4ONUA

Camp-binding acyltransferase from mycobacterium smegmatis, e234a mutant
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
332
structure length
314
Chain Sequence
AELTEVRAADLAALEFFTGCRPSALEPLATQLRPLKAEPGQVLIRQGDPALTFMLIESGRVQVSHAVADGPPIVLDLIIGEIALLRDAPRTATVVAAEPVIGWVGDRDAFDTILHLPGMFDRLVRIARQRLAAFITPIPVQVRTGEWFYLRPVLPGDVERTLYRRFQSVRKPTRALLEYLFEVDYADHFVWVMTEGALGPVIADARFVREGHNATMAAVAFTVGDDYQGRGIGSFLMGALIVSANYVGVQRFNARVLTDNMAMRKIMDRLGAVWVREVVMTEVDVPPVDTVPFEPELIDQIRDATRKVIRAVSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyltransferase Pat
publication title Allostery and Conformational Dynamics in cAMP-binding Acyltransferases.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
total genus 93
structure length 314
sequence length 332
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4onuA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4onuA02
1CAXB 1VKCA 4JWPA 3R96A 2KXLA 3USSA 2VXKA 2Z69A 1CAWB 5KHHA 3R6SA 3ST7A 3UKVA 1XF8A 4HVQA 3FBUA 3IIAA 5EZWA 1YK3A 4IEUA 2OZ6A 3LA7A 4U9YA 2OZUA 1ON0A 3VHRA 5I0TA 3LZZA 5BY5A 5F49A 5JQ4A 4KWLA 5FPZA 2CNSA 1UD1A 3QOPA 2PQQA 5JAXA 1RO5A 4JXQA 3SMHA 2H6CA 4H6UA 4PIZA 4IERA 5KTAA 5T3NA 5GCNA 1IICA 4I2OA 2Q04A 1ZZ9A 3RYPA 2PAEA 2FIAA 1S7LA 2ZW6A 3KGLA 3S6FA 1YFYA 5BV6A 2QIRA 4AB7A 2PHDA 1CAUB 1O3QA 1SQHA 4XF1A 4PSWA 4XNHB 2HKXA 1PMIA 1Y9WA 5E96A 1CAXA 4XPKA 1VJ2A 4I3PA 1IPKA 1CAWA 1U6MA 3LAGA 2OH1A 1I12A 4IEQA 4F7ZA 1RC6A 3FE5A 4LEJA 4XFAA 3WW3A 3EY5A 4YFJA 1Q5OA 1CGPA 1ZZCA 3SCGA 3PGPA 3R9FA 4PK2A 2XLAA 3BJ8A 2GU9A 4JD6A 2D4PA 2Q1ZB 2PAKA 2Z2SB 4XF0A 5I0UA 1J4JA 1MK4A 2FE7A 5BXXA 2AJ6A 4WVZA 5KTDA 3EHKA 1LR5A 2J8MA 3K9UA 4WBBA 2GAUA 2Z10A 1M44A 3HQXA 1NSLA 4NVPA 3MZHA 2K9ZA 2QNKA 3E5QA 3RYRA 2R1IA 2XGXA 4B5OA 3TNPB 1SEFA 2HUZA 4XNHC 2I79A 1CAUA 2FSRA 5FLJA 3H8UA 3RYOA 1SQ4A 4Q0UA 4ZU5A 2CY2A 3DV8A 4P9GA 1B87A 3DR6A 4EWAA 2VEZA 4LLOA 4OAEA 3OF1A 2D5FA 3C3VA 1YVKA 4HNXB 4NXYA 5EC4A 3FXTA 1I5ZA 1IIDA 1CX4A 3QAHA 1N71A 1IB1E 4ZU4A 1Q43A 1Y3TA 4DNCA 3KGZA 4UBGA 2OYZA 3LWCA 5JSRA 5FLHA 5AVPA 3W6SA 4B5PB 1H1MA 3RZZA 1OFNA 3OGJA 2CGPA 3NJZA 3TFYA 5FVJA 4E8OA 1LRHA 3PLQA 3H1WA 4HMZA 4UXAA 5C8WA 2H6BA 1ZREA 3ZJ0A 3FB3A 1Z4RA 1YLLA 2B4DB 1Q2DA 3ES1A 3U10A 2WFPA 4JLYA 4WZCA 2GC2A 2ZPAA 2B58A 2VZZA 3CXQA 4KWKA 2EUIA 4PJYA 4HNYB 4QGNA 3DDDA 4IEXA 3OCPA 4ZBGA 4XPDC 2EA7A 4CAXA 4HLTA 1FXZA 2FL4A 3JVNA 2BEIA 5C88A 2NMTA 2Y0MA 3H7JA 3FYNA 2FQPA 4AXOA 5KHKA 2GC1A 4OADA 4QUSA 3LA2A 3GKRA 1S60A 5F48A 2V09A 5F1RA 3T9YA 1WLTA 3W91A 1RTVA 4HVRA 2ETEA 1DGWA 4KVXA 4B5PA 4FD7A 1S7KA 1J3RA 2XL9A 2B5HA 1M1DA 1L0CA 2PSWA 3TTHA 1Y9KA 1YFWA 2UY8A 4A2UA 2CAUA 3HIFA 5BPXA 4F8AA 2F5IA 3E6DA 2QMLA 2B5GB 2CAVA 4MX3A 4MY0A 4KZTA 1WGPA 1VP6A 1P0HA 5C82A 2PQ8A 2DCTA 3NSTA 4L11A 1Z4EA 3F5BA 3FIXA 4AG9A 3MPBA 2ZW5A 4KUAA 4GS4A 3LA3A 4MGYE 5FCCA 5FLIA 3SCFA 2PTMA 4XFBA 1J58A 4KU7A 1BO4A 2ZCWA 3B8GA 2BEOA 5I0RA 5JCTA 2Q4VA 4IUSA 4JJXA 5LRSA 3RYKA 1K4JA 1O3SA 1O5LA 1XE7A 4AVCA 2IXIA 3F8KA 2WPWA 5FPXA 3I59B 2P6GA 3IWGA 4F6AA 4EV0A 2Z11A 4LX9A 1QSOA 4I01A 4QGMA 1TIQA 3VWDA 2AE6A 2K0GA 4K30A 3H3UA 4QX5A 2B5GA 2REFA 3RNSA 1ZRFA 4XEZA 4NF1A 3SHPA 4CS0B 4L8AA 4UA3A 2IL4A 3EFAA 4M3SA 2EVNA 4TLFA 3TO6A 4R3KA 1O7FA 1QSMA 1Q2CA 2B3UA 1DGRA 2QVSB 2IXCA 1UCXA 5KTCA 4O9EA 4HZFA 4XF3A 1ZRDA 1QSNA 1XEBA 4YARA 2Q7BA 1OD5A 3WW4A 1P4NA 4HNWB 1NE4A 1O4TA 2IXKA 3KSCA 4HSLA 3I59A 1YUDA 2OZHA 4AVAA 3SXOA 2PRBA 2E9QA 4XF4A 1JUHA 2EAAA 5H84A 2O28A 2BNNA 2O1QA 4YSFA 1RUNA 4AVBA 4KU8A 3EO6A 4MGIE 4BYYA 2VPVA 4FD5A 1RUOA 1PU9A 5K8SA 4QC6A 4I02A 4Y49B 3NVCA 1S5KA 1B6BA 3FRMA 3TT2A 3FWEA 3EO4A 1V70A 2FCKA 3SXWA 1YLEA 1YREA 2N7GA 4Q29A 3U0ZA 4J3GA 3OD0A 2JEVA 4MY3A 4OFGA 2WC2A 4Q0VA 3JUWA 2D40A 3BALA 1UW8A 1HW5A 4R8HA 4LA3A 3IWZA 3GYAA 4LULA 4FD6A 4KOXA 4F0YA 3OTFA 4YNIA 3CL1A 3D2PA 4R87A 4KVOE 4RI1A 4IEYA 4FAGA 3FHIB 4E2QA 4FBFA 1SFNA 1I21A 2VBQA 4BIFA 4XPDB 1J3PA 3S6KA 2RC4A 1NZCA 1WWZA 4IEWA 3S0MA 3EBRA 2ZKLA 2JLMA 2Q44A 3DKWA 3QACA 4Y49C 4YGOA 4II9A 1FT9A 2PHLA 2QCSB 4MUVA 4HN1A 4XFFA 1PUAA 1XIXA 3D3SA 5FDBA 1EPZA 4CYDA 4AG7A 4HKFA 3TOBA 4IESA 2J8RA 4KLWA 5DWNA 3R9EA 4CRZB 3BPZA 2OZJA 3TO9A 1ZNPA 1YFXA 3PZJA 1DZRA 1NXMA 4YRHA 4HSJA 3I9SA 2UYAA 1OZPA 3ROUA 1IPJA 2VQYA 4NSQA 4I0AA 5J48A 1YX0A 3WW2A 4EWDA 5IB0A 2JDCA 1GQGA 1UIKA 4ZU7A 3NL1A 4I0BA 4R9MA 3WR7A 3H1MA 1YGHA 4MBUA 5DWMA 2HJIA 4RD7A 3LODA 2O8QA 1YWKA 3P2HA 4E0AA 3L2HA 3VWEA 1U12A 4I09A 4IEOA 5IV0A 1ZX5A 2WPXA 3FFQA 2GC0A 4ORFA 3UKNA 2IXLA 3CJXA 4Q0SA 5LRRA 1KUXA 3R9GA 5F46A 5J8FA 5KBFA 3GYDA 1I1DA 4EWEA 1H1IA 3BU7A 3TO7A 2GC3A 3E5UA 3LOIA 3FNCA 2QJVA 4PIYA 1DZTA 1UPIA 2Y0OA 3IBMA 5FQ0B 2ZXVA 2J8NA 3KCCA 2OZGA 4JTNA 2D93A 1EYBA 2FIWA 1Z9UA 2VI7A 4KLVA 4I49A 1OMIA 4RS2A 2VQAA 4FAHA 1Q3EA 4KL1A 3S7IA 3MGDA 3O14A 1O3RA 4R57A 1J59A 3EJKA 4PSXA 4O9GA 1FI2A 3BCWA 2UY9A 3CXPA 1QXRA 4HBNA 1YHFA 2GZWA 1M4GA 2G3AA 3SXNA 5JSPA 2IXHA 1MJBA 1WK4A 2OU2A 4MH0E 2G0BA 3HT2A 5I8SA 3ZDSA 2R98A 1IYLA 1ZVFA 2I45A 4LUAA 3U11A 4GULA 4MZUA 2OPKA 4JXRA 2DXQA 2GH2A 5HMNA 4XFIA 4IEZA 1UFHA 4XPLA 5FQ0A 1L3JA 3NW4A 3T90A 4QBJA 2P17A 1CM0A 1X82A 1GQHA 3E6BA 4L2NA 3D2MA 4UBRA 4XF9A 3ZZIA 1QSTA 4CAVA 2PC1A 3KKWA 2FXFA 5D1IA 4J1WA 4IETA 5CU1A 2ZW4A 3EQEA 4LA2A 4LUKA 3E0KA 2PR1A 1O5UA 3R1KA 3D82A 2H5MA 1YR0A 3H3ZA 5LEJA 5I91A 2Q0YA 1ZRRA 3S7EA 4KOVA 4IEPA 3S6GA 2D4OA 4EVYA 4EROA 5EBVA 2IC1A 1WA4A 3PNAA 2MHFA 4FD4A 1YFUA 2C27A 3E5XA 5CVRA 5I93A 1S7NA 5J3UA 2Q4SA 5I8YA 2ZW7A 1NYWA 4PK3A 5CNPA 3RDIA 2K5TA 5JPHA 3F0AA 3R95A 3E97A 1G6NA 3KMHA 3IGRA 2HQYA 4R3LA 4Q0PA 1XE8A 3DN7A 1NE6A 4LUMA 3M70A 1V0CA 2XLFA 4E2AA 4YYOA 2FS5A 3BLNA 2D5HA 3IDCB 3B02A 5KHIA 2F4PA 4BHPA 3WW1A 3H4QA 3CO2A 4X6QB 5JSOA 1XE4A 2P6EA 3V8IA 2PA7A 4MI4A 3RPQA 3SCHA 2OA2A 4Q0QA 2CNTA 2G3TA 4ONUA 3UKTA 4AQ6A 2ARHA 3DR8A 3N7ZA 4KOSA 4KORA 3TE4A 4META 1X7NA 2GE3A 4HN0A 4D7SA 1CAVB 2Q4YA 1CJWA 2UYBA 1RGSA 2MPFA 3JZVA 1KZFA 1M4IA 2XL7A 2QECA 4MV2A 3I54A 2R7HA 3HT1A 2B4BA 4JTOA 4R52A 3NE7A 3MDPA 1I6XA 2CV6A 4CAWA 1RL3A 4N9IA 1M4DA 1KUYA 3NKTA 5JR7B 2BSWA 4CRYB 2Q0AA 4XETA 2CNMA 4X5KA 4PIXA 4XFCA 1ZZ8A 1ZZ7A 4M85A 1Y9QA 2P6FA 4BH9A 1LB2A 3G8WA 2JDDA 2EVXA 2MNGA 4MGKE 5E1RA 1EY2A 3CEWA 5EFUA 3QB8A 4MHDA 2BYVE 4NCZA 3UY5A 4N9HA 1GHEA 3H1YA 1CAVA 4AQ2A 4FT8A 1X8EA 4D7TA 2BNMA 4YRDA 3W6XA 1J3QA 3GBFA 2KCWA 1BOBA 5IX3A 1ZRCA 5CADA 2B8MA 3BB6A 4HVOA 1S3ZA 4BMHA 5KHGA 4H6ZA 4UWJA 2P0WA 3N4MA 1S7FA 2Z0ZA 3IDBB 3DSBA 3BJ7A 1IYKA 2X7BA 3PP9A 3EXNA 3D8PA 4H89A 1QWRA 3H7YA 2HV2A 2R8VA 1J1LA 1UIJA 3S6HA 3C26A 4QM8A 5J8CA 5LEKA 4XFHA 2PAMA 3ACLA 4QMAA 3CXSA 4LTAA 2XKPA 4UBHA 1TQ5A 5H86A 3CLPA 4QB9A 5I0SA 4KOYA 2VECA 4U5YA 5J7MA 1Q2YA 2ET7A 4QGLA 4J1XA 3GY9A 4KOTA 4Z82A 3DL3A 3TCVA 1ZZBA 5KHJA 5ISVA 1EP0A 3D0JA 3FJSA 4QXKA 3G3SA 3FZ3A 4QM9A 5BUVA 3CF6E 2GIVA 5HI0A 2PFWA 3DNSA 2PYTA 2QDRA 3LD2A 4XFGA 1VHSA 2XKOA 1MJAA 1YVOA 3P2FA 3G7DA 4KOWA 1RXTA 2FT0A 2IXJA 3H50A 2ATFA 2I00A 2PDOA 1X8MA 4E2GA 1XRUA 2BL1A 4OLLA 2Q30A 3E6CC 4Z07A 1OI6A 4PV6A 2GANA 4KWJA 1VR3A 5E16A 2XHKA 3SHRA 5HH1A 2OB0A 3M3IA 1R57A 3TOAA 4IF5A 4UWIA 3FX3A 5F47A 3I7DA 4B29A 3ELNA 4IEVA 3EC4A 3PVBB 2B4DA 1QY4A 3D0SA 3MYXA 1ZZ6A 4E2SA 4K8FA 2PR8A 4KOUA 4KVME 4QVTA 2FMYA 1KUVA 1PM7A 1NE9A 5I8TA 2BUEA 3I3GA 3OWCA 1Y7RA 2VZYA 1QSRA 4JV4A 2REEA 5C6CA 2BNOA 1O3TA 1MJ9A 1LKNA 2H0VA 4H7LA 2A4NA 1LRZA 1XMTA 3TNQA 4U9ZA 2ET1A 2ATRA 5I0CA 3ETQA 2B9UA 1NMTA 4JVAA 1FY7A 4MJ8A 2XLGA 4MGZE 4KUBA 2BGCA 2C0ZA 4DINB 4NEXA 2B3VA 3H9AA 4X6RB 3ES4A 4L89A 1QXJA
chains in the Genus database with same CATH superfamily
3QD6A 3RWKX 4A7YA 3R6SA 2IJZA 3JBG2 2ARAA 2D3SA 5C9AC 4YG6A 3TX8A 1ND2C 3DPRC 5GCNA 5LYDA 4JAAA 4DS0A 3OUHA 5DDJ2 5FPVA 5BV6A 3GZUC 4XF1A 2IZWA 2WWUA 5FXZA 1MZ5A 1VBA3 1AVBA 2FDKA 3PIGA 1G9CA 1RUH3 1GNYA 1MZFA 1NUKA 4TTGA 4EWTA 1KITA 2W2IA 3C7EA 4GIQA 4RHV3 1SEFA 4L8QA 4XNHC 3DF0A 3IDAA 4Q0UA 4IGPA 4P9GA 5E88A 4EWAA 5G22A 2GALA 5T5OA 3QAHA 1H2KA 1Y3TA 5A33A 1ZLHA 3KHCA 4QPWA 1MEC1 2R1DA 5LYIA 1HN1A 2DTYA 4COWA 1YCIA 4HLTA 4P9JA 5SV5A 1OA4A 1PIV2 4LHKA 3GKRA 2HWF2 4C68A 3IWWA 1S7KA 1VHEA 2CTVA 4MFKA 2F5IA 4CDQC 4MY0A 4KZTA 2QTWB 5DDJ3 4NIDA 2FHRA 3FIXA 4MGYE 2OKXA 2Z79A 5L9BA 1BO4A 1Q8VA 2V73A 3TEZA 3WOGA 1XE7A 4AZZA 1TIQA 4N8MA 4Y20A 2XBO2 1NAEA 3O12A 5A7OA 3HQRA 2XG3A 5CG8A 1W28A 3PB6X 3EFAA 4S2GA 2PQSA 1GQPA 5K8OA 2PIZA 3ZFEC 2HWB2 1OD5A 2AFUA 3BI3A 4M4RA 5GLZA 1RUNA 4LIUA 3FN9A 3FRMA 3I2IA 5A6XA 1YREA 5JWPA 3U0ZA 1C8M1 4FPFA 4MY3A 3AVSA 3PHMA 5F3IA 2BVVA 4XPDB 3TN93 1WWZA 1EPZA 4CYDA 2G9FA 2BOAA 2WS91 1ZNPA 1FPN3 4YRHA 4Q4W3 1O8PA 2WYFA 1HJFA 4S2HA 2WSVA 3KWVA 4FXKB 4A38A 2W47A 1UIKA 3NL1A 3WQ0A 3H1MA 4QPIC 1YWKA 2EIGA 4Q0SA 5IVJA 5KBFA 4B11A 4XCBA 2J8NA 4X8PA 1NZIA 3S9MA 4BK5A 2E7AA 4C7IA 4KL1A 1X9TA 3T08A 2VAUA 5FYUA 5A28A 5IATA 3MIBA 1GLHA 2I45A 4MZUA 4AEDA 3ZZIA 1OF4A 2HWC1 2WDBA 2ZJCA 1UMZA 5JXJA 3I4IA 1LOGA 2YFUA 3S7EA 4KOVA 4KGGA 4WZFA 5EBVA 2MHFA 1F4AA 3O5SA 4LITA 2YBPA 3WCSA 1SBEA 1H9WA 1OBRA 1KD7A 4Q0PA 4CYQA 1JH5A 1TMF1 4FPLA 3R4DB 3RJ2X 1GZWB 3VBHA 4P45A 3BUCA 3PB4X 3GDBA 5FWJA 1H8TA 4X6QB 1TKHA 1AR63 1H1AA 5LYLA 1S0FA 4X8NA 4W50A 4DJLA 1UAIA 4INDA 2QECA 2CF4A 2JG8C 1MS3A 1NCQC 5D21A 2DUQA 3CU7A 2W1QA 2ZHMA 2HWE3 2A5ZA 5FY7A 1LB2A 2LS6A 1C1LA 3GBGA 3BB6A 4BMHA 2ANPA 1MS8A 4UFMA 4LTAA 3RZGA 5C71A 3LMSA 2KA3A 5ISVA 1WCQA 2HWD2 4OI4A 4PLMA 1WMDA 2BW8A 3MHZA 2VW2A 2QYVA 2NMNA 1HXS2 1RXTA 2NYYA 2FT0A 1X8MA 2D97A 1S4CA 3E6CC 2DPSA 1AYN3 5E16A 4UWIA 1Y7BA 4CCLA 2F17A 2RDNA 5L7OC 2R073 3RMXA 5I8TA 3OWCA 1GWKA 3ZMOA 5I0CA 4JVAA 3D6EA 3UV9A 1EAH2 4TZDA 1RUG2 1CAWB 5K0UB 4E4SA 3IIAA 1OD3A 4U9YA 5H9PA 1OLMA 4OYUA 3B00A 1UD1A 4PF5A 1OT5A 5FZFA 5AG4A 1D7PM 2D6PA 1IICA 1WBLA 1M4WA 4F3JA 1EUTA 4TSVA 2RM22 3GF6A 1SQHA 1XU2A 3VH9A 5JGFA 2W87A 4Y1YA 2OH1A 1I12A 1CGPA 5A7QA 2ARCA 4Y1XA 4LKDA 1MK4A 4YM2A 5EJZB 2ABZA 3GIUA 4NIGA 4R76A 4SLIA 5T54A 4ZU5A 3RAMA 2CY2A 3DYOA 1B35A 1FNOA 5BNOA 2C4XA 2FD8A 1YEWA 1S0IA 3KGZA 4RS5A 1RB8G 1AR72 2P3JA 1DCSA 2CGPA 2R042 4UXAA 3ZJ0A 4MXVA 2VE1A 1Q2DA 2W0XA 2VZZA 3VBUB 1EAH3 4QGNA 3DDDA 2DEAA 2EA7A 2GP5A 4G9SB 4MFJA 2J1SA 4MFZA 2FQPA 4XJWA 1OSGA 4IV3A 3W91A 4HVRA 4ITCA 1YFWA 4MFLA 5ACA3 4E8CA 4MCQA 3KGQA 2ZW5A 4KUAA 3NWKA 1BQPA 5IK4A 3SCFA 1VBB2 2W94A 2WABA 3KF3A 1GP5A 3S5AA 2ZXQA 4AW7A 2VNOA 1R091 1D4VB 3I2HA 3U1XA 3VWDA 4DXSA 1AXYA 4WVMB 2VM9A 1WCDJ 5LRGA 2EVNA 4TLFA 2IXCA 2JD4A 3CZJA 4IE7A 2PXJA 2YNDA 1LGNA 3VB9A 1QJX1 3BTAA 1AX0A 1VRBA 4KU8A 4MGIE 5LA9A 2DURA 3NVCA 4E8DA 1RITA 4JGYB 1VHOA 1AF9A 1HEEA 1W0PA 1UW8A 1QKQA 3UESA 3DLJA 1NZCA 2ZKLA 3D3SA 4MUVA 4XFFA 3FBMA 3VD3A 2WNUB 2W1UA 5C4WA 1IGBA 4OHWA 1IZ3A 2OUJA 1HRI2 3M3CA 1XB9A 3JXSA 1KJLA 2ARBA 4CP1A 5BNNA 2IXLA 3AYAA 4EZHA 2RMU1 3BIEA 4OI0A 3IIIA 3GCWA 4A45A 3VBSC 1UYPA 2D93A 4I49A 4FAHA 3B7MA 3O14A 2WJSA 1N47A 3EJKA 2JDMA 4AAPA 4O9GA 5A32A 2VGDA 4IGOA 4XCAA 1A8DA 3MICA 5FYCA 3HT2A 4J25A 1GYKA 1PO22 2GH2A 2GREA 1CP6A 3VDDB 4B12A 3UJOA 3D82A 4JHZA 4AK3A 5IVBA 5LCWL 5G20A 1YFUA 2QQKA 1RUI2 2X53S 3RDIA 2K5TA 2HQYA 1Y9GA 3ECQA 2HB6A 1JBCA 2NLRA 4N53B 3N9MA 4BQYA 1JYWA 1IKQA 1GFF2 4C1WA 4CXXA 2P6EA 4YGEA 3DECA 2NYQA 1M06G 3V65A 4FBEA 1RUJ1 4UFIA 5DPNA 2CV6A 2ZEXA 4CAWA 4N9IA 3NQHA 2EAKA 1SHWB 3H8GA 4YM3A 4AEJA 2VZPA 1JZ3A 1WD3A 1UU4A 2B46X 1RUC2 5J1XA 3GBFA 3AL6A 3GCXA 4HK8A 1PO23 2CSGA 4MADA 1RUE3 1GNHA 3EXNA 5AFBA 1QWRA 2BUKA 1K12A 2DBNA 4R7MA 1EV13 4XW3A 4F9UA 4OHVA 1LCPA 1U5XA 1Q2YA 2ZHNA 2R1BA 4AI1A 1MQTA 2J1UA 4G3YC 3ZPOA 4ZS3A 1AR92 3MN8A 3RGBA 4P9LA 4KS9A 5D8AC 1LHOA 4KOUA 3N36A 2O14A 2WNVC 4CDUC 1NXD1 1BPNA 3NFZA 1IU8A 4CDXC 4KUBA 4XTPA 1OA2A 5FO8B 4W6XA 2V8HA 3FBUA 4PPZA 3VLBB 1QF3A 3FVLA 2VCCA 5C9AA 3H8RA 2CNSA 3QOPA 4XZUG 1ND2A 1GP4A 3DXUA 5GKAC 1CWPA 4AI8A 3A4UA 2PHDA 2DVGA 3NH5A 2VL4A 2P6HA 3ZMNA 3K4DA 3R9FA 2EIDA 3JU9A 2FDFA 3ACIA 2AUYA 5FMOS 4TYSA 4Q4V1 5L9VA 2XQRA 3A0NA 4NGQA 3O0XA 5FUNA 4NXYA 4ONWA 2V5DA 2HEYF 5G21A 2PELA 1IB1E 3TFYA 5D29A 4E8OA 2DCKA 3FB3A 2WAOA 4CE8A 1C4RA 2PJ6A 1COV2 5KHKA 3IPVA 2XONA 2Y60A 2FMDA 4DY5A 3HOBA 2XL9A 1CG2A 3LIGA 1DQ6A 4Y20B 4AFBA 4MX3A 1EPWA 4XABA 2CL2A 2PQ8A 1BJQA 2H0BA 5DUXA 1UX7A 1PZ8A 4CCMA 1D4M3 1LAJA 1X12A 2F4LA 2YNEA 1HQNA 3SKVA 3HWJA 4F6AA 4LORA 5FK7A 2PRQA 4I01A 1FOD2 3A0KA 4Y4RA 3THTA 1G8WA 2A75A 5K8MA 3TO6A 1O7FA 3RZHA 4DEVA 1QSNA 3WUCA 3ZFEA 1F35A 2VMIA 3MUY1 3L2NA 1N3QA 3PU3A 2JDKA 3A7QA 2B9VA 1C8M3 1US3A 3SXOA 5H84A 1CESA 3SJGA 3AZYA 4BYYA 4QPGA 1S5KA 3SXWA 4B8EA 2POKA 3KM5A 3OD0A 3BGAA 3IWZA 4CEWA 1TNFA 4KVOE 2BWCA 2WS93 1OUXA 3AMPA 4MYEA 4NROA 4IEWA 1XSQA 4XIKA 2ZEGA 3R4UA 3ABZA 4HT1T 1BYHA 1RMU2 2A3XA 5FKBA 4D6SA 2Q1FA 3QH7A 2PJ4A 5J36A 3UGHA 4HANA 3V7ZA 3WNOA 1H2MA 4NAOA 3GALA 4RD7A 2A6WA 2RVAA 3FFQA 3V0AA 3K2KA 4EWEA 1Q7LA 4AEDB 2NQYA 3VDAA 4LK7A 4XJZA 4ZI6A 4PSXA 5F5CA 5JR2A 2GU2A 3K9TA 5FZMA 4MH0E 3WR0A 3ZSLA 2XVLA 3FX6A 4B1MA 1ND3C 3RWNA 1L3JA 3T90A 3VBHB 2AEYA 5CU1A 3EQEA 1FATA 4BQ2A 4LIVA 1H8TB 1Y43B 2H5MA 1TMF3 5FYSA 1AR82 1WA4A 4FD4A 1OLRA 1S7NA 5I8YA 1WCKA 1W8FA 1RJ7A 5JPHA 1RMU3 2DWRA 1UKRA 1JU4A 2Y6LA 2CNTA 2Q43A 2EXIA 3KCYA 3J8F2 3FBYA 4JGZA 3ZIWA 2MPFA 4ZZ5A 1GMMA 5I0DA 1RL3A 2JG8A 3AMNA 1QH7A 1NCQA 2JG9A 4UF0A 1BEV1 2R063 2FDHA 4LKFA 1ZZ7A 4M85A 1RHI3 4FOYA 1DYPA 4D69A 5EFUA 1KXGA 2HEVF 3H1YA 4FT8A 2TNFA 4MHZA 3T8WA 1HN0A 1LHNA 5FKCA 4PF1A 4R9BA 2ZGOA 3ZFFB 3RG0A 1DG6A 3E1F1 2QE3A 3ZXDA 4CSWA 1S0DA 3NNMA 1V6KA 3S6HA 2OVUA 4QMAA 1TQ5A 1YXWA 4EYUA 4OI1A 5BUVA 2FDIA 5HI0A 1BK0A 2PFWA 4Z1VA 3KS7A 2VMFA 3G7DA 2CIJA 4E2GA 1K5MA 2WFF1 2XR4A 4DZGA 3ZX7A 3PB8X 3BU0A 3R4SA 2NMOA 1KUVA 5L7OA 4R4XA 2QZ3A 4Q2FA 5IWFA 2VZYA 1LULA 2YYOA 3TNQA 4P14A 1QEXA 3CIHA 5ISLA 3WT3A 2Y6KA 5FZ8A 4Q36A 4L89A 2VL1A 2GDFA 3A21A 3VATA 2BQPA 1FT7A 3IU2A 4CDWB 5JQ4A 3SMHA 3WY6A 1X9PA 4L92A 4YPJA 2Q04A 4CP9A 3WCRA 4LBMA 3ZSMA 4LPLA 2JD9A 3POFA 1B35B 3Q8FA 5BNOB 4QXCA 4XOGA 1ZZCA 5F2SA 4PK2A 4M4PA 5DAWA 3W20A 2Y6JA 3ZKYA 1IQDC 4RS5B 4YVSB 3NV3A 3NAPA 1O8SA 4WBBA 4P02B 4Q4Y2 2A6YA 4BM8A 4HKLA 1TNRA 3N7KA 2UWBA 5L9RA 3T3YA 3N7JA 5FLJA 4ASLA 5EYXA 1ZM1A 1NKGA 2UWAA 2HLEA 3ZYRA 4K1YA 1ASJ2 3NJYA 3DKQA 4IV3B 4YW4A 1OVSA 2ZGNA 1F5FA 2JEMA 2C6SA 1YLLA 4ARYA 3U10A 1A78A 2ZPAA 1VALA 1BHGA 4XPDC 1VBC2 3H7JA 4QUSA 2VNRA 4Q8KA 1S60A 4MCSA 4NJRA 1W6PA 2VNVA 4UFWA 1YQ5A 4FAIA 1ULEA 1WLCA 4A6SA 5FP3A 1VP6A 1W2OA 3N5FA 2B39A 2VTXJ 4M6GA 2PTMA 1RXGA 3ILNA 2Y6FA 3B8GA 2VCBA 4A94A 1POV0 1LU1A 4A7KA 4QGMA 3RMYA 2EK8A 1S1AA 4QQ2A 4L8AA 4XQDA 2IL4A 1SLLA 2PLV2 4D0QA 2JDZA 1UYYA 2ZA9A 1HRV3 4O9EA 3VZMA 1APNA 3FFZA 4ZX9A 3AFGA 1O4TA 1E5SA 4AVAA 4U36A 1R1ZA 5FYBA 2VY0A 2E7TA 4SBVA 1VRH3 1US2A 5C4WB 3CL1A 4K20A 1RUF3 4RI1A 4E2QA 1SFNA 4BIFA 4AHXA 5FTTC 4GJYA 5BNNB 4A33A 3WF2A 3DKWA 2DV9A 4AGGA 4EN0A 1JXNA 2WZR2 1W8WA 2J8RA 3THCA 2D3RA 5GJ6A 1NXMA 3I9SA 2HEWF 5FYVA 4I0BA 3H8EA 4FP2A 5A32B 3VWEA 1U12A 4K1ZA 2WLPA 2FZ2A 1QJZA 4A4AA 2PLV3 2JDNA 5G05L 3IBMA 3LFIA 3WHUA 3VBSA 2NZ9A 4YM1A 1LAPA 3MGDA 1H4HA 3ZR5A 1J59A 3N7LA 2VUCA 2PJAA 3B5LB 5JSPA 2YGWA 4BQ5A 3IWEA 5FPAA 2QUOA 4Y22A 3VARA 4FWUA 4UBRA 1YIPA 1CX8A 4P4BA 5AC92 5D1IA 3WHTA 5FMOL 1ZRRA 4OC2A 1Z8LA 4YFWA 5FXWA 1BBT1 2EK9A 5JXGA 4X8IA 5J3UA 2VXJA 1VIWB 4PK3A 4YLZA 5HBAA 2NN8A 3AXEA 2A73B 3KR5A 5FZOA 3POYA 2P2KA 5FYYA 3MF9A 4OMDA 3UKTA 4YZ2A 3VL8A 3BI1A 2GE3A 1FV3A 4HN0A 2AZ5A 3O1OA 2D43A 4B7KA 1U5IA 1MS1A 5F6KA 3J7MA 3W5MA 1PM4A 3FUQA 1C3HA 3OJBA 3MIHA 4NR1A 4BE3A 4P5HA 2ZGTA 1VBE1 3NV1A 2ZX0A 1ZRCA 4UWJA 5K7PA 2YU2A 3PP9A 4R4ZA 3QLQA 4M3CA 5CKMA 2GSYA 3CPXA 4KI5M 1PZ7A 1VHSA 2XKOA 3SNMA 4W6YA 3ACFA 4H2KA 3SH3A 4PV6A 1PMJX 2BU9A 2YGLA 2W91A 5D8AA 4BMBA 3VBUC 5C9AB 4CU9A 3D5OA 4CDUA 2ZZQA 4W8JA 5IAXA 8CPAA 1FY7A 5A3MA 4CDXA 3PB7X 4CGOA 3USSA 3H8FA 3CZUA 3UKVA 2PHUA 3K3NA 4JRLA 2OZ6A 4EFDA 5BY5A 2PQQA 5JAXA 3UGFA 1I3HA 5DABA 1AHSA 3RYPA 1REFA 4AB7A 2G9GA 2IWGB 4XNHB 3D8CA 1K45A 2UURA 2V4VA 1KEXA 4I3PA 2ZBJA 3LAGA 2VMCA 4PXDA 3MIFA 4Y1ZA 3I3BA 4RA0A 4XF0A 1UMIA 1CZTA 5BXXA 2AJ6A 3AL5A 4LNVA 5IT6A 2R1IA 3ZSKA 4P5YA 1CAUA 1YW4A 4AFMA 3ZYHA 4YZ3A 4UF4A 4LLOA 2QFEA 1F57A 4JGYC 1N71A 3IPVB 1SBDA 2ZGRA 4LBJA 1AL0G 2JKXA 1ZREA 5GLUA 2YNCC 3IM0A 4WZCA 2EUIA 3VV1A 5EJ3A 4QX8A 5ERLA 2V09A 3H8XA 4B3NA 3T9YA 4MSVA 1WD4A 1A8MA 1TF9A 3UK9A 4CXYA 2PSWA 2VOVA 3HIFA 1MZ6A 3FJUA 2A6VA 2J1TA 3OBAA 3WP3A 4ZXEA 2RS32 5FZKA 3HMYA 3FMCA 2AC1A 2W1SA 3AZXA 2LRPA 4LJHA 5JCTA 1TME2 4MLOA 3ZFEB 4ZHNA 2LW8A 3NV2A 4YG3A 4QPGB 3RO0A 1G9FA 2RDRA 1PVC1 1UCXA 4XZPA 1JYNA 4CEWB 1Z7S2 5IAVA 1OQ1A 1NE4A 3RZKA 3MW3A 2O1QA 4KSFA 4B7EA 5JPMB 4A39A 1XXNA 5FK8A 3T2TA 1OFSA 4Q29A 4QAWA 5A3LA 2DVAA 3WSOA 2C9KA 4YNIA 4D3WA 3K75B 3MRUA 2YG0A 4BZ4A 3IC1A 4N53C 1W9WA 2PJCA 2QCSB 4HN1A 4NPMA 4R8FA 1ODNA 2WLQA 2QQPA 4DXTA 4MHUA 2YUEA 3ZXGA 1JZ8A 4Q38A 4NWVA 1GQGA 1V6IA 3O1MA 3WNPA 4Y5TA 1LHUA 2BPA2 2VMEA 4R9MA 3M4FA 2ZEWA 1FAYA 4QQOA 3L2HA 4OCTA 4QD2A 3JD71 4I09A 4Q4X3 5F46A 5DAPA 1XNTA 3BU7A 2X05A 3S5QA 5BYNA 3FNCA 2Q7SA 1MEC2 2FIWA 2YGMA 1Z9UA 3JTKA 4BQWA 2AGSA 2VBDA 4AVVA 4MO3M 2RDSA 3Q8BA 1SPPA 2AR6A 1M4GA 3VBOC 3W58A 1RVF1 1GOFA 5L73A 2DXQA 1UU6A 4IUGA 5A6QA 1CVNA 5FQ0A 3U78A 5L36A 1X82A 5GLTA 4GKXA 3C7OA 2O53A 1YR0A 4ZS2A 4HPKA 4K3NA 4GZ9A 3B94A 1J1TA 1O6UA 4JGZB 4MHPA 1NYWA 5CNPA 3O1SA 2PJ9A 3GBWA 3PB9X 2JG8B 3EXUA 5K8NA 4OVEA 5FO9B 1NCQB 3IDCB 2JG9B 3IDEA 1XPWA 2A3WA 4UF0B 1Q8SA 1JS9A 2W52A 4AI9A 1LFWA 5JMOA 1IKPA 4GWJA 1X7NA 1HB2A 3PFOA 2G19A 2X10A 3CNAA 5IVCA 1RUH1 4XQWA 4D7TA 2R7EB 3GZAA 1PO11 4RHV1 2I3CA 4BJ0A 3B7IA 5DS0A 1K5MB 2YV8A 5F5AA 4GWMA 4HPSA 1V6MA 2JIJA 4XVHA 1LEDA 1UN1A 5L7OB 2ZGMA 4Z82A 3B3QE 3FJSA 4A42A 2WAAA 1XRUA 2C9AA 5EJ1B 4AE2A 1UX6A 4KWJA 2OB0A 2EBJA 5LB6A 4B29A 3PVBB 3MYXA 3TAYA 3T4HB 1PM7A 3KHZA 3LPFA 1O3TA 2BNOA 2EICA 1ACCA 3TC8A 2ZTNA 1IOFA 2ATRA 5DDJ1 4IL7A 4CP9B 4NEXA 1UMHA 2B3VA 2E33A 3H9AA 3AKRA 4K40A 5ANQA 2VXKA 3ST7A 4Z65A 5EZWA 2XJVA 4M00A 5GZDA 3S9NA 3SEPA 3NAPB 2GNMA 1HDUA 3BKZA 2ZX3A 4FVVA 4KGQA 2BZDA 2XJPA 2HKXA 1Y9WA 5DN2A 1I9RA 4OC3A 3J4UH 1JODA 4NGTA 3KQRA 2PIYA 3LGRA 2ILMA 2J8MA 2E31A 3VKOA 5JOYA 3CJIC 5F9TA 4PBOA 3UYJA 4AVTA 3FMGA 2HWF1 4AHZA 1W6OA 3EYPA 1W6PB 1H1MA 3RZZA 1D2SA 3NJZA 1HQLA 2H6BA 1Z4RA 4RUHA 2B4DB 2GNTA 2WFPA 2CXAA 2B58A 1FPN1 2EIEA 5F3EA 4Q4W1 4Q27A 4NGMA 4UW6A 3FYNA 1TEIA 2EXKA 2DU0A 1S0BA 4YW7A 5FXXA 2QDNA 1JOJA 1WW6A 4JQRA 3KLSA 2XBO1 4FPCA 1Q8QA 1Y9MA 1J83A 2WR9A 3ZYPA 3LA3A 5FCCA 2JB4A 4WM7C 2R32A 5KXDA 4JJXA 4XXPA 4AEDC 4HK9A 1R1A3 4ZY2A 3NV4A 4BCUA 1ZRFA 4UEFA 2V72A 3TEYA 1F15A 1S0JA 3R05A 2B3UA 1DGRA 4HZFA 1QOOA 4XF3A 1A2ZA 3LPGA 4AEMA 3ASIA 4XDOA 1GKBA 3WC5A 3VBHC 1H9PA 4YSFA 4KQ7A 4AVBA 2RJ2A 4CCJA 3PTRB 1UKGA 4CTEA 5FZ1A 2BBVA 2VULA 2R6QA 4LULA 2JENA 3WNMA 1AR61 2CTCA 2EIBA 1DYOA 3BTXA 2PHLA 4WJBA 1SFYA 3KV4A 3O1UA 3OY8A 1DE4C 4ZY0A 4AFCA 2XEJA 1YX0A 3UJQA 3VBSB 2VVEA 3NKGA 4N43A 4QX0A 2LALA 5K9YA 1T6GC 3CHXA 2HJIA 2JDUA 4LLFA 2WN3A 1QJU3 1W8NA 4UWDA 4Y22B 4PIYA 3K2OA 1N3OA 3M3EA 3KD4A 2EO8A 1Q3EA 2IVIB 3SITA 4LBQA 2ZMNA 3ZFFC 1OQDA 1B09A 4HBNA 1YHFA 5JXHA 2QVPA 3CZXA 2G3AA 3B3TA 2R98A 1IYLA 1DIWA 1AYN1 1BBT3 2ZMLA 2ZW4A 4LUKA 1O5UA 2VCAA 4GKYA 4LK6A 3UETA 2BVBA 1GR3A 1PGW1 2IFRA 5CVRA 2Q4SA 4UCPA 1R092 3IGRA 1UO9A 4UFJA 1XSRA 3KR4A 4ARXA 1SCRA 1YI9A 2F4PA 1OUSA 4Q0QA 3KQ4B 3MFAA 5GZCA 2A70A 3WDUA 1M4IA 1DGWX 1XMBA 4R52A 5F7UA 2YBSA 1N1YA 4CDWC 3RNZA 1QJX2 3GLJA 4FPOB 1Y9QA 1OVPA 5C8CC 4M3CB 1OKOA 3G8WA 1QNYA 2XEGA 1JHNA 2HWD1 4YRDA 1UWWA 4O61A 1JOBA 3PUAA 4P9XA 3M1HA 1S3ZA 1NLSA 5CKQA 2VG9A 5C5TA 4YVSC 3D8PA 2BGOA 3H7YA 5GLWA 5GZGA 1JZ2A 2R8VA 3C26A 4QM8A 2OR4A 4YFZA 3OGGA 5J7MA 1CR7A 2VOXA 3VZLA 2IUWA 2QDRA 3T2QA 1YVOA 4IV3C 4TLGA 3KB5A 2I00A 1EAH1 4CDXB 5CNAA 4IQPA 1A6CA 2G4IA 4BXSV 3EC4A 4H14A 2BUEA 1NE9A 3VBUA 1OH4A 3USUA 2WQZC 4TXWA 2YPJA 1W3VA 2PN5A 2ZGPA 2A4NA 1ZBA3 2CGOA 1LGCA 2RS52 2ET1A 2VH9A 1OLQA 2RM21 2JBJA 3S30A 2KXLA 1VAKA 4EMEA 4IEUA 5DG1A 5F49A 1LHWA 5KXEA 5LW9A 3OBZA 3VHOA 2H6CA 4CU7A 4B4RA 1VIXA 4Y33A 3O1RA 2QIRA 1R083 1CAUB 5DUWA 2OIIA 3B2YA 1S0GA 3FE5A 4YFJA 3EY5A 3V56A 2IVJA 3P3NA 1DFQA 3K4ZA 4NVPA 3E5QA 3ON7A 2HC9A 2WNOA 1UZ0A 3L2YA 3TEWA 3KASA 3ZOIA 1RUJ2 2ZEEA 3DR6A 2K46A 3FXTA 1X33A 4P4JA 3Q9OA 1U5ZA 3WX5A 3MI8A 5EMIA 1A3KA 1MS4A 5FVJA 1LRHA 3TYJA 2RS53 3OGSA 3JCIA 2YNCA 4FOQA 2GC2A 2D6KA 3LACA 5BNNC 1Y0YA 3VHPA 4EN7B 2MEV2 4QKFA 5F1RA 4BB3A 2E51A 4AGVA 4FD7A 2CAUA 4IE5A 1FMD3 2DVBA 3VD4A 4U2AA 4GH4B 5CA6A 4BINA 4LO6B 4Z8BA 2DCTA 1QDCA 3V0BA 2QQMA 5FZIA 1JYIA 2WO2A 4KU7A 2ZCWA 5CZKA 3NNFA 4XQ4A 5LY1A 3RYKA 2ZGLA 4KH9A 1DP0A 1QSOA 3OSDA 4NHXA 4K30A 4AYUA 4MG2A 3AC0A 3WC7A 1JZ4A 1QJY3 3WDTA 3ORJA 3CPAA 1W6MA 4IE4A 3VKNA 5CAZA 5FYTA 4AI3A 1ELMP 3I59A 1E5IA 4OHYA 3NO8A 2O28A 2I2SA 2WZPP 4BOWA 2RB7A 2VPVA 1LOFC 2PJ7A 4UW5A 1JOPA 4DUWA 4NHLA 2RFHA 2D40A 1PK6C 4FD6A 4P6YA 3OTFA 2E32A 2NPIA 2WINB 1X36A 1HRI1 2VBQA 2PMWB 3D3AA 5CEHA 4E4HA 4N53A 3J7HA 2RS12 4HKFA 3HQUA 4ZKTB 4NJQA 4NIIA 5FOJB 4Q4V2 3JD73 1AXZA 1XBFA 2X09A 3ZXAC 1SPPB 4YGDA 4RSUA 3LOBA 2TEPA 2J1RA 3GYDA 1PO21 3DUIA 4MGSA 5FQ0B 5TSWA 1RUE1 3ZFGB 1EYBA 4R9CA 2GH8A 5JIAA 4KLVA 1EV11 4HPKB 3CXPA 1QXRA 4L9BA 3SXNA 2IXHA 3FL7A 3VBOA 3ETPA 1CPXA 2RR12 4W65A 2VZ3A 1VBD2 4KWUA 2DBIA 4CGNA 3ISZA 1W99A 1SLAA 1GANA 3AX4A 4OC4A 2D6OX 2Y0IA 3P5BA 4EN8B 3D7FA 2W9XA 1OH3A 1HB3A 3POBA 3B02A 4MHNA 4FPGA 3CO2A 4PHZA 3ITQA 3V8IA 3POSA 4KOSA 1VMFA 5GZEA 2PHFA 1IY7A 1RUC1 3WD5A 2XL7A 4CCEA 1ZBE3 3WDVA 5LWBA 2X5IC 1EUUA 3U14A 2YZ4A 4NGRA 3CDZB 2Q0AA 1VGYA 4XBQA 4XETA 4OC0A 4PIXA 4X2TA 1F5JA 1G9DA 1PO13 2JDDA 4NCZA 5E1RA 3LEIA 4GA9A 1D0HA 4FUUA 3SQOA 3D68A 5L19A 3N4MA 2RR13 3A22A 2VO5A 4LBNA 4H89A 1NSAA 3ZYFA 5LEKA 4Z2AA 1WZXA 2VZ1A 4BQ4A 2Q8EA 5KHJA 3JBG3 1AL22 5JOZA 2BL1A 3FEEA 3SHRA 4IEVA 1OA3A 1QY4A 5FZ0A 4GWNA 4B4PA 2Y8KA 2REEA 1IOAA 1OPMA 4XUOA 1CJDA 1LKNA 1X10A 1XNAA 1S2BA 5DUUA 4EQVA 1VAVA 4WVVA 1VKCA 4JWPA 1D4M1 5KHHA 1CPMA 1JUIA 3VHRA 2ZAHA 5C70A 1CPNA 3GZEA 3N9OA 2V8GA 2ZHKA 4AXVA 5DZEA 2DU1A 5A3TA 4QDQA 5T3NA 2YB7A 3LIHA 2E53A 1ZZ9A 2F6BA 2FIAA 5C3PA 3THDA 2GLFA 3H0OA 5DG2A 5IVVA 1IPKA 1U6MA 1RC6A 4QPGC 4XFAA 2ZEMA 1HV1A 1Q5OA 4V2WA 5AG5A 1W6OB 1TZOA 5HVFA 4K7JA 2Q8OA 1WLDA 1AYM2 2GAUA 1M44A 1XE0A 5AFEA 4CEWC 1PIV3 4C8DA 2HWF3 3KT1A 3TNPB 2HUZA 2Z3MA 2EWBA 1SQ4A 3ZYBA 3CJIA 3DV8A 3BN6A 1YNAA 1CX4A 1Q43A 4QDSA 4DYOA 2ES3A 1REEA 2CU5A 1VAMA 1BEV2 3CBNA 5C8WA 3OYWA 5IFTA 2P4EA 2DUPA 3C2UA 3H5ZA 3LA2A 5HCFA 2XBO3 4GQ7A 3VBRC 1R3NA 5T5LA 4K8RB 5A27A 1FOD1 4KBZA 1NA1A 1WGPA 4GMP0 1XNCA 1Z4EA 2HWB3 3AMMA 4BD9A 3LDRA 4WM7A 5I0RA 1F2PA 3IB3A 1LNSA 1W6QA 2WFF2 3IWGA 2A3YA 5FXVA 2ZGKA 1LENA 4DXRA 2JICA 4JZ0A 1SCSA 2QVSB 4UI9L 4A2ZA 4QX2A 2GP3A 2ZKNA 4HSLA 1YUDA 1CP7A 2OW4A 5CKNA 1NOVA 5FYIA 4QC6A 4D8MA 4XJUA 3T09A 3EO4A 3FWEA 3OY8B 1RMU1 2DCZA 4JGZC 1PNFA 1DDLA 2JBKA 3POIA 4IGQA 2PHRA 3N3HA 4C0HA 4N43B 2NM1A 2XPJA 1W6NA 3AVRA 2R0HA 5KXBA 2Q44A 2JG9C 3S0MA 3FLTA 2VVDA 1UZZA 4NIAA 1UPSA 3NRUA 5E89A 3FH4A 4BMEA 2O0OA 3BOPA 5JOWA 4HSJA 2FBEA 1CPSA 3MEPA 2XVKA 2R061 4O65A 5CB7A 3LQCA 4AVSA 1RHI1 3T1LA 4LBQB 3WR7A 3PUHA 2WO1A 5IV0A 1K5JA 4AR2A 1LEMA 4B13A 1DZTA 2BRTA 3KCCA 2OZGA 4FPEA 1W2UA 3OBTA 3ACHA 3T1MA 2W39A 2DFCA 5KC6A 3ZFFA 1K5MC 3ZXFA 2VZUA 2XUEA 1XJOA 3MBWA 1ZVFA 5T5JA 3T2OA 4GULA 1ZRIA 4LE3A 4P4FA 5HMNA 4IK2A 2ADDA 4RGAA 3NW4A 1E5HA 3D2MA 1GQHA 1UXXX 3ZXEA 2PR1A 1MZEA 4P9YA 4BQ3A 2Q0YA 3KVBA 2A6ZA 3E5XA 3J8F1 5CISA 2DFBA 3AP5A 2C1FA 4R3LA 2Z5WA 1XE8A 5HXVA 5LBFA 2XLFA 1V0AA 1FX5A 1GOGA 3LEMA 3SC7X 1HX6A 1XNBA 5JSOA 3IU1A 3I1UA 2XEIA 4MI4A 4NIHA 3DR8A 4CVUA 2IQ6A 2DUOA 2EXHA 3IN9A 4K9SA 1CJWA 4JRAA 4P9WA 1SLTA 5FP7A 3BOWA 4XBNA 3NE7A 5IVEA 3WT4A 1H2LA 4CPBA 1KUYA 4LO8A 4CDWA 3FUOA 1RUD2 2BSWA 3NAPC 4ATEA 1ZZ8A 2HWD3 2HYKA 3GJAA 4Y24A 1HXS3 5C8CA 3CEWA 1BCXA 5IHRA 5DXDA 4P00B 4L99A 4H6ZA 3W21A 1GBGA 2XQXA 1IYKA 1BK1A 1LU2A 4YVSA 2BDRA 2PAMA 3MW4A 4JC1A 2X29A 2WN2A 3TEXA 2WT2A 3USUB 1W9FA 3TCVA 4QXKA 3WZ1A 2GIVA 1RUG3 2PYTA 4XFGA 4JDNA 5HCBA 2PDOA 3LF7A 2V8VA 2D44A 3FX3A 5I4MA 1STMA 3GHMA 4QB6A 4B4QA 4JV4A 2RM23 4CYOA 3U4XA 1XMTA 4U9ZA 4FFFA 4GMP3 2K2SA 2PHTA 1RUD3 5F32A 2ARHA 5KXCA 3WINE 5A7WA 3G6JB 4P10A 3LA7A 5I0TA 4XIOA 2GN3A 1W8TA 4AFDA 4P44A 4YW1A 2YY1A 1BKZA 1AMPA 4Q4Y1 4LQ6A 4I30A 3LEKA 5FRAA 2ORZA 1AR73 1HRV1 2R043 4CCCA 1NT0A 1ASJ1 3PGPA 3TTHA 2D4PA 4RGKA 5I0UA 5KTDA 3K9UA 2ARXA 5GM0A 2K9ZA 3RYRA 2YXSA 1V9U2 1VRH1 1UNBA 5FZDA 2ZGUA 4QHBA 1B87A 2D5FA 2XWJB 1VB4A 4LHNA 1RUF1 2WQ4A 1LOBA 1VBB3 3H1WA 2ADEA 3ZN5A 5FPBA 2ODFA 2OX0A 4PJYA 1S2KA 1W04A 4OUMA 3V0BB 2ZGSA 2VD7A 1VBE2 2QQVA 4FCAA 4HONA 3L9JT 3VKLA 1DGWA 4B5PA 4RFT0 5ELYA 5CBMA 4MFPA 4K21A 4PLNA 4DXZA 2VW0A 1W9YA 1H6XA 1UY0A 1W3XA 3EB7A 3KT7A 2PLV1 5FPLA 4DOUA 1W6MB 1QQ9A 1CN1A 2DCYA 4IUSA 3ACGA 1O3SA 4NMIA 5FPXA 3I59B 1OURA 5JDBA 3HNYM 2DF5A 2OXBA 1UWYA 4CS0B 2ZEHA 2WO7A 3JQWA 1IGOA 4DPNA 3FHQA 2C1CA 4R3KA 2CTBA 2KM2A 1YMEA 4OI2A 4HL0A 4MCPA 4IW3A 5EPAA 2JIGA 5FV3A 3HLPA 2OZHA 2R49A 2PJ5A 3IMMA 4XHXA 4CYPA 4IV1C 1LOFA 1V70A 1HRI3 4J3GA 5J09A 2LROA 3JUWA 4GD4A 2AFOA 4LA3A 4KOXA 2ERFA 1PK6A 4F0YA 4XAAA 4DNYA 1XFOA 3FHIB 3J7NA 3FEDA 5AG7A 2FCVA 2VUAA 3EBRA 3CKHA 4II9A 1GP6A 5FY9A 3MGUA 2ZEYA 3PBEA 3TO9A 1YFXA 4CP2A 1TE1B 3WW2A 2AYHA 4TNUA 2WUHA 2ZABA 3F95A 3C8XA 5A7PA 2O8QA 3P2HA 3WP4A 4IEOA 2WPXA 4ORFA 5FOBB 3OEBA 5FZ7A 5LRRA 3VBOB 1H1IA 3DGVA 1PZ9A 2F7VA 4A44A 1CIWA 1RUI3 2VQAA 1MVEA 5EQUA 1FI2A 3BCWA 4ZY9A 2JB8A 4QU1A 3IIBA 4FTEA 2W92A 3GGLA 1C57A 3UT0A 4ISQA 4W4ZA 4QBJA 4CAVA 1QSTA 3ILRA 4UFKA 3RZAA 3VL9A 3I3MA 1E57A 4BBHA 1QXPA 1ENSA 1ZG8A 5IFPA 1ENRA 1LCLA 5EYYA 1LOEA 1V0CA 3RI8A 3BLNA 3WF0A 1RUC3 2WWSA 3SKJE 4MOAA 1QQP2 1JN2P 4BA6A 2G3TA 3ZPYA 1PVC2 4FQ4A 5EV7A 3I54A 1HKDA 1IOIA 5IW0A 2WBKA 4Q7AA 5EP9A 2X5IA 2PJ2A 4MGQA 1XC6A 2EVXA 2MNGA 3I49A 1AR93 4O7XA 3W5NA 4M3CF 2WIIB 4ZGYB 1BOBA 1RYYA 2B8MA 1W9SA 4GB32 5KHGA 5JUVA 4A6OA 2Z0ZA 3H3LA 1NG0A 4UFHA 2ZACA 2JDHA 5C3SA 3LB9A 4XACA 2XMLA 2WL1A 3CLPA 1DYKA 3DL3A 1MS5A 5LYFA 4UOJA 3HNMA 4UCNA 2IXJA 1TF8A 2ATFA 2AFMA 5LASA 1ARMA 1FV2A 1H4GA 3M3IA 5LBBA 1MVQA 2NP0A 1H8LA 1W8ZA 2PR8A 4OIWA 1LOCA 3AMQA 5B4NA 5JZGC 1LRZA 1RINA 4XILA 1IHMA 1Z0HA 2BGCA 2AEZA 3THPA 4QKBA 1QXJA 1N1VA 1RVF2 3SJEA 4HXCA 3VGIA 4GH4C 2GN7A 1W2TA 4N7IA 2OZUA 1ON0A 4B6ZA 1CJPA 5A80A 4JXQA 5BNQA 4C7HA 4PQQA 3O0VA 2Z42A 4NHMA 2P5BA 3KGLA 2LUWA 2Z4FA 3CJIB 1YQ6A 4K6BA 4LEJA 3WEZA 4R9AA 4BK4A 2AFSA 3FLRA 5E8AA 3VUOA 1COV3 2GNDA 4LBQD 3OYWB 2QNKA 4YZ4A 4B5OA 2QQUA 2FSRA 2X8KA 1REDA 2VEZA 1LTEA 1YVKA 1I5ZA 3HAGA 4UBGA 4FTSA 1OFNA 1VBA2 3FC0A 3QH6A 5FY4A 5JI7A 1IS6A 1NA1B 1RUH2 3ATGA 4JLYA 2RS31 5HXMA 3JVNA 1LHVA 2QQNA 2Y0MA 1FOD3 4WM7B 1TME1 4RHV2 1WLTA 1RTVA 1W05A 1W6QB 3VBRA 1L0CA 5K4LA 3RVHA 4F8AA 4Q4X1 2JDYA 4D6QA 1P0HA 1AX1A 3NSTA 3UL2A 4FPJA 4GS4A 5FLIA 4A7ZA 2EF6A 4NJ4A 1P8JA 3POGA 2Q4VA 1Z7S1 5LRSA 4MHRA 3F8KA 4AWDA 2CHHA 3ZFGC 3P3PA 3M7AA 4Y26A 3C7HA 1JWQA 3SHPA 2RJKA 1W8HA 3K4AA 1S2EA 4FOWA 4LBLA 1NY71 5LRKA 5J98B 2JE7A 4BQXA 2Q7BA 2Z3KA 4HNWB 2IXKA 1W6NB 4XUQA 5JXIA 4LT5A 2XJRA 2V5YA 4G4FA 2W95A 4I02A 4XJAA 2JEVA 3AP9A 1LOKA 1F9KA 4R87A 4CGPA 4COYA 4PI0A 2E6VA 5FP4A 3I2GA 2G1MA 4QX7A 4OKOA 4ZPIA 2OQ6A 1PUAA 4DB5A 3TOBA 4KLWA 5DWNA 2OZJA 5CPAA 5CBLA 4NPLA 4EWDA 5HCAA 3Q8AA 5LA2A 3ZLIA 4EZ4A 4UAPA 3VDBA 1XYPA 4Y1VA 3KZ4C 2GC0A 3CJXA 1KUXA 3R9GA 5CFCB 5J8FA 3H8OA 3H42B 4RQPA 3TN92 1AR83 2VI7A 4AOCA 3ALQA 1YRZA 1FPN2 3JUUA 1DTDA 4Q4W2 1Z8WA 2Q4ZA 2Z3PA 2B45X 1VMHA 5LBCA 2TBVA 5I8SA 4MXUA 1FNYA 2OPKA 2CDOA 3VBFB 5IB9A 2ZZJA 3J8F3 1NQJA 3E0KA 3P1IA 4KMQA 2ID4A 1BAVA 1KGYA 4GAZA 1OOPB 4EVYA 4EROA 2D98A 1WKYA 3VKFC 1RJ8A 1PNGA 4Z92B 1BVP1 4H7MA 4YYOA 5BNPC 1LANA 4M6IA 2JECA 4GM5A 4AQ6A 5C8CB 1ZG9A 1ELLP 4YGBA 2UYBA 1R43A 1W03A 2VQ0A 1OF3A 4JTOA 3U37A 3B3WA 1WCUA 2VUDA 2PJ3A 1M4DA 4S2FA 3SEEA 4N7UA 4XFCA 2Z3LA 4NGPA 3UY5A 4N9HA 4DFSA 4ET7A 3TWIA 2BNMA 1F8VA 1AR62 4BIOA 4HVOA 3O1TA 4NE9A 1XQNA 3AP4A 3NNJA 1UIJA 4XC9A 1C5IA 2VR4A 4ASMB 3C7GA 2RDQA 2HWE2 1DHKB 3CF6E 2JE9A 4P4EA 2WA3A 1YSJA 5FZBA 5E6HA 4BLIA 1OI6A 1PGL1 5FZCA 4OIDA 1R57A 3TOAA 4IF5A 4MXWA 5A7WB 3LWUA 2B4DA 4KVME 2OOTA 3O7OA 4RN5A 1GV9A 5JOXA 3ZYGA 4KNCA 4Q1PA 1RTQA 2C24A 4MJ8A 4AI2A 5FZ6A 3UGGA 2Y34A 4YW6A 5FZAA 3VZNA 3D7DA 4NGNA 4PBPA 4Q4Y3 2BERA 1AYN2 1R1A1 4BU2A 4H6UA 4NHKA 2R072 2PAEA 3OOXA 1ASJ3 3IKWA 3U07A 1PGW2 2D3PA 3S6FA 5CFDA 5IVFA 1XBUA 4KG0A 1PMIA 1CAXA 4CU8A 3AP6A 3BPSA 1DZQA 2A1XA 1J4JA 1VBC3 3HQXA 4OMCA 4XUNA 2WZNA 4LXLA 3RYOA 3OBRA 4F8ZA 3IAQA 2JDPA 1IIDA 4ZU4A 3HPNA 3MIGA 4Y3OA 4B5PB 5IK5A 1KDMA 3PLQA 1SBFA 1C5HA 3ES1A 4N43C 2Q51A 3V38A 3KHBA 4ZZ8A 2GC1A 5A1LA 5EHDA 3N9PA 3O1VA 2XDVA 2ETEA 2WRAA 2QMLA 1DLLA 1QJU1 2Y6GA 3MPBA 4MCRA 2BFUS 3I97A 4RL7A 3CDXA 4CEYA 1SDDB 4XFBA 4NRPA 5B2GB 4XJ8A 2WPWA 1F31A 1QJFA 4CXWA 4QX5A 2CGNA 4NF1A 4M3SA 4CCDA 5KTCA 5FJHA 5ACA2 2YC4A 1PK6B 4FPHA 2WZR3 1JYXA 4CAFA 2CNAA 2WA4A 3NJXA 1O59A 2J1VA 2BV4A 3WP6A 1VPHA 2QQJA 2PJ1A 4IV1A 1YLEA 3IJ3A 3PEIA 3LSDA 4Q0VA 4R8HA 3GYAA 1GYTA 2SBAA 5EWSA 4L97A 3OPWA 1OLME 4FBFA 1UZVA 1XOYA 2WSUA 3QACA 2ZHLA 4XTMA 4NHYA 4XJ9A 2RJLA 2ZEFA 4CZSA 2XEFA 2VCMA 3PVEA 3D66A 1W0NA 3N9QA 2UYAA 3ROUA 2ZEZA 4QXHA 5FY1A 3RSJA 1KS4A 2JDCA 1VLNA 1OHFA 3LODA 1UOFA 3B9IA 4GWIA 1YQCA 5AC93 2RV9A 2J42A 2HBUA 1JZ6A 3E5UA 5HXDA 3IO1A 4YVWA 2ZXVA 1JYVA 4ISRA 1GSLA 5EIYB 3M3QA 4WM8C 1UYXA 4BXFA 4CAEA 3I2OA 1WK4A 2YC0A 5C33A 2DDUA 3NE8A 1WW5A 5AGEA 1IPSA 4J1WA 3ZN6B 2Q8DA 1VB2A 1C1FA 5FP9A 4CPAA 3S6GA 3WF4A 2WSAA 1UY3A 4MRIA 4FFHA 1ZBA1 1F4HA 4NRQA 3D7GA 4JX0A 3OGVA 3DN7A 1POV3 4PXEA 5FZ4A 1GUIA 1KJRA 3SI1A 1KDKA 3WQ1A 2X5IB 1F2OA 4YWYA 3POJA 4CYNA 1HQWA 2XXZA 3QCWA 2Q4YA 1BMV2 2R0FA 1KZFA 3K46A 4XDPA 3KQZA 3NKTA 1R081 3BVCA 4NN0A 2CNMA 4X5KA 2QQIA 3VN4A 3ZSEA 5FY5A 4PXCA 1CAVA 3O1PA 4AQ2A 3ZYJB 4QWNA 2PHWA 5CADA 2P0WA 3WF3A 4MVTA 4CP0A 1PGSA 2B4KA 3D67A 4KOYA 4PI2A 3ZSJA 4FP3A 2RS51 3HN1A 1VR3A 3WQBA 1YI7A 3AYEA 4QVTA 2Y6HA 1WWYA 1RUE2 3KL9A 2UWCA 1GICA 1JW6A 2AFWA 5C6CA 4XDQA 2C6PA 1EV12 3OEAA 1FMD1 5JZGA 3PUSA 4DINB 4AF9A 2OS2A 2DTWA 1XF8A 4HVQA 2GMEA 4NRMA 1YK3A 4GH4A 4DUKA 3WQ7A 3KF5A 4KWLA 5FPZA 2PVVA 1WA6X 1HJGA 2ZAAA 3PVOA 1QJY1 1Z78A 4PSWA 2VQTA 4JCKA 4XPKA 5FR3A 4FQZA 3VD5A 3SCGA 1LESA 3BJ8A 4JD6A 1JU3A 2VUJA 5DAVA 2CWSA 1SLBA 4HKOA 2Z10A 3NMBA 3S6PA 5DMYA 5FZEA 2XGXA 2PCUA 1X50A 5F39A 2XJSA 3C3VA 2MEV1 3D7HA 3B69A 3RI9A 2RS33 2OYZA 3VBRB 5BWAB 2WQ8A 3GXUA 4HMZA 1G7YA 1QJEA 4FTBA 1TME3 3RBUA 3FHAA 4KWKA 2FL4A 5C88A 4OHZA 4RR3C 3T4VA 1AX2A 1Y9KA 4CUGA 1O91A 4PDWA 4OMEA 3AZZA 1Z7S3 4LHSA 4D7YA 3F5BA 1M4LA 1W2NA 1J58A 2O8OA 4LO5B 2LTNA 2ZMKA 4CPBD 2D6NA 3DYPA 3FF3A 5C5UA 2P6GA 3JRUA 2VU9A 2K0GA 2B5GA 3ZFGA 2REFA 3MLJA 5H9QA 3RNSA 4PQ9A 4XEZA 1ENQA 4JDOA 4BISA 1TKJA 2WKKA 1QNWA 4PT6A 3DPRA 2VMDA 4ASKA 1XEBA 4YARA 2WZEA 2P34A 1OKQA 1QMUA 1D4M2 2BTVC 5APAA 2ZOEB 3EO6A 1I1EA 1RUOA 1H8VA 2RS11 5KC5A 1JYCA 4Q8LA 4D94A 5A33B 3N35A 3I8TA 4ZX8A 4OFGA 1BVVA 2SLIA 4XYXA 1V6OA 5HVHA 1IS3A 2C26A 4QKNA 5IVYA 2GLJA 4Y1UA 1J3PA 3OGRA 1G86A 3HBZA 4Y49C 1MEC3 3BI0A 3RRDA 2G9ZA 5FDBA 3NH8A 1JMUB 1ZBE1 4LOTA 1C8M2 1DZRA 2VOTA 4RQPB 5JLVA 1OZPA 1NQDA 4NSQA 2DPTA 2QQWA 3TBDA 2FCTA 1YYNA 1LAMA 4QHZA 2ORXA 1YQEA 4E0AA 4LQRA 3UKNA 1SDWA 3B3SA 4OQ9A 4DMIA 3FECA 3W9AA 3PJQA 2WS92 3LOIA 2RR11 4JTNA 4CDQA 1OMIA 1S0CA 1VBD1 3MV01 5IYYA 3RZLA 5DUVA 4DQAA 4F83A 3K3OA 2OU2A 1Y0RA 5HVGA 1NCRC 2AH2A 4WV8A 1JTZX 4OQ8A 3JBG1 4E4ZA 3T2PA 5A3PA 2P17A 2YPDA 5ABJC 4XF9A 4YU9A 4FPYA 4IXLA 3R1KA 4BPZA 2CY6A 4IEPA 2Z3OA 5I93A 3WUDA 1YJLA 4L0PA 4AQTA 5GALA 2ENRA 1NLQA 2HWC2 5BNPA 1ZG7A 5KHIA 3H4QA 1XE4A 3N7ZA 1QMJA 3RQ0A 2FCUA 5DQ0A 3VDCA 5FBZA 1I5PA 1XJAA 1TMF2 2C6CA 1JZ7A 1O4YA 2DCJA 3R0RA 4IHMA 2P6FA 2OPWA 4MGKE 1Z2LA 2BYVE 5FYHA 2BFUL 4N90A 2BOIA 1PIV1 5FZLA 4OUEA 1S7FA 2FDJA 3IDBB 1AL21 1YQ8A 4QPIA 2R16A 4BDVB 1J1LA 3CXSA 3T30A 4MXWB 2XKPA 4R9DA 3ZVXA 2VECA 2ET7A 4J1XA 1QIQA 1G9AA 2R062 1W39A 1RHI2 3AZVA 3DNSA 1LODA 1KQRA 1DQ1A 4Q1RA 2HWC3 2QQLA 1ULPA 2WT1A 1NA1C 3I7DA 3D0SA 4E2SA 2FMYA 4CCNA 5F8PA 1MJ9A 2JEWA 1YO8A 3KV6A 1KS5A 1CZSA 2HWB1 4A30A 2I07B 5CFDB 4MHYA 1CAXB 2L9LA 4GXLA 1DBNA 1L7RA 2RE9A 1ZO0A 3LZZA 5CIRA 5GLVA 2WT0A 3JB8A 1AYM1 4IERA 2ZX4A 3IMNA 3TRSB 3MUZ1 2ZW6A 4FI9A 1DGRN 4OZXA 4CUAA 1ONAA 4IEQA 5IJRA 4EE2A 1BZWA 3QNVA 3BTZA 3M8LA 2FE7A 1W90A 2C6GA 3INAA 4KSIA 2YHJA 4FXGB 1U5YA 1NSLA 2BCOA 1V6JA 4OP4A 1XNKA 2I79A 3LFMA 2XB6C 3OF1A 3A9LA 1H0BA 3PMSA 3T0AA 2PJ8A 4P08A 5JSRA 5FLHA 3JQXA 4P9IA 5IK7A 3NA6A 3MO4A 3K51A 4XAEA 4LBKA 5LA0A 3OCPA 5IUQA 4CEYB 1WUVA 3U75A 1AYEA 1IS4A 3WNLA 4A2UA 2NSMA 5BPXA 1N1SA 5JIUA 2CAVA 4OZOA 3O0WA 3AKPA 3AZWA 2IFWA 4AHYA 2VTFA 5CFCC 4P4IA 1W0OA 1HB4A 1PX4A 1IG0A 4EV0A 4QPYA 4UCMA 3PUQA 5KR7A 3VZOA 1DLCA 4IV1B 3GJBA 1ODMA 1SZBA 5T5PA 4C90A 2V77A 3TOJA 4YW3A 3VBFC 3WW4A 1CBXA 5D8NA 3RZMA 2E9QA 1JUHA 2BNNA 2E26A 1B6BA 3OPZA 3TT2A 1OOPC 1POQA 1DGLA 3AK0A 4PCRA 3MW2A 1MS9A 5LA1A 3D2PA 2FZ1A 1Z5RA 4FAGA 1I21A 2Q8CA 1HRV2 2RC4A 3BTYA 6CPAA 2JDAA 3I2FA 4IESA 3R9EA 3BPZA 1UU5A 3PTYA 3AM2A 1UOJA 1GZ9A 4QU2A 4YVWB 4B10A 1D0GA 1PX3A 4CGLA 1VRH2 1KWMA 1HXS1 3WDYA 4C2YA 4MBUA 4M6HA 1RUF2 2QJ8A 1PMHX 5A7SA 4EJRA 2QJVA 4WVWA 2GMMA 3WF1A 2BWAA 4RS2A 4MMOA 3S7IA 1R093 4WM8A 3VD7A 2ZEDA 2UY9A 3TB0A 4CCOA 2E7QA 3HN3A 2G0BA 2D7FA 5IK8A 1RUG1 2RMU2 1WLWA 2VW1A 5A3UA 5H9SA 3KKWA 2DVFA 2FDGA 4FSJA 5I91A 3B3CA 4EN6B 3PNAA 3PURA 1JHJA 2C27A 2W46A 1QJX3 4DUXA 4KSAA 3KMHA 4GMP1 3WG4A 4COUA 2LM3A 2W5FA 3WDXA 1RUD1 4COZA 4FFIA 3RPQA 4ONUA 4KORA 4RFRB 2IMOA 5J1QA 4A32A 1CAVB 4RN7A 1E5RA 3PJYA 4ATFA 3HT1A 2OT7A 1I6XA 2P3IA 3IZOA 5M0TA 3GM8A 5FY0A 4CRYB 1AR71 3LKJA 2R041 5A70A 1QGLA 1LGBA 1DF0A 4MHDA 1EY2A 3QB8A 5A3WA 4CCKA 1X8EA 1MS0A 2RMU3 1MACA 4YW2A 3KVAA 5AG6A 5LATA 5C3OA 4AI0A 4A3XA 5I0SA 1JYTA 1OC1A 3PU8A 4QGLA 3GY9A 2AFZA 2PVWA 4KOTA 4K3UA 1VBB1 2WNEA 5JZGB 2C5DA 5KWRA 3LSEA 4B14A 3IT8A 3WNKA 4OLLA 4H2AA 1PVXA 1GOHA 4QQHA 1ZZ6A 2ZS6B 1N3PA 1URXA 1ZA7A 3AMHA 2GMPA 1JQGA 2H0VA 4H7LA 3F2ZA 3SISA 3SH4A 4MGZE 3M3OA 4X6RB 4A31A 2YMZA 1U0AA 2GNBA 4H55A 3WLUA 1A34A 2FVGA 2D6MA 2AACA 1RUJ3 4PIZA 4NAMA 3S9LA 3N9LA 4HFSA 1S7LA 1YFYA 1V9U1 5E96A 4NWWA 5K0UC 3PBBA 4F7ZA 3AYCA 3BODA 2V8DA 4KBBA 4HOOA 2XLAA 3V64A 4IAVA 1XU1A 3EHKA 4DIQA 2MEV3 1ZLIA 3H8UA 1LOAA 1Z8TA 3LCPA 1MQTB 2OUHA 2UU8A 2WYSA 4QB2A 3APBA 4PDWB 5C7GA 1HV0A 4HNYB 2VOWA 4UIBA 4E4DX 3CT9A 2BEIA 4RR3A 4AXOA 2XVGA 2G9DA 3DXTA 4KVXA 3SI0A 4AG4A 4ES8A 2UY8A 1DQ5A 3W59A 3VKMA 2B5GB 3ZM8A 5A6YA 4JDMA 5FYMA 5G04L 3PIJA 2WNVA 2WUUA 4JKKA 1VMJA 1ND2B 3A23A 3DPRB 2BEOA 1RUI1 1HLCA 1OPOA 4CGMA 3J9SA 4M3CE 1H6YA 1YQ2A 4QHOA 1K4JA 1UY4A 1SFPA 2ZEOA 2Z11A 5HV4A 3BHXA 2AE6A 4LBOA 4A37A 3B3VA 4QX3A 1QSMA 2CWMA 5F2WA 5A3NA 5LRJA 2RS13 1P4NA 4PXBA 5F6LB 4XMAA 3ZDVA 4Q4V3 4FD5A 2YC2A 2N7GA 4O23A 3BALA 1HW5A 1QOSA 1IG3A 5A1FA 2E63A 4F0XA 4I3GA 2JLMA 4YGOA 4QXBA 5J37A 2XH6A 4AG7A 4CRZB 4XBLA 4FFGA 2ZENA 1CZVA 5J48A 1UZWA 4AL9A 4CDQB 5C3QA 4ZU7A 3VHNA 2VJXA 5DWMA 4J6GA 1AR91 4DRRA 4ZY1A 2PE3A 4QDRA 1K3IA 2GFQA 1ZA4A 2WNUC 1VBD3 5EXOA 3QAYA 4LE4A 2VXRA 5JH9A 1BPMA 4F9VA 3HEIA 4LO7A 2JE8A 4URAA 4E9KA 4UYBA 5JM6A 2VZOA 3HNBM 1UYZA 4JXRA 1NCRA 1S0EA 4LMFA 3PRTA 3ENRA 1WCSA 1CM0A 3I3DA 4Q4X2 3E6BA 5ABJA 5BNPB 4UW3A 4IETA 5LZ6A 4LOSA 4AAXA 1QQP1 4KG8A 2BO9A 2D4OA 5FZ9A 5FMDA 2W68A 3DCQA 3DEMA 3T0DA 2ZW7A 4DEQA 3PVNA 5FBJA 4MFQA 4LQGA 4X3RA 5AVAA 3VDDC 4E2AA 3GHNA 4XUPA 3MF6A 1DQ2A 4H3WA 3AFKA 2PA7A 3AXDA 3SCHA 2OA2A 3TE4A 1NY72 4AEKA 5LY2A 1AUGA 5A1AA 3JZVA 1OQEA 3DYMA 3U4SA 4GB31 3OUIA 1TG7A 3RZJA 1ARLA 3I3EA 5JR7B 4QPIB 3V0AB 3AKSA 1WMFA 2PHXA 1GHEA 1AL23 4NOTA 2DVDA 1COV1 2Y38A 2I74A 1R64A 1MPXA 2X7BA 2VMGA 4LKEA 1AJOA 4U5YA 1T2XA 1V00A 1ZZBA 4DY3A 4TN7A 1MJAA 5JMCA 3ME2A 4KOWA 1C8NA 2Q30A 5LK5A 4Z07A 2GANA 2XHKA 4QB1A 1ND3A 4YG0A 4AHWA 3I3GA 1FYUA 1LECA 3IFEA 1Y7RA 2JJ6A 2YBKA 1QHDA 1NMTA 2C0ZA 3ES4A 2VZQA 3R96A 5K8PA 3RJRA 1AYM3 2YROA 2R30A 3D4UA 2BP6A 5T52A 3KHXA 4YM0A 4YW5A 1RIRA 3PFEA 2AENA 2VBBA 5KTAA 3AKTA 4I2OA 5FO7B 1XOVA 1O3QA 4LR4A 1VJ2A 3I2JA 1BEV3 3RS6A 2GU9A 3DGTA 2Q1ZB 2PAKA 2XJTA 4WVZA 1NX9A 1VBA1 1LR5A 3WG3A 1ZYBA 4XPVA 3KZWA 3MZHA 1UOGA 4Y5Z0 4ZXKA 4QX1A 1FNZA 4C2XA 5EC4A 1L7LA 1YW6A 2J1EA 4V2VA 3ZXJA 4URTA 1SLIA 4DNCA 1UL9A 3W6SA 3J7LA 2VMHA 4BLJA 3BYWA 4QKDA 5F09A 4AGRA 3HJRA 5HCHA 5T50A 1IQAA 3VZJA 4NO4A 4YWAA 3CXQA 3ZIXA 4XE9A 1GZTA 2WFF3 4IEXA 2EXJA 4ZBGA 1KFXL 1FXZA 2Y26A 1O4ZA 4OADA 1OBNA 4XHBA 2J7MA 2VBPA 4RQPC 2XJQA 2B5HA 2VTXA 4W9YA 3WDWA 1JZ5A 3C7FA 4AG9A 5FIXA 3AP7A 1AR81 5CFCA 3HD8B 5HV0A 2IXIA 4OC1A 5FZGA 1TXRA 1PGL2 1QDOA 3B35A 5A3OA 1SMVA 5T55A 2VOKA 4JKLA 1WMEA 1GWMA 4OHXA 3OD4A 3NNGA 1PCAA 3IEHA 1DQ0A 4UIAA 3D4KA 4CU6A 2HH9A 4XURA 2ZOGA 2J1AA 3VBFA 4A41A 5FWEA 4UEZA 2PRBA 4XF4A 1Q8OA 4XUTA 5A7NA 5K8SA 3MIDA 2JWPA 2QQOA 5J96B 1MR5A 1OOPA 1QU0A 1R1A2 4XXAA 3ZKUA 4NGSA 3OB8A 1GNZA 3OUJA 4Y5SA 2VZRA 1TVGA 2V4AA 1WW4A 3POEA 1J84A 3PL0A 3S6KA 1CIYA 3KV5A 1AUYA 1XIXA 3SH5A 3PZJA 3TN91 4FO9A 2VQYA 4I0AA 5IB0A 3T0BA 1KRIA 1IS5A 5SV8A 4WM8B 1DU3D 1AZDA 3CQOA 4R6TA 3MFCA 1ZX5A 5F37A 1I1DA 1CX1A 4NUBA 1UY2A 2XWBB 1BXHA 3GUXA 1UPIA 2Y0OA 2CDPA 5FZHA 1EE3P 5FZ3A 1HIXA 1YC61 4YGCA 4HKWA 1O3RA 5A6ZA 2AFXA 3ISXA 5F5QA 2BGPA 1HDKA 1QH6A 3S57A 2VZSA 1MJBA 3WC6A 3MV11 4LUAA 3N9NA 3NNLA 1AJKA 3AJYA 1RXFA 1D2QA 4XFIA 2HYXA 5FFOC 4XPLA 2KR2A 2BBAA 2PC1A 2FXFA 1GZCA 1QJU2 4PQAA 4LA2A 1SLCA 3H3ZA 2ZELA 2Z3NA 5HPOA 2IC1A 3EMRA 2VQUA 2A7AA 1KFUL 1Y4WA 4DUVA 1HB1A 1G6NA 4BWOA 1YLOA 4OC5A 3M70A 2D5HA 1H8TC 3VZKA 4BHPA 2KD7A 3WW1A 3AYDA 1LJ7A 5DAQA 4UFVA 3MIEA 5CFDC 4IDZA 4META 3WNNA 4D7SA 1BBT2 4FOVA 4MV2A 3I3QA 2B4BA 5CYYA 4C2ZA 4B1LA 1GZWA 5GZFA 2VC9A 4LKSA 3Q8EA 4UW4A 2QKDA 4BH9A 5FJKA 3LEGA 3HBKA 2XUMA 1VBC1 2HWE1 2XHNA 3W6XA 2KCWA 1JI6A 1ULGA 3M2MA 3BJ7A 2RHPA 3BIWE 2HV2A 5J8CA 3KI9A 4UBHA 3SLIA 5H86A 3KT4A 3D0JA 3G3SA 3FZ3A 3ZR6A 4P4DA 5LK7B 4TWEA 2JX9A 4YZ5A 4CUCA 3P2FA 5JVVA 4UEEA 1T6BX 3WV6A 4E27A 2ZPXA 3K48A 3GB0A 1W8OA 1NLRA 3QBQA 4K8FA 4TWTA 3KCXA 4PLOA 1ULFA 1QSRA 1H30A 2XJUA 4CEYC 1ALYA 5FZOB 7CPAA 5LBEA 4JZRA 3ETQA 3RFRA 2R071 5ANNA 3POWA 2XLGA 2P3YA 2ZX1A 1BLLE 3MPPG 4EN9B 2Z69A 3FLPA 5F3GA 2OQ7A 3HR9A 2Y33A 1V9U3 1WMXA 2J22A 2PJ0A 3WVJA 4Z2WA 4AQSA 1RO5A 2WZ8A 1CONA 3WP5A 3WG1A 2W08A 5C3RA 3I2KA 5F5IA 1YJKA 3K77A 5B4XA 3WABA 2Q5TA 1ZBA2 1CAWA 5K0UA 3MLKA 3WW3A 4GJZA 3ZO0B 5FUIA 2WZR1 3GNEA 3MLLA 2PJBA 1XRYA 4RYDA 2Z2SB 4LHLA 1VBE3 5FMCA 1B35C 4Q26A 5BNOC 2W1WA 4HG6B 4OAEA 4RR3B 4HNXB 1V6LA 1W06A 1R082 4RS5C 4A3ZA 4W6WA 3WXPA 3LWCA 1V6NA 5AVPA 1TKFA 4GXHA 3OGJA 2VZVA 4IE6A 5D8AB 4RGGA 3B93A 2P37A 2ZX2A 3PDQA 2WNVB 4CAXA 4A95A 4UFLA 4CDUB 2NMTA 2YFZA 4M0NA 3SI2A 5F48A 1F2NA 4OUSA 4GALA 1J3RA 1SG3A 4JKMA 1M1DA 4YVWC 4DRVA 3E6DA 5AC91 5C82A 5JPNB 4L11A 5FREA 4MGTA 1PYTB 1W2AX 3PMEA 5ACA1 2AREA 2P6CA 3ZXLA 5DZGA 5FUPA 2BOJA 4C0BA 3B9CA 5FPUA 5CG9A 1DQ4A 3IAPA 4G1PA 1O5LA 4AVCA 4M01A 1WW7A 4LX9A 1Q56A 5JI9A 3H3UA 4C1XA 4CUBA 4UA3A 2YU1A 2VNGA 4IE0A 4OULA 3PUIA 1Q2CA 2JXAA 1FMD2 2WWJA 5THWA 1ZRDA 4JHTA 1ULCA 1OXCA 3X29B 4QQPA 1AXKA 3KSCA 3LE0A 2EAAA 1ST8A 1UF2C 1PU9A 4WVMA 3ZN6A 1ULDA 4Y49B 2FCKA 1UOBA 1POV1 1Z8XA 2WO3A 3KQXA 2WC2A 1WBFA 3JB4C 4IEYA 1QJY2 2B42B 4WWVA 2ZGQA 3B01A 1FT9A 4UFXA 4JGYA 4V1PA 3AB0A 5G1ZA 4JYWA 5C4WC 4ES9A 2EALA 5H9RA 1HDQA 3N7MA 1IPJA 3NH4A 3URFA 5FYZA 5DZFA 1YGHA 4YZ1A 2TUNA 4JQTA 4NFRA 4CRQA 2ZOFA 3KV9A 5FMBA 2QZ2A 3TO7A 2GC3A 1NCRB 1UZYA 2WNUA 4Y4YA 2DF7A 3NJVA 5ABJB 2J9AA 2O4HA 4R57A 4HETA 1W9TA 1XNDA 4ZYQA 2ZEPA 3JD72 2GZWA 1ENXA 4UT5A 3ZDSA 3U11A 2VZTA 1Q8PA 4IEZA 1QQP3 3P6BA 4Q5OA 4XMIA 1UFHA 4L2NA 1PVC3 1G9BA 3WNXA 2D6LX 3SJFA 5LEJA 3ZN4A 3J26N 4QQLA 1C28A 2W3JA 1L7QA 1BMV1 4AFAA 3F0AA 3R95A 3CMGA 3E97A 3ZYIB 1BLZA 4LUMA 1NE6A 4FPKA 4ZONA 2JKBA 3VDDA 1ULOA 3LDKA 4C91A 2FS5A 5DAXA 1UXZA 3LD8A 1XYNA 3Q8CA 1CQ9A 3GZTB 4CA9A 3ZXKA 5D2AA 2WYRA 4GB33 3AKQA 4NPRA 1RGSA 4LO4B 4I0WB 2R7HA 1Y7EA 2Y64A 3MDPA 2P1BA 2QBXA 2BJSA 1UQXA 1UY1A 1W8UA 2CYFA 4D6RA 1XYOA 1SACA 4S2DA 4COVA 2P3KA 4QT6A 3ILFA 1J3QA 5IX3A 1YIFA 1H2NA 3HVDA 3DSBA 2DYCA 3AJZA 3SJXA 2XOMA 1PHMA 2VVFA 4XFHA 3UNPA 3ACLA 1ZBE2 2A71A 1ND3B 5F3CA 4M0HA 4QB9A 1N1TA 3LDBA 1K42A 3OG2A 5FY8A 2B7YA 1EP0A 1GU3A 3BXMA 1MQTC 2Q1MA 4QM9A 1RVF3 1VE0A 3LD2A 1PO12 1QOTA 2F8HA 1CD3G 3H50A 1S55A 4PDWC 5HH1A 4DO0A 5F47A 3ELNA 2RG4A 1GWLA 2A6XA 3VD9A 3I2DA 5FP8A 3WG2A 5FAXA 3HUVA 2HBTA 4BQ1A 2YDEA 3OPTA 2B9UA
chains in the Genus database with same CATH topology
5KXCA 1CAXB 3QD6A 3USSA 4A7YA 3R6SA 3UKVA 3WINE 2PHUA 4JRLA 3G6JB 3JBG2 2OZ6A 1DBNA 3LA7A 4GXLA 2D3SA 2RE9A 1ZO0A 5I0TA 5C9AC 3LZZA 5CIRA 4YG6A 5BY5A 4XIOA 5GLVA 2GN3A 2WT0A 3JB8A 2PQQA 5JAXA 1I3HA 1ND2C 1AYM1 4IERA 3DPRC 4AFDA 1AHSA 2ZX4A 5GCNA 4YW1A 2YY1A 3IMNA 3TRSB 1BKZA 4JAAA 3RYPA 4DS0A 5DDJ2 4Q4Y1 2ZW6A 5BV6A 1REFA 3GZUC 4AB7A 2G9GA 2IWGB 4I30A 4XF1A 4XNHB 1DGRN 3D8CA 4OZXA 2IZWA 2UURA 5FRAA 1AR73 1MZ5A 4I3PA 1VBA3 2ZBJA 1ONAA 1HRV1 3LAGA 2R043 1AVBA 4IEQA 3MIFA 4Y1ZA 1G9CA 1BZWA 1ASJ1 1RUH3 3PGPA 1MZFA 3TTHA 3M8LA 2D4PA 4RA0A 4XF0A 2FE7A 5I0UA 5KTDA 5BXXA 1KITA 2AJ6A 3INAA 3K9UA 2ARXA 2YHJA 4FXGB 5GM0A 1U5YA 1NSLA 2K9ZA 4LNVA 5IT6A 1V6JA 3RYRA 3ZSKA 2R1IA 2YXSA 1V9U2 4GIQA 1VRH1 1SEFA 4L8QA 4RHV3 1XNKA 2I79A 3DF0A 1CAUA 4XNHC 4Q0UA 4AFMA 4YZ3A 2ZGUA 4QHBA 4P9GA 1B87A 5E88A 4EWAA 4LLOA 5G22A 2QFEA 2D5FA 2XB6C 2XWJB 3OF1A