4ONUA

Camp-binding acyltransferase from mycobacterium smegmatis, e234a mutant
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
332
structure length
314
Chain Sequence
AELTEVRAADLAALEFFTGCRPSALEPLATQLRPLKAEPGQVLIRQGDPALTFMLIESGRVQVSHAVADGPPIVLDLIIGEIALLRDAPRTATVVAAEPVIGWVGDRDAFDTILHLPGMFDRLVRIARQRLAAFITPIPVQVRTGEWFYLRPVLPGDVERTLYRRFQSVRKPTRALLEYLFEVDYADHFVWVMTEGALGPVIADARFVREGHNATMAAVAFTVGDDYQGRGIGSFLMGALIVSANYVGVQRFNARVLTDNMAMRKIMDRLGAVWVREVVMTEVDVPPVDTVPFEPELIDQIRDATRKVIRAVSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyltransferase Pat
publication title Allostery and Conformational Dynamics in cAMP-binding Acyltransferases.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
total genus 93
structure length 314
sequence length 332
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4onuA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4onuA02
2CNTA 3USSA 3KGZA 1JUHA 5I0TA 1KUXA 4CAXA 4XF0A 3IIAA 2Q1ZB 1Z4RA 2H5MA 2K5TA 1IPJA 1HW5A 2D5HA 5KTDA 1L3JA 3NJZA 5F48A 4QGMA 1DGRA 4IERA 4XFBA 4LUMA 4F0YA 4CYDA 4J1XA 2KCWA 4Q0UA 3BPZA 5LRSA 1O4TA 3WW4A 1O3TA 4JD6A 2HKXA 4KOVA 2EVNA 3K9UA 2CGPA 4JTNA 3FJSA 4UBRA 2PAMA 1O5LA 1VHSA 2R7HA 5KTCA 1ZRRA 1EP0A 3LAGA 2R98A 3I54A 4XPKA 2VI7A 5JPHA 4KUBA 1CAUA 4YNIA 2KXLA 4HVQA 3R9GA 5J8CA 4FAHA 5C82A 1WA4A 1U6MA 4WZCA 3H7JA 3IBMA 2GIVA 2VQAA 5KHKA 1Y9KA 4XFFA 2BEIA 2OH1A 4NVPA 4O9GA 2PSWA 2HV2A 1OFNA 2ZCWA 2VXKA 4YRHA 2GH2A 4H6UA 5I0CA 3DV8A 1ZX5A 2X7BA 4B29A 5LEKA 4D7TA 3BCWA 2J8MA 3GYDA 3DNSA 3FYNA 4JWPA 3RYRA 3MYXA 4IEPA 2Z2SB 4AVAA 4YYOA 3C3VA 3TO7A 4K30A 2PFWA 2HUZA 1K4JA 3U10A 3UKTA 3MZHA 4UWJA 2ZKLA 1Q3EA 4J3GA 4MY3A 2F4PA 1XF8A 3D2MA 4E8OA 1Y9QA 3SCGA 4R9MA 1QY4A 1ON0A 2VECA 1ZNPA 3N4MA 2BUEA 1ZZ7A 1X82A 1X8MA 2OZUA 2WPWA 1H1MA 3I59B 3FB3A 4LULA 1I21A 1VP6A 1S3ZA 1U12A 1YHFA 3FBUA 3RDIA 3B8GA 1ZRCA 2IC1A 1V70A 1J4JA 3D2PA 3PP9A 1FT9A 5KHHA 3RYOA 2JDCA 1Y9WA 3TOAA 2HJIA 1BOBA 3DL3A 3LA3A 3P2FA 3TE4A 2PQ8A 1R57A 2FMYA 2C0ZA 3PVBB 3JVNA 1SQ4A 1YVOA 4OFGA 2B4DA 5IB0A 2G0BA 4FD6A 1XE8A 2WFPA 1S60A 5CU1A 5C8WA 3LD2A 2IXCA 3OD0A 1FI2A 1B87A 5KHJA 3F8KA 4L11A 4LTAA 3M3IA 5FCCA 4BIFA 5FQ0A 1P4NA 4KZTA 3I3GA 3OWCA 4IEXA 4BHPA 3SHPA 4QUSA 3LWCA 4R52A 3VWEA 5JR7B 3QACA 3CLPA 2QECA 2PA7A 4AB7A 3WW1A 1O7FA 4AQ6A 1ZVFA 2P6FA 1WLTA 4XPDB 3FNCA 1PUAA 4B5PA 3DKWA 3CL1A 1EY2A 3IDCB 4CS0B 4R87A 4HVRA 2IL4A 2FQPA 3ZZIA 4O9EA 1YGHA 3O14A 4E2GA 2GC1A 5D1IA 5E1RA 3RPQA 3TOBA 3FWEA 1I6XA 5JAXA 2OU2A 3MDPA 1Q5OA 5J3UA 2REEA 2N7GA 1XIXA 2XGXA 3BU7A 1UIKA 1VJ2A 3OCPA 4BH9A 4KOXA 3H50A 1ZREA 4LUKA 2B3VA 2VPVA 4N9HA 4XFIA 2FIWA 1YFYA 1UW8A 4I0AA 2FCKA 3LOIA 2ZXVA 5JSPA 5EC4A 2PYTA 1I12A 1QXJA 3I9SA 1LRHA 4KOWA 2CAUA 4DNCA 3QOPA 2Q0AA 4XEZA 2FT0A 1X8EA 2ATRA 1ZZCA 2BYVE 3BB6A 2FIAA 3FXTA 3QB8A 5ISVA 2Q4SA 5DWMA 1V0CA 3H7YA 4ZU4A 5EZWA 4AQ2A 5CADA 4I2OA 1WK4A 4E2AA 2QJVA 2FE7A 2ZW6A 2B3UA 2QIRA 4HMZA 3TO9A 3R1KA 3R9FA 2B9UA 3IDBB 3NL1A 4R8HA 1CM0A 3IWZA 3HT2A 1Q2DA 1CAXA 1UPIA 2DCTA 3VHRA 4UBHA 4X5KA 5HMNA 2VEZA 2EAAA 2NMTA 3ES1A 3KGLA 4HNXB 3DDDA 4FAGA 4NSQA 4CRZB 2Q30A 3EY5A 4Z82A 1KZFA 1M44A 4MY0A 5KHGA 2D5FA 4H7LA 5FLHA 2Z11A 3UKNA 1M1DA 4OAEA 3TNQA 4DINB 1VR3A 2BGCA 2IXLA 4PK3A 3SCFA 2QVSB 4UA3A 5E96A 1RTVA 3FFQA 4EROA 3R6SA 1SEFA 3LODA 3NVCA 4QB9A 1Q43A 2OPKA 4MGYE 2OB0A 1ZRDA 3CO2A 4OLLA 3S7IA 4QVTA 3CXQA 1NXMA 2K9ZA 2O8QA 1UFHA 4I0BA 4I09A 3NE7A 3F0AA 1J3PA 4KVXA 3C26A 5C88A 4KOTA 4IESA 2J8NA 5I8YA 1OMIA 3SMHA 1RUNA 4L2NA 4IEQA 2I79A 3D8PA 4AVCA 4FD7A 1UD1A 4MHDA 4YFJA 2VQYA 3EO6A 2IXIA 2B5HA 5LEJA 2EUIA 3R9EA 3ZDSA 4N9IA 4AG7A 2OA2A 2PTMA 1WGPA 1QSOA 2XKPA 5BXXA 4HKFA 4LX9A 4U9YA 1UCXA 3TNPB 5I0SA 2H0VA 1P0HA 4YARA 2UYBA 2EA7A 3ST7A 1J59A 4KWKA 3PNAA 3PGPA 3TT2A 2B4BA 1WWZA 4I02A 3RZZA 1YR0A 5C6CA 3H3UA 3ACLA 3UKVA 2CV6A 1RO5A 2D4OA 4XFCA 1O3SA 1IPKA 3SCHA 4QC6A 1CAVA 3L2HA 2UY8A 4HNWB 3OTFA 2GANA 2XLFA 1DGWA 4FBFA 4MV2A 4X6RB 2PAKA 1LB2A 4HVOA 4YRDA 2CNMA 4I01A 2BEOA 2Q44A 3E5XA 2I45A 1DZTA 2F5IA 4UWIA 4HSLA 2GAUA 1I1DA 2ZW4A 3GBFA 4FT8A 3DR6A 3WW3A 4XFAA 2MHFA 2OYZA 4XETA 1M4DA 4XF3A 5EFUA 1QXRA 2R8VA 2BNOA 5H84A 1NZCA 3H8UA 4U5YA 3CEWA 4KOSA 2WC2A 2MNGA 3LZZA 4PIYA 1CAUB 4IEOA 3T90A 3S7EA 4EWEA 3BLNA 2FXFA 4TLFA 2B8MA 5T3NA 1OD5A 3D0JA 2OZGA 2XHKA 4QXKA 4GS4A 1TIQA 1FXZA 3KKWA 3TCVA 4KOYA 3W91A 3HIFA 2GC2A 4JVAA 3G8WA 4MGIE 2QNKA 4RS2A 2DXQA 2ZPAA 5I0RA 1ZRFA 1I5ZA 3DR8A 1NMTA 4R3LA 4II9A 4IEZA 5FLJA 4BYYA 4ZU7A 3GKRA 2Z10A 4AVBA 5BV6A 2VZZA 3WR7A 4XF1A 4I3PA 1IB1E 2Q4VA 3DN7A 4QGNA 2K0GA 3T9YA 2OZJA 5I91A 5J48A 2HQYA 4JTOA 4OADA 3V8IA 1YREA 4JXQA 1O3QA 2JDDA 4QM8A 2ARHA 4PJYA 5I8TA 2H6CA 3EO4A 1EYBA 5FLIA 2O28A 5GCNA 5BY5A 1YK3A 3EFAA 1CAWA 3JZVA 4K8FA 3H1WA 2XL9A 1QSRA 1CAVB 2PR8A 3S6KA 1VKCA 3TTHA 1XRUA 1Z4EA 4MGKE 2PAEA 3WW2A 1KUVA 4R3KA 1GHEA 4Y49C 3TO6A 2CNSA 2PHLA 1J3RA 1GQGA 3U0ZA 4AXOA 1PU9A 5JQ4A 2A4NA 2FSRA 2Z69A 2D4PA 1LKNA 4Q0PA 1B6BA 2ET1A 2B4DB 2PDOA 5F47A 3UY5A 4X6QB 4HN0A 4MI4A 1ZZBA 3SXOA 2XLGA 2EVXA 3H1MA 1S7FA 4XFGA 4B5OA 4PSXA 1PMIA 1IICA 1QWRA 4HLTA 3IWGA 4LEJA 4IEUA 1N71A 5FQ0B 2PQQA 4M85A 1OI6A 4LUAA 1SFNA 2ZW7A 3W6SA 4CRYB 4JLYA 5BPXA 2VBQA 3ROUA 3OF1A 1ZZ6A 4PIZA 1RL3A 1YWKA 4U9ZA 2BSWA 2ATFA 3NKTA 1NE6A 4MZUA 5JSOA 4KLWA 4YSFA 3RNSA 3H9AA 4IEVA 2IXHA 4P9GA 3CF6E 3FX3A 3SHRA 4F8AA 2GE3A 4HBNA 3B02A 4IF5A 4B5PB 1Z9UA 2G3AA 1RGSA 4MGZE 4NCZA 3ZJ0A 2FS5A 3I59A 4HN1A 5F1RA 2OZHA 3U11A 3HQXA 4QX5A 4KORA 1O5UA 5F46A 4LA3A 2BNMA 2IXKA 2I00A 2D93A 1GQHA 5DWNA 1S5KA 4QM9A 1M4GA 2WPXA 4ONUA 4ORFA 4JV4A 1ZZ8A 5I93A 1XE4A 2VZYA 4M3SA 4F7ZA 1S7KA 3EC4A 4JJXA 1H1IA 3KSCA 2ZW5A 1YUDA 3N7ZA 1L0CA 4EV0A 3S0MA 1IYLA 3DSBA 1XEBA 5BUVA 3D3SA 2Q4YA 5HH1A 4J1WA 2RC4A 2GC0A 2GC3A 4ZU5A 2BNNA 5K8SA 2O1QA 3EHKA 4H6ZA 5H86A 1LRZA 1PM7A 1CAWB 4WBBA 5KHIA 4L89A 5FDBA 3E0KA 4YGOA 3CXSA 3P2HA 4XNHB 5J7MA 3W6XA 4Q0QA 3TFYA 3H1YA 4KLVA 2GU9A 2XKOA 3FE5A 1CJWA 4KOUA 4FD4A 2Q7BA 2J8RA 2CY2A 3ELNA 3E5UA 4EWAA 2PR1A 2E9QA 3EQEA 2QDRA 1CAXB 4Q29A 3H4QA 1NSLA 4KL1A 4XF9A 3HT1A 3QAHA 4MJ8A 4XF4A 4XNHC 4NEXA 1OZPA 5IV0A 1J1LA 1YFXA 3EJKA 2UY9A 5EBVA 1KUYA 2P6EA 2Z0ZA 3EXNA 4EVYA 3D0SA 2Q0YA 3BJ8A 3IGRA 5HI0A 3S6FA 1YLLA 1QSTA 4JXRA 3KMHA 4A2UA 5I0UA 1IYKA 5IX3A 3FZ3A 1G6NA 4KVME 3CJXA 4MX3A 3ETQA 4IEWA 3G3SA 4PK2A 2D40A 4R57A 5KBFA 4UXAA 4D7SA 1YFUA 1XE7A 1RXTA 2PRBA 4L8AA 3PLQA 4IETA 1J3QA 3MGDA 2AJ6A 1MJAA 3BJ7A 2H6BA 2XLAA 3G7DA 4MH0E 1NE4A 2REFA 5AVPA 2XL7A 3PZJA 4CAVA 4EWDA 1CGPA 1QSNA 1MJ9A 5FVJA 4MBUA 3E6CC 1RUOA 2B5GA 1YX0A 4QBJA 3NSTA 3R96A 1J58A 2QCSB 3E97A 3SXWA 4LA2A 1YLEA 4BMHA 4QGLA 5E16A 3EBRA 1Y3TA 3VWDA 5CVRA 1RC6A 2BL1A 2P17A 2B58A 3CXPA 5KTAA 1XMTA 2OZ6A 3LA7A 2JEVA 4KU8A 4FD5A 1ZZ9A 4IEYA 4XPLA 4KU7A 4KWLA 4HZFA 3E6DA 3FIXA 2UYAA 2Y0MA 3F5BA 4H89A 4PSWA 4E0AA 2G3TA 3R95A 4NF1A 1SQHA 4Y49B 3LA2A 4WVZA 5FPZA 1NE9A 2ET7A 3JUWA 4I49A 5J8FA 3MPBA 4IUSA 1MK4A 4MUVA 1IIDA 4HNYB 2PC1A 2V09A 4XFHA 2FL4A 4NXYA 4META 3H3ZA 3RYKA 2P0WA 3GYAA 4KUAA 2ETEA 3E6BA 1Y7RA 2Y0OA 2CAVA 2IXJA 5JCTA 4XPDC 4AG9A 4HSJA 5F49A 3D82A 2GZWA 2JLMA 4KVOE 3E5QA 4LLOA 1MJBA 4F6AA 3BALA 3S6HA 5LRRA 3RYPA 1O3RA 2R1IA 3I7DA 4Q0VA 4CAWA 1NYWA 1BO4A 1EPZA 1S7LA 4RD7A 5FPXA 3ES4A 5CNPA 1YFWA 4QMAA 3FRMA 3KCCA 3M70A 5I8SA 1DZRA 4E2SA 1M4IA 2QMLA 5JSRA 1S7NA 3GY9A 4KWJA 4E2QA 3OGJA 3NW4A 2C27A 2Q04A 1Q2CA 2P6GA 4GULA 3S6GA 2PHDA 1QSMA 1CX4A 4PIXA 1Q2YA 1YVKA 4ZBGA 3FHIB 4Z07A 1TQ5A 1FY7A 1LR5A 2AE6A 4PV6A 1X7NA 2MPFA 4UBGA 1UIJA 2B5GB 3SXNA 4Q0SA 4RI1A
chains in the Genus database with same CATH superfamily
1H6YA 4MCSA 5H9PA 5CAZA 1F4AA 1R3NA 4EZ4A 4AI0A 2HWE3 4QDQA 5C3PA 1QF3A 3PUSA 2CGPA 1DZQA 4UBRA 3LEGA 3RI9A 2IWGB 3ZIXA 1N1SA 1OFNA 3POWA 3MIFA 4EN9B 3W21A 2J8MA 4MCQA 1AXYA 1RYYA 4Y5Z0 1KWMA 2W46A 2YNEA 1DLLA 2XBO2 2F4PA 1E5SA 3PL0A 3N4MA 1MZ5A 1SCSA 3NH5A 5FYBA 2Z3KA 2DVFA 1BZWA 3IN9A 3CJIA 2FMYA 5HVGA 4A94A 2A71A 3HVDA 1COV1 5KHJA 2BV4A 1SZBA 2XWJB 4S2DA 2YNCA 3I3GA 4YW7A 5EYXA 4QUSA 2R042 3VZKA 1UXXX 3DKWA 3CL1A 4RGAA 4OKOA 1KEXA 3U4SA 1LHOA 4QWNA 4LJHA 2N7GA 2BRTA 3OCPA 4CUBA 2ZELA 1ZREA 3OUIA 5EC4A 4ZX9A 1N3QA 5A28A 4KOWA 3POYA 4YZ4A 2ZABA 1GQPA 4CU7A 3O1MA 1TF8A 2WNVA 3BB6A 4TXWA 1OT5A 4X8IA 1AR83 2VZ1A 3RQ0A 2ZW6A 1DQ2A 1YQCA 3C7FA 1XSQA 3NL1A 1SPPB 5F39A 2DVBA 3B3SA 2PVVA 1AYN3 3THTA 4N53C 1RMU1 5IB9A 4Y22B 1JWQA 4OLLA 4TTGA 1R091 5T5LA 4CXXA 5EYYA 3VL8A 3SMHA 1CBXA 4N90A 3RWKX 5LEJA 1SCRA 4P4FA 1Z8XA 4KSAA 3O12A 2UYBA 2EA7A 2AEYA 5JMCA 3PGPA 3TT2A 4YU9A 2HWB1 2CV6A 1HN1A 4BM8A 4XFCA 1O3SA 4OUMA 1C3HA 1B35A 1PGL1 4OP4A 5FUPA 5K8NA 4Z1VA 4Q4V3 1NY71 2VQUA 1VMHA 1APNA 3D5OA 1M4DA 1W9SA 1H8TA 4NHKA 1MR5A 5F5IA 3MIBA 1WW6A 2WC2A 3T0DA 3K75B 1V6OA 2B8MA 2QDNA 1W6OA 3D0JA 5CYYA 4GWNA 3ZXLA 5DXDA 3VKOA 4O65A 1OQDA 2AH2A 4JXQA 3ASIA 5A3OA 2JDDA 2XDVA 5L73A 4EFDA 1S0GA 2Y38A 1G9AA 2WABA 2ZGMA 4C7HA 3N7JA 5AFBA 3HBZA 1GHEA 1GQGA 3VBFC 3LF7A 4GWIA 4LO4B 1HRV3 3BODA 3JRUA 3T3YA 4RR3B 1OI6A 1H30A 3OJBA 3KQZA 4YFZA 1Z5RA 4U9ZA 2WSVA 4MZUA 5JSOA 1OKOA 4B8EA 1NA1C 3PDQA 1GV9A 2WO1A 4UEFA 1ENSA 1EV12 2W68A 1YJKA 4YVWA 4AHXA 4WVWA 4UFIA 1C1FA 1IYLA 3AZYA 5HH1A 1ENXA 1W6PB 5K8SA 4H6ZA 1W8ZA 1PMHX 3NNMA 2O14A 3WNLA 1MVEA 1UY1A 4OHZA 1VALA 4EWAA 1DTDA 4Q29A 2Z3NA 1W6QB 2J1RA 3AP4A 1DQ6A 2DVAA 3MN8A 2XJQA 1IYKA 3FZ3A 4KVME 5FP8A 3ETQA 3L2YA 5KBFA 1W2TA 1OLRA 1NT0A 5F3IA 4B7EA 4MHZA 3T2TA 3E6CC 2VZVA 4K21A 2VC9A 2P17A 1TNRA 4DYOA 4JZRA 4H2KA 1W8NA 1UO9A 3WF0A 2WKKA 4CEWC 4ZONA 2ODFA 4I49A 2BGPA 3MPBA 3PTRB 5A3NA 5JXJA 3IEHA 5EJZB 2P2KA 2NP0A 2IUWA 3BGAA 2JDAA 2ILMA 3HAGA 1K12A 3V0AB 2R1IA 4QPIB 3OYWA 4DIQA 1UZ0A 1I5PA 4KG0A 4DUVA 2C27A 4PF1A 2WO2A 2V4AA 3R4DB 1GYTA 4UBGA 4OI4A 5CISA 1HW5A 3DEMA 4RYDA 4CPAA 2XVLA 2EXHA 5FYUA 1C8M3 5IK5A 2V8DA 4PBOA 3WNKA 3VDDA 3OGGA 1ONAA 5C82A 3H7JA 2QQKA 1LOCA 4DUKA 3WC7A 2YGWA 3RJRA 5C4WC 4IW3A 1C28A 5KC5A 1COV2 2P3IA 1IHMA 3PIGA 5DDJ1 2LTNA 1BXHA 1PK6C 2WAOA 1JYVA 1S3ZA 1QJU3 1IS4A 1SFYA 2R32A 3TE4A 1A8DA 2Z5WA 1VBE3 1GZWA 4RS5B 2JG8C 3JCIA 1B87A 5CFDA 4TWTA 3O0WA 3HOBA 4XPVA 1WLCA 3CLPA 3VBOA 4AQ6A 1IPSA 4CGLA 1H4GA 1YGHA 2EXJA 4P14A 5E1RA 3TBDA 3HN3A 4JYWA 5CG9A 1YFYA 1HB2A 3KZWA 2FHRA 1JW6A 2Y6FA 2BTVC 3QOPA 4B6ZA 1AX2A 1LNSA 2JIJA 3TYJA 3GIUA 1RUE1 4C68A 4BPZA 3AK0A 4INDA 4A6SA 3DGVA 2AENA 1RMU2 1S1AA 2EO8A 3DDDA 1B09A 1M44A 1KZFA 5A3TA 1R092 3K46A 4H7LA 3Q9OA 4KG8A 2VMCA 4ZY9A 4SLIA 4QPYA 4YG6A 1XQNA 1KJRA 4FOWA 3J7MA 3SLIA 1JU3A 2OPKA 3KHCA 2OB0A 3IAQA 2W39A 4OUSA 4QPWA 4Y5TA 2PJ6A 1UFHA 4QXCA 1LJ7A 4TN7A 3AP9A 1J3PA 3ZFGB 5GZDA 2B5HA 1M4WA 4BZ4A 3V56A 3AZXA 2BVVA 1AX1A 2Y64A 2AFZA 2C1FA 1NY72 4K1ZA 2D98A 1H0BA 5C6CA 3ACLA 3QH7A 3OG2A 3IIIA 1E5HA 1VBD3 3OSDA 1W03A 3VKMA 3B2YA 4P5YA 2Z42A 2BNOA 3Q8FA 3IB3A 4CU9A 3S6PA 4OIWA 4YVSC 1ZA4A 1LU2A 2PJ9A 5HXDA 2VOTA 1R1ZA 4BIOA 2PJ5A 1RHI3 2RR13 2ZPAA 5F6LB 1OSGA 3P3PA 5FJKA 2GP3A 4LHSA 2Z10A 1ZYBA 4LQ6A 4YVWC 2Q4VA 1F2NA 1HDQA 1QGLA 4PJYA 2ARHA 4IHMA 2D3SA 3H1WA 2AC1A 5BYNA 5FZIA 2JENA 1A3KA 3HNMA 4W6WA 2A4NA 2FSRA 1VLNA 4XUTA 4Q0PA 5F47A 4XFGA 2YY1A 1OOPB 2JIGA 1ND2B 5CG8A 1UMHA 4ZZ5A 1IS6A 5CKMA 1QHDA 2XPJA 3BTZA 2GE3A 5A7OA 1YQ2A 2RS32 5LYFA 1KS4A 3WINE 4LXLA 3B7MA 4LK7A 4P5HA 5BNNB 1ZZ8A 4DXSA 1YUDA 1MVQA 1FX5A 1OBNA 1PVC3 2J7MA 2BOJA 5D8AB 2O1QA 4GQ7A 4P9LA 3I4IA 2AFWA 3I3EA 2VQ0A 4KLVA 2WA3A 4LBLA 3PB6X 2Q7BA 3TAYA 1UZWA 1AX0A 2GMPA 5FRAA 4BQ4A 1QKQA 4AOCA 4E4HA 3W5NA 2JDNA 4AI1A 4BISA 4MVTA 3NV3A 4M6GA 1OF3A 4XIKA 3BTXA 3S6FA 2ZENA 5BNOA 4R7MA 5IX3A 2I2SA 2FDIA 3G3SA 4PK2A 4YW4A 3AVRA 1TME1 2XJUA 4GJYA 1ZA7A 3UGHA 1NE4A 3K2OA 4IV1C 4PQQA 1OA4A 2B5GA 3GF6A 4AFCA 5CVRA 5DPNA 4K1YA 1XMTA 4WM7A 3HQUA 4XPLA 2ZGTA 2VGDA 4E0AA 4NF1A 2XG3A 3WG1A 2JE7A 1H2KA 1VBC1 3VDDC 4CU8A 5C5UA 5JCTA 5LYLA 2PJAA 2QQOA 3RYPA 4L9BA 1XNAA 1XNCA 1NYWA 5IW0A 1BO4A 2JKBA 1VRH1 3FRMA 2D6OX 2QMLA 1PX3A 1PZ9A 5LBEA 1KFXL 1CX4A 2VZOA 4P6YA 2OVUA 4AAXA 2ZBJA 2JDHA 3PVEA 3AP5A 4XF0A 4ARYA 3RAMA 2Q8OA 1WD3A 3E1F1 1FMD3 2ZEPA 2GN7A 5EMIA 2PCUA 4NIDA 2Z3MA 1W6MB 5KTCA 4XPKA 3NAPB 4KUBA 4NGSA 5J8CA 1QDCA 3VBOC 4BINA 1EUTA 2B9VA 1T6BX 3WP3A 5D29A 2VXKA 3WC6A 4XHBA 3FYNA 4EE2A 2NM1A 3W20A 3UKTA 4MMOA 3OGVA 4GMP3 4JHZA 2BW8A 1K5MC 3VBHB 1QY4A 2VECA 5HCBA 1I21A 1K45A 1NLRA 4YGCA 3ZKUA 4QX2A 4OFGA 4FD6A 5C5TA 4JGYB 3OD0A 5LRJA 3FH4A 3VUOA 2R30A 2JG9C 5CB7A 1WLTA 3MHZA 1AXZA 1HQWA 4O61A 3UGGA 1W05A 4D3WA 2GC1A 4BK4A 1MS4A 4DS0A 1C4RA 1K5JA 2ZGQA 3LEKA 3QCWA 3ISZA 4CAFA 4KOXA 4N9HA 3AYAA 1CIYA 4BQ2A 2XJPA 1CPXA 2Q4SA 2F4LA 1W28A 1VE0A 4UW6A 1F31A 3BI3A 2EXKA 3MO4A 2D6PA 2W1SA 2ZMNA 5FOJB 1JYXA 5DS0A 1Z0HA 3T4HB 1J84A 4UBHA 2A3YA 5G04L 4C2ZA 1RXGA 4AFAA 1KITA 4LBQA 2VVEA 1DBNA 5C9AA 3ISXA 4OAEA 4DINB 2E31A 4A42A 4MOAA 5FZKA 4QVTA 2Y6LA 4I0BA 4I09A 1VHOA 2WNUC 2BJSA 2OW4A 5DZEA 2C24A 4IEQA 2WS93 4JKLA 4O7XA 4AEMA 1RITA 4HKFA 4LX9A 4U9YA 3ALQA 2ZEGA 3TNPB 2E33A 2B4BA 4I02A 1GU3A 1YR0A 4P4JA 2RDRA 3SITA 1A6CA 3ZMOA 3SCHA 1UF2C 2R063 4RFRB 1JOBA 3VKNA 5FXZA 4HSLA 1GNYA 3MW3A 2JDUA 2J42A 4A4AA 5CBLA 3T90A 1Q8PA 3BIEA 5IWFA 1R1A1 3W91A 4B4PA 4E8DA 4AEKA 4C7IA 4XZUG 2RDSA 4FBEA 5I91A 2QQWA 2VXJA 4LO5B 3ZIWA 1EYBA 1S2EA 2HWE2 1HB4A 2XEIA 2Y8KA 3KT4A 5FZ7A 3WW2A 2CNSA 4QT6A 2PDOA 1S0IA 1QJX3 3NV1A 2EVXA 2BZDA 5IVJA 5JZGA 1CP7A 3N7LA 4IEUA 4GA9A 4N53B 4UF0B 4HT1T 4JHTA 4Q4W1 3OF1A 3KV9A 1YIFA 3MRUA 1Z8TA 4HBNA 2W5FA 1I1EA 4KSIA 1XSRA 4QX5A 6CPAA 3JD71 3OPWA 2OUHA 1F2PA 1GQHA 1FNYA 2VZYA 3KSCA 1GWLA 5C8CA 2ZHMA 5BNQA 1CAWB 4YGOA 1ELMP 3CXSA 3P2HA 5J7MA 2OT7A 4DXZA 2VH9A 4FTSA 3K2KA 4FTBA 1QJU1 3E5UA 2W9XA 4CDQC 1DDLA 1EE3P 2R6QA 5FPAA 1VBA3 5E8AA 2IFWA 4CGPA 1NQJA 2ZAHA 4PDWA 2VZTA 1QSTA 4UIAA 3ZR6A 5HVFA 1C8NA 1EAH1 4LIUA 3FUOA 2FDHA 1JYWA 1MJ9A 3CXPA 2XR4A 1KRIA 4Y1ZA 4FTEA 3FIXA 1GSLA 3WD5A 4XACA 5CBMA 3VBFB 3JUWA 5A32A 1F2OA 1AYN2 3TWIA 3GUXA 2P0WA 1R083 2Z3LA 4IE5A 2JDKA 3S9NA 3S6HA 2PHXA 3O5SA 2D6LX 4QMAA 4RGKA 1NA1B 1VBB3 1UY4A 1EUUA 4PIXA 3MGUA 2WL1A 3UYJA 3ZYBA 4UFLA 5K0UA 3QAYA 1DGRA 1HB1A 4P10A 4QQHA 4YGEA 2KCWA 4Q4V2 4HKWA 3DPRC 3LAGA 5FO9B 1CAUA 4YNIA 5FJHA 2PXJA 2XHNA 2WQ8A 5FKBA 4EQVA 1UX7A 4B14A 4LE3A 4JWPA 3RYRA 3OD4A 4GKXA 2Z2SB 4E8CA 4MYEA 1Q3EA 3D2MA 5SV5A 4E8OA 4XILA 3GM8A 1F5FA 3ZYHA 3LACA 3OOXA 1ZZ7A 4CE8A 3AJZA 3RDIA 1XBUA 3PP9A 1FT9A 5KHHA 2HJIA 1VPHA 1DGLA 1TNFA 3JVNA 5H9RA 2VG9A 5CU1A 1LENA 4LTAA 2RB7A 1F35A 4QX8A 3SHPA 2O0OA 3MV01 4IE0A 2PE3A 3I8TA 1X50A 2ZACA 1EY2A 2WFF3 4AHWA 5JAXA 3OB8A 4HPKA 2Y26A 1HV0A 1UIKA 1E57A 4UW3A 1RINA 2EK9A 1POV3 5FY9A 2VZ3A 3FXTA 5ISVA 1N1TA 5FBJA 1NLQA 2E7AA 1XRYA 2QIRA 3CJIB 2JX9A 3IWZA 2UWBA 2RJKA 4WV8A 2LUWA 2P1BA 1OA2A 3FLTA 3UKNA 3AXDA 1SFPA 3K77A 4Y3OA 3RGBA 1Z8WA 4QB9A 3ZFFC 2YC2A 5C4WB 4DXRA 1WUVA 3T4VA 2CY6A 3AP7A 4H14A 3ZDSA 2PN5A 2PIYA 1PK6B 4JGZA 4JDMA 4CZSA 2G4IA 4UT5A 4QXBA 1IPKA 1YI9A 1DQ5A 1RUC3 3MPPG 2HLEA 1LB2A 2WYRA 1KGYA 1N47A 3UT0A 4C0BA 3VDAA 3SI1A 5FZGA 1WD4A 4NWWA 5JIUA 3IZOA 4QHOA 2QZ2A 3OEAA 2QQPA 3O0VA 5A7NA 3UESA 4L92A 5FUIA 4NJRA 4PQ9A 2VVFA 2HH9A 2OIIA 4AVBA 1MZEA 3WCSA 1UMZA 5C8CC 3T9YA 4JTOA 3V8IA 1O3QA 5I8TA 2HWD3 4JDOA 4CCDA 1WWYA 2WUUA 1C8M2 3I2FA 1JH5A 2E7QA 4E4SA 3HUVA 3UGFA 2GNTA 4XAAA 4A30A 1LKNA 2HBUA 3IIBA 2Y60A 2OPWA 2W47A 2HWF1 1OQ1A 3WT4A 1I3HA 4YZ1A 2ATFA 1CJPA 4YSFA 5A3WA 1W6OB 3ZJ0A 3BHXA 3B3WA 4JAAA 5FZDA 3B9CA 1O5UA 1O8PA 4QM9A 1AR63 4JV4A 3RS6A 1QJU2 1PO13 3IU2A 1GLHA 5DUWA 3VKLA 4AAPA 3PEIA 3JB4C 4J1WA 1H2MA 2GC3A 2P3KA 4Z2AA 2WN2A 5LBCA 5F37A 2GU9A 4KOUA 3OEBA 2WUHA 1G9CA 2B45X 1V6NA 4Y26A 3PHMA 5G21A 1J1LA 5JH9A 2WSAA 2DTYA 4EVYA 4YVSB 4OHXA 5ANQA 2D40A 3WXPA 4ATEA 4Q36A 3P3NA 4UXAA 1YFUA 1OVSA 2ANPA 1G9FA 3BJ7A 4NPLA 2WZEA 1FPN3 1CGPA 4YVWB 1YIPA 5C70A 3NSTA 1OF4A 1QQP1 5E88A 5FZ0A 2E32A 4QGLA 2ORXA 2B58A 3LWUA 4W65A 5K0UC 2OZ6A 3VZNA 4ZS3A 3JBG1 4HZFA 4YZ2A 5FO7B 2A7AA 5FPZA 2RM23 4MUVA 4HNYB 3KD4A 4UCNA 4NXYA 4XFHA 4BE3A 5I0DA 3H3ZA 3NO8A 3E6BA 3U37A 4LNVA 2WN3A 2QQNA 2YGMA 5SV8A 1M4IA 5C3SA 4F9UA 3KASA 1IG0A 3KT7A 1QSMA 2JECA 1KFUL 3WQ1A 4COWA 2CNTA 4QX0A 1WLDA 3N35A 3AL5A 1VBD2 1WMXA 5LRSA 3ACFA 2HKXA 5K7PA 3D7FA 1EP0A 3HN1A 2R98A 2EAKA 4CSWA 2OH1A 5ELYA 1W90A 2NYQA 3FLPA 5FZAA 2SBAA 1V00A 3NFZA 1X12A 3TO7A 4XDOA 4OQ8A 1BEV1 1CPSA 2RR12 1FOD3 4CDXC 1XF8A 5HCHA 2B46X 4LBQD 4A45A 1HB3A 4NGRA 4G3YC 1U12A 1LEDA 3WG3A 1ULEA 2A3WA 1DGRN 1BOBA 1R57A 4MRIA 5FP7A 1SQ4A 1JZ2A 1GBGA 1XE8A 4QKNA 4GH4C 4RR3A 3VATA 5CIRA 3VDDB 1JOPA 1IGBA 4BQ5A 5IHRA 1ZVFA 4XDPA 5T5PA 1SBDA 3P5BA 4TSVA 1Y7EA 3O14A 3ECQA 4MXUA 2YB7A 3BVCA 1Q5OA 2VPVA 2D44A 2Y6HA 4N7IA 2ZMLA 4GD4A 4XEZA 1W6PA 1L7RA 3M3CA 4MFZA 2LM3A 4JGZC 4UCPA 1RUD3 2HEVF 3C7EA 4UEEA 2QJVA 3PRTA 4RN5A 2B9UA 4XJWA 5FYHA 1CM0A 1GZWB 1HRI1 4CUGA 2X05A 5JOWA 1RUH1 1W6QA 3OBZA 3Q8CA 3O1UA 2GNMA 4MY0A 5KHGA 5LWBA 3VBOB 1A78A 4XTPA 1H9WA 1QEXA 4PK3A 3VBSC 5FZ6A 4RHV3 4BWOA 1RUI3 4OC4A 2K9ZA 5GLTA 1XYNA 1K5MB 4XJZA 3ZN6B 4OHWA 5GM0A 3VD7A 2EIDA 4GXHA 1WWZA 3HMYA 1A8MA 4Q8KA 3S5QA 2RV9A 4NIAA 3H8RA 4CP1A 4NO4A 4FBFA 1ND3C 5FZ1A 1J1TA 3GBFA 3V0AA 1D4M1 4QPIA 4XQWA 2R8VA 4TYSA 3H8UA 4Q4Y3 2FDJA 4J6GA 3B35A 1PIV3 4OYUA 4C90A 3AKRA 1MS5A 3GJAA 5T5JA 4I3GA 5B4NA 2H0BA 5LBFA 3VL9A 2YFZA 1US2A 3GBWA 2HWF2 2ZEFA 5G20A 3TTHA 2J1AA 1G86A 2ZZJA 1NCQC 5FFOC 1DU3D 3W6SA 3CDZB 5L19A 1RVF1 3ROUA 4AZZA 5FV3A 4IEVA 2P34A 4B5PB 2WNUB 4B10A 4MGZE 5IK8A 4D8MA 4HN1A 3SQOA 3U11A 3ZM8A 1PHMA 5F46A 2I00A 4E4ZA 3L2NA 4KMQA 2ZHLA 2RS51 4YM3A 1ARMA 1SHWB 4JJXA 2ZW5A 4RS5A 2R1BA 1OLQA 2WYFA 1UWYA 2ARAA 1CPNA 4WBBA 5IJRA 3WHUA 2I07B 2QDRA 3DYOA 4XF9A 4YW6A 4XF4A 3AZVA 4XABA 1SLAA 1QQP2 3PBEA 3PVOA 3OBRA 1LOFA 3M1HA 4IETA 1J3QA 3JBG2 1UOBA 3G7DA 2DCZA 1F9KA 4BXFA 4QBJA 1YX0A 4OMDA 4YLZA 5KXCA 4Y4RA 2X10A 4UFHA 4H89A 1UU4A 2VOXA 1T2XA 1CD3G 3MLLA 2ET7A 4Y33A 1X36A 1IIDA 1QJFA 1S0DA 5FYCA 1PO23 3D82A 4FP2A 1QQ9A 3ZSMA 3ZFGA 3I7DA 4BD9A 3TEYA 4RD7A 4XBNA 4EZHA 2CDOA 1S7NA 3GY9A 3FMGA 3MEPA 3OGJA 3RZAA 2D43A 1D0GA 2AACA 2BDRA 3S6GA 2GLFA 1YQ8A 1Q2YA 2JDPA 5A3LA 2GSYA 2R073 2B5GB 5I0TA 1L3JA 4WM7B 4J1XA 1O3TA 5A1AA 2R062 2ZGOA 1VHSA 2OXBA 5B2GB 4M01A 3WF2A 4D0QA 3WF1A 1U6MA 2HV2A 3PFEA 5I0CA 3GYDA 3DNSA 4YZ3A 1LULA 3J8F1 3MIEA 1XPWA 2FCVA 4OCTA 3SCGA 1M06G 4W9YA 3PB8X 3Q8AA 3U14A 3DCQA 1ZRCA 2WQZC 4BMEA 3VD5A 1LAPA 1SLBA 2P3YA 4EN8B 1ND2A 3MICA 4FO9A 3PB9X 4ZX8A 4HVRA 4LKEA 3ZZIA 1Y43B 3AYCA 5D1IA 4FPFA 4XURA 3K48A 4DRVA 2YYOA 2OU2A 1XIXA 5FYZA 4I0AA 2PYTA 4NRPA 5D8AA 4YFWA 4I2OA 4B12A 2DEAA 3O1PA 1ZLIA 2NMTA 1D4VB 3D68A 3PVNA 2PMWB 2RFHA 5DN2A 4AE2A 1VR3A 2QVSB 2QZ3A 1ZBA1 1JYIA 3WG2A 1E5RA 4NUBA 2F8HA 3CO2A 3S7IA 3CXQA 4CGMA 5LZ6A 1OD3A 3IO1A 2IXIA 1D2SA 2EUIA 2BCOA 3ZSKA 5J1XA 4LBKA 1M4LA 1QSOA 1W8HA 1WZXA 4Y5SA 1QJEA 1J59A 1XFOA 3RZZA 3H3UA 1F15A 4Q4X1 3WDXA 1RO5A 1Y0RA 1AR71 4ASMB 4UEZA 1BBT3 4FXKB 4IE4A 5A3UA 3A0KA 5FPVA 2BEOA 3LDRA 3S5AA 1V0AA 2GNBA 3CMGA 3NV4A 5A6ZA 4R4ZA 1QXRA 4ZXEA 5HV4A 4ZKTB 3S7EA 4XJAA 2FXFA 1VBB2 4CTEA 2VUDA 5ABJC 1AL23 4D6SA 1F5JA 1O91A 3D6EA 1XJOA 3IDAA 4IGPA 2ZS6B 3WNXA 1LOGA 4FQ4A 5J48A 4XTMA 4Q1PA 5AFEA 1W6MA 1K3IA 2X53S 4UWDA 5GCNA 3NA6A 5FTTC 5BNPA 1RVF2 2FMDA 5FZFA 2C26A 4MHNA 3U0ZA 2WWSA 4E2AA 4UOJA 4MI4A 1S7FA 4LMFA 1IICA 2QQUA 2RE9A 1AXKA 1WW5A 4CAEA 3POEA 4M85A 2BVBA 4LUAA 1W8UA 2RS52 1YWKA 3VBHA 1MEC1 1GP5A 3ZFFB 3LGRA 3R05A 3O0XA 4JQTA 2IXKA 1FYUA 5DWNA 4ONUA 5I93A 3BOWA 2JB8A 5FYTA 4BA6A 1R64A 3KHBA 3S0MA 2XJTA 2C1CA 3THDA 3I2KA 1TG7A 3AKQA 2OOTA 1BLLE 3KLSA 4BLJA 1CJWA 1JZ5A 3GNEA 1DQ4A 2PR1A 1BVVA 1CAXB 3WVJA 3H4QA 4WJBA 5IV0A 3PUHA 5IK7A 3J26N 4AGRA 2WZR3 1BMV1 1YLLA 4JXRA 3LD8A 3IFEA 5FZ4A 2V5YA 3MGDA 2XBO1 4FPLA 1VIXA 1S2KA 3FC0A 4QB2A 5C8CB 2Y6GA 3E97A 2PJ1A 1D0HA 1N3OA 3EBRA 2Y6JA 1XBFA 2JEVA 2VCCA 1ENQA 1LOEA 1W0NA 2J9AA 1QJZA 4XBLA 1W6NA 2EIEA 1BQPA 4KUAA 4AG9A 2ZGPA 1MJBA 2O4HA 3TEZA 3RZKA 4FFFA 3T2PA 1GZ9A 2Q04A 4FP3A 1GWMA 2PHDA 1TQ5A 1FY7A 1LR5A 4CCLA 2XJRA 1UIJA 2Z3OA 4RI1A 2ZGKA 5KTDA 1YJLA 2C6GA 4AQTA 2VZUA 1ACCA 1MPXA 3KCYA 4Q0UA 1O4TA 3VV1A 4KOVA 2EVNA 4GM5A 1NKGA 4LLFA 4QPGC 2KXLA 3C7HA 4M00A 3J8F2 4WZCA 3U07A 1Y9KA 2DCKA 4NVPA 4YWAA 2O8OA 4B1LA 3K9TA 4YRHA 4OVEA 2ARXA 1HXS1 2VNVA 2ZKNA 4UWJA 3MZHA 2PLV3 3PIJA 4XCAA 1X8MA 3WNPA 1JYTA 4C91A 5F32A 4CVUA 3JTKA 5K0UB 1WW7A 2ZX2A 4OC0A 2C0ZA 1D2QA 5IB0A 2IXCA 5FBZA 2P4EA 4CEYA 4KZTA 2NPIA 4UF0A 2XOMA 3GBGA 2UWCA 4IE7A 3VWEA 2GN3A 1LOKA 2VE1A 4AB7A 1PUAA 3JB8A 4HFSA 4O9EA 3FF3A 1TVGA 3ZR5A 1PGSA 2XGXA 4BH9A 4FPYA 1IQDC 3B94A 1GWKA 1RUF1 5JPNB 3B3TA 1LRHA 2XUMA 1PO12 4XJ9A 2FZ1A 3WP5A 1V0CA 4OC3A 5HVHA 3T08A 3ZXDA 2XEJA 1OC1A 1X9TA 5FP3A 4HNXB 4NSQA 3VBRA 3ZPOA 4UA3A 1PNGA 2L9LA 3C26A 2KM2A 1W3VA 4CDXB 1RUNA 4MHDA 2ZEOA 4M4PA 5FZLA 4OC5A 1OH3A 2JDYA 4Y1YA 1PZ7A 4UW4A 3VBFA 5EPAA 3BTYA 1IU8A 2ZX0A 4QC6A 2UY8A 3D66A 3ZXKA 2QQMA 3BKZA 4MHYA 3SI0A 4HKOA 4XFAA 1NA1A 3N7MA 2WINB 5AC91 4R9AA 1RTQA 5T54A 3OGSA 1Q8VA 3B69A 3BLNA 2LRPA 1UX6A 4JVAA 4Z2WA 1NMTA 1QMUA 3BI0A 5BV6A 5A6XA 5GLUA 4JGZB 4A7KA 4FI9A 3DXTA 1YREA 3SKJE 4QM8A 3D7GA 2ZEHA 2H6CA 4NWVA 4QKBA 5FMOS 2XL9A 1QSRA 3M4FA 3TC8A 3S9LA 4AL9A 3HNBM 4GIQA 1V9U3 1ODNA 4AXOA 5JQ4A 3FHAA 3UY5A 2YBPA 4DJLA 3NV2A 4GB33 3U1XA 3TN91 3IWGA 3VBSB 5FQ0B 1RUG3 3N36A 2E51A 3O1SA 4LO7A 3I1UA 3I2HA 4P9GA 3CF6E 3H8OA 3FX3A 4GMP0 1FOD2 2DBNA 3BU0A 1UYZA 2FS5A 1BLZA 4OMCA 3M7AA 3GALA 4HK8A 3VBUC 2BGOA 2E7TA 1LODA 1UOGA 1UZVA 2XMLA 4F7ZA 3IAPA 1AUGA 3LDBA 1UOFA 3DSBA 4CEWA 1VB4A 5LCWL 1BMV2 4XNHB 1ZBE3 2XVGA 2V4VA 1LCLA 1ND3B 2ZZQA 2WQ4A 3IC1A 3V7ZA 2VOWA 3TX8A 3FVLA 1ASJ3 2NYYA 3IM0A 5DUUA 5JVVA 4GZ9A 2D6NA 2HYKA 1JODA 3GXUA 2QYVA 1RUD2 3AZZA 1W8TA 1RC6A 2DDUA 2A75A 2VU9A 4HG6B 1XNTA 4KU7A 1FNZA 3LA2A 3ZXEA 1ULOA 1MK4A 1NCQB 2QQIA 2VD7A 4XPDC 2Y0OA 4UYBA 5C4WA 5F49A 2JLMA 3BALA 1XYOA 2ZGRA 5K8MA 2R043 4Q0VA 3POGA 1UKGA 1S7LA 1Q8OA 2YFUA 1PK6A 5JSRA 3RO0A 1WCQA 2VUCA 4ZBGA 4QB6A 2JG8A 2W95A 3N9OA 1KUXA 3IIAA 4OUEA 1AR93 4F8ZA 1XC6A 1AYM3 2TNFA 4LKSA 5F5AA 1DYPA 1HXS2 2VTXA 3LFMA 4CEYC 1XJAA 1LCPA 2WT1A 2YBKA 4Y1UA 2ZCWA 1X9PA 4Q4Y2 1ZX5A 1UN1A 3HPNA 4QX1A 2FDFA 4EN0A 4F0XA 3C3VA 3SJFA 4FUUA 2VNGA 3RI8A 2DF5A 2IJZA 3U10A 2Q4ZA 1G9BA 2Q43A 3HBKA 1REEA 2QQVA 4MY3A 1JN2P 4KGQA 5DQ0A 1ON0A 2BUEA 4IQPA 2C9AA 3T0AA 4AG7A 4H2AA 4XOGA 1VP6A 3B8GA 1LAMA 3BUCA 3D4UA 4XVHA 3LD2A 2R49A 5FCCA 4BHPA 4CGOA 1H8VA 3LFIA 3WW1A 3VBRC 1RUF2 2DFBA 2PJ3A 3TOBA 1QU0A 4CDWC 4C2XA 3SH4A 1LOAA 1AF9A 2ZXVA 2P6HA 1I12A 1SLTA 3OGRA 3RZMA 1TMF1 1JMUB 3DYPA 1DIWA 2ES3A 1ZG7A 4AG4A 3ILRA 2G9FA 5J98B 4HK9A 3PFOA 4X5KA 3AM2A 2E26A 4WZFA 2Q1MA 2JB4A 4FAGA 4YVSA 4AR2A 3JUUA 2OQ7A 3TNQA 4BQWA 2NN8A 2ZOGA 1MS9A 2EICA 3SKVA 3R6SA 1ULCA 4M0HA 4MGYE 3GCXA 1RXFA 4YGBA 4QX7A 1W9WA 4DMIA 4FD7A 5FPLA 3CNAA 2W92A 3QLQA 3GHNA 5CPAA 3R9EA 5F7UA 2RS31 3AKSA 2PTMA 1TF9A 3I2IA 2ZHNA 4XDQA 1LHUA 3U4XA 3C2UA 4DEVA 1P0HA 2TUNA 3PNAA 4N43A 1UNBA 4LK6A 5AC92 1EV13 4LE4A 2XLFA 4OULA 3AB0A 2RJ2A 3W58A 1PO22 2ZW4A 3POJA 2CWMA 5FUNA 3DR6A 4CCJA 3KV5A 5D2AA 3VDBA 1YMEA 4PXBA 4F83A 5H84A 1MQTC 4CA9A 2W2IA 4FPGA 4XYXA 2VY0A 4QXKA 3ZYRA 2O53A 2DFCA 1PYTB 3KT1A 5FLJA 2R072 3B7IA 4H55A 2CNAA 4IAVA 4S2GA 4QGNA 4WM8C 3RJ2X 3TN92 3EFAA 3DGTA 3JU9A 2A6YA 2BU9A 2E53A 5ACA1 1Z4EA 2PAEA 4R3KA 3IMNA 4CP0A 2Z69A 2B4DB 4FAIA 2D97A 4RA0A 4ZI6A 1ST8A 4LEJA 2PQQA 4CRYB 1OLME 2VBQA 2RHPA 3H5ZA 1QOTA 3RNSA 1Z7S1 4IF5A 4IV1A 4COZA 2GDFA 1ARLA 4L97A 4FPKA 1S55A 3FN9A 2VMGA 4KS9A 3IMMA 4K6BA 4HL0A 3V38A 2BNNA 2ORZA 5JIAA 3LSEA 1L7QA 3W6XA 3ZVXA 3MLKA 1SLCA 5BWAB 2J8RA 2BOAA 4YW5A 3PURA 1VAVA 5DAVA 3HT1A 2DYCA 4MGSA 3K4ZA 3R4UA 2CWSA 3EXNA 3PUQA 2Q0YA 5EIYB 3KMHA 4IEWA 5ABJB 1IQAA 1F4HA 4D7SA 2Q8CA 1POV0 4URAA 3BYWA 1JZ4A 3W59A 2XL7A 4CAVA 2RMU1 4MBUA 5L9RA 5IFPA 5FZ8A 5KTAA 4XAEA 4P45A 1NLSA 1COV3 3LEMA 4KWLA 3PJYA 5F3GA 2GMMA 4UFKA 2BP6A 2V73A 5LA9A 3R96A 2EWBA 2ETEA 3KQ4B 1K5MA 1VGYA 4ARXA 3ZN6A 1OFSA 5FREA 1GZCA 3NW4A 1S0EA 1RUJ3 4EMEA 2A6WA 4D94A 2BFUL 2FCTA 3JXSA 5KC6A 2H5MA 1AMPA 1W0OA 2X29A 2A73B 2JG9A 4NIHA 4GXLA 2VOKA 3WW4A 1YO8A 4M6IA 4B4QA 3NJXA 3X29B 2P6CA 1RMU3 1QJY1 3DV8A 2X7BA 1R093 4ES8A 5E6HA 4A3ZA 2VJXA 1AL22 4G4FA 3K4DA 3N5FA 4QDSA 4J3GA 3USUB 2WWJA 1Y9QA 5A6QA 4C1XA 3I59B 4G9SB 1V70A 3D2PA 2HWB3 3TOAA 4K40A 2GLJA 4NJ4A 1YYNA 2MEV1 1N3PA 2AFSA 4TWEA 5AG6A 1BKZA 1YXWA 4B5PA 1SG3A 2WNUA 1ALYA 4Q8LA 4DRRA 4MCRA 1TMF2 3K3OA 3GDBA 5J3UA 2FCKA 2P5BA 1BPNA 4LOSA 4RQPC 4YM2A 1GR3A 5EP9A 3SH5A 2ZEMA 4N43C 4QAWA 4FPCA 3R1KA 1ULFA 1ELLP 4X8PA 3W9AA 5HMNA 3V0BB 5EJ3A 2HWE1 5FMBA 2YU1A 2HB6A 2D5FA 2Z11A 1CQ9A 3VHPA 3SCFA 1SEFA 1Q43A 1NXMA 3LE0A 2FBEA 2X8KA 4KOTA 5FY8A 2SLIA 3EO6A 1QNYA 4N9IA 5F2WA 5FY5A 4WVMB 3ZX7A 2DBIA 2ZEZA 1YNAA 3LIHA 1KXGA 3I2GA 1VHEA 2C4XA 2DPSA 4OZOA 4AI2A 1U5ZA 2Q44A 3E5XA 2F5IA 1EPWA 3VARA 1AYEA 3ZYGA 4ZPIA 4KOSA 4IEOA 2QE3A 1LEMA 3AMHA 1DLCA 1OD5A 2JBKA 2OZGA 1O4YA 5LY1A 3KKWA 4CDUC 1Q7LA 4II9A 2JICA 4HKLA 4BYYA 5ACA2 3GKRA 1IB1E 1JU4A 3LPGA 2HQYA 2VNRA 1AR81 2WDBA 2BERA 4CDQA 2ABZA 3ZOIA 3NH4A 3TO6A 2BO9A 1C1LA 1Z7S2 3WP6A 1DG6A 1OH4A 2HYXA 1ZZBA 3ZFEC 3C7OA 4MFLA 3AYDA 4HLTA 2CDPA 4QU1A 2W91A 1N71A 1AYN1 4KI5M 3VD9A 4JLYA 1CWPA 2RG4A 4FOVA 4P9IA 3TEXA 3MF9A 4EN7B 2DPTA 4AK3A 1RGSA 2AFUA 3HQXA 4A32A 1M4GA 4AW7A 4ET7A 3EC4A 4LQGA 4QKDA 5FYSA 2CF4A 3PU8A 4C2YA 5A7WA 4ZU5A 3LCPA 2IMOA 5BNNC 1NCRA 3KWVA 5BNPB 4IV3C 4L89A 3GJBA 4XUNA 5CA6A 3WX5A 3J4UH 4FD4A 2CY2A 1NSLA 4Q4V1 1G9DA 3QAHA 1OZPA 1NX9A 1YFXA 3EJKA 3AZWA 4MXVA 2OUJA 2RMU2 3D0SA 4O23A 3BJ8A 1HDKA 1BK1A 5I0UA 1G6NA 3MIGA 2JXAA 2QJ8A 4R57A 3KB5A 2PRBA 5DDJ3 4ES9A 3VD3A 2H6BA 4BU2A 4BXSV 3PTYA 1IKPA 4BMHA 3DPRA 4IEYA 3F5BA 3WZ1A 3VHNA 3ZYJB 3ZYFA 4Y24A 4N8MA 4QQLA 3WABA 3PUIA 1HRV1 1IOAA 2PJBA 2DCYA 5FPXA 3ES4A 5CNPA 4KGGA 4R8FA 3RZJA 3LOBA 5FPUA 3VBUB 2J1SA 5HBAA 4NRQA 1RUE3 1X7NA 3M8LA 4Q0SA 4ZGYB 4I30A 4CAXA 2VW0A 2ZEDA 3WDWA 4LBOA 4OMEA 1QJY2 3BPZA 5LATA 1C5IA 1N1VA 3DKQA 1O5LA 3WLUA 2R7HA 1OUXA 1W6NB 2ZAAA 3OBAA 2VL1A 1SDWA 4HVQA 1JUIA 1PMJX 4BQ1A 2VXRA 5G22A 1Y0YA 4B29A 3I3DA 4R76A 3NAPC 2K2SA 5GLWA 3BPSA 2YPJA 1T6GC 2PFWA 3U78A 2CIJA 2MEV2 5JOXA 2QVPA 3TEWA 1ZNPA 2RVAA 2VCMA 2OZUA 4PXCA 4BB3A 3DL3A 5I4MA 1PVXA 1YVOA 1S60A 5C8WA 1V9U2 5L36A 2PQSA 3QD6A 4BIFA 4QD2A 2YROA 3LWCA 4R52A 3WT3A 3IPVB 3ZFFA 4XPDB 2XEFA 1POQA 1OQEA 5LYIA 2J1UA 4S2HA 3KV4A 1I6XA 5IVCA 1LESA 5JI9A 3ZDVA 2FIWA 3M2MA 4H3WA 2WBKA 4AQSA 3AMQA 3SJGA 4AHZA 4JKMA 1X8EA 1ZZCA 3IWWA 2VUJA 5FYMA 5A7PA 3J7HA 4ZU4A 4URTA 1C57A 5F6KA 2HBTA 4HMZA 3VH9A 4MO3M 2HC9A 2HEWF 3IDBB 1ZBE2 2CSGA 2LW8A 1CAXA 2WAAA 2VEZA 5FZMA 4NJQA 3VZJA 4CEYB 1C8M1 1MZFA 4LHNA 5L9BA 5FLHA 2QFEA 1JXNA 4DB5A 1ASJ2 4PLMA 2ENRA 3HLPA 3ZXAC 2AEZA 4XUPA 4R6TA 2I74A 4RL7A 4NOTA 2O8QA 4XHXA 1OLMA 4KVXA 5I8YA 2LROA 3IT8A 1H6XA 1IS3A 2OA2A 4AWDA 4B13A 5FXVA 1CVNA 2NMNA 1DQ0A 2ZX1A 4NN0A 1TXRA 1UU5A 2D4OA 2VCAA 1FT7A 3I3BA 1YW4A 1CAVA 3WC5A 1VBE1 3KHXA 4UAPA 4ATFA 3ZMNA 5DMYA 1DZTA 1WMDA 2GAUA 4FFHA 3VBRB 4BQXA 3AMNA 3GCWA 5FYVA 3MI8A 5G1ZA 2ZHKA 4CDWB 2YG0A 2AR6A 3K4AA 5GZEA 2PJ2A 1AR82 4K20A 3H8FA 2XHKA 1TME3 3HQRA 4GS4A 4RN7A 3HIFA 1Q56A 2ZEXA 2BUKA 3A0NA 2VZZA 2B7YA 1GNZA 3DN7A 1SLLA 1TEIA 1AR92 4PLOA 4ZY2A 3AL6A 4LBMA 1AYM2 1RUJ1 5BY5A 1NCRC 3JZVA 2UWAA 3VZLA 3KR4A 2A6XA 3B9IA 3VZMA 1VBC3 3ZKYA 2WRAA 1J3RA 4XJ8A 2X5IC 3D3AA 2CL2A 2YC4A 4BOWA 1PMIA 3TOJA 4XC9A 5BPXA 4Z65A 4NIIA 1VRH3 2C6SA 3SHRA 2R16A 3POBA 2OZHA 4BDVB 2QQJA 2BNMA 3OUJA 1WCSA 2PJ0A 3RMXA 3MW4A 2BBVA 5IATA 2IZWA 2TBVA 3RRDA 3AMMA 2WYSA 1CP6A 1S0CA 1VBD1 1QOOA 3MLJA 1WCDJ 3R0RA 1J83A 2ZEYA 1A2ZA 3VHOA 1KUYA 1DHKB 1MQTB 1Z78A 2ZTNA 8CPAA 2XLAA 4UIBA 1RHI1 2RR11 3CKHA 4WM8B 4P4IA 4M4RA 2VMDA 4CEWB 1Z8LA 5FZCA 2ZOEB 1HRV2 1ZZ9A 5LK5A 4JZ0A 4JQRA 4R9BA 4NHYA 2Q5TA 4WVZA 1CZSA 3ZSJA 4IUSA 1XMBA 4NGQA 1YI7A 2FL4A 1CIWA 1GNHA 5FY7A 4MHPA 1XNDA 3KV6A 2F7VA 7CPAA 4OQ9A 4CDXA 4Z92B 1YFWA 3FLRA 3GLJA 2DU0A 1ODMA 1PGW1 4CYPA 4LKDA 1JBCA 3ZN5A 2A3XA 4GH4A 1JUHA 2K5TA 3OY8A 1PVC1 5L9VA 4XFBA 3A21A 1YCIA 5FZHA 3GGLA 1ZRRA 4FAHA 2PJ8A 5KHKA 4O9GA 4BQ3A 2HWC3 3CDXA 2GH2A 1BYHA 3I3QA 4AVVA 3MYXA 3IJ3A 2HUZA 2XVKA 3O7OA 4UFWA 5CFCC 2UU8A 4NHXA 1X82A 1HJGA 2JG8B 2WT0A 3M3EA 1Y9WA 3LIGA 5JGFA 2ZGNA 4HANA 1BCXA 3VBSA 3AKPA 5FQ0A 3POIA 1SBFA 3OWCA 1KDMA 3SISA 2C6CA 3A4UA 1XYPA 1HQNA 4TNUA 1O7FA 4QQPA 4R87A 3FECA 2W1WA 1F57A 1LFWA 3MF6A 1R1A3 1I9RA 1NUKA 2REEA 4QDRA 4DXTA 5IVYA 3C8XA 4JDNA 2CAUA 4DNCA 2A1XA 2Q0AA 4DY3A 1GMMA 2CYFA 4KBZA 1ULDA 4A44A 4AQ2A 1WK4A 1ND3A 3UJOA 1HJFA 5FYYA 3TB0A 2OQ6A 4R8HA 1W8WA 4AEJA 1FMD1 3KGLA 4P9XA 1ZLHA 3CJIC 5D21A 4HETA 3KZ4C 1S4CA 3GZUC 4ZY1A 5C33A 2BGCA 2NMOA 4Q4W3 2YNCC 1XE0A 1ENRA 3LODA 3VKFC 3JD73 3NE7A 3WUDA 5C88A 1C5HA 4L2NA 5IVVA 4ZHNA 1CONA 1UD1A 1CZVA 4GMP1 1XXNA 3GZTB 1VBE2 3CIHA 2VZSA 2W87A 2H0VA 3I2OA 3RG0A 1KDKA 2WNVC 1NCQA 4N7UA 1UYYA 4LR4A 4MV2A 2ZPXA 1UKRA 1Q8QA 1H2LA 1PCAA 4RUHA 4FT8A 5KXDA 1MS8A 4QHBA 5LW9A 5K8OA 5EFUA 2C6PA 2D7FA 2MNGA 2PHTA 3BOPA 3NNLA 2VL4A 4L8QA 3SH3A 1EAH3 4AI8A 1RUJ2 4GJZA 4OZXA 3G8WA 1JYNA 4RS2A 1ZRFA 4R3LA 4RQPB 4B7KA 4P4DA 4XF1A 3IDEA 4UFVA 4TZDA 4N43B 1JZ8A 4AFBA 5JMOA 4ITCA 3BXMA 1VKCA 4PT6A 4B3NA 1HX6A 2YZ4A 3NNFA 1B6BA 2VULA 4X6QB 1BK0A 1B35C 3Q8EA 2JD9A 2ZW7A 1ZZ6A 4PIZA 1H1AA 5FY4A 5IAVA 4BLIA 4F8AA 2PHUA 2VOVA 1IGOA 4NIGA 2G3AA 4NCZA 1H8TC 4XMIA 3EMRA 4KORA 5FZOB 3ZPYA 3WDTA 4CP9B 3D7HA 2DVGA 2WS91 1H1IA 2HWB2 4HPSA 3D3SA 2Q4YA 2V8HA 1LAJA 1PGL2 3ZSLA 2Z4FA 5JWPA 5LRKA 5A70A 4ZY0A 3TFYA 3H1YA 4L99A 4UI9L 2Y0IA 2R061 2YHJA 2AREA 5A3PA 5LYDA 1RHI2 5IVBA 2Z0ZA 1IS5A 4CGNA 5LB6A 4AGVA 4A2UA 3H0OA 3CJXA 4IV1B 5FPBA 4IDZA 4CDUB 2PHRA 5JLVA 5F2SA 3A7QA 1YSJA 5F5QA 1SACA 4XZPA 1CJDA 1BJQA 2XONA 4LA2A 3MW2A 5HXVA 3EYPA 4NROA 4UW5A 5L7OA 3LKJA 1WBLA 4KU8A 4FD5A 3D8CA 3AP6A 2WLQA 4PI0A 2AFOA 3WDYA 4LKFA 3ZFEB 3DLJA 1GZTA 1QJX1 2QKDA 2ID4A 3BI1A 1X33A 3I97A 1PGW2 1RJ7A 2D6KA 4OIDA 5HPOA 1PVC2 4E2QA 4YW2A 2P6GA 2AFXA 3FHIB 3WOGA 4PV6A 4E27A 2AJ6A 3RSJA 3GZEA 2GH8A 2D5HA 3WP4A 4IV3B 5A7QA 3NNGA 3IU1A 3D67A 3K9UA 4QX3A 3FJSA 2ZJCA 4A39A 1IG3A 3I54A 2VI7A 4NPRA 4D6QA 4M3CB 3EXUA 1VBA1 3CPAA 1LHWA 2LS6A 3WQ0A 4LO6B 1AUYA 5LA0A 1U5XA 4OI1A 2B39A 3ME2A 4R9MA 2XJVA 1HDUA 4XMAA 3FBUA 4LULA 1YHFA 2R0HA 2IC1A 3OUHA 1W2OA 2PJ4A 4FCAA 1Z2LA 3P2FA 3LA3A 4AXVA 2B4DA 2V72A 2G0BA 2JG9B 3BTAA 4Q5OA 4J25A 4IEXA 2FZ2A 3HNYM 3THCA 1OXCA 4GALA 2G9ZA 1N1YA 3FNCA 4OC1A 1R081 3GB0A 4A31A 2YNDA 1FV2A 3RPQA 2WJSA 4B1MA 5JI7A 5TSWA 3RBUA 3FX6A 3CZUA 4FSJA 3T09A 5DABA 3M3OA 1VBB1 1FMD2 4XXPA 2ATRA 3ITQA 3QB8A 5FYIA 4FXGB 4XXAA 2JDMA 1VAMA 1UPIA 1V6LA 1OURA 4K9SA 5LK7B 4LT5A 2CTCA 4ONWA 2OR4A 2C9KA 2NLRA 1XOVA 1GP4A 2IFRA 2HWF3 1WKYA 4KQ7A 2IXLA 5A1LA 5CFDC 2GP5A 5ABJA 1DYOA 3INAA 5DDJ2 5JOYA 2BBAA 1JZ3A 2J8NA 1OMIA 3D8PA 5C3RA 1AHSA 4UF4A 4YM0A 2B42B 2ZA9A 3ST7A 4P9WA 4D69A 4JRLA 4KWKA 5JOZA 5LBBA 1UZZA 3KR5A 3ZN4A 4S2FA 2PHFA 4XBQA 2VBPA 4HNWB 1PX4A 4X6RB 2PRQA 4UWIA 1XNKA 1NZCA 4CUAA 3LZZA 2WFF1 2CGOA 4EWEA 3ACGA 4TLFA 1DQ1A 1TIQA 5DUXA 1TE1B 3DR8A 1I5ZA 1P8JA 1RUE2 3FEEA 1SDDB 2ZXQA 1POV1 3WF4A 3WR7A 1QQP3 4OADA 1DP0A 4AEDA 4P08A 3K51A 4BMBA 1W2NA 1IY7A 3JBG3 1OA3A 3WHTA 2PR8A 4CU6A 4M6HA 2PHLA 1V6MA 1SBEA 1TKJA 1ZG9A 3SXOA 2OX0A 4B5OA 3CQOA 4A7YA 4MXWB 4PSXA 4CYQA 2WS92 3USUA 3CT9A 3H9AA 4Y1XA 5CEHA 3B02A 1Z9UA 2R1DA 2IVJA 1QNWA 3I59A 5F1RA 2HWC1 1LGBA 2VMHA 1G7YA 2D3RA 4M3SA 1YEWA 1JZ6A 4EV0A 2VMEA 1XEBA 3I3MA 1OBRA 2RC4A 2GC0A 2VZPA 5L7OC 4QB1A 4CDQB 2J22A 5FDBA 3KI9A 1RUC1 3PBBA 1W99A 3LEIA 5FMCA 1Y9MA 4DQAA 3J9SA 2YBSA 4PHZA 4MADA 5A3MA 1DF0A 1SMVA 4Y20B 2G9DA 4YW3A 1GICA 3VLBB 2VBBA 1LTEA 4LQRA 1BEV3 5ANNA 3HR9A 4IGQA 2LALA 3UNPA 4W50A 1RB8G 1CX8A 1MJAA 4MH0E 2REFA 1PM4A 4M3CF 3O1OA 5FVJA 3ACIA 1J58A 3KM5A 2QCSB 1HKDA 3V0BA 4QPGA 1QJX2 5A7WB 1NCRB 2G1MA 2WLPA 2HWD1 4NPMA 1STMA 2UYAA 2Y0MA 3R95A 1VIWB 2EXIA 1NE9A 2X5IB 5A33B 1BHGA 4META 3B93A 1Y7RA 2IXJA 2GZWA 2AZ5A 1UOJA 1URXA 4XE9A 5LRRA 3WY6A 3S30A 4FVVA 3FBMA 4WVMA 5I8SA 4E2SA 1Q8SA 4A7ZA 1UY0A 4RSUA 1Q2CA 3N9NA 1CX1A 3VB9A 3MBWA 5F8PA 2YXSA 1YW6A 5BNOC 2YGLA 3HD8B 3Q8BA 3WNOA 1FV3A 1AR61 2BL1A 1PO11 3IKWA 2XWBB 4RFT0 1CG2A 3DPRB 2VAUA 1HRI3 4IERA 1DFQA 2XQRA 1VBA2 1RUH3 4CYDA 1UQXA 4IE6A 1CESA 3ENRA 1UAIA 4WM7C 1H8LA 2GMEA 3R9GA 2VQAA 2BEIA 5IUQA 4C1WA 5AG4A 2VR4A 3BCWA 1AZDA 1O6UA 1HIXA 4PPZA 2Q51A 1TME2 2VUAA 4COVA 5T5OA 4K30A 4YZ5A 4QKFA 5FOBB 1LGCA 3OBTA 1MACA 4FOYA 5CKQA 1FPN1 1UL9A 1MS3A 1J4JA 3N9QA 3RYOA 5JPMB 4KWUA 3T30A 1U0AA 3O1RA 3T1MA 1QH6A 1R082 2D6MA 1VBC2 1ULPA 3F8KA 3WDUA 1AJOA 4IXLA 1D4M3 4LPLA 4LIVA 4NE9A 2RM21 3QACA 4E9KA 4CCCA 4WWVA 2E6VA 1ZRIA 1CR7A 5LASA 2IL4A 1VRH2 2FQPA 5B4XA 4I0WB 4E2GA 2VTXJ 4OC2A 2W1QA 3H50A 2B3VA 4GAZA 2VMIA 2WO3A 1QXJA 3I9SA 3WNNA 4OI0A 5KWRA 3SC7X 2BYVE 2FIAA 3S9MA 3BN6A 4IL7A 3RFRA 5HV0A 4JRAA 1JS9A 4GKYA 4R4XA 2VW1A 3VZOA 3TO9A 1UYXA 5EQUA 3B01A 4XW3A 1YQ5A 4Z82A 4COUA 2XH6A 1RVF3 2JE9A 5E96A 3FFQA 4DY5A 2DCJA 1W8FA 4Q26A 3FUQA 3H8GA 1CZTA 5CFCB 3PU3A 1UXZA 2I79A 3VN4A 4JX0A 4AVCA 4ASKA 3I2JA 1FOD1 2RS53 4C8DA 5BXXA 4W8JA 4K3NA 3RVHA 1US3A 3SI2A 4AEDC 1AJKA 4UFJA 3UKVA 2EF6A 3FHQA 3FJUA 3AXEA 5FZEA 2WFF2 4Y1VA 5GJ6A 2PAKA 4HVOA 4JCKA 1I1DA 4DUWA 3WW3A 4CUCA 2W52A 5JDBA 5DAPA 1GFF2 5J36A 1QOSA 3VBUA 2QTWB 5C9AC 3KHZA 1QH7A 2VQTA 2JKXA 4MFPA 4MG2A 2ZMKA 1GANA 5IVFA 4ZU7A 2DWRA 2JD4A 4LOTA 3KF3A 4I3PA 4OHVA 4CP2A 4AFDA 2OZJA 3R4SA 1RUD1 3EO4A 3D7DA 2W3JA 5HXMA 5A1FA 1W04A 2ADEA 1CAVB 2YC0A 2V77A 1XRUA 5LA2A 2RDQA 2ET1A 2HWC2 3T2OA 2J1VA 5GZGA 3NJYA 2J1EA 1OHFA 3NKTA 4RHV1 5EV7A 1AL0G 4CXWA 1RUI1 5T50A 5FK8A 4P02B 4KH9A 4LITA 5FZBA 2WPXA 5APAA 1O59A 1RUC2 4JKKA 4UFXA 1JHJA 2FVGA 3ZLIA 4A6OA 2WNVB 5H86A 1PM7A 1JQGA 2YMZA 5KHIA 5C3QA 3IPVA 4PBPA 3FE5A 1NAEA 3A22A 2E9QA 1XNBA 3KS7A 5F9TA 1DYKA 4DPNA 5EBVA 5CZKA 1R1A2 4PXDA 3AYEA 2Y34A 4V1PA 5HI0A 3ILNA 5JZGC 4Q4Y1 4MX3A 3J8F3 2GNDA 3O1TA 1BVP1 3N7KA 2HWD2 3PLQA 3WEZA 1PIV1 1DCSA 2ARBA 4V2WA 4DZGA 2AUYA 3AFGA 4QQ2A 2JDZA 4FFIA 4X8NA 1HEEA 4FPJA 4M3CE 1W0PA 2G9GA 2G3TA 1SQHA 4IUGA 3UJQA 1W9YA 5J8FA 2WZ8A 2PC1A 4Q4W2 1B35B 2EIGA 1QMJA 4LLOA 4NAOA 3HJRA 3FMCA 1AR62 3JD72 4XJUA 4MFJA 2V5DA 1H8TB 4FQZA 4P9JA 1IKQA 4GULA 4PDWC 3O1VA 4ISQA 5DAWA 2AE6A 4D6RA 5HCAA 1ULGA 3SXNA 4YG3A 4LHKA 3KGZA 1IPJA 1NXD1 4A41A 2CHHA 4JD6A 2DVDA 4JTNA 2WT2A 3CU7A 5JPHA 3S57A 4CDWA 1GOHA 2DF7A 4XFFA 1XU2A 1ZBA3 3OPTA 2ZGUA 1VRBA 2PIZA 2DV9A 1FPN2 2RS13 1WMEA 4IEPA 1EAH2 1RIRA 2C5DA 2ZKLA 5K8PA 3T8WA 4PLNA 4EN6B 4XUQA 3LMSA 1MS0A 4GH4B 1LHVA 2RM22 3OY8B 2JDCA 4Q4X3 1AR73 4W6XA 2PQ8A 2PJCA 3NE8A 1SPPA 4NGPA 3SEEA 4AI9A 5EWSA 5THWA 1OVPA 3AKTA 2HEYF 5H9SA 1V6JA 1PO21 1QXPA 4Y22A 1H9PA 4NGMA 3MDPA 3F95A 4K3UA 5DG1A 3BU7A 1VJ2A 1MZ6A 4LUKA 5FIXA 1UW8A 3LOIA 4Q1RA 2YU2A 3CZJA 4Y4YA 3PUAA 1LU1A 4A38A 4MHUA 4DUXA 3KVAA 5DWMA 2Z79A 3H7YA 2Q1FA 2R071 3DF0A 4BQYA 5CADA 2ZX4A 4GWJA 3KCXA 3R9FA 3HT2A 3WR0A 1Q2DA 2DCTA 3VHRA 3UETA 2EAAA 3P6BA 2ADDA 3ES1A 3LB9A 5FMDA 2K46A 2XXZA 3EY5A 3PMEA 2ZGSA 4CCKA 2I3CA 1MQTA 4CPBA 2Q8EA 1M1DA 2WA4A 3UK9A 4NAMA 4RGGA 3SNMA 4CYNA 1MEC3 4NFRA 3N9MA 4HOOA 3MIHA 4YGDA 2JWPA 2X09A 2QUOA 3WQBA 1UYPA 4WM8A 4IESA 2Y6KA 3ZO0B 2FDKA 2ZOFA 1KS5A 1Y9GA 1X10A 4LBJA 3OYWB 2XKPA 4LBNA 1UCXA 5AG7A 1KJLA 5F3EA 3WG4A 2GU2A 3N3HA 3UL2A 2YV8A 4E4DX 2WWUA 2JJ6A 4XQ4A 1DGWA 2CNMA 3V64A 1U5IA 4I01A 2I45A 2F6BA 2MHFA 2OYZA 1R43A 4XETA 2XUEA 4CXYA 4U5YA 3CEWA 4KNCA 3VGIA 3C7GA 5JR2A 4PIYA 3I2DA 5EHDA 4R9DA 5H9QA 1FXZA 4Q38A 1OPOA 2XBO3 3B00A 2QNKA 3M3QA 5J1QA 2DUOA 5GLVA 3LSDA 1YQEA 2TEPA 2DTWA 4K8FA 5AVAA 1W3XA 3S6KA 3LPFA 4MGKE 4RHV2 4Y49C 4NHMA 2D4PA 1RUI2 3WV6A 3H3LA 1QWRA 3G6JB 1W9TA 5CFDB 2ARCA 1SFNA 2G19A 5HCFA 2P3JA 4KLWA 3ZXJA 1ZG8A 3B3QE 2ZEEA 1LHNA 4LO8A 4MCPA 2DUPA 3ZXGA 1S5KA 4UFMA 5T55A 1MS1A 1OUSA 4LORA 5BUVA 2PJ7A 2WNEA 3EHKA 4U36A 1JYCA 2BPA2 2IVIB 2JEWA 4A33A 1BBT1 1JZ7A 5A27A 4A37A 5DG2A 1VB2A 2CTVA 4MJ8A 4XNHC 3OPZA 3KQRA 1PIV2 3ATGA 4U2AA 2P6EA 2VVDA 4QXHA 5FXXA 1IOFA 1HXS3 3MFCA 3IGRA 3A23A 2Q7SA 3WDVA 3ACHA 4IK2A 5DAQA 3HEIA 2BOIA 3HWJA 1RXTA 4L8AA 4L0PA 1AL21 2FCUA 4EWDA 1QSNA 3GHMA 1OKQA 4XIOA 2WIIB 2V8VA 1WLWA 1FAYA 4W4ZA 4Q7AA 4NGTA 4NMIA 1Y4WA 2VMFA 2CAVA 3SJEA 4F6AA 1CN1A 4PF5A 3B3VA 5DAXA 1RJ8A 2VM9A 1UZYA 1DZRA 1RUF3 5J09A 3GZAA 4AVTA 5ISLA 3RWNA 4Z07A 3D4KA 5ERLA 3NQHA 1LOBA 3USSA 2CTBA 4YPJA 4QHZA 1Z4RA 5L7OB 4QGMA 5FY0A 1W8OA 2CGNA 1WW4A 2WR9A 2AGSA 5KXBA 5EXOA 4D7YA 3CBNA 2GFQA 2PAMA 4ZZ8A 4DFSA 1ZO0A 1WA4A 5GZCA 3IBMA 3ZSEA 2GIVA 5FWEA 4X2TA 4COYA 3AX4A 5LEKA 4D7TA 2WZR1 5IFTA 1NOVA 5KXEA 2B4KA 1QDOA 4ZXKA 4RQPA 4AVAA 4P4EA 1K4JA 1IOIA 1S0FA 1GP6A 5CNAA 2POKA 2GALA 4DOUA 2ZGLA 4DO0A 2WPWA 1H1MA 2PVWA 2NSMA 5IYYA 4MLOA 3PVBB 2E63A 5IT6A 2WFPA 3WF3A 3IWEA 3NNJA 4L11A 2EK8A 3THPA 5LRGA 5JXGA 2QQLA 3RZGA 1CPMA 1NZIA 5JR7B 1YC61 3JQXA 2P6FA 5AC93 4CS0B 5A80A 2RJLA 5FZOA 4CP9A 3T0BA 1E5IA 4R9CA 5FY1A 1LGNA 5JSPA 4CYOA 2JBJA 5BNOB 2FT0A 3UV9A 2WNOA 3A9LA 3FFZA 3NWKA 3W5MA 2DU1A 2FE7A 1Y7BA 3WQ7A 3APBA 2XEGA 3PMSA 4G1PA 1TKFA 3H8EA 5EJ1B 4QU2A 5FZ3A 5LA1A 3TN93 1GOGA 4RR3C 2P37A 4CDUA 1BEV2 3NVCA 5DZGA 1ZRDA 4AGGA 3F0AA 1K42A 4YFJA 2JEMA 2PLV1 2WO7A 2BWAA 2NQYA 5I0SA 2W0XA 3MV11 3AC0A 3ZFEA 3ZYPA 2AYHA 2CU5A 3MUZ1 4A95A 4QQOA 3AFKA 1V6KA 5FR3A 3KVBA 1L7LA 1S0JA 1O4ZA 5FWJA 4TLGA 1OOPA 3FBYA 1HV1A 2KA3A 2YUEA 1ZM1A 2A6VA 3WUCA 4X3RA 5F5CA 5GKAC 3CPXA 3TCVA 1V6IA 4KOYA 1H2NA 4P44A 2VCBA 2DXQA 5I0RA 1KQRA 4K8RB 4IEZA 3KF5A 5BNNA 5JXIA 4IV3A 4IGOA 3SEPA 2Y33A 1HRI2 3ORJA 3T2QA 5JM6A 3NKGA 1RUH2 5FLIA 4YM1A 2FD8A 2AFMA 1BPMA 1DGWX 2XQXA 4M3CA 1KUVA 1O8SA 1NQDA 3ABZA 3FL7A 3KGQA 2VW2A 4HN0A 1JTZX 3H1MA 3QH6A 5AG5A 3CHXA 2D3PA 3MUY1 1RL3A 3PB4X 2BSWA 4PQAA 1XB9A 2BQPA 1W06A 2PELA 4CCNA 4QPIC 2ERFA 4YW1A 5G05L 5J96B 1OPMA 4EYUA 2EBJA 4PCRA 2R0FA 1BBT2 4ORFA 2RS11 2XJSA 5F3CA 3N7ZA 4AEDB 3AVSA 1UWWA 2Z3PA 3NRUA 5LY2A 4OHYA 4P4BA 2WZPP 5E89A 2XKOA 1D4M2 4P00B 2CXAA 1PNFA 3EQEA 4FPOB 3N9PA 3RNZA 2KD7A 4KL1A 4MHRA 1GUIA 2Q8DA 4NEXA 1GOFA 3T1LA 3ETPA 2UY9A 4BJ0A 4LBQB 3P1IA 3I49A 1HN0A 5GZFA 5C9AB 2KR2A 1W2AX 4P9YA 5C3OA 5C7GA 3TRSB 4B4RA 4WVVA 3NH8A 3PB7X 5K4LA 3SJXA 5AVPA 5IK4A 5IAXA 1VMJA 4MGTA 1UPSA 1LANA 1YLEA 4BCUA 1Y3TA 1PZ8A 4ISRA 3LA7A 4M0NA 4RS5C 2DURA 5FK7A 3KQXA 1WMFA 1V9U1 2VTFA 3NAPA 4BK5A 2EALA 2VZQA 2V8GA 4GB31 4BBHA 4EJRA 3F2ZA 2WSUA 3DECA 1RUG1 1O3RA 4CAWA 1F8VA 1EPZA 4AHYA 5J37A 3KCCA 3MFAA 5FO8B 5IVEA 1TMF3 3WSOA 4XUOA 4AYUA 3JQWA 5T52A 2MPFA 1TZOA 3LDKA 5DUVA 1LOFC 2BFUS 2Q1ZB 3AJYA 4QPGB 3NJZA 4KSFA 5F48A 4LUMA 4F0YA 4JGYA 3POFA 2WZR2 4FOQA 1ZBE1 3L9JT 1NG0A 3POSA 4YWYA 1S0BA 2PSWA 4H6UA 2PHWA 1ASJ1 5JZGB 4NHLA 3RMYA 1W39A 2J1TA 1YLOA 4YYOA 4XQDA 3N9LA 3ZFGC 2RS33 2XB6C 3ZXFA 4DEQA 4NGNA 2VZRA 1VAKA 4AF9A 3FB3A 3AMPA 1SLIA 3QBQA 4CPBD 4FPEA 4MFQA 2RDNA 4PXEA 1XU1A 2R7EB 3J7LA 4MXWA 1FI2A 1AVBA 3M3IA 1P4NA 2YPDA 2QECA 2PA7A 3DXUA 1WCKA 3IDCB 3LQCA 1D7PM 3U75A 4EWTA 1JHNA 3FWEA 2QBXA 2DUQA 2R041 1A34A 5GALA 2YDEA 4H7MA 4XFIA 4PDWB 4Q27A 3ILFA 1WBFA 3NJVA 1REDA 4PI2A 5EZWA 1HQLA 5FP4A 2B3UA 1BAVA 1AR91 2EIBA 5ACA3 4HONA 4FWUA 4K7JA 1AYM1 4DNYA 2ZX3A 4CRZB 3URFA 5F09A 2Q30A 4Y20A 1GYKA 1WCUA 1UY2A 1JOJA 4GWMA 2NZ9A 1OOPC 1ND2C 2PLV2 1RTVA 4EROA 5A32B 1Z7S3 1FNOA 5CKNA 4KBBA 2BWCA 4F3JA 2A5ZA 2VQYA 1UU6A 3CZXA 2A6ZA 1U5YA 1WGPA 4AVSA 1YRZA 4YARA 3BIWE 4JC1A 5D8AC 2X5IA 5A33A 1YQ6A 4FPHA 1QIQA 3J7NA 3L2HA 1UY3A 5JUVA 3OTFA 2GANA 4YRDA 3VD4A 4XF3A 3H8XA 4N53A 4W6YA 1CAUB 4A2ZA 4Z8BA 3DUIA 5T3NA 5AGEA 4B11A 5A7SA 4SBVA 2GC2A 1WA6X 3V65A 4MGIE 2VNOA 2RMU3 2GREA 3MIDA 3KL9A 4CCEA 2K0GA 2W1UA 4NR1A 4AFMA 5M0TA 1IZ3A 2O28A 1YK3A 1KD7A 1CAWA 5FMOL 4HXCA 4YG0A 1XOYA 1PU9A 1VMFA 4UCMA 1GKBA 2XLGA 1UMIA 1DE4C 2FDGA 1ZBA2 5KR7A 2W08A 1JI6A 4FFGA 3RZLA 4OI2A 2RS12 4ZYQA 1NE6A 4NRMA 2IXHA 5A6YA 2OKXA 3B3CA 1HLCA 4C0HA 3B5LB 4LA3A 2D93A 4HPKB 1XE4A 1S7KA 4CCOA 4Q4X2 1L0CA 1W2UA 1AR72 3WNMA 3K3NA 4ZS2A 4ASLA 3DYMA 4Q2FA 2F17A 5GLZA 1LRZA 2VBDA 3E0KA 4Q0QA 1EV11 4F9VA 3ELNA 5D8NA 5FAXA 5BNPC 1S2BA 4LHLA 4XCBA 1QJY3 4V2VA 3H42B 1TKHA 5FP9A 1G8WA 1H4HA 4MGQA 5FKCA 3VDCA 4MSVA 2IQ6A 1XE7A 4MFKA 2W94A 3NMBA 2VO5A 3VBHC 3PZJA 2A70A 1RUOA 5C71A 3SXWA 5K9YA 1REFA 5E16A 2MEV3 3VWDA 3ZYIB 1FATA 3FEDA 5JXHA 4GB32 3PJQA 3WCRA 3E6DA 4PSWA 1W9FA 1RUG2 4JGYC 4Y49B 3ON7A 2V09A 2ZEWA 5FZ9A 3GYAA 3RYKA 1NSAA 1MEC2 4HSJA 4KVOE 3E5QA 3QNVA 5CFCA 2UURA 4CCMA 2JE8A 2WZNA 1LECA 4A3XA 5FXWA 3M70A 4CRQA 4KWJA 5DZFA 2OS2A 1YVKA 3EB7A 3RZHA 4AI3A
chains in the Genus database with same CATH topology
2BFUL 2CNTA 1PO11 3IKWA 2XWBB 1WLDA 5KC6A 2H5MA 5H9PA 4RFT0 3DPRB 5CAZA 1HRI3 3N35A 4IERA 1DFQA 4AI0A 1VBD2 1VBA2 1W0OA 1RUH3 2A73B 2X29A 2JG9A 4CYDA 2HWE3 4GXLA 5LRSA 2VOKA 3WW4A 1QF3A 2HKXA 1YO8A 5K7PA 2CGPA 1DZQA 4UBRA 1CESA 1EP0A 3HN1A 3ENRA 2R98A 1UAIA 4B4QA 3RI9A 2IWGB 4WM7C 3ZIXA 2GMEA 3R9GA 1N1SA 2EAKA 3X29B 2VQAA 2BEIA 2OH1A 5IUQA 4C1WA 1OFNA 5AG4A 1RMU3 1QJY1 3POWA 3FLPA 3DV8A 3MIFA 2X7BA 4EN9B 2SBAA 3BCWA 2J8MA 1AZDA 1V00A 1AXYA 1HIXA 4Y5Z0 1R093 1TME2 2VUAA 4ES8A 4COVA 5T5OA 3TO7A 2YNEA 1AL22 4K30A 1BEV1 4YZ5A 1DLLA 2XBO2 2RR12 4G4FA 1FOD3 4J3GA 4CDXC 2F4PA 3USUB 5FOBB 1XF8A 1LGCA 1Y9QA 2B46X 3N4MA 4LBQD 1MZ5A 3OBTA 1MACA 4FOYA 1SCSA 4C1XA 3I59B 1FPN1 4G3YC 1U12A 1UL9A 1LEDA 4G9SB 1MS3A 1ULEA 1V70A 3WG3A 1J4JA 2Z3KA 2DVFA 3D2PA 2A3WA 1BZWA 2HWB3 3RYOA 1DGRN 5JPMB 3TOAA 4K40A 1BOBA 1YYNA 3IN9A 1R57A 3CJIA 2FMYA 2MEV1