4ONUA

Camp-binding acyltransferase from mycobacterium smegmatis, e234a mutant
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
332
structure length
314
Chain Sequence
AELTEVRAADLAALEFFTGCRPSALEPLATQLRPLKAEPGQVLIRQGDPALTFMLIESGRVQVSHAVADGPPIVLDLIIGEIALLRDAPRTATVVAAEPVIGWVGDRDAFDTILHLPGMFDRLVRIARQRLAAFITPIPVQVRTGEWFYLRPVLPGDVERTLYRRFQSVRKPTRALLEYLFEVDYADHFVWVMTEGALGPVIADARFVREGHNATMAAVAFTVGDDYQGRGIGSFLMGALIVSANYVGVQRFNARVLTDNMAMRKIMDRLGAVWVREVVMTEVDVPPVDTVPFEPELIDQIRDATRKVIRAVSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allostery and Conformational Dynamics in cAMP-binding Acyltransferases.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
molecule keywords Acetyltransferase Pat
total genus 93
structure length 314
sequence length 332
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4onuA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4onuA02
1O3QA 3P2HA 4E0AA 4YFJA 2Q44A 3D0JA 1CAWA 2WPXA 1ZZCA 4IUSA 3VWDA 1PM7A 1CGPA 4QVTA 1XRUA 2PHDA 3UY5A 5HI0A 4O9EA 1M44A 3U0ZA 1NMTA 2VQYA 2J8MA 3MYXA 4XF3A 3TFYA 4KOVA 2D4OA 1I5ZA 5DWNA 1Y7RA 2QNKA 3UKVA 1XEBA 1VJ2A 1J3RA 2GE3A 3H50A 1R57A 4LX9A 4UWIA 1Q2YA 2AJ6A 1GQGA 3FZ3A 2C0ZA 2V09A 1XMTA 2RC4A 3R9EA 4H7LA 3E5UA 1P0HA 3JUWA 4XFFA 3C26A 1YFXA 3C3VA 4H6UA 3DV8A 4Q0SA 4HVOA 3BJ8A 3P2FA 3H3UA 5I8SA 1UCXA 1UPIA 3BLNA 2Q0AA 3OGJA 4PK3A 2Y0MA 4I3PA 2B8MA 2P17A 1S7FA 1CAXB 5FCCA 3F5BA 3DDDA 3EQEA 4U9ZA 4O9GA 5DWMA 1SEFA 3SCHA 3JVNA 3ZZIA 4FD4A 4R3KA 1NSLA 2HV2A 4KLVA 4QGMA 4L2NA 4B29A 2XKOA 4Y49B 1FT9A 3I7DA 1EY2A 4DNCA 3TTHA 3DNSA 4PV6A 2O8QA 2B4DA 3TO6A 2O1QA 2Q7BA 1EP0A 5EZWA 4EVYA 2XL9A 4AVAA 1Q3EA 4AQ2A 3SXNA 2Q30A 4WBBA 1HW5A 2MHFA 3E6DA 4R8HA 1LB2A 1O3TA 4QC6A 2REEA 3EXNA 4L8AA 2FE7A 3NVCA 3FRMA 2ATRA 2FQPA 3MGDA 4BMHA 3E97A 5FVJA 5JQ4A 1YHFA 2GIVA 4I2OA 1Y3TA 3MZHA 5JCTA 3CEWA 3UKNA 2Y0OA 4F7ZA 2PTMA 4BYYA 2P6EA 2ZPAA 3N4MA 4LULA 5KBFA 2CGPA 1J3PA 1S7LA 2J8NA 1Y9KA 4HNYB 5H86A 2GC3A 4MY0A 3BB6A 2EA7A 3TE4A 1IICA 3OF1A 5HH1A 3GY9A 3LA3A 5D1IA 3TOAA 2EVXA 1Y9QA 1TQ5A 1NE4A 4KWJA 5F1RA 1H1IA 1MJAA 4FD5A 2B9UA 5LRRA 2VZZA 3MDPA 4MGZE 1ZZ6A 4I09A 1U12A 3ROUA 1ZREA 3F8KA 3HIFA 4WVZA 4K30A 4RI1A 4P9GA 1OMIA 1GHEA 4IEVA 2BEOA 3E5XA 5I0TA 1CM0A 4FAGA 4HNWB 5I8YA 3S6HA 3H8UA 2WPWA 4LLOA 1OD5A 4LUAA 2K9ZA 1XE4A 3M70A 2B4DB 4HSJA 2Q4SA 3EO4A 3S6FA 3I59B 2B58A 2UY9A 1LRZA 1S60A 3LD2A 1M4IA 3DN7A 4QGNA 4E2QA 1EPZA 2KXLA 3TNQA 1ZVFA 2XKPA 4GULA 4KVME 4Y49C 2XLFA 4IEYA 4QMAA 4X6QB 1SQ4A 1RUNA 3R1KA 3RYRA 1UIJA 2Q04A 1B6BA 1KUVA 1O7FA 1J58A 4QM8A 4NF1A 4JTOA 2HUZA 1LKNA 5BXXA 2PSWA 2REFA 2QDRA 4Q0UA 2IC1A 3E6BA 1XF8A 3TCVA 2XHKA 4IEPA 4Q0QA 1DGWA 5F47A 4B5OA 2PAMA 4XPLA 2BSWA 3EFAA 4EWDA 3WW2A 1YREA 3BJ7A 2CNMA 2XGXA 2Q4YA 4CS0B 2K5TA 2OPKA 2VXKA 3CXPA 5K8SA 4GS4A 2CAVA 3CF6E 3GYAA 1X8MA 4JXRA 4LUMA 2CV6A 3SHRA 5KHHA 1X8EA 1VR3A 2VPVA 5EBVA 4EV0A 5JSOA 4J3GA 2PRBA 2CY2A 4XF1A 4XPDC 2D5FA 3FHIB 4KWKA 1S7KA 1QSNA 2NMTA 1I12A 1I6XA 2HJIA 4KWLA 2KCWA 4E2AA 3VHRA 2FXFA 2PYTA 4LA2A 3DR8A 2D93A 4OAEA 1NYWA 5FPZA 4YSFA 2FT0A 3NE7A 4M85A 4KZTA 2PQQA 2Q4VA 2QMLA 2GC0A 3DKWA 4NSQA 4KOWA 5IX3A 4KOTA 1ZZ9A 4YNIA 5J8FA 3DL3A 5LEKA 4KUAA 2H6BA 1CAXA 5JSRA 3EC4A 1J59A 3NW4A 4TLFA 4ZU5A 3CJXA 3ES1A 4AVCA 3WW4A 2GZWA 2ZXVA 5J7MA 2J8RA 4XFGA 4NCZA 2JEVA 1O5UA 2UYAA 4FD7A 1YR0A 3R96A 2PAEA 3RPQA 3DSBA 3E0KA 4CRYB 1Z4EA 5GCNA 4KUBA 1IYLA 4IEZA 4XEZA 2B5GA 1WK4A 3GBFA 1O4TA 2P0WA 2GAUA 2B3VA 1CAVA 4DINB 3R9FA 2E9QA 1NE6A 3L2HA 1CAWB 2A4NA 4IERA 5BUVA 4KOSA 5C8WA 3CXQA 3USSA 3RYKA 3G7DA 3H1YA 2DXQA 5EC4A 2OB0A 1WWZA 2R7HA 2ET1A 1PU9A 1UFHA 5E1RA 4CAVA 4M3SA 3FFQA 1LRHA 4IEQA 2H0VA 4LA3A 3GKRA 1Q2CA 1FI2A 4R57A 1JUHA 5EFUA 2QJVA 2G3AA 4BH9A 4XF9A 3IWZA 4YYOA 2P6FA 1V0CA 3H4QA 3PNAA 3TT2A 5F46A 1LR5A 1UIKA 5JSPA 1ZRFA 3D2PA 4FD6A 4JWPA 5ISVA 3LZZA 2ZCWA 4K8FA 4D7SA 2PFWA 4AB7A 2VZYA 2XLGA 3B8GA 4HN1A 3H1WA 2FIWA 3FNCA 2IXCA 3R6SA 3KKWA 3W6SA 5T3NA 4HN0A 4ZU4A 1J4JA 5FQ0B 2PQ8A 1IB1E 3D0SA 3GYDA 4XFCA 4XNHC 1YFYA 2B5HA 1P4NA 4UBHA 3OCPA 1OI6A 3FXTA 2JDDA 4UBGA 3LAGA 4II9A 3D3SA 5KHGA 1YGHA 2Z2SB 2FCKA 3WR7A 2B5GB 3OWCA 3RDIA 2ZW5A 3IWGA 2PA7A 3NJZA 4HZFA 2ZW4A 2UY8A 4B5PB 3ZDSA 1VHSA 3BPZA 5CU1A 1YLEA 4X6RB 1X7NA 1DZTA 4IEWA 1RUOA 1S7NA 4X5KA 3ST7A 4YGOA 1WGPA 3LODA 1ZRDA 3FWEA 4KORA 4I0AA 3S7EA 2BUEA 3LWCA 2JDCA 4FAHA 5LEJA 2WFPA 5KHKA 1RTVA 2CAUA 3BU7A 1M4DA 2H5MA 4Z07A 2O28A 4OADA 3OD0A 3H9AA 1XE8A 1I1DA 4MUVA 5BPXA 2OYZA 2BEIA 1O3SA 3IIAA 4LEJA 2JLMA 4PSWA 2PHLA 3KGLA 2FL4A 4E8OA 3U11A 4HKFA 3V8IA 1YUDA 3BALA 2D40A 4LUKA 4AG7A 2IL4A 4LTAA 3R9GA 5I0CA 3E5QA 3EJKA 4RD7A 3QB8A 2R98A 2OZ6A 1YLLA 5KTCA 1KZFA 1ZRRA 1UD1A 5C82A 2VQAA 4JD6A 2B4BA 1QXJA 1V70A 5J3UA 2PR8A 2ZW7A 2H6CA 1SFNA 1Q2DA 5E96A 5I0UA 3O14A 2K0GA 4B5PA 4ONUA 1BO4A 2FIAA 4PK2A 1J3QA 5AVPA 5CADA 2Z11A 3FYNA 3T90A 2FS5A 2OU2A 1L3JA 3RZZA 2GC1A 1QSMA 3I3GA 3ELNA 4AQ6A 3IDCB 3KMHA 5LRSA 4IF5A 4MGYE 2BNOA 5IB0A 3LA7A 2F4PA 2P6GA 4MGIE 3I54A 5FDBA 4MH0E 3H7JA 3TO7A 1O3RA 5C88A 5F49A 3G8WA 3KCCA 2D5HA 1G6NA 3RYPA 4QX5A 3I9SA 4AXOA 1XE7A 2CNSA 1QSRA 1S3ZA 2I00A 1J1LA 1RL3A 3IBMA 4I02A 2Z0ZA 4L89A 4IEXA 3FB3A 1CX4A 4PSXA 3PP9A 3ES4A 1QXRA 4IESA 1TIQA 4R87A 4HVRA 3PGPA 4KOUA 4MI4A 4U5YA 1WLTA 3ACLA 3JZVA 4R52A 4IEOA 4CAWA 1PUAA 1YVKA 2OH1A 3OTFA 1ZZBA 4KOYA 2ARHA 1MK4A 4KVOE 2ZW6A 5I0SA 3TOBA 1RGSA 2UYBA 3CO2A 3WW3A 2QIRA 4PIYA 2FMYA 1CAVB 2IXLA 4BHPA 4OFGA 1YK3A 5I0RA 3QACA 2F5IA 4XFBA 4I01A 3DR6A 1NZCA 1QY4A 1O5LA 3D8PA 2D4PA 4MY3A 3UKTA 2BNNA 2EAAA 1OFNA 2GC2A 2OZJA 1YX0A 2OZHA 3BCWA 2VEZA 5KHIA 5I93A 1Z9UA 3FIXA 3K9UA 3TO9A 4HVQA 3KGZA 3EY5A 2QECA 4U9YA 1XIXA 2BL1A 4PIXA 3G3SA 1OZPA 3D82A 1M1DA 1KUXA 4KVXA 5FQ0A 2ETEA 1M4GA 2B3UA 3SMHA 4L11A 1YFWA 4A2UA 1U6MA 4I49A 1CAUA 4ORFA 4MV2A 5IV0A 2GH2A 3H7YA 2VECA 1DZRA 1Q43A 4J1WA 2ET7A 4N9HA 5I8TA 3EHKA 4MZUA 4EWEA 5C6CA 4CAXA 4CRZB 4IEUA 3H1MA 2HQYA 4KU7A 2PDOA 2BGCA 2G0BA 2HKXA 2XLAA 3NSTA 1QWRA 4D7TA 4EWAA 4HSLA 3CL1A 3FJSA 4MGKE 1MJBA 4JXQA 2IXKA 4I0BA 3SCFA 1NE9A 1RC6A 4JJXA 4KLWA 2ZKLA 3SXWA 3T9YA 3E6CC 2QCSB 2CNTA 3VWEA 4E2GA 4CYDA 4KU8A 1L0CA 4NXYA 5F48A 4J1XA 4Z82A 5JPHA 3KSCA 2Q0YA 1CAUB 3SHPA 5KTAA 4NEXA 1MJ9A 4JVAA 2WC2A 3CLPA 3LOIA 4EROA 5BY5A 4H6ZA 2QVSB 4Q0PA 4AVBA 5E16A 2I45A 3LA2A 4PJYA 4QB9A 3W91A 5J8CA 4F6AA 1N71A 2VI7A 5FLIA 4QBJA 1BOBA 1Q5OA 2G3TA 4XPKA 5KTDA 3PLQA 1WA4A 5FLHA 1QSTA 3MPBA 5JR7B 2X7BA 3EO6A 4PIZA 5CVRA 3PZJA 2PC1A 4QM9A 3ETQA 4IETA 4MHDA 4JTNA 2BNMA 1I21A 4META 4XF0A 4OLLA 1ZX5A 1K4JA 4YRHA 3SXOA 4XPDB 4FBFA 3ZJ0A 2IXIA 5FLJA 3S7IA 4HLTA 2FSRA 5I91A 2BYVE 3FE5A 3M3IA 3NKTA 5KHJA 3HT2A 4YARA 3QAHA 3WW1A 2GANA 4MBUA 2OZUA 1KUYA 4XETA 2MPFA 4R9MA 2PR1A 4FT8A 4UBRA 1ZZ8A 2GU9A 2ATFA 1H1MA 2N7GA 2PAKA 3NL1A 3RNSA 5CNPA 4JV4A 2Z69A 4UWJA 4AG9A 4Q29A 1X82A 4XFAA 1CJWA 3IGRA 2DCTA 4HBNA 5FPXA 2C27A 2XL7A 1IIDA 3U10A 4WZCA 1FXZA 3B02A 4BIFA 3EBRA 1FY7A 1Z4RA 4JLYA 1ZZ7A 4KOXA 1ZNPA 3W6XA 4ZU7A 4F8AA 5BV6A 4F0YA 3TNPB 2R1IA 4MJ8A 1EYBA 4ZBGA 3I59A 4H89A 3QOPA 1Y9WA 2Z10A 4MX3A 4HNXB 4R3LA 3R95A 4QXKA 1IPKA 2AE6A 2EUIA 2OZGA 3S6GA 1YFUA 1NXMA 1SQHA 3N7ZA 1GQHA 2EVNA 4E2SA 4QUSA 1PMIA 1VP6A 1IPJA 4XF4A 3F0AA 4Q0VA 4UXAA 1B87A 1IYKA 4UA3A 4KL1A 4XFHA 4NVPA 4YRDA 4QGLA 1UW8A 3FX3A 4XFIA 1QSOA 1RO5A 2VBQA 3PVBB 2MNGA 3H3ZA 3D2MA 4RS2A 3FBUA 3RYOA 2IXJA 5H84A 3IDBB 5JAXA 2OA2A 3HT1A 2I79A 4HMZA 1YWKA 4N9IA 4XNHB 2IXHA 5HMNA 1VKCA 1ON0A 3HQXA 2Q1ZB 1YVOA 2R8VA 3S6KA 1DGRA 3CXSA 1S5KA 1ZRCA 3S0MA 3SCGA 1RXTA 5J48A
chains in the Genus database with same CATH superfamily
1O3QA 4YM3A 3OEAA 3D0JA 3FLTA 1CAWA 2WPXA 4IUSA 4IGQA 4AGGA 1MS9A 3GNEA 8CPAA 1IS4A 1YLOA 4M0HA 3GCXA 5HI0A 1ENSA 1NMTA 1NY71 2ODFA 4ZS2A 4WJBA 1UYYA 1MS4A 4XF3A 1UU4A 1IU8A 2ZOFA 4ZXEA 1I5ZA 3JB8A 2D4OA 2ARXA 4HOOA 1AR92 1W06A 4UFKA 4KH9A 1XEBA 5DWNA 4CDWB 2WNUC 4CGOA 4URAA 2R7EB 1XBFA 2J7MA 3GDBA 5FZDA 1Q2YA 2Z3NA 2JDMA 1W8NA 4Q1PA 1U5YA 1FX5A 4YGCA 5FZGA 5C3SA 5JUVA 5FP9A 2QZ3A 1ND3C 2VMFA 2BJSA 1E5SA 4LHKA 4OULA 4XABA 4H7LA 1R082 5DZFA 1W2UA 1A34A 1P0HA 3BIWE 5K9YA 2HWD2 4H6UA 1V6IA 4G4FA 1WMEA 1DIWA 4G1PA 1QNYA 3CJIA 4AEKA 4JKLA 3H8XA 2Q0AA 4OMDA 1CZVA 3OGJA 5FBJA 4KG8A 2B8MA 4PBPA 3ZN6A 3JU9A 1UXXX 4JKMA 2R042 3ACFA 2PJBA 1IG0A 3MIHA 1ULEA 3KI9A 4FPLA 3OGSA 3WP6A 3DDDA 4U9ZA 1FNYA 1SEFA 3SCHA 4MSVA 3VBHC 3AVRA 4M6IA 4XUNA 4GAZA 1NSLA 4AZZA 4GXHA 4OUSA 1CN1A 4F0XA 3TB0A 5IAXA 3OBRA 4B29A 2HWC3 2XKOA 2ZEYA 1ND2A 2WNOA 1EY2A 2YYOA 2BGOA 3T3YA 2VOTA 3GJAA 1MVQA 2Q51A 5IT6A 3A9LA 3D4UA 3RAMA 3ZDVA 4CDWA 2ZX2A 3TO6A 1QJEA 2Z79A 2VUAA 3O1UA 2XL9A 4AVAA 1Q3EA 3L2NA 2Q30A 3P5BA 4R8HA 1IG3A 3KV4A 1LOGA 4R4XA 5FTTC 1LAMA 5FZ9A 3VBSB 4I0WB 2D43A 3EXNA 1HLCA 1VBC3 2GNBA 3NVCA 4OYUA 1CONA 2R30A 3WF2A 3FRMA 5LZ6A 5CFDB 1BLZA 4FAIA 1Q8OA 4DRVA 2HWC2 4R9AA 4I2OA 3MZHA 2W95A 5GM0A 5JCTA 4F7ZA 3S6HA 1UF2C 2VU9A 2HEYF 5DG1A 1LANA 2AFZA 4L97A 1TVGA 5FY4A 4QDRA 4LULA 4BQXA 2CGPA 2IUWA 3K51A 2Y6JA 4IAVA 2RS13 2NLRA 4CCCA 1ZA7A 2I74A 3TEZA 4A31A 1C8M3 1PK6A 3OF1A 3NRUA 1XYPA 5HXMA 2EVXA 3W5NA 1FYUA 3AYCA 1COV2 5F1RA 2E7AA 4CP2A 1ZLHA 3NWKA 3NE7A 2J1RA 3V0BB 1ZZ6A 4K30A 4DFSA 3ROUA 1W6OA 1OMIA 2P6CA 4Y5Z0 1AL21 1HN1A 4QX7A 4C0HA 2DVBA 4B11A 4QWNA 2C24A 5IVVA 5I8YA 2YHJA 4A38A 4DUKA 4CEYC 2QYVA 1GP6A 1W8HA 1UWYA 2WUUA 1XXNA 4W8JA 2UY9A 3T09A 3LD2A 1CD3G 1H8TB 2XWBB 3OYWA 1M4IA 3KL9A 4OIDA 2GN3A 2RR11 4B1LA 2GP3A 1EPZA 2E53A 2KXLA 2ZMLA 3WX5A 1GWLA 3ZYJB 4GULA 1PIV2 1PNGA 2GN7A 2ZS6B 5JLVA 4IEYA 4QMAA 4OC3A 5FZKA 2HYXA 4Q8LA 4R76A 2LALA 2WFF3 3RYRA 5I4MA 4NHMA 1B6BA 5GZEA 1O7FA 4QM8A 5TSWA 2F5IA 3A0NA 3ILFA 3AZVA 5BXXA 2HUZA 3FLPA 3J26N 4Q0UA 5CZKA 4AEDB 4C0BA 4YZ1A 1H4HA 1MEC2 2XHKA 5GALA 2RMU2 5JH9A 1GP5A 3POWA 1DGWA 4FPJA 5FO8B 4XDPA 5F47A 2WZR1 4CDQB 2W3JA 4ZX8A 1ZBE3 4CSWA 3WUCA 2PVWA 4KSIA 2VOXA 3J7NA 1J83A 2AH2A 4RN7A 3BJ7A 2X8KA 2XGXA 1DQ0A 1PIV3 1G9AA 3LSEA 4ZZ8A 3VBUA 4PQAA 2OPKA 1AX1A 4E4ZA 5K8SA 4N53C 2PIYA 1F5JA 3CXPA 4CEWB 3VATA 1CBXA 1X8MA 5AC92 3VBHA 2A6VA 3PB7X 2CV6A 3SHRA 3O0VA 1X8EA 5CA6A 4A32A 1F9KA 1W0PA 2CDOA 3H0OA 4LITA 1TMF1 4NAMA 4J3GA 2D5FA 2YC2A 2E32A 3FHIB 3DCQA 3MLLA 4N43C 4Q4W1 5FMOS 1QSNA 2ZEDA 2NMTA 1WW5A 2RJLA 2ZMNA 2KCWA 1W04A 1AUGA 2RDSA 1H8LA 3DR8A 4QX8A 1JOBA 3BOWA 4XVHA 2YXSA 4AVVA 4CUGA 2VZ3A 4O23A 4M85A 5LATA 5C71A 1RVF2 5E6HA 4FPOB 3VLBB 5FYBA 1ZZ9A 2C1FA 1WD4A 4Q4W2 3DL3A 2VMHA 3NNGA 4YG3A 5LEKA 4KUAA 4QU1A 1JBCA 4P9YA 2ZOGA 4U5YA 1CPMA 1GNYA 1QNWA 5F8PA 5AC91 5L9RA 5JSRA 1G7YA 3POBA 3IJ3A 5DAQA 3NW4A 3NJYA 1O6UA 1Q56A 2XEIA 3VDDC 4DUVA 3IM0A 4A7YA 2MEV1 2WNVC 3WW4A 3RSJA 5J7MA 2ZEGA 2ZXVA 1OLQA 2UYAA 4NGQA 1T2XA 1APNA 4IE4A 2Y6GA 3DSBA 4QHZA 3W20A 1BBT1 1EUUA 4XEZA 1WCSA 4ZZ5A 4AF9A 1O4TA 4UI9L 3UJQA 3VZMA 2YZ4A 2B3VA 1CAVA 4NCZA 3FLRA 3S9LA 1CAWB 5EQUA 3ZN4A 2AFOA 3AMPA 2AFSA 5AG6A 2VD7A 3IPVB 4B6ZA 4CGNA 5EC4A 4AHYA 4JHTA 3MUZ1 2G9ZA 1TF9A 1IGOA 2WIIB 1RITA 3LOBA 6CPAA 3EXUA 5DAPA 3VDAA 4M3SA 3KLSA 3FFQA 3AKSA 1XYNA 2OX0A 2LRPA 1CQ9A 2WSUA 1Q2CA 2X10A 3ZMOA 4WV8A 5FY1A 1MEC1 1X9PA 1QSTA 1IGBA 2WZ8A 4BH9A 5JZGA 1Z7S2 4YGDA 2B42B 3SQOA 5KXDA 1W9YA 1V0CA 1GNHA 3H4QA 3TT2A 1LR5A 5JSPA 3D2PA 1AR61 4P4FA 2VZQA 1AJOA 4P45A 4PLOA 4K8FA 1QSOA 4HKOA 4JYWA 1OA2A 4AB7A 1AL22 4OCTA 1IOFA 1WLCA 1YXWA 1XNBA 3M8LA 5FYUA 1L7QA 4HN1A 2VOKA 2XJUA 5A6ZA 1ND3B 2VMCA 2FIWA 3T2OA 2WQZC 1RUE3 1ZLIA 3T2TA 4CYOA 2PQ8A 1GWMA 1PMHX 4XNHC 4XFCA 1V6NA 4UBHA 3OCPA 2E7QA 3I8TA 4CCKA 1FAYA 1RYYA 3UK9A 3CIHA 3VDDB 4FTBA 5J09A 5CFCA 2WA4A 3GALA 4CP9B 2R0FA 4GKYA 3WR7A 2KA3A 1SBFA 1ZG7A 3M1HA 4RHV2 3MHZA 3RDIA 4COWA 2PA7A 4HZFA 4UFJA 4LJHA 2A75A 1S2KA 4DNYA 5EHDA 4B5PB 4HKWA 2RE9A 1X7NA 4TYSA 1S7NA 4RQPC 1HDUA 1WGPA 2CSGA 1QIQA 4LBLA 3RJ2X 3W5MA 4I0AA 1YW6A 2F7VA 1OKQA 2VW2A 3C7HA 3VBSA 4FAHA 4AAXA 5LEJA 3BTYA 1BLLE 2QE3A 4NGNA 5FMOL 4Z07A 4OADA 1S0IA 1ZBA2 3OD0A 3IMMA 4A3XA 3VZJA 4M01A 1G9FA 3KT4A 1NCRC 4B3NA 2DPTA 1MZEA 3O7OA 4FFGA 3AP9A 5GLVA 4AL9A 4K7JA 4LT5A 4XJ8A 4H55A 4NIDA 1UZVA 5LY2A 5I0CA 3I2FA 4GWMA 2EAKA 3EJKA 4MXWB 3U4SA 3I3MA 1BMV2 3QB8A 3ZLIA 1S4CA 2GU2A 3IIBA 1VBD3 1F2NA 3MIDA 1KZFA 4NFRA 2EIEA 3O0XA 4MHNA 2AR6A 3K4DA 1REDA 2ZGLA 4NRPA 4QDSA 3SISA 5C3PA 2B4BA 4JD6A 1STMA 1H9WA 3PUQA 1I9RA 1ZBA3 4Y20A 4Q36A 5FBZA 2H6CA 1RUI3 1SFNA 3POEA 4QU2A 5CIRA 5E96A 3MI8A 2DPSA 2K0GA 4XUTA 4B5PA 2JWPA 4JGYA 1CP6A 2Z11A 2QTWB 4FP2A 1DQ5A 4Y4RA 3MF6A 1W6OB 3UGHA 2C6PA 2FS5A 2OU2A 1QSMA 4GJYA 1F15A 4OHYA 3ELNA 1H2NA 1S0DA 3QLQA 4OKOA 2X29A 4D8MA 5LRSA 4IF5A 1UWWA 4MGYE 3I2HA 4A95A 3LA7A 2F4PA 3VKNA 2EWBA 1JZ6A 4R7MA 3N3HA 1JYIA 3J4UH 2W2IA 4ZY2A 4JRAA 4LO6B 3MICA 4QPGC 5FZCA 3PB9X 2D5HA 4RA0A 4KMQA 3L9JT 3RYPA 2YBSA 4M3CB 1WKYA 1XE7A 2A6WA 3PHMA 3WEZA 3UJOA 2AFUA 2Q8EA 2WWUA 2I00A 5LK5A 3IBMA 4BINA 1ZBE1 2VZ1A 3F2ZA 3I3BA 3PIGA 5DZGA 3TEYA 4L89A 4UFXA 1V6LA 2XBO2 2JDPA 4C2YA 1DQ6A 2PQSA 3LACA 2ZX4A 3HVDA 3KV5A 1ZO0A 2YC4A 4N43B 4C91A 5EJ1B 3PGPA 5C4WB 4N53A 3HNYM 3LFIA 4MI4A 2XEGA 4LBKA 4MGSA 4CAWA 3VBUC 1W8WA 1ENXA 3K48A 1PUAA 1XJOA 5C33A 1ZZBA 3VBRC 4GKXA 4HPSA 2ARHA 1MK4A 3NJVA 2Z5WA 1W6QB 4PXBA 3TOBA 4HFSA 4OMCA 3CO2A 5LBFA 3WHUA 3WG2A 5CFCB 5CEHA 4MHPA 4CYPA 3E1F1 4ARXA 4YFZA 4UIBA 1YK3A 2VZSA 2EICA 5C8CC 4RR3A 1HN0A 5FZ8A 1HRV1 1HDKA 1HKDA 1OBNA 3I2GA 4FOYA 4YM1A 2D4PA 4LE4A 3D8PA 1QJY3 4NGPA 1S0BA 5E88A 3KD4A 1OF4A 2ZEFA 2GC2A 2B7YA 1YX0A 4JDMA 4NPRA 4RGAA 3R05A 4ZGYB 3K9UA 5I93A 2RJKA 5A6YA 3J9SA 4OQ9A 2HWE3 5T5OA 1V6OA 4O65A 3AP6A 4PIXA 3B94A 4TLGA 1OZPA 3PJYA 3H8GA 3PRTA 2OPWA 4UBRA 1SLTA 3LGRA 4PT6A 4QKFA 3SMHA 4CU9A 3GUXA 5CG9A 5BNPB 1ARLA 1U6MA 4LOSA 1AXKA 2SLIA 2J42A 4ORFA 5F3CA 2GH2A 2VECA 3H7YA 4LOTA 4J1WA 1Y43B 2ET7A 4N9HA 5FYTA 5I8TA 1BPMA 3WSOA 4B13A 2R32A 3AB0A 1R092 4KSAA 2P3YA 1CR7A 1TNRA 5F5AA 4D7TA 4EWAA 1UZYA 3CL1A 3FJSA 4MGKE 2WN2A 1YQEA 5FYVA 5K8OA 1NE9A 3T0BA 4AFCA 3E6CC 1DDLA 4CYDA 1OUXA 1XOYA 1FNZA 4K40A 4UCMA 2D6MA 4Z82A 2WABA 3TN93 4Z2WA 5JPHA 3LEGA 4FPYA 3KSCA 1GBGA 4TZDA 1CPNA 4M0NA 2V8GA 3SHPA 2VVEA 3PUSA 3WCRA 3LOIA 4H6ZA 4Q0PA 4AVBA 5E16A 1RB8G 2ABZA 4L9BA 4F6AA 3D3AA 3J8F3 1Q8SA 4NPMA 1H2KA 5IK5A 2R16A 4IXLA 3IAPA 4M6HA 1PZ7A 3C2UA 4DY3A 4Q2FA 1VBB3 5EWSA 4IV3A 5A3OA 5BNPA 1LOKA 1XMBA 2Y60A 2YNCC 3PZJA 3R4SA 1RUD1 4YW1A 4AVTA 1N1SA 4JTNA 1RTQA 4MLOA 2PELA 4META 4XBLA 1F5FA 1I21A 4OLLA 3GIUA 3ZFGA 2PN5A 4UW3A 4P44A 3SXOA 3TC8A 4CGLA 1G86A 2IXIA 3FFZA 4CDWC 1IKQA 1QEXA 1TKHA 3PU8A 4XILA 2YNDA 1Z7S3 3J8F2 1ND2C 1S0EA 3ATGA 5LWBA 4P6YA 2VE1A 5JGFA 3NAPA 3O1PA 5IK7A 1OA4A 5IW0A 5LBCA 1VBB2 2AUYA 1AL23 3IN9A 2PR1A 3O0WA 4R9MA 4BQ3A 2VNGA 2N7GA 3ZPOA 2PAKA 4C1WA 1HXS1 2AFXA 2Z69A 3LIHA 4A41A 4Q29A 4UWJA 2ERFA 1RUE2 5BNOC 4BQ5A 5L7OC 1EV11 4K1YA 3WNOA 4AI3A 1H4GA 5EXOA 5FUPA 3PTYA 3IDEA 3U10A 5FZFA 4XZPA 4JKKA 3MO4A 4WZCA 4UCNA 1QQP2 2WNEA 4KBBA 3AYDA 4OI2A 5FY0A 3WHTA 5HVHA 5JM6A 3ON7A 1LU2A 3FF3A 4CPBA 1HB2A 1ZZ7A 4F8AA 2D7FA 2R0HA 2P3IA 2BUKA 2DTYA 3SEPA 5A3WA 4UF4A 1XE0A 2JEMA 3IB3A 4AQSA 1LFWA 4MX3A 1NLQA 2LTNA 2BDRA 2Y64A 5CKMA 3WOGA 3WQ7A 3ZPYA 4GB33 5LYIA 1JTZX 3LDBA 2OZGA 2P4EA 5GZGA 1W6PB 2WZPP 1SQHA 4UEFA 2RFHA 1DCSA 3VBRA 4E2SA 2W0XA 5HVGA 3DYOA 1NSAA 3B69A 4CYQA 1IPJA 1RMU1 2ZGUA 1FMD3 3HWJA 4Q0VA 4UXAA 4W4ZA 4S2FA 4XF4A 4XHXA 3WR0A 3SEEA 1IYKA 4XJZA 1LU1A 4ASMB 2GDFA 4JGYC 4NVPA 3WP5A 3FX3A 1Y4WA 2UWAA 4CDXC 3AP4A 2J1AA 4P9JA 2POKA 3D2MA 4RS2A 4QKNA 2IXJA 1H8TA 3OYWB 3T2PA 5H84A 4DJLA 5C7GA 3WD5A 2BOJA 4LBOA 2VUDA 2DU0A 4MGTA 2HWB1 4ITCA 5LBBA 5ABJB 5HXDA 3JRUA 4QQ2A 3ZSKA 2I79A 3A22A 3OY8B 1LCPA 3DLJA 5IVYA 1VKCA 3HQXA 4QPGA 2YPJA 5A1AA 3ZYIB 1S5KA 4YW5A 2P5BA 3O12A 1O91A 1GOFA 4A3ZA 1YI7A 3LEMA 3USUA 4E0AA 2DVDA 5D21A 3WG4A 2PJCA 2AACA 1X12A 1NT0A 5LASA 1PM7A 1RUC3 2QBXA 2JDUA 1L7RA 2PHDA 2NN8A 5FZ0A 2EK8A 4R4ZA 2VQYA 3U0ZA 3HQRA 3UY5A 4Y4YA 4PDWB 3DPRA 3MUY1 3URFA 4AE2A 4GWIA 3P3PA 4RS5A 4WM8C 5FPBA 2YGMA 4OP4A 1Z8TA 5F32A 1SPPA 2RVAA 1FV3A 2QVPA 5AFBA 1U0AA 2AJ6A 3V38A 3T1MA 1GQGA 2C0ZA 1XMTA 2RC4A 4L99A 3R9EA 1W05A 2WO7A 3Q8EA 1POV3 1S2BA 3JUWA 1YFXA 2G9FA 3C3VA 3ETPA 4N90A 5FPVA 2ARBA 4HVOA 5J96B 3BJ8A 3MGUA 4LKSA 3P2FA 2R1BA 3H3UA 5I8SA 1UCXA 2ZGNA 3VGIA 4CA9A 1UPIA 3B3WA 4EN8B 3BLNA 5D29A 2Y0MA 2P17A 3PVNA 3PUAA 2C9KA 1CAXB 4UF0A 2RDRA 4AHZA 4MHUA 3SJFA 4RGGA 3POGA 3VH9A 3WG3A 5DWMA 1S0CA 3ZZIA 1K5MB 4R3KA 3ACHA 4NHYA 1GZTA 1UYXA 2WO3A 3SI0A 2ZGMA 4QGMA 3FEEA 4Y49B 2BBVA 1OOPC 3I3EA 1FOD1 4CXWA 2RM22 2VQTA 3ILNA 4PV6A 2O8QA 5A3LA 4Q5OA 2Q7BA 2R041 1EP0A 3IO1A 4OC0A 2JBJA 4EJRA 4NJRA 4A39A 5FUNA 4BOWA 4F8ZA 3SKVA 4WBBA 3E6DA 1RJ7A 4EN6B 1LB2A 2C26A 3WZ1A 2HC9A 2DV9A 3CQOA 1O3TA 1YCIA 1UMZA 3GZEA 5IUQA 3KZWA 4Q4Y2 2PVVA 4L8AA 1QHDA 1VBD1 3VD9A 3TN91 5C3QA 2CF4A 2B4KA 5C9AA 3PMEA 1WW4A 5K0UB 3CDXA 2C4XA 1N3PA 3CMGA 4DMIA 2GIVA 3N5FA 3PFEA 3KASA 5DAXA 1MS5A 2D98A 4NOTA 1LCLA 3IPVA 3IIIA 1C57A 3N4MA 3WC5A 4Q4V3 2QQKA 5H86A 2DUQA 4CXYA 2GC3A 1T6GC 1HB1A 1RUD2 5FPUA 3RWKX 4NGTA 4XMAA 3TE4A 1HJFA 1R093 2WNVA 3SH4A 5HH1A 3OEBA 1TKFA 1AL0G 3R4UA 3AMQA 3MV01 2TEPA 1VBE2 5FYIA 1X50A 4R6TA 1FOD3 1KDMA 5LRRA 1RMU3 4YGBA 3MDPA 2NZ9A 5FMCA 3UETA 4I09A 3F8KA 4LO4B 4P9GA 5BNNA 4AHWA 3HAGA 4IEVA 1GHEA 4A44A 4YW7A 3VHNA 2PJ1A 3LFMA 1PZ8A 3ENRA 3QD6A 4LUAA 2HWB2 1RUD3 1AX2A 1GFF2 1QJY1 2K9ZA 5DPNA 3WNPA 4PLNA 4K8RB 1XE4A 3EO4A 3I59B 3BUCA 2ZHNA 1S60A 3BN6A 4NRMA 3WCSA 2NMOA 2NYQA 4PQ9A 4QGNA 1GOHA 1OC1A 1W0NA 3NV1A 3ZIWA 4E2QA 2FDGA 3IC1A 1LULA 1FOD2 1R091 1ZVFA 1KFXL 1RMU2 2P2KA 1UY0A 2RG4A 2VMEA 2XKPA 1IS5A 4Q1RA 5A33B 3WF1A 2Q7SA 4X6QB 3D7HA 3R1KA 5GLWA 3QBQA 4BM8A 4K21A 4NF1A 3VBHB 2PSWA 1NA1C 4OC5A 1YQ2A 2ILMA 2PLV1 2QDRA 3S57A 2YGLA 3E6BA 4GALA 3ZXEA 1HEEA 3VZNA 3HUVA 3Q8FA 2JDAA 2DCYA 4XQDA 4FTSA 1W90A 5JOYA 3HR9A 5ELYA 1E5HA 1JH5A 2ORZA 3N9OA 3VBFC 3NNFA 3WW2A 3T08A 5IVEA 3MIGA 3OUHA 3D7GA 3PBBA 3B5LB 1SLIA 4A94A 5EP9A 3TAYA 4FSJA 5JMCA 4OMEA 1W8FA 1OH4A 3T30A 2V8VA 1B35C 1DF0A 1W8ZA 2XMLA 4CCJA 5FKBA 2F8HA 1HRI1 2GH8A 3HNMA 2QQNA 5KHHA 3OPTA 2VPVA 4MRIA 3AX4A 5JSOA 3S30A 2PRBA 1PGSA 1UY3A 4JX0A 3VD3A 2CY2A 4NR1A 4XPDC 5FFOC 1TF8A 2I3CA 1RHI1 4RL7A 1SACA 2ZEOA 3RWNA 4F83A 1DYKA 4IUGA 1IY7A 1X36A 4UWIA 2JD9A 4MXWA 2FXFA 4RUHA 1OH3A 4B4QA 2OT7A 1Q8QA 5T5JA 3RJRA 4OAEA 2HWD3 1NCQB 3ACGA 4FFIA 4NHXA 5FPZA 2ORXA 3FUQA 2D6NA 3SC7X 4AI2A 4GH4C 4KWUA 3VBUB 4A4AA 2GC0A 4NSQA 1OURA 2PHXA 3QH7A 1Z5RA 5LYLA 4BLIA 1CAXA 3I2JA 3ZSLA 4GQ7A 4HT1T 4DPNA 1AMPA 2JD4A 4LLFA 3EC4A 5SV5A 5K7PA 2BWAA 4OI0A 5IVBA 2ZX1A 3CJXA 3PBEA 2GREA 4CDUB 2YDEA 2BV4A 1OOPB 4WVMB 3N9MA 5FYZA 4HL0A 5JXIA 4LBQD 3HEIA 3UV9A 2WT1A 3IMNA 2TNFA 2PAEA 1WUVA 3RPQA 4CRYB 1Z4EA 1UZ0A 2R062 5JXHA 4NUBA 4BK5A 2HYKA 2ZOEB 3GBFA 3GHNA 2ZABA 3DEMA 4IGPA 4C90A 4DINB 5A32A 2BVVA 3L2HA 4OHXA 4QQLA 4M00A 1YNAA 4Y1ZA 1ZG8A 1XC6A 2C6CA 4KOSA 1ULCA 2VZVA 2LS6A 2AYHA 4UYBA 4NPLA 1QH6A 5FYSA 3RYKA 1PM4A 3AYEA 3WY6A 4P9WA 4CTEA 4X2TA 3JUUA 2D97A 1VBC2 3FBMA 1UFHA 2GP5A 2L9LA 5DDJ2 1XB9A 4EN7B 4CAVA 1WW7A 2ZGRA 4IEQA 2H0VA 4M3CF 3WF4A 4DXRA 3K9TA 1FI2A 2HWE1 3CT9A 1XBUA 4R57A 2WZR3 1JUHA 5A27A 2A1XA 2QJVA 2XG3A 2ANPA 5I0DA 1VHEA 2A5ZA 4YYOA 4BDVB 4XXPA 1AF9A 2CYFA 1UKGA 2ZPXA 1UIKA 1A8MA 1OLMA 4G3YC 3LZZA 3NO8A 3GBGA 1A3KA 2PFWA 2FCVA 3NNLA 3J7LA 2XLGA 3OGVA 4C2ZA 1C4RA 3KZ4C 4QHOA 5JOWA 5F5IA 1AXZA 1CPXA 3H1WA 5T5LA 1UYPA 2EXHA 2VZPA 5JXGA 3KKWA 4P4IA 3NE8A 2HBTA 2JIJA 1TMF3 2VC9A 2XHNA 3TOJA 3W6SA 1IQDC 1RUE1 4EYUA 1IB1E 3RZMA 1RUH1 1YFYA 3O1RA 5A7WB 4UCPA 2B5HA 1P4NA 1VGYA 4Y33A 2W91A 3RGBA 3FXTA 2VY0A 1VBB1 1S0GA 2E33A 1LOFA 1LOBA 4JGZA 4E4HA 3D3SA 2E31A 4LE3A 3T1LA 1QOOA 3VD7A 1Y7EA 2FDJA 2FCKA 1QJU1 3LE0A 3VKMA 4NHKA 4V2VA 3ZVXA 3J8F1 1UXZA 3BTAA 3I3DA 3KV6A 3P1IA 1E5RA 4QQHA 2ZW4A 3O1MA 5IYYA 1JS9A 3ZDSA 1VHSA 4K9SA 3O1OA 2HWF3 2DBIA 3KCXA 1EUTA 4HK9A 1DZQA 3POJA 4YW2A 4X5KA 1W8TA 2VTFA 1PX3A 4HKLA 4KORA 4KNCA 2HBUA 1M4WA 2WFPA 3ZFFA 5KHKA 1FPN3 3BU7A 4AG4A 1ND2B 5CAZA 4D7YA 4X8IA 4BE3A 1RUH2 3H9AA 1VBA2 3BPSA 5BPXA 4CUAA 3K2KA 2BEIA 3IIAA 5GLUA 5C4WC 1M4LA 2P6HA 1AR81 1Y9MA 2D6PA 1POQA 2QQPA 2J1SA 1IQAA 3KGLA 5FP3A 1GOGA 3CU7A 3I49A 5L73A 2DU1A 2PJ9A 4HKFA 3BALA 3V8IA 4IE5A 4LUKA 2DF5A 4AG7A 1ZBE2 2UU8A 3D8CA 1O4ZA 2A7AA 3ITQA 2A6YA 3MW2A 3AZWA 1YLLA 4N8MA 4NMIA 4QPWA 4ES8A 2FZ2A 1AR62 5KTCA 1QDOA 1QJX1 2JENA 2AENA 4ZYQA 1SLCA 3RFRA 3D67A 1FPN2 3THDA 2VZOA 1XYOA 3ZMNA 2ZW7A 1S55A 3BOPA 1JHJA 4MFKA 3VKFC 2WS91 3TEXA 1TG7A 2RV9A 2WS92 1G9CA 3RZHA 3B7IA 1C8NA 5AGEA 4A37A 2XUEA 4ONUA 4JQRA 1BO4A 1ASJ2 2FIAA 1J3QA 2CNAA 4Q4V2 3ZYRA 3FYNA 4PK2A 4EWTA 4XBQA 1WCQA 1QJX2 3ZKUA 3T2QA 2WT2A 1BXHA 2GC1A 3RZZA 2CY6A 2Y26A 3A4UA 2W39A 4HANA 4NE9A 4NN0A 1OPMA 1BZWA 2BOIA 1R081 3KMHA 4D6RA 3F95A 2HB6A 5E8AA 4PDWA 4B12A 5FYMA 4O61A 1LEDA 2IFWA 4QHBA 4UFHA 4MGIE 2C6SA 1VBE3 3BXMA 3OGRA 5LRJA 4Q4W3 4MH0E 3TO7A 4RN5A 5C88A 5F49A 2WS93 1C8M1 3Q9OA 3ZXLA 1MVEA 5DMYA 4N7UA 1Z78A 3I9SA 1D0HA 1ZYBA 3GM8A 3IKWA 2CNSA 3GF6A 4XHBA 4CP1A 1QSRA 1KD7A 1RL3A 3M4FA 4OC4A 2E26A 5FYHA 1JZ8A 3LB9A 1CX4A 4PSXA 4ISRA 3PP9A 3AP5A 3WDYA 1IZ3A 4JDNA 1OA3A 5A28A 1TIQA 4W9YA 4BQWA 1V0AA 4B7EA 1W3XA 2RS53 2VBDA 4TSVA 2CIJA 3B2YA 4MCQA 1WLTA 1TME3 5DG2A 3JZVA 1DE4C 3VKLA 2PLV3 4OZXA 5EIYB 2QJ8A 1VPHA 2ZHKA 2OH1A 1UL9A 4KOYA 1UOJA 4CCNA 2DWRA 2ZW6A 3ZXGA 2QIRA 4PIYA 4UW6A 2WBKA 5FZIA 2A70A 1W39A 2Y6LA 4AI1A 1OQDA 4BHPA 5L7OA 2UWCA 4XURA 1YJLA 5FO7B 2ZAAA 4XFBA 5I0RA 4QX1A 3ZFEC 1R083 1VRH2 1DQ2A 1O8PA 1QY4A 4UFVA 2IFRA 4CEWC 3LPGA 3WNMA 3UKTA 1MPXA 2PHUA 2PHTA 4COYA 1REFA 4FBEA 1W99A 5D8AA 5IB9A 1CVNA 4LMFA 2VEZA 3GZUC 1UU6A 5KHIA 1YQ8A 5FY8A 5H9RA 3ZFFB 4ZX9A 1REEA 4HVQA 2QECA 4U9YA 2YGWA 1UYZA 3G3SA 2FMDA 1MQTB 2XDVA 5F6LB 1M1DA 1YC61 5FQ0A 3VBOC 4BPZA 1M4GA 3VHOA 3A23A 2GLJA 1PX4A 4NIIA 4DXZA 4EZHA 2C5DA 1LTEA 1PGW2 2R071 4W50A 2Q1MA 2V73A 4F0YA 1JYCA 5HV0A 2Y0IA 3EHKA 3KF3A 5C6CA 2ZX0A 1SLBA 3H1MA 2IZWA 2YBPA 3AL5A 4OZOA 4RFRB 1HJGA 2BGCA 2XLAA 3HMYA 1LECA 3O1VA 4JXQA 2FD8A 2YU1A 3SCFA 5C8CB 1YMEA 2BBAA 2VQUA 2ZKLA 1V6KA 4FP3A 2CNTA 3VWEA 3DXUA 4A33A 5C3OA 2B9VA 2RJ2A 3OBAA 4R9DA 4CEYB 4CP0A 2BZDA 3MRUA 1LHVA 4U36A 1F4HA 1AYN2 2C9AA 3DPRB 3W9AA 2Q0YA 2FCTA 4NWVA 2Z3MA 3PEIA 4NEXA 4CVUA 5HVFA 5KTAA 5FXXA 1MJ9A 2RDNA 1FV2A 2W52A 4JVAA 4F3JA 3H8OA 1LGNA 5J8CA 3WINE 4QB9A 2NYYA 2ZKNA 1WLWA 1MQTA 2VUJA 5LRGA 2G3TA 5KTDA 2X7BA 3NH5A 1ULDA 2YFZA 3FEDA 1AR91 3EO6A 1HV1A 4U2AA 4LPLA 5CVRA 5FP8A 1CWPA 5FZEA 5HCHA 4QM9A 2GFQA 2VMGA 2J1EA 1G9BA 1X33A 2BW8A 3ETQA 2W47A 4IETA 5ERLA 2BNMA 3ZN5A 4FQZA 5HCAA 2VBBA 1ZX5A 1SBEA 1WCDJ 2RR13 4MXVA 3ZKYA 3S5AA 1CIYA 2IMOA 4XPDB 1EAH3 3H42B 5T55A 3FL7A 3RZKA 3DGVA 3BU0A 2BYVE 5DUWA 4EZ4A 4RHV1 3FHAA 3HN1A 3HT2A 1K5MA 3U75A 2P3KA 5CFDC 3AKRA 1OQ1A 2OZUA 4YZ5A 2CHHA 2VMDA 2ZACA 4XETA 5ABJC 3NH4A 4FT8A 4YU9A 2GU9A 1LNSA 1H1MA 2JE8A 3RNSA 4OHWA 3ZN6B 4AVSA 2IJZA 1KS4A 4YVWC 4XFAA 3O1SA 5C8CA 1KJRA 2XVLA 1CJWA 2DCTA 1GR3A 1TMF2 4HBNA 4ES9A 5FPXA 2G9DA 3OPWA 4DYOA 1UAIA 1ZA4A 5FZMA 5JI9A 3JD72 5LYFA 3M3OA 1EAH2 1KJLA 1N47A 1UY4A 4KQ7A 4P4JA 1Y0RA 4CCLA 4D0QA 2GNDA 3UGGA 2I07B 3THTA 1FXZA 4P08A 3IWWA 2V4VA 3B02A 3NAPC 3RMYA 1Z4RA 2Z3KA 1NCQA 1QH7A 4JLYA 5BV6A 1WMDA 4HONA 3TNPB 2RMU3 2JG8C 1AYM3 2ZHLA 4JZ0A 1DGWX 4UT5A 3I59A 1L7LA 4AW7A 2NMNA 4H89A 1Y9WA 2JEWA 4MHZA 1TEIA 2YU2A 3JB4C 2PJ8A 1G8WA 4HNXB 4XJUA 4DEQA 3MBWA 2EUIA 3LDRA 5LRKA 4I3GA 1MZ6A 5A70A 4TTGA 1GQHA 4FFFA 5BNNB 4DUXA 1R1A2 2QQMA 5AC93 1VRBA 2X5IA 3U4XA 1MS1A 1NX9A 1VP6A 1VBA3 3HOBA 5GJ6A 1B87A 4UA3A 4A2ZA 4XFHA 2EBJA 5L7OB 4YRDA 1H1AA 3EB7A 1AR82 2WR9A 2CTBA 3HLPA 3PVBB 3RYOA 4W6WA 1W2AX 2DBNA 4YVSB 2R061 3FBUA 1XPWA 3IDBB 3JBG1 4EN9B 4XJ9A 1PO13 2PJ3A 1KS5A 4BISA 4YM2A 1YWKA 3MIBA 3ACIA 3Q8BA 5K8PA 1XU2A 1OQEA 4FOVA 2FDFA 2DFBA 1ON0A 1R1A3 4JC1A 1YVOA 4MFQA 3CXSA 3S6KA 4F9VA 1ZRCA 5A6QA 1RUF2 3LSDA 5A3TA 3ZX7A 4K6BA 3VKOA 1F57A 1LOEA 1COV1 3K77A 1NQJA 4FVVA 1PVC2 3VWDA 4CCOA 3V65A 1QMJA 2Z3PA 5CISA 3FX6A 1R1ZA 4Q4Y1 1ONAA 2R49A 4O9EA 2IVIB 1LAJA 4KS9A 2J8MA 2NSMA 1LESA 1MZ5A 3OD4A 3SH5A 4ASLA 2DEAA 1MS3A 4KOVA 1F2PA 3TFYA 4LHSA 2YUEA 2QNKA 3SNMA 1Y7RA 1VJ2A 1J3RA 5IK4A 3AK0A 5LA9A 3H50A 3PUIA 3SKJE 3Q8AA 1BEV2 4CRQA 1R57A 4MG2A 1GKBA 1BK0A 4QQPA 2C1CA 5IATA 5T50A 4MADA 1OD3A 2V09A 2VO5A 2YB7A 3FZ3A 3JQWA 1JMUB 1XQNA 3NNMA 3PU3A 5FY5A 1W2OA 5KR7A 3E5UA 4XIOA 4YW3A 4XFFA 3FH4A 3C26A 3DV8A 1J84A 1LHUA 4Q0SA 4XC9A 5T5PA 3WDUA 3VBFB 1W2NA 2PHRA 4LO8A 1HIXA 2JG9C 4BWOA 2YNEA 1UOFA 1JODA 4I3PA 1S7FA 5B4NA 4OI4A 4ZONA 4JHZA 3PMSA 2JG8B 1NA1B 2PLV2 1WLDA 1GANA 2JE7A 1NG0A 4KI5M 4YW4A 4XCBA 5CFCC 3JVNA 4FD4A 1CX8A 1FMD1 2VNOA 4KLVA 4BD9A 4CEWA 2ZEMA 1H6XA 1FT9A 2YMZA 3I7DA 3DNSA 3IDAA 1SPPB 4D6SA 1KEXA 2B4DA 4NGRA 5DS0A 2O1QA 1EV12 5FPLA 5JOXA 5EZWA 4EVYA 3ZM8A 5LBEA 5DUUA 5FZHA 5DUVA 3SXNA 1MS8A 2RHPA 2PJ7A 1HXS2 3BGAA 5FPAA 4AWDA 2NM1A 5J37A 1GNZA 1WCUA 1UN1A 1LOCA 3HD8B 4OHVA 4MO3M 3ALQA 4C68A 5M0TA 2FQPA 5A1FA 3MGDA 4BBHA 4ET7A 5FVJA 4RS5B 1QKQA 1YHFA 5JDBA 2X09A 2TBVA 4IHMA 5JQ4A 2XPJA 1Y3TA 2AC1A 3UKNA 2Y0OA 2PTMA 4UFIA 4L92A 2ZGKA 1RUF1 4IV1A 2XH6A 4OUEA 1JYWA 1C1LA 4YPJA 3T4VA 4LO5B 1S7LA 1Y9KA 2J8NA 4HNYB 2VCMA 4CYNA 1PHMA 4LQ6A 5L9BA 1HXS3 3BB6A 1YSJA 1KQRA 3CJIB 3THPA 1F35A 1HX6A 1C1FA 2DFCA 3J7HA 2BFUS 3MLJA 3U37A 3LA3A 3GY9A 4JAAA 3KWVA 5SV8A 2W1UA 5F2SA 3TOAA 1LHOA 1Y9QA 1NE4A 2B45X 3POFA 4MGQA 4MVTA 4XDQA 3GLJA 3I1UA 4Z92B 4FD5A 1O8SA 4MHYA 2VZZA 3I2KA 4XZUG 4UEZA 1WWYA 4PHZA 4YG6A 1HQNA 1GP4A 2HWC1 4TWTA 3HIFA 5DAWA 3MFAA 3VB9A 1ZREA 4RGKA 3VBRB 3H8EA 1VBD2 2BEOA 1R1A1 2O0OA 3E5XA 5I0TA 5IAVA 1US2A 3H8UA 1RUG3 4LLOA 2WPWA 1OD5A 2WWSA 1SZBA 4XXAA 7CPAA 3PL0A 2B4DB 3M70A 2BERA 1RUI2 4ZPIA 4Y26A 3AMMA 2AFWA 2DURA 2B58A 4MXUA 4IV1C 2CL2A 4S2DA 4YVSC 3WP4A 2ZELA 4NGMA 4OHZA 3I2IA 3TYJA 4OC2A 2OQ6A 5JOZA 3N7KA 4IV1B 2XWJB 3TNQA 1PGL2 2CGOA 2Q4ZA 2QQIA 4KVME 1YW4A 4Y49C 4H2AA 4AXVA 3CBNA 4MFLA 2F4LA 4XJWA 1RUNA 1F8VA 4QPGB 1GZWB 5L36A 1KUVA 5FWJA 4P4EA 3V56A 5C9AB 4JTOA 1GICA 4LBQB 2V5YA 5AG4A 1C28A 2REFA 4Q4X1 1XSRA 4GB31 3OOXA 3FHQA 4N43A 1XF8A 3TCVA 3KHCA 4MFZA 2PJ0A 2VTXA 2YFUA 4IW3A 1XU1A 1WBFA 2W68A 4Y1UA 1VB2A 2AEYA 1UKRA 1DYPA 2PAMA 1PYTB 3CXQA 1W9TA 1AYM1 3ZFFC 1YREA 3WQBA 4CGPA 1W6NB 2X53S 3NAPB 2HEVF 3GGLA 2CNMA 2EO8A 2Q4YA 2K5TA 2CU5A 4BMEA 3A0KA 2W92A 2VXKA 2XBO3 3LKJA 4YFWA 2ZMKA 2CAVA 3AVSA 1K5JA 1XNTA 2Q1FA 2W5FA 1FNOA 3ZSEA 3ZOIA 1VR3A 3LQCA 1Z8LA 4EV0A 2A71A 1CZSA 1VBE1 2G9GA 4KWKA 3GJBA 3VUOA 5BWAB 2VW1A 4CCEA 1ODNA 2VCAA 2LUWA 4UF0B 2JG9A 4KWLA 1LOFC 3J7MA 1OPOA 4WVVA 3VV1A 4E2AA 1Q8VA 2PYTA 2F6BA 4YGEA 5B2GB 3GCWA 1HV0A 2PQQA 5IX3A 3DKWA 4BQYA 4KOWA 3C7FA 4YNIA 1PO21 1CX1A 1FT7A 2ZEEA 2H6BA 3INAA 1KITA 3CZJA 5IVFA 2GSYA 2XBO1 4XIKA 3ZR5A 2XJQA 1VIXA 2WSVA 4TLFA 4ZU5A 3WABA 1DBNA 3PJQA 1JU4A 3RVHA 1N1YA 1W6NA 1LJ7A 1POV1 5FYCA 3ZXJA 1O5UA 2XQXA 5A3UA 3MW3A 3VDBA 4JGZB 1YR0A 1CG2A 4S2HA 3CHXA 3ZYHA 3JTKA 3R96A 2ZGPA 3E0KA 3OSDA 2A3XA 3HJRA 1CP7A 4OI1A 3MN8A 5GCNA 2ARCA 4Q27A 1AR83 3TX8A 2A6ZA 3AFKA 2B5GA 1QU0A 5T52A 1WK4A 2JBKA 5ANNA 1H0BA 3I4IA 1JI6A 1Q8PA 1NE6A 3KR4A 2A4NA 4IERA 3BODA 3OUIA 5C8WA 3USSA 2PXJA 2ZAHA 3H1YA 2DXQA 1RINA 2OB0A 4GXLA 4RSUA 5CPAA 2R7HA 3AMNA 2ET1A 1X10A 4DEVA 4Q4Y3 1PGW1 2R072 4HG6B 5E1RA 4QXBA 3SLIA 4QX2A 5K8NA 2PMWB 4LA3A 4BQ4A 5FZAA 4DUWA 2YBKA 2ZXQA 3JQXA 5DABA 3GKRA 3USUB 5EFUA 2G3AA 1PVC3 3IWZA 4XF9A 1PO23 4KSFA 5LY1A 2QZ2A 1WW6A 4OUMA 4CU8A 1O4YA 4Y5SA 5CKQA 4YZ4A 1UY2A 3U78A 4ATFA 5G04L 5F46A 4JWPA 1QF3A 5CBMA 4G9SB 2AFMA 2ZCWA 1C3HA 2ZX3A 4AFMA 3CDZB 2C6GA 2FDHA 2ES3A 2O14A 3VN4A 3T8WA 3OUJA 3VDCA 4P9IA 4QPIB 1IS6A 1XFOA 3RO0A 3FNCA 3RZAA 2B46X 2IXCA 2BQPA 1LENA 3R6SA 3RG0A 3HBKA 5T3NA 1BEV3 4TNUA 5EV7A 4HN0A 3B3SA 1OSGA 2PJ5A 4E4DX 3D0SA 3GYDA 1NA1A 1DLCA 1ZBA1 4B4PA 1Z8XA 2ENRA 3WG1A 2JDDA 2WZNA 5G1ZA 4Y1XA 3PUHA 1SG3A 3LAGA 4II9A 1W6PA 1GU3A 5KHGA 2HLEA 2P37A 1YGHA 3B3TA 2Z2SB 2V72A 3OBTA 1XRYA 2EXJA 2B5GB 2ZW5A 4R9BA 3FVLA 3IWGA 3N9QA 3N7JA 4QQOA 4AGVA 5CB7A 4P5YA 3GB0A 4X6RB 1U5IA 1DZTA 4IEWA 3ST7A 1V6JA 1Y7BA 3B9CA 4GZ9A 4Q4X3 1ZRDA 1GZCA 4P10A 5IFTA 1EE3P 1IPSA 1H8VA 3LWUA 3LWCA 5DXDA 2RS12 4BIOA 5J1XA 4X8NA 2H5MA 2JDKA 2VW0A 1H2LA 1ZM1A 4COVA 1C8M2 5JIUA 1XE8A 2H0BA 2JXAA 2CTCA 4W6XA 4MUVA 2OYZA 5FZ7A 1BPNA 1YYNA 3LD8A 1O3SA 2JLMA 4PSWA 2QFEA 2PHLA 3LIGA 1BK1A 3M7AA 4V1PA 3AMHA 1YUDA 5EJ3A 3ZYFA 4FPHA 4CEYA 3KHXA 2IL4A 3E5QA 4RD7A 5KWRA 1UZZA 5JI7A 1JZ3A 2R98A 2D6LX 2OZ6A 3CZXA 3UT0A 4IE7A 4QDQA 1ZRRA 5JXJA 1UD1A 3I2OA 5C82A 2VQAA 5CKNA 4BXFA 4NJQA 3RRDA 2PIZA 1QXJA 4FXKB 4PLMA 5J3UA 2PR8A 2ID4A 3KVBA 5J36A 1V9U1 2FHRA 1UX6A 5DAVA 5FK7A 5ACA1 2Q8OA 2ZEHA 5I0UA 3O14A 4N53B 3ZO0B 3N36A 4GB32 3T90A 5AVPA 5A7PA 5CADA 4EMEA 3S6PA 5DUXA 5A7NA 2CDPA 3QCWA 1B09A 3AYAA 4XCAA 3BKZA 3QAYA 1EPWA 1FMD2 1ZRIA 4ZY1A 2WLPA 3B01A 3NH8A 2DVAA 2K2SA 5IB0A 3AZYA 4ZXKA 3KT7A 3B93A 2OR4A 4AEJA 1ULOA 2FBEA 1AR71 2V8DA 1NCRB 2VL4A 4QXHA 1O3RA 2Q8DA 2VG9A 1ALYA 1VBA1 2YV8A 1RUI1 4RFT0 3UYJA 2JIGA 3KCCA 1J1TA 3MW4A 3G8WA 4FWUA 4CGMA 3ZIXA 3HNBM 4AXOA 5LB6A 5D8NA 1VB4A 4A6SA 4I02A 1DGLA 5LA0A 3RZLA 1R64A 1TNFA 2ZGQA 5AG5A 3FB3A 1PVC1 4Q7AA 4HPKA 3RBUA 4J25A 1XNAA 4A7ZA 4BZ4A 4XUPA 4IQPA 4IESA 2VGDA 2VOWA 2W08A 4XQWA 3VBOA 5C70A 5F9TA 4R87A 2AZ5A 4KOUA 2WT0A 4P9LA 4R52A 5HCBA 4UFMA 4IEOA 3ABZA 4TXWA 1D2QA 1N3QA 1RXFA 3NV2A 3WQ1A 5C3RA 2P3JA 1AX0A 2PJ6A 1N1VA 3IU1A 4NAOA 1WBLA 3JBG3 4ISQA 2W46A 4KVOE 3KV9A 3ORJA 4QX3A 4AFBA 1CJPA 5F3EA 4LKEA 5LA1A 5DDJ3 2GLFA 1RGSA 4CP9A 2Y6FA 3W21A 2FMYA 5A32B 5FUIA 1HQWA 4OFGA 1MS0A 1RUJ2 1T6BX 3QACA 5APAA 3ZXDA 4CPBD 4I01A 4LKDA 1F2OA 2ADDA 1QQ9A 1DQ4A 1O5LA 2JB4A 3CJIC 3ILRA 4AEDC 4MY3A 1SDWA 2EAAA 5A80A 5FK8A 3WV6A 4CCDA 1DHKB 2OZJA 4P4DA 4TWEA 4Q8KA 3BCWA 3V0AB 1AXYA 2ZEZA 3FUOA 5KXBA 4GM5A 3S9NA 1US3A 4QPIA 3JBG2 1ND3A 3MV11 3KGZA 5KC5A 5FZ1A 4C2XA 2BL1A 1AUYA 4B1MA 1DP0A 4YVSA 1UMIA 3D82A 3DXTA 1UX7A 1KUXA 2JDNA 4KVXA 3GXUA 1GWKA 2ETEA 2Q5TA 4HETA 4XUQA 4AI0A 4D3WA 4H2KA 3PFOA 1F4AA 4L11A 1GQPA 4Y5TA 1YFWA 4IV3B 5DDJ1 3TRSB 3QNVA 3ZSMA 1CAUA 4MV2A 5IV0A 4Q26A 1DYOA 1DZRA 1Q43A 2WA3A 2ZEXA 4PI0A 2W1QA 1JOJA 3D7FA 4CAXA 5IFPA 2WYSA 3FMGA 4HPKB 4IEUA 3WNLA 4B4RA 5JWPA 4BQ1A 2PDOA 1P8JA 3AC0A 4DZGA 3JD71 1BHGA 4BXSV 1N3OA 3NKGA 5A3MA 2WKKA 1MJBA 3HN3A 2IXKA 2IQ6A 4M6GA 4WM8A 1SBDA 1RC6A 4BCUA 4AR2A 5GZFA 4JJXA 4KLWA 3T9YA 2QCSB 4AEMA 5CBLA 2JDZA 2FDIA 4KU8A 5F48A 1NAEA 5A7QA 2J1UA 4CDUA 3B35A 4N7IA 5IWFA 2WAOA 4GWJA 2MEV2 5A33A 5H9QA 1Z0HA 4M4PA 5FWEA 4UIAA 4EROA 4NWWA 4XACA 5BY5A 1UOBA 3O1TA 1RUH3 2Y6HA 1OVSA 2I45A 2DUOA 3WDWA 4AI8A 2NQYA 2VI7A 5FLIA 3CPAA 3H5ZA 2BGPA 2EXIA 1AHSA 2FCUA 4C8DA 3AZZA 2VR4A 3PLQA 1BOBA 4XPKA 3MPBA 5JR7B 4A6OA 4PIZA 2ZBJA 1H9PA 1YI9A 2B39A 3H3LA 4QB6A 4QPIC 3NV4A 4P00B 3WT3A 3BTZA 4QKDA 4P5HA 4B14A 4PBOA 4XF0A 4CDUC 5KXEA 1AR63 2OUHA 4RQPB 4UW4A 4YRHA 4AEDA 1YQ5A 1ODMA 3S7IA 2A3YA 5HPOA 1D2SA 4HLTA 4CUCA 4RHV3 4XUOA 5I91A 5BNOA 3FE5A 1PO22 3M3IA 5FZ4A 5FY9A 2JDHA 4H14A 5KHJA 1ASJ3 3BIEA 3QAHA 3AM2A 4IE0A 1U5ZA 3WW1A 3CPXA 1UMHA 3OG2A 4QXCA 1QJX3 2EIDA 1KUYA 1BJQA 2MPFA 2Z42A 1IOAA 4MFJA 5LYDA 1D4M1 1ZZ8A 2V5DA 4LK6A 5CNPA 1YQCA 2KM2A 2RDQA 3N9LA 3NL1A 3OY8A 3RQ0A 5IVJA 1JZ5A 4FFHA 3U07A 1DQ1A 1X82A 4ZKTB 4PXDA 1W6QA 3IGRA 2RMU1 4R8FA 2XL7A 4DOUA 4NRQA 2P34A 1TE1B 2DDUA 2Y6KA 4M4RA 2GALA 1W03A 3FBYA 5LCWL 4UWDA 4BB3A 4PPZA 4UOJA 1XNKA 4YVWB 3POIA 4FPFA 2VCBA 2JKXA 1W9SA 2JE9A 1GYTA 1UOGA 2VZRA 4JGZC 1R3NA 1DLLA 1VHOA 3EBRA 3NMBA 4IV3C 5BNPC 3HQUA 3V0AA 1QJZA 2WO2A 4NIGA 3LCPA 2R1IA 1ASJ1 1OKOA 1A6CA 1EYBA 4MJ8A 4AHXA 1PZ9A 2GMPA 2CXAA 5F6KA 2WQ8A 2YC0A 3AJZA 3D5OA 1GLHA 5IHRA 4X3RA 1NQDA 1IHMA 1D4M3 4Q4X2 2RS52 4P4BA 1TME2 1H6YA 3S6GA 1VALA 4FTEA 1UO9A 1YFUA 3R4DB 1NXMA 3AKTA 2WINB 5D8AB 3N7ZA 4QUSA 2VXRA 2KR2A 4H7MA 1UNBA 5J1QA 1VRH1 1TKJA 4KOTA 5K8MA 5FAXA 3G6JB 2ZEPA 1OFSA 2QQWA 3SJEA 4QGLA 1UW8A 2G4IA 2VZUA 3H3ZA 2AREA 2WDBA 5IJRA 4BMBA 5C5TA 5KXCA 3VL9A 4DXTA 2VL1A 2O4HA 5JAXA 4K3UA 1X9TA 5G22A 2ZZJA 3N7MA 3ISXA 2IWGB 1D4M2 2OA2A 3U14A 2R1DA 4FPEA 1NY72 3HT1A 4XQ4A 2YNCA 3WUDA 1I1EA 5EMIA 2IXHA 4PQQA 5HMNA 4B7KA 4Z2AA 4GWNA 2Y34A 2R8VA 1DGRA 2AGSA 4GA9A 2X05A 1RIRA 2XB6C 4XTMA 3S0MA 2BCOA 4Y22B 4CDQC 5J48A 1UY1A 1BAVA 4IL7A 2VUCA 3P2HA 4YFJA 1BYHA 2Q44A 3VL8A 5ANQA 1RVF1 1QJU2 1ZZCA 1S0JA 1CGPA 4QVTA 1GZWA 1VAMA 1KWMA 4Y3OA 1XRUA 2OS2A 4BLJA 2W9XA 4M3CA 1M44A 4GMP1 4UFLA 3VHPA 2LW8A 3MYXA 2ZA9A 4IGOA 2ZENA 4MOAA 3WXPA 4Y24A 1BQPA 2VULA 1Y9GA 3UKVA 2UWBA 3WC6A 5EYYA 5K0UA 3ME2A 1JXNA 4P9XA 1S2EA 2FVGA 2GE3A 4LX9A 4CDXB 2OQ7A 4M3CE 5G21A 3K4AA 3LEIA 1D7PM 1NCQC 4E4SA 5FXWA 3R0RA 3VZLA 4CZSA 3BYWA 3WDTA 5KC6A 4GH4A 2XONA 2WL1A 1QMUA 1O59A 3RI8A 1AYN3 1ARMA 1SCSA 4MCRA 2WRAA 2E63A 3D4KA 3LF7A 3ZR6A 3RNZA 1RVF3 3GHMA 1HQLA 3DGTA 1DG6A 1DFQA 1Z7S1 4YW6A 1C5HA 2WZEA 3P6BA 1A78A 2W87A 2WZR2 4DIQA 4PK3A 2VNRA 2HWE2 3WNXA 3ZFEB 3F5BA 1QXPA 2QKDA 3MLKA 4P02B 1PNFA 2JG9B 5FCCA 3BTXA 1OXCA 2VBPA 3EQEA 1W28A 3KQZA 4O9GA 1NXD1 3AJYA 4RR3B 2D6OX 5THWA 4GD4A 2HWD1 5F3GA 2HV2A 1RJ8A 2Z3LA 5CFDA 4L2NA 1CPSA 4XDOA 1WMXA 3FN9A 4RR3C 4Y22A 4ARYA 3TTHA 4DNCA 3VBFA 1RHI3 1V00A 2RR12 1ULFA 3PURA 2XQRA 2GNMA 4J6GA 5FJHA 4AQ2A 5FY7A 4MYEA 1HW5A 2MHFA 2VM9A 3PIJA 5FO9B 1XJAA 2G19A 4QC6A 2REEA 3PVEA 2FE7A 4AYUA 1WCKA 1BMV1 2ATRA 2BO9A 5FZ6A 4BMHA 3E97A 3D7DA 2V77A 4GJZA 1M06G 2QQJA 3VZKA 3TEWA 1MQTC 4SBVA 4WM7C 4LO7A 1Y0YA 3CEWA 1CJDA 2P6EA 3S9MA 4BYYA 1W0OA 2VXJA 4FOQA 4XAAA 1AR73 4DS0A 1I12A 4JDOA 3C7EA 2ZPAA 3JD73 3RI9A 1D4VB 3ECQA 5KBFA 4MCSA 1J3PA 4GIQA 3IU2A 2DYCA 4MY0A 4A30A 4DB5A 2VZTA 5FV3A 2EA7A 2YY1A 4AI9A 4LBJA 5JR2A 1IICA 3ISZA 2XUMA 3AXDA 4EE2A 3IWEA 5D1IA 4DY5A 1GYKA 4NO4A 4W65A 1TQ5A 4KWJA 1S1AA 1H1IA 4E9KA 5FIXA 1MJAA 4MMOA 1ST8A 1PMJX 4COZA 2B9UA 1IKPA 1NCRA 2XJSA 1JZ7A 2PJ4A 4MGZE 3WF3A 4RI1A 1U12A 4FPCA 1JZ4A 4CE8A 2DCKA 2F17A 4WVZA 4PXEA 1JHNA 3PVOA 1F31A 1VE0A 1XSQA 5F5QA 4UEEA 4LIVA 4ATEA 4CU6A 2MEV3 3VBSC 4FAGA 1CM0A 2V8HA 2D6KA 3DUIA 4HNWB 4O7XA 5G20A 4AAPA 4MFPA 1H2MA 4LK7A 4BA6A 2VQ0A 4HSJA 5GLZA 1HB3A 2Q4SA 3S6FA 1ENQA 1LRZA 1C5IA 1VAKA 2OOTA 1QDCA 1S0FA 2LM3A 3DN7A 3AKQA 2DUPA 2QQUA 2D3RA 2QQVA 3WQ0A 2QQLA 2AEZA 3GZTB 3I97A 4ZHNA 1DTDA 3H8RA 2XLFA 1QOTA 1HB4A 1E5IA 2I2SA 3D66A 3T0DA 1SQ4A 2X5IB 1UIJA 5H9PA 2GMEA 2Q04A 1LODA 3WDXA 5IK8A 2PJAA 1J58A 1QQP3 3POYA 1PIV1 2ZGSA 1LKNA 1TME1 1RUC1 3WF0A 1SDDB 4Q4V1 3C7GA 1LOAA 2IC1A 4XOGA 1BBT3 1YO8A 4Q0QA 4IEPA 2VNVA 3T4HB 3V0BA 2BFUL 1W6MB 2EALA 5GZCA 4B5OA 2ARAA 4PF1A 4TN7A 1FPN1 3M3QA 1ELMP 2BSWA 3EFAA 4FD7A 4XPLA 4UAPA 4BJ0A 4EWDA 5F3IA 1SLAA 1OT5A 4ONWA 1OOPA 4WVMA 4XE9A 3M3CA 2WNVB 4CS0B 2P1BA 1ULPA 1LAPA 1PK6B 1SLLA 3I3QA 2HWF1 4GS4A 5H9SA 1OHFA 2O53A 3CF6E 3GYAA 3KHZA 5FREA 4JXRA 4LUMA 1EAH1 3ZXAC 5JZGC 5T54A 1GSLA 1RUJ1 5EBVA 1ULGA 3IFEA 2IVJA 4XF1A 2XEFA 1BBT2 3N9PA 4NJ4A 1S7KA 3K75B 1I6XA 2HJIA 5AVAA 4LQGA 1IS3A 4YG0A 3W58A 3VHRA 5J98B 2QUOA 2CWSA 4LA2A 2D93A 4INDA 5FYYA 3PTRB 4XTPA 1NYWA 5GZDA 1ELLP 1POV0 2EK9A 5E89A 4YLZA 1W8OA 4YSFA 4KZTA 2KD7A 2Q4VA 2QMLA 5J8FA 3NQHA 1YRZA 4OVEA 3BI0A 4XAEA 3B3VA 4NGSA 5AG7A 4E8CA 1VRH3 5F2WA 4XYXA 2XJRA 1YIPA 2A73B 4PDWC 5FMDA 4XJAA 3GBWA 4JRLA 3KT1A 1J59A 3WVJA 2GMMA 1G9DA 3ES1A 2DVFA 4AVCA 2BRTA 2GZWA 3B3CA 3DPRC 2J8RA 4XFGA 5B4XA 4Z65A 4A7KA 2K46A 2JEVA 1QOSA 2ZEWA 3HPNA 4LBQA 3VDDA 4AGRA 2VCCA 3RZJA 5LK7B 3NA6A 4FUUA 1CZTA 2BU9A 1IYLA 4IEZA 5F39A 4KUBA 3P3NA 4FXGB 1EV13 3S5QA 3ZSJA 2GAUA 4LXLA 2P0WA 4XPVA 3R9FA 2E9QA 3N9NA 2Z4FA 3AFGA 1Z8WA 2TUNA 5BUVA 2PE3A 1A8DA 1K12A 2VTXJ 4B10A 3G7DA 1JUIA 4MHRA 5EYXA 1I3HA 3LEKA 1WWZA 1PU9A 4K3NA 2BP6A 2XXZA 4IE6A 4QB1A 2RS51 1LRHA 4WM7B 5A3PA 1H8TC 5C4WA 4Z1VA 2A3WA 1IOIA 2OXBA 1QJU3 4D6QA 2P6FA 1QJY2 5FP4A 3PNAA 3SI1A 3DKQA 5ISVA 1VBC1 1ZRFA 1GZ9A 3K3OA 3WDVA 2E51A 3THCA 4FD6A 1JU3A 1OF3A 4D7SA 4LIUA 2VZYA 3B8GA 5JVVA 1LGBA 2CTVA 1OVPA 2J1TA 5ISLA 2XR4A 3B3QE 4DO0A 2DCJA 3IAQA 3POSA 3SI2A 3LDKA 3ZXFA 3DYPA 4PI2A 4ZU4A 1J4JA 5FQ0B 3FMCA 2RS33 3IEHA 1QGLA 4NROA 4WM8B 3RZGA 1XNCA 2OVUA 3JCIA 1OI6A 4BQ2A 2RS11 3VD5A 4UBGA 3KS7A 4IDZA 2NPIA 3A21A 4FPKA 2Q43A 1RUG2 2OUJA 1UQXA 4XBNA 5FZBA 3W59A 4R9CA 2NP0A 1NZIA 3A7QA 3V7ZA 5F7UA 3OWCA 1JWQA 5A7OA 2PJ2A 3NJZA 3SITA 3HBZA 2UY8A 4LBNA 4RYDA 3VZOA 1JYXA 3BPZA 5CU1A 2R6QA 1RUOA 1YLEA 3ASIA 1LHWA 4WZFA 3T0AA 3KF5A 1OBRA 1BKZA 4GH4B 4YGOA 4LR4A 3LODA 3CKHA 3FWEA 3TN92 2RS32 2UURA 3KQ4B 3S7EA 2BUEA 4KG0A 2JDCA 4QPYA 4HXCA 1M4DA 1RTVA 2CAUA 1Z2LA 2O28A 2FZ1A 1MR5A 3V64A 1JQGA 3DECA 1RHI2 4IK2A 1I1DA 1WD3A 2XEJA 2VAUA 4LEJA 1W6MA 2VVDA 2ZZQA 4AFAA 5GLTA 3KQRA 3PDQA 3VBOB 2FL4A 4I30A 1JN2P 2DCZA 3U11A 4CPAA 4E8OA 1OLME 2D40A 4FPGA 1LEMA 4JQTA 4Y1YA 4LTAA 4BU2A 5HBAA 1AZDA 1NOVA 1PK6C 2W1WA 3MFCA 3ZFGC 3R9GA 5GKAC 3K4ZA 2VMIA 2WQ4A 5D2AA 4K1ZA 5FZLA 1AYM2 2BWCA 2JKBA 1KXGA 2J1VA 2ZTNA 4JZRA 5A6XA 1W9WA 1JOPA 1V70A 4ASKA 5ACA3 2DVGA 5A7SA 1PCAA 1SFPA 1JZ2A 1Q2DA 1AR72 3OPZA 4JCKA 5FP7A 3Q8CA 4CDQA 1B35B 4QD2A 5A3NA 2CGNA 2RM21 2WAAA 1QJFA 2BOAA 4V2WA 1L3JA 4D94A 3UGFA 4QKBA 2VOVA 2PRQA 1K45A 3I3GA 2X5IC 1I5PA 2OW4A 4AQ6A 2DTWA 5BNQA 5K4LA 2HH9A 3IDCB 4PCRA 3PB8X 4LKFA 2W1SA 1DGRN 2BNOA 2VVFA 3WNKA 1AR93 3KCYA 3NNJA 2P6GA 1YIFA 3FECA 1BEV1 3I54A 1N1TA 5A1LA 3AP7A 1W2TA 3H7JA 5ACA2 5FDBA 3PB6X 4WM7A 4YZ3A 5G05L 2WJSA 3QH6A 1GMMA 1PO12 2O8OA 2QDNA 2V4AA 4LBMA 4XMIA 1JYNA 1MZFA 1UZWA 4UW5A 4EFDA 2DF7A 4GMP0 2D44A 1G6NA 4QX5A 2EIBA 3APBA 3K2OA 2Y33A 1OUSA 1XNDA 3N35A 1S3ZA 3ZYBA 1J1LA 3FC0A 3WP3A 4BK4A 2PCUA 2Z0ZA 1RUF3 2FDKA 1SCRA 3PB4X 4IEXA 3MPPG 1AYEA 1WZXA 3ES4A 5IVCA 1QXRA 3RS6A 5BYNA 1K3IA 3KM5A 2R043 2JDYA 4MCPA 1YEWA 2WNUB 1U5XA 4FQ4A 1B35A 4HVRA 5FZOB 3C8XA 2LROA 1W8UA 1SFYA 3ACLA 5DN2A 4YVWA 4YWYA 3AXEA 4LORA 1YVKA 1UPSA 2WFF1 2YROA 1NUKA 3OTFA 4AK3A 1VLNA 5ABJA 2XVGA 4PXCA 1K42A 3M2MA 4LQRA 1W3VA 4K20A 5I0SA 2R073 3KVAA 1K5MC 2UYBA 3GZAA 3WW3A 3FJUA 4WWVA 3SJGA 3NV3A 1CAVB 2IXLA 1PVXA 5JMOA 3WC7A 2JB8A 3B7MA 1AVBA 3DR6A 2JG8A 2WYFA 1NZCA 3U1XA 3KR5A 5L19A 3LMSA 1CIWA 3D68A 3M3EA 4OQ8A 2BNNA 4C1XA 1D0GA 1NKGA 3K3NA 4KBZA 4SLIA 1OFNA 4A45A 2OZHA 1YQ6A 4QT6A 2XJVA 3JXSA 2Y38A 3K46A 3EYPA 3FIXA 1Z9UA 4H3WA 4DXSA 3TO9A 3ZFGB 4EQVA 3EY5A 5FKCA 3MIEA 1JYVA 1PO11 2BVBA 1V9U3 2HEWF 2ZHMA 1XIXA 4X8PA 1KGYA 2R063 1JW6A 3LPFA 5DQ0A 5L9VA 1KDKA 4W6YA 5K0UC 2B3UA 2Q8CA 5FZOA 3OBZA 2D3SA 4A2UA 1RUC2 2WLQA 2J9AA 4I49A 4LHNA 4CRZB 4MZUA 4EWEA 5BNNC 4A42A 4QB2A 2WN3A 4ZS3A 2HQYA 1PGL1 4KU7A 4AFDA 4S2GA 2G0BA 2HKXA 3NSTA 5F5CA 1QWRA 2JJ6A 5FMBA 4HSLA 1HDQA 2WNUA 3BHXA 3SJXA 1COV3 5C5UA 3N7LA 4I0BA 1JYTA 1V9U2 3IZOA 2WSAA 1GV9A 3SXWA 3AZXA 3WLUA 4YWAA 4E2GA 3MEPA 1ACCA 1L0CA 4NXYA 4NIHA 5DZEA 4J1XA 1ENRA 2EF6A 2BTVC 5CG8A 1XOVA 3UL2A 5FJKA 3O5SA 4Y1VA 1BVVA 1CAUB 5JPNB 3TBDA 3OJBA 1VIWB 2JECA 4PF5A 4ZY9A 2WC2A 3CLPA 4QX0A 4CAEA 2QVSB 5FOBB 3LA2A 4PJYA 3W91A 4ZY0A 2WWJA 1N71A 5CYYA 1VMJA 4FCAA 4OC1A 1Q5OA 3SH3A 3UESA 5EPAA 4QBJA 4ZI6A 1VMFA 1OLRA 1WA4A 5FLHA 4CUBA 5C9AC 1LHNA 3CZUA 3KHBA 3OGGA 3CNAA 4NHLA 4URTA 2Z3OA 5LA2A 2PC1A 2FT0A 4D69A 1RXGA 3VARA 3VD4A 2WFF2 4Z8BA 4MHDA 4Y20B 2RS31 2G1MA 3C7OA 2XOMA 3KB5A 2RM23 4WVWA 5D8AC 1KRIA 1K4JA 2PHWA 1YJKA 4Q38A 4FBFA 3ZJ0A 4B8EA 5FLJA 1AJKA 1HRI3 2VJXA 3OB8A 5HCFA 1MEC3 3ZFEA 2FSRA 4CCMA 4YZ2A 1SHWB 2BPA2 3NKTA 3KGQA 1BCXA 5CNAA 2HWF2 3ZXKA 4YARA 2ADEA 2YG0A 5AFEA 1RUG1 5FZ3A 1A2ZA 2GANA 2JX9A 3DF0A 4MBUA 4F9UA 1AYN1 4OIWA 2SBAA 3AL6A 3D6EA 2ATFA 2QQOA 4QAWA 3H8FA 1NLSA 4JV4A 4COUA 1Q7LA 1VAVA 4UFWA 4AG9A 2WUHA 4FO9A 4RQPA 5FXVA 1NLRA 3KQXA 4JGYB 2ZJCA 2XJPA 2C27A 4L8QA 5LW9A 2WYRA 1TZOA 1IIDA 2E6VA 1SMVA 1E57A 1HRI2 1W9FA 4KGQA 5HV4A 3UNPA 2JICA 2RB7A 3BI1A 1VMHA 2W94A 3WT4A 4KGGA 3MIFA 2EIGA 5FOJB 1V6MA 3NFZA 3WNNA 4GMP3 1CESA 2CWMA 2EXKA 4AQTA 4AOCA 4BIFA 4DRRA 1FY7A 4KOXA 1ZNPA 5JIAA 3RMXA 4ZU7A 5F37A 3W6XA 4CAFA 2J22A 4CXXA 1URXA 1MACA 4ZBGA 3B9IA 1FATA 5EJZB 1WA6X 3QOPA 3EMRA 4RS5C 2Z10A 5A7WA 3B00A 3BVCA 2OIIA 4HK8A 2PHFA 4R3LA 4QXKA 3R95A 1IPKA 4E8DA 2AE6A 2WO1A 2ZGTA 4E27A 1R43A 3X29B 2EVNA 2E7TA 1QQP1 2HWB3 1PMIA 3AKPA 2VH9A 4DQAA 3TWIA 3F0AA 1TXRA 1HRV2 1KFUL 4KL1A 4C7IA 3ZYGA 2VBQA 1GUIA 4XFIA 1RO5A 1ZG9A 4C7HA 3ZYPA 2YPDA 5BNOB 2MNGA 1BVP1 5FRAA 1RUJ3 2D3PA 1LGCA 4FOWA 4L0PA 1UU5A 3I2DA 2OKXA 2ZGOA 4CU7A 5JZGB 1WMFA 3BI3A 1H30A 3L2YA 3IT8A 2A6XA 4HMZA 4YM0A 4N9IA 3NJXA 4XNHB 4LHLA 3MF9A 4P14A 5JPMB 2Y8KA 4XW3A 2XVKA 2Q1ZB 5FXZA 5HXVA 2XJTA 4NIAA 4EN0A 4LNVA 5FR3A 1DU3D 5F09A 2GNTA 3SCGA 4FI9A 4CDXA 3DYMA 1HRV3 1RXTA
chains in the Genus database with same CATH topology
1O3QA 4YM3A 3D0JA 3FLTA 1CAWA 2WPXA 4IUSA 4AGGA 1MS9A 3GNEA 1IS4A 4M0HA 5HI0A 1ENSA 1NMTA 1NY71 1MS4A 4XF3A 1UU4A 2D4OA 1I5ZA 3JB8A 2ARXA 5DWNA 1AR92 1XEBA 4KH9A 4CDWB 2WNUC 4CGOA 4UWIA 1Q2YA 2Z3NA 4Q1PA 4YGCA 1U5YA 1FX5A 2QZ3A 1ND3C 4OULA 4LHKA 5DZFA 4H7LA 1R082 1W2UA 1P0HA 3BIWE 5K9YA 2HWD2 4H6UA 1V6IA 4G4FA 1WMEA 1DIWA 1QNYA 3CJIA 4AEKA 2Q0AA 3OGJA 4KG8A 2B8MA 4PBPA 3ZN6A 3JU9A 2R042 3MIHA 1ULEA 4FPLA 3WP6A 3DDDA 4U9ZA 1FNYA 1SEFA 3SCHA 4MSVA 3VBHC 4F0XA 1NSLA 4OUSA 1CN1A 3TB0A 3OBRA 4B29A 2HWC3 2XKOA 1ND2A 1EY2A 2YYOA 3A9LA 1MVQA 5IT6A 3TO6A 4CDWA 2ZX2A 2Z79A 2VUAA 2XL9A 4AVAA 1Q3EA 2Q30A 4R8HA 1LOGA 4R4XA 5FTTC 3VBSB 4I0WB 2D43A 3EXNA 1HLCA 1VBC3 2GNBA 3NVCA 3FRMA 1CONA 2R30A 5CFDB 1Q8OA 4DRVA 2HWC2 4R9AA 4I2OA 3MZHA 5GM0A 5JCTA 4F7ZA 1UF2C 2VU9A 2HEYF 5DG1A 4L97A 4LULA 2CGPA 3K51A 2RS13 2NLRA 2I74A 4A31A 1C8M3 1PK6A 3OF1A <