4ONUA

Camp-binding acyltransferase from mycobacterium smegmatis, e234a mutant
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
332
structure length
314
Chain Sequence
AELTEVRAADLAALEFFTGCRPSALEPLATQLRPLKAEPGQVLIRQGDPALTFMLIESGRVQVSHAVADGPPIVLDLIIGEIALLRDAPRTATVVAAEPVIGWVGDRDAFDTILHLPGMFDRLVRIARQRLAAFITPIPVQVRTGEWFYLRPVLPGDVERTLYRRFQSVRKPTRALLEYLFEVDYADHFVWVMTEGALGPVIADARFVREGHNATMAAVAFTVGDDYQGRGIGSFLMGALIVSANYVGVQRFNARVLTDNMAMRKIMDRLGAVWVREVVMTEVDVPPVDTVPFEPELIDQIRDATRKVIRAVSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allostery and Conformational Dynamics in cAMP-binding Acyltransferases.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
molecule keywords Acetyltransferase Pat
total genus 93
structure length 314
sequence length 332
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4onuA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4onuA02
5BXXA 1R57A 5F48A 3IWGA 3RPQA 1ZZ6A 2CAUA 2KXLA 4JTOA 1BO4A 4HVRA 1YVOA 5KHHA 2BNMA 3KSCA 2Q4SA 4KOTA 1O3TA 1QXRA 4L2NA 4MGIE 4MGYE 1MJBA 2QVSB 2B8MA 3CL1A 4YSFA 2H6CA 1S7FA 2VQYA 1EPZA 2Y0MA 2GAUA 2EVNA 5ISVA 2BEOA 3FZ3A 1U6MA 5DWNA 2REEA 4Q0VA 5CNPA 4AQ6A 3F8KA 2A4NA 4NF1A 3R9GA 3MGDA 1PUAA 1CAUA 3DR8A 3TOBA 1ZX5A 2FMYA 4X6QB 2FIWA 1NYWA 4ZBGA 2QNKA 1DZTA 2OYZA 5I8YA 4R87A 1IYLA 4II9A 5I8SA 3D8PA 3IDCB 5FDBA 1OZPA 2OZHA 1U12A 3BALA 4PK3A 3I7DA 1RUNA 4WZCA 4XFFA 2DXQA 3D3SA 2O1QA 5DWMA 2MNGA 1OFNA 1CJWA 3H4QA 3LD2A 3QAHA 4KOUA 4PK2A 3KCCA 4MI4A 3RNSA 1X82A 3EBRA 4B5PA 3WW3A 1ZZ9A 5JSRA 4I0BA 4E2QA 2B4DB 4H6UA 5JAXA 5KHGA 1YR0A 4RS2A 4GULA 1Y7RA 3F0AA 4MBUA 5I93A 2ZPAA 5I0SA 1NSLA 3O14A 2QDRA 3NW4A 1YGHA 3JZVA 3NSTA 2HV2A 2XHKA 2PYTA 4QM9A 4YARA 2VBQA 1EY2A 4PJYA 5KHJA 2JDDA 2ZW5A 1WWZA 4MGKE 3GY9A 4KWKA 2B3VA 3SXOA 5FPZA 4KLWA 5BY5A 1YUDA 2P17A 4HN1A 3CXQA 2PAMA 5HMNA 3D0JA 3KKWA 1DGRA 1IPJA 2PR8A 1Z4RA 3T90A 4JLYA 3LODA 2OPKA 3USSA 3IIAA 3G3SA 2PA7A 4R57A 3OD0A 3ACLA 3E97A 2B5GA 2EAAA 4FD7A 4HSJA 2WC2A 4O9GA 2ZW4A 1KZFA 4AG7A 4JTNA 1I6XA 1S5KA 4UWIA 5LEJA 1RL3A 3QACA 3CJXA 4Q0QA 5GCNA 4LUKA 2Q7BA 4FAHA 2I45A 4E2SA 3CO2A 4F6AA 4B29A 4EVYA 3HT1A 4N9IA 3MZHA 4IUSA 3D2MA 3U10A 5T3NA 1YHFA 1YFWA 3NL1A 1YWKA 4LA3A 3I3GA 2MHFA 5HI0A 1Y9WA 3WR7A 3NKTA 3TCVA 1IIDA 4UWJA 5EBVA 1V0CA 4UA3A 2ARHA 3TT2A 2GC2A 2R98A 4IEQA 1XE4A 1EP0A 2FL4A 1QWRA 3OWCA 4XPLA 3I59A 1O3RA 3DR6A 3H7JA 1ZRCA 1YFYA 2EUIA 3RYKA 1LRHA 3H1WA 4PIXA 5KBFA 2BL1A 3I54A 4L11A 5FLJA 4LEJA 2OZUA 5FCCA 1XF8A 3LA7A 3WW2A 3W6XA 4IEYA 4EV0A 3W91A 1P0HA 1X7NA 1FXZA 2D5HA 4D7SA 1PU9A 1FI2A 2Z0ZA 5BPXA 4XFIA 3RZZA 1ZZ7A 1Y3TA 4QGMA 2PFWA 2ETEA 1VP6A 4LUAA 5F49A 3FWEA 2CNTA 2FS5A 1LRZA 4P9GA 3RYOA 4LA2A 3EXNA 1UCXA 5I8TA 1Q3EA 2BNOA 2OU2A 3FE5A 4KVOE 1DGWA 4YRHA 1O5LA 2GZWA 4I0AA 4IEXA 3R9EA 4PIYA 2IXJA 5E1RA 1J59A 5CVRA 4QXKA 4LULA 3ZDSA 2UY8A 3HIFA 5C6CA 1J3QA 3D2PA 4J3GA 5I0CA 3U0ZA 2QCSB 1L3JA 3LOIA 3H1MA 3UKVA 4MGZE 2FT0A 1OD5A 5FVJA 4KOVA 1B87A 3LA2A 4KUAA 3SHRA 3WW4A 3BJ8A 3RYRA 4FD6A 4E0AA 4HVQA 4CS0B 4KVME 4KU8A 4MH0E 5H86A 2O8QA 3H3UA 3VWDA 3R96A 4BHPA 1O3SA 3FYNA 3IDBB 1X8EA 3H1YA 4RD7A 2PHDA 4JWPA 3F5BA 1QSTA 1YLEA 1YK3A 3ES1A 3VWEA 3S6KA 3GKRA 4IEVA 3P2HA 4HSLA 1YX0A 2FCKA 4JD6A 3ZZIA 5HH1A 3SCHA 4IEWA 2BGCA 3LWCA 1M4GA 2I00A 2RC4A 2Q4YA 1XE7A 4KOYA 4R9MA 5IX3A 4Q0SA 5EZWA 1FY7A 2GIVA 3FXTA 4F8AA 2AJ6A 4F0YA 2B3UA 3B02A 2VXKA 3R6SA 1B6BA 1XRUA 4IEUA 4NVPA 1UIJA 2ZCWA 2Q4VA 5F47A 4MY3A 3KGLA 5J48A 1CAWA 3MDPA 2G0BA 2VZYA 2B4BA 1HW5A 2ATRA 3LA3A 3OGJA 4QGLA 2CY2A 1VR3A 3S6GA 2I79A 5FLHA 2XKOA 1IB1E 2OH1A 5J3UA 2H6BA 4NEXA 3EO6A 3DV8A 2V09A 3FJSA 2DCTA 4XEZA 5JSPA 3FNCA 4KOWA 1ZZBA 5E96A 2IXLA 2G3TA 1BOBA 1Q43A 2D5FA 1CAXB 4MY0A 3I9SA 4XNHB 5I0TA 3S6FA 4IERA 5F46A 5FLIA 1K4JA 5FQ0A 4I09A 1TIQA 5K8SA 4IEZA 4JXRA 3EHKA 1YVKA 4XF9A 1M4IA 2ZW7A 2WFPA 4HN0A 4HNXB 4CYDA 4I01A 1WK4A 4KORA 4LUMA 2CNMA 4UBRA 4FBFA 3V8IA 3HT2A 4BMHA 3TNPB 2PC1A 3FB3A 4CRZB 4HZFA 4KL1A 1S60A 1EYBA 5F1RA 4QUSA 4FT8A 3N4MA 4U5YA 2PR1A 3CF6E 4I02A 4R8HA 3SMHA 4XF4A 4QBJA 3SCFA 3BPZA 2HKXA 3GYAA 2FSRA 4NCZA 2OZ6A 2Z10A 4D7TA 2PAKA 4KLVA 3TE4A 4XFCA 1SQ4A 4H7LA 4DINB 2OA2A 3TOAA 5JPHA 1J4JA 1UIKA 3E6BA 1MK4A 4PSWA 1YLLA 2UYAA 2BYVE 4M85A 2D4PA 1OI6A 4HNWB 2PAEA 3L2HA 3E0KA 4HNYB 3TFYA 1G6NA 2Q0AA 4J1XA 4ZU7A 4IEPA 4L8AA 4XFHA 3KGZA 4YNIA 1NXMA 2B5GB 4QGNA 3S6HA 3TO9A 3H3ZA 4AB7A 1Q5OA 1WGPA 4CAWA 2XLGA 1Z9UA 3D0SA 4X6RB 1ZRDA 1ON0A 2VI7A 4EWDA 1Q2DA 3ROUA 3EO4A 3FX3A 4WBBA 2WPXA 4XFBA 3JUWA 1J3PA 2GE3A 4WVZA 4FAGA 3S7IA 2HJIA 4OADA 3IGRA 1O7FA 4PV6A 3BJ7A 3OF1A 3UKTA 4XFAA 4JV4A 4EROA 3N7ZA 5C82A 4XPDC 2FIAA 4Y49B 3FFQA 1QSNA 2HUZA 4QVTA 2K0GA 4LLOA 4QM8A 2P6FA 1X8MA 5JR7B 4J1WA 3UKNA 3T9YA 3HQXA 2D93A 4YRDA 2IL4A 4M3SA 5LRSA 1I12A 1QSOA 3E5XA 5J7MA 3NVCA 4MX3A 4AVAA 2R8VA 4K30A 1CM0A 3EFAA 1UPIA 5D1IA 3R1KA 4KU7A 5LRRA 1RC6A 1SFNA 2QMLA 4B5PB 3OTFA 2ET1A 4JJXA 5C88A 1KUYA 4KWJA 4QX5A 4E8OA 4F7ZA 1S3ZA 3QB8A 3SXNA 2E9QA 4BH9A 5EC4A 3P2FA 1M4DA 3TNQA 4Z82A 2J8RA 2XL7A 1SEFA 4O9EA 4MJ8A 3M70A 2OZJA 1S7NA 2KCWA 4I2OA 3DN7A 1RTVA 1I1DA 1JUHA 1LR5A 3ETQA 4FD5A 3BB6A 1KUXA 3PZJA 4UBHA 1QXJA 5C8WA 2BSWA 3DNSA 1I21A 1VHSA 2VZZA 2GANA 1H1MA 4K8FA 2PDOA 1GQGA 3G7DA 2ZXVA 5CADA 4HVOA 4ZU5A 4L89A 3SHPA 1WA4A 1SQHA 3E6DA 3H50A 4AXOA 4I3PA 2GC0A 4LTAA 2G3AA 1PM7A 1IPKA 1WLTA 4EWEA 1ZRRA 1P4NA 4Q0PA 1LB2A 1Q2CA 5KTCA 4PIZA 1YREA 4OAEA 2BUEA 4KUBA 5KHIA 1ZZCA 2PQ8A 5J8FA 3JVNA 2XGXA 2IXCA 2OZGA 4ONUA 3SCGA 3W6SA 4Y49C 1DZRA 1NZCA 1PMIA 2CNSA 2OB0A 3S0MA 2J8MA 3LAGA 3GYDA 1NE9A 3UY5A 4JXQA 2XLFA 4QMAA 2BNNA 2AE6A 3E5QA 2Z2SB 2JEVA 1RUOA 3ELNA 1ZNPA 3H8UA 4MHDA 2H5MA 3MYXA 4YFJA 3FHIB 1NE6A 3LZZA 4A2UA 3PLQA 2FE7A 3DDDA 5I0UA 1QY4A 1TQ5A 3E5UA 3S7EA 2D40A 3RYPA 4OLLA 3PVBB 2CGPA 3TTHA 3NJZA 1O3QA 4XETA 4BIFA 4XF3A 4E2GA 2R1IA 1I5ZA 2F4PA 2JLMA 3PGPA 5LEKA 4I49A 1M44A 3PNAA 1Q2YA 4E2AA 1QSMA 3R9FA 4QC6A 2VECA 2Z11A 4R3KA 4BYYA 1NMTA 2C0ZA 2GU9A 3C3VA 2ATFA 4HMZA 4MUVA 1RGSA 3K9UA 4IESA 4UBGA 4MV2A 3TO6A 4KOSA 2X7BA 1Z4EA 3WW1A 4LX9A 4ZU4A 4NSQA 1NE4A 2Q04A 3IWZA 1ZZ8A 1IYKA 1CAXA 4HKFA 4R52A 2PTMA 2ZKLA 4KOXA 1CGPA 1MJ9A 1S7KA 4XPKA 3DL3A 3ST7A 2C27A 1N71A 4IF5A 3EY5A 2CAVA 3M3IA 2Q44A 1CX4A 4XPDB 4AQ2A 1Y9KA 3KMHA 3SXWA 4RI1A 2VEZA 4GS4A 1CAUB 2P6GA 3ES4A 2XKPA 5JCTA 2F5IA 4XNHC 2EA7A 2WPWA 3E6CC 2K9ZA 4H89A 4DNCA 2GC1A 4YYOA 1J58A 2VQAA 4MZUA 4OFGA 1YFUA 5I91A 4XF0A 5JSOA 1RO5A 2PQQA 1M1DA 2REFA 4NXYA 2BEIA 1KUVA 4CAVA 2IXHA 2IC1A 2GC3A 3CEWA 4EWAA 5J8CA 2IXIA 3IBMA 1L0CA 5KHKA 5FQ0B 3DSBA 3EQEA 4U9ZA 5I0RA 3I59B 3EJKA 1GQHA 1H1IA 3FRMA 4KVXA 2XL9A 1QSRA 5CU1A 1UW8A 1VKCA 3GBFA 1J1LA 1V70A 5AVPA 1XIXA 1CAVB 2XLAA 2QIRA 3OCPA 4KWLA 1XMTA 4Q0UA 3H9AA 2B4DA 1Y9QA 2Q30A 4ORFA 4XFGA 2VPVA 4CAXA 3G8WA 1CAWB 5E16A 1CAVA 4AVCA 2K5TA 1MJAA 5H84A 4META 4CRYB 2GH2A 4Q29A 3NE7A 5IV0A 3C26A 3BU7A 2CV6A 3EC4A 5BV6A 4FD4A 3BLNA 5IB0A 5JQ4A 3U11A 3PP9A 5KTDA 2HQYA 5FPXA 2H0VA 4AVBA 1VJ2A 1ZRFA 3R95A 5EFUA 5BUVA 4B5OA 1RXTA 2Z69A 2UY9A 4Z07A 1O5UA 2PHLA 2J8NA 2QECA 3B8GA 3VHRA 2PSWA 1OMIA 3DKWA 2JDCA 2O28A 3MPBA 4N9HA 1S7LA 2MPFA 3CXPA 2Y0OA 2PRBA 5KTAA 1J3RA 2N7GA 4IETA 3BCWA 2B58A 4X5KA 4U9YA 1YFXA 4TLFA 2Q1ZB 3ZJ0A 4H6ZA 4HBNA 1IICA 1O4TA 3D82A 2R7HA 1ZREA 2EVXA 2FQPA 1XEBA 3QOPA 2D4OA 2Q0YA 3CLPA 4R3LA 3FBUA 4PSXA 4XF1A 1UFHA 3RDIA 2P0WA 4HLTA 2FXFA 4KZTA 2QJVA 4IEOA 1FT9A 1LKNA 1UD1A 4UXAA 3TO7A 2ET7A 1XE8A 1ZVFA 2NMTA 2P6EA 2UYBA 2B5HA 4AG9A 4JVAA 3FIXA 2IXKA 3H7YA 2ZW6A 3CXSA 1GHEA 4YGOA 2B9UA 4QB9A
chains in the Genus database with same CATH superfamily
1RUH2 2R1BA 3EMRA 2ZOFA 4MCQA 4A39A 4A6SA 3DXTA 2KXLA 3AMHA 3EB7A 1BO4A 1YVOA 3RGBA 4JKLA 5KHHA 1GFF2 2BNMA 2Q4SA 4B7EA 5J09A 2RFHA 2HWD2 4YW6A 4Y33A 3RG0A 3WP3A 1IKPA 3I3EA 3PHMA 2QVSB 5ABJC 1UU5A 4MFPA 1AL22 2Q5TA 2VQYA 2VTXJ 1EPZA 5T5PA 3BTYA 4XIOA 1AR73 5FZCA 2Y0MA 2BP6A 4A38A 2GAUA 4J6GA 3T1MA 1VMHA 3FZ3A 2BTVC 4CEWA 2YB7A 3B7IA 1UF2C 2C5DA 1YW4A 4AQ6A 3F8KA 3S9NA 1KGYA 3RI8A 4DO0A 4GD4A 4MHRA 4N90A 1K5MA 4IDZA 3BI1A 1JYWA 1PUAA 1CAUA 3PFOA 3TOBA 1ZX5A 5BNNA 4C1XA 4ZBGA 2EALA 2VNVA 1GMMA 2QNKA 1DZTA 3VZKA 3WUDA 3NAPC 5FZAA 3HJRA 3I3QA 1YEWA 4NIAA 2GLFA 1ZBE2 5EWSA 2YGWA 4XPVA 3IDCB 2HLEA 5FDBA 3DLJA 5FPVA 4M00A 3JBG3 5DQ0A 1RUNA 4WZCA 3RNZA 3VDDA 4Z1VA 2O1QA 4L97A 3ITQA 5LATA 4AHXA 1RTQA 1LESA 2DXQA 1CPSA 1JOBA 1N1YA 3ZFEB 2C6SA 1NSAA 3H4QA 3LD2A 3LSDA 1WMDA 3LACA 4NEXA 1SMVA 1V6NA 1VE0A 2ERFA 4FWUA 1GOGA 1T6GC 2WINB 4KI5M 2BJSA 1X82A 3CJIA 2JG8B 1E5HA 3JUUA 4XOGA 5BNQA 3PIJA 4I0BA 5JSRA 1LCPA 2FVGA 2C24A 5JAXA 1W8OA 2O0OA 2W3JA 1REDA 1VBE1 1YR0A 3IO1A 4MBUA 4YVWB 3BHXA 1NZIA 4IV1C 4NPRA 2ZPAA 1GKBA 2DVDA 5I0SA 3VBHB 3BXMA 3FVLA 2R042 1IU8A 3J9SA 4C2ZA 4YZ3A 4LBLA 2BWCA 4A31A 3VKFC 2BERA 3PMSA 4FI9A 4C2YA 3GY9A 2D3PA 4GWMA 2ZKNA 1YUDA 4HN1A 5BY5A 5HMNA 1NQJA 2PAMA 4GMP3 1QJY2 4Y4YA 2YY1A 3T30A 5CISA 1IPJA 1NY72 1Q8PA 2R071 4KMQA 3T90A 5C9AC 4JLYA 1WBFA 3WG2A 4QHBA 5FYCA 2PA7A 1ZM1A 3PMEA 2XB6C 2VZQA 2EAAA 5JMCA 3NJXA 1A78A 1G9DA 2VL1A 4O9GA 4TTGA 3FEDA 3DCQA 2W1WA 1QU0A 4P9JA 4R9BA 1IGOA 2Q7BA 1CJDA 1RL3A 2EIDA 2WZ8A 3ZXLA 2I45A 3CO2A 4BMEA 2D44A 2GU2A 2QZ2A 3E1F1 2XBO3 4NHYA 3H8RA 3HT1A 5G04L 1XBFA 1YQ8A 2E51A 4H2AA 4QXCA 1STMA 2QQUA 4DZGA 1MQTB 1FOD1 3AFGA 3NL1A 5EJ3A 3VBSA 1YWKA 1K5MB 4LA3A 2C6PA 5APAA 2RDQA 1V0CA 4XUPA 1YW6A 3MW2A 3MPPG 3VDDC 2HBUA 2JD9A 1F5JA 4I30A 2BOAA 2LALA 1W9YA 4IV1B 4XYXA 4DXRA 3VD4A 3DR6A 4BK4A 3ABZA 1XMBA 1LRHA 5F3CA 2P6HA 3TN92 3LSEA 1ZG9A 5G20A 5C4WA 5FLJA 1GLHA 4CXXA 1HRI1 4AI3A 1CX1A 2DCJA 3T4HB 4QXBA 4CGMA 2WYSA 1BYHA 4D7SA 1FI2A 5FMOL 5FYHA 1B35B 2NLRA 4YW4A 3TEYA 5G22A 4XFIA 2ORZA 2E7QA 3S57A 5F49A 2RS53 3NO8A 5HVFA 2FS5A 5K8PA 4P9GA 1OHFA 5GLVA 5A3MA 5DAVA 4FP2A 5GLUA 5LRGA 4ZY0A 2R16A 2WAAA 3AFKA 4S2HA 1UCXA 2WT2A 1OKOA 2BNOA 2ZPXA 8CPAA 2XJRA 3B93A 4AEKA 1O5LA 2VMGA 3O0VA 4PIYA 5E1RA 1LENA 3QBQA 4QXKA 4LULA 1QQP2 3LGRA 4GJYA 2UY8A 1J3QA 1QEXA 3X29B 4J3GA 5I0CA 5A3TA 1W6NB 1JWQA 2HBTA 4UEEA 4HG6B 4MGZE 4PCRA 3UKVA 1XU2A 4OC0A 1PO11 5A7PA 2Q8DA 3RI9A 2HWB3 2A71A 5FWJA 3PB8X 4KUAA 2WSUA 3BJ8A 4QKNA 4FD6A 1ZG8A 1F15A 2X5IC 4W50A 1VAMA 2Z3PA 2P37A 1ND3B 4K21A 4L92A 5BNNB 2WNUC 3WP6A 1X8EA 4RD7A 2KD7A 2PHDA 1TKHA 4ZX9A 3RZHA 2XONA 4UF0A 5FFOC 5AVAA 1EAH1 5KXDA 1BKZA 1WLWA 2A6WA 3IN9A 3JBG1 1LAJA 4IV3A 2RC4A 5LZ6A 4KOYA 4W9YA 1RXGA 5GLWA 5ACA1 1UQXA 2WNVB 1VBA2 2PHRA 3LPGA 4ZS3A 5LBBA 4D69A 1IOFA 3FECA 3FXTA 4DYOA 3B02A 4QX3A 5CZKA 1UZ0A 1ULGA 1W0OA 2V4AA 1WA6X 1A6CA 1XNTA 4XAEA 3T1LA 3THPA 3CT9A 2VOTA 3LDBA 4N43A 4AI2A 5IHRA 5F3IA 4LE3A 4GMP0 2JG9C 2ZGQA 4QQPA 1LFWA 2WN2A 2VZYA 2B4BA 3UGFA 3KQXA 4R7MA 3WC7A 4KS9A 2R1DA 1PMJX 3LA3A 4QGLA 2CY2A 3I2OA 1J83A 4B7KA 1UZWA 5FLHA 4KSFA 2HWB2 4B8EA 3OJBA 4CEYA 1UOGA 3NFZA 2YPJA 3ASIA 3EO6A 1VBB2 2DCTA 3N9MA 3Q8EA 5LA0A 1CZSA 1ZZBA 3FNCA 3IJ3A 1ZBE3 2C4XA 4N53A 2V72A 1K5MC 4BE3A 2SBAA 4YG6A 1LECA 2D5FA 3ZKYA 3OB8A 1CAXB 3HPNA 4XNHB 3UK9A 1W39A 2P34A 4CXWA 5I0TA 4IERA 4FPYA 4BDVB 4CAEA 4P14A 1K4JA 2AREA 4LPLA 1LHWA 2IFRA 4IEZA 4CRQA 5C9AA 5FQ0A 1TIQA 1TKJA 4XF9A 1MACA 2IVJA 4H3WA 1XQNA 2WFPA 2EIGA 2GH8A 4HN0A 4I01A 5F6KA 2ZOGA 1PVC2 2JDKA 1WWYA 4KORA 4UBRA 4FBFA 2RR11 3TNPB 3FB3A 1PO22 3OG2A 3JD72 4UAPA 2PRQA 2Z79A 3U14A 5F1RA 4QUSA 3SH5A 2VNGA 1W8FA 3M3EA 2OXBA 1W8TA 4XF4A 4ES8A 3H42B 1H2KA 1EAH2 2GALA 2HKXA 2W9XA 2OQ7A 3KT7A 3R05A 5GZCA 2F8HA 3LPFA 1IGBA 4AR2A 1X33A 1GU3A 4XFCA 1F31A 1KRIA 4H7LA 4DINB 2BQPA 3BODA 2BZDA 4AQSA 3B9IA 1F2NA 5CFDC 2FDKA 2PCUA 2ADDA 3NH4A 1WCSA 4PPZA 2D4PA 4LO5B 5T5JA 1CBXA 2NN8A 4HNWB 4HNYB 2E7AA 2AFOA 3AXDA 1RJ8A 5IVBA 4J1XA 1CP6A 1ODMA 2QQMA 3D68A 1NXMA 2LROA 3MFCA 4HANA 1ARLA 3K3OA 4AEDB 3POGA 3H3ZA 3S6HA 3T8WA 1RB8G 1WGPA 2WR9A 3KF5A 4BQ3A 5FY0A 2JDAA 2XLGA 4Z92B 5JI7A 3KHXA 2CTVA 2NYQA 5HV4A 1ON0A 2QYVA 4CEYC 3RZJA 1YC61 2ZJCA 4E9KA 4EWDA 2VI7A 3EO4A 4GB33 1Z8TA 3T2OA 1TF9A 3SNMA 4A2ZA 1IZ3A 1U0AA 4FOVA 4UW4A 2YUEA 5A1FA 5FMCA 5A3OA 4CEWC 2C6GA 3GALA 4DXSA 4FAGA 3QD6A 2ZX3A 3VBUA 5CG8A 1S55A 3NQHA 1O7FA 1SFYA 1WMFA 1GNZA 3U37A 3OF1A 3ZSJA 1BHGA 4XFAA 2J22A 1LHUA 1W2OA 4EROA 4Y24A 4ZY1A 5C82A 1X36A 2RM22 2VZUA 4XPDC 1H4GA 5LYDA 2ZEXA 1W6MB 4QM8A 1O59A 1X8MA 3V0AA 2Y38A 3HQXA 4DMIA 1X9PA 4Q1PA 1Y0YA 4K3NA 4P08A 1I12A 4P4DA 4DUKA 1TEIA 1OURA 1QJU2 2CHHA 5B2GB 4K30A 3IU2A 3EFAA 5D1IA 1RMU1 5FPBA 4R9AA 3RMXA 3VBOB 3BTXA 3WZ1A 4QDQA 5FP7A 1ZO0A 1V6IA 3C7FA 5KR7A 3N7JA 3MIHA 3KHCA 5DUUA 2Q8CA 5ACA3 3NNMA 4DXTA 3QB8A 4W8JA 4BH9A 1S0GA 1Y9MA 4KWUA 3P2FA 1GYTA 2AFWA 1D2SA 2LUWA 4XXPA 1SHWB 1DP0A 1LOFC 2C9KA 2VY0A 2KCWA 4I2OA 4MCPA 4CEYB 1RTVA 4HPKB 4XMIA 1W2UA 4KGQA 1JUHA 1LR5A 3T3YA 1QOTA 4NJQA 1PNGA 5FZ4A 2BFUS 4IXLA 5LYFA 2ZEEA 2GANA 1GQGA 1RIRA 1RUD2 1WMEA 3G7DA 3K2OA 4G4FA 4LHKA 4U36A 1SCSA 3ZYGA 2ZXVA 4UW5A 4OQ8A 1O8PA 3SITA 1WA4A 4ZZ8A 3NH5A 1K12A 5F39A 4OI4A 5DN2A 1EV11 4BD9A 2A7AA 1AR72 1OT5A 4JQRA 5C3RA 1IPKA 1ZLIA 2G3AA 4EWEA 1RJ7A 4GZ9A 2R041 3ACHA 1UAIA 1SG3A 4Q0PA 4CP9A 2W47A 1LB2A 1Q2CA 5FZMA 5KTCA 5FMOS 2Y34A 1U5ZA 1YREA 4Q4X1 1UKGA 2PLV3 1B35C 5KHIA 2PQ8A 4UEZA 3VH9A 5J8FA 2ARBA 2XGXA 4RHV3 3W6SA 1RHI1 4Y49C 1NZCA 3BKZA 2CNSA 2OQ6A 3OGSA 3TOJA 3T0BA 1UPSA 3WHTA 5FY7A 5L9RA 2RMU2 3GYDA 4H55A 5T52A 1NE9A 2PIYA 2XLFA 2XBO1 5F5AA 2WWUA 3VBSC 4FFGA 4TSVA 4BCUA 3E5QA 1LHNA 2Z2SB 3RZKA 3NAPA 3WUCA 4EN7B 5J36A 1F8VA 3H8UA 4AFBA 2JJ6A 2ZMLA 2DBIA 2YU1A 1UOJA 4FOQA 5C71A 1PCAA 3I3MA 5JZGA 1MQTC 3OEBA 4CDQC 4E8CA 2DDUA 1OF3A 2P6CA 3PLQA 1QY4A 1TQ5A 1MPXA 2WNUA 5IT6A 5JXIA 1YNAA 5IWFA 4AYUA 1RUC2 4NHMA 4OLLA 2KA3A 4BMBA 4BQ1A 3IPVB 5C4WB 4MFKA 4CYQA 4XF3A 4I49A 1RUE1 2JLMA 3MLJA 4EZ4A 5JWPA 3KCYA 2PLV2 3RFRA 2XJPA 1QSMA 3R9FA 4QC6A 1PO23 4BB3A 4QD2A 3KD4A 1G9CA 2C0ZA 4DEVA 2VH9A 3WT4A 2QQVA 1QJY3 1RGSA 5F2WA 2O14A 4IESA 4D0QA 3A9LA 1WCUA 3VUOA 1TNFA 4KH9A 4CCLA 2BO9A 2X7BA 4IV1A 1UY2A 3MIBA 1NE4A 2R6QA 4BU2A 4JHTA 3POFA 5IJRA 2BRTA 2PTMA 1ZRIA 1UYPA 3DL3A 1DLLA 5LBEA 2XVLA 3VB9A 3W58A 4YZ2A 3V0BA 4ATFA 2P3YA 2PJ5A 2Q7SA 2C27A 4RHV1 4LT5A 1ARMA 2JDPA 1HRV2 1HXS2 3EY5A 1CX4A 3JTKA 1GSLA 4RFT0 4IUGA 3WCRA 4XPDB 4AQ2A 1M06G 3KMHA 1V6KA 4O23A 2ILMA 2R49A 4CTEA 2VEZA 3MN8A 4GS4A 4RI1A 1JXNA 1D0HA 4GQ7A 3UESA 4RR3B 4CVUA 2PHXA 5M0TA 1SLCA 3ES4A 2XKPA 4QX0A 1AR61 1POV0 3FHAA 5CFDB 5JCTA 4P9YA 3WC6A 4GWNA 3MV11 2RG4A 4AI8A 3E6CC 2WKKA 1T6BX 4DNCA 3KQZA 3FUOA 3A0NA 1J58A 4KQ7A 2VQAA 4P9XA 1AYM3 3JXSA 3PUSA 3WNOA 3CZXA 1UZYA 4OFGA 1KQRA 3AVRA 3JQXA 3OUIA 3PL0A 4E4DX 5JSOA 3SISA 2QQJA 1AR83 2PQQA 1M1DA 3MRUA 4NXYA 1S1AA 2ZTNA 2IXHA 3BOPA 4HXCA 5C3OA 1HDUA 3WQBA 1FMD1 3CEWA 4GXLA 4JGYC 4Y20B 1JYXA 1LAMA 1FPN1 1TME3 2BOIA 2VJXA 1JZ8A 5KHKA 4PDWC 4GWJA 3EQEA 3LFIA 4QPIC 3GJBA 5ABJA 5DABA 1YJLA 2VNRA 3WNPA 1JYTA 2FBEA 4X8NA 5HV0A 4LKFA 1DGWX 1Q8SA 2W95A 3ZYRA 2HEYF 4TWTA 2Q51A 4K7JA 1V70A 4QDRA 1BEV1 5A27A 1A8DA 3PBBA 4M6IA 2C9AA 4UF4A 5LK7B 5C3SA 3H9AA 1VHEA 2IWGB 1ULCA 4R9CA 1N1SA 2ZS6B 5FZGA 2VPVA 4CAXA 5FR3A 1US2A 2ZMKA 5KXBA 4FTBA 1UMZA 3I8TA 4MADA 3GBWA 2K5TA 3UV9A 3M3QA 3WQ1A 1DQ0A 4Q29A 2RJLA 3NE7A 1QJZA 1H0BA 1AYM2 3BU7A 5IB0A 2HWF1 3BLNA 3PP9A 4AXVA 2HQYA 4FAIA 5C8CA 5THWA 4AVBA 1F2PA 5SV8A 5BUVA 3PB6X 3FN9A 5L7OA 2QQOA 3OYWA 4K1ZA 4RGKA 4Z07A 4CSWA 1QF3A 2PHLA 3I2GA 5FO8B 4WWVA 2O28A 1HV0A 2JDCA 3MPBA 1DTDA 1S7LA 2MPFA 1PGW2 2POKA 3CXPA 1T2XA 5EJZB 1ELMP 1XFOA 2ZENA 1ALYA 4CEWB 1H1AA 1HB1A 4CP2A 2DPSA 2EO8A 3BCWA 4LK7A 4TLFA 3J7HA 3ZJ0A 1OQ1A 3H8FA 4EJRA 1E57A 4LBOA 5A6YA 2YU2A 3NNFA 3OUJA 1AMPA 2EVXA 2YFZA 1XEBA 4PI2A 1XOYA 4Y5Z0 2W0XA 1BK1A 2FHRA 1O4ZA 1WKYA 4V2VA 2D4OA 4O61A 4R3LA 4PSXA 4UT5A 2GNTA 3RDIA 2P0WA 1S0IA 1DDLA 2VMDA 2WYFA 4Y5SA 3N5FA 4PHZA 1XE8A 2EF6A 4QPGC 5A1LA 1XPWA 3LMSA 2WS91 3CPXA 2IXKA 3DYPA 2ZW6A 1YIFA 2RR13 5D21A 5A3PA 4MHZA 4ZI6A 1IS5A 3I49A 5B4NA 1R57A 2Y6FA 4Z8BA 1J1TA 3RPQA 2CAUA 1V6MA 2WABA 2ZGUA 4NGQA 2CU5A 3AP5A 3Q8AA 3WCSA 4RQPC 4FTEA 3AM2A 1GOHA 3KSCA 4IE6A 3B94A 1JQGA 1VHOA 3M3OA 2VM9A 1R091 4MGYE 3H8OA 3SI1A 4PXCA 5FZBA 5C7GA 2RDNA 1OF4A 1HB2A 2O8OA 2WA3A 3M1HA 1W99A 4F9UA 5DDJ1 4NJRA 4Y1ZA 1JUIA 2QQLA 2J1UA 4NUBA 3USUA 2VOXA 1S0BA 2AR6A 3VBFC 3W20A 4ASMB 5FPUA 2EVNA 1L7QA 1U6MA 1TMF3 4F3JA 1S2EA 2WDBA 2REEA 3OD4A 4Q0VA 2A4NA 3ILNA 3PUAA 3PFEA 2W68A 4AL9A 3R9GA 2RS33 2XPJA 4X8PA 4EYUA 5DAPA 3ZIXA 2WYRA 5IK5A 2YDEA 4GM5A 2XEIA 1MS0A 3DEMA 1GQPA 4YM3A 4LKDA 4A37A 4OKOA 5I8YA 4R87A 5L7OC 5I8SA 2PXJA 5F7UA 4BQXA 2AFUA 3AKPA 2I07B 5FZ8A 4PK3A 2ES3A 1W6PB 2WAOA 3I7DA 1CZTA 4XFFA 3D3SA 4JYWA 1F4HA 3ZSEA 5J1XA 2MNGA 2ORXA 4QKDA 5JOYA 2WZNA 1V0AA 4HK9A 1OFNA 3JB4C 3ZSKA 4LOSA 1CJWA 4P44A 3VARA 1VAVA 4C8DA 2NYYA 4YW2A 3FX6A 4Y1UA 5GJ6A 3WP4A 1BPNA 2Q43A 2WN3A 5CFCC 3BI0A 3AKRA 4E2QA 1OBNA 4E4HA 4C0BA 4ZPIA 4Q8LA 1SLBA 4XJ8A 2W5FA 5K0UA 5KHGA 2XEJA 1VLNA 3OSDA 5H9QA 3UGGA 4EMEA 1NSLA 3HD8B 3O14A 3AB0A 4N7IA 1D7PM 3NW4A 3MBWA 4IL7A 3ZFGC 4QM9A 2A75A 2VBQA 2VMFA 4QPGA 4UFMA 3Q8BA 4PJYA 4N53C 3RO0A 4D6RA 2WIIB 4MGKE 1W0NA 3IDEA 2E6VA 4KWKA 3UT0A 2PVWA 2QBXA 3SXOA 4ZGYB 4NRQA 3LB9A 3VD3A 3CXQA 2QZ3A 2Q1MA 2VCAA 4V2WA 2GLJA 4ZXKA 3TRSB 1QOSA 2PR8A 4LQ6A 2P3IA 2OPKA 4QPYA 3E97A 2BWAA 2B5GA 4CDUC 4CAFA 2LS6A 2WC2A 4HSJA 3NMBA 4GH4A 5LK5A 4AG7A 1AR93 1I6XA 1G8WA 1RUG1 1SBEA 1S5KA 4UWIA 5DZEA 3VBSB 5J1QA 3CJXA 4Q0QA 4FAHA 4P10A 4EVYA 1GICA 3MFAA 4IUSA 3IM0A 3DPRA 4M6HA 4IAVA 4CPBD 1YFWA 2PHTA 3N35A 2MHFA 5DG1A 1H30A 5KXCA 1Y9WA 2I3CA 1R1A1 4UWJA 5EBVA 4OHYA 2ARHA 5BNPA 2GC2A 3WF0A 5D8AC 1E5SA 4AFDA 5SV5A 2FL4A 4FFHA 3I59A 4JQTA 2E33A 3OWCA 1SFPA 1FT7A 1PYTB 3VBHC 1ZRCA 1YFYA 4LLFA 1ENRA 2BL1A 4JGZC 2QQWA 4IV3B 4L11A 1C28A 4IGPA 1LULA 2DUQA 4LEJA 4XZPA 5F5QA 5FCCA 5TSWA 4EZHA 1XF8A 2C1CA 2ZEMA 4EV0A 1GP6A 1X7NA 2D5HA 1D4VB 2HWE1 4FXKB 3VZMA 5IVCA 1OH4A 1ZBA2 3B3QE 3SKVA 3LDRA 2Z0ZA 2VXRA 2YG0A 2VOVA 3U07A 3BN6A 2OOTA 2JB8A 3LEGA 1V9U2 5F2SA 4XQ4A 1PX3A 1W05A 3FWEA 4XQWA 1LRZA 1JYNA 4LA2A 2NZ9A 4JGYA 4MGQA 3EXNA 2BBAA 3MF9A 5AG7A 4QX8A 5I8TA 5DS0A 3AP4A 3FE5A 3ECQA 4PT6A 1DGWA 5K9YA 2GZWA 3RQ0A 3KLSA 1DIWA 3NKGA 4K6BA 4S2DA 5CVRA 1J59A 1I3HA 5FAXA 4WV8A 4LBQD 4ZYQA 3HIFA 2B4KA 2OPWA 2Y60A 5EXOA 1VIWB 4P5YA 5FYYA 1L3JA 3LOIA 5J96B 5GZEA 4C7IA 3HLPA 4YM2A 4W65A 2L9LA 3B9CA 4AGVA 1E5RA 3LA2A 4FQ4A 3IAQA 2X10A 5JVVA 1RUF2 3RYRA 1WW7A 4AHYA 5BNOA 4HVQA 4Y4RA 4P6YA 2FDIA 4MH0E 2WFF2 3WF4A 5JOWA 4UOJA 5CBMA 3WVJA 1MS9A 3A21A 3VKMA 1O3SA 4CPAA 3GB0A 3NNJA 1QOOA 3IDBB 2GN7A 5EV7A 3VV1A 3F5BA 5IK7A 1YLEA 1CIWA 1Q8QA 5JDBA 2JG9B 1C57A 3R0RA 3GKRA 4IEVA 1GZTA 4HSLA 3K46A 1YX0A 4E27A 1LU1A 1U5XA 5HH1A 4IEWA 1JZ3A 4WM8C 2Q4YA 1XE7A 4NAMA 5LRKA 4Q0SA 5EZWA 5FJKA 3LCPA 1PGW1 1OA2A 2AJ6A 2HB6A 4F0YA 2WNUB 4KG0A 1GP4A 5H9PA 5HXDA 4XMAA 2IZWA 3R6SA 1JZ4A 4ASLA 1QSOA 2ZHKA 2Z42A 3CHXA 2PJBA 2PIZA 3A7QA 1UU4A 1UIJA 4Y1XA 1JZ5A 4M3CF 5F47A 1ULEA 4CUAA 4MY3A 4JZ0A 3KGLA 5G1ZA 1CAWA 4NFRA 2DCZA 2G0BA 2HWF2 5DMYA 4PF5A 3IWEA 2RV9A 4OULA 3LDKA 2WFF1 1VR3A 2G9DA 1FYUA 3IB3A 2XKOA 3RJRA 3AZZA 2OH1A 2ZEZA 3FHQA 3IZOA 2YBKA 5EYYA 5H9SA 2FDGA 1AX1A 3FLPA 2ZEWA 2W91A 2YC2A 3DV8A 4XEZA 1D2QA 1CR7A 2AZ5A 2BGOA 5G05L 3POIA 1VBB1 3O1VA 5E96A 2IXLA 2IVIB 1S0FA 4Q4V3 2JDHA 3I9SA 3TX8A 4JDMA 1R093 3S6FA 3NJVA 4ASKA 3L2NA 4XJWA 4P4JA 4QKFA 4JXRA 2YNCA 3DECA 2HWE2 3EHKA 4GH4C 3N36A 4A95A 2DF5A 3I2HA 1LEDA 2Y6KA 5DXDA 1BJQA 4NIIA 1QQ9A 3ZXJA 1RUC1 5L7OB 1FMD2 2CNMA 2RJ2A 3V8IA 2VBPA 1XOVA 4BMHA 5LA2A 3NJYA 1IG3A 2ZHLA 4P9LA 4AVTA 5F09A 2AENA 2PQSA 3O5SA 2JDNA 4DFSA 3BYWA 4FT8A 4COZA 1VBA1 1CZVA 2ZAHA 2PR1A 1ZBA1 4I02A 4S2GA 3SMHA 1US3A 1C5IA 3ZYJB 2HC9A 1OA3A 5E8AA 3SCFA 3F95A 4QBJA 1HJGA 3MF6A 3NV3A 3BU0A 4HKOA 5FBZA 3U75A 4XHXA 2Z10A 2A70A 2PAKA 3CJIB 3SEEA 2JDUA 5CEHA 3TE4A 1W2NA 1WCDJ 3PTYA 5JPHA 1V6OA 1UIKA 2VCBA 4BLJA 1DGRN 4C0HA 1UY3A 4GALA 4M85A 4Q2FA 5FZFA 1OI6A 3ZFFC 1FNZA 3B3CA 5CFCA 4LHNA 1TG7A 4P4FA 1OOPA 1VMJA 4CA9A 1CWPA 4QQOA 3F2ZA 4AHWA 1RHI2 5DUXA 4ZU7A 4IEPA 4L8AA 1FOD2 3KGZA 5F5IA 3UJQA 1UNBA 3W59A 2E7TA 1V6LA 4QGNA 2VUJA 5ELYA 1QQP1 4OP4A 1QJX1 2OUJA 2Y64A 4DUWA 3V7ZA 2TNFA 2VG9A 2R061 4X6RB 5ANQA 1H6YA 2W1UA 3GLJA 1JOJA 1ZRDA 4B10A 4QXHA 5FWEA 3TC8A 3GZAA 1Q2DA 3ROUA 3FX3A 3JUWA 5A3UA 2ZEGA 1NCRA 2GE3A 3AXEA 3P1IA 1CN1A 4B5PA 1OUXA 2R0FA 4WVZA 4YLZA 4LBQB 3N9OA 1RVF3 4Q26A 5L36A 1NY71 2G1MA 2R072 3V0AB 3IGRA 3A23A 3BJ7A 4OI1A 1R081 5JXGA 2FIAA 3KVAA 5FUIA 2P6FA 2RJKA 5JR7B 5LBCA 3WQ7A 4COYA 3T9YA 1YJKA 2CF4A 2Z4FA 1RUJ3 1R1A3 1H8TB 2DF7A 3E5XA 2ZGOA 1OUSA 3NVCA 3WD5A 1AX0A 1CP7A 4AVAA 1W9SA 2RDSA 4ZKTB 4OIDA 1FPN3 1TME1 4IGQA 3AK0A 1X12A 1NA1A 4KU7A 5LRRA 3SEPA 1RC6A 2WWJA 4BA6A 1L7RA 2QMLA 4B5PB 2B45X 5BWAB 2ET1A 3VKNA 1AR81 1NG0A 4KWJA 4E8OA 2ZMNA 1K42A 1N3PA 1C1LA 4A7ZA 3ME2A 1M4DA 3SH3A 3TEZA 4MGTA 3VBOA 5I4MA 3M70A 1BAVA 1R43A 1S7NA 3KVBA 4FPKA 3GHNA 5E89A 2LW8A 3MUZ1 4MRIA 2WNEA 2ZEHA 1LOKA 4BQYA 3ETQA 3PRTA 3BB6A 4Q4X2 4DS0A 3PZJA 4CU6A 1GWMA 1NLQA 3POYA 4AAXA 3DNSA 1PZ8A 2XHNA 2VZZA 2A3XA 1H1MA 2E63A 1TNRA 1WCKA 5CADA 4HVOA 1PK6B 4ZU5A 3SHPA 3W91A 1SQHA 1KFXL 1JYCA 1IY7A 2D6LX 3AYCA 6CPAA 1FV2A 2JE8A 1SBDA 2JIJA 2R32A 1PZ9A 3IKWA 1S0DA 1ZRRA 4L99A 5DUVA 1P4NA 3DGVA 3KI9A 3DKQA 1WW4A 2XQRA 3H3LA 1NOVA 3J8F3 1TVGA 4B1MA 1XJOA 4NGPA 4KUBA 1SPPA 2YNCC 5K4LA 3BVCA 5C33A 2G9FA 2OZGA 3SCGA 4MHPA 3GGLA 4JRAA 2AH2A 2OB0A 2JDMA 3AL5A 4MXUA 2J8MA 1VRH2 3OBTA 2X09A 3ZM8A 4MHYA 4DRRA 2ZA9A 3LAGA 1RUH1 3IIIA 5IVFA 4ONWA 4GIQA 2D97A 2BNNA 1YMEA 3AMQA 1AZDA 4XXAA 4IE5A 4BPZA 1CG2A 2D6PA 4A7KA 2X05A 1UYZA 2JEVA 1RUOA 1EPWA 5GZGA 5IB9A 1JYVA 2VTXA 1C3HA 4MGSA 3POBA 3AC0A 4MHDA 2V4VA 4QDSA 3MYXA 3U1XA 4YFJA 3CIHA 2WZR2 4XJAA 5J37A 3QNVA 4EN6B 1NE6A 2W92A 2FE7A 3ZLIA 3JD71 4I3GA 1HLCA 5CIRA 1UX7A 5I0UA 2QQIA 4F6AA 3SJFA 2X5IB 3ZPYA 1GR3A 3PVBB 5GZFA 3TTHA 4EN9B 2RM21 5FZHA 3OPWA 1S2BA 3WXPA 4BIFA 3QCWA 4RS2A 3PGPA 5LEKA 4M0NA 3PNAA 2VCMA 4LBNA 1RUG3 4RQPA 5FYUA 5HCFA 1AYM1 4NGTA 4WVMA 2D6MA 2VECA 3ZFFA 1JZ2A 4R3KA 2EXIA 5IW0A 4ET7A 3PIGA 4UFXA 2GU9A 1ASJ3 4HMZA 4K40A 4MUVA 4ARXA 1VB2A 4IE4A 3ZDVA 3K9UA 2DPTA 5C4WC 4GA9A 1Z4EA 4HK8A 3DPRB 4QHOA 3RWKX 3WW1A 2VXJA 2Q04A 1HV1A 2HWB1 4OMDA 3D7FA 3KR4A 3AZYA 3MIGA 3T0DA 1XYNA 1OA4A 2GSYA 2ZKLA 1CGPA 2Q8OA 1S7KA 1NUKA 2YC0A 2HWC1 1H8TA 3ZXKA 1HN0A 5FZOA 2VGDA 1N71A 4PBOA 4IF5A 1HRI3 4A4AA 2Q44A 4CGPA 5FXWA 3RBUA 4P00B 4Y22B 5JMOA 4IE7A 3SXWA 1BEV2 5FKCA 2JD4A 1QJX3 4GMP1 1YYNA 4CCMA 4LOTA 2WPWA 4CUBA 2K9ZA 1LU2A 1ONAA 1WUVA 2CDPA 2GC1A 3LEMA 4XDQA 4H89A 2GDFA 4UCNA 4C2XA 5DZFA 1YQ2A 1F2OA 4XCBA 4HETA 2VUAA 4E8DA 4XF0A 1RO5A 1RUE3 3C2UA 5A6XA 1TKFA 1WD4A 4H14A 2UURA 4OC1A 2Y6GA 2WZR1 2J1EA 5FIXA 3OYWB 2OW4A 2VCCA 2YV8A 2GC3A 2RR12 3K3NA 4KG8A 1R1A2 4EWAA 2R30A 5GLTA 1PO12 2YZ4A 4QPGB 5F3EA 3LOBA 4UFKA 1L0CA 1SLIA 1RUD3 4Z2AA 5C70A 5I0RA 4CCDA 2ZEPA 4CDQA 2ENRA 4CU8A 1QSRA 5IATA 1N3QA 2WT1A 1UW8A 1MQTA 1RUJ2 4XABA 4XUQA 5DPNA 1BBT3 5FJHA 4AK3A 4BXSV 3HBZA 1AYEA 4XTPA 1AL23 3IEHA 3I1UA 1JU3A 1QQP3 3FC0A 1LAPA 2QIRA 4Q0UA 3PVEA 3J4UH 2Q30A 3VL9A 4A42A 4W6YA 4XFGA 3ZMNA 1HXS1 3P5BA 3WP5A 1ND2A 2BDRA 4NRMA 3T2TA 4A94A 4XHBA 2YNDA 2J1TA 4NE9A 1CAVA 1DCSA 3V65A 1MZ6A 4CRYB 4META 2GH2A 2VQ0A 4PXEA 1FNOA 1GWKA 1AUGA 2EXHA 3IAPA 3SQOA 3WEZA 2CSGA 1VIXA 4FD4A 1RUF3 3U11A 1YIPA 4RQPB 3NA6A 3D5OA 4LKEA 1B35A 1HN1A 2RVAA 3AYAA 5BNOC 1O4YA 1ZRFA 2JENA 3POEA 3ZN5A 3LEKA 4NOTA 2FD8A 1CESA 1XNDA 4OHZA 4L0PA 3D8PA 1JN2P 3J7LA 3B8GA 2YC4A 4XBNA 3HBKA 2Y0OA 2PRBA 1XNKA 3BGAA 4R76A 3HWJA 2AGSA 2UWBA 4OQ9A 1IOAA 4QKBA 3VBRB 1QKQA 4NPMA 1MZFA 3RZGA 4D8MA 1RUC3 3W5MA 4U9YA 4CPBA 5BNOB 2X5IA 4AEMA 2D3RA 2WO1A 4LKSA 3WNMA 2R7HA 1ZREA 4SLIA 2FQPA 3CNAA 4A44A 3QOPA 3MICA 1LHVA 3CLPA 2Q0YA 3M8LA 4B13A 5A7SA 4XF1A 2VZVA 2A1XA 4UWDA 1Y43B 4URAA 1VRH3 4S2FA 3B2YA 2QJVA 1W9TA 4FFFA 1FT9A 4UXAA 3I97A 3V56A 1GZWA 1TZOA 3TO7A 1JHJA 1VBB3 5T50A 4NGNA 2F6BA 2UYBA 1VGYA 4J25A 3H7YA 4MXVA 1RUI1 1GHEA 3O12A 4AFMA 2PC1A 4MCRA 4FPJA 4N7UA 2CYFA 5BXXA 1Z5RA 5F48A 1ULDA 3IWGA 1XNBA 1ZZ6A 1OQEA 2V73A 2A6ZA 3A22A 3IMMA 2WNVA 4HVRA 4MXWA 4D7YA 4F0XA 1H4HA 2WLPA 5CKMA 1HEEA 2G19A 1QXRA 4MGIE 2BCOA 4UFLA 4Q7AA 2HWE3 4CE8A 2J1AA 5JH9A 4PBPA 2ABZA 3VDAA 4OUSA 2R063 2PJCA 1UMIA 2B8MA 1VBC1 2WZR3 1DYKA 3CL1A 4LMFA 2QDNA 1LGCA 4QX1A 4BM8A 4YSFA 1R3NA 4UEFA 4FBEA 3ZOIA 2ZGKA 1JI6A 1R083 4DY5A 1ND3A 1CD3G 1EV12 5ISVA 1OLRA 1X9TA 2BEOA 3UJOA 5A33A 4CU9A 2DV9A 3L9JT 3CPAA 5DWNA 2XG3A 5CNPA 2W08A 2VO5A 4R4XA 2VU9A 2OKXA 3VBUC 3AL6A 1RUD1 2FDJA 3DR8A 4W6WA 3ZFEC 4DY3A 2FMYA 2D98A 1Z78A 2JEMA 3OEAA 4K1YA 4LIUA 4X6QB 5FZEA 5JXHA 2FIWA 1Q8VA 2ZHMA 4QX2A 5K7PA 2DURA 1AR82 1YI7A 5IX3A 2CWMA 1OZPA 2OZHA 1W6QB 4OC5A 3NRUA 4A33A 2D7FA 3ALQA 1JW6A 1ZA7A 1RMU2 3BALA 1JBCA 5IYYA 4ARYA 3JB8A 5DWMA 2W52A 3ZFGA 5FXVA 4CXYA 1CPNA 3ZXAC 4BQ2A 3QAHA 3D67A 3KCCA 3PVNA 3ZXDA 4CDWB 3S5AA 2UWAA 3ZX7A 3RNSA 1UX6A 2CGNA 1ZZ9A 3WW3A 2ZEOA 1WW6A 2VULA 1UOFA 5K0UC 4H6UA 3APBA 3Q8FA 4M3CA 1PM4A 4FP3A 4GULA 1F35A 1R082 3F0AA 2RS52 1EV13 4YFWA 4KNCA 1CJPA 2MEV3 2WA4A 1N1TA 4YM0A 1KS5A 2QDRA 3AVSA 3WF3A 3JZVA 4YGEA 1YGHA 2XUMA 4LBQA 3D7GA 4RFRB 1F5FA 4AI0A 5A7OA 4A3XA 5KHJA 2JG8C 1PK6A 3HMYA 4AFCA 2RM23 1PVXA 2CNAA 2XWBB 3CDZB 1LOGA 3IDAA 2NSMA 1ODNA 5FPZA 2P17A 5HBAA 1Z8LA 5FYSA 4Q4Y3 5DDJ2 5HXVA 2A6XA 2NP0A 4C68A 3GUXA 2EICA 4PQQA 3O0WA 3KZ4C 2HWD3 5CKQA 3S6PA 3USSA 1A34A 1CVNA 3IIAA 4CDXB 3G3SA 3LODA 4R57A 5LA9A 1ASJ1 2QVPA 5E6HA 4YW3A 4TNUA 4JKMA 2GNDA 4N53B 2ZW4A 4ZS2A 2XMLA 1VMFA 3QH6A 1LTEA 1GNHA 2WRAA 4RSUA 3QACA 2W87A 5GCNA 1GZWB 3K77A 4HONA 2X29A 4LUKA 5FMDA 1DYPA 2EXKA 1H2LA 2MEV1 1XNAA 1X10A 4FVVA 1OQDA 1YXWA 3MZHA 3KM5A 5IUQA 3D2MA 2B7YA 2WS92 3ISXA 2BU9A 1YHFA 3WG4A 1MS4A 3TBDA 2ZZQA 1ZLHA 1OOPB 5HI0A 1AR91 1JZ7A 3NKTA 5HCBA 4N43B 1IIDA 4RGGA 3PB7X 5LWBA 4UA3A 3TT2A 2R98A 2P3JA 2BUKA 4IEQA 5A7WA 1XE4A 1EP0A 1QWRA 1G9BA 5ABJB 3THCA 5A32B 3VZLA 1PZ7A 1W8WA 3AP6A 3H7JA 4L9BA 1ACCA 2EUIA 5IFPA 3ENRA 3H1WA 1GP5A 4PIXA 4Q27A 2EK8A 2DFCA 2Z3MA 2OZUA 1DF0A 4M01A 3GIUA 1W6OA 3NWKA 3MHZA 3LA7A 3PU8A 1YQEA 3W6XA 3BIWE 1V9U3 2EIEA 1HB3A 1RUH3 1FXZA 2JWPA 3JU9A 4M3CB 5IVJA 1PU9A 5IAVA 3TAYA 3B3WA 4P4IA 5BPXA 1GYKA 3ZXEA 1IPSA 3RZZA 5A1AA 1UKRA 2GMMA 2ETEA 2P5BA 1DE4C 4LUAA 2ARAA 4Q4V2 5FZDA 2CNTA 1R092 4MXWB 2AC1A 2FDFA 1XYOA 4XQDA 5FP3A 4LXLA 4RHV2 1QH6A 1UY4A 4QT6A 1JOPA 3MO4A 4CCKA 2OU2A 2ZEYA 4KVOE 2E31A 2Y26A 1MS3A 4PLMA 4YRHA 4CDWA 3LFMA 3O7OA 5AC92 3O1SA 5FY1A 4XJUA 2FDHA 3ILFA 1WMXA 3D2PA 3U0ZA 5GM0A 2QCSB 1W04A 1SZBA 2RS32 1S2KA 4TLGA 3PB9X 4OAEA 1OD5A 4KGGA 5CB7A 3UETA 4IK2A 5FVJA 4F8ZA 2PE3A 3ILRA 1AXYA 4HOOA 4KOVA 5FBJA 1DFQA 1UN1A 4QB1A 4E0AA 4FPGA 4CS0B 2RMU3 4CDXA 1VBE3 5FUNA 3SLIA 3O1RA 3DXUA 4B11A 5H86A 1DZQA 2O8QA 3ZPOA 3MV01 3OBZA 4YPJA 5DZGA 4BHPA 3R96A 3WF1A 3B7MA 3H1YA 2CTBA 4JWPA 3JBG2 4QWNA 1GANA 3ES1A 1A3KA 4WVMB 2AYHA 1W2TA 3B5LB 3VKOA 4AWDA 1CONA 3D8CA 4LHLA 1DQ2A 1VB4A 2PMWB 1OOPC 2XQXA 2DVGA 3J7MA 4COWA 2FCKA 3SCHA 2I00A 3LWCA 4A3ZA 1M4GA 4WJBA 4R9MA 3PURA 1FY7A 2GIVA 4F8AA 2B3UA 4M6GA 3B01A 5ACA2 4URTA 5EJ1B 1RUF1 2PJ8A 3L2YA 3ON7A 3RRDA 4D94A 1S0CA 3N9QA 1WZXA 4IEUA 2DVFA 1Y4WA 2ZCWA 3AP9A 3R4UA 4NVPA 5FRAA 2Q4VA 4PDWA 2VQTA 3AYEA 3MDPA 1Z7S1 1HW5A 2J42A 1HQWA 1OFSA 3OGJA 5EHDA 2ARCA 4NGRA 2I79A 3S6GA 3CZUA 1M4LA 1IB1E 3SI0A 3OPZA 4BISA 1RVF2 5J3UA 2H6BA 5A6ZA 1IS4A 3FJSA 2V09A 4PLNA 1BVP1 2PJ6A 4MFZA 2NMOA 4YVSC 5FPLA 2IJZA 1RYYA 1MZEA 3INAA 5FOJB 4MY0A 2VBDA 3I3DA 5T5LA 2Q1FA 3ZKUA 5FLIA 1FX5A 1NLRA 3AYDA 3G6JB 1ND3C 4I09A 2PHWA 2QFEA 2VW1A 3OGGA 4INDA 4RGAA 5LASA 5K8SA 1YVKA 2F7VA 1FNYA 2OS2A 4LBMA 1M4IA 4YG3A 5HCAA 2ZW7A 1HRV3 4XUOA 4CYDA 2CL2A 2YPDA 1FPN2 4IV3C 5CPAA 4LUMA 2A3YA 5DAQA 4YZ5A 3FEEA 3IIBA 1O91A 1UY0A 4AGRA 1LODA 3MLLA 2YNEA 4CRZB 5LBFA 2Z3LA 4HZFA 1VBC3 4WM7B 4KL1A 2DVBA 1EYBA 2BVVA 3WINE 4Q38A 2VOKA 3JQWA 2A3WA 3D7DA 4PQ9A 4PQAA 2AACA 4R8HA 1PX4A 1NX9A 3FMGA 3PUIA 4O65A 3S6KA 5GZDA 3H8GA 4BQWA 3BPZA 2G9ZA 3D6EA 2G4IA 2ADEA 3CKHA 3U78A 2OZ6A 4EE2A 1X50A 4I0WB 4NO4A 5F8PA 4UFJA 1AR62 3KR5A 2Y0IA 2OA2A 2ZHNA 4DQAA 1J4JA 1SBFA 1MK4A 4PSWA 5IFTA 1YLLA 2UYAA 3NNGA 3RZAA 1DU3D 1LOFA 4Q1RA 1ZBA3 1RINA 3HAGA 2PAEA 3L2HA 4PF1A 3E0KA 1G6NA 1R64A 2P3KA 2Q0AA 4G3YC 2KR2A 1C8M1 3ACFA 2FCUA 3T0AA 1G9AA 1Z8WA 1ULPA 4ZZ5A 1JZ6A 1XSRA 1AJOA 3VKLA 2D6OX 3TO9A 1Q5OA 1H9PA 3OUHA 3BTAA 1AF9A 2RMU1 1Z9UA 3D0SA 1S0JA 2ZEDA 1H6XA 3ATGA 4CP9B 3IC1A 2PVVA 2ZBJA 1IG0A 4RS5A 5GALA 4AFAA 2WPXA 4XFBA 2JE7A 3VHOA 4BWOA 3IU1A 4YVSB 2JKXA 3QLQA 4MHNA 1KITA 2RB7A 4Q4V1 3O1UA 1I9RA 1COV2 2GNBA 3WNNA 4OADA 4OCTA 4OUMA 1UXZA 2GP3A 3FBMA 3B69A 3HNMA 4XTMA 5FP4A 5A3NA 1CX8A 5JM6A 3UKTA 1W06A 1HB4A 1AR71 2PN5A 4JV4A 4C1WA 4Y5TA 3N7ZA 4KOSA 3VL8A 3PJQA 3RZLA 4Y49B 3QH7A 2FZ2A 1Z2LA 2JXAA 1QSNA 4QVTA 3UGHA 1UY1A 1U5YA 2K0GA 4LLOA 4MOAA 4Y26A 4J1WA 3UKNA 3ZSLA 3FF3A 2IL4A 1OXCA 1L7LA 2VBBA 4M3SA 5JZGB 2XXZA 4CCEA 5J7MA 2EXJA 3OOXA 5IVVA 2R8VA 1LGNA 3TB0A 1UPIA 5T55A 1NAEA 5FREA 3R1KA 4B6ZA 1QXPA 3VD7A 2ZEFA 5JUVA 4B4RA 4X3RA 2VNOA 4NAOA 3NH8A 4CDXC 4JJXA 2DYCA 1OLQA 3LIGA 1KUYA 5EP9A 4O7XA 4QX5A 5C88A 2X8KA 4OZXA 1XB9A 5FZ7A 4F7ZA 2ZGPA 3LEIA 2E9QA 3OY8A 2V8GA 5EC4A 1A8MA 1KJLA 3B35A 3TNQA 4YZ1A 4Z82A 1ENSA 2ZABA 3HNBM 3T2PA 4CCJA 2J8RA 1SEFA 3MI8A 4O9EA 1IQAA 4Q4X3 4MJ8A 2OZJA 4LNVA 2V8DA 5JIAA 3KHBA 3POSA 3GNEA 3DN7A 4BQ5A 1I1DA 3AMPA 3VD5A 4M0HA 1W8ZA 4CDWC 1UZZA 1KUXA 1POQA 4COUA 2WSVA 2YMZA 4UBHA 1IQDC 2C1FA 1C8NA 4QQLA 5L73A 3RMYA 5C8WA 3TEWA 1I21A 1VHSA 2XEFA 3FL7A 4K8FA 1W3XA 3N9LA 3RVHA 3K4DA 4G9SB 4WM7A 5FYMA 3WDXA 2GFQA 1YQCA 1QNYA 1UWYA 4L89A 4X2TA 2OT7A 4AAPA 4LO8A 4AGGA 5F9TA 3WSOA 4AXOA 2ZZJA 2GC0A 4YVSA 4JGZB 3OBAA 1PM7A 1WLTA 3NAPB 2JB4A 3T09A 4F9VA 3I3BA 4Y1VA 1K3IA 4HPKA 1H8TC 1GNYA 1H2MA 2BPA2 3GCXA 4OMEA 3GXUA 3JVNA 2IXCA 1H2NA 4OUEA 4GB32 1W8NA 2V77A 2BVBA 4AI1A 3OGRA 4XUTA 5LY1A 2K46A 3KV6A 3FJUA 3HN3A 4YM1A 4CDUB 4UCMA 2JEWA 2XWJB 3VHPA 2J9AA 1BZWA 3PDQA 3J7NA 4OHWA 3URFA 3D3AA 4QQ2A 1KXGA 1ENXA 3M4FA 4XDOA 3ELNA 4KBZA 1AUYA 4BJ0A 4MSVA 3VBOC 5AG5A 3GBGA 4YGDA 2H5MA 1J84A 4LE4A 5FY4A 5IK8A 2VUCA 3HN1A 3WT3A 5F37A 1QJU1 2A6VA 1G9FA 3FHIB 2GREA 2RS13 2ARXA 3WG3A 5A70A 1PHMA 2EWBA 3OBRA 2W94A 4RN7A 3E5UA 3KT1A 5E88A 2D40A 4FPFA 1ULOA 3RYPA 4HKLA 3IFEA 2CGPA 3R4SA 1WLCA 1I5ZA 3T4VA 5JI9A 3SKJE 4E2AA 5EIYB 4NIHA 1Q2YA 4ITCA 1GV9A 1NXD1 3KS7A 3P3NA 5IVEA 2AFZA 2RS11 3WDWA 3QAYA 1VBC2 1NMTA 1HQLA 3DGTA 4AQTA 2K2SA 2AFSA 3T08A 1AR63 2ATFA 2WNVC 3C3VA 3J8F1 4RS5B 3KV4A 1AX2A 4QX7A 1SLLA 4UBGA 4MV2A 1AYN1 1LJ7A 4M4PA 5C8CB 1TXRA 2XH6A 1DQ4A 4UI9L 4OI0A 2EBJA 2E53A 5FZOB 4ZU4A 4NSQA 4JRLA 4RA0A 1MVEA 4K8RB 3IWZA 1YI9A 1ZZ8A 1IYKA 1PIV2 2JBJA 2VOWA 1E5IA 1FV3A 2ZGSA 4XVHA 1W3VA 4R52A 3VGIA 2GN3A 5FOBB 5K8MA 1POV3 1MZ5A 2F17A 1W0PA 3HEIA 4A30A 4LJHA 2Q4ZA 3M3IA 4RN5A 4BLIA 4TN7A 4OZOA 4AE2A 1N3OA 4Y20A 5FPAA 4JDNA 4R9DA 4XBLA 5LW9A 1C1FA 1FAYA 3JD73 4LO7A 3KQRA 2FCVA 5FK8A 3AZWA 4JX0A 1OSGA 1PNFA 2R0HA 2P6GA 4NR1A 2ANPA 1QNWA 2WO7A 3TWIA 2F5IA 2VUDA 4LBJA 1ZYBA 5FZ0A 1RUE2 1DG6A 3N7LA 4AF9A 4EQVA 1QHDA 2XJVA 4OC3A 3VHNA 4MZUA 5DUWA 5AG6A 2YROA 1YFUA 2ZX4A 4E4SA 1W6OB 5LB6A 5I91A 1YLOA 1AVBA 1WD3A 4ZX8A 3HR9A 4Q4Y2 5DDJ3 3SH4A 1G7YA 1COV3 2ZGTA 2BEIA 3OGVA 3MIEA 4P9WA 2IC1A 1UO9A 2WLQA 4K3UA 5J8CA 1PVC1 4D6QA 4Y1YA 5C3PA 3I4IA 4LIVA 4AVSA 4CYOA 1JODA 2RS31 3EJKA 1W9FA 1NKGA 4KVXA 2XL9A 1W9WA 4BBHA 5CU1A 1R1ZA 5JOZA 1UYXA 3GBFA 1J1LA 1VKCA 2BGPA 2ZX0A 4HPSA 1CAVB 2DU1A 1LEMA 2XLAA 3ZO0B 3OCPA 5AC91 3U4XA 1YCIA 2B4DA 2W2IA 5AC93 4ORFA 4XC9A 4JKKA 1YRZA 3H8EA 3RS6A 5L9VA 5C8CC 2VZSA 5ISLA 2ZELA 2OVUA 4BZ4A 4GXHA 1PK6C 4FPHA 1MEC1 1D4M3 3M3CA 4GH4B 4AVCA 3VDCA 2J1RA 3V64A 1MJAA 3AZXA 4Z65A 4B14A 1KDMA 5IV0A 1F4AA 2CV6A 3EC4A 5FZLA 2PLV1 3LF7A 3ZR5A 1C5HA 5KTDA 3P3PA 3WDUA 5FPXA 4YWYA 4FFIA 3R95A 1W90A 5CKNA 3W5NA 2UY9A 2QECA 2J8NA 2PSWA 4MFJA 4XCAA 1EUTA 2VZ3A 5JR2A 4R4ZA 1J3RA 3LIHA 4EN0A 5A32A 2VZ1A 4KOWA 3PU3A 3U4SA 2B58A 4YU9A 3S30A 1YFXA 3VDBA 1UZVA 4YGCA 4HBNA 3VLBB 3WY6A 2DBNA 5AFBA 1F57A 1ENQA 1O4TA 4OIWA 3D82A 2Z3OA 4NGMA 3C7EA 2CIJA 3FBUA 1SACA 1UFHA 1LCLA 1KS4A 1QDCA 2JDYA 3CJIC 4HLTA 4JZRA 1POV1 4GJZA 3UYJA 2C26A 2ET7A 2DUPA 3POJA 4YG0A 1NCQC 2NMTA 1ZBE1 3I2JA 3FH4A 4PDWB 4XJ9A 1LANA 4AG9A 4JC1A 4Q8KA 2QKDA 4XZUG 3FIXA 2PELA 1TME2 1V6JA 3WHUA 2Z5WA 3D4UA 4GWIA 2SLIA 4LBKA 3V38A 4RL7A 5F32A 1W6QA 4RYDA 5EMIA 1Q8OA 1XNCA 2OR4A 1URXA 3KT4A 4JTOA 4NGSA 1IHMA 1WBLA 4IHMA 5KWRA 4GB31 4K20A 4KOTA 3PVOA 4QB6A 5FP9A 2P4EA 2XR4A 4L2NA 4RS5C 5BYNA 3WX5A 1O3TA 1MJBA 5A33B 1DQ6A 1CQ9A 4CYNA 2VVEA 4H7MA 2Y33A 4UFIA 4OI2A 4LK6A 2H6CA 1S7FA 3K4AA 2ZGMA 4N8MA 1BXHA 2TUNA 5CYYA 1OBRA 1BQPA 3BUCA 3UL2A 2RHPA 5JPMB 4LHSA 3EXUA 1S0EA 2EAKA 1ZG7A 3OPTA 4D6SA 1K45A 1NCRC 2BFUL 2BW8A 2RDRA 3SI2A 4GKXA 1BLZA 3KV5A 5IAXA 4NF1A 2VVFA 5C9AB 3MGDA 5BNPB 5HCHA 4QPWA 3SJEA 1NYWA 4BOWA 2YBPA 3GZEA 5FUPA 4ES9A 2D43A 4ATEA 2OYZA 3SJGA 5FYZA 1QMUA 1IYLA 4II9A 5FYTA 4XAAA 2ZGLA 1PO13 4BQ4A 1DLCA 3WABA 1RUI3 1U12A 3CBNA 3K9TA 4FOYA 4L8QA 4CGNA 4CUGA 4XPLA 1VBA3 2GNMA 5F6LB 1W03A 3MEPA 3VDDB 3OY8B 2PHFA 3WDYA 3ZVXA 3NV2A 4HT1T 5BNPC 1QJU3 2WQ8A 3ISZA 4KOUA 4PK2A 4MI4A 1QMJA 1VRH1 3B3SA 1S4CA 2E32A 1XC6A 2ID4A 3EBRA 3VZNA 3M2MA 5JLVA 2B4DB 2Y8KA 5LYIA 1KJRA 1FOD3 1OD3A 4FCAA 4JGYB 3T2QA 3ZR6A 3CDXA 4YFZA 1Y7RA 2QTWB 1KFUL 1OLMA 1V00A 4LITA 1OVPA 5I93A 3ZFFB 1BPMA 4OYUA 3I2FA 3Q9OA 2WT0A 4YW5A 1PO21 3NSTA 2CY6A 2PYTA 2XHKA 4XE9A 4YARA 1EY2A 1NCQA 1KWMA 2HV2A 3D66A 2WO3A 5H9RA 1LOAA 2JDDA 2ZW5A 1WWZA 1OKQA 3ZMOA 3D7HA 1SDDB 3VZOA 1RXFA 4DUVA 1HKDA 2B3VA 3O1PA 2VZPA 3VD9A 5FXZA 4DNYA 2AFXA 4KLWA 2FZ1A 5FYVA 5LYLA 4C7HA 2CWSA 2XJSA 3D0JA 1AL21 3KKWA 1DGRA 1Z4RA 2WFF3 4NHXA 2HEWF 2WUHA 3ZYFA 1RUI2 3FMCA 1YQ5A 2VR4A 1LOEA 5CNAA 2XEGA 3OD0A 4Q4W1 3ACLA 1UXXX 2BBVA 4MO3M 3ZXGA 4FD7A 1KZFA 2VMCA 3J26N 1Y7BA 4JTNA 2Q8EA 4PI0A 3PJYA 1FATA 2E26A 3K4ZA 5HPOA 5LEJA 5B4XA 1VBD2 2VD7A 1OVSA 3MIDA 4E2SA 2YGLA 1ZA4A 3GZTB 4B29A 1N47A 1O6UA 4FSJA 4PXDA 2Z3KA 2P2KA 4N9IA 2AEZA 2B39A 2TBVA 2B9VA 5LA1A 3U10A 2VW0A 4F83A 5T3NA 3I3GA 2C6CA 1EAH3 1QJFA 3GHMA 5FZ3A 3WR7A 1BVVA 3WNXA 4UYBA 5CFCB 3VN4A 1DHKB 1PMHX 4K9SA 3O1TA 3TCVA 3AMNA 4MHUA 4A32A 4AW7A 2PHUA 4QQHA 3RJ2X 1K5JA 1O3RA 3TEXA 3WDTA 3K48A 4JGZA 1B09A 1JH5A 3RYKA 4GAZA 3WG1A 3VBHA 4B1LA 5KBFA 3I54A 2BOJA 1F9KA 5C3QA 1DQ5A 2W1QA 4JAAA 4WM8A 3WW2A 3ZYIB 5K0UB 4IEYA 2ZX2A 3N7MA 1MS5A 2XVGA 5FZIA 2DVAA 1P0HA 1Y0RA 3KL9A 3S9MA 5K8NA 1YSJA 2Y6LA 4NN0A 1ZZ7A 1Y3TA 3FLRA 2PFWA 4QGMA 1VP6A 2NQYA 3RWNA 4AG4A 3O1OA 1MEC2 4CCOA 2HWD1 4B12A 3P6BA 1P8JA 4QAWA 3RYOA 1KEXA 4V1PA 1TMF1 3VBFA 5JIUA 1HJFA 2PJ4A 2D6KA 1Q3EA 3GM8A 4XILA 2NPIA 2P1BA 1XSQA 4I0AA 4IEXA 2F4LA 3R9EA 2IXJA 4Y22A 5BNNC 5KXEA 3NNLA 4FQZA 5L19A 3ZDSA 3NE8A 1PIV1 4ZXEA 1U5IA 3ZYPA 4CDUA 5C6CA 3H5ZA 4AOCA 1UU6A 4XW3A 2HWC3 4P4BA 1LOBA 2QJ8A 1W2AX 1G86A 2I74A 2W39A 3H1MA 2FT0A 1AYN2 2DTWA 4DXZA 3ACIA 3MGUA 4AEJA 7CPAA 5EYXA 1B87A 2W1SA 3SHRA 3WW4A 3WQ0A 5C5TA 4KVME 3S9LA 2XVKA 4KU8A 2YHJA 3LD8A 3BPSA 3USUB 3VWDA 2XDVA 3H3UA 2WNOA 4FO9A 5IK4A 2XJTA 2VMIA 4Q5OA 3FYNA 3ZYHA 2QQPA 2DUOA 4SBVA 1QSTA 2OX0A 3VWEA 2AEYA 1MR5A 4UFHA 4NIGA 3P2HA 4JD6A 3ZZIA 2BGCA 2H0BA 1XBUA 2CTCA 3ZN4A 4LQGA 5DAWA 2RE9A 1AJKA 1BBT2 3N9NA 5CFDA 3I2IA 3WC5A 1GZ9A 5D2AA 1XRYA 2VXKA 2LRPA 5EPAA 1B6BA 3WDVA 1XRUA 2YXSA 3B00A 3LQCA 5FMBA 5C5UA 5J48A 4P45A 2XJQA 1LOCA 3NV4A 3HVDA 4GKYA 1M4WA 4NRPA 1UMHA 4UW6A 5JXJA 1Q7LA 2ATRA 2R073 3ZXFA 2WQZC 3C7OA 2LTNA 2W46A 4DRVA 2DWRA 1PGL2 1VALA 1H8LA 3WV6A 1PGSA 3EYPA 1HRV1 5F5CA 5FTTC 2WZPP 5JSPA 1WW5A 3VBFB 1QDOA 1W6NA 4OVEA 1QGLA 2BV4A 2VL4A 4FTSA 1Q43A 3ZYBA 1BOBA 2G3TA 2JIGA 4DOUA 5I0DA 3ZSMA 5FY8A 3NV1A 1BLLE 1A2ZA 5F46A 2WBKA 1YO8A 1LGBA 4NPLA 5D8AB 3GDBA 1XYPA 5A3LA 3I2KA 1Z7S2 4A41A 2VTFA 3ZN6B 1UOBA 1HRI2 1TMF2 3ZIWA 1WK4A 2WSAA 4HNXB 4Q36A 1HIXA 3N7KA 3UNPA 1DGLA 2WS93 4YZ4A 5HVHA 3HT2A 5FZ1A 3IPVA 4WVVA 1BEV3 4U2AA 2VE1A 2DFBA 1S60A 5ERLA 3N4MA 4U5YA 4ZY9A 3CF6E 3HNYM 3AKQA 4RR3A 5K8OA 2JX9A 1DBNA 4UFVA 5FXXA 4R6TA 1AL0G 2CGOA 2JG9A 1IKQA 3PBEA 5HXMA 4XJZA 4YW7A 5T54A 2FSRA 2IUWA 3C8XA 3GYAA 4NCZA 2V5YA 3VBRC 4D7TA 1EUUA 4KLVA 3LKJA 5A28A 1SQ4A 5JGFA 5JPNB 2VVDA 3TOAA 2V8HA 4CUCA 3E6BA 2Y6JA 3CU7A 3ZFEA 2BYVE 4YVWC 3H0OA 4YW1A 5GLZA 4LR4A 4A45A 4KSIA 1XE0A 4JHZA 3TFYA 4KBBA 4LO6B 4CZSA 2XOMA 1GUIA 3FUQA 4XFHA 4YNIA 3Q8CA 2A73B 4AHZA 4W6XA 1W28A 2B5GB 4AB7A 4AEDA 2XBO2 1VBD3 2VW2A 1YQ6A 2ZXQA 3I2DA 3PTRB 3WNLA 5CBLA 2R7EB 5D8NA 2ZGRA 3SJXA 1QJY1 4CAWA 5GKAC 1MS8A 2HWF3 3SC7X 3BTZA 3FLTA 1D4M2 3KB5A 2O53A 4DB5A 1AHSA 4WBBA 4Y3OA 1J3PA 4UCPA 3J8F2 4Q4W2 4ZHNA 4YGBA 5FK7A 1V9U1 2GMEA 3S7IA 2HJIA 4OHVA 2WQ4A 3AP7A 1COV1 4AI9A 1UL9A 4FXGB 4PV6A 3O0XA 3AMMA 4OC4A 3N3HA 2IMOA 2NMNA 1VBE2 1LNSA 4LO4B 2LM3A 1WLDA 4B3NA 2JE9A 5DAXA 3S5QA 4NMIA 3ZN6A 1DYOA 3FFQA 2HUZA 4PXBA 3M7AA 4ISQA 1WCQA 2JKBA 3C7GA 2D93A 4M3CE 5D8AA 3D4KA 2ZACA 4YRDA 5LRSA 3WNKA 4EFDA 1FMD3 4MX3A 1NCRB 1CM0A 1PVC3 4BINA 1REFA 2YYOA 4P4EA 4CGOA 4JDOA 5D29A 2WWSA 3PUQA 1HXS3 3IWWA 1C8M2 3DPRC 4MCSA 1SFNA 3B3VA 1GOFA 2ZGNA 3DUIA 3OTFA 5J98B 4DJLA 4UIAA 3ETPA 4QPIA 4P5HA 2Y6HA 1OPOA 4WVWA 4TYSA 4FPLA 1S3ZA 3SXNA 1SCRA 2MEV2 5JZGC 4UIBA 2WUUA 1W8HA 4JCKA 1AXKA 2XL7A 4Q4W3 4QU1A 2DTYA 4Z2WA 4KSAA 3MUY1 4NWWA 1IS3A 1REEA 1RUG2 2VQUA 2XUEA 4ZY2A 4EN8B 1UYYA 1AYN3 2PJ0A 3WLUA 3POWA 4FD5A 3VBRA 4FPEA 2B42B 3TN93 1QXJA 1BMV1 2BSWA 2PJ9A 3WR0A 2GMPA 2NM1A 4WM7C 2PDOA 4FPOB 3W21A 3DYOA 1BCXA 2OUHA 4B4QA 4UFWA 1PIV3 3VBUB 4P9IA 2AFMA 1ND2C 1NT0A 1NQDA 3CQOA 1RHI3 5AFEA 4CYPA 4MG2A 3E6DA 3H50A 4NHKA 4HL0A 2KM2A 4I3PA 4LTAA 4BIOA 4COVA 5LRJA 2IFWA 2R062 3PUHA 4QU2A 1N1VA 1QJX2 1XXNA 4OHXA 1TE1B 3IMNA 4C91A 2ZOEB 4PIZA 1GZCA 5A6QA 2A6YA 2RS51 2YBSA 3DYMA 4PLOA 1Y7EA 1ZZCA 2BUEA 5DG2A 2A5ZA 1ND2B 4NWVA 4ONUA 1DZRA 2D6NA 1PMIA 4NHLA 2Z3NA 1APNA 5ANNA 1GWLA 1D0GA 3KWVA 5EQUA 3S0MA 1D4M1 4QHZA 1Q56A 5FY9A 1OC1A 3H8XA 1YK3A 3UY5A 4JXQA 4QMAA 3JCIA 2AUYA 2GP5A 4E4ZA 4HKWA 2AE6A 1NA1B 5FKBA 1QIQA 2YGMA 1RITA 4MYEA 2HH9A 1ZNPA 2EK9A 2JBKA 1Z7S3 2VZOA 3W9AA 1UWWA 3CZJA 2VC9A 1ULFA 3FBYA 2IQ6A 4MFQA 4QB2A 3LZZA 4ISRA 4A2UA 3DDDA 2VAUA 4P02B 3S7EA 4IE0A 4LORA 3THDA 5HVGA 3NJZA 1QH7A 4C90A 2D3SA 1H8VA 4XETA 4E2GA 1O3QA 2R1IA 1Z8XA 2F4PA 5L9BA 1M44A 4A6OA 1VRBA 5A80A 5LY2A 4UF0B 4BXFA 3N9PA 3RZMA 5AGEA 4CCNA 2WZEA 2Z11A 3RAMA 4BYYA 3VATA 4RUHA 2VMEA 4WM8B 1OPMA 1QJEA 2HYKA 3BI3A 2JDZA 1ELLP 4XIKA 4OC2A 4QPIB 4BK5A 3B3TA 3TO6A 1HDKA 2J1SA 3AZVA 3GJAA 2UU8A 3GCWA 3R4DB 3IT8A 1CIYA 2O4HA 3HUVA 4LX9A 5FY5A 1KD7A 1ST8A 2V5DA 4DEQA 1CAXA 3KGQA 4HKFA 4W4ZA 3GZUC 4RR3C 3CMGA 1I1EA 4KOXA 1W6PA 1KDKA 1MJ9A 4XPKA 4D3WA 2XJUA 5CA6A 3K2KA 3AJZA 3ST7A 3O1MA 5FO9B 3GF6A 4WZFA 2ODFA 1IOIA 1HX6A 2CAVA 1PGL1 3KASA 4FOWA 2DEAA 1Y9KA 2VZTA 2WL1A 2R043 3KHZA 1CAUB 1Z0HA 4IW3A 3WF2A 2WJSA 2QUOA 3MIFA 1MVQA 1W8UA 4Q4Y1 5CAZA 4CDQB 2CXAA 2HYXA 4EWTA 4IGOA 4XNHC 2TEPA 2EA7A 4NJ4A 1O8SA 2B46X 1W6MA 2FCTA 4TWEA 4YYOA 1HDQA 5AG4A 4NIDA 3KCXA 4XBQA 2G9GA 4FUUA 2YFUA 3VZJA 4CGLA 4MVTA 3THTA 2REFA 5FYBA 5CG9A 3KZWA 1RMU3 1KUVA 4CAVA 3KQ4B 4AEDC 4YWAA 4H2KA 4CU7A 5FZ6A 3AKSA 3ACGA 2PJ7A 5F3GA 2CDOA 5IVYA 1CPXA 2IXIA 1NCQB 3IBMA 3LE0A 3ORJA 4CP0A 3JRUA 5FQ0B 3DSBA 1Y9GA 4U9ZA 1IS6A 2X53S 3I59B 4XACA 1GQHA 1H1IA 1MEC3 5FYIA 3V0BB 2PJ3A 3FRMA 5A7QA 4X8IA 2JICA 3ZFGB 2QQKA 4YVWA 3BIEA 1JMUB 2DCKA 4FPCA 5LCWL 5AVPA 4AZZA 1JHNA 2QQNA 1XIXA 1VBD1 4R8FA 1XMTA 1SDWA 3A0KA 4KWLA 4A7YA 1H9WA 3FFZA 3MLKA 1XU1A 1Y9QA 1JS9A 3WOGA 1SLAA 1TF8A 1XJAA 4ZONA 2PJ1A 3G8WA 1CAWB 1C8M3 5E16A 1JYIA 3AX4A 1RVF1 1ASJ2 2HWC2 4UW3A 4AVVA 4NROA 3BOWA 4XUNA 2I2SA 3RSJA 4DPNA 5H84A 1AXZA 2J1VA 3AKTA 3K75B 4B4PA 4MFLA 1I5PA 1RUJ1 4CCCA 4CP1A 4XURA 3HQRA 3C26A 2FMDA 2UWCA 5BV6A 5JQ4A 4MLOA 1MS1A 2V8VA 1JU4A 2PJAA 2DU0A 2H0VA 1VJ2A 4HFSA 5EFUA 3MW3A 1DQ1A 4B5OA 2DCYA 1RXTA 2Z69A 3DF0A 3K51A 1O5UA 2JECA 3VHRA 5FV3A 1OMIA 3DKWA 4XDPA 3MW4A 4N9HA 4TXWA 1BBT1 1OH3A 3A4UA 2HEVF 1C4RA 3TYJA 2RS12 1BMV2 4MMOA 5KTAA 1VPHA 2N7GA 4IQPA 1LHOA 1SLTA 4IETA 5FZ9A 4G1PA 3KF3A 4N43C 5KC5A 5KC6A 1OLME 4X5KA 1AR92 2VZRA 1EE3P 2Q1ZB 3HOBA 3PB4X 4H6ZA 4M4RA 1NA1C 3TN91 1IICA 3LWUA 5G21A 5FO7B 2J7MA 1GBGA 2PJ2A 3AJYA 5A7WB 2VMHA 2ZAAA 1JTZX 3KV9A 5JOXA 1NLSA 4DUXA 2QE3A 5FZKA 1CPMA 2EIBA 5FP8A 3HQUA 2FXFA 2JG8A 3C7HA 4IEOA 1LKNA 1UD1A 4KZTA 1ZVFA 2P6EA 1VAKA 1HQNA 2ZX1A 2B5HA 5A7NA 4JVAA 4TZDA 5T5OA 1SPPB 4DIQA 3PEIA 2WO2A 4OMCA 5A3WA 3CXSA 4LQRA 1BK0A 4YGOA 2B9UA 4QB9A 2OIIA
chains in the Genus database with same CATH topology
1RUH2 2R1BA 2KXLA 3AMHA 1BO4A 1YVOA 5KHHA 1GFF2 2BNMA 2Q4SA 4B7EA 5J09A 2HWD2 3RG0A 3WP3A 1IKPA 3PHMA 2QVSB 5ABJC 1UU5A 4MFPA 1AL22 2Q5TA 2VQYA 5T5PA 1EPZA 4XIOA 1AR73 2Y0MA 2GAUA 4J6GA 3T1MA 3FZ3A 2BTVC 4CEWA 1UF2C 2C5DA 4AQ6A 3F8KA 3RI8A 4N90A 1K5MA 1PUAA 1CAUA 3TOBA 1ZX5A 5BNNA 4C1XA 4ZBGA 2EALA 2QNKA 1DZTA 3VZKA 3WUDA 3NAPC 2YGWA 1ZBE2 5EWSA 4XPVA 3IDCB 5FDBA 3JBG3 1RUNA 4WZCA 3VDDA 4Z1VA 2O1QA 4L97A 4AHXA 2DXQA 1LESA 1N1YA 3ZFEB 3H4QA 3LD2A 3LSDA 1WMDA 1SMVA 1V6NA 2ERFA 1T6GC 2WINB 5BNQA 1X82A 3CJIA 2JG8B 3JUUA 4XOGA 4B5PA 5JSRA 4I0BA 5JAXA 2O0OA 1YR0A 1REDA 1VBE1 4MBUA 4YVWB 4NPRA 4IV1C 2ZPAA 1GKBA 2DVDA 5I0SA 3VBHB 2R042 4C2ZA 3J9SA 4YZ3A 4LBLA 2BWCA 4A31A 3VKFC 3PMSA 4C2YA 3GY9A 2D3PA 4GWMA 2ZKNA 1YUDA 4HN1A 5BY5A 5HMNA 1NQJA 2PAMA 4GMP3 1QJY2 4Y4YA 2YY1A 1IPJA 1NY72 1Q8PA 2R071 3T90A 5C9AC 4JLYA 1WBFA 3WG2A 4QHBA 2PA7A <