4ONUA

Camp-binding acyltransferase from mycobacterium smegmatis, e234a mutant
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
332
structure length
314
Chain Sequence
AELTEVRAADLAALEFFTGCRPSALEPLATQLRPLKAEPGQVLIRQGDPALTFMLIESGRVQVSHAVADGPPIVLDLIIGEIALLRDAPRTATVVAAEPVIGWVGDRDAFDTILHLPGMFDRLVRIARQRLAAFITPIPVQVRTGEWFYLRPVLPGDVERTLYRRFQSVRKPTRALLEYLFEVDYADHFVWVMTEGALGPVIADARFVREGHNATMAAVAFTVGDDYQGRGIGSFLMGALIVSANYVGVQRFNARVLTDNMAMRKIMDRLGAVWVREVVMTEVDVPPVDTVPFEPELIDQIRDATRKVIRAVSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Acetyltransferase Pat
publication title Allostery and Conformational Dynamics in cAMP-binding Acyltransferases.
pubmed doi rcsb
source organism Mycobacterium smegmatis
total genus 93
structure length 314
sequence length 332
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4onuA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4onuA02
5E1RA 3UKNA 1M4GA 4HVOA 1SEFA 3BB6A 2GC3A 3ZDSA 2B5GA 2ET1A 1FXZA 3ES4A 2XLFA 5C8WA 3I9SA 2FQPA 3R9EA 1WLTA 3I7DA 2V09A 2PRBA 4KOXA 1OI6A 1SFNA 4IEYA 4AVBA 4PJYA 5FPZA 4F7ZA 5I0SA 2BL1A 2BEOA 4QM8A 1ZZCA 3FFQA 3H3ZA 5FQ0A 1Y3TA 1N71A 2PHDA 4KOUA 3H4QA 3FE5A 2B4DB 2BYVE 1KUYA 4KOVA 2FIAA 2UY8A 2B4DA 4HVRA 4MHDA 3HT1A 1CAWB 2B3UA 4NCZA 1CX4A 3DN7A 1IICA 1UW8A 2GZWA 2XL7A 3H9AA 1L3JA 4XFBA 4OFGA 2ATRA 3G7DA 2H6BA 4JD6A 4LUAA 4IEXA 1YGHA 1I6XA 2FL4A 3PP9A 4R87A 3DSBA 4BHPA 5J8CA 5FVJA 2OA2A 2QIRA 2XL9A 4R9MA 4IEQA 5EC4A 4CAXA 4E2GA 2FMYA 3H8UA 4YYOA 2Z10A 4E0AA 3KGZA 4II9A 1LKNA 1SQ4A 1O4TA 2GC0A 2VPVA 1RC6A 1XMTA 4HNXB 4JJXA 3D2MA 3SCGA 2PR8A 4IEVA 1OZPA 3P2FA 4XF1A 1VR3A 3DL3A 4AG7A 4IESA 4LULA 3I59A 3JUWA 5LRSA 4J1XA 4BMHA 4F0YA 5I0RA 4Q0VA 4IERA 2B5HA 4XFHA 2AJ6A 3SXOA 1GHEA 2Q04A 4QXKA 4K30A 3SXNA 4Q0QA 1IB1E 2X7BA 1BO4A 5I8SA 5C6CA 5KHKA 2QNKA 3P2HA 3PZJA 3QB8A 1LB2A 3E5UA 1Q43A 3UKTA 4XEZA 1L0CA 1IPJA 2AE6A 2ARHA 1Q2YA 2IC1A 2XKOA 2BUEA 3FNCA 1DZTA 1J4JA 3GKRA 2PAKA 3DNSA 3KGLA 4NF1A 1V70A 3EBRA 4XF3A 5FLJA 4Y49B 4Y49C 1I21A 2OZGA 3H1WA 3I54A 3IDBB 4UBRA 4AQ2A 3RYRA 4B5PB 5I8YA 2KCWA 4MH0E 4KVME 4H89A 3HQXA 5F46A 3R95A 2FSRA 1GQHA 4IEPA 1IYKA 4KWLA 2RC4A 1CAXA 3H1YA 5JSRA 4XFCA 1NE9A 1Z9UA 2HV2A 4PSXA 5IX3A 5JQ4A 3LOIA 4JTNA 1QXJA 5JPHA 2C0ZA 4KUBA 1NSLA 4HN1A 1XE7A 4KWJA 4HN0A 2PYTA 5I93A 3LZZA 5JR7B 5JCTA 2GE3A 2R8VA 1RXTA 1YLLA 4BYYA 2UYAA 4HKFA 4M3SA 4UWIA 2Q4VA 3SHPA 3BCWA 4IEWA 3N4MA 4HBNA 1X7NA 2B8MA 2GU9A 5BPXA 1Q2CA 4KLVA 4MBUA 5EBVA 3CF6E 4KORA 1CAVB 1YFXA 5F1RA 1ZZ8A 4KWKA 1MJ9A 5HH1A 3E5QA 1RTVA 2EAAA 1ZRFA 4KZTA 4MGIE 5KHHA 1UIJA 2K5TA 4D7TA 2PAMA 1PUAA 2ATFA 2CY2A 2QJVA 2D5FA 2HUZA 4XPLA 5J8FA 4QB9A 1OD5A 3USSA 4CAWA 5I0TA 3CJXA 4MX3A 3WW4A 1S3ZA 4KU7A 4PIZA 3U0ZA 1U12A 2WPWA 3D2PA 4KOSA 1XRUA 4RS2A 4B5OA 5CNPA 3LA2A 2VEZA 3SCHA 3S7IA 4IF5A 4PIYA 1M4DA 3FIXA 4GS4A 3W6SA 2Q1ZB 2Z0ZA 3R6SA 3R9FA 4R3KA 2Q4YA 4XNHC 2Q0YA 3ZZIA 2ET7A 3TNPB 4Q0PA 1O3RA 2C27A 4MJ8A 4FD7A 2JEVA 5D1IA 2FE7A 1Y7RA 4QGNA 4ONUA 5FCCA 2BNOA 3MYXA 4NVPA 1ZREA 1J59A 1XIXA 3EXNA 2PDOA 3GYDA 3S0MA 3LODA 2BNNA 4U9YA 1UPIA 2I45A 1OFNA 3VWDA 3ST7A 4HVQA 1WK4A 2DCTA 5CADA 4JXRA 1EYBA 2HKXA 4YNIA 2BNMA 1S5KA 3D3SA 3ELNA 1WGPA 4LA2A 4KLWA 5CVRA 4JTOA 3V8IA 1X8EA 4META 5F48A 2XLAA 4IEOA 2H5MA 2D4PA 4J1WA 4CYDA 1XEBA 4XPKA 1UD1A 4R8HA 4MI4A 4OAEA 1NE6A 3K9UA 4L89A 1X82A 2REEA 2ZPAA 3O14A 4J3GA 1CAWA 1YR0A 3KSCA 3JVNA 3B8GA 2I79A 4IUSA 4L11A 2VQAA 4UWJA 3TCVA 3KKWA 1Q3EA 2CAUA 3E6DA 4O9EA 3F8KA 2G3AA 3TFYA 1MK4A 2CV6A 1LRHA 3C3VA 3ACLA 3B02A 2ZCWA 4LEJA 4E2SA 5ISVA 1XE4A 5F49A 4F8AA 2IXLA 4FT8A 3PLQA 2OPKA 2QCSB 4AVAA 4DINB 1QXRA 2PQ8A 4AG9A 2CNTA 5FPXA 2ZXVA 4UBGA 4PK2A 5FDBA 4M85A 4H6ZA 4I02A 2CNSA 5IV0A 4YRDA 4E2AA 3PNAA 2ZW6A 3TO6A 1S7NA 5HMNA 5AVPA 1U6MA 5BV6A 5F47A 1QSTA 4CAVA 3KCCA 4EWAA 2PAEA 3L2HA 3MZHA 4I3PA 4I49A 1M44A 2OZJA 1V0CA 3DV8A 3TT2A 1O5UA 3BJ8A 4QGMA 3FJSA 3BJ7A 4XF0A 3CO2A 3FWEA 1M4IA 2JLMA 3ZJ0A 4HSLA 4BH9A 1J58A 1VJ2A 2IXCA 1NE4A 4LTAA 1R57A 2EA7A 3GBFA 4EWDA 4UA3A 1J3QA 5K8SA 2F4PA 1QY4A 1YFUA 4QUSA 1JUHA 1NXMA 1UCXA 5DWMA 3S6KA 1UFHA 3D82A 5KTAA 5I91A 4WZCA 1Q5OA 3EO6A 3U11A 2ZW5A 4I2OA 2CNMA 4DNCA 3EY5A 4B5PA 2E9QA 1J1LA 4JXQA 5J48A 2O1QA 1Y9KA 3QAHA 4YARA 2PC1A 3JZVA 3FXTA 3E6BA 2IXHA 3MGDA 4KOWA 1QSOA 1O3QA 3OF1A 2HJIA 2PA7A 4I0AA 4KL1A 4QGLA 1Q2DA 2K9ZA 5J7MA 3FBUA 5KTCA 2PQQA 2FXFA 1EP0A 2G0BA 2OYZA 2OU2A 4KU8A 3UKVA 5KHJA 4UBHA 1O3SA 1XF8A 5KBFA 2PSWA 4IEZA 3IIAA 3F5BA 4U9ZA 3R9GA 3WR7A 1PU9A 3OGJA 4L2NA 3IDCB 5LEKA 4XFIA 3FX3A 3MDPA 4ORFA 5BY5A 4N9IA 3EQEA 4QVTA 3H1MA 5I0CA 2UYBA 5LEJA 3CLPA 1G6NA 3H7YA 4F6AA 3M70A 4KOTA 2CAVA 1CAVA 4X6RB 1TQ5A 1YFYA 1S7KA 5BXXA 2P6GA 1YVOA 4LLOA 2R98A 4ZU5A 2BEIA 2BSWA 1O5LA 3NJZA 4OADA 1ZRCA 3W91A 4AVCA 1CM0A 1FY7A 4PK3A 2J8RA 3G8WA 4IEUA 5J3UA 1QSMA 3IWGA 2XHKA 2B58A 3CL1A 3FYNA 1CJWA 2QMLA 5IB0A 4EROA 4JWPA 3QACA 2Y0MA 4Z07A 3WW1A 4H6UA 3LA7A 2VZYA 1O7FA 1I12A 1H1MA 3ROUA 3BU7A 5BUVA 2G3TA 2QDRA 4OLLA 4ZU7A 3ES1A 1BOBA 3CEWA 3IBMA 1PMIA 1ZZ6A 4HSJA 2O8QA 2OZHA 4AQ6A 3UY5A 3NL1A 4XF4A 5KTDA 5LRRA 1B87A 3M3IA 1HW5A 3TO7A 4LA3A 5T3NA 4BIFA 1VKCA 3D8PA 1GQGA 3OD0A 2K0GA 1S7LA 4LUMA 2GIVA 4EWEA 3HIFA 2VZZA 2D40A 4L8AA 3KMHA 4FD5A 2Q44A 1PM7A 2OH1A 3VHRA 2WC2A 2WFPA 2IXJA 3S6FA 1S7FA 4B29A 1J3RA 1YVKA 1RUOA 3CXSA 4KUAA 2ETEA 4RD7A 4R57A 4MY0A 4QMAA 1WWZA 2ZW7A 1OMIA 1SQHA 1CAUB 4A2UA 4XF9A 1KUXA 1NZCA 1CAUA 3D0JA 4E8OA 2P6FA 4MV2A 2B5GB 3S6GA 2DXQA 2D93A 3LD2A 3OWCA 2IL4A 2R7HA 3PGPA 4I01A 2OB0A 2OZUA 3F0AA 4FD4A 3RYOA 1NMTA 2O28A 3I3GA 5EZWA 4X5KA 1ZZ7A 2Q0AA 1IPKA 1Z4EA 3CXQA 5FQ0B 4PV6A 3TO9A 2PFWA 2EVXA 3ETQA 4HMZA 4YSFA 2F5IA 1K4JA 4CRYB 4XFGA 3NSTA 3FHIB 3WW3A 3BLNA 3S7EA 5JAXA 4CRZB 3C26A 1QWRA 4K8FA 1B6BA 4EV0A 3EJKA 2D4OA 3NE7A 4XFFA 3IWZA 3CXPA 3E5XA 1WA4A 2PTMA 4MZUA 2B9UA 4LUKA 3RPQA 4FBFA 1J3PA 4WVZA 4JVAA 4H7LA 2KXLA 2PR1A 1RL3A 1DGRA 5DWNA 3BPZA 2H0VA 2UY9A 2XLGA 2FT0A 3EC4A 3LA3A 4QX5A 3RYPA 1EPZA 1ZZ9A 1O3TA 2Z2SB 1RUNA 1ZX5A 2OZ6A 3RZZA 2A4NA 4YRHA 3TE4A 2B4BA 4HNWB 4R3LA 3OTFA 5HI0A 2FCKA 4R52A 2XKPA 2D5HA 3I59B 1MJBA 2R1IA 2MPFA 2N7GA 4PSWA 3DR6A 5H86A 1P0HA 5H84A 4O9GA 5FLHA 1CGPA 2EVNA 3LAGA 1YHFA 2CGPA 2VQYA 2QVSB 1YWKA 4I09A 3E0KA 1ZRDA 3LWCA 3IGRA 2Q7BA 2BGCA 5GCNA 3GY9A 4LX9A 1TIQA 3DDDA 3FRMA 4PIXA 3E6CC 1M1DA 2REFA 2VBQA 4WBBA 1ZZBA 1VP6A 4AXOA 5JSOA 1QSRA 3FB3A 5C88A 1LR5A 1DGWA 4EVYA 4N9HA 4CS0B 2J8NA 4Q0UA 4D7SA 2VXKA 3U10A 1ZVFA 1ZRRA 4AB7A 4ZU4A 4UXAA 4XPDB 4MGZE 4MGYE 3N7ZA 2P17A 4XPDC 4Z82A 4HNYB 1P4NA 2FS5A 1FI2A 4RI1A 3SMHA 3T90A 3RDIA 2QECA 3EFAA 2I00A 3VWEA 3R1KA 1XE8A 4IETA 4FD6A 2Y0OA 2MHFA 3H50A 4FAGA 3PVBB 4KVXA 1QSNA 3TTHA 2ZW4A 1CAXB 4HLTA 2Q4SA 2Z69A 1Y9WA 1YLEA 3RNSA 3EO4A 1YX0A 5EFUA 4E2QA 1I1DA 1Z4RA 4YFJA 3E97A 3DKWA 2B3VA 2GC1A 4QBJA 2H6CA 1NYWA 1KZFA 1Y9QA 3FZ3A 2JDCA 3H3UA 4MY3A 2HQYA 3G3SA 1YFWA 2GH2A 4XETA 4KVOE 3NVCA 3GYAA 2IXIA 4JLYA 1ON0A 2PHLA 5KHGA 2GAUA 1YK3A 4HZFA 4Q0SA 4X6QB 4YGOA 3SCFA 2WPXA 3QOPA 2MNGA 3DR8A 4P9GA 2J8MA 1YUDA 3MPBA 4QM9A 4Q29A 4GULA 4KOYA 1YREA 1EY2A 2Q30A 3BALA 3OCPA 4MUVA 2GC2A 2IXKA 5JSPA 1RO5A 5FLIA 2JDDA 3HT2A 1S60A 2FIWA 1LRZA 2VI7A 1MJAA 4TLFA 3SXWA 5I0UA 1VHSA 3TOAA 2ZKLA 2P6EA 1UIKA 5KHIA 1IIDA 2NMTA 5E16A 1X8MA 4U5YA 5CU1A 1H1IA 5E96A 1I5ZA 5I8TA 4ZBGA 3S6HA 3W6XA 1KUVA 4I0BA 3NKTA 2XGXA 4FAHA 4NSQA 3H7JA 2GANA 1IYLA 1DZRA 3T9YA 3D0SA 3TNQA 1RGSA 2P0WA 3RYKA 4XFAA 4NXYA 1FT9A 2Z11A 4QC6A 4XNHB 5C82A 4MGKE 3SHRA 3TOBA 4JV4A 3WW2A 3R96A 2EUIA 2VECA 3EHKA 3NW4A 4NEXA 1ZNPA
chains in the Genus database with same CATH superfamily
3R05A 4TSVA 1FMD3 2PJ4A 3RFRA 1U5ZA 1H2KA 1OI6A 2XUEA 3KT1A 5FZCA 4QM8A 1PO22 5LATA 3NNJA 1HDUA 3W5NA 2NLRA 4OFGA 1HDQA 3G7DA 2WNVB 4JGYB 1ASJ3 1C8M2 3POYA 3FEDA 1UXXX 4NUBA 4BHPA 2OA2A 1UY4A 1SQ4A 4OC0A 3RMYA 3NJVA 3WABA 3ZMOA 1W6PA 1ND3B 3KWVA 4NRQA 5GLVA 4AK3A 4M4PA 1ZBA2 2X7BA 4CDWB 3VBRA 3IJ3A 1H8TA 3T30A 5C8CB 1NSAA 2ZS6B 3UKTA 1DZTA 4X8PA 4Y49B 1JHJA 1V0AA 2QVPA 4B5PB 4CGNA 1BLZA 5C70A 3TOJA 3U4XA 4IEPA 2C5DA 3DECA 1BMV1 5JOYA 4N8MA 3IWEA 1WWYA 4XCBA 3MFCA 2ADDA 2VNRA 2ZGRA 1O4YA 2VM9A 1FPN1 5F8PA 2Y6KA 3WP4A 4PDWA 3K9TA 2D6NA 3W59A 4XBNA 2AUYA 4LMFA 4YLZA 4R3KA 3WLUA 4LBOA 3ZX7A 3RO0A 4R76A 1RUE2 3ISZA 2WZ8A 3NV4A 3ZPYA 4BU2A 4LE3A 5DUUA 2XLAA 4IEOA 4AEDA 4M4RA 4LBMA 3PB7X 3LB9A 4YM0A 1OUXA 3BI0A 2PE3A 3SJGA 1MK4A 1GMMA 2ORZA 2IFWA 3C3VA 5LK7B 4BA6A 2X09A 4F8AA 1UX7A 2YBKA 1QOSA 5JWPA 2Q8OA 4JAAA 3OSDA 1AF9A 2ZGLA 3PNAA 1CPMA 1JWQA 1U6MA 2AFOA 1V6MA 2DDUA 5SV5A 1L7QA 2BOJA 3MI8A 4LTAA 4DRRA 1GICA 1YJKA 2HEVF 2R063 1J3QA 4MXWA 4UOJA 1ULGA 5DWMA 5HV0A 4M6GA 4NJQA 2ERFA 2QFEA 1YO8A 2AZ5A 4PHZA 1O8SA 3OF1A 4IV1A 1Q2DA 2K9ZA 2EXHA 4IEZA 3V0AB 1DBNA 4OC5A 3FX3A 5F5IA 1SHWB 1ARLA 4A6SA 4BDVB 1BYHA 4RQPB 1YVOA 4AFBA 5HCFA 4ZU5A 4QPGA 1ODMA 3C7HA 4LBQB 5IB0A 4XUOA 1YQ2A 1SDWA 1AL22 5KTDA 1H8VA 2YNCC 4FPJA 4RS5C 4K40A 3B7IA 2RJ2A 2W47A 5LYIA 3ZYJB 4R57A 2YNEA 2ORXA 3KR5A 1NZCA 1CAUA 3D0JA 2C1FA 1ULDA 3LPGA 4I01A 2ZEDA 2ZHLA 2BFUL 3I3GA 1DGRN 1JUIA 3NSTA 2HWF1 3BYWA 1N1SA 3IMMA 4DQAA 3RPQA 5FPAA 4K20A 2DPTA 1VBC3 1DQ2A 3Q8CA 3E1F1 4C2ZA 1AX2A 3AKRA 2RM21 2WYFA 1V9U3 1YQCA 3LDBA 4URTA 2FDJA 4R52A 1H2MA 3I59B 3MPPG 4DXSA 2CGPA 2VQYA 5BYNA 1ZRDA 2WNUB 1UYZA 4LX9A 1IS4A 1S0CA 3DDDA 1I3HA 4P9YA 4MGQA 4NRPA 3J7NA 4EVYA 3K75B 4CGPA 2VNGA 1FI2A 3NWKA 3SMHA 4LKDA 4CP0A 3VL8A 2ZABA 2QQNA 4WZFA 1PMJX 4P5YA 1H6YA 4ZYQA 4QBJA 3ZXDA 1KZFA 3CZUA 3B3CA 1DP0A 2IXIA 4IE0A 3ZFEA 2MNGA 4PLOA 4NGTA 4QDQA 1B35A 1H1IA 1MS1A 4LIVA 2V4AA 4S2DA 3B69A 3H7JA 2XEGA 4BOWA 4XFAA 4QC6A 2Z79A 1OF4A 4ET7A 4GWIA 4KOXA 2ZGQA 1NCRC 3ZYFA 4UFLA 2FZ1A 3JCIA 3RWNA 3U4SA 1CAWB 1W0OA 3DN7A 2PRQA 2CSGA 1RUC3 2ARCA 4Q1PA 1I6XA 3NE8A 1UQXA 2ZX0A 2VOXA 5FVJA 4E2GA 3H8UA 1OA4A 4QXHA 3KGZA 1YMEA 4JJXA 3IC1A 2C1CA 1W6QA 4XC9A 3PL0A 1GFF2 4XDOA 2AC1A 2BPA2 5I0RA 3JD71 3CJIC 4LBQD 1GQPA 5IHRA 3JRUA 4QXCA 4WVMA 4P9WA 3DPRA 4DO0A 1WMFA 3CDZB 4KBZA 4HPSA 1Q2YA 1V6JA 2XKOA 5FMOL 3LCPA 3EBRA 1H4HA 2VBPA 3IDBB 1W8OA 3BOWA 1GNHA 4CGMA 1TG7A 5JCTA 2R8VA 4HKFA 2Q4VA 4RR3B 4UF0A 1X7NA 3R4UA 2D97A 5EBVA 4ZXEA 3AL6A 3PUHA 1XC6A 2NPIA 1PUAA 1W9SA 2ZGOA 4FI9A 2VVFA 2YGLA 1S3ZA 3BODA 1QMUA 1TME1 3GZTB 1MS9A 1M4DA 4IV3C 4A32A 1YSJA 2B42B 2EWBA 2CF4A 3VBOB 2NSMA 1NUKA 2XOMA 4YW3A 4EN6B 1XMBA 1UN1A 4WM8C 4WM7A 4YZ3A 3NJYA 2BV4A 4MI4A 2C6GA 2BZDA 5BNNA 1YR0A 2RS53 5B4NA 3J8F1 4NGSA 4O9EA 3FEEA 5C9AC 1RUH2 1HIXA 1XRYA 4KSFA 2NN8A 1SMVA 2WT0A 3PIJA 2XWBB 5AC92 2BWAA 3D8CA 4M3CA 5FFOC 2OW4A 4W8JA 2FZ2A 3Q8BA 1LNSA 4BQYA 4BQXA 2EA7A 4AYUA 2AFMA 1WLDA 3APBA 1W99A 1S2EA 3HQUA 3VD7A 4TXWA 1YC61 4I2OA 1OPOA 3I1UA 2O1QA 3QAHA 2J1AA 3T4HB 3MFAA 5FY0A 2GMPA 2DURA 5IX3A 4XXAA 2PSWA 3IIAA 4ASKA 1DDLA 2GH8A 4NE9A 5FY8A 5LEJA 2NM1A 1CAVA 1XNTA 1YFYA 2WA3A 1BHGA 2O0OA 3IPVA 2CY6A 4AVCA 1NCQB 5G21A 5LBCA 5FZ6A 5CEHA 2PVVA 5LY1A 2PXJA 2OZHA 1VBE3 3NAPC 5FZMA 3TX8A 1LOAA 1F5FA 4QAWA 2HYKA 2J1UA 4FD5A 2PJ8A 3MW4A 4OI0A 5THWA 4PLMA 4ZZ8A 4MHUA 2ETEA 1H9PA 5DAPA 3FMCA 3PGPA 2JE8A 1ND2A 2CWSA 5FYYA 4X5KA 3AC0A 4AWDA 1GOFA 1RUD1 4ZKTB 3FVLA 3S7EA 3WT3A 5L36A 3R0RA 4N43B 1FAYA 4M6IA 3FLTA 4CEWA 3J7LA 4XIKA 3CNAA 5BNOA 2BQPA 3GNEA 3JB8A 2X5IB 3ZFGB 1WMEA 1AMPA 4ZS2A 1PNFA 4YW6A 4LBJA 2AYHA 4GWJA 4BMBA 3J4UH 4AAXA 3PFEA 1TMF1 3GY9A 4F0XA 4L97A 5A7WA 5J09A 2E33A 4LNVA 3WHTA 4FUUA 1JZ8A 2J8NA 4QQLA 3N9QA 1ZVFA 4ZU4A 1W39A 2EAKA 3N7ZA 2K46A 2X10A 2XXZA 3H50A 2WZR3 4B10A 1Y9WA 4E2QA 2OOTA 2B3VA 1DYKA 2H6CA 1NYWA 1Y9QA 2ZHNA 5FAXA 2JDCA 4Y3OA 4NROA 4UCPA 4JQRA 5FZBA 4BXFA 4QX2A 1W6MA 4XACA 4Q8KA 2CXAA 1TKFA 1BBT1 2WT2A 1EY2A 1AJKA 1LCPA 5FLIA 3ZN5A 2JDDA 2ZZQA 4DJLA 4GKXA 2RS12 1PGL1 3GCXA 3HJRA 4YWAA 3S6HA 5FYSA 1FMD1 1RUF2 2P0WA 1IZ3A 1OVPA 5T5JA 5F2WA 4DEQA 2VL1A 4P4BA 4AE2A 5E1RA 4II9A 3GXUA 1UMZA 2D6LX 1PVC3 4LOTA 3ZYBA 4NAMA 1W6NB 4C0BA 1N71A 1ASJ1 2BYVE 3POSA 2FIAA 2W91A 1UOJA 2R16A 3LACA 1CG2A 3D7DA 3C7OA 4YG3A 4JGYC 4GH4C 3HAGA 5C5TA 1F35A 4CP9A 1W6PB 4UFHA 3K3OA 1GUIA 2GALA 5EIYB 3VDDA 4F9VA 4NHMA 3VBRB 1UAIA 1H8TB 5T54A 5C6CA 4K1YA 3QB8A 3GJBA 2Q1MA 3ZSKA 3MUY1 3SJEA 2WO1A 4HETA 1LOKA 1AR72 5IK8A 3GIUA 4Y49C 3LQCA 4Q4X2 4AQ2A 1CZVA 3J9SA 3KHZA 1CAXA 3H1YA 4XFCA 4FBEA 1UYXA 2EIEA 1XSRA 1FX5A 1JZ4A 2UYAA 2XVLA 4UWIA 1N3QA 5LW9A 1PVXA 1T6BX 3F2ZA 5C4WA 3RZGA 4B4RA 4QB9A 2JDUA 4YW7A 1BPMA 2WPWA 5GLTA 5T52A 3DGTA 5G20A 4YM2A 4MCRA 1O3RA 1BEV3 2POKA 4D6SA 2GMEA 4KUAA 2F4LA 1S0DA 1EYBA 5FZ3A 4KLWA 5CVRA 2VOTA 4META 4YVWA 4M0HA 4CYDA 2ZMLA 1NA1C 3K9UA 2WWSA 1K45A 2JX9A 1FNOA 4BZ4A 3KKWA 1LHOA 2Z4FA 4UFIA 5DABA 3WCSA 2XH6A 4OP4A 3TO6A 2VMDA 3SC7X 1QSTA 3KCCA 3ABZA 2R061 4E27A 1LAMA 3ZXFA 4WV8A 1NE4A 4XAAA 4EWDA 1DQ0A 3GBFA 3T08A 4MXWB 3GB0A 3A21A 1O8PA 1W0NA 5K8SA 4QUSA 3O0WA 2YU2A 3TN92 3D82A 2A3YA 5IK5A 4CGOA 1ZRIA 1O3QA 1S0JA 2DVGA 4IV1B 1SCRA 2PA7A 3FBUA 2DU1A 1QU0A 3AXEA 2C9KA 3WG1A 3BUCA 4B4PA 2HC9A 1DZQA 3IAQA 5HXMA 2HBUA 1S7KA 5H9SA 3S9MA 4QPGB 4YVSB 3G8WA 3T4VA 2A6WA 4RN5A 5IK7A 1UL9A 2QDRA 4A7KA 1HJFA 4X8NA 4XF4A 4N53B 1AYN3 3PJQA 3FBMA 4MCPA 3L2NA 2ZEGA 2OH1A 2BJSA 1XNBA 5K7PA 4QMAA 3O1UA 1CAUB 4XJ9A 3JBG3 2R7HA 1JMUB 4AHYA 1RXFA 4FPKA 4ZX9A 5L7OA 1AR81 3S9NA 1VBC1 1HQWA 1K4JA 4AXVA 4H2AA 2ZEPA 1W9YA 1PNGA 4E4SA 2WLPA 3VZMA 1V9U1 4WVZA 3MN8A 5DWNA 3RBUA 4ES9A 1VPHA 3RWKX 2UY9A 3HBZA 5HCHA 2RJKA 2CTCA 5G05L 3S30A 4Q4W1 4G1PA 2OIIA 5A3OA 3OOXA 5DDJ2 1M4LA 5F2SA 5JXJA 5A80A 1SLBA 5GCNA 1YI9A 1WW5A 3FRMA 5FBJA 1URXA 2PMWB 2R32A 4D7SA 5A3TA 2WSUA 2VULA 1U0AA 2FS5A 3FFZA 4CYNA 1CZTA 1UZ0A 3TTHA 3KF3A 3IU2A 3HN3A 2GC1A 2GNTA 3FZ3A 4GA9A 3ZFEB 1KD7A 4OZXA 1ULPA 3OGSA 3TC8A 1H2NA 4GULA 2D6PA 1YREA 1B35B 3BPSA 3HT2A 5FYTA 5CISA 2XJUA 2ZMNA 4M00A 2P6EA 2RS33 4M01A 5BNQA 1KGYA 2ZGMA 5I8TA 1HV1A 3D0SA 1SLTA 3T0AA 1GP4A 1DYPA 4YPJA 4YGEA 3ACIA 5C8WA 5D8AB 2VOWA 4EQVA 2BEOA 1BK0A 3B94A 1RUC1 4HPKB 5GKAC 5JPNB 4PXCA 1PZ9A 1OHFA 1G9CA 2JDPA 1YQEA 2XL9A 3M3QA 2CNAA 2WNOA 3OD4A 3SCGA 1R083 3UETA 1W6QB 2DVDA 1C1LA 1MS3A 3MIHA 4UW5A 2HWB3 2E26A 3ZXJA 3FECA 3IZOA 2JG8B 1BO4A 4WVMB 4EE2A 3DPRB 1LB2A 1XOYA 4LQGA 3C7GA 1OURA 3R4SA 4L99A 4OCTA 4E4ZA 3M3EA 1QJX2 2VUCA 1Y4WA 1QNYA 3K4ZA 3QLQA 4CU8A 3WF1A 5L19A 4LK6A 5K0UC 3U07A 2AFZA 4AZZA 2GE3A 1W8NA 4UF0B 3BCWA 4BINA 4RR3C 4YZ2A 1WLWA 4XTPA 4K1ZA 1YFXA 3FHAA 4AF9A 5DXDA 3U14A 2YFZA 1G8WA 1OD5A 2XBO3 2TNFA 2W1SA 3LFMA 1JYWA 1HDKA 5LA0A 5LYDA 1RJ7A 3WG2A 5FCCA 2BNOA 3GYDA 4MXVA 2BNNA 4QX3A 1K5MB 4JXRA 2BNMA 4LA2A 4JTOA 3SH4A 2NP0A 1ULCA 4LHSA 1PZ7A 4YW1A 4A6OA 2JE9A 4Q4Y2 3ACLA 3WXPA 3KD4A 3TB0A 3VATA 3CZJA 4H6ZA 5E6HA 3C7FA 5FZEA 5AVPA 5GM0A 4N90A 3HUVA 4PQ9A 2V5DA 1M44A 1RHI1 3PRTA 2QJ8A 3FWEA 2G9FA 4B7EA 3BIEA 2ZGKA 3WD5A 3K77A 1D7PM 4DXRA 3T2TA 2PELA 5FJKA 3D7GA 1Y7BA 1UFHA 5KTAA 1AR92 5CBMA 3HNMA 4Z1VA 5J48A 3C8XA 2PC1A 1OOPC 4KOWA 4GWMA 4W6XA 4I0AA 1ULEA 4UIBA 1UY0A 3UV9A 4CDUA 5FZOA 1W8HA 3OGJA 5I0CA 5JZGC 4FXKB 3M70A 5GJ6A 1AL0G 1ZBA3 4DS0A 5A7PA 2QQUA 2JDMA 1VBE1 1X50A 1NCQC 2R073 4URAA 4EROA 2VJXA 3ROUA 1HJGA 2OPWA 1O4ZA 3GHMA 4OMCA 4XQDA 4CCEA 2HWC3 5H9QA 4M3CF 1VGYA 1JU4A 2JBKA 5HBAA 4BIFA 4K8RB 2K0GA 2VMEA 3ZN6B 4EWEA 2VZZA 3JB4C 2PJAA 4WVVA 1PM7A 4MMOA 4K9SA 1RJ8A 1RVF3 5L9RA 2A3XA 5C3OA 2IFRA 3F0AA 1SFYA 1IPKA 5FQ0B 2WFF2 3WX5A 5JAXA 4CRZB 2V4VA 5DUXA 1XU1A 2QDNA 1BLLE 5L9VA 5A32B 4EZ4A 1KFUL 3BPZA 2R0HA 3W21A 4CDXA 1JBCA 4AFCA 1RUE3 2ZX1A 2Z2SB 1DF0A 2X5IC 2LS6A 2JIGA 2W1UA 2ZZJA 4PI0A 2XMLA 3OBRA 5A7WB 3NFZA 5KXBA 1QQP1 1L7LA 3WP3A 5E89A 4Q0UA 1VMFA 1VBD2 4PXDA 2WDBA 1UYPA 1FV3A 4HLTA 5JM6A 2ZELA 2ZOGA 3LWUA 3B3VA 3R4DB 4OMDA 3DKQA 1NQDA 1OSGA 3WT4A 2BBVA 4CE8A 3JQXA 4QM9A 1GWLA 1HQNA 1EV12 4QKFA 4Y5Z0 3O1VA 3JQWA 4ZBGA 1KUVA 1ZLHA 2XGXA 4H2KA 3AFGA 2YGMA 1DZRA 1AR82 1LGBA 1PVC1 1PIV2 1W03A 2WN2A 1E5RA 4UWDA 4JZRA 1VAMA 4MFQA 3R9EA 2FQPA 2PRBA 1SFNA 4PJYA 4MGTA 1JTZX 3AXDA 3I4IA 5CYYA 1F9KA 4HVRA 1UY3A 3VB9A 4QPWA 1UU5A 3AM2A 1AL23 4COYA 1R093 3ZXAC 1N1TA 2XJSA 5IT6A 1WKYA 1JZ3A 5FWJA 2QIRA 3MW2A 4CAXA 3MF9A 3CHXA 1F2NA 2LUWA 2PR8A 3VDDB 3CQOA 4TTGA 2VXJA 4XF1A 4LO7A 4IUGA 1S0IA 2VW0A 3OY8A 4ZS3A 2E51A 3IO1A 3VBRC 5KHKA 3LSEA 1H8TC 1NAEA 3D68A 5EQUA 1L0CA 4UF4A 2ARHA 2C6SA 1GKBA 3HQXA 4UW3A 1XBFA 3A7QA 1DLLA 4XOGA 5AG7A 4H55A 3WNNA 3ORJA 3RSJA 2WWJA 3HNYM 4GZ9A 4Y33A 5FPLA 2ABZA 5F1RA 4KWKA 3KV9A 4MXUA 4GD4A 1AR62 5FO9B 5J8FA 1W04A 3N3HA 4R9CA 3ZFFB 3GM8A 2VC9A 4PDWC 1BEV1 2A3WA 1CP7A 5CNAA 1Z7S3 3LF7A 4J6GA 2I3CA 1QJY1 4OQ8A 2DVAA 2Z0ZA 2Q0YA 2C27A 4ONUA 5JXIA 1OFNA 4GB32 2HKXA 2RR11 4XZPA 2VGDA 5HVFA 2ZTNA 4YVWB 3DXUA 2W52A 4AEDC 1POV3 3IIBA 3POEA 3TCVA 4F8ZA 1Q3EA 2Y8KA 3N9OA 1OH4A 4NHLA 2NQYA 5DZFA 4Q36A 5FPXA 2ZXVA 3TAYA 1LEMA 2AEZA 3DLJA 2ARBA 3CMGA 3H8GA 3MV11 1DQ6A 2R1BA 4GALA 3TWIA 4C90A 2WRAA 2OZJA 4NHKA 3ZMNA 3ZJ0A 4QD2A 3B3TA 1FOD2 1UCXA 1QJZA 1NXD1 2VH9A 3BI3A 5FYCA 1GNYA 5KXCA 1HRI2 4IV1C 2A71A 3LIHA 2PJBA 2G0BA 4JHZA 5I0DA 3Q9OA 3NO8A 1OLME 4N9IA 2B39A 2UYBA 1JYVA 1LOGA 5GZGA 3BU0A 2WT1A 2WQ8A 4OADA 4QPGC 4W4ZA 3B93A 1QSMA 1AYN1 2JENA 2R0FA 3A4UA 2IWGB 3O5SA 4ZU7A 2J42A 3EB7A 4UFKA 4P9JA 1REEA 5ANNA 2HWD2 2PLV3 4G9SB 2WN3A 2WQ4A 3JBG1 3C7EA 2XEIA 5C3SA 3PUIA 1Z8XA 4XF9A 1AVBA 4QDSA 1W8TA 4GXLA 4FD4A 3B3QE 5L7OB 5FZ7A 4YSFA 4O61A 4JDMA 4EV0A 2ZAHA 3SKVA 3POFA 4L9BA 3K46A 5IB9A 3LA3A 4FTBA 1WW6A 2JWPA 1VBB2 3OTFA 2FCKA 3H8XA 2LALA 5A6QA 2C24A 5GLUA 2QVSB 2DU0A 1J84A 1W6OA 3WDWA 4AI9A 3NV3A 1TIQA 4NR1A 5FXXA 5FMOS 3LSDA 1WUVA 4L8QA 3PB9X 1RUH3 4PI2A 1Q8VA 2XEJA 2A5ZA 2UWBA 2ZW4A 4MSVA 2DUQA 2JDAA 4D6RA 4YWYA 2VUDA 3K2OA 2OUJA 3ZFEC 4HZFA 4X6QB 2V73A 1YRZA 3MUZ1 1S1AA 4KOYA 2VMCA 1CWPA 4XVHA 4DEVA 4IGOA 1S60A 1B35C 5CKQA 5A3WA 1XB9A 4LLFA 3RZHA 1BVVA 1UU4A 3NKTA 3P3PA 3VKLA 5C71A 4TWTA 4Y4RA 1FT9A 5C82A 4LIUA 3SHRA 1JYCA 3U1XA 3A9LA 4ZONA 5G1ZA 5FY5A 2DUOA 4BISA 2GC3A 4D69A 3IFEA 5DAWA 2YROA 2W87A 2DCJA 1LANA 4IQPA 2VTXA 5FY9A 3T1LA 4QPIA 3I49A 3HWJA 1R081 2VUJA 2RVAA 1ZYBA 3USUA 1WA6X 4R87A 5J8CA 5H9PA 1HX6A 4CAEA 4CVUA 3VKFC 3WVJA 1RC6A 3I3EA 1DIWA 3ZXEA 3ZSLA 1XJAA 4J1XA 4X3RA 4Q0VA 4DUVA 3MW3A 3IDEA 3INAA 2PJ2A 4OZOA 2Q1FA 3DPRC 3B5LB 3D67A 4XEZA 4P00B 2O14A 5F5CA 1WCQA 2PAKA 5FKCA 5J36A 5LRKA 1TXRA 4LJHA 2GMMA 4SBVA 2QBXA 2AGSA 2XHNA 2DEAA 3PBBA 1IPSA 4XHBA 1X10A 1XYNA 3SHPA 1V6NA 2B8MA 2ZJCA 2J1TA 5FPVA 5D21A 2EK9A 2XBO1 4KORA 4CA9A 4FO9A 3ZO0B 2WO2A 2HWE2 2CU5A 1CIWA 4MX3A 1A78A 2Y6JA 2W39A 3OYWA 2WLQA 1D4M2 2VAUA 3T0DA 1HRV2 4OVEA 1DU3D 2ET7A 2AFXA 3AMQA 1Y7RA 4YGDA 3MYXA 4RS5B 1QXPA 3S0MA 3LODA 1Q8QA 4MFZA 1A8MA 4ATFA 4UCMA 4KGQA 3KQRA 2ZGNA 1JZ6A 4M0NA 2PJ5A 4WM7C 1UD1A 4OAEA 4FFHA 3UJQA 4BQWA 2WS91 5BNNC 3CZXA 2ILMA 4Q4V1 2RHPA 1GOGA 2ZCWA 1H6XA 2RS13 5F49A 1GANA 1X9PA 2CGNA 1UO9A 4IK2A 4XJAA 4PK2A 4NWVA 4E2AA 1DHKB 1RUF3 4AHXA 5BV6A 3SI0A 1G9DA 2NYYA 1PO21 1UOFA 3MIBA 3CBNA 4UA3A 1JOBA 1C8M1 1Y0RA 5LWBA 1ST8A 1T6GC 1PGW2 3D6EA 4LXLA 5FZIA 3CU7A 5FZOB 2OYZA 3UKVA 1O3SA 1ZBA1 5A1AA 2PIZA 2RDQA 1G6NA 3A23A 4D6QA 4JRAA 2CAVA 4KG8A 3V38A 1YQ8A 4NWWA 2P6GA 3A0KA 3GZAA 3VHPA 1WCUA 2B58A 4MCSA 3CL1A 2JG9A 4H6UA 4JKKA 1ZZ6A 4MFLA 4MYEA 5FUPA 1NLQA 2YDEA 4LA3A 4FVVA 4XUNA 2EXIA 1W3XA 4DPNA 1S7LA 4HFSA 2GIVA 1C5IA 3VV1A 3VHRA 3ENRA 4JKMA 4BQ5A 1J3RA 5JH9A 3IMNA 2B5GB 3OWCA 1NCRB 2OXBA 1ND2C 1IS6A 2Y0IA 3GBGA 1NG0A 1W06A 2F5IA 1B09A 1RUE1 1D0GA 2VD7A 2B9UA 1S2KA 4CEWC 1T2XA 4C1XA 1GV9A 2Y38A 4DRVA 1R43A 5BNOC 2PCUA 1STMA 3UL2A 1XNAA 4NJRA 2IQ6A 5T55A 4R3LA 4MHRA 3DXTA 2XKPA 2D5HA 4CTEA 1YWKA 3CJIB 4FAIA 4AVTA 4D0QA 3CPXA 1TZOA 4PIXA 1M1DA 1QSRA 4B8EA 2A1XA 3EMRA 2QZ2A 2GNDA 4Z82A 5I4MA 1MEC1 1YLEA 1W05A 3E97A 3PTRB 5CG8A 5CB7A 4INDA 4MY3A 3A22A 3NVCA 1FNYA 2WPXA 1MVEA 2RMU1 4YG6A 3DR8A 2VTFA 2Q30A 3N9LA 1CP6A 2IXKA 5JSPA 5C3RA 2FIWA 5A33A 4TLFA 2LTNA 2ZKLA 4AVVA 3KV5A 3SISA 3D3AA 4NSQA 5FZ4A 4IV3B 4LITA 3VHNA 2FD8A 3NW4A 1LESA 3UKNA 1OQEA 3I7DA 4CDQA 2CHHA 4WM8B 1AL21 1EUTA 4CEYA 2QYVA 3VBHA 4V2WA 1Z0HA 4H7MA 1A34A 2XL7A 2WZEA 4P9XA 2GP3A 4CAFA 5C9AB 4C68A 3ZPOA 1XYOA 4LUAA 3KT7A 5IK4A 5EC4A 4GMP1 2VPVA 2DBNA 3D2MA 2VZ1A 4A7YA 3VDDC 3P2FA 3SNMA 4JGZA 3OY8B 3ZXKA 4MGSA 4K30A 3VKOA 3SXNA 2E63A 2GLJA 3B9IA 2VZQA 4YW5A 3FNCA 3IM0A 5FLJA 2R1DA 5FYHA 2KCWA 4AVSA 2VTXJ 2BVVA 1IYKA 5AVAA 1CIYA 5JSRA 5TSWA 5A7NA 4BBHA 5DAXA 4S2HA 2P3IA 4K7JA 4M3SA 5DDJ3 1YEWA 1V00A 5C4WC 2VZ3A 2ZEMA 2CGOA 2EAAA 2Q7SA 4UI9L 2WZNA 2ATFA 2WAOA 1GU3A 1W2UA 2V8GA 4CAWA 5F5QA 3CJXA 4OI1A 1WD3A 3RJ2X 3NV1A 3I2HA 4UEFA 4IE5A 3LA2A 3O0XA 5C3QA 3NAPB 3VBSA 2Q4YA 3TNPB 3VZJA 4QDRA 1XIXA 4UEEA 1POV1 3MGUA 2QQOA 4YVWC 2H5MA 5HVGA 4L89A 1X82A 2CYFA 3B8GA 1EAH2 1IG3A 1H4GA 3GDBA 3K51A 2TUNA 1ZG9A 3VZOA 5EYYA 1FYUA 1V6OA 1UNBA 4UBGA 1QJU1 4R9DA 3I2IA 4CAVA 4DIQA 1O5UA 3PBEA 5LA1A 3BJ7A 2VBDA 3CPAA 2OR4A 3ZR5A 5F6KA 5CFCA 4ASLA 3OUIA 5KXDA 4KMQA 1JUHA 3KCYA 1GWMA 3LDKA 4DNCA 1SCSA 2IVIB 5JPMB 2KD7A 1CPSA 4RFRB 2D3RA 1H2LA 1EP0A 3POWA 3SITA 5K8NA 4LHLA 4D3WA 4TLGA 2WZPP 5F6LB 1DQ4A 4Y22B 2W68A 4AEKA 1OT5A 2YMZA 4RHV1 4PK3A 2XHKA 5ABJA 1NOVA 3HD8B 3IBMA 4CU9A 4MHNA 1QJX3 1HW5A 5FZFA 5J98B 5LCWL 1DGLA 3CIHA 3RZAA 5A7QA 4YZ4A 3OD0A 3VDBA 2D40A 3KMHA 2Q44A 2JB4A 3PMSA 4Q4V2 3VN4A 2QE3A 3VZNA 1RUOA 3MO4A 4RD7A 3RZMA 3AKPA 1OMIA 2VBBA 1SQHA 1VB2A 4E8OA 2YGWA 5JXGA 2C6CA 4SLIA 2D93A 2QQWA 5AG5A 1NMTA 4C1WA 4A44A 2OKXA 3HPNA 5L7OC 3VBFA 2RDRA 3ILNA 1YLOA 3FLPA 4R7MA 3IWZA 3E5XA 4GH4B 1JQGA 3GHNA 1R3NA 5KWRA 4G4FA 5JLVA 4YRHA 2BGPA 4HNWB 1OLRA 5HI0A 2CDOA 1MJBA 1P0HA 1RUH1 1IU8A 1H0BA 1YQ5A 1OA3A 1ZZBA 1V6KA 4Q4Y3 5AC91 4RA0A 4N9HA 4NIAA 5LA2A 1RUI2 2AFSA 4W6YA 2FMDA 2IMOA 5HPOA 1NX9A 2GNMA 2Z69A 5F3IA 4BQ3A 2EK8A 3H5ZA 4YFJA 1QMJA 3DKWA 5EJZB 3VD3A 5FZAA 4FFFA 1GZWA 1QDOA 4KVOE 1I1EA 3H8EA 4ISQA 3ETPA 3V0BA 1LRZA 1MJAA 4K21A 1HQLA 1ENXA 4BQ4A 2VOKA 2WO7A 2NMTA 3TEXA 5E96A 3PJYA 1I5ZA 3I2JA 3T9YA 1S2BA 3O1OA 2DYCA 3R96A 4QB6A 4FQZA 1FXZA 2G19A 2ARAA 1RUG2 5FPZA 4GM5A 3M1HA 1UKRA 2HEYF 4C91A 3H3ZA 2E53A 5IVCA 1NA1B 3HT1A 3POBA 2GZWA 5DAVA 2RE9A 3USUB 1OPMA 4HKLA 2ZGSA 4R9MA 4GWNA 2AEYA 1O4TA 4P02B 4NGPA 2QTWB 4IEVA 1OZPA 5IATA 3DL3A 4XUPA 3T3YA 4BMHA 3TBDA 2VMHA 4KH9A 3IIIA 1LOEA 1MEC2 1GWKA 3WUCA 2WFF3 1OLQA 3VH9A 1N1VA 5EJ3A 4R4ZA 3I54A 5I8YA 4MH0E 3AZWA 4FFIA 2RMU2 1NE9A 1Z9UA 2GREA 5JQ4A 3PUSA 1MS8A 3HN1A 1HB3A 4FPYA 1VRBA 3AZVA 1XNDA 2RS52 4DUXA 1AX0A 3E5QA 1UIJA 5DG2A 3GCWA 3OYWB 5A3MA 3VKNA 1QDCA 1QGLA 2GU2A 3R6SA 1OH3A 3H0OA 4QGNA 2RJLA 1OLMA 4OULA 4QHZA 3ST7A 4HVQA 2P37A 4C0HA 2Z3MA 1JODA 3ELNA 4YW2A 4J1WA 2E7QA 1XEBA 2RS11 2QQVA 1PK6A 3AB0A 2I79A 1EV13 4Z8BA 2UWCA 3GJAA 3SH3A 2WNVA 3B02A 5A3UA 1RUF1 5CFDA 1DE4C 4M85A 2WQZC 5LYFA 5KR7A 5AFBA 1YW6A 1ND3A 1AR83 1H9WA 3L2HA 5D8NA 4AFDA 3TT2A 3H8OA 4DNYA 4CDWA 4XABA 1M4WA 1VJ2A 3SQOA 2E32A 5C8CA 4GJZA 3H8FA 3AZZA 3LMSA 1QJEA 5EPAA 3TEZA 3S6KA 4PPZA 3LD8A 5K8MA 5EJ1B 3EY5A 4OIDA 4B5PA 4Q4W3 2FDHA 5ANQA 3U78A 4XYXA 3AK0A 1X12A 3WNLA 1HXS2 1RTQA 4ZGYB 3BTXA 5KTCA 4CDUC 1SPPB 4P4EA 4A95A 1PU9A 3PUQA 3MDPA 2ZEOA 5A3LA 5FZLA 4ZX8A 1LHNA 2GFQA 2BSWA 1AR71 3WG4A 5T50A 3W91A 5CKNA 1Y0YA 4Q4X1 1CJWA 1UOBA 3QACA 1IHMA 3M7AA 5BUVA 4BLIA 4YZ1A 1JI6A 1UY1A 1B87A 1TF9A 1JYNA 3ECQA 5BNPA 3TO7A 5DUWA 1JOJA 4CCMA 3S5QA 4F83A 4AEMA 2V5YA 1AJOA 1PYTB 2JBJA 2XQXA 1QJU2 1LU2A 4JQTA 4A33A 1ZZ7A 1W8ZA 4PV6A 1Z4EA 4NHYA 4PXEA 3FX6A 5FK8A 2G1MA 4ONWA 4AL9A 1B6BA 3IU1A 4LHNA 2TBVA 4Z2AA 2YU1A 1YJLA 4FBFA 2VVDA 1J3PA 3GALA 2HLEA 5FY4A 2XR4A 1DGRA 1XYPA 1Q56A 1S55A 2B45X 3O1RA 4AQTA 4QX5A 3N5FA 1GP6A 2VZPA 2B7YA 5JXHA 4PBPA 4PSWA 3LWCA 3IGRA 3E6CC 4RGKA 2ZEFA 4AB7A 3NH5A 3WDVA 1AX1A 4UXAA 1MQTA 3AL5A 4CCNA 1PX4A 1P4NA 3RZLA 1MS4A 4RHV2 4EFDA 1AZDA 4FAGA 2EIBA 4W9YA 5K0UB 4RQPA 4W6WA 3TN91 3N9NA 3IT8A 3T0BA 1PO11 5CBLA 2W08A 1FOD3 4YGOA 5D29A 4Q8LA 1YUDA 2FBEA 1P8JA 3M2MA 5FV3A 3RGBA 1U5YA 1JH5A 2CDPA 3OCPA 3OPWA 1PMHX 1XE0A 3O1TA 1HRI3 3PVOA 3HNBM 2P5BA 2PHTA 3RYKA 3RZJA 2D3PA 3FN9A 4JV4A 2VECA 2YPJA 1TF8A 1ULOA 3WNPA 3QAYA 1IQAA 1SEFA 4CDQB 4GJYA 2BCOA 1GLHA 4HK8A 3ZSEA 3FMGA 5K4LA 4PQQA 4CEYB 2L9LA 3BOPA 1VBA1 1Y3TA 1HV0A 1GYTA 1MZEA 1KUYA 1Z78A 3MICA 2VQ0A 3WCRA 1IQDC 2XWJB 2HWD3 4E0AA 2JDZA 4I0WB 4JGZB 2V77A 2WUUA 3I59A 4IERA 4Q7AA 2OX0A 3LEIA 5IYYA 1RITA 4NIGA 3DGVA 3FUQA 2WNUA 4Q5OA 2DPSA 2Y6FA 3WQ7A 2TEPA 2YZ4A 3UJOA 1AYM2 2AE6A 1X33A 2BGOA 1RHI3 3GKRA 3KGLA 4P10A 1I21A 3H1WA 4LE4A 1OOPB 2VCCA 2K2SA 3LOBA 3LOIA 3GF6A 2XJPA 5APAA 4O65A 5DDJ1 2LROA 5J1XA 4XXPA 3ALQA 5IFPA 3AYAA 3AYDA 1VBB3 4QX1A 4BLJA 3N4MA 5JZGB 4F9UA 3OBAA 3JUUA 5LBFA 5F3GA 3WF0A 2VCBA 1W2OA 5CA6A 1Q7LA 4IL7A 4D7TA 2HUZA 4XPLA 3WC7A 3PEIA 3USSA 4AI3A 3D2PA 1W90A 4KOSA 4B5OA 3V7ZA 5LBEA 3A0NA 4PIYA 3OG2A 2Q1ZB 3VBSB 3R9FA 4IW3A 4XNHC 2A70A 4MJ8A 4K3UA 1SBFA 1V6LA 4EN8B 4U36A 2I45A 1EUUA 3GZEA 1TNFA 4QB1A 1REFA 1WGPA 3X29B 1W28A 2BU9A 1NE6A 1CAWA 3JVNA 2W46A 5DN2A 1MPXA 1VALA 2CV6A 3K2KA 2ADEA 1XE4A 2OPKA 5FJHA 1MZFA 4AG9A 1WZXA 1XNCA 4Q2FA 3EYPA 1D2QA 4P5HA 1IGBA 1TEIA 4BMEA 4AG4A 3SJXA 1C3HA 1KJLA 1W9WA 3IB3A 2PHWA 2ANPA 2YBPA 4NOTA 4CCOA 3AP6A 4BH9A 1LECA 3KVBA 2Y6GA 1QY4A 1PHMA 1NXMA 1I9RA 1D0HA 3N35A 3O1SA 1J1LA 4W50A 3WDUA 3ATGA 3PUAA 1QNWA 2QQJA 2Q8DA 5KHJA 1QQP3 3WDXA 2DFBA 2VZTA 4YZ5A 1XQNA 4AI8A 1TQ5A 2VMGA 3ON7A 1OQ1A 2QQIA 2WJSA 1FY7A 1QJX1 4HOOA 5J3UA 4AAPA 4UCNA 3MIEA 3IWGA 3FJUA 3MBWA 1PX3A 1BXHA 1UPSA 3VLBB 2SLIA 3UY5A 2QZ3A 4X2TA 1DGWX 5FZ1A 1KRIA 3VBOA 2BBAA 4F3JA 3ZN4A 3PVEA 4V1PA 3QH7A 2WC2A 1IKPA 1JHNA 3NRUA 1N1YA 5IVJA 1WWZA 3V64A 4A2UA 5FXWA 1KUXA 3D5OA 4MV2A 1UXZA 4U2AA 2Q43A 4C8DA 1RXGA 1BJQA 2Q4ZA 4FP3A 3OUJA 3O0VA 2YXSA 2HWE3 4EN7B 3CXQA 2Z42A 5DPNA 4ISRA 4QX8A 3EJKA 2D4OA 1WA4A 4ZY1A 1D4M3 4FOYA 1HRV3 5FKBA 2KXLA 5FP9A 2PR1A 2JJ6A 3KB5A 2B4BA 1SBDA 4Q4Y1 2H0BA 1L7RA 2NMNA 4WBBA 2WL1A 5KC6A 2RS32 5FR3A 4O23A 4E4DX 5ELYA 2PQSA 1MR5A 4RI1A 1ZBE2 3T90A 1J83A 3AZXA 2W2IA 2BOIA 4FD6A 1A8DA 5IVVA 2ES3A 4OUSA 1QSNA 1I5PA 1AR91 3N7LA 1ON0A 4Y1ZA 3MEPA 4BK5A 4UFMA 3V0BB 3MIDA 3O7OA 1KS5A 3N7JA 3SEPA 1K42A 5HXDA 1BZWA 4XUTA 2B46X 4PDWB 2E6VA 1LENA 2ZBJA 4MRIA 1VRH2 2HWB2 5FXZA 4NXYA 5L9BA 2DV9A 3S57A 4GIQA 1ZNPA 2EVNA 3T2OA 2ET1A 3ITQA 1VLNA 1WLTA 1QJY3 4IEYA 4F7ZA 2BL1A 1HB4A 1Z8WA 1W2TA 1ZZCA 4AEDB 1DLCA 3ZVXA 1AYEA 1WBLA 3FE5A 1LOBA 2E7AA 4N43A 4QPIC 2RR13 4Z92B 2VQUA 3NMBA 3AX4A 3WV6A 3FH4A 4Y20A 4OC2A 4RUHA 1LOCA 1NQJA 2P6HA 2UURA 3ZFGA 1CPNA 4JC1A 1UWYA 1NY71 1CR7A 2Q04A 4XIOA 2WFF1 2VW1A 5I8SA 3PZJA 5IAVA 4TYSA 2ZEWA 3DUIA 4ZPIA 2OZGA 1LHUA 1PO12 1UZWA 1XOVA 5JR2A 3R95A 1SZBA 4EN0A 2I07B 1N3OA 3OJBA 4HBNA 5BPXA 1ZZ8A 1SACA 4NIIA 1MJ9A 5HH1A 1Q8PA 4WWVA 1RTVA 5A7OA 1VBD1 2W94A 2K5TA 2ZEEA 2QJVA 4XCAA 3T2QA 1G9AA 1W9TA 1LCLA 4QWNA 3U0ZA 4PIZA 1U12A 2Y26A 4KSIA 1R1A2 4AI1A 4TNUA 4IF5A 3W6SA 1VBA2 3WP6A 2VY0A 4FD7A 2JEVA 2YBSA 1C4RA 4U9YA 3WDYA 3KASA 1FT7A 5DZEA 2DCTA 1CQ9A 2R7EB 4QPYA 1HEEA 1EV11 1W6NA 1XNKA 3NNGA 5F48A 2WA4A 1PK6B 3WSOA 1CVNA 2RDNA 2ZPAA 4L11A 3E6DA 4OI4A 3TFYA 4QU1A 3NA6A 1LRHA 3UNPA 2FDGA 2I2SA 5CFDB 3UYJA 1JXNA 3WC5A 1W2AX 2IXLA 1PIV1 2RDSA 2BP6A 4YRDA 4NIHA 3H42B 1Z2LA 1YW4A 1LTEA 1JU3A 2QQLA 5F7UA 4QGMA 2J1SA 1J58A 2R072 1UYYA 2OS2A 1COV2 5I91A 1VAVA 3TRSB 2E9QA 2WAAA 2HWC2 1S4CA 2MEV2 4ARXA 2VQTA 3ZYPA 3UGFA 1NT0A 2PJ7A 2OU2A 3F5BA 5FXVA 1RVF2 4B3NA 3ZYHA 2BW8A 3P6BA 2UWAA 2DTWA 1M06G 4KOTA 4BWOA 4E8DA 1JW6A 3M3CA 2R98A 2BEIA 3NJZA 4FPHA 1ZRCA 1CM0A 1MZ5A 3DYOA 1H8LA 2G9DA 2VXRA 3MIFA 4IEUA 1W8WA 2QMLA 2JG9C 2VVEA 2Y0MA 1TVGA 4FP2A 1G9BA 3GGLA 4QHOA 2XQRA 5LRRA 5BNPB 5ACA2 3M3IA 2FDKA 5JUVA 1ELMP 5FZ8A 5T3NA 5DUVA 1GQGA 2JEMA 1RMU2 1AR61 1S0EA 1YCIA 4YU9A 1KQRA 5FPBA 2VMFA 4OHZA 2D6KA 3RYOA 1SG3A 1IKQA 2C6PA 3VD9A 3ETQA 3I3DA 2VG9A 1A2ZA 3Q8FA 1QWRA 4R8FA 4CPAA 4XFFA 3WY6A 2DUPA 2PTMA 1F5JA 4LUKA 1YXWA 4GB31 4QQ2A 1RL3A 2JEWA 5IVYA 4CP1A 4FPLA 2Q8EA 2X05A 2OT7A 3RYPA 1O3TA 5ERLA 5K8PA 4QQOA 5LASA 4HXCA 4RGAA 1O91A 5FLHA 1YHFA 4NGRA 5FZHA 2IUWA 1EAH3 4GXHA 3BI1A 4MO3M 4MCQA 2XJVA 4BCUA 1OD3A 1MQTB 4XPDB 6CPAA 4E8CA 3I3MA 1F2PA 3R1KA 1XE8A 3AP9A 3CKHA 3PVBB 1LOFA 2A6VA 3RNSA 3AJZA 1FOD1 5FZ9A 2F8HA 2EXJA 2HQYA 3G3SA 4YVSA 2DVFA 2IZWA 4PF1A 4UW6A 4Q29A 1HRI1 4XDQA 1R092 5CAZA 4N53A 2VI7A 3SXWA 1VHSA 4LBLA 2ODFA 4RL7A 4N7IA 3KQZA 1ZM1A 5FRAA 5IAXA 4P4DA 3TOBA 3EHKA 4NEXA 5A27A 3KV6A 1ENQA 1VE0A 2VZVA 2P34A 2V09A 4CDQC 3KZ4C 3KV4A 4M6HA 1CX8A 4MFKA 1GZ9A 4CEYC 3VD5A 4WM7B 2Q51A 4R6TA 3QNVA 3VBHC 4MHDA 4RN7A 2WIIB 5BNNB 2HWD1 1F2OA 5A1LA 3PP9A 4LOSA 3B7MA 5T5LA 2WS93 1XMTA 1CONA 4XHXA 4Q4V3 2QUOA 1VR3A 4JGZC 4UFVA 3KHBA 1OBNA 4M3CB 3SXOA 2AJ6A 1X36A 2VR4A 3PB6X 2QNKA 1HLCA 2PJ1A 4S2GA 2IC1A 2BUKA 1PO23 1Z7S2 3DNSA 4NF1A 4XF3A 4MOAA 5LA9A 1SLAA 2RC4A 4FOWA 1KFXL 4MHPA 1H30A 1C8M3 1VBB1 4CCCA 1FNZA 4Y1YA 2DBIA 5A3NA 2PYTA 5I93A 2R042 5BWAB 4DFSA 1YLLA 5A6XA 5DAQA 4IEWA 3I2FA 2GU9A 2ZEHA 4MBUA 3CF6E 1CAVB 2OQ6A 4MVTA 2A6ZA 4MGIE 2E7TA 3IPVB 1GOHA 5LZ6A 5FYUA 1RUI3 2WINB 4FWUA 3VKMA 3SCHA 5DMYA 4FFGA 1OKQA 1S0BA 4GS4A 1C28A 2R30A 3VBSC 2EALA 2FE7A 4IE7A 1GSLA 1J59A 4NPMA 1IS3A 3NNFA 3MLKA 1AXKA 3PTYA 4YNIA 1ELLP 1UZVA 5D8AA 3V8IA 4HPKA 1C57A 1OUSA 2JECA 3AKTA 1QH7A 4XPKA 2BOAA 3I2GA 1SLLA 5EHDA 4KSAA 1ND2B 2G3AA 4YGBA 1NY72 5FZ0A 4MLOA 1W3VA 5A3PA 3RZKA 2QCSB 4AVAA 4YM3A 4D7YA 2NYQA 3LEMA 5FDBA 2ZW6A 3WQ1A 1OKOA 4CEWB 1ENRA 1VB4A 2PAEA 1RUJ2 2JE7A 1OFSA 3DV8A 5BNOB 1FV2A 2JG8A 2V8VA 1M4IA 1RUG3 2VZUA 5A28A 5CFCC 4XAEA 1C8NA 2EICA 3VBUA 3PURA 5FZKA 1Q5OA 3LDRA 4AW7A 2CNMA 3AKSA 4Y1XA 5F3EA 1QEXA 3HMYA 1Y9KA 1F8VA 4MFPA 3SLIA 1UY2A 2PLV2 1N47A 4KL1A 3AP7A 3HR9A 4XBLA 4BM8A 4KU8A 4CYPA 3KQ4B 4UW4A 4L2NA 4ORFA 2NZ9A 5BY5A 4DUKA 5H9RA 1JYXA 3H7YA 3LEKA 4DMIA 1Y9MA 4KBBA 1TKHA 4DYOA 1LGNA 3RAMA 1O5LA 2J8RA 1MEC3 2ZOEB 3FYNA 1W6MB 5ABJC 2HEWF 4P4JA 3LA7A 1CX1A 4OLLA 4RYDA 3LKJA 5IVEA 4WVWA 4JRLA 2RMU3 1ZLIA 1F4AA 1GYKA 1K5MA 2R49A 5LK5A 2FVGA 4B29A 2O4HA 2ZXQA 4P14A 2GNBA 2HWE1 2DCYA 1WLCA 1CPXA 5HV4A 3RI8A 3ZDVA 2IL4A 1YNAA 5IW0A 4NGNA 2AREA 4QT6A 3ACGA 3ASIA 1D4M1 1HRV1 5DG1A 3VBFC 4XFGA 4RSUA 4C2XA 5IJRA 3WW3A 3BLNA 1A3KA 3AMNA 5JOXA 4UIAA 1SBEA 3VZLA 2ZMKA 4NMIA 1GZCA 4AQSA 4CP9B 1ZX5A 2OZ6A 4ZY0A 2F6BA 1QQ9A 2R1IA 2MPFA 4GMP3 1BMV2 3LPFA 3LAGA 2ZX4A 5FOBB 4J25A 4NPLA 3AMMA 2REFA 2VBQA 1FPN2 2XVGA 3UGHA 2AH2A 4MGYE 2BVBA 1PGSA 3RDIA 3RS6A 2GDFA 2PN5A 3FUOA 4YGCA 1CAXB 2Q4SA 2A75A 4P08A 1YX0A 2Y6LA 4JX0A 5KXEA 1GZTA 4HT1T 4XURA 2GN7A 1PGW1 2GAUA 1YK3A 4P44A 4E4HA 5FWEA 3AZYA 5C4WB 1GP5A 3PB8X 2HBTA 3QBQA 2BERA 4DUWA 1CD3G 1IY7A 4CCDA 1HXS3 3ZN6A 4P6YA 3W6XA 3AFKA 4FCAA 2VZRA 2OUHA 5FOJB 2Z3NA 1HN0A 2EUIA 4IDZA 4CUBA 3I9SA 3ZDSA 3ES4A 4XILA 1CN1A 3KQXA 4JHTA 2ID4A 2Y6HA 5FQ0A 1Y43B 2PHDA 2BWCA 2UY8A 4FOVA 2B4DA 2B3UA 2JDKA 1CX4A 4XMIA 1UW8A 5DS0A 3WNXA 4JD6A 4Y20B 5A32A 4CYOA 3BGAA 2Z3OA 3L2YA 4HNXB 1F4HA 2XJTA 2HYXA 1H1AA 4QXKA 4KQ7A 1XBUA 1QJU3 3WHUA 5FY1A 4Y5TA 2XONA 2VNOA 1J4JA 2Y33A 1V70A 5JGFA 4UBRA 2CIJA 3DYPA 4KVME 2FSRA 5FP7A 1OQDA 2VZSA 3MRUA 3JXSA 4HN1A 4KWJA 2RG4A 2VL4A 1WCKA 4BYYA 4HL0A 4NRMA 5AFEA 1K12A 1EPWA 3I8TA 4IXLA 1OBRA 3W9AA 2V8HA 2EIGA 1SLCA 3HOBA 4Q27A 2WSAA 4PXBA 2ZOFA 3KI9A 5FYMA 2XEFA 2W92A 4RHV3 2ARXA 2HWF2 1HN1A 4Q0PA 4ZY9A 4QKDA 2CL2A 2JDNA 1UPIA 2RM22 2D4PA 2YG0A 4QU2A 3LE0A 1PK6C 2YFUA 4J3GA 5A6YA 5K8OA 5M0TA 3F8KA 2P6CA 2WNVC 1AXYA 4LBNA 2V72A 4E9KA 5CFDC 1E5HA 1ND3C 5JDBA 1AUGA 5F5AA 4EWAA 3NH8A 1V0CA 3T8WA 2RFHA 4NAOA 4CDWC 1LAJA 5FZGA 3N9MA 2Q8CA 5C8CC 3LGRA 1JZ7A 4WZCA 1U5IA 4JXQA 4CXWA 5F09A 1WW4A 1QSOA 3P1IA 2Y64A 2FCVA 5JOZA 1RIRA 3WNKA 5A7SA 4BB3A 5AC93 5LEKA 4JKLA 4OHYA 3PIGA 1Z8TA 4Q26A 4F6AA 3OB8A 2XG3A 5FK7A 2BDRA 1F15A 3NKGA 1ZO0A 3OPZA 1Y7EA 2IJZA 1AYM3 4JWPA 3ZFFA 1UKGA 4QQHA 4CCJA 3BU7A 2G3TA 3CEWA 2EO8A 4HSJA 4COWA 2DVBA 5F9TA 5BNPC 1KDMA 1VKCA 2YY1A 4L8AA 1NKGA 1OVSA 2B9VA 1CJPA 5HVHA 3PB4X 1NLSA 4UEZA 2ZW7A 5AG4A 5IVFA 2OB0A 5FYVA 3BTYA 4XQ4A 3VUOA 3JD72 4CRYB 2JD9A 1DFQA 3NE7A 3CXPA 4MZUA 1VMHA 3T1MA 4AFAA 3MLJA 2XLGA 4I30A 3K4AA 3OGVA 3ACFA 1EAH1 3DR6A 5H84A 1CGPA 4PBOA 4FTEA 3I2OA 5JSOA 3MF6A 3WP5A 2DF7A 2VXKA 3RG0A 1MQTC 1LFWA 4XPDC 2WSVA 1KXGA 1REDA 1US3A 3KF5A 3FLRA 2PIYA 5GALA 2LRPA 5EFUA 1TME2 3POGA 4A30A 4OC3A 4RQPC 1UX6A 4NIDA 4XETA 4JLYA 4BK4A 3PFOA 3ZIWA 2J8MA 1ONAA 4AGGA 4OC1A 3KLSA 1W2NA 4XE9A 5J96B 3AP4A 3J8F2 4U5YA 5CU1A 1YIFA 4NO4A 2J22A 2VCMA 1IYLA 3NV2A 3TNQA 2A6YA 4DXTA 1WW7A 3ZYGA 4HVOA 5K9YA 4OHWA 4UYBA 4KOUA 3H4QA 2ZPXA 2RB7A 4KS9A 3IWWA 1ARMA 4XFBA 5FYIA 2ATRA 2H6BA 2YC2A 1RB8G 3LEGA 1JS9A 4LR4A 2GC0A 2V8DA 1C5HA 3L9JT 4JCKA 5FO7B 4FPEA 1JYIA 4IESA 4F0YA 3KL9A 1MZ6A 3ZKUA 2WNUC 3WINE 4Q0QA 1QHDA 2C26A 1POQA 4IAVA 3PHMA 3S9LA 3VGIA 7CPAA 2BUEA 5L73A 2AR6A 3I2KA 4CUAA 2SBAA 4LO6B 4XBQA 3ZOIA 3ZYIB 5JI9A 4JTNA 2EXKA 5JPHA 4KUBA 4FOQA 2WBKA 4CDUB 3ACHA 3DF0A 2XVKA 1Q2CA 3SJFA 3QCWA 4AHWA 2GN3A 1ODNA 1RUI1 1BK1A 2CY2A 2D5FA 1DYOA 5F3CA 2ZX2A 3WUDA 5CG9A 5I0TA 5J1QA 2G9GA 2JICA 5A1FA 1US2A 1AR73 5FO8B 1ZBE3 4OHXA 4AI2A 1BQPA 1RUD2 4Q4X3 4XPVA 4YFWA 3ZZIA 4LQ6A 3D7FA 4IHMA 3BIWE 4C7IA 2FCTA 1ZREA 2FDFA 4FPCA 1X8EA 1DCSA 4OI2A 2ZGTA 4EMEA 3N9PA 3W5MA 4R8HA 3ZKYA 3AVRA 2ZEZA 2VQAA 4ES8A 4UWJA 2CAUA 5ISVA 1TMF2 3GZUC 5FMBA 4KI5M 3PLQA 1LU1A 4DINB 1IGOA 1G9FA 4I02A 1VHEA 2P3KA 1VRH3 4N7UA 1RUG1 1YQ6A 5FUIA 4CDXB 4I3PA 2HB6A 4I49A 5E88A 4XF0A 1WMDA 4TN7A 1JOPA 4B13A 2D3SA 3AMPA 1UU6A 3TYJA 3VBUB 1VAKA 4Z65A 3U11A 3WF2A 3D4UA 1S0FA 3KHCA 1OA2A 1OXCA 2XDVA 1BBT2 2BRTA 3B01A 5ISLA 2PQQA 3VL9A 2FXFA 2ZX3A 5G04L 3R9GA 1PGL2 2PVWA 1R64A 2C9AA 2ZGUA 2PJ9A 3GUXA 3H1MA 1MACA 2I74A 4XJZA 1FMD2 5BXXA 1ZG8A 2YPDA 4B1MA 2DCZA 4PCRA 3WW1A 2VZYA 1I12A 1YYNA 4NFRA 4LKFA 3TN93 5F39A 5FREA 1PMIA 1PO13 1ASJ2 3WQ0A 1XXNA 3OBZA 3FBYA 3VBOC 3NH4A 2YNCA 4RS5A 4QHBA 3CT9A 3ME2A 2RS51 3K3NA 1S7FA 2FHRA 2D98A 4QKBA 3S6GA 4R9BA 4UFJA 3RRDA 4BPZA 2O28A 3SI2A 4BJ0A 3TO9A 4HMZA 1CJDA 4K8FA 1K3IA 1R1A3 1UF2C 4P4IA 1VBA3 3J26N 4COZA 2VW2A 2VO5A 3OGRA 2FT0A 4QB2A 4P4FA 1LODA 4FPOB 2A4NA 3RI9A 4KNCA 1TNRA 4DOUA 1E57A 3W20A 5EXOA 3OGGA 3MLLA 4I09A 1R1ZA 2Q7BA 3BVCA 2LM3A 2G9ZA 5C88A 4AXOA 2P1BA 4B6ZA 1LR5A 2HH9A 3Q8AA 4MGZE 3S6PA 4FPGA 3EFAA 2WYSA 2Y0OA 2ZGPA 1LHVA 2YC0A 3H3UA 4DY3A 1YFWA 3GYAA 2A6XA 2PHLA 1D4VB 2FCUA 1XPWA 4P9GA 1COV3 4OHVA 1HXS1 3RVHA 5I0UA 3RMXA 3F95A 4EWTA 1UIKA 2MEV3 2ZHMA 2J7MA 3BTAA 3WNMA 3CDXA 1F31A 3POIA 2GANA 1RGSA 4XNHB 5KC5A 4P9LA 2UU8A 4FQ4A 4LEJA 4FXGB 4QX7A 3BB6A 3J7MA 4MADA 2B5GA 4OUMA 1NCRA 4G3YC 2YB7A 5DZGA 4LK7A 3UESA 4AVBA 2R062 3QD6A 2B4DB 3UGGA 4FSJA 4N43C 4B1LA 4LO5B 1ZA4A 1L3JA 1HB2A 1MVQA 3T2PA 5ACA3 1YGHA 2IVJA 3FC0A 4IE6A 1W9FA 4KWUA 4IEQA 4ZZ5A 3B00A 2GP5A 5GZDA 1LKNA 1RMU3 3U75A 4YW4A 3ZFGC 3M4FA 4LULA 3JUWA 1OF3A 2PHRA 1GR3A 2DCKA 3CJIA 2WYRA 2WUHA 2VNVA 3P2HA 1FATA 1Q43A 2WZR1 1IG0A 1VMJA 2P2KA 4Y1UA 4PQAA 1ACCA 1BPNA 3AVSA 3KR4A 3H8RA 5F46A 4P9IA 1IS5A 3WR0A 5FZDA 1TKJA 2HV2A 1NSLA 2NMOA 4HN0A 1KEXA 3LZZA 5JR7B 4FPFA 2PHXA 2EBJA 3OUHA 1QOOA 3BTZA 2GSYA 1ZRFA 4KZTA 1JZ2A 4AR2A 4A31A 1DQ5A 2PAMA 4CU6A 4A38A 1TE1B 3AP5A 3NQHA 1JN2P 3HEIA 2LW8A 1BKZA 2X8KA 3WDTA 5CNPA 2JDYA 1VBC2 3FIXA 4IV3A 1Q8SA 1WBFA 5EYXA 5JIAA 3IEHA 5D1IA 5C5UA 2Q5TA 3EXNA 5G22A 5LY2A 2AFUA 3VWDA 1V9U2 5JI7A 5CADA 5LB6A 2PHFA 3WC6A 4WM8A 4CCLA 3VD4A 1ZA7A 2REEA 4BQ2A 3KSCA 4Q4W2 5C9AA 5GLWA 2ZA9A 4MG2A 4CPBA 4FT8A 1QXRA 4HG6B 3UT0A 5IV0A 3D7HA 3G6JB 3DEMA 2DFCA 4CCKA 3MZHA 4ARYA 3BJ8A 2GLFA 4QX0A 3FJSA 4X8IA 2VUAA 3OEAA 4A41A 5D2AA 5A6ZA 1V6IA 1W6OB 5FPUA 4V2VA 4YARA 3E6BA 3N7MA 4AOCA 1GNZA 4LT5A 4QGLA 1LJ7A 2X53S 1LEDA 4ZXKA 3WR7A 3IDCB 4XFIA 1XSQA 4W65A 4UT5A 1AYM1 2YC4A 4TZDA 3VDCA 3V56A 4LLOA 4H14A 1AHSA 4B14A 4YM1A 1H1MA 4B4QA 4ITCA 2Z5WA 4GMP0 1AR93 1RUC2 3NL1A 3NAPA 4AGVA 1IOAA 1KWMA 4CUGA 2R043 4BXSV 3POJA 2WFPA 1VIWB 1YVKA 3CXSA 4MY0A 2BFUS 4NGQA 4H3WA 4OKOA 1QOTA 1UZYA 2Q0AA 4HANA 4NHXA 3FHIB 3C26A 2AACA 3B2YA 4QPIB 3MHZA 4IGPA 5FP8A 1UMIA 3B3WA 4QXBA 4JVAA 4H7LA 4NJ4A 1G7YA 2W1WA 4OMEA 3EC4A 4S2FA 2YYOA 3RZZA 3I3QA 4A3XA 4Q1RA 4KGGA 5H86A 4O9GA 3HBKA 5DQ0A 1XJOA 1KS4A 1VP6A 1DGWA 5GLZA 2VZOA 4DZGA 2I00A 3VWEA 4IETA 1POV0 4KVXA 1LOFC 3EO4A 1RUJ3 1I1DA 3ILRA 3D4KA 4Y22A 1Z8LA 3RNZA 2VE1A 4NPRA 4Y26A 4YVSC 2GH2A 2ZACA 2CTVA 5KHGA 4XQWA 3FHQA 1ENSA 4Q0SA 8CPAA 3WQBA 2JKBA 3AYCA 3DCQA 3BALA 5CZKA 4N53C 3TOAA 3KCXA 5E16A 1X8MA 3KVAA 3B9CA 4XW3A 1WD4A 1VBD3 4FAHA 4CRQA 3ZXLA 2RV9A 2J1RA 2VMIA 4FTSA 1UZZA 3THDA 2VOVA 3B35A 1SDDB 1M4GA 2XLFA 4R9AA 5I0SA 4A45A 3THTA 3FFQA 3WEZA 5F37A 1RHI2 2JD4A 2DF5A 3FL7A 3WNOA 1MS0A 3H9AA 3FF3A 1QKQA 4IEXA 4JDOA 4JGYA 4ZY2A 2O53A 4GH4A 2J1EA 4YYOA 2Z10A 4GAZA 3BN6A 1UWWA 5IFTA 4HONA 5JIUA 3IKWA 3KHXA 2JXAA 4TWEA 1PIV3 4RFT0 2B5HA 4EN9B 1GHEA 3JTKA 2WR9A 3HVDA 4B11A 4DY5A 3E5UA 1A6CA 5FBZA 3THPA 1VBE2 2W9XA 4OIWA 2XUMA 3KGQA 2C4XA 3RQ0A 4H89A 4A39A 4C2YA 2W1QA 4KWLA 4JDNA 4PSXA 3W58A 1W8FA 4IE4A 3IN9A 1CZSA 1XE7A 4ASMB 4Y1VA 1RXTA 3ZYRA 1E5IA 5HCBA 5FIXA 4CXXA 2RS31 4KLVA 1BVP1 1BCXA 2WABA 1AUYA 1K5JA 5EMIA 5LRGA 5KHHA 4A7ZA 3C2UA 2AENA 1ZBE1 3VHOA 1PZ8A 1FPN3 2JG9B 3WW4A 4KU7A 4XJWA 1XRUA 4COUA 3H3LA 5E8AA 2D7FA 3WZ1A 4HKOA 2PDOA 2Z3KA 5GZCA 4CUCA 1WK4A 1NLRA 1S5KA 3D3SA 2XB6C 5D8AC 2P4EA 4IGQA 4AI0A 2VCAA 2D44A 3BHXA 1QH6A 1NA1A 5T5OA 5EV7A 1LHWA 3UK9A 1AR63 2F17A 1VRH1 3M8LA 2JKXA 2HWB1 4XTMA 4A4AA 2PQ8A 2A73B 1QQP2 2CNTA 2WZR2 2XJRA 5JMOA 3AYEA 2OQ7A 4CDXC 4YFZA 2JG8C 3CO2A 2PJ6A 2JLMA 4GB33 2A7AA 4HSLA 1R57A 3KS7A 2PJ3A 2KA3A 2F4PA 1YFUA 4D8MA 3VBUC 2ZW5A 1IOFA 3FXTA 3KT4A 3MGDA 4ZI6A 3PU3A 5J7MA 1VIXA 4RGGA 1SLIA 4AG7A 1XF8A 4U9ZA 5KBFA 4Y24A 3V0AA 3EQEA 3VARA 4X6RB 5HCAA 4A94A 5LBBA 1PVC2 4LO4B 1IOIA 4BE3A 4Q38A 2W5FA 4LBQA 4Z07A 2BO9A 1O7FA 1BOBA 3ZXGA 2O8QA 2F7VA 5A33B 4COVA 3SH5A 1SFPA 4LUMA 3HIFA 2ZENA 1YI7A 5FTTC 1K5MC 4M3CE 1XFOA 5LYLA 2IXJA 1MS5A 2ZHKA 5FP3A 2BTVC 4XMAA 5CKMA 1C1FA 1Q8OA 3NNLA 4Y5SA 2XPJA 5SV8A 3PVNA 2E31A 4L92A 2OZUA 3I3BA 3ZIXA 1XU2A 1R1A1 3AJYA 5EZWA 3KM5A 4BD9A 4YG0A 3VBHB 1X9TA 4DXZA 5JVVA 2HWF3 2YV8A 3TE4A 4CU7A 3AKQA 3S5AA 2N7GA 3HQRA 3ZSMA 2RM23 5C7GA 5EWSA 5F32A 4ZHNA 2BGCA 2ZEXA 4AEJA 1O6UA 3URFA 1ZRRA 2QQMA 4A3ZA 1ZG7A 4HNYB 1SPPA 2X29A 4MHYA 2QECA 4O7XA 2KM2A 1VHOA 1S0GA 1BEV2 3THCA 2R071 1QJY2 2QKDA 2O8OA 1COV1 5LRJA 4LQRA 3LIGA 3GBWA 2HWC1 3O1PA 3SCFA 2MEV1 1KDKA 2RR12 3MPBA 5AG6A 4MUVA 2GC2A 3PDQA 1RO5A 5FYZA 1RVF1 2ZAAA 5KHIA 5FMCA 3AMHA 4GQ7A 2B4KA 1GBGA 4K6BA 4PLNA 1E5SA 4MGKE 1W8UA 1KJRA 2W95A 3WF4A 4DB5A 2ZKNA 1DG6A 5J37A 1RINA 4LBKA 4EYUA 4NN0A 5ACA1 4KOVA 3P5BA 2P3YA 1LGCA 4NCZA 1IICA 1RMU1 4BIOA 2FL4A 3DSBA 2EIDA 2FMYA 2YHJA 4L0PA 4PF5A 4LKEA 3GLJA 2ENRA 4UAPA 5LRSA 1OC1A 4MHZA 4XFHA 4A42A 2JIJA 4AGRA 1F57A 4LPLA 1DTDA 1IB1E 3J7HA 5CPAA 2KR2A 1HKDA 1EE3P 4LHKA 4CP2A 1ULFA 5CFCB 2G4IA 3I97A 5C33A 3LFIA 1IPJA 3JD73 5AGEA 1WMXA 3ISXA 2VU9A 2P3JA 2WO3A 3OEBA 1QF3A 1AYN2 3RYRA 1O59A 4NGMA 1GQHA 2Z3LA 3K48A 1QXJA 3BKZA 4MFJA 4AFMA 2C0ZA 2OVUA 5K0UA 3V65A 3WG3A 1CBXA 1YIPA 4RR3A 4K3NA 3N7KA 3O1MA 5FUNA 3JBG2 4JYWA 3HLPA 3NNMA 4R4XA 4CSWA 3D66A 3ZR6A 4QKNA 5IUQA 5ABJB 3VDAA 4RS2A 3OPTA 3N36A 2VEZA 3S7IA 4OUEA 2D6MA 3TEYA 2JDHA 4KG0A 1AXZA 2AFWA 3NJXA 1N3PA 1QIQA 4UFXA 4NVPA 5FMDA 5GZEA 1TME3 2W0XA 4CYQA 3BXMA 1RYYA 1LULA 3Q8EA 1R091 4EJRA 5B2GB 2DWRA 4ATEA 4HK9A 2Z3PA 4BQ1A 1QJFA 3O14A 1D2SA 4IUSA 3KZWA 1J1TA 2EF6A 4E2SA 3VBFB 3K4DA 3PU8A 1Z5RA 3J8F3 2J1VA 1PM4A 3OBTA 4QQPA 3DYMA 2CNSA 1U5XA 1S7NA 5HMNA 4D94A 1LAPA 3IDAA 3P3NA 5FYBA 2CTBA 5F47A 3SI1A 2J9AA 5FP4A 1UOGA 4LKSA 2R6QA 2FDIA 2WNEA 4XJUA 2IXCA 2PHUA 5CIRA 3JU9A 3EO6A 1HB1A 2PJ0A 5C3PA 3JZVA 1OOPA 4JZ0A 2IXHA 4UFWA 4AHZA 3MV01 2HJIA 3WOGA 4Z2WA 3EXUA 1UMHA 2JB8A 4UBHA 5HXVA 2PJCA 3PMEA 4I3GA 5GZFA 4QVTA 5IWFA 5JZGA 3CLPA 3SEEA 2Y60A 4A37A 4CGLA 4HKWA 4CZSA 1Z7S1 1GZWB 4XJ8A 1NCQA 3I2DA 3ZFFC 1APNA 3O12A 1JZ5A 3ES1A 3MIGA 4AQ6A 4OC4A 2R041 4B12A 2CWMA 3TEWA 3D8PA 1R082 4XUQA 4CXYA 3S6FA 5JMCA 1CESA 5EP9A 1WCSA 1BAVA 2P6FA 2DXQA 4Y4YA 5IVBA 3LD2A 3ILFA 4B7KA 2YUEA 3ZLIA 2PFWA 2EVXA 2WKKA 2W3JA 4EZHA 4P45A 1JYTA 2XJQA 2WWUA 1NZIA 1RUD3 2ZEYA 4WJBA 1ALYA 4PT6A 1WCDJ 2H0VA 5T5PA 1EPZA 1ZZ9A 2D43A 5JOWA 1RUNA 2X5IA 3E0KA 4OYUA 4LORA 3FB3A 5B4XA 2YNDA 4CS0B 2XBO2 4OQ9A 3QH6A 3U10A 1TMF3 3WF3A 5FY7A 2P17A 3SKJE 1RUJ1 1W0PA 2MHFA 3IAPA 4LO8A 1PCAA 1Z4RA 5A70A 2Y34A 3M3OA 2QQKA 1G86A 2DTYA 3QOPA 3U37A 2QQPA 2PLV1 4CPBD 3ZSJA 2D6OX 4XDPA 3VZKA 1BBT3 2WS92 1IIDA 4XZUG 4GKYA 1Y9GA 3B3SA 4I0BA 1KITA 3T09A 3ZM8A 1DQ1A 2Z11A 3WW2A 3RJRA 4C7HA 4A2ZA
chains in the Genus database with same CATH topology
1VAMA 1IQAA 3R05A 3ZYGA 4HVOA 1SEFA 4TSVA 5K9YA 1FMD3 4MFQA 4CDQB 3R9EA 1GLHA 2FQPA 4HK8A 1U5ZA 1H2KA 2PRBA 4OHWA 1OI6A 1SFNA 4PJYA 1JTZX 3KT1A 3ZSEA 3FMGA 4QM8A 4CEYB 3BOPA 1PO22 1VBA1 1Y3TA 3AXDA 1HV0A 4KOUA 3I4IA 3H4QA 2ZPXA 1MZEA 1KUYA 4KS9A 1F9KA 4HVRA 1Z78A 2NLRA 4XFBA 4OFGA 1UU5A 3AM2A 3G7DA 1AL23 3MICA 2WNVB 1R093 4COYA 2H6BA 4JGYB 2ATRA 3ZXAC 1N1TA 2XJSA 1ASJ3 1C8M2 3POYA 5IT6A 2VQ0A 3WCRA 4BHPA 2OA2A 2QIRA 2XWJB 3MW2A 1RB8G 4CAXA 2HWD3 3MF9A 4E0AA 4LR4A 1SQ4A 2GC0A 1F2NA 3RMYA 2JDZA 1C5HA 2LUWA 3L9JT 4I0WB 4JCKA 3ZMOA 5FO7B 3VDDB 1W6PA 2PR8A 4FPEA 4JGZB 1ND3B 4XF1A 2WUUA 4LO7A 1JYIA 4IESA 3I59A 4F0YA 1S0IA 2VW0A 1MZ6A 3OY8A 5GLVA 4AK3A 4IERA 1ZBA2 1RITA 3FUQA 2WNUA 2WNUC 3WINE 4Q0QA 2DPSA 1QHDA 2E51A 2X7BA 4CDWB 3VBRA 3VBRC 5KHKA 1H8TA 1H8TC 3LSEA 3WQ7A 2TEPA 3PHMA 2YZ4A 5C8CB 2ZS6B 3UJOA 1AYM2 3UKTA 3VGIA 1L0CA 2AE6A