4ONUA

Camp-binding acyltransferase from mycobacterium smegmatis, e234a mutant
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
332
structure length
314
Chain Sequence
b'AELTEVRAADLAALEFFTGCRPSALEPLATQLRPLKAEPGQVLIRQGDPALTFMLIESGRVQVSHAVADGPPIVLDLIIGEIALLRDAPRTATVVAAEPVIGWVGDRDAFDTILHLPGMFDRLVRIARQRLAAFITPIPVQVRTGEWFYLRPVLPGDVERTLYRRFQSVRKPTRALLEYLFEVDYADHFVWVMTEGALGPVIADARFVREGHNATMAAVAFTVGDDYQGRGIGSFLMGALIVSANYVGVQRFNARVLTDNMAMRKIMDRLGAVWVREVVMTEVDVPPVDTVPFEPELIDQIRDATRKVIRAVSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyltransferase Pat
publication title Allostery and Conformational Dynamics in cAMP-binding Acyltransferases.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
total genus 93
structure length 314
sequence length 332
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4onuA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4onuA02
2DXQA 1MJBA 1RL3A 3R9EA 4J1WA 4XFAA 3FFQA 1LRZA 1M1DA 3IDCB 3R9GA 1ZZCA 1IYKA 2ARHA 4UWIA 4K30A 3FE5A 2KXLA 1RXTA 1JUHA 4LUMA 3PZJA 4JD6A 4LUKA 4UA3A 4R52A 4M3SA 2REEA 2FIWA 1CAVB 1B87A 4FD7A 1L0CA 2Z2SB 4MH0E 2P17A 4KZTA 3TOBA 3DR6A 3OTFA 4JLYA 4EWDA 1O3TA 4DNCA 1OD5A 3FBUA 4QGNA 4TLFA 3W6SA 4YARA 4YRDA 5BY5A 1K4JA 4HLTA 3B8GA 4UWJA 3BJ8A 4EV0A 4MY3A 1QSTA 4I01A 2PYTA 2OZHA 2HUZA 1XE4A 2V09A 4LX9A 5FPXA 1NZCA 4RD7A 1ZNPA 2BYVE 5FLIA 3E6CC 4CRYB 1FY7A 4XF4A 5KBFA 4UBHA 4ZU5A 2Q04A 1VP6A 5IX3A 5BUVA 4QX5A 2B9UA 3PLQA 4KL1A 3ELNA 2H0VA 5I93A 2OU2A 1ZX5A 2O8QA 2R98A 3IWGA 2B5HA 4FD5A 4CRZB 2XLGA 2XL7A 2PAMA 1KUYA 3GKRA 1Q3EA 2GAUA 2P6GA 3EO4A 1DZRA 4XETA 5KTCA 4RI1A 2Q4SA 4I0BA 3ZJ0A 2E9QA 2ZCWA 1J59A 1J4JA 1O5UA 2P6FA 4E8OA 3CO2A 4KVME 3KKWA 2ET1A 3HIFA 4IERA 4IEXA 4MUVA 4IUSA 1EPZA 1EY2A 3WW4A 1YVKA 3E5QA 4KVOE 1G6NA 4PJYA 1QY4A 1GHEA 2VZYA 4J1XA 4FBFA 4IEQA 1V0CA 1H1IA 4R3LA 3T90A 2BGCA 1EP0A 3RYPA 2VEZA 2UYAA 3ACLA 4R8HA 2R1IA 3F5BA 4E0AA 4PK3A 3BCWA 3E6BA 3N7ZA 2QVSB 2PC1A 4MI4A 1ZRFA 1CAWB 4MZUA 4PIXA 2FT0A 2JDDA 4H6UA 1X82A 3VWEA 1VR3A 4D7TA 4E2SA 3JUWA 4LUAA 4A2UA 4F8AA 2I79A 3D2MA 5JPHA 1YFWA 4QXKA 2GC2A 1WLTA 3GY9A 3H7YA 3G7DA 2GC1A 1CX4A 1ZREA 1WK4A 3R1KA 1VJ2A 2D40A 4L8AA 4DINB 1I5ZA 1X8MA 3EC4A 5JSPA 1BOBA 3VWDA 4KLVA 1UFHA 1QXRA 2UY9A 4AB7A 4QGMA 3TO7A 3MDPA 3LODA 2B58A 3GBFA 2GANA 4KOTA 3TTHA 4J3GA 4HVQA 1RTVA 5FLHA 4MV2A 2G3TA 2XLFA 3DL3A 3S6FA 2IXCA 1XIXA 3MZHA 1WGPA 3I7DA 4KOWA 3OGJA 1S3ZA 4XPDB 1XRUA 4HZFA 4MGZE 2Z10A 1M44A 3O14A 2BEOA 2QMLA 2FCKA 4ONUA 5LEKA 4KWLA 2Z0ZA 1Y9WA 1PM7A 5CNPA 3N4MA 1BO4A 3QAHA 1O3SA 4PSXA 4YGOA 1KZFA 2PR8A 3D3SA 1FT9A 1NXMA 1M4GA 3USSA 5E1RA 2HKXA 4XPDC 3HT1A 2BL1A 4U5YA 4UBRA 4XNHB 1CAWA 4E2QA 4LULA 3FWEA 2I00A 2D5FA 2B3UA 1Q43A 1WA4A 2R8VA 3LZZA 2EA7A 5KTAA 2OZUA 2B4DB 3E6DA 1Y3TA 3G8WA 5FDBA 2J8RA 4IEOA 2EVXA 5F48A 4E2GA 4Q0UA 3IWZA 2XKPA 3NE7A 4XNHC 3LAGA 1Z4RA 2BNMA 1LKNA 1QWRA 3LWCA 5I8TA 4I2OA 2HQYA 3TO6A 4B5OA 2BNOA 4O9EA 3CXPA 1J1LA 1SQ4A 2XLAA 3R9FA 5I0TA 1DGRA 2OA2A 4YYOA 2XGXA 2UY8A 4M85A 1UCXA 5E16A 4KOSA 1P4NA 4HMZA 2JEVA 5I0SA 1M4DA 5EBVA 3ES4A 1O7FA 3LA2A 3SCGA 1IB1E 4GS4A 1UPIA 2ZW6A 4MJ8A 4E2AA 5IV0A 1CM0A 3EJKA 2K0GA 4I49A 2GC3A 1YR0A 2IXLA 2PA7A 4JV4A 4NVPA 4F7ZA 1S7NA 4BIFA 2CNSA 3MYXA 4N9IA 4NSQA 5EC4A 4WBBA 3P2HA 3DSBA 1S7LA 3TCVA 5IB0A 2P0WA 5FVJA 2A4NA 2OB0A 2Q0YA 2ATFA 3H4QA 3PP9A 4UXAA 4XFIA 2QDRA 2AJ6A 3FJSA 1QSMA 3SCFA 3R96A 4Z07A 3P2FA 2VQAA 4IEUA 4QBJA 3H7JA 1I6XA 2PAEA 2B4DA 2IXHA 4L89A 1HW5A 3RPQA 3CLPA 5LRSA 2BSWA 4KU7A 4YSFA 3R95A 4B29A 2IC1A 1YLEA 3D8PA 2H5MA 1UIKA 4FAGA 5KHJA 4KOUA 1O4TA 3IDBB 2D5HA 3JZVA 4AQ2A 5JCTA 4FD4A 4X5KA 3SXNA 3TO9A 2QJVA 2PQQA 2WPWA 5C82A 1H1MA 1ZZ7A 5LRRA 3S7IA 3H1WA 5F1RA 1KUXA 1Q2CA 3CXQA 4PK2A 1L3JA 1Q5OA 3UKNA 2N7GA 3ES1A 2CAUA 2OYZA 4OLLA 2EAAA 2OZ6A 1PUAA 5F46A 5J8CA 4QM9A 3TFYA 4JXRA 1ZZ6A 4N9HA 3GYAA 1OI6A 1TQ5A 4BHPA 3ST7A 1I21A 2Y0OA 1YHFA 3M3IA 5C8WA 5HMNA 4JTOA 3H50A 3V8IA 2MNGA 3U0ZA 2GE3A 1PMIA 1YK3A 4IETA 4NF1A 4R87A 4X6RB 1J3QA 2EVNA 4YFJA 4I09A 1V70A 5JAXA 1IPKA 4AVCA 2FXFA 1R57A 1NYWA 2EUIA 4JVAA 1J58A 5T3NA 4JTNA 5CVRA 1P0HA 1ZRRA 1ZZBA 3SCHA 4KVXA 4EROA 3TE4A 1YFUA 1IICA 5J8FA 3BB6A 4AQ6A 2Q0AA 4HN1A 4I0AA 2VBQA 3QB8A 2IXIA 2WFPA 1S60A 2RC4A 4PIYA 1PU9A 3MPBA 4WVZA 2XHKA 4XF1A 3WW2A 3OCPA 4Y49B 4XFGA 4RS2A 3K9UA 4KUAA 3H1MA 3H3UA 4QMAA 4Z82A 3FXTA 5KTDA 4CS0B 3HQXA 1NSLA 3C3VA 1YGHA 2J8MA 4H7LA 1YWKA 5J7MA 5J3UA 1QSRA 2ZKLA 2GC0A 5I91A 3I59B 1WWZA 5C6CA 2Q4VA 1ZZ8A 3W91A 5EFUA 4Y49C 2Q1ZB 3SXOA 1FI2A 4XFCA 4KWJA 5GCNA 3EHKA 1NE6A 3FZ3A 2F4PA 1U12A 4OFGA 4F6AA 3KSCA 4II9A 5DWNA 1DZTA 3M70A 3SXWA 5CU1A 2R7HA 1YVOA 2O1QA 4ZU4A 1QXJA 1S5KA 3MGDA 3R6SA 2FSRA 4QGLA 2IL4A 2ET7A 1X7NA 1OMIA 1RC6A 4IEPA 5C88A 1LRHA 3D0JA 1IIDA 3S6KA 1Z4EA 1NE4A 3TT2A 1CJWA 3D82A 4Q29A 4GULA 3WW1A 2ZW7A 2QCSB 4AXOA 3FB3A 2B5GB 2KCWA 1N71A 2MPFA 3PVBB 1O3QA 4MBUA 4HSJA 3EO6A 2MHFA 3EFAA 2D4OA 4UBGA 5KHGA 1ZZ9A 2JDCA 4FT8A 1O5LA 3DNSA 2O28A 3B02A 2ETEA 5I0UA 2F5IA 4HN0A 4XEZA 3I3GA 4XPLA 3S6GA 4EWEA 3I59A 5KHIA 4OAEA 1MK4A 4XF3A 2WC2A 4IF5A 3S6HA 4QM8A 3DV8A 4I02A 3SHPA 1X8EA 1DGWA 1LR5A 3NVCA 4D7SA 2QIRA 3E5UA 3FHIB 4X6QB 2FE7A 3TNQA 3KCCA 5FQ0A 2IXKA 2AE6A 4MHDA 3EQEA 1ZRCA 1OFNA 5D1IA 4PIZA 2GH2A 2OZJA 3DKWA 4HSLA 3I54A 1NE9A 1ON0A 4QUSA 4R57A 2K9ZA 3IBMA 3QACA 2I45A 3KMHA 4IESA 4MGIE 2Z11A 2VI7A 2IXJA 4AVAA 2CNMA 3OWCA 2FIAA 5E96A 1J3RA 4IEZA 1QSNA 2B5GA 4HNWB 2J8NA 3PNAA 3KGZA 4XF0A 4Q0SA 4I3PA 1Y9QA 3U11A 5LEJA 1Q2YA 2PQ8A 4QB9A 2ZW5A 4META 3UY5A 3ZZIA 3F8KA 1YLLA 2FMYA 4HKFA 2PR1A 3CF6E 5I0RA 1IYLA 4XFBA 2Z69A 4HNXB 2DCTA 2XKOA 3LA3A 4KWKA 4LTAA 1RUNA 1Q2DA 2BUEA 3D2PA 4KOYA 4IEVA 2Q44A 2D93A 1RGSA 1UD1A 4AG7A 1VHSA 2QECA 4XPKA 5F47A 3LD2A 5KHKA 1YX0A 5JSRA 4L2NA 3JVNA 5JQ4A 2B8MA 4BMHA 2UYBA 2OZGA 4H89A 5I0CA 1MJ9A 2D4PA 2ZPAA 3F0AA 2BNNA 1OZPA 2JLMA 3SHRA 4HVOA 1Y7RA 2VZZA 2C27A 2VXKA 4JJXA 3E0KA 4P9GA 5HI0A 3U10A 4PV6A 2OPKA 5KHHA 2K5TA 3VHRA 3IIAA 1EYBA 2PSWA 5I8SA 4QC6A 5EZWA 2PTMA 1ZVFA 4BH9A 2PHDA 3NSTA 3FYNA 3IGRA 3H3ZA 5DWMA 3CJXA 1RO5A 1KUVA 4MX3A 3TNPB 1NMTA 2CV6A 2B3VA 4U9ZA 3NKTA 3W6XA 3DR8A 4EVYA 5JSOA 2GU9A 1I1DA 4IEYA 1GQGA 2PHLA 5J48A 2PDOA 2B4BA 4MGYE 3NL1A 1I12A 5AVPA 5CADA 1LB2A 2CAVA 2C0ZA 4EWAA 3FRMA 3SMHA 2CY2A 4K8FA 2G0BA 5BV6A 3OD0A 3EXNA 4ZU7A 4OADA 3WR7A 2XL9A 1CAVA 4KU8A 3H1YA 1GQHA 1U6MA 3I9SA 2GZWA 4AVBA 1S7FA 1XF8A 2G3AA 1UIJA 4F0YA 3UKTA 3ROUA 4KOVA 1CAUB 3NW4A 2HJIA 4HBNA 3RZZA 4HVRA 1S7KA 4KOXA 4R3KA 3E97A 4MY0A 3QOPA 1SFNA 2PAKA 3FIXA 4KLWA 2Q7BA 3ETQA 5K8SA 5FCCA 3EBRA 1B6BA 1Y9KA 2VQYA 2ATRA 1XMTA 2BEIA 1VKCA 4ORFA 3PGPA 4B5PB 4NCZA 5FQ0B 3NJZA 1J3PA 2H6BA 4L11A 3EY5A 2FQPA 3HT2A 4XF9A 1FXZA 2Q4YA 3BU7A 3RYRA 2CGPA 2CNTA 3RNSA 3BJ7A 3KGLA 4MGKE 2HV2A 4U9YA 2NMTA 4CAXA 3D0SA 1CGPA 4H6ZA 5FLJA 1SEFA 4LA2A 1UW8A 3S7EA 2VECA 3LOIA 3E5XA 4NXYA 3RYKA 1YREA 1Z9UA 4R9MA 2PRBA 5H84A 3CEWA 3OF1A 1CAXB 4Q0VA 3WW3A 3G3SA 4HNYB 4LEJA 5HH1A 1IPJA 4LA3A 2P6EA 2ZW4A 2X7BA 3L2HA 4LLOA 1XE7A 4BYYA 1XEBA 4NEXA 4YRHA 4CAWA 1CAUA 4ZBGA 4FD6A 2PFWA 2Y0MA 4KORA 2VPVA 5F49A 1YFXA 3DN7A 1YUDA 4JXQA 1RUOA 1SQHA 3H9AA 1YFYA 4CYDA 2QNKA 2ZXVA 3BPZA 4Q0PA 5BPXA 2REFA 4JWPA 4QVTA 4WZCA 3GYDA 4Q0QA 2GIVA 4AG9A 4B5PA 4YNIA 3T9YA 4IEWA 4FAHA 4CAVA 5JR7B 2FL4A 3C26A 5I8YA 3CXSA 4PSWA 3CL1A 1XE8A 1MJAA 2Q30A 2FS5A 3H8UA 4XFHA 5BXXA 2WPXA 5H86A 3TOAA 3RYOA 3LA7A 4XFFA 5FPZA 1ZRDA 1CAXA 1M4IA 3RDIA 1TIQA 3FNCA 3FX3A 4O9GA 1QSOA 3DDDA 3BLNA 3UKVA 3ZDSA 2H6CA 3S0MA 2OH1A 5ISVA 4KUBA 1O3RA 3BALA
chains in the Genus database with same CATH superfamily
4K3NA 2DXQA 4CCOA 4MOAA 4CGLA 2HEYF 3BIWE 2E6VA 3PMEA 3R9GA 2YG0A 4CUBA 3S5AA 3K4ZA 1E5RA 2D6MA 2X5IC 1CZTA 1JODA 5K7PA 3AL6A 5BY5A 5C9AB 3B8GA 3O12A 4A32A 2PIZA 3KCXA 3W21A 5KC5A 1XJAA 2B9UA 5EYYA 2OU2A 5IB9A 1KUYA 4D94A 4LBQD 1R082 3ZFFC 4KQ7A 5JXHA 4Z92B 2UYAA 4GD4A 1AYM3 3VD3A 2VOXA 1X82A 2QQMA 3D2MA 3DLJA 1VIWB 2DBNA 3B69A 3VBUC 4P44A 1UY3A 3LWUA 1AR62 4P5HA 4MV2A 1XIXA 4UF0B 3OGJA 1YIPA 2Z10A 4R76A 5A6ZA 5A33A 1BO4A 2R061 4W8JA 3USSA 2E7TA 2JXAA 3AKSA 2FDIA 3I97A 5FDBA 2HBUA 1W2OA 4Q0UA 3LAGA 4I2OA 5J09A 5I0TA 1DGRA 1A8MA 2UY8A 3IEHA 4Q4W3 1VB4A 2JJ6A 3OGVA 1O7FA 1VRH3 3FEEA 1GNYA 2ZELA 1R43A 5FVJA 2OB0A 1QMJA 4R7MA 3FJSA 2YY1A 4H2AA 2QQUA 4QAWA 3PUSA 1OD3A 1QNYA 4L89A 2R1BA 1DTDA 1WCKA 3CT9A 3SH3A 4FVVA 4OI1A 1I21A 2V5DA 3ZYRA 1ZG7A 2GE3A 5I4MA 1DCSA 4Q4V3 1O59A 1B35A 4K40A 2R49A 1F2PA 1ZBA3 1PVC2 1VBA3 1F2NA 5LB6A 4NGMA 4CS0B 1YWKA 1QSRA 3PJYA 3ZX7A 4NRMA 2JDYA 1YW6A 1MQTA 1QOSA 2XJUA 3ISZA 2EIDA 2XVLA 1S5KA 2YFUA 4GWNA 4XPVA 4XZUG 3NWKA 3NNLA 2VBDA 4YG6A 4H55A 3IDAA 4PBPA 2VZUA 4RFT0 1WUVA 2F17A 3ZYJB 1W9SA 5BNNC 3TBDA 3CU7A 2K2SA 5D2AA 3T1MA 4AQSA 3E5UA 4DMIA 5D1IA 4QUSA 5IYYA 1U5XA 3QACA 4UFIA 3PB8X 1MS1A 3AMQA 4FTBA 4S2FA 3KGZA 3JTKA 3UY5A 5LEJA 4QB9A 2GNDA 2VH9A 1NZIA 1F2OA 3ZSJA 2XKOA 4LTAA 4KOYA 2PLV2 1H1AA 4JDOA 1VHSA 4XPKA 4HKOA 4AEKA 1DYPA 1AL23 1YJKA 2JDNA 1BXHA 2OPKA 2PSWA 5EZWA 3H3ZA 3S9MA 1EUTA 3VKNA 2XONA 3CIHA 2EF6A 1SDDB 1FMD1 3WDXA 3DR8A 1PVXA 2X29A 1UX6A 4FPYA 5J48A 2AZ5A 1OLMA 3VKLA 4P45A 4LBLA 1GQHA 4K9SA 3I9SA 4KOVA 2QQJA 5LYIA 3I2OA 1PYTB 3FIXA 5FRAA 1E5HA 2ATRA 2BEIA 4MO3M 1W8WA 4L11A 5F9TA 1D2SA 4CUGA 4K1YA 2VECA 4N7IA 2Z3PA 1FPN2 1CPMA 2BRTA 1UOBA 3ON7A 2RMU1 1Y4WA 1RUOA 3T0DA 3H9AA 1H8TA 1W39A 5ELYA 1Z7S3 4IEWA 2BO9A 5LYLA 5SV8A 3P3PA 1NQDA 2VQ0A 1LOGA 4XDQA 5EYXA 3AZZA 1AR83 5L73A 3V64A 4TTGA 3BU0A 4FOWA 5FXXA 1PO13 3UKVA 5F37A 5ISVA 1N1SA 1NCRA 2VL4A 2R7HA 1MJBA 2X5IB 4M3CA 1GP6A 1WMDA 2ARHA 4LO8A 4EYUA 3FE5A 4LUKA 4JZRA 1WW7A 1TG7A 4MH0E 4QDRA 2WLPA 1NT0A 4QDQA 5GALA 3WX5A 3BXMA 2DUQA 3K2OA 4DOUA 1IG3A 2AENA 4FTSA 1GZWA 2Z3MA 4Q36A 1F5JA 2OZHA 2EBJA 2HUZA 1QU0A 3UNPA 2YYOA 4PHZA 4CXWA 4WM7A 1HRI1 4LQ6A 4FD5A 1WA6X 1JHJA 1PMHX 2XL7A 5JMCA 2Q4SA 1CPXA 1J4JA 1W9TA 2X05A 2JD4A 3F2ZA 4FBFA 4IV3A 2R1IA 1HV1A 2Q43A 4Q4Y3 4W65A 3VBUB 4Y3OA 4RSUA 1LENA 2ZEOA 2FHRA 5G21A 3I2KA 3BOPA 2H0BA 2TNFA 2VMDA 3MZHA 4IHMA 4WVWA 1TME2 3ZXDA 4KWLA 3N4MA 2RS12 5GZCA 2JIGA 3LEMA 3VZMA 4DPNA 4U5YA 4LULA 3K3OA 1V00A 5L9BA 3VBHB 2PJBA 2XKPA 1AYM2 4FQ4A 2BNMA 3N5FA 3GM8A 2OQ6A 3MW2A 2PIYA 3ZLIA 4BISA 2R043 3NH4A 4GS4A 2EIEA 1XOYA 2K0GA 2BUKA 3K77A 1S7NA 4BIFA 4N90A 4NIHA 2B7YA 5EC4A 1VBD3 1QF3A 1IS6A 2BWAA 3AXDA 1QSMA 5AG4A 2VQAA 2XJSA 3PUHA 5FZMA 2B4DA 1CESA 1UMHA 2XMLA 2ORZA 4LE3A 4AOCA 3UGGA 1ZYBA 3TWIA 5KHJA 4KOUA 2Z42A 1ZZ7A 1S0IA 1VE0A 1B35C 3ZSKA 4DYOA 4LO4B 2ZPXA 1NY72 1OI6A 3ST7A 3M3IA 2B42B 2DPTA 1PHMA 2C6SA 4Q4W2 2WZ8A 3KV6A 4X6RB 4EMEA 5IVVA 4JRLA 4CCKA 3U4SA 2BVBA 2WFF2 1LU1A 3PEIA 1JH5A 1COV2 2XHKA 1LEMA 3GBGA 4A38A 1H6XA 1PVC1 2R1DA 2J8MA 3SNMA 2GC0A 1RUJ2 1CP6A 3A22A 4NHYA 1NLRA 4OC2A 2IL4A 2ET7A 1RC6A 1GFF2 1IG0A 1AL0G 3ZFEA 1I5PA 3DUIA 2RE9A 5A32B 3CNAA 1QJU3 4AFBA 2DFBA 3AP5A 4DEQA 4PI2A 3I59A 1ZBA2 1Y0RA 2WC2A 2ORXA 3SISA 1OOPB 2W1QA 4P9XA 5FMOL 4WM8A 3VL8A 4DJLA 3TB0A 1REEA 3TEZA 3P6BA 1FYUA 2AE6A 4OIDA 1YEWA 2AFXA 3WNPA 2FCUA 3PNAA 1PNFA 2PQ8A 3PMSA 5HCBA 4JDMA 5F2SA 4KWKA 2J1SA 5IFPA 2AC1A 2Q44A 5T55A 5EPAA 2JIJA 2WKKA 3D66A 3C7GA 3LD2A 1YX0A 3WP4A 4AEDA 2D4PA 2GMPA 4WVMA 2OQ7A 2ZXQA 2ZABA 3I8TA 3SEEA 4XJUA 4YGCA 2V72A 4EZ4A 4LK7A 5DAXA 5F3CA 1JXNA 1SACA 2BFUL 4OUEA 3J8F2 1VBC3 5FY8A 4KGGA 2YPJA 3E97A 1YXWA 3PURA 2BOIA 1VKCA 1VBE3 4QHOA 5F8PA 4QT6A 4BMEA 2ZEGA 5FYBA 3A0KA 1H8TC 1ASJ3 3NQHA 2B45X 4H6ZA 2XJTA 4B7EA 2D3PA 3G3SA 3MO4A 3OOXA 3W59A 2E32A 3B9CA 1FPN1 5AFEA 2VMFA 5T5LA 1I3HA 1SLCA 4U2AA 2JDHA 2ZACA 4CUAA 1NCRC 2BWCA 4M3CF 4B5PA 4CAVA 1XE8A 3TOAA 2DTWA 3LA7A 3T2QA 3T3YA 2J22A 2ZW7A 3ZXLA 1RL3A 4WM7C 2Y6GA 2P17A 2RV9A 4DIQA 5BNPA 5F7UA 4ZPIA 3C2UA 1Z7S2 4YVWB 2VY0A 3MHZA 1W0NA 5KBFA 2RM22 4IV3C 4MFQA 4QXCA 1C8M3 1D0GA 2P6GA 1PO12 3H3LA 3ENRA 2ZCWA 1J59A 1SFYA 2P34A 5DAWA 5A33B 2VEZA 5T54A 2DU0A 3BCWA 1CIWA 1V6KA 2ZEHA 1SZBA 4HOOA 3KV4A 1H8LA 2JE7A 4QXKA 3O1SA 4CDUA 3R1KA 1VJ2A 1X50A 5C4WA 3EC4A 3WT4A 2B4KA 1F31A 4EN9B 1H4GA 2Q8OA 2ZHKA 4FPLA 4UWDA 5FLHA 3S6FA 3HAGA 1QQ9A 2J7MA 4Q1RA 2C5DA 2J1RA 1SBEA 2QMLA 3POJA 2JDPA 1W3VA 3KR5A 5IT6A 3ZIWA 1KZFA 5FYZA 1BCXA 1TNFA 1WA4A 3LZZA 2EA7A 4JAAA 3MN8A 1EUUA 4EN6B 5F48A 4Q4Y2 5FXWA 4XNHC 4D8MA 2DUOA 2L9LA 3WHTA 2C6PA 1T6BX 2XLAA 1AYM1 4XIKA 3I2FA 1JW6A 3EMRA 4AWDA 1M4DA 1LAPA 4P4IA 2B39A 4N9IA 3MIHA 4CAFA 4A31A 1HKDA 1W6PB 4JCKA 3TX8A 3KM5A 4Z07A 3H7JA 2VOKA 1APNA 1UIKA 4CDQA 2TBVA 3WDWA 1PUAA 4XUQA 4QM9A 3GZEA 5EP9A 5FY9A 5GZEA 3M3CA 1UX7A 5C8WA 4M00A 3ZIXA 4D6QA 1NY71 2MNGA 1PK6A 1DQ1A 5LBFA 4Q4W1 3ZKYA 3FC0A 1T2XA 2WINB 5T3NA 4JTNA 1LESA 3ZXEA 4K20A 4L92A 4D7YA 1VBD2 1YFUA 4ZXKA 4XE9A 4Q1PA 1VRH1 4RA0A 3ZFEC 4BA6A 5KTDA 1SCSA 2VCBA 5IAXA 1XNAA 5LY2A 5C6CA 2WDBA 4XQ4A 1NE6A 4A4AA 2MEV3 4O61A 4P9WA 5CU1A 5LASA 4ZU4A 1UMIA 1ALYA 2A71A 1DDLA 4WM8C 1Z0HA 3GDBA 1O91A 1QOOA 1LAJA 3SKJE 2WN3A 4AI1A 4Q4V1 1L7LA 3FVLA 5JDBA 3JB8A 1XNTA 3APBA 3V0AA 2VUCA 1MZEA 1OHFA 1W06A 1RYYA 1ZBA1 1VBA1 3HBKA 2J1TA 4P5YA 1ZRCA 4PIZA 2GH2A 4NN0A 3I2HA 4AEDC 4MGIE 1POV3 1X12A 1SFPA 4IXLA 4QB2A 3SI0A 4JKKA 4HKFA 4CCCA 1AVBA 1SDWA 4A37A 2XQRA 1QJFA 3F0AA 1NG0A 2Q8DA 2QDNA 4A7YA 3CJXA 2VTXJ 2GP3A 4QQOA 2CV6A 4U9ZA 2DVAA 4EVYA 2XPJA 1V6NA 4MGYE 1LB2A 4EWAA 5K0UA 4ZU7A 1CAVA 2GZWA 2G3AA 1OQDA 4LLFA 1DGWX 2PJ2A 1W2UA 4S2GA 1ARMA 2XBO3 1QIQA 3SJEA 1AL21 2F8HA 4MGKE 1GUIA 5FLJA 4LA2A 5AG5A 4FPFA 3B7MA 5LZ6A 4P08A 4D6SA 3O7OA 2P6EA 1IS5A 2ZW4A 4LBJA 1XE7A 1NCRB 4BYYA 1XEBA 5BWAB 2PFWA 3CKHA 1YFXA 4M3CB 2X53S 4CVUA 2OW4A 1A34A 1UL9A 4CYDA 4Q0PA 1VBC2 5FY5A 3PFEA 3QBQA 4AI3A 4YNIA 4FAHA 4KBZA 2W1UA 3U07A 1GZWB 5LK5A 1VBE2 3RYOA 5BNPC 3B3QE 1VMFA 4CDXB 1CR7A 4D6RA 4Q38A 4WM7B 2ZEDA 1ASJ2 3POIA 3ILRA 4BM8A 1KJLA 3HQRA 4M6HA 3AC0A 3RO0A 3AMPA 3TOBA 1GSLA 4TLFA 1MZ6A 2DVBA 3N9OA 4IV3B 2VU9A 5JR2A 3H8EA 2BYVE 2WZPP 5FZ1A 3FEDA 4UYBA 5IX3A 4DY3A 1MACA 1FATA 2R98A 2C1CA 2ZHMA 3GKRA 1Q3EA 4MHZA 1AR81 5JOZA 3ZM8A 4CDUC 1HN0A 3RWKX 5C4WC 4KVME 4FTEA 1EPZA 3K75B 5FP7A 4GKXA 2ZX1A 3RYPA 3AB0A 4R8HA 3IPVA 4JZ0A 2JDDA 1N1VA 3U1XA 4UIBA 1WLTA 1Z78A 1X8MA 3TO7A 2VNGA 5CYYA 2VZVA 3PTRB 5C70A 2IXCA 3DXTA 4HZFA 2BEOA 1C8M2 4DZGA 4YZ4A 1QKQA 3VZKA 2CWMA 2WWUA 2EWBA 3ECQA 3FLTA 4QU2A 4UBRA 1WMXA 3CQOA 4XNHB 2B4DB 3VBRA 4SBVA 1ZG9A 4MFPA 3TO6A 1T6GC 1SQ4A 4Q4Y1 2C6GA 2VZSA 3IKWA 4Q2FA 2Q1FA 1MVQA 4GM5A 4NR1A 4CDQC 3B3VA 1P8JA 4BD9A 3RG0A 5F32A 1TF9A 1C28A 1OH4A 3UT0A 5JPNB 1HW5A 4R4XA 1PK6C 1E57A 4A33A 1S0CA 4IE6A 2WYSA 3LKJA 4FD4A 4FOVA 1H1MA 4P4EA 5A80A 3ZYBA 3J7LA 4KG8A 1ZZ6A 4RS5A 1YHFA 4JYWA 1RUE3 2ZKNA 5HMNA 3U0ZA 1X9PA 3ME2A 4R87A 2EVNA 3VZNA 4JVAA 5FP3A 3ZFEB 2R041 3SCHA 4OIWA 2I07B 1BVVA 1VBD1 4FPGA 1WZXA 3K9UA 2DUPA 4Z82A 5FPVA 1NXD1 4ZY1A 4H7LA 2W2IA 1UPSA 3I59B 2Q4VA 4AAXA 4XYXA 2W95A 2RVAA 4KWJA 1XE0A 3RZGA 1U12A 4WM8B 2BOJA 3RI8A 3U14A 2HWE3 2QQNA 2UWBA 4GJYA 5FY4A 2YMZA 2HB6A 1NE4A 4ZI6A 2RDRA 4HSJA 3EO6A 3VATA 2VMHA 3T8WA 1N47A 2VZPA 4CTEA 2V8HA 4L9BA 3K48A 3LIGA 2E7AA 3S6GA 1W8OA 3HBZA 1U5ZA 3IWEA 2HC9A 2YNCA 3I2GA 5JVVA 3SHPA 4J6GA 1W6MA 4AEDB 5D29A 1AHSA 5A1AA 2VC9A 1ZLIA 4WVMB 4OMCA 2MEV2 1J3RA 4HPSA 2VMCA 1XC6A 4HL0A 5EJ3A 3RZMA 3D2PA 1ZBE3 3GIUA 2R0HA 4K21A 1SCRA 3JVNA 5HV0A 2EO8A 1QJU1 2VL1A 1O8PA 2POKA 2BNNA 4PXBA 4FPKA 5K0UC 1GNHA 3U10A 5KHHA 3BPSA 4BH9A 1XBFA 4YW3A 5DWMA 1RO5A 2RFHA 4IV1A 2Q1MA 2V8VA 4P14A 3IAQA 3GF6A 3B5LB 1YQ2A 5JM6A 1K5MA 4YM0A 5A7SA 5FK7A 5J1QA 4Q26A 5EWSA 4ZHNA 4MCPA 3JQWA 2PAKA 4LJHA 3L2YA 4B5PB 5FQ0B 3EY5A 3RYRA 3I3EA 4QKNA 1UU4A 1CGPA 3MW3A 4OMEA 1YREA 1WMEA 4NRPA 1ENSA 1CD3G 1YI9A 2Y0MA 4PLNA 1HXS2 1JS9A 4JWPA 5FYHA 2WNUC 3AYCA 3ILFA 1AYN1 5ANQA 2RHPA 3ZO0B 4A3ZA 2VE1A 5HPOA 5BNPB 1C57A 2XBO2 2JEMA 2WPXA 5T5OA 1AJOA 2JG9A 5FPZA 1D4M3 1XBUA 4Y22A 1ASJ1 4MGSA 2YPDA 5FAXA 4UA3A 4LUMA 3PZJA 4AHWA 1UY1A 4ZZ8A 4GXHA 1RUF3 2ZGQA 1MVEA 1HLCA 1PNGA 3THCA 1JYCA 1KXGA 3TYJA 1Z8LA 1RXFA 5LWBA 1VP6A 2ADDA 4CDUB 2NPIA 5C4WB 2PVVA 2O8QA 5FZ6A 1OLME 4XETA 1LGCA 4NUBA 4LBMA 1LGBA 2P6FA 1GKBA 1UXXX 2ET1A 4CDWA 5CBLA 2A73B 3WQ7A 2ZTNA 4KH9A 4TLGA 2HLEA 1H2LA 2VVEA 4LITA 1AX1A 3MUY1 1IQAA 5IWFA 1CX4A 1BPMA 1GOGA 4L8AA 4YVSA 5FREA 2R6QA 1Y9MA 1XNBA 2ZBJA 3VBRC 4OI4A 3WV6A 1WGPA 5CNPA 1M4GA 4AW7A 5E1RA 4CE8A 1MS8A 2I00A 1VALA 3ZN5A 4ES8A 4MYEA 1FNOA 1ULPA 3AZWA 4NIIA 1IGOA 3NE7A 4AEJA 1BEV3 4AHZA 3HPNA 4CDQB 4NHMA 4YYOA 1DYKA 1POV0 2VXJA 4CP2A 3LA2A 1IB1E 2BV4A 4DRVA 1W04A 4M3CE 2VCAA 4H7MA 1BVP1 1PK6B 3ZMNA 5FZCA 4UXAA 1OA2A 3CBNA 4G9SB 4RS5C 4IEUA 2PAEA 3RPQA 1DG6A 1C1FA 1W8HA 3I3DA 1Q56A 5C82A 3V65A 4MG2A 1U5YA 3M3EA 3NNJA 1XSQA 1GZ9A 1TKHA 1MS3A 1NYWA 1CIYA 4FXGB 2GFQA 4GWJA 2VBQA 1S2BA 2Q51A 2PJ7A 3TN93 4QMAA 4IUGA 1NSLA 2ZEWA 1TXRA 4B12A 4SLIA 3V0AB 3KSCA 1BBT1 3ZPYA 1RUE2 1DYOA 2YNCC 4C2ZA 2TEPA 3WW1A 1ULDA 2KCWA 2XH6A 2MPFA 4DQAA 5KHGA 1ZZ9A 1YQ6A 2SBAA 3AMMA 2BPA2 3RS6A 1HEEA 4EWEA 3S6HA 2ZGLA 2YNDA 3VUOA 1DGWA 5JIUA 1Q8SA 1R093 3NVCA 4LQRA 2RDSA 3BTYA 1BLLE 1ON0A 5FWEA 5A7PA 5IK5A 5FFOC 5JPMB 1KJRA 2NZ9A 2HWE2 2MEV1 1ULOA 3F8KA 2PMWB 3CF6E 4IV1C 5A1FA 5K0UB 3P5BA 4L2NA 3WNXA 2OZGA 3SHRA 2XOMA 2C27A 1K5MC 4OI0A 3FYNA 3NSTA 2ANPA 2Z3KA 4QWNA 1PX3A 4YWAA 2WUUA 2VG9A 1H9PA 3OEAA 2R063 5CA6A 4BQ3A 1ZM1A 1NQJA 4XUTA 1POV1 4IK2A 1AMPA 1JU4A 5GZFA 3ROUA 1SBDA 1AR73 1EV13 1UF2C 3KZWA 5FP4A 4QPIB 3POFA 3AZVA 3KWVA 4ORFA 4P4DA 1XSRA 3HT2A 5CB7A 1ND2A 3RNSA 4MHNA 4MHPA 4HG6B 4B13A 3LOIA 3E5XA 3RYKA 4UT5A 4LA3A 4OUSA 3B35A 2WNUB 4F9UA 3MW4A 3B3WA 5FKCA 2JKBA 2JG9C 1H2MA 4LO5B 1RUH3 4QX0A 3I4IA 2IUWA 2BU9A 3PU8A 1O8SA 3VHPA 1RB8G 3IDEA 1EAH3 3WF1A 1DZQA 3H0OA 3GGLA 1HDQA 2HYKA 3KHCA 1KFUL 4XBQA 4Y1YA 2Y6LA 3BUCA 2VUJA 3LF7A 4ZY9A 4HKLA 2XBO1 3A4UA 3BI3A 3N7JA 4UF0A 5CNAA 4L0PA 3KLSA 1LOAA 4PQ9A 5L7OA 4OP4A 4XFAA 3FFQA 3FF3A 1RUD3 4B10A 2FIWA 5FZ3A 2VBBA 4XTMA 3OTFA 1AX2A 4EWDA 3WT3A 1YRZA 3IPVB 4I01A 4CDWC 3NV2A 4LX9A 3VDBA 3O1VA 2JECA 4QX5A 2NM1A 3WZ1A 1RUC2 4CU7A 3GCXA 4XTPA 2RR13 3GZAA 2FDHA 4MHYA 1Q8QA 2XEGA 1HRV2 4XBLA 2E9QA 4YVSC 3T2PA 3KKWA 2WZR2 4IEXA 1M06G 4KVOE 3VZOA 3KB5A 1S0JA 2Q7SA 3ZYHA 4ATEA 1TZOA 1ZREA 2XR4A 4WZFA 3FUQA 4QGMA 3DPRA 2B58A 5LYDA 3K51A 3DL3A 4H3WA 1QJX3 3WQBA 5HXDA 4HONA 1GYTA 3MV11 1PM7A 1FOD2 4B4QA 1LCPA 2XXZA 2WT0A 3IN9A 5KTAA 1REFA 4CXXA 2EVXA 5JI7A 2ZHLA 4NPMA 4B5OA 1LKNA 1QWRA 3LWCA 2DF5A 2BNOA 3BN6A 1SLAA 3O1OA 1NLSA 1UYXA 5FMCA 3VDAA 3BTZA 4E2AA 3OBTA 4RS5B 2BBVA 4NVPA 4Q5OA 2HH9A 2VZQA 4QB6A 3MYXA 4DRRA 1W6QB 2A4NA 5F6KA 2AJ6A 4QBJA 3P2FA 1WCQA 4P4FA 5C8CA 5F39A 3OUJA 2G9FA 3BI0A 2YFZA 4B29A 1RITA 3DF0A 4EWTA 1KD7A 5LRRA 2Y26A 1CPSA 1OF3A 4CYNA 1PGW1 1IHMA 5F46A 3KI9A 2P5BA 4JXRA 3VKOA 1BEV2 3RFRA 1CP7A 3RZJA 2CGNA 1UZWA 3AJZA 4QPYA 4W4ZA 4E4SA 3NH8A 1JMUB 4NF1A 4R8FA 5FZEA 3NV4A 4IE5A 3ABZA 4BCUA 2C4XA 3RGBA 1S0DA 3WVJA 2SLIA 3BB6A 4AQ6A 1S60A 3MPBA 1MS5A 5LRKA 1VIXA 1GICA 1F9KA 2ID4A 5F3EA 4MLOA 3RZKA 1WWZA 1GWKA 3SXOA 4UW6A 5FP9A 2VNOA 1W6MB 4C0BA 1XMBA 2Y34A 4XW3A 1RUE1 3D82A 1F4HA 4AXOA 4JGYA 4JHZA 1E5SA 4XCAA 3PVBB 3AK0A 1W03A 3O1UA 1HB1A 3VDDA 4CPAA 5FYUA 5KHIA 3TN92 5D8AC 3KCCA 1M4WA 4XMIA 3H8OA 3PUQA 4CEYA 2IFWA 3U75A 2B5GA 1LOFA 5C3OA 3PBEA 3ZFGA 1Y9QA 4IV1B 3J26N 3KF3A 3LFMA 4C68A 2HWE1 3FL7A 3WLUA 2WQ4A 5F47A 1OFSA 1K5MB 4CAEA 2B8MA 5J98B 2UYBA 3N35A 3B00A 5FZBA 1OZPA 4ZGYB 2QQVA 1Z8XA 2VULA 3M8LA 4UFVA 3U78A 2PTMA 4KSAA 4R4ZA 1KDKA 2Y60A 1LHVA 3K46A 4KSIA 2W39A 1I1DA 2CAVA 1R1A3 3PB4X 2WYRA 3FRMA 2ZMNA 4E8DA 1ND2C 3EXNA 1ENQA 3PVEA 4CEWA 4FI9A 1S7KA 3KVAA 7CPAA 1GOFA 1ZBE1 2ZZJA 1XMTA 4LIVA 4XF9A 1UNBA 4GALA 2V4AA 2ZGUA 4NGRA 5FOBB 2QTWB 2AREA 3D7GA 2JG9B 4YZ1A 3CEWA 4XUNA 4Y22B 2JD9A 2R062 3HJRA 3KASA 2QYVA 4KORA 2EK8A 4JX0A 2W0XA 1UYZA 2G9ZA 2JDAA 2VOVA 3GYDA 1AR72 5L7OC 2AH2A 4V2WA 1QJZA 1W8TA 4XC9A 3RZLA 5J37A 1GV9A 4OC0A 5HXVA 3PB7X 2VXRA 1FT7A 4FFIA 1G86A 1M1DA 3MV01 1ZZCA 4K30A 1JUHA 3BVCA 3N9QA 1L0CA 3MGUA 4CDWB 1RUH2 4V1PA 1F35A 3D4UA 1GWLA 3VBHA 5HCFA 5ISLA 2BTVC 4OC5A 4YRDA 1SPPB 1EAH2 3A9LA 4URAA 2PJAA 4UI9L 2XHNA 4OKOA 5BUVA 3KQ4B 4YVSB 4WVVA 1Z8WA 5CG9A 4AGRA 3KHBA 5GM0A 4LR4A 1SLIA 1D4M1 4E8OA 4G3YC 1EY2A 3DPRC 5DAPA 1RUD2 4PJYA 1QY4A 3WNOA 4GB31 3MBWA 2Z79A 4MI4A 4H6UA 1OQ1A 4F9VA 3GY9A 3PIGA 2WZNA 3ZN4A 3HLPA 4OCTA 4RN7A 1UFHA 1RUF1 3TTHA 3VBSA 4MCSA 2V77A 3Q8FA 2W94A 5FUIA 4PSXA 4YGOA 5K4LA 4DEVA 5CPAA 2IJZA 5A3MA 2J8RA 4IEOA 2G9GA 3IWZA 1UU6A 4B6ZA 4ZXEA 2JE8A 3CPXA 5C8CC 2IQ6A 1PMJX 2ARBA 1QJY3 5EBVA 3IU2A 2W9XA 4NMIA 4C0HA 2PA7A 4F7ZA 5K8PA 5IB0A 1UY4A 2NYQA 2G4IA 2O53A 1QXPA 4PLOA 5DS0A 2WABA 2IC1A 5A6QA 2D5HA 4U36A 1OOPA 2YXSA 2CAUA 3CMGA 4HK9A 3TFYA 1W9YA 2Q8EA 4HK8A 2D6KA 1BEV1 1HDKA 4XDOA 1JI6A 1FMD2 3HR9A 5CVRA 1P0HA 4MCRA 3AKQA 4LPLA 4C90A 4EROA 2ZGSA 5J8FA 3LPGA 1D0HA 4QKDA 3CZUA 4ZKTB 3FXTA 1UXZA 4I30A 4JGYC 2ZKLA 2BQPA 4PCRA 2NLRA 1ZZ8A 3W91A 3VDDC 3FX6A 1G9AA 4NAMA 3KGQA 1X7NA 1OMIA 3S30A 3TT2A 5G05L 4BQ5A 5DXDA 2QCSB 1CWPA 1IS3A 2OS2A 4CEYC 4ARXA 4FPOB 3SI1A 5D8AB 2VMGA 3H8FA 1LOFC 5A7WA 4PI0A 3ZFGC 4XF3A 1W3XA 4QM8A 5CG8A 3TRSB 2CXAA 4OHZA 1DQ0A 2QIRA 4QQ2A 2IZWA 3EQEA 3AJYA 2ZJCA 2PHWA 2J8NA 1IOAA 4Q0SA 1V6MA 2CHHA 4DUVA 4C2YA 3T08A 1VPHA 3ASIA 5DUUA 3LSDA 4Q4X3 3WP6A 4BIOA 1VGYA 4AG7A 2QECA 1TNRA 2AFZA 4YM2A 1BK0A 4KI5M 4H89A 2RS33 3TC8A 2JLMA 1N3OA 2K5TA 2DTYA 5C5TA 1XPWA 4CEWC 1XFOA 1HRI2 1R091 1ND2B 4DO0A 3JXSA 1CN1A 2PHLA 2PDOA 3SJGA 3ILNA 4BXFA 4IE7A 2FD8A 4OADA 2BGPA 4CGNA 1UIJA 2Z3NA 2VOWA 1XYPA 2B9VA 2VQYA 5IK7A 2CDPA 2VZTA 2D6LX 4YVWA 2FMDA 3PGPA 1UOJA 4XZPA 3H8RA 2Q4YA 3B01A 3BU7A 2DEAA 3KGLA 2A6ZA 1IS4A 4Q0VA 1FAYA 3O5SA 1XYOA 4UFMA 1YMEA 4IAVA 4NROA 5L7OB 1ELMP 1EE3P 4BXSV 4A7KA 4XUOA 4Q0QA 3W5MA 5JR7B 2VQUA 1M4LA 1AR71 1EV11 3CL1A 3H8UA 2GLJA 2UWCA 5EIYB 1TF8A 2Q8CA 1CAXA 3VBHC 1LGNA 1JZ7A 5IVYA 1TE1B 3BLNA 2KM2A 3VDCA 4FXKB 3D5OA 1JTZX 1IYKA 5LBBA 4CZSA 3WY6A 1PZ7A 1D7PM 4CUCA 3LIHA 5GJ6A 3ZYGA 1HB2A 1I9RA 1KGYA 3SC7X 1RUH1 1K4JA 3S5QA 2FDGA 4UWJA 3GHNA 2VMEA 2VZ1A 4NWWA 2JDMA 1ZNPA 2QQWA 1EAH1 5IK8A 3PRTA 2D6NA 5DUVA 3I3QA 2B5HA 3DPRB 4I0BA 1W6PA 4OC4A 3KT7A 1X9TA 1XOVA 3I2JA 4CCJA 3VBSC 4J1XA 4R3LA 2ZX4A 1EP0A 2C26A 5DAVA 1RUD1 3RZAA 2WQ8A 1ZRFA 1ELLP 1N3QA 3IIBA 5FIXA 4ZS3A 2I79A 1JZ4A 2GC2A 4DXSA 1AUGA 3FMGA 1I5ZA 2ZA9A 4M4PA 4Y5SA 3DYOA 3AKTA 4I3GA 1RUG3 5IATA 4TNUA 3RMXA 1GANA 4YZ3A 5DDJ3 2Z0ZA 2VBPA 2RR11 1LOEA 2PVWA 3A21A 4XIOA 2Z3OA 5F5CA 3NV1A 3E6DA 5C8CB 2W87A 5A27A 1Z4RA 2RB7A 4RYDA 5ERLA 5GKAC 2VZ3A 4FCAA 1OOPC 3KL9A 1BZWA 3EJKA 3WG4A 4XJZA 5J96B 1QQP1 3HQUA 3EXUA 2ATFA 4LBKA 4BINA 1J84A 5F5QA 2IXHA 1QJX1 3B3CA 3V56A 3CZJA 2H5MA 4GXLA 4B7KA 4X5KA 4PPZA 4Z65A 1W2AX 4K1ZA 1D4VB 1K3IA 1K12A 2CSGA 5J8CA 3WF2A 4R9BA 1XB9A 3GYAA 2YUEA 2WSAA 3O1TA 5FYCA 4LBNA 2FCTA 1QJY2 3HN1A 3W5NA 1V70A 5JAXA 1IPKA 2YV8A 1H30A 1ZRRA 3C7EA 1YW4A 1H6YA 2ILMA 4MFLA 2Q0AA 2P4EA 3N9PA 4JGYB 1W2TA 1PGL2 4YM3A 1PU9A 3R4SA 3WW2A 2YGMA 1GLHA 3VDDB 5EMIA 2ZEZA 2DVDA 4COUA 4FO9A 3IJ3A 2NMNA 2Q1ZB 4X8PA 2ZX3A 1BJQA 2BBAA 4II9A 1KDMA 1FV2A 4BJ0A 2CYFA 4FUUA 4JKMA 3H5ZA 1SMVA 4CEYB 1LRHA 2AFOA 2NYYA 4KS9A 3NNGA 1CJWA 1ARLA 2HEWF 4Q29A 4UFLA 2B5GB 1N71A 5C71A 1O3QA 3ZFGB 1O5LA 4BQ1A 4HN0A 4XEZA 1MK4A 3DV8A 3CZXA 4RGAA 3ZYIB 2DCKA 1A8DA 3HOBA 4KG0A 2WRAA 1HIXA 3AP7A 4Q7AA 3R05A 1G9DA 3KMHA 1YQCA 5C7GA 2ARCA 2DPSA 4UCMA 1W8FA 4N43A 5JOXA 1PO23 5F5AA 4AGGA 4L8QA 4CPBA 4Z2WA 2ZPAA 1OVPA 4CEWB 1WBLA 2VZZA 2VXKA 1QDCA 3J7NA 3JCIA 1KUVA 3ZSLA 4AFDA 4CDXA 3HD8B 4IGOA 2W46A 2VW2A 1K5JA 3D4KA 3HNYM 3T2TA 5FO8B 4YVWC 2CTCA 5DUXA 5LW9A 3RBUA 2NP0A 4FFFA 3MI8A 2WO2A 1S7FA 4F0YA 1FV3A 1O4YA 4Q4X2 3FJUA 4MY0A 2ZOEB 5LBCA 1JOBA 2PE3A 2ZOFA 5G20A 1BMV2 1J3PA 1RUI3 4QPGB 2AEZA 2HV2A 2VO5A 3KVBA 2BW8A 2R0FA 5T5JA 1UW8A 2ARXA 5F3IA 2O14A 2ZOGA 2VZOA 2PRBA 4HNYB 3POSA 5HH1A 2E53A 2VAUA 4FP3A 4R9CA 2VPVA 1FNYA 3GBWA 1IQDC 2ZXVA 4P9JA 1UWWA 5BPXA 3WXPA 1R1A1 5B2GB 3VH9A 4GMP3 2KR2A 2PJ4A 2CNAA 2ES3A 3W9AA 2P2KA 3VHNA 4IW3A 5J36A 1ZRDA 3IIIA 1M4IA 3FNCA 2XEFA 2PRQA 4MXUA 3JD71 1DQ5A 3R9EA 3TAYA 2CTVA 1OLRA 4P4JA 4OI2A 3D7DA 2WO1A 1UKRA 2RG4A 2ZGTA 3THPA 4MFKA 2J1AA 4YZ2A 3THTA 1S0FA 4I0WB 5FLIA 3GB0A 3K4DA 2JBJA 5KXEA 1GP4A 4QHZA 3ELNA 5I93A 3P1IA 2XLGA 1XXNA 5SV5A 3KV9A 3VBSB 1HDUA 1DBNA 3CO2A 3I2DA 1YC61 1VRH2 3I2IA 1V0CA 1H1IA 5C3RA 5E8AA 3ACLA 3F5BA 2CWSA 1GYKA 3E6BA 2FDKA 5A28A 2PC1A 4G4FA 2FT0A 3VWEA 4A2UA 3MUZ1 4YFWA 5KXCA 1UZ0A 4KLVA 3FHQA 3AXEA 3TEXA 1SLTA 3NJXA 5FZKA 1WCSA 1OA4A 1US2A 4KOWA 4MHUA 3NFZA 1NXMA 2NSMA 4E2QA 4Q4V2 2OUJA 1Q43A 4MXWB 4CP9A 2JKXA 1AXZA 3GUXA 4A45A 2WIIB 1MS0A 1VBA2 4LKDA 4ARYA 4NHLA 4QB1A 3AL5A 2HWD1 3SJXA 3FHAA 1UPIA 1AXKA 1CM0A 1R083 2Y6FA 4JV4A 5CIRA 2ERFA 4ES9A 3Q8EA 3WQ0A 3SCFA 1CJPA 4Y24A 4ISRA 1DF0A 2JG8B 4NOTA 3O1PA 5ANNA 1HQLA 2ZGNA 1UY2A 1WBFA 1J83A 1H8VA 1Q2CA 1L3JA 3WNLA 1AR63 1ZLHA 1C3HA 1ZA7A 1OUSA 2IFRA 1STMA 1J3QA 3GZUC 4AG4A 4XJ8A 1QJY1 1VAVA 3O0WA 4N7UA 3LCPA 3ZXJA 4O7XA 1IICA 4HN1A 1AYN3 3ZR6A 1JOJA 1JYVA 4XF1A 5APAA 2KA3A 4FQZA 3H1MA 1Y7BA 3I3BA 1PGL1 4ONWA 1RMU3 4CCMA 5A7WB 5JGFA 5LYFA 2WWSA 4XBNA 5GCNA 2OR4A 1AL22 5FOJB 5FZ7A 2C24A 2X10A 3WQ1A 2FSRA 5FYVA 2WN2A 3VBFA 4ZX8A 1RINA 1OURA 2XG3A 4MBUA 4UBGA 4FT8A 2NN8A 3JUUA 2RS51 1F5FA 3BTXA 4OAEA 1ACCA 2PQSA 4AI8A 3NA6A 4N43C 1V6IA 3UESA 3RNZA 5DG2A 5FQ0A 2DBIA 5EJZB 2TUNA 1GMMA 4EQVA 1CVNA 3RZHA 2OZJA 4HSLA 4ZONA 5JXIA 4NJQA 3CDXA 2Y6JA 1YLLA 5FK8A 3OBRA 4AL9A 4ATFA 2Z69A 3LA3A 1ZO0A 1XNCA 4CDXC 1C5HA 3FECA 5FY7A 5JZGB 4B1LA 5I0CA 1BHGA 5HI0A 3VHRA 4CGPA 4ZS2A 4AVTA 2PHDA 2YDEA 4CCLA 2ZENA 3POYA 3TNPB 4IGPA 2AGSA 3NKTA 5JLVA 4AFMA 1RIRA 4N53A 3OJBA 3O0XA 3N9NA 3MF9A 2GU9A 3PU3A 3VD7A 1Z5RA 2R32A 4YW2A 1AR82 3NL1A 1QNWA 2FDJA 5BV6A 3LSEA 4XQDA 4BQYA 5IHRA 3H1YA 4KNCA 1U6MA 5F3GA 2YC4A 3UKTA 4CRQA 4CU9A 3HVDA 2PHXA 4EN7B 3I1UA 2ZEFA 2XUEA 4Q4X1 3ETQA 5TSWA 1V6JA 3AFGA 2PJ5A 2P6CA 1RJ7A 5CISA 1KITA 4TWTA 2IVIB 1C1LA 2RS31 1BMV1 2NMTA 1W8UA 2PLV3 3B3TA 1JYNA 1CAXB 4LEJA 2CL2A 2E33A 3THDA 3OGSA 1CAUA 3MICA 1K42A 1YFYA 2QNKA 1OPMA 5KXDA 4FPHA 4MMOA 5H9SA 1RHI3 1XNDA 1W6NA 1S4CA 3CXSA 3IU1A 3EB7A 1JZ8A 1BAVA 4XFHA 4YGEA 5C5UA 5FPLA 4OQ8A 2O8OA 2OH1A 3IT8A 2YGWA 3ZXGA 3GHMA 4EFDA 2W52A 4LHNA 1IPSA 3UJOA 4Y4YA 2RJ2A 1MPXA 1BBT3 4C7IA 5HVGA 4RD7A 4CRYB 5DZFA 3P3NA 2E51A 4JC1A 5IVJA 2GAUA 4GH4B 1XQNA 4RI1A 3PFOA 2GH8A 1N1TA 1O5UA 2R042 3NNFA 4MUVA 4C91A 1YVKA 5IVEA 5H9QA 4IEQA 3AP4A 1NLQA 1DLCA 3RQ0A 4LHLA 4GWIA 3JUWA 1YFWA 3IMNA 3SI2A 3WDYA 5JSPA 4IE4A 4AB7A 2GANA 1UOGA 1UAIA 4J3GA 3UL2A 1Z8TA 2XLFA 3KV5A 3H8XA 4COWA 3U4XA 3C7OA 1M44A 3VBOC 1Y9WA 2WA3A 2WS91 1XYNA 3QAHA 4HXCA 5FMOS 3S6PA 1CAWA 4LXLA 1UO9A 4E2GA 4JQTA 5I8TA 3CXPA 4XHXA 3R9FA 1UCXA 5AG7A 1RTQA 2R30A 3M3OA 5AG6A 2XWBB 2Y64A 3WF3A 3D8CA 4TN7A 2P3JA 3U37A 2JENA 4KBBA 1RUG1 3TCVA 2Q0YA 4XCBA 1JUIA 2GMMA 5DDJ1 4Y4RA 2P1BA 1JHNA 4AQ2A 5JCTA 1QJU2 2WPWA 2N7GA 4F3JA 2EAAA 1BPNA 1TME3 3H50A 2BFUS 2RS13 3WP3A 2F6BA 1OUXA 4YGDA 4YW6A 3X29B 1J58A 1YYNA 3TE4A 4AGVA 4GAZA 3M2MA 3VBFC 4RS2A 1JZ6A 3KS7A 4AZZA 5AGEA 5I91A 1Q8PA 3OPWA 4Y49C 5A3UA 2QJ8A 2F4PA 4Y33A 1SBFA 3EYPA 4XAEA 4Z2AA 2JEWA 5LBEA 2WO3A 2V4VA 1Z4EA 3V7ZA 2WAOA 5FZ0A 3ZYPA 3EFAA 4N43B 5DQ0A 1UU5A 3OGGA 1GQPA 4GMP0 4ZY0A 4UFKA 2E31A 4DXRA 1AYN2 4QPIA 2YHJA 4CSWA 2WZEA 1X8EA 2D98A 3IZOA 4D7SA 1RMU2 2IXKA 1URXA 1E5IA 2WFF3 4NGPA 1PIV1 3O1MA 3O1RA 1SG3A 5IW0A 1COV3 5I0RA 3AP9A 1IYLA 2WNUA 4E27A 5ABJA 5FJKA 2DFCA 1UD1A 2VQTA 4CU8A 2PELA 4N53C 4A44A 4UFHA 1RUJ3 5FO9B 4W6YA 4NGQA 1MJ9A 2EK9A 4XHBA 2VUDA 4NGNA 4PV6A 4QC6A 3IGRA 5A3TA 5DPNA 3M4FA 3BIEA 1ZRIA 2WWJA 4EN8B 2B4BA 4NIGA 5FZIA 3OPTA 5CADA 3SLIA 3ZOIA 4BK4A 2A6XA 5IVCA 4E4HA 1DGRN 3MF6A 4R3KA 3QOPA 2YC2A 1PO21 1W28A 2EICA 1YO8A 5K8SA 3ZMOA 2J1VA 1B6BA 4MSVA 4CYQA 4RGGA 2UU8A 3SH4A 4U9YA 2WT2A 2GALA 5EHDA 3T1LA 3LMSA 3VV1A 3WW3A 3ACHA 5LA9A 2Y6HA 3ORJA 2KD7A 4ZBGA 4FD6A 1MS9A 1G9BA 3FUOA 5I0DA 3T9YA 1ZA4A 5BNOA 2QQIA 2XWJB 2R16A 1RXGA 2XEIA 2DCYA 4UFJA 5H86A 4H2KA 2IVJA 2WYFA 5D21A 1JU3A 3J8F3 5FMBA 5KWRA 2PXJA 5T5PA 1Y9GA 3QCWA 4K8RB 3Q8CA 2BP6A 4QDSA 1RUI1 1QEXA 2CDOA 4QHBA 1MZFA 4J1WA 4OZXA 4JD6A 4LBQA 3UGFA 1OVSA 1CZSA 5FWJA 4XURA 2Z2SB 1VB2A 2QQLA 1WLCA 2HYXA 1LTEA 1YLOA 3BJ8A 2DVGA 1IY7A 1DU3D 1PM4A 1RHI2 3AYEA 5A7QA 4GMP1 1FY7A 5H9PA 2ZEMA 3A7QA 4IQPA 4Q8LA 5THWA 2W3JA 3S9LA 1OXCA 5KTCA 1YIFA 1W6QA 3NMBA 5A3LA 3HIFA 3OBZA 1G6NA 1W0PA 2VZYA 2G9DA 3RJRA 3NJYA 1YI7A 4X8NA 4D7TA 4E2SA 3NAPA 5FKBA 4CP9B 2W08A 3G7DA 2GC1A 4FWUA 3KR4A 1ND3C 2YU1A 4WJBA 1BBT2 3VBOB 2JE9A 3MIBA 5FPAA 1VMJA 4PQAA 3I7DA 4UW5A 2EAKA 4AVVA 4A30A 1O3SA 2PR8A 1Q8VA 3KT4A 2VW0A 2QFEA 5FP8A 5JIAA 1KS4A 2RM23 1WLDA 3RI9A 1S1AA 5E16A 5ACA3 4S2DA 2QQOA 5I0SA 2OKXA 4I49A 2IXLA 2A75A 4O65A 3NV3A 4RN5A 1W6OA 4IE0A 3CLPA 4FOYA 2Y33A 3R95A 1F8VA 1V6LA 3S7IA 3CXQA 3H1WA 4FAIA 3UKNA 1GBGA 2V73A 5T50A 2VM9A 4BHPA 2OXBA 5CEHA 2LUWA 3GCWA 4JTOA 4MGQA 3ZFFB 3OBAA 2XDVA 5E89A 3LB9A 3FBMA 4UEZA 2WT1A 3PTYA 4AVCA 4MXVA 3IB3A 1LAMA 3VBFB 3BKZA 4RUHA 1TKFA 1R081 2GN3A 1GNZA 3ITQA 1OBRA 4WVZA 5FBJA 1US3A 4Y49B 3ATGA 1FNZA 4NGTA 2FZ1A 4AYUA 1VAMA 4XFCA 2FZ2A 4LK6A 5C3QA 5DWNA 2OX0A 1K45A 2XVKA 4NPLA 3R6SA 3PVNA 4P02B 4COVA 4ZZ5A 1AR61 4QPIC 4IEPA 5A6XA 3D0JA 4DXTA 2VTXA 2YBSA 5EJ1B 3VHOA 2MHFA 2O0OA 4HPKA 4LNVA 1TMF3 2I2SA 4WWVA 3I3GA 4A95A 2Y38A 3LEKA 4GWMA 4ASKA 2FE7A 5ABJC 3TNQA 3AFKA 4PF1A 3I3MA 4CP1A 1NX9A 4F6AA 3DKWA 4R57A 1RMU1 3IBMA 4IESA 3HN3A 4AVAA 4QX1A 3OWCA 2FIAA 4IEZA 1QSNA 2ZW5A 4META 3WP5A 4N53B 3PJQA 5IAVA 4D69A 3DGTA 4GB33 5CKNA 4CGOA 5FZ4A 3LEGA 1LHNA 4K6BA 3SH5A 5FTTC 2RJLA 4HVOA 5JXJA 4JJXA 3H8GA 5LY1A 3UK9A 3FN9A 1NMTA 4LMFA 1MS4A 4Q8KA 1MQTC 4UEFA 4IEYA 4XJ9A 5A3WA 3LDRA 2D43A 1JBCA 4RL7A 1ENRA 3VL9A 5LRJA 2AFMA 2ZEXA 1HQNA 1CAUB 4FSJA 1YQEA 3RRDA 4KLWA 2WLQA 1SPPA 3EBRA 5A3OA 3OY8A 3IFEA 1W6NB 1ZG8A 3B94A 2CNTA 3C7HA 1L7RA 4CAXA 3WC6A 1PGSA 3B2YA 4NXYA 1KS5A 2WNVA 4QX8A 3W58A 4BE3A 2JICA 5BNOC 5BNNB 4P9LA 3AKRA 3BYWA 4D3WA 1A78A 4YRHA 2BGOA 1Y7EA 3KZ4C 1S0GA 2XJQA 4JRAA 4WZCA 4QX3A 3KCYA 4AG9A 2ADEA 2WBKA 1VBB3 4PSWA 3K2KA 4PXEA 3AX4A 1OBNA 5FXVA 3AKPA 4BQXA 5JI9A 2WJSA 3ZPOA 4FFHA 2V8DA 2ZX2A 2PN5A 2PLV1 4M3SA 5HXMA 3VKMA 1GU3A 1V6OA 4YWYA 3DR6A 1JWQA 1EPWA 1O3TA 3ZVXA 5IFTA 3FBUA 1PGW2 2AUYA 2ZEPA 4X3RA 5FPXA 2VJXA 1RHI1 4A7ZA 4A41A 4XXPA 3VARA 2H0VA 4YGBA 1W9WA 4W50A 3NAPC 4BPZA 4R9AA 5FZLA 3LQCA 5FY1A 1OF4A 3N7MA 5JH9A 1MEC3 1ND3B 1CG2A 2HWC3 3N7ZA 4HT1T 3PB9X 1NOVA 1CAWB 1XJOA 1VR3A 4R9DA 2BOAA 3UYJA 4JHTA 4MFZA 4TWEA 3PDQA 1YQ5A 4COZA 4FOQA 4LIUA 5FV3A 1ENXA 1W99A 3ZDVA 2UY9A 2WR9A 5CZKA 5K9YA 4E8CA 3MDPA 4KOTA 2GREA 4MHRA 4QD2A 1ULFA 3ZXKA 1VHEA 5FXZA 4YW4A 4AVSA 5LEKA 1DQ2A 1YJLA 2BJSA 1OQEA 5A7OA 2D5FA 2GLFA 2AEYA 1Y3TA 1WLWA 2HQYA 2V5YA 4CCDA 2XGXA 5C3SA 1DE4C 2ARAA 4GIQA 4XQWA 4P9IA 4W6XA 4NSQA 1NA1A 1PCAA 1S7LA 2VTFA 5D8AA 3SITA 3F95A 4INDA 4YSFA 5M0TA 1JYIA 3CHXA 2A3XA 3JZVA 2AFWA 3TO9A 3JBG3 1YQ8A 4MFJA 5F1RA 4PK2A 2Z4FA 3UETA 1Q5OA 3ES1A 2OZ6A 3UGHA 4N9HA 5EV7A 4ASMB 2Y0OA 1QGLA 3VN4A 3V8IA 1GOHA 1PMIA 1YK3A 5ACA2 3WDUA 2FDFA 1JOPA 4UFWA 4I09A 4F0XA 1U0AA 2R7EB 1VHOA 5A6YA 1KQRA 2GU2A 4I0AA 4AAPA 2IXIA 3MEPA 2VVFA 3USUA 4C2XA 3GZTB 5FZOA 3C3VA 4E4ZA 1YGHA 2X09A 1ZBE2 4OHWA 5CKMA 4XAAA 2ZMKA 1NSAA 1KFXL 2XQXA 3WDVA 1DIWA 2QZ2A 3HEIA 4LQGA 4DUWA 1QXJA 2VCCA 4QGLA 5E88A 2I3CA 2R073 4COYA 3ALQA 4LOSA 4IL7A 1WD4A 1TME1 2RS11 2HWB3 1U5IA 4Y5Z0 1UZZA 5GZGA 3LOBA 3DNSA 1IOIA 5ABJB 4IF5A 3NJVA 5FY0A 4MHDA 3OD4A 2OVUA 4QX7A 1FX5A 1IOFA 2O4HA 2EXKA 4QKBA 5E96A 2RDNA 2HWF3 1QOTA 4I3PA 3U11A 4Y20A 2FMYA 3H42B 4XFBA 4RQPA 2IMOA 1B35B 2QQPA 2WSVA 3BGAA 2D93A 3POWA 5KHKA 2E63A 3MLLA 1TMF2 1Y7RA 3RJ2X 5L9VA 3E0KA 4P9GA 1LU2A 1LCLA 1MQTB 1IU8A 5BYNA 5FZ9A 5IK4A 4LE4A 2C9KA 3NNMA 2B3VA 1RVF3 5FZGA 2VNVA 1DGLA 4UAPA 5JSOA 4ET7A 3VGIA 1WW6A 1TKJA 5CKQA 3FMCA 1HB3A 2WFF1 1D4M2 4K8FA 4B11A 1XF8A 1DFQA 1COV1 4GB32 3NW4A 3ACGA 1F15A 4HVRA 4FPCA 4KOXA 2WNVC 1OH3A 4IDZA 4XUPA 2Q7BA 5HV4A 2GSYA 4HETA 4YU9A 1D2QA 1RUJ1 2PHUA 2B46X 3D7FA 2H6BA 4YZ5A 5CFCA 1RUF2 2CGPA 5BNOB 4Y1XA 3BJ7A 4C1XA 1TVGA 4PBOA 2UWAA 1Z9UA 1QQP3 3OF1A 4BB3A 1IPJA 3WABA 2F4LA 2X8KA 4E4DX 4NHXA 5F49A 4UCPA 4LBQB 4OHVA 2GIVA 2FL4A 1S0EA 4UF4A 2QZ3A 1IKQA 3AZXA 4LT5A 1Q7LA 3KHXA 1AX0A 3ZR5A 3S57A 1MJAA 3B7IA 5BXXA 1UQXA 1G9FA 1TIQA 3MIDA 3DDDA 1QSOA 4MCQA 2YC0A 3ZDSA 8CPAA 1B09A 4KUBA 4QX2A 3BALA 3IDCB 4QQLA 4Q27A 2DCJA 1RXTA 4FD7A 5DZEA 4KZTA 1DQ6A 1CX1A 3AVRA 1OD5A 4C1WA 3L2NA 3SQOA 3W20A 1ULCA 1VBB2 2OPWA 4CCEA 3NAPB 2Q04A 1HN1A 2AACA 5LRGA 4LORA 5IJRA 3PLQA 4KL1A 4OQ9A 1ZX5A 1HXS3 2FCVA 4NRQA 3EO4A 3J8F1 2LTNA 3RSJA 5C33A 3LGRA 1H8TB 2QVSB 4PIXA 2D3SA 4F8AA 1QMUA 5JPHA 3OPZA 3WSOA 3H7YA 1WK4A 1G7YA 4DINB 3NE8A 3VWDA 4OMDA 4LKSA 1AXYA 2NQYA 4HVQA 1RTVA 2GNBA 1H4HA 1LOKA 1UZVA 4JKLA 1S3ZA 1OA3A 3J7MA 2C9AA 3O14A 1AJKA 4ONUA 1J1TA 1AYEA 1QH7A 2HKXA 3PIJA 1W6OB 5EQUA 3VZLA 4AHXA 4QXBA 3NH5A 1NA1C 1MEC2 3IAPA 1ODMA 2HWC2 3AZYA 2J42A 4LO6B 5DG1A 4O9EA 4AI9A 2P6HA 2OA2A 5GLUA 4LHSA 3BOWA 2DVFA 4BQ4A 1BYHA 3DXUA 3ES4A 4XJWA 3WDTA 3POGA 2ZW6A 5FPBA 3N7LA 3P2HA 4NFRA 2J9AA 3UV9A 2QDRA 5JWPA 3R96A 3ZKUA 5LRSA 3FBYA 4FAGA 1O4TA 3OYWA 3SXNA 2PQQA 1UYPA 2DWRA 4BOWA 1Z7S1 2YBKA 1G9CA 4TZDA 2RM21 1XNKA 1HV0A 4BBHA 3B93A 5JXGA 3CPAA 4WV8A 3FLPA 2P3IA 1R092 5FBZA 4M0NA 5L9RA 2AFUA 2D6OX 3HMYA 1PO11 5ACA1 2FXFA 4NE9A 2CU5A 1W2NA 4PDWA 1MR5A 4KSFA 5AC93 4BLJA 5GLWA 4BQ2A 4RGKA 4MVTA 3BHXA 4XFGA 4EZHA 3H3UA 4KUAA 4HPKB 1W0OA 3HQXA 5J7MA 3VB9A 2LS6A 2OT7A 2DDUA 3JBG2 4UOJA 3N9LA 3ETPA 3EHKA 3FZ3A 3V38A 1GP5A 1YVOA 2O1QA 1HX6A 3JD73 4CGMA 1F57A 3S6KA 3WG2A 4GULA 3FB3A 3DYPA 1CQ9A 5JUVA 4XVHA 2YNEA 3IC1A 3OEBA 1LANA 4PQQA 3B02A 2WAAA 1PZ9A 3ISXA 4M4RA 3WD5A 3WNKA 1LULA 4W9YA 2LW8A 1GZTA 4RQPC 2ZGMA 4JGZA 1EV12 1R64A 1QH6A 3URFA 4A94A 4QPGA 5LCWL 2JWPA 1NCQA 3JU9A 2HBTA 3Q9OA 2G1MA 2R072 3ZZIA 4NJ4A 2WNOA 4HNXB 1RUNA 1Q2DA 3V0BA 2QE3A 4NIAA 2HWB2 5JQ4A 1OSGA 1SLBA 1R1ZA 1TMF1 4XMAA 2F7VA 3D67A 2ODFA 5I8SA 3Q8BA 2WO7A 2ZGKA 1LHUA 5AVAA 1WCDJ 1R3NA 3ZN6A 3OY8B 2CY6A 1HQWA 5B4XA 4QQPA 5IVFA 3PB6X 2FBEA 2HWF2 2J1UA 2C0ZA 5CFCC 2WNVB 3SMHA 2P3YA 2G0BA 4TYSA 1WW4A 2HJIA 4HBNA 4EJRA 5JMOA 3IM0A 1QDOA 1SFNA 1OKOA 4GKYA 5G22A 2Y8KA 4FBEA 5HBAA 2OOTA 2HWD3 1OKQA 1A2ZA 5F2WA 4AK3A 2PJ9A 3T0BA 4DUKA 1RVF2 3WHUA 4YG3A 2OUHA 2X7BA 4UW3A 4OULA 4NEXA 5A7NA 2RR12 4L99A 3OG2A 4BZ4A 3C7FA 1I1EA 2BVVA 4O23A 2A5ZA 3NKGA 2W91A 1LOBA 2VOTA 1UOFA 3AP6A 3TEYA 4QKFA 1W8NA 5IUQA 2K46A 3J7HA 3D3AA 4LKFA 1IZ3A 2W5FA 5L19A 2Q5TA 1VLNA 3KT1A 1QQP2 4FFGA 3BODA 4UWIA 2KXLA 3UJQA 4CP0A 3PUIA 4QU1A 1QJX2 3VLBB 1B87A 4JQRA 4MXWA 5FUNA 3WG3A 3KQXA 4QGNA 2YB7A 5EXOA 1SHWB 2QBXA 4EV0A 3L9JT 2A1XA 2PYTA 5FJHA 2WQZC 3OGRA 1NZCA 4NIDA 1VBB1 1C5IA 5E6HA 3IWGA 4QXHA 3FFZA 4MGTA 4TSVA 4IERA 2RS53 4IUSA 3E5QA 1QJEA 1BK1A 2JG8A 3WUCA 1LODA 1YSJA 2C6CA 4Y1VA 4E0AA 4AFCA 1LHWA 4MZUA 4HFSA 2CF4A 2D40A 1X10A 3IO1A 3RVHA 2PJCA 1LECA 2QKDA 3CJIA 3LODA 3GBFA 1JYXA 5GLVA 1S2EA 3VKFC 5K8MA 3M1HA 1FT9A 1NA1B 4CU6A 1VBC1 3GXUA 5A3PA 4URTA 4AFAA 3WEZA 2VD7A 1OC1A 4AXVA 1RUC3 1MEC1 2HWC1 4LO7A 4RHV3 5CFDA 1VBE1 4K7JA 1HRV3 1XU2A 2XJPA 3SCGA 3O0VA 2WZR3 1BLZA 4C8DA 5LK7B 2C1FA 2VUAA 4WBBA 3T30A 3WOGA 3H4QA 3LD8A 4XFIA 1W90A 3D68A 2JDZA 4KU7A 1YLEA 3AM2A 3JQXA 2EIBA 5FYIA 1X36A 4J25A 5H9RA 3USUB 4A6SA 4B3NA 4PDWC 2OYZA 5FZOB 3QNVA 3NO8A 3K3NA 1FOD3 4GJZA 4OUMA 5J1XA 2JDUA 1BKZA 1H9WA 1JZ5A 3ZSMA 2WFPA 2RC4A 1AF9A 5JZGA 3QD6A 2JB8A 2DU1A 4PXCA 2D97A 2FVGA 4B14A 5EFUA 4GA9A 4G1PA 2EXHA 3JBG1 4NGSA 1DZTA 4QPWA 3MGDA 1WCUA 4A2ZA 4JGZC 1C8M1 2LRPA 4MADA 2RDQA 5KC6A 4Y20B 4QPGC 2D4OA 5HVHA 1NCQC 5T52A 4B4PA 2O28A 4RQPB 1R1A2 5AC92 3OUIA 2XJVA 5JOYA 2UURA 3POEA 3KHZA 1LR5A 3FHIB 4H14A 4XOGA 2A6VA 2Y6KA 2GMEA 1OFNA 1NE9A 3OUHA 5FYTA 2CNMA 4HNWB 4XF0A 3JD72 3HNMA 2A3WA 3SEPA 3RWNA 2R071 1MZ5A 4XACA 3VZJA 1RGSA 3R4UA 3AYDA 5KR7A 2HWB1 1H0BA 3N9MA 2Q4ZA 5DMYA 1ZVFA 3MIEA 1AR93 4P10A 1V9U3 5CFCB 4PT6A 4A39A 1ST8A 2W1SA 1H2KA 4YW7A 2WS93 1I12A 1VMHA 2CY2A 3OD0A 2HWF1 4KU8A 4CPBD 3D7HA 3WCRA 3JB4C 4PLMA 1IGBA 5HVFA 1O4ZA 5G1ZA 1OLQA 2LM3A 4NCZA 1WW5A 4LKEA 5B4NA 1Y43B 1FXZA 3QH7A 4RR3A 2PHRA 2DCZA 1SEFA 5GLTA 3S7EA 2PJ0A 1L7QA 5H84A 4GH4A 2Z3LA 3R0RA 2ZEYA 2IWGB 1RVF1 2XJRA 4AR2A 4BMBA 3BPZA 2GDFA 4F8ZA 2JDKA 1POQA 4XDPA 1N1YA 3C26A 3C8XA 3DCQA 2GNMA 1AUYA 3AVSA 3HNBM 4P6YA 2HEVF 4XFFA 2HWD2 1Z2LA 3GLJA 4D0QA 3BI1A 2WSUA 1O3RA 3ACIA 2VW1A 4KWUA 3MFCA 2VR4A 4R52A 2REEA 1CAVB 4AE2A 4YM1A 2Y0IA 5FUPA 4JDNA 2I74A 4A6OA 4YARA 4IGQA 4M0HA 2P3KA 5CAZA 3RMYA 1W9FA 4UFXA 1XE4A 2JG8C 4UBHA 4ZU5A 3KQZA 2XVGA 1NKGA 4CRZB 3MFAA 1YNAA 1UWYA 1RJ8A 1HJGA 4FPEA 3CJIC 4K3UA 4UIAA 4B8EA 3T90A 2PCUA 5C9AA 2CTBA 3T4HB 3MLJA 4LUAA 2LROA 2WA4A 2XUMA 5DUWA 3VD5A 4R6TA 1ULEA 1QXRA 2W1WA 1PX4A 5F09A 1F4AA 1PIV3 4XILA 2G3TA 6CPAA 1XRUA 4MGZE 4DUXA 4NHKA 1XU1A 3WCSA 1G8WA 5CFDC 3J4UH 4YLZA 3D3SA 1LNSA 1UKGA 4XPDC 1HXS1 2RS52 3FWEA 2R8VA 2Z5WA 1S2KA 3FH4A 2BERA 5FYYA 2OIIA 5HCHA 3OYWB 3PUAA 4YFZA 4M85A 4S2HA 4KOSA 5AFBA 1P4NA 5FPUA 3GJAA 2GC3A 1PZ8A 2E26A 2CNSA 2ZAHA 3DSBA 2P0WA 3CDZB 1I6XA 1OT5A 2BSWA 1N3PA 4GQ7A 4M6IA 4PDWB 5KXBA 4YW1A 2QJVA 2GN7A 2AFSA 3SKVA 4CA9A 4OLLA 5LA2A 4P4BA 4PXDA 2VNRA 5JZGC 4RHV2 1V0AA 1S0BA 4IETA 4DFSA 3LPFA 1LJ7A 2EIGA 3M7AA 4L97A 4E9KA 2ZGRA 4OVEA 3PL0A 1C8NA 4V2VA 3QB8A 4PIYA 3B9IA 1WMFA 3A0NA 3VBRB 5J3UA 1KEXA 1JYWA 4CXYA 2ZGPA 3R4DB 1JN2P 3HUVA 3M70A 5FR3A 2RS32 4JGZB 5L36A 3FLRA 5F6LB 5C88A 4NWVA 1IIDA 1NCQB 2AYHA 2ZHNA 2W68A 4Y5TA 2JDCA 5DAQA 4AEMA 3WNMA 3BTAA 4KGQA 2YZ4A 2F5IA 2ETEA 2VZRA 3V0BB 4N8MA 4XPLA 4AF9A 3DEMA 3JRUA 5AC91 3HWJA 4AI0A 1GR3A 1FMD3 4B1MA 4X6QB 2JBKA 1VAKA 4FP2A 3D6EA 2Z11A 2IXJA 2CIJA 4W6WA 2E7QA 1Q2YA 3ZN6B 3INAA 1JYTA 2EXIA 2PR1A 4A3XA 2ZGOA 2DCTA 4IEVA 3MIGA 4UCNA 3ZYFA 2V8GA 1JZ2A 5A1LA 2ABZA 1C4RA 3DGVA 3IMMA 3TEWA 3LACA 1CONA 4MX3A 1X33A 4NJRA 3MPPG 3J9SA 2RMU3 1GQGA 5AVPA 3N7KA 3QAYA 2JX9A 4RR3C 2DF7A 3WR7A 4AVBA 3WC5A 1WKYA 3RZZA 4GH4C 2ZZQA 1JQGA 4FPJA 3KF5A 4BWOA 2VMIA 3NJZA 2DURA 3WR0A 5DABA 3N36A 1UYYA 4B4RA 5G04L 3T09A 1AR92 2A7AA 3GNEA 1JZ3A 4R9MA 1V9U2 2P37A 3L2HA 4LLOA 2WS92 1OPOA 2PJ3A 1Y0YA 2QUOA 1YUDA 4JXQA 1AZDA 3T4VA 1NAEA 4PF5A 2EXJA 4QVTA 2YROA 5FZHA 4XJAA 1HRI3 3WG1A 5FZDA 2ZX0A 4AHYA 2FS5A 2Q30A 1CBXA 3T0AA 4UEEA 3VBOA 3LDBA 5GLZA 3N3HA 4O9GA 2A3YA 2H6CA 3S0MA 3PBBA 3VD4A 3ZXFA 2XB6C 2J1EA 1RUG2 1LRZA 4YG0A 4UW4A 3GJBA 3E1F1 4ZX9A 1LFWA 5K8OA 5C3PA 5DDJ2 5FYMA 4JLYA 4DNCA 4Z8BA 3W6SA 2ZEEA 4HLTA 5A70A 4MY3A 3SJFA 1QSTA 5FMDA 3WINE 2V09A 4AI2A 3E6CC 4XF4A 1LEDA 4OHXA 5C9AC 3IWWA 3T2OA 1CJDA 4ITCA 2ZAAA 2X5IA 3NRUA 4QQHA 5FO7B 2ZS6B 3CJIB 2PAMA 3MIFA 5GZDA 5JOWA 1DZRA 3DKQA 3ZJ0A 2QQKA 3WUDA 3WW4A 1LHOA 1GHEA 1XRYA 5DN2A 2BGCA 1W05A 1CZVA 4ISQA 4PK3A 3KD4A 3OSDA 1BOBA 3WF0A 3ZFFA 4BDVB 5HCAA 5CFDB 3QH6A 2YGLA 5FZ8A 4Y1ZA 4CYOA 4XPDB 3MRUA 4ZY2A 2G19A 2FCKA 3K4AA 2EALA 1REDA 3Q8AA 3HT1A 2BL1A 3AYAA 2W47A 5A3NA 2B3UA 3VBUA 4EN0A 2OZUA 3G8WA 2GP5A 1UN1A 1Q8OA 1J1LA 2D3RA 4HMZA 2D7FA 2JEVA 4M6GA 3LE0A 4NAOA 5IV0A 5FZAA 4MJ8A 1YR0A 1DQ4A 1PIV2 4YPJA 4DY5A 4OHYA 3PP9A 4A42A 1PVC3 4LOTA 1KWMA 4BK5A 3LFIA 4LHKA 3D8PA 1SLLA 3IDBB 1O6UA 1W8ZA 1LOCA 4MRIA 3S9NA 3OB8A 4CCNA 1KUXA 2VGDA 1UZYA 4KMQA 4HKWA 4OC3A 2VCMA 5BNQA 1UY0A 1TQ5A 2PHFA 4DB5A 3LEIA 4Y1UA 1GWMA 2NMOA 1RUC1 4RHV1 4YFJA 4X2TA 1R57A 2EUIA 1HRV1 4BLIA 3MLKA 2XEJA 1ZZBA 4KVXA 2WZR1 3QLQA 3WNNA 5LATA 3ZSEA 5LA1A 1ODNA 3OCPA 1PO22 1UMZA 2GNTA 2PHTA 2AR6A 4RFRB 2WL1A 2D6PA 1FI2A 2LALA 2A6WA 1S55A 4OFGA 4M01A 3SXWA 5CBMA 4Y26A 4OYUA 1ULGA 3TOJA 1VRBA 1H2NA 5K8NA 4DXZA 4NPRA 2QVPA 2DV9A 1FOD1 2BZDA 2BCOA 1CX8A 3LDKA 2RJKA 2DYCA 1TEIA 2CGOA 5I0UA 1WWYA 3PHMA 3GALA 3K9TA 3M3QA 2PJ8A 4I02A 2W92A 4ZYQA 1KRIA 2VVDA 4OC1A 4XXAA 3I54A 2K9ZA 2I45A 4CYPA 2VI7A 1NUKA 1QHDA 3G6JB 2BDRA 5A32A 5D8NA 5BNNA 1RUI2 2YU2A 4YW5A 1GZCA 4F83A 1WD3A 3RAMA 2BUEA 4DS0A 1DHKB 2A70A 4X8IA 5JSRA 1HB4A 4BMHA 1A3KA 1HJFA 3B3SA 3IIAA 1EYBA 2PJ1A 2D44A 3VD9A 5F5IA 5IVBA 4OZOA 3W6XA 4DNYA 1FPN3 4RR3B 4Z1VA 4GZ9A 3DECA 1A6CA 2WNEA 2JB4A 3WF4A 3ACFA 3A23A 4P00B 2XL9A 1ONAA 4C7HA 2WUHA 4NO4A 3I49A 4P9YA 5FCCA 1Y9KA 5FZFA 1BQPA 5DZGA 4BQWA 2FQPA 1IKPA 4HANA 4TXWA 3D0SA 1DLLA 4LBOA 2ENRA 2RMU2 3DYMA 1AR91 2ZMLA 1V9U1 3AMHA 4ASLA 4CAWA 2A6YA 3DN7A 1YCIA 1SQHA 1CPNA 2PJ6A 2REFA 3WC7A 1ND3A 4XABA 3TN91 4BU2A 4EE2A 5I8YA 5LA0A 5FYSA 3POBA 3RDIA 3ZXAC 3FX3A 3PVOA 3KQRA 4AQTA 1DP0A 3AMNA 2YBPA
chains in the Genus database with same CATH topology
2DXQA 4CGLA 2HEYF 3R9EA 1ASJ1 3BIWE 2E6VA 3IDCB 3PMEA 3R9GA 4QQLA 4Q27A 2DCJA 3TAYA 1RXTA 5FAXA 4UA3A 4LUMA 2CTVA 3PZJA 1OLRA 2D6MA 4FD7A 4AHWA 2X5IC 5DZEA 4OI2A 4KZTA 1DQ6A 5K7PA 1OD5A 4C1WA 1UKRA 2ZGTA 3THPA 4MFKA 1RUF3 2ZGQA 5BY5A 5C9AB 3B8GA 1MVEA 1HLCA 4YZ2A 3THTA 1PNGA 3O12A 4A32A 1S0FA 1JYCA 3KCXA 1ULCA 4I0WB 1VBB2 5FLIA 1KXGA 3TYJA 3NAPB 2Q04A 1VP6A 4CDUB 2NPIA 5KC5A 2B9UA 5C4WB 3PLQA 4KL1A 5KXEA 3ELNA 5EYYA 5I93A 2OU2A 1ZX5A 2O8QA 2XLGA 1XXNA 5SV5A 1KUYA 1HXS3 4D94A 3VBSB 3EO4A 4XETA 1LGCA 4LBMA 1LGBA 4LBQD 1DBNA 2P6FA 1GKBA 3CO2A 3I2DA 3J8F1 2ET1A 4CDWA 5CBLA 1R082 3ZFFC 4KQ7A 2A73B 3WQ7A 1VRH2 2LTNA 2ZTNA 1V0CA 1H1IA 3RSJA 5C33A 5E8AA 4KH9A 4Z92B 2UYAA 3ACLA 3LGRA 1H8TB 3F5BA 2CWSA 1GYKA 1AYM3 3E6BA 2QVSB 2PC1A 5A28A 1H2LA 4G4FA 2VOXA 2VVEA 4PIXA 2D3SA 2FT0A 1X82A 1AX1A 3VWEA 4A2UA 4F8AA 1IQAA 3D2MA 5JPHA 3OPZA 1VIWB