  1XJO A;  3EO4 A;  4F0X A;  2DPS A;  3WT4 A;  1XF8 A;  3D3S A;  4P4E A;  1R43 A;  1Z4E A;  5BWA B;  3S9M A;  4ZY0 A;  4LQG A;  4UA3 A;  1MJB A;  3B3C A;  3F5B A;  4R76 A;  2PQ8 A;  4WWV A;  4M6I A;  2P6E A;  2AFW A;  4NFR A;  1Q7L A;  1Z8T A;  1LOK A;  1M4D A;  3D68 A;  3H8E A;  3NH8 A;  1LCP A;  1IOF A;  5DWN A;  3P2F A;  5LRG A;  2ZOF A;  4KZT A;  4R87 A;  2Z3L A;  3BHX A;  2WUU A;  3CXP A;  2ZEF A;  4I49 A;  1YLO A;  3FH4 A;  4MRI A;  5HMN A;  3D2M A;  4IHM A;  3KHX A;  4PQA A;  1GYT A;  1L0C A;  3D7G A;  4M6G A;  2V8H A;  1FY7 A;  1CG2 A;  4OC0 A;  2PJ6 A;  3FRM A;  3F0A A;  2GRE A;  2EK9 A;  2REF A;  2DEA A;  3NH4 A;  4E2A A;  5IB9 A;  3TFY A;  2OOT A;  2ZW7 A;  4FD7 A;  2GAN A;  3FMC A;  4UWJ A;  3PBE A;  2Z3M A;  2Y0M A;  3K2K A;  3IWG A;  1LAP A;  3ISX A;  5ELY A;  4NGQ A;  5THW A;  2F8H A;  1BAV A;  4A31 A;  4KVX A;  5F09 A;  1TKH A;  2B58 A;  4BMH A;  2Q4Z A;  5G20 A;  2I00 A;  2BO9 A;  2G3T A;  5AG4 A;  2RB7 A;  5JPH A;  2WPX A;  3BI1 A;  4RS2 A;  5HXD A;  4CAF A;  2IJZ A;  3KAS A;  4FWU A;  1ZG8 A;  4MFJ A;  2PCU A;  4ONW A;  2Q04 A;  2CNT A;  5HVF A;  4KOV A;  4R8F A;  5A28 A;  3HUV A;  3PB8 X;  5AGE A;  3CZX A;  3C26 A;  2OZU A;  5GCN A;  3R9E A;  4KVO E;  4YWY A;  1LAN A;  1M1D A;  3SI0 A;  4BIN A;  5JM6 A;  5LYL A;  3S6H A;  4HPS A;  5J8C A;  1QSM A;  3T90 A;  4F6A A;  1Z8X A;  4NGN A;  4CYO A;  5JH9 A;  2HQY A;  4WJB A;  4QUS A;  4QVT A;  2I3C A;  2Z10 A;  4TNU A;  2B5G B;  2NSM A;  1OZP A;  1F2O A;  3BI0 A;  3TOB A;  4CS0 B;  5EMI A;  3GYA A;  4MHP A;  4CGP A;  4P4B A;  5I4M A;  1I12 A;  1TKF A;  2FT0 A;  1YSJ A;  1ZG9 A;  2PJ8 A;  3GB0 A;  4UCM A;  4CAW A;  5HVH A;  4XPL A;  2Z0Z A;  2WZN A;  4CRZ B;  2A4N A;  3NA6 A;  3NE7 A;  4Q36 A;  2P6F A;  4C2Z A;  1BLL E;  1Z2L A;  2ZEG A;  4UFW A;  1I1D A;  4YU9 A;  4P6Y A;  5KTC A;  1QSR A;  3B3S A;  3DGV A;  1V0C A;  1Z9U A;  4R3L A;  3P2H A;  3BJ7 A;  4AXV A;  1JQG A;  5KTA A;  5HVG A;  2Z3K A;  2QYV A;  4OKO A;  1NSL A;  4L89 A;  4M3S A;  5LYF A;  1LRZ A;  2IMO A;  2PJ3 A;  3KQX A;  4XNH C;  4NGS A;  3DDD A;  4DUK A;  3NFZ A;  3VWE A;  4ZY1 A;  2VXK A;  4KLV A;  3DLJ A;  3FB3 A;  4NGR A;  4ZY2 A;  2VQY A;  1QSN A;  2R7H A;  3R9G A;  2FXF A;  4PXE A;  2O53 A;  2VZZ A;  2B4D B;  1TKJ A;  1TF8 A;  4MMO A;  2PRQ A;  4MY0 A;  3B3V A;  3N5F A;  2PVW A;  4OAD A;  3W6S A;  3V8I A;  3SI2 A;  3WC5 A;  1Q2D A;  2EVN A;  2ZOG A;  4W9Y A;  4ZX8 A;  2CIJ A;  3GY9 A;  3K9U A;  1XRY A;  4UIB A;  4MFQ A;  3T9Y A;  2ANP A;  1PYT B;  4P4I A;  4DJL A;  1VHO A;  3N7Z A;  4P45 A;  1IYL A;  3JUW A;  2O28 A;  3JTK A;  3CPX A;  2CNS A;  3FX6 A;  1CPX A;  2PJ1 A;  2ZEM A;  3TTH A;  4B5O A;  1Z8L A;  1Z5R A;  2JDC A;  2J9A A;  2PSW A;  5H86 A;  2FVG A;  4NJR A;  2VL1 A;  2ZEP A;  4PK2 A;  2Q44 A;  2YNC C;  4M85 A;  3NE8 A;  1KUX A;  3D67 A;  3G3S A;  4TWE A;  4NGM A;  3VAR A;  3HLP A;  2Q4Y A;  3QAY A;  2FSR A;  4H2K A;  2ABZ A;  4UEE A;  1YVO A;  4ONU A;  4HNX B;  3BLN A;  1IGB A;  8CPA A;  3D7F A;  4CGL A;  1Y9W A;  2AE6 A;  4IUS A;  5LRJ A;  4KVM E;  4C7I A;  2K5T A;  4GXH A;  1IU8 A;  2AJ6 A;  3DR6 A;  2CTB A;  1QQ9 A;  4O23 A;  3TC8 A;  4AG7 A;  2XEI A;  4P4D A;  4PPZ A;  2F5I A;  4JXR A;  2ZEH A;  4MXU A;  2PJ4 A;  4UIA A;  4KOT A;  4P4F A;  2J8N A;  3JVN A;  1MJA A;  2PDO A;  1LAM A;  5G22 A;  1M4I A;  2OH1 A;  2BCO A;  4F9U A;  1ZLH A;  3EC4 A;  4FAI A;  3RNZ A;  3FED A;  3MRU A;  1YW6 A;  1P0H A;  2FCK A;  3IWE A;  2C27 A;  3BXM A;  5F47 A;  2F7V A;  5G1Z A;  2OZH A;  2GLF A;  1M4G A;  4MI4 A;  4DYO A;  3TO7 A;  2ZW6 A;  1CJW A;  2KCW A;  2QJ8 A;  3KR5 A;  3RAM A;  1XBU A;  1KWM A;  3CXQ A;  4A94 A;  3DSB A;  4P4J A;  2R1I A;  1Y0R A;  2DXQ A;  4H6Z A;  2VEZ A;  2AFZ A;  2X7B A;  4R57 A;  4IAV A;  3PB4 X;  1Q2C A;  2Z11 A;  3DR8 A;  3FF3 A;  4CAV A;  5KTD A;  3DNS A;  4B10 A;  1NMT A;  1XIX A;  3W91 A;  3PFE A;  2AFS A;  1PU9 A;  4X2T A;  4XPK A;  2AFX A;  5JGF A;  3RO0 A;  2B4D A;  2BSW A;  4PSX A;  2D4O A;  1NE9 A;  2HV2 A;  3G8W A;  1XMB A;  4GM5 A;  4R3K A;  4UFV A;  5FVJ A;  5K8P A;  2EK8 A;  4CRY B;  2VBQ A;  5CBM A;  2B4B A;  1M4L A;  4AG9 A;  4CGM A;  3CPA A;  2ARH A;  2Q51 A;  2Q7S A;  5LYI A;  1RO5 A;  4OIW A;  4NCZ A;  3WC7 A;  4RUH A;  1YW4 A;  1ARM A;  4HNY B;  3TX8 A;  2WPW A;  1KZF A;  3KR4 A;  3GKR A;  4YGO A;  2YNE A;  4CAX A;  3R1K A;  4QBJ A;  1RXT A;  4XPD B;  2PJ9 A;  2CY2 A;  3IGR A;  2Z3O A;  1N71 A;  2AFM A;  2Q0Y A;  3FNC A;  4PV6 A;  5K8M A;  3T8W A;  3B3W A;  1U6M A;  2GFQ A;  4KOX A;  2YND A;  3F8K A;  2PC1 A;  3SJG A;  3S9N A;  4B12 A;  3IO1 A;  3FEC A;  4ORF A;  5H84 A;  4MHY A;  4EWT A;  2G0B A;  1Q2Y A;  1YGH A;  4KSI A;  4A39 A;  5IB0 A;  4KLW A;  5AG7 A;  4HNW B;  5I0C A;  5F48 A;  1PCA A;  2ZW4 A;  1UFH A;  3JRU A;  4XPD C;  3S6G A;  3ZZI A;  2D4P A;  3PRT A;  1TIQ A;  2WYR A;  1HDU A;  5LRK A;  3TE4 A;  3WR7 A;  2B3V A;  2PJ5 A;  3KQZ A;  5AG6 A;  5G21 A;  4ZBG A;  2C6G A;  2I79 A;  1NSA A;  4E0A A;  1TXR A;  3R96 A;  2ZXV A;  5K8O A;  4NJQ A;  4Z65 A;  1YQE A;  2P0W A;  4A32 A;  3D4U A;  4B6Z A;  2JBK A;  3D2P A;  5EBV A;  3IJ3 A;  1YRE A;  1S7N A;  4AVB A;  3IU1 A;  2JBJ A;  3SJF A;  4B13 A;  3S6K A;  1Z8W A;  4CYP A;  3PB9 X;  5EC4 A;  4J3G A;  1AYE A;  2DPT A;  2BL1 A;  3FEE A;  1YVK A;  2CF4 A;  4YFJ A;  3FJU A;  4ZX9 A;  5J1Q A;  2BEI A;  4A95 A;  4FD4 A;  3CDX A;  1I21 A;  4R6T A;  1J4J A;  1CPS A;  3PEI A;  3B8G A;  4DNC A;  4L8A A;  4CPA A;  4UWI A;  4MBU A;  3L2N A;  2PRB A;  5D29 A;  2B3U A;  5IX3 A;  5J8F A;  1IB1 E;  1YR0 A;  2PIZ A;  4KSA A;  2V8V A;  4OC4 A;  1YX0 A;  4A38 A;  3QNV A;  1S7F A;  3H4Q A;  1WK4 A;  2R8V A;  4OC3 A;  1B6B A;  1FT7 A;  4BBH A;  1S7K A;  1QST A;  4YRH A;  2J8R A;  2EO8 A;  3E0K A;  5DWM A;  2VZY A;  3D7H A;  3LOD A;  3QAH A;  3TCV A;  2FL4 A;  4UBR A;  4QC6 A;  4AVC A;  2FS5 A;  4JLY A;  4KOS A;  3IIB A;  3CT9 A;  4A2Z A;  4CAE A;  5K8N A;  2WSA A;  4G1P A;  3VWD A;  3D66 A;  4MHN A;  1S7L A;  3PB7 X;  1QSO A;  4E8O A;  5HH1 A;  4K30 A;  4OC1 A;  4EVY A;  4Q7A A;  2IL4 A;  4OAE A;  1VIX A;  2BUE A;  4OC2 A;  2Z3P A;  4B11 A;  1YME A;  4C2Y A;  4RN7 A;  1S5K A;  4B5P A;  1VGY A;  5F46 A;  4KUA A;  2RC4 A;  2JLM A;  3LWU A;  4MFK A;  4Q38 A;  4JXQ A;  4KOR A;  1RTQ A;  4CGN A;  1ZG7 A;  1H8L A;  2Z3N A;  4F0Y A;  1IIC A;  1AUG A;  3LMS A;  4KOU A;  6CPA A;  2VI7 A;  2JEW A;  5E96 A;  4UF4 A;  1X12 A;  2G9D A;  3FYN A;  4HKF A;  4MCR A;  1ELM P;  2Q43 A;  1CP6 A;  4NXY A;  4X3R A;  4P10 A;  3RBU A;  3FVL A;  2C6P A;  2OR4 A;  2QVP A;  1DE4 C;  1GHE A;  4MFL A;  2AFO A;  2PJ7 A;  4RI1 A;  3KKW A;  3RYO A;  1S3Z A;  4KS9 A;  1OBR A;  1CM0 A;  1UWY A;  3GIU A;  5C82 A;  4XNH B; 
#chains in the Genus database with same CATH homology
 1MK4 A;  1KUY A;  2P6G A;  5F49 A;  2FIW A;  4JWP A;  4JJX A;  4A30 A;  1P4N A;  5CNP A;  2CXA A;  4H89 A;  4C7H A;  1IID A;  3TT2 A;  4KOW A;  3BJ8 A;  4LUA A;  3A9L A;  4U9Y A;  4II9 A;  2R98 A;  1YK3 A;  1Z4R A;  1WWZ A;  3PP9 A;  4CGO A;  2OU2 A;  3EXN A;  4FD5 A;  3TO9 A;  1Y7R A;  2HUZ A;  4C68 A;  4KOY A;  1S60 A;  1VKC A;  2PR8 A;  3R95 A;  3ZJ0 A;  2YNC A;  3MGD A;  4NEX A;  4NF1 A;  1IYK A;  4MHD A;  3TO6 A;  4UCP A;  2JDD A;  4CYN A;  4U9Z A;  3R9F A;  4KSF A;  1K4J A;  4UFX A;  3I9S A;  1MJ9 A;  2Q4V A;  4CYP A;  2J8M A;  5IV0 A;  3EFA A;  3SXN A;  4MFP A;  4A33 A;  4R9M A;  3PZJ A;  4MJ8 A;  5ISV A;  2FE7 A;  2QEC A;  3I3G A;  4CYQ A;  3FBU A;  3H5Z A;  5JQ4 A;  2OB0 A;  4KUB A;  3SXO A;  4GS4 A;  1B87 A;  1M44 A;  4FD6 A;  4AB7 A;  1PUA A;  2PR1 A;  2ZPA A;  3EY5 A;  3IU2 A;  4OLL A;  1XMT A;  4U5Y A;  3PGP A;  5C88 A;  4Y49 C;  4JD6 A;  4H6U A;  1BO4 A;  2EUI A;  1YLE A;  4PSW A;  1SQH A;  2B5G A;  3D8P A;  4X5K A;  3W6X A;  4IF5 A;  3SHP A;  3LD2 A;  4MY3 A;  4QB9 A;  4AVA A;  1BOB A;  3QB8 A;  1XE4 A;  2GE3 A;  2ATR A;  2QIR A;  2G3A A;  4MFZ A;  3UY5 A;  2QML A;  1Y9K A;  2H5M A;  2Q7B A;  4ZGY B;  4Y49 B;  2JEV A;  2OZG A;  2REE A;  1KUV A;  1ON0 A;  1ZO0 A;  4NSQ A;  1VHS A;  3FXT A;  4UCN A;  4PK3 A;  3CXS A;  4B5P B;  4B14 A;  1R57 A;  2ZW5 A;  4LX9 A;  2FIA A;  1XEB A;  3OWC A;  4C2X A;  5AG5 A;  3FIX A;  2NMT A;  2YGW A;  2GIV A;  2CNM A;  3S6F A;  3TOA A;  4F0X A;  3EO4 A;  2DPS A;  1XF8 A;  3D3S A;  1Z4E A;  5BWA B;  4UA3 A;  1MJB A;  3F5B A;  2PQ8 A;  2P6E A;  1M4D A;  5DWN A;  3P2F A;  4KZT A;  4R87 A;  2Z3L A;  2WUU A;  3CXP A;  4I49 A;  5HMN A;  3D2M A;  1L0C A;  1FY7 A;  3FRM A;  3F0A A;  3TFY A;  2REF A;  4E2A A;  2ZW7 A;  4FD7 A;  2GAN A;  4UWJ A;  2Z3M A;  2Y0M A;  3IWG A;  4A31 A;  4KVX A;  2B58 A;  4BMH A;  5G20 A;  2I00 A;  2G3T A;  5AG4 A;  5JPH A;  2WPX A;  4RS2 A;  4CAF A;  4MFJ A;  2Q04 A;  2CNT A;  4KOV A;  5A28 A;  5AGE A;  3C26 A;  2OZU A;  5GCN A;  3R9E A;  4KVO E;  1M1D A;  3S6H A;  5J8C A;  1QSM A;  3T90 A;  4F6A A;  4CYO A;  2HQY A;  4QUS A;  4QVT A;  2Z10 A;  2B5G B;  1OZP A;  3TOB A;  4CS0 B;  3GYA A;  4CGP A;  1I12 A;  2FT0 A;  4UCM A;  4CAW A;  4XPL A;  2Z0Z A;  4CRZ B;  2A4N A;  4Q36 A;  3NE7 A;  4C2Z A;  2P6F A;  4UFW A;  1I1D A;  5KTC A;  1QSR A;  1V0C A;  1Z9U A;  4R3L A;  3P2H A;  3BJ7 A;  5KTA A;  2Z3K A;  1NSL A;  4L89 A;  4M3S A;  1LRZ A;  4XNH C;  3DDD A;  3VWE A;  2VXK A;  4KLV A;  3FB3 A;  2VQY A;  1QSN A;  2R7H A;  3R9G A;  2FXF A;  2VZZ A;  2B4D B;  4MY0 A;  4OAD A;  3W6S A;  3V8I A;  1Q2D A;  2EVN A;  3GY9 A;  3K9U A;  4MFQ A;  3T9Y A;  3N7Z A;  1IYL A;  3JUW A;  2O28 A;  3JTK A;  2CNS A;  3TTH A;  4B5O A;  2JDC A;  2PSW A;  5H86 A;  4PK2 A;  2Q44 A;  2YNC C;  4M85 A;  1KUX A;  3G3S A;  2Q4Y A;  2FSR A;  1YVO A;  4ONU A;  4HNX B;  3BLN A;  4CGL A;  1Y9W A;  2AE6 A;  4IUS A;  4KVM E;  4C7I A;  2K5T A;  2AJ6 A;  3DR6 A;  4AG7 A;  2F5I A;  4JXR A;  4KOT A;  2J8N A;  3JVN A;  1MJA A;  2PDO A;  5G22 A;  1M4I A;  2OH1 A;  3EC4 A;  2FCK A;  1P0H A;  5F47 A;  3IWE A;  2C27 A;  5G1Z A;  2OZH A;  1M4G A;  4MI4 A;  3TO7 A;  2ZW6 A;  1CJW A;  2KCW A;  3CXQ A;  3DSB A;  2R1I A;  4H6Z A;  2DXQ A;  2VEZ A;  2X7B A;  4R57 A;  1Q2C A;  2Z11 A;  3DR8 A;  4CAV A;  5KTD A;  3DNS A;  4B10 A;  1NMT A;  1XIX A;  3W91 A;  1PU9 A;  4XPK A;  2B4D A;  2BSW A;  4PSX A;  2D4O A;  1NE9 A;  2HV2 A;  3G8W A;  4UFV A;  4R3K A;  5FVJ A;  4CRY B;  2VBQ A;  2B4B A;  4AG9 A;  4CGM A;  2ARH A;  1RO5 A;  4NCZ A;  4HNY B;  2WPW A;  1KZF A;  3GKR A;  4YGO A;  2YNE A;  4CAX A;  3R1K A;  4QBJ A;  1RXT A;  4XPD B;  2CY2 A;  3IGR A;  2Z3O A;  1N71 A;  3FNC A;  2Q0Y A;  4PV6 A;  1U6M A;  4KOX A;  2YND A;  3F8K A;  2PC1 A;  4B12 A;  4ORF A;  5H84 A;  2G0B A;  1Q2Y A;  1YGH A;  5IB0 A;  4KLW A;  5AG7 A;  4HNW B;  5I0C A;  5F48 A;  2ZW4 A;  1UFH A;  4XPD C;  3S6G A;  3ZZI A;  2D4P A;  1TIQ A;  3TE4 A;  3WR7 A;  2B3V A;  5AG6 A;  5G21 A;  4ZBG A;  2I79 A;  4E0A A;  3R96 A;  2ZXV A;  2P0W A;  4A32 A;  3D2P A;  5EBV A;  4AVB A;  1YRE A;  1S7N A;  3IU1 A;  4B13 A;  3S6K A;  5EC4 A;  4J3G A;  2DPT A;  2BL1 A;  1YVK A;  2BEI A;  4A95 A;  4FD4 A;  1I21 A;  1J4J A;  3B8G A;  4DNC A;  4L8A A;  4UWI A;  4MBU A;  2PRB A;  2B3U A;  5IX3 A;  5J8F A;  1IB1 E;  1YR0 A;  4KSA A;  1YX0 A;  1S7F A;  3H4Q A;  1WK4 A;  2R8V A;  4BBH A;  1B6B A;  1S7K A;  1QST A;  4YRH A;  2J8R A;  3E0K A;  5DWM A;  2VZY A;  3LOD A;  3QAH A;  3TCV A;  2FL4 A;  4UBR A;  4QC6 A;  4AVC A;  2FS5 A;  4JLY A;  4KOS A;  4A2Z A;  4CAE A;  2WSA A;  3VWD A;  1S7L A;  1QSO A;  4E8O A;  5HH1 A;  4K30 A;  4EVY A;  4C2Y A;  2IL4 A;  4OAE A;  2BUE A;  4B11 A;  4YFJ A;  2Z3P A;  5A27 A;  5F46 A;  4B5P A;  1S5K A;  4KUA A;  2RC4 A;  2JLM A;  4MFK A;  4Q38 A;  4JXQ A;  4KOR A;  4CGN A;  2Z3N A;  4F0Y A;  1IIC A;  4KOU A;  2VI7 A;  5E96 A;  3FYN A;  4HKF A;  4NXY A;  1GHE A;  4MFL A;  4RI1 A;  3KKW A;  3RYO A;  1S3Z A;  4KS9 A;  1CM0 A;  5C82 A;  4XNH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...