4ONUA

Camp-binding acyltransferase from mycobacterium smegmatis, e234a mutant
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
332
structure length
314
Chain Sequence
AELTEVRAADLAALEFFTGCRPSALEPLATQLRPLKAEPGQVLIRQGDPALTFMLIESGRVQVSHAVADGPPIVLDLIIGEIALLRDAPRTATVVAAEPVIGWVGDRDAFDTILHLPGMFDRLVRIARQRLAAFITPIPVQVRTGEWFYLRPVLPGDVERTLYRRFQSVRKPTRALLEYLFEVDYADHFVWVMTEGALGPVIADARFVREGHNATMAAVAFTVGDDYQGRGIGSFLMGALIVSANYVGVQRFNARVLTDNMAMRKIMDRLGAVWVREVVMTEVDVPPVDTVPFEPELIDQIRDATRKVIRAVSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allostery and Conformational Dynamics in cAMP-binding Acyltransferases.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
molecule keywords Acetyltransferase Pat
total genus 93
structure length 314
sequence length 332
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4onuA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4onuA02
3UY5A 1MJ9A 3MYXA 1PM7A 4XFGA 1UFHA 2OH1A 1CAVB 2ARHA 2AE6A 1IICA 3V8IA 1NSLA 4CS0B 3DNSA 3OGJA 1QSMA 5E96A 5CADA 2GC3A 2GANA 2F4PA 3D8PA 3SHRA 1I6XA 5KTDA 4AVCA 2O28A 4MHDA 1I5ZA 1RO5A 1KZFA 4KORA 2P17A 3W91A 4BYYA 2X7BA 1MK4A 3E6DA 2PYTA 4WBBA 2ZKLA 5I8TA 2CV6A 4UWIA 2BSWA 4KWKA 4CRYB 3H3ZA 3ZJ0A 2P6EA 1QXRA 1YLLA 3IGRA 3RNSA 4IEVA 1Y7RA 2XLGA 3S7IA 1ZZ6A 3N4MA 5C6CA 1FY7A 2OZHA 4KVXA 2Z11A 5FLIA 2ETEA 5LEKA 1CM0A 3NW4A 1NMTA 2K5TA 3FYNA 4B5PB 3OWCA 4KU7A 1S5KA 3U0ZA 4UBRA 1YUDA 2PAMA 5JSRA 2UY9A 4IERA 4YYOA 4QM9A 5I0UA 2OYZA 3FNCA 4JWPA 1KUXA 2A4NA 3C26A 1XRUA 1LB2A 4FBFA 3KGLA 2Z10A 1RTVA 3HT2A 4LLOA 4R3LA 2PSWA 1XIXA 1EY2A 1VHSA 1X7NA 2PR1A 2B5GB 2BNOA 2BL1A 4L8AA 2B58A 3PP9A 4YSFA 4PK2A 1QSRA 3QB8A 2QJVA 2VQYA 3EXNA 5I8SA 4HVRA 4P9GA 4J1XA 1UIJA 2N7GA 2MPFA 4MX3A 3WW4A 4IEZA 1M4GA 3DL3A 2MNGA 3BJ7A 1YFUA 5EC4A 1WLTA 1UPIA 1ZZ9A 4IEQA 4PSXA 1G6NA 1YVKA 3L2HA 1J3PA 3S6HA 1V70A 3PNAA 2GU9A 2GAUA 5C8WA 2R98A 2B5HA 1U12A 1IB1E 3BU7A 2QMLA 2FMYA 5JSOA 1XMTA 5CVRA 2XL9A 3UKTA 2CAUA 3FFQA 3NJZA 1S3ZA 1CAWA 1Q3EA 5F1RA 2IL4A 2R8VA 4MY0A 1YFYA 3IBMA 1B87A 3RDIA 2RC4A 4IUSA 1Q2DA 2FS5A 5I0SA 3RYPA 4KOWA 2OPKA 4N9HA 1J58A 4I02A 3SCFA 3SMHA 2P0WA 1YLEA 1QSTA 4H6ZA 4ONUA 1CAVA 2XL7A 3IDBB 4IETA 4NEXA 4XFIA 5BV6A 2IXJA 2FT0A 3NSTA 3BLNA 3PLQA 3TE4A 2D4PA 2PQ8A 1X8MA 2IXHA 3H3UA 4UBHA 2B5GA 2PC1A 1M4DA 1M1DA 3R9GA 1Q43A 4X5KA 1SQHA 4LA2A 1O3TA 3FXTA 2D4OA 4QX5A 4TLFA 2VPVA 3TO7A 3NKTA 5T3NA 4YGOA 3WR7A 2PTMA 1O4TA 5KHIA 2OU2A 1YVOA 4EWDA 3GBFA 4XETA 3ZDSA 3WW2A 1ZVFA 2H0VA 1CAXB 5D1IA 4E2QA 1SEFA 2FIAA 4JJXA 2IXKA 4KOUA 2BGCA 4MUVA 4Y49C 2E9QA 3ROUA 1Z4RA 4PSWA 3B02A 2OZUA 4BH9A 3R96A 3WW1A 3I7DA 2QNKA 5JSPA 3E6CC 3I59A 4HZFA 4XFFA 2F5IA 3MPBA 3G7DA 3D82A 3PVBB 4WZCA 4D7SA 5I8YA 1KUYA 2P6GA 1H1IA 3CJXA 3GYDA 4MGZE 2G3TA 4HMZA 2Q04A 3ACLA 1QWRA 4AXOA 1PU9A 4MGKE 4I2OA 4PK3A 5FLJA 3H1YA 3VWEA 4XFHA 5JCTA 2ATRA 2QIRA 3KCCA 1VJ2A 4F0YA 3EFAA 3E5UA 4F8AA 4CAWA 2GC2A 3OTFA 3N7ZA 4GULA 2VBQA 3IWZA 4CRZB 4Q0UA 1ZRFA 4I49A 5HMNA 1OMIA 2PHLA 3E0KA 4Y49B 2I00A 1WA4A 2Q4YA 3R1KA 3CXQA 2Q4VA 4KOTA 1V0CA 3OD0A 1OZPA 4MY3A 3M70A 4ZU5A 4M3SA 5FVJA 1GQGA 3FB3A 2ZCWA 4X6QB 2K9ZA 3ST7A 2VECA 3BPZA 1ZZ8A 4J1WA 2JEVA 2D93A 3USSA 2EUIA 3P2HA 1CAUB 4KOSA 1X82A 1P0HA 4META 4AB7A 3H9AA 1B6BA 4Q0VA 3W6SA 4JTNA 1M4IA 2PHDA 1XE7A 3FIXA 3TCVA 5J8CA 1QSNA 2H6BA 1UD1A 4HSJA 3EC4A 4I0BA 1LKNA 2C0ZA 1J3RA 3LWCA 1ZRDA 2QECA 1RC6A 3H1WA 5ISVA 1VR3A 4FT8A 4CAVA 4UWJA 1IYKA 3SXNA 5FDBA 3I59B 3NE7A 4HNYB 3KSCA 2WFPA 4KU8A 2D40A 5BPXA 4OLLA 1I12A 2G3AA 4IEXA 4XNHB 3DV8A 5F46A 4YRHA 4FD4A 1RGSA 2OB0A 1ZNPA 3ES1A 1O3SA 4QGLA 4EWEA 3DSBA 1Z4EA 5AVPA 4IEUA 4LULA 5IB0A 3BJ8A 2ZW4A 3MGDA 5F49A 1DGRA 3CF6E 4O9EA 4RD7A 2FCKA 4GS4A 4KOVA 4LX9A 4O9GA 5H86A 5FLHA 2PRBA 3LA7A 3TT2A 4ZU4A 5H84A 2Q7BA 4IESA 1RUOA 3NVCA 3JVNA 3SCGA 5I91A 1XE4A 4IEOA 4KZTA 3S6GA 1ZZBA 5EFUA 4ZBGA 5EZWA 3LOIA 3TNQA 3S6FA 1YX0A 3SXWA 1ZZ7A 3OCPA 4QXKA 3TOAA 1TIQA 4RS2A 3EO6A 2VI7A 3PZJA 3NL1A 4YARA 3CXPA 1UIKA 3CLPA 2VXKA 5KTCA 4E2GA 4XPDB 2HKXA 5CNPA 2PQQA 1CAWB 3IIAA 3SCHA 1ZREA 2XKOA 4Q0SA 4U9ZA 1YFWA 2ATFA 3HIFA 4YNIA 4NVPA 1NZCA 1BO4A 3JZVA 5DWNA 4II9A 1CJWA 4M85A 2EAAA 1QXJA 1YFXA 4MJ8A 2R1IA 3F0AA 1JUHA 5J8FA 3U10A 3I9SA 5J3UA 4QBJA 4E2AA 4HN0A 5KHHA 4JTOA 4AQ2A 5J48A 4HLTA 4FAHA 2JLMA 2Q0YA 3LZZA 4AVAA 2VQAA 1IYLA 5LRSA 2MHFA 3H7YA 1WWZA 4QVTA 4YRDA 3TTHA 3ETQA 5IX3A 1PMIA 2QDRA 3EHKA 4LUMA 4IEWA 1MJAA 2WPXA 5BY5A 4NSQA 4EVYA 2BYVE 2BUEA 3H1MA 4KWJA 4OFGA 5FQ0A 2BEIA 2REEA 3DDDA 4F6AA 5I0TA 4D7TA 4UXAA 3DR8A 5GCNA 4MBUA 3DN7A 4XFBA 5KHGA 2FSRA 5HH1A 2QVSB 1EP0A 2H6CA 4Q0PA 4X6RB 4XPLA 3VWDA 2Q1ZB 2ZPAA 4E8OA 2O8QA 4JVAA 4Q0QA 2WPWA 3ES4A 3QACA 1RXTA 1S7FA 3R9EA 2NMTA 3R9FA 3QOPA 3H4QA 2IXLA 1H1MA 5E1RA 1NXMA 4UBGA 1QY4A 4NF1A 1VKCA 1J3QA 4HSLA 2B9UA 1S60A 3OF1A 4XF4A 1DZTA 4JXRA 4MZUA 2WC2A 4U5YA 1IIDA 4HNWB 2IXCA 3G3SA 2BEOA 5KTAA 2HQYA 2VEZA 3EY5A 3G8WA 1MJBA 5KBFA 4HKFA 2IXIA 3FJSA 1LRHA 4HVOA 1S7LA 4B29A 1RUNA 4LTAA 2GH2A 4AVBA 1GHEA 4FD5A 1J1LA 5FQ0B 1VP6A 2KXLA 4BIFA 1M44A 2BNMA 2FQPA 2JDDA 5I0CA 1BOBA 5K8SA 4JLYA 3I3GA 3H50A 3I54A 3T90A 4HBNA 4KL1A 1CAXA 4ZU7A 1YK3A 3R6SA 4CAXA 3D2PA 4K30A 4B5PA 1SFNA 2ZXVA 4KUBA 3FZ3A 1X8EA 4XFCA 1WK4A 2GZWA 1HW5A 2Y0OA 1FT9A 1ZRRA 3FHIB 3IWGA 3TNPB 1NYWA 3E5QA 2OZJA 4KVME 2GE3A 3FBUA 2XLFA 4Z07A 1WGPA 3EJKA 2XKPA 3EBRA 1I21A 2B4DA 1TQ5A 4PIZA 4QGNA 2KCWA 2CAVA 4FAGA 1Y9WA 2C27A 1NE6A 4JV4A 3UKVA 3K9UA 4DNCA 5FPZA 2G0BA 3TFYA 1O3RA 4J3GA 4IEPA 4AQ6A 3EQEA 5FPXA 3D2MA 5IV0A 1UW8A 4R52A 4IEYA 2GIVA 2R7HA 4R8HA 2VZZA 3BB6A 1ZRCA 5BXXA 5JAXA 5F47A 4AG9A 3LODA 2K0GA 4QUSA 4QB9A 1SQ4A 1O7FA 3TOBA 1PUAA 4PV6A 4CYDA 2Z69A 1NE9A 4FD6A 4L2NA 2UYAA 2GC0A 2FE7A 3C3VA 4EV0A 2OA2A 4I01A 4BHPA 2CNSA 2QCSB 5LRRA 2VZYA 4QM8A 2Q4SA 4ORFA 4E0AA 2XLAA 1Y9QA 2ET7A 4MGYE 3KKWA 3W6XA 1J59A 2V09A 3FE5A 2CY2A 1ZX5A 3S6KA 3WW3A 4I3PA 1R57A 4PIXA 2CNTA 3F8KA 1YGHA 3FWEA 5E16A 1XEBA 2B3VA 5BUVA 4R9MA 3B8GA 3CL1A 4H6UA 4LUKA 5J7MA 1J4JA 3T9YA 3JUWA 2D5HA 3SHPA 2PAKA 1DZRA 3ZZIA 2ET1A 3FX3A 2ZW6A 4KUAA 4XF3A 5CU1A 1Q2YA 3F5BA 4IF5A 4U9YA 3GYAA 2FL4A 3MZHA 1LRZA 3VHRA 2I79A 1L3JA 3TO9A 5F48A 1OI6A 5C82A 1ZZCA 4MH0E 2PR8A 4MGIE 1S7KA 4H7LA 3D3SA 2Q44A 2UY8A 4NCZA 3D0SA 3BCWA 3ELNA 1K4JA 4LEJA 5I93A 5HI0A 2HUZA 5KHKA 1U6MA 1O3QA 2ZW7A 2I45A 3CXSA 4L89A 3E6BA 4WVZA 1QSOA 3E5XA 2XHKA 1YREA 5C88A 2Q30A 3D0JA 1EPZA 2PAEA 1Q2CA 2JDCA 4OADA 3HQXA 3LD2A 1EYBA 5KHJA 2J8NA 3P2FA 4H89A 2J8RA 2Y0MA 3HT1A 1CX4A 5I0RA 3EO4A 1FXZA 3CEWA 4K8FA 4R57A 5EBVA 3RPQA 1FI2A 1YR0A 4JD6A 3LA2A 4EWAA 2CGPA 2GC1A 4BMHA 3R95A 4PIYA 4MV2A 2PFWA 2EA7A 3KGZA 2Z0ZA 2B4DB 3QAHA 4Z82A 4AG7A 2DCTA 1Q5OA 3E97A 2B3UA 1OD5A 4QMAA 4XPDC 1S7NA 1GQHA 2EVXA 1XE8A 4MI4A 1Z9UA 4R87A 4HNXB 1UCXA 3RYOA 4B5OA 3GKRA 4F7ZA 4KLVA 1I1DA 4QC6A 1IPJA 4L11A 5JR7B 2ZW5A 3S7EA 2PA7A 4I09A 3DKWA 4XEZA 2OZGA 3BALA 1N71A 2FIWA 1YWKA 2XGXA 2Z2SB 4HVQA 5FCCA 3MDPA 1YHFA 1IPKA 1P4NA 5JQ4A 4XF9A 4LUAA 1L0CA 3UKNA 2DXQA 2OZ6A 4A2UA 4JXQA 4XF1A 1XF8A 2HV2A 2PDOA 2FXFA 1LR5A 4PJYA 4XF0A 3H8UA 3TO6A 2CNMA 4KWLA 4UA3A 4KOYA 1DGWA 4EROA 3LA3A 1CAUA 1Y9KA 3DR6A 1OFNA 3RZZA 3GY9A 4XPKA 4I0AA 4XFAA 4Q29A 2REFA 2B8MA 2B4BA 4XNHC 2Q0AA 3O14A 4E2SA 4RI1A 3LAGA 1KUVA 3IDCB 3U11A 5DWMA 2IC1A 4LA3A 2H5MA 1O5UA 3S0MA 4R3KA 1CGPA 1ON0A 3FRMA 4YFJA 2D5FA 2AJ6A 1NE4A 2EVNA 2P6FA 2BNNA 2UYBA 4HN1A 2J8MA 3KMHA 3CO2A 2O1QA 1RL3A 1Y3TA 3RYRA 4FD7A 2HJIA 3RYKA 3PGPA 4KLWA 5LEJA 4N9IA 4OAEA 4NXYA 1O5LA 4DINB 4QGMA 5JPHA 4KVOE 3SXOA 4KOXA 3H7JA 3M3IA
chains in the Genus database with same CATH superfamily
2VZ3A 4RL7A 4NN0A 4XBNA 3S9MA 4XFGA 5JPNB 3AKRA 4LKFA 2AACA 4Y3OA 4PQQA 1D2SA 1US2A 3W59A 1G8WA 3OGJA 4ISQA 3IKWA 4H3WA 4PF5A 2F4PA 4J6GA 3SHRA 5KTDA 2BOAA 2XH6A 1I5ZA 4DEVA 1LOFA 1ZM1A 3POIA 4OVEA 4BYYA 5DUXA 1YYNA 4COVA 2EXHA 2ZX3A 4EN8B 5ABJB 2LS6A 3E6DA 3U14A 3LD8A 1JH5A 1QMJA 4MADA 5FYCA 1ALYA 2ZKLA 4GJZA 3K4AA 2ZEFA 4HPKB 3P6BA 1UZVA 4CRYB 2A70A 1WCKA 4AFMA 2ZGMA 1LGCA 3AKTA 1X12A 1NQJA 5FP4A 2LRPA 2P6EA 4IAVA 2ZGNA 5CBLA 3RNSA 1C8M2 2G1MA 1SDDB 2XLGA 4IEVA 5F2SA 4WJBA 5CBMA 3BKZA 1ZZ6A 5F3CA 3BTZA 4B4QA 3NMBA 4QQ2A 4RGKA 3N4MA 1FY7A 2OZHA 2K5TA 3IB3A 4QKFA 3NW4A 3NWKA 2E33A 4CUAA 1OLQA 4HOOA 1VBD3 1ND2C 5I0DA 2C1CA 2NM1A 1NX9A 2Y0IA 2Y8KA 2PAMA 3RZLA 3BI0A 1SHWB 4IERA 2OYZA 4TWTA 3A23A 1KUXA 1LB2A 2RB7A 4AOCA 4FBFA 1AR93 1VRH3 3HT2A 2DDUA 4R3LA 2BERA 1QXPA 5A1FA 1LGNA 5CKNA 2O8OA 4N7UA 1AL0G 2HLEA 4CEWC 4CXYA 3SKJE 1QJX3 1X7NA 4LQRA 3MIEA 4Q4W2 4CU7A 1VHSA 2P5BA 3IC1A 4L8AA 1Q7LA 5ANQA 2B58A 4A3XA 2VH9A 3PP9A 1PGL1 3UL2A 2WS93 3VBFB 4XJZA 3DGTA 2QJVA 4DO0A 2GLFA 1BHGA 2RJ2A 2WT2A 5I8SA 4DQAA 4OC1A 5J36A 5A7WA 3GUXA 3WW4A 2C6CA 2VMHA 1RTQA 2VW1A 2VL1A 4A4AA 1M4GA 3DL3A 3KL9A 3BJ7A 1YFUA 4CDXB 2R0FA 3QCWA 4LOTA 2JDKA 1B35A 5EC4A 4NRMA 2PHRA 4CDWB 2XEJA 1NY72 2YC4A 1UPIA 1W6NA 1ZZ9A 1W6OA 1YVKA 5DDJ3 1XNTA 1EV11 1OT5A 1AJKA 3K4ZA 4Q8LA 5C9AC 3PNAA 1RXFA 1J84A 1UWWA 5GZCA 4XBLA 5IK4A 4OIWA 1WKYA 4XZUG 3R05A 4MXVA 2F6BA 5JSOA 3M8LA 2CAUA 3FFQA 3NJZA 3N9QA 1CAWA 1Q3EA 2AFSA 4BCUA 4CYNA 1IOIA 3GCWA 1IG0A 5LYLA 1IGOA 5I0SA 1VBE3 3RYPA 1PVC3 4FPGA 4DIQA 2OPKA 3KF5A 5KXBA 1W9YA 2BFUL 4LBJA 3N7LA 1VBA2 5JVVA 3I2HA 3SMHA 4PLMA 4D94A 5A7NA 1QSTA 3VWDA 4QKBA 4QX7A 3F95A 5BNPC 2VOKA 5CFCC 3MFAA 3OBAA 1LHVA 3NKGA 2XOMA 3ZN5A 4BOWA 5CFCB 2EWBA 2Q7SA 2PQ8A 3JRUA 1X8MA 1B35C 2IXHA 3FN9A 4DOUA 2Z3KA 2PC1A 5GZDA 3LGRA 1MEC2 1RVF1 1M1DA 4R76A 2HWB3 1CIWA 3WNXA 2GH8A 2D4OA 3ZM8A 3POYA 2RS52 2CTVA 4QD2A 3ZLIA 6CPAA 2JKBA 2VPVA 3CNAA 3MF9A 3NKTA 4UCNA 3NAPC 3TO7A 2PTMA 1S0EA 2VUDA 2Q43A 4FI9A 3CQOA 4RA0A 3UJQA 2OU2A 3J8F1 3P3NA 2WN3A 1AR62 5A3OA 3ZDSA 5IYYA 1CWPA 5A1LA 2CWSA 2Y6HA 1UY1A 3LDBA 4GMP3 1O4ZA 4OHVA 1S0GA 2CF4A 1JOPA 3O1RA 1Y4WA 2HBUA 1W8NA 2IXKA 5FO9B 3VHPA 4Y49C 1FPN1 4YFWA 4A3ZA 1AR73 3B7MA 3U4SA 1LECA 1JZ7A 3PU8A 4UF0A 3W6SA 1AR82 2XQRA 5EQUA 4FOQA 4V2WA 1W0PA 1COV3 1CZTA 1HDKA 1UXZA 2PLV3 2VOVA 3I7DA 4AF9A 2XEFA 2F5IA 3AX4A 4M3CB 2WUUA 1V0AA 2HEWF 1VBC1 2POKA 2JG8B 4QPIC 5DQ0A 5I8YA 1XNDA 2CL2A 4CCEA 2AUYA 2P6GA 2RFHA 3JBG3 3VKMA 1ENRA 3B93A 3HNYM 4MGZE 2TNFA 4L9BA 4HMZA 3PFOA 5FZAA 4NIAA 2NYYA 4BPZA 1PU9A 4X3RA 4I2OA 4YVWC 5A3PA 4PK3A 5FLJA 4KNCA 4MCRA 5GZGA 1Q8SA 3H1YA 4QQHA 4YW6A 5JCTA 1HKDA 1AZDA 2G4IA 3WDVA 4V2VA 3EFAA 4GJYA 3N7ZA 5FIXA 3IWZA 3VGIA 4CRZB 4I49A 2PHLA 2XPJA 4Y5TA 2Q4YA 4HKLA 4I30A 2LTNA 2Q4VA 4MY3A 4IUGA 3LE0A 3THTA 4MHNA 1UOFA 3HOBA 1S0JA 3NE8A 2ZTNA 3CJIB 2I07B 3ST7A 4CPAA 2Y6KA 2VECA 3WV6A 1ZZ8A 1EUTA 1BCXA 4AK3A 2GN7A 4LIUA 2EUIA 4GALA 1GV9A 1X82A 5LZ6A 1RUH1 4MVTA 4P08A 1N3OA 1P0HA 4KOSA 5AG4A 2BBVA 2Y64A 3VBRB 3LEMA 5C9AB 2WZR2 2YC0A 2ZJCA 4WZFA 2CYFA 1YQCA 3IU1A 3DYOA 4XYXA 3NV2A 1QJU1 2RVAA 2XG3A 5JXHA 5GALA 3SI1A 1OPMA 4WVVA 1UOGA 1J3RA 2CGOA 1ZRDA 1YQ8A 1AX0A 4NIIA 5ISVA 4NJRA 3ECQA 2A6VA 4FT8A 1GYTA 4AI9A 3SXNA 1KGYA 4YG3A 4GKXA 4Z1VA 5FDBA 2JEMA 4OMCA 2LM3A 4KU8A 4FOYA 5AC92 2QDNA 4OHYA 1RUI3 3G6JB 5F46A 2ZA9A 2VZVA 1RGSA 3N9PA 1ZNPA 3WNKA 1VHEA 3T09A 4FO9A 4QGLA 3J7LA 3ZPOA 3DSBA 1Z4EA 5AVPA 1ULEA 4LULA 3GJBA 5F49A 3WDTA 1UX6A 3LDRA 2OKXA 2AC1A 4AEDB 2FCKA 1NZIA 4GS4A 4PXDA 1W2TA 2ARAA 4HANA 1PIV3 4Q4W1 2P4EA 5G05L 3TT2A 4ZU4A 5FZIA 5H84A 4IESA 3WNMA 3KB5A 4CCCA 2DVGA 2P34A 1H2MA 1SCSA 2H0BA 3DXTA 1POV0 3PURA 5FP7A 2DBIA 5FZOA 5EIYB 4KZTA 3BIWE 5EZWA 3TNQA 3ZXKA 3V65A 3GGLA 2PIYA 1S2EA 1ZBA1 2R49A 4ITCA 4QXKA 1FMD3 2CSGA 4O65A 4KWUA 4ES8A 4UW4A 5A3NA 4C2XA 1POV1 5AFEA 4EZHA 1W6QB 3CXPA 1EAH1 1JBCA 4JKKA 2VNGA 2VVFA 4FFIA 1GZ9A 1RXGA 4E2GA 2PJAA 4BK4A 2PQQA 3AMPA 1JYWA 1ZREA 1YFWA 4P9IA 4YNIA 1R3NA 1I5PA 2BGOA 3FMCA 4P4JA 4PQ9A 4AGVA 1ZYBA 3IAQA 4NAOA 4IV1B 1OKQA 2XB6C 1R081 3JZVA 3AB0A 4II9A 1MZ5A 1REFA 1MS0A 1Q8QA 4MJ8A 3AJYA 4CDXC 3V38A 2C9KA 1W39A 1ZBE2 1RUD3 2ABZA 1LU1A 3WHTA 4ZX8A 1V6OA 3FBYA 3SEEA 2JECA 1G9DA 5GLUA 5J3UA 4HKWA 4E2AA 2C1FA 1RUF1 4JTOA 4HLTA 2NQYA 2YPJA 1GR3A 3N7JA 4L0PA 2J22A 4AVAA 5JPMB 3H7YA 2AYHA 1WWZA 4INDA 4QKNA 1R1ZA 1PMIA 2QDRA 3H3LA 4K20A 3EHKA 5LBEA 3WF0A 1XB9A 2PJBA 1MJAA 2XMLA 4P4IA 1C1LA 3WHUA 5IWFA 1GP5A 2MEV3 2D3RA 4Z2AA 3DN7A 3RBUA 1AYN3 5A28A 2QVPA 3OSDA 2FSRA 4A7YA 5AC91 3USUB 2BVVA 3ILRA 4CTEA 2Q1ZB 3ZFGB 3SKVA 2WQ4A 1MZFA 3IWWA 2VTFA 1AX1A 4MO3M 2VQ0A 3QACA 4TYSA 1S7FA 2VQYA 3R9EA 1JHNA 3NV4A 3LDKA 1SLLA 1BVP1 1W6QA 1H8TA 2W47A 3E0KA 2R6QA 1I1EA 2DF7A 3ZIXA 3ETPA 1AR72 2R042 3T2TA 1Q8VA 1VKCA 1IPSA 1OA4A 3NNLA 3OF1A 4LJHA 4XF4A 3O0VA 1LFWA 1XMBA 2GNTA 3S9NA 2A6XA 2D6NA 1KS5A 3UT0A 3HBKA 4HFSA 5FP9A 1Z7S1 3EY5A 2KD7A 3G8WA 2HH9A 5ABJA 4C7IA 1JS9A 1QJY3 2IXIA 3OGRA 4JZ0A 1GBGA 2E51A 4IXLA 2GH2A 4TSVA 3HMYA 1POQA 5FYTA 2KXLA 4BBHA 1BK1A 1OUSA 4BDVB 4RGAA 2W95A 5I0CA 1BOBA 5A33B 5K8SA 4JLYA 2NPIA 3VD7A 4AGRA 1TMF3 2YBSA 4GQ7A 3T90A 3ASIA 4CDUB 1H9PA 1KEXA 2W1SA 3GDBA 4K9SA 5IVYA 4CAXA 1SFNA 3VDCA 1BMV1 2Q4ZA 1IS6A 4XFCA 1WK4A 4KUBA 4X8PA 1PGW1 1ZRRA 3IWGA 2D3PA 3VZOA 2OT7A 2XEIA 1HB3A 4KVME 4MCPA 1GWMA 2GE3A 4F0XA 3T1MA 1LU2A 2ID4A 3JQXA 3MGUA 1PZ7A 4CP2A 3RZMA 4BZ4A 3JTKA 2ZXQA 5JI9A 4AEMA 5L9VA 5G20A 2CAVA 3K9UA 5G1ZA 3UKVA 1HRV1 2ERFA 2ZGSA 4JKLA 4IEPA 4AQ6A 5CFDC 1XYOA 4YM3A 2BPA2 5EJZB 1DIWA 3EQEA 1TVGA 5FPXA 1FMD2 3RZJA 5IV0A 1TMF1 1YI9A 2QQIA 4YM0A 1QKQA 3PIGA 4YVSC 2GIVA 4B3NA 1ZRCA 1VMHA 2VD7A 2WSAA 5K8MA 1PO22 2YNCA 4QB9A 2YG0A 1HRV2 1O7FA 4M3CA 1GWLA 2VOWA 4NUBA 1PUAA 4PV6A 2UURA 2Z69A 5D29A 4AXVA 3NAPA 1D4VB 2X5IA 4Q5OA 2UYAA 5DS0A 3ILFA 3WDYA 3C3VA 5F3IA 1GZCA 2AFMA 3FEEA 1QJY1 1LHWA 2OQ7A 1VRBA 2QCSB 4UEZA 3RJ2X 1Z7S3 4QM8A 3WSOA 2RJLA 1TKJA 4FP2A 4P45A 2JD4A 4G9SB 1Y9QA 1VIWB 2ET7A 1UOJA 1ZBE3 4OHXA 2HWD3 3PVEA 1J59A 4TN7A 3FE5A 4YVWB 2W9XA 2CY2A 1UZZA 4KS9A 2J7MA 1VAMA 2VZSA 1H8TC 1W04A 3O0WA 1CIYA 3PVOA 4U36A 4PIXA 2CNTA 3EXUA 3F8KA 4JDNA 2VOXA 1RUD2 1RUJ1 3BVCA 1WD3A 3VBUC 3B8GA 4H6UA 2AFWA 2IVIB 2DU1A 5C4WA 5BYNA 4JZRA 3JUWA 4HKOA 4XDQA 2PAKA 4EWTA 3T1LA 1OF4A 2VM9A 4BIOA 1AYN1 2A75A 2X05A 2JBKA 2VE1A 4KUAA 2C24A 4NROA 3VBFC 4XF3A 1CVNA 5KC5A 3O1SA 3GYAA 3Q8EA 2W08A 2AFZA 1LRZA 2G9GA 4PQAA 2I79A 4BM8A 3ZYHA 4B7EA 2WO7A 1L3JA 2J1TA 1TKFA 3W5NA 2XJPA 5C82A 4YGDA 2DCYA 2X29A 2XWJB 4UW6A 1LOBA 4YM1A 2WUHA 1S7KA 3D3SA 4H7LA 3HEIA 2Q44A 5K9YA 5K8NA 2A71A 2I3CA 4OHWA 4CGMA 3BCWA 3ELNA 4M6IA 3GXUA 4NGQA 1XE0A 4DUKA 2WBKA 3C7HA 1ZO0A 1RUD1 1RUJ2 4M0NA 3VZNA 2Y6JA 2X10A 4WVZA 5HCFA 2HWB2 4QAWA 5C4WC 2ZOFA 3E5XA 1YQ6A 4UIBA 5L7OA 5F5CA 4OI0A 3A21A 2WNUA 2PAEA 3TWIA 3I2JA 4NGPA 1W8WA 5LY1A 1EYBA 2JENA 4H89A 5EYYA 5IW0A 2J8RA 2Y0MA 4S2HA 3CEWA 4R57A 4A6OA 3RPQA 5L19A 3AKQA 4BMHA 1CJPA 4RS5A 1EAH3 1UOBA 1HB4A 1H4GA 4P9LA 1JZ4A 1POV3 3QAHA 4GWIA 2GNDA 2EK9A 4GXHA 4HETA 1DQ2A 2ES3A 1OD5A 1PZ9A 2Y6GA 2QKDA 2E7TA 1O91A 4XTPA 1PO23 1F57A 2EVXA 2WNVB 1AR83 3VBHA 4BE3A 1S7NA 2VNOA 3H5ZA 1RMU2 2AFXA 5D21A 2R16A 3Q8AA 1ND3A 4LMFA 4F7ZA 2NP0A 4QC6A 3SLIA 2ARXA 5JR7B 5D8AB 4H2KA 3MIFA 1W8OA 1W8UA 4GKYA 1JUIA 3ZR6A 4E4ZA 4B12A 1PGL2 3I2OA 2E31A 4ATFA 1OURA 3K77A 1JYCA 1IPKA 2LROA 1BZWA 5FYYA 3VKFC 4E9KA 1P4NA 1DZQA 5K0UA 5DUWA 1PIV1 2VMDA 1ARLA 3PB6X 5EMIA 1OQDA 2OZ6A 2V4VA 1LCPA 2PJ0A 4JXQA 2EAKA 4XABA 1XF8A 4ZHNA 1WZXA 1JYIA 3S9LA 4XACA 4BISA 3CJIA 5F6LB 3W20A 1E5RA 4KSIA 2CNMA 4W9YA 1OLMA 4UA3A 4KOYA 1A3KA 1Y9KA 1W28A 4UFVA 3KQRA 4XPKA 1PGSA 5FPVA 3NH5A 1SBFA 2QQMA 3FX6A 1TE1B 4NFRA 1JYTA 3HBZA 1QIQA 2Q0AA 3BPSA 5KXDA 4RI1A 4DS0A 2GLJA 1S2KA 4JGYB 1LOCA 1AJOA 2IC1A 4FQZA 1RUI2 4OUMA 1VMFA 1FNYA 3HN1A 5T52A 4CRQA 4YFJA 2D5FA 1NE4A 4QDQA 3RZGA 2EXIA 3KMHA 1RUE3 4OMEA 3NNFA 2VMGA 3TN92 4BD9A 1STMA 5CZKA 5FZ0A 5FYVA 3TEXA 1UMZA 3PGPA 4UBRA 3DXUA 4YPJA 4N9IA 4Q4V3 2WSUA 3OPWA 5FZ7A 3I3QA 2ZX4A 1CG2A 3RQ0A 3VH9A 4PBOA 3POEA 4HG6B 5FZ3A 1KD7A 4KOXA 4NO4A 5C71A 1CZVA 1UAIA 3RJRA 1MJ9A 4QHBA 4Q4X2 1QF3A 5JDBA 2B45X 5G04L 1UU6A 3VKNA 4EFDA 3SI2A 4WM7B 3SH4A 2ZEPA 4M3CE 1NSLA 1OA2A 5E96A 5HPOA 1QSMA 5CADA 1FV2A 1MVEA 4FFFA 3AFGA 2GANA 4LQGA 5C5TA 3MICA 4OP4A 1I6XA 5GZFA 1LOEA 3ZX7A 2ADDA 3WF3A 4AI0A 3AZVA 3RAMA 3W91A 3ZXEA 4CPBD 4CDXA 1GNHA 1MK4A 4XPDC 1UXXX 4WBBA 2SBAA 2AH2A 1VIXA 3CBNA 3JBG1 4OIDA 1JOJA 2ODFA 5F5AA 4CSWA 4UWIA 3GHNA 3H3ZA 1VBC3 2EXJA 1R093 3ZJ0A 3AYEA 2C6PA 1AVBA 1U5ZA 3DKQA 5FY5A 1QJZA 3VBSB 3N3HA 1AUGA 2Z5WA 3S7IA 1NSAA 5C6CA 5JZGA 1A6CA 4ET7A 1FNOA 2O53A 4KVXA 5FLIA 1CM0A 5LEKA 1NMTA 3FYNA 5LWBA 2HWE1 4D8MA 4PBPA 2R1DA 2BRTA 3CZUA 3U0ZA 4OAEA 4GMP1 1QQP3 2EK8A 3OB8A 3RI8A 4PI0A 5I0UA 3J8F3 3O0XA 4NHKA 3ILNA 2PQSA 3FNCA 1U5XA 3T4HB 3C26A 1XRUA 4NPMA 5GZEA 2JDYA 4FPOB 3KGLA 4LNVA 1PO11 1D0HA 1RTVA 4LLOA 3AL6A 3WP3A 2PSWA 2VAUA 5CAZA 5A33A 4FFHA 1ZLIA 5JXIA 5F6KA 4TLGA 3FFZA 3MLKA 1CONA 2PR1A 2B5GB 2YMZA 3VDAA 4B1MA 4NJ4A 2QE3A 4QKDA 1K5MA 1HQWA 4UF4A 1ZLHA 4M4PA 2JBJA 4PK2A 5JOXA 4KMQA 4AEJA 2WT1A 3EXNA 3TEZA 5KC6A 1GUIA 5DAPA 1UIJA 3NRUA 2MPFA 1RUH2 2RMU3 1JZ6A 1T6BX 4IEZA 3SXOA 3GZEA 1BPMA 1XRYA 2QQWA 1F2NA 1MACA 1ND2A 4COWA 1JZ8A 1HB1A 1TME1 2AENA 3BIEA 4KI5M 5FYZA 1BJQA 4IEQA 1VAKA 1G6NA 2BFUS 1KJRA 4RQPC 3SH5A 3PUIA 1DGLA 2GU9A 1SLTA 2GAUA 4DY5A 4LBOA 4PI2A 2WIIB 3FF3A 1U12A 2GP3A 1IB1E 3BU0A 5FWJA 3ZXAC 4KBZA 2DUOA 2FMYA 4NGMA 3GZAA 3N9OA 5A70A 3ISXA 2DVFA 5F1RA 1PMHX 1GANA 4YG6A 1S0BA 2YNEA 1AYN2 1JI6A 4MY0A 1HRI3 1YFYA 2YPDA 2RC4A 4N9HA 1R092 5EXOA 3DF0A 4I02A 3H8OA 1RUE2 1YLEA 4ONUA 3HVDA 1CAVA 2XL7A 3OBZA 1QOTA 3UK9A 2W1WA 2JDUA 4QPIA 3Q8CA 5BV6A 2PJ4A 1VBB2 3WQ0A 4AFBA 3NH4A 3TE4A 2WS91 1QMUA 2D4PA 3WG4A 1QOOA 3H3UA 2B5GA 2W1QA 1M4DA 5A32B 2XHNA 4UFHA 4XW3A 5JZGC 4XVHA 4X5KA 1SQHA 4CU9A 1YW6A 4LA2A 1O3TA 1DQ5A 3LFIA 4QB6A 3ZFEC 4P4DA 1GOFA 2ZEOA 1AR91 1U5YA 1VRH1 3M2MA 4R9BA 4DPNA 5A7SA 4P9XA 4P5HA 2YXSA 1NG0A 1O4TA 4Q4X3 3GB0A 5LRKA 2CU5A 4URAA 4GXLA 3GBFA 2EIDA 4XCBA 3WW2A 5HV0A 1CAXB 5FXZA 4E2QA 1PYTB 3ZKYA 2FIAA 2PJ3A 4NGNA 2P3KA 4KOUA 1RHI1 2BGCA 4XIOA 2JB8A 3ISZA 3ROUA 2LW8A 2EO8A 5FP3A 3KD4A 4BH9A 3R96A 2J1AA 4BQ3A 3WDXA 2IWGB 3E6CC 1OBNA 3I59A 4HZFA 5FZ4A 4NJQA 4COYA 4TXWA 2VCMA 3LMSA 2WINB 3G7DA 1AYM2 2EIBA 3ZXJA 2FZ1A 3MLJA 4N7IA 5F2WA 5GLWA 2G3TA 1V6MA 4ARYA 1M4WA 2Q04A 2PJ6A 2VZUA 5HVFA 1GNZA 1BBT3 3OPTA 2JEWA 2VZTA 3I8TA 2Y26A 1IU8A 5IVFA 3LEKA 4D6RA 2QYVA 1RINA 2RDSA 3PMSA 5C3OA 3VWEA 4DNYA 3B7IA 1DGRN 1VJ2A 3WOGA 1LAPA 4CAWA 4F0YA 4CDUC 3OTFA 3AVSA 4GULA 4Q1PA 1CQ9A 1Y7EA 1BAVA 5BNNA 1VALA 2I00A 3D7GA 1UZYA 1WA4A 2HWF1 1NCQC 4KG8A 2NMNA 4PDWA 4ASKA 5A6QA 1OZPA 1TME3 3AP5A 3CXQA 4NGSA 4M3SA 3N9LA 1R1A3 1GQGA 3FB3A 5FVJA 3QD6A 4OYUA 3DPRC 4X6QB 5HBAA 2O4HA 3AL5A 2FDHA 4IE7A 4XZPA 3USSA 3P2HA 3WP5A 3C7GA 1FOD3 2DTYA 3CDZB 2RS32 2WFF1 2RS12 5HXMA 4CP1A 2OUJA 5KWRA 4C2YA 1DQ4A 1Y43B 4YZ5A 1GP6A 1B6BA 1VBB3 2O0OA 2R041 1R082 2RHPA 4Q0VA 5DG1A 1H8VA 1F5JA 2VBDA 5JZGB 1JZ3A 3FC0A 1CR7A 2ORZA 4K21A 4PT6A 5FZMA 4AEDC 1ENSA 4AG4A 5JMOA 5K0UC 1DYPA 3KASA 4SBVA 4LBQA 4OQ8A 2VCCA 1G7YA 1JW6A 2C0ZA 4I0WB 4IV1A 4LO6B 5JIUA 2ZMNA 3KZWA 5HXDA 1SDWA 3H1WA 1VR3A 2R063 1RUF2 4OC0A 1H2NA 4QPGC 5IAVA 4HNYB 1I12A 5BPXA 2D40A 2Y6FA 2XVGA 2XJSA 3S57A 3T0DA 4CYOA 4AHYA 1LANA 4QX2A 4YRHA 3RG0A 4XUQA 3ES1A 5F3GA 1CPSA 4EWEA 3WC7A 4LOSA 2HWE3 5IB0A 3MGDA 4RD7A 3HUVA 4LX9A 2V72A 2OR4A 3AYCA 2ZS6B 4O9GA 5FZCA 4YGBA 5CPAA 1F4AA 1H0BA 3IPVB 1PK6A 1UPSA 2PRBA 4YM2A 3CHXA 1I9RA 3OY8A 3H42B 2GMEA 4BK5A 3WG2A 3NVCA 3T0BA 3SCGA 1LOAA 2FD8A 3VATA 3KV6A 1PK6C 2A3XA 3PUQA 3KR4A 5I91A 1XE4A 2WLQA 3B9IA 1EPWA 2R061 3LSDA 5EFUA 1UQXA 3B5LB 5LA2A 1H4HA 3T2QA 1G86A 1OQ1A 3LOIA 4NAMA 4NGTA 2VNRA 5E6HA 5FTTC 1ZZ7A 4BQ4A 3WX5A 4DUWA 3OCPA 1QQ9A 5AVAA 3TOAA 3FLPA 5FY8A 2VI7A 1XC6A 3VBOC 4XDOA 3ALQA 4YARA 2B4KA 1H8TB 1HQNA 5DAVA 4F3JA 4NPRA 2WFF3 1YC61 4QQPA 1FOD1 3WG1A 4XPDB 2HKXA 5CNPA 4B14A 2FDJA 3SCHA 1VHOA 3AJZA 4Q0SA 2W2IA 2ATFA 3UYJA 1AF9A 3W21A 5FXXA 3IT8A 1R1A1 3J9SA 4FPEA 4J25A 5FJHA 1MS1A 2Q8EA 4DMIA 5CB7A 1GSLA 2NYQA 4BXFA 1HB2A 1BO4A 2PRQA 1ZA4A 3ZN4A 2V8DA 5FZ6A 1FOD2 2EAAA 2G19A 1ZG9A 4XQ4A 5F39A 3GBGA 2R1IA 2PN5A 1ENXA 2HEYF 2JDMA 4IE6A 2W91A 5FYUA 2CXAA 4N43C 1RUE1 3K3OA 3AKPA 5FY1A 2Z79A 1C8NA 2ZOEB 4HN0A 5KHHA 4RHV2 1PVXA 2ZX0A 3ZSKA 4AQ2A 1XBUA 3LZZA 1IYLA 2EALA 2VQAA 2MEV2 2MHFA 4M3CF 4MSVA 5LRSA 1X9TA 1N1SA 3ETQA 3VBUA 1WCSA 3K4DA 2ZPXA 5BY5A 4EVYA 4BQXA 1O4YA 2WYRA 4KWJA 5LA1A 3S30A 1F2PA 2REEA 3SI0A 4F6AA 1PMJX 1C3HA 1ULCA 3AZYA 1E5SA 3DR8A 4BQ1A 5GCNA 4D3WA 4LKSA 1XQNA 3JB8A 4QX1A 3JXSA 5HH1A 4OMDA 2J1SA 2H6CA 3FL7A 4X2TA 1LHOA 2ZPAA 1VBE2 4Q0QA 4QPGB 2ADEA 2JICA 3ES4A 4L99A 2ZACA 1MR5A 5DABA 3T2PA 2NMTA 3UGHA 3THDA 3WT3A 5JLVA 4FXGB 1G9CA 3WDUA 5E1RA 4YZ1A 4GWJA 3K9TA 1NXMA 3JQWA 1QY4A 3MFCA 4RR3A 4UBGA 3K2KA 4Q4V2 4CDQB 4HSLA 2B9UA 1S60A 4NF1A 2ZXVA 3ME2A 5FBZA 2VGDA 1DZTA 5HVGA 3BGAA 4MZUA 5FZFA 2WC2A 1LEDA 1X36A 4BQYA 1W6MA 5K0UB 2IXCA 4JHZA 4YW4A 5DDJ2 2RS33 3G3SA 4JDOA 1JWQA 3KCYA 3ON7A 3PL0A 2HQYA 2VEZA 5KTAA 5KBFA 3Q8FA 4LHKA 2EF6A 5EJ1B 2WNUC 1O8PA 3MIBA 1S7LA 2DF5A 1RUNA 3W9AA 4LTAA 5CG9A 4FD5A 1HEEA 2TBVA 5FYMA 1VP6A 4LBLA 1M44A 2BNMA 5LATA 2X5IC 2J1RA 4FPFA 1Z7S2 4NHMA 2DVBA 5JUVA 1OLRA 2BW8A 3ITQA 1OFSA 3BN6A 4LR4A 4B8EA 1K3IA 3H50A 3QAYA 2VVEA 1YO8A 4R7MA 1FATA 2YUEA 4HBNA 4KL1A 5T5LA 1SZBA 2WSVA 3LKJA 4LKEA 3D2PA 3A4UA 2GP5A 4R4XA 3DUIA 3GHMA 4YVSB 5D2AA 1M4IA 2Y0OA 1AXYA 1HW5A 3FHIB 5IUQA 3RO0A 4B11A 3TNPB 3GF6A 4CEYB 4IE0A 1AR61 1X50A 2RR11 2XLFA 4BXSV 1QDOA 4Z07A 4M0HA 5D8NA 1S0CA 1GMMA 2XKPA 3EBRA 1F2OA 1DFQA 1GZTA 2YGMA 3IN9A 5IFPA 4AHXA 5K8OA 1DF0A 4W4ZA 3ZYPA 2BCOA 2DU0A 4LE4A 2KCWA 2C27A 3PUAA 1D2QA 1PGW2 1WA6X 2Z42A 4MLOA 3MW3A 2BU9A 1QQP2 1SACA 4AVSA 4D69A 3ZPYA 2R32A 3ZFFB 4CGPA 3D2MA 3D7HA 3RGBA 1UW8A 3IMMA 4JX0A 4OZXA 2R7HA 2VZZA 5BXXA 5F47A 1ULGA 4AG9A 4C90A 1GNYA 3LODA 4IE4A 3OUHA 3TOBA 3KHCA 2G9FA 2VL4A 4S2FA 1AYEA 4DJLA 2ZEXA 1NE9A 4Q38A 1ASJ1 2P2KA 5K7PA 2WNEA 2ZGRA 2WNVC 4AVTA 4A41A 5T54A 1ND3C 2B9VA 2OA2A 3C7EA 3PHMA 3MO4A 2FMDA 2WNUB 1GLHA 1PX4A 1RUJ3 4E0AA 1R43A 4MGYE 3W6XA 4Q8KA 1UY3A 1PO13 2VTXJ 2WYSA 2D6PA 4RYDA 5FBJA 1ZX5A 4Q26A 3WD5A 1SLIA 4CCOA 4LT5A 4FTBA 1IGBA 1DP0A 3TYJA 4QX8A 2YFZA 4L92A 3DLJA 1EV12 5A1AA 2W5FA 3TOJA 1E57A 3BI1A 4F83A 4K3NA 1OC1A 2B3VA 5E16A 1XEBA 5F8PA 2ZMKA 3T4VA 4IGQA 3PB7X 3RZKA 3WLUA 4AHZA 1MPXA 4UFJA 3AZXA 4XHBA 4XTMA 4HL0A 3SHPA 1N1TA 1NA1A 1OVPA 2JDPA 2ZGUA 5GJ6A 3VKLA 3H8EA 1HLCA 3NJYA 3D5OA 2WZR1 2EIGA 2VZ1A 3FX3A 3LIHA 4XXPA 4YZ4A 1WMFA 4XJWA 4Y22B 3JD71 3RWKX 4YZ2A 2ZW6A 1DBNA 1XYNA 1SPPB 5CU1A 1Q2YA 2XUMA 2V5YA 1R091 3KHBA 2JG9C 4U9YA 1MQTB 4QPWA 2YB7A 2L9LA 1G9AA 4OC4A 1TNFA 2XVLA 3VHRA 4MG2A 3GNEA 4Y1VA 3TO9A 4C1XA 1OI6A 1WW4A 2JIJA 3VL9A 4OC5A 2WNVA 1XXNA 2EIEA 2ZX1A 4ASMB 4H7MA 1K5JA 2B42B 4MGIE 5GLTA 3OD4A 4NCZA 4XURA 3D0SA 4NIGA 1K4JA 2Y33A 2KA3A 5HI0A 4MHPA 5KHKA 2ZZJA 1O3QA 2RE9A 1U6MA 3AVRA 5FOJB 5DMYA 1AXKA 5FZOB 2RMU2 1YIPA 3NO8A 1QSOA 5K8PA 2D7FA 2XHKA 4IGOA 4FPYA 2OIIA 5FUIA 1OBRA 4COZA 1Q8OA 2AFUA 3NH8A 1EPZA 4EE2A 5FY7A 3IWEA 4OADA 2CY6A 5KHJA 3CPXA 5C5UA 4EQVA 1ODMA 2E7QA 4SLIA 5ACA3 3FMGA 1XJOA 3RVHA 5EBVA 3URFA 3HAGA 1W2NA 1ZRIA 4K8FA 2Y60A 4V1PA 2JXAA 4UYBA 4K3UA 1H8LA 2GC1A 2WO1A 2BGPA 1XNBA 3AXDA 3BOPA 3H0OA 1LAJA 3R95A 3KGZA 1YJKA 3FUOA 2B4DB 4Z82A 2WKKA 1Q5OA 3E97A 2DBNA 5DZEA 1JYVA 2W68A 3MBWA 5DAQA 1SFYA 1QH7A 4UFWA 1Z9UA 4ZY1A 2C26A 2VQUA 4XPVA 4OUSA 1I1DA 1IPJA 4MXWA 2ZW5A 2RDRA 3S7EA 4UOJA 3B69A 2OZGA 1AL21 1E5IA 4A2ZA 4P4EA 3AMQA 5FCCA 3IIBA 5F09A 1YHFA 1QOSA 4S2DA 2VZOA 1C8M3 2IUWA 4CZSA 4LUAA 1O8SA 4E4DX 2DXQA 4CCJA 1LCLA 1SLAA 2TEPA 2ZHNA 2V77A 2PDOA 1QH6A 1LR5A 1OHFA 4XF0A 3H8UA 4W6WA 4XJAA 4QB1A 1W0NA 3EMRA 1MEC3 5F32A 5IK8A 4EROA 5E89A 2AEZA 3ORJA 4I0AA 2MEV1 4ZY0A 3C2UA 4FTEA 2JDAA 2B39A 1LOFC 2ZGOA 3DCQA 4AHWA 2YDEA 5THWA 3O14A 3ACHA 1RITA 3LAGA 3NV1A 3GZUC 5EJ3A 5L7OB 4TNUA 4B10A 1O5UA 1QGLA 3S0MA 1AR81 3WP6A 5J1XA 1CGPA 1DLCA 1PO21 3D7FA 5KR7A 3T2OA 2AJ6A 5IVCA 2EVNA 5FZDA 2BNNA 4UCMA 3CT9A 1UU5A 4E4SA 2GNMA 1H1AA 1YEWA 2DEAA 1Y3TA 4OULA 3BUCA 1V00A 2HJIA 5ERLA 1UU4A 1YQEA 4R6TA 2WT0A 2W92A 4LBKA 1WLDA 4W65A 3ZDVA 1R083 4DINB 3C7FA 2RM22 5H9QA 5F9TA 3M3IA 2ZOGA 3NNJA 1PM7A 1UFHA 2BP6A 2D98A 2OH1A 1DU3D 1CAVB 4E8CA 3DPRB 4CUBA 2ARHA 4N43B 3V8IA 2AREA 4AAXA 4CS0B 2VUCA 2QJ8A 3DNSA 1PNFA 3ZN6A 2RV9A 1NCQA 1ODNA 3D8PA 4LO8A 5DXDA 4XQWA 2O28A 4MHDA 3VDDC 5C7GA 1KZFA 3KQZA 2P17A 4KORA 4M6HA 1WCQA 2VMIA 4LHLA 2WNOA 4RGGA 2ARBA 2PYTA 1N1VA 3KHZA 2BVBA 1GP4A 2CV6A 5I8TA 2BSWA 4LE3A 1MS3A 3WNLA 3LSEA 1YLLA 3AXEA 5J37A 4LBNA 4YWYA 2QQOA 2XJUA 1Y7RA 5T50A 1MEC1 1GFF2 1F31A 5FV3A 3H8RA 3ABZA 1BLZA 2Z11A 1HN0A 2ETEA 3R4DB 4NOTA 3O1TA 3VHOA 4YVSA 2QQJA 3ZFEA 1WCDJ 4KU7A 4BA6A 1CESA 1JYXA 3VDDB 1S5KA 3OWCA 2VR4A 2X09A 4CEYA 1C8M1 1RUC2 4XXAA 1PCAA 1RUI1 3WQ1A 3J8F2 2UY9A 2VZPA 5L9RA 4QM9A 4YYOA 4ZZ5A 4L97A 5CA6A 4JWPA 1S55A 3D6EA 2XXZA 5HV4A 3SITA 4CP0A 5JMCA 1Y0YA 1SLCA 1AL23 2Z10A 2HWD1 1ZBE1 3PB8X 2DCKA 3OUIA 5K4LA 3NAPB 1V6JA 3CPAA 1EY2A 3FUQA 4H14A 3CIHA 4DXRA 4ZX9A 4FPJA 3I2KA 1JZ5A 3I1UA 4NPLA 5LYIA 2BJSA 1JN2P 2BNOA 2D44A 4CEWB 2Z3PA 2WO3A 4B6ZA 4LO4B 3M7AA 2HWD2 1QSRA 1NCRC 1VLNA 1UYPA 1XPWA 1OOPB 4WM7A 4Y5Z0 5T55A 1K5MC 1F5FA 2FDGA 4HVRA 5HCHA 4P9GA 2A73B 1PIV2 1OH3A 1RUH3 4J1XA 4YW7A 2N7GA 3TBDA 1C57A 4MX3A 4AQTA 2ZBJA 5DZGA 3D4KA 4DZGA 5CFCA 4CDQC 5A3WA 5BNPB 5ACA1 4WWVA 2MNGA 2DUQA 3BHXA 3VBOA 5FR3A 1HRV3 1MZEA 1MZ6A 1ZG8A 3FVLA 4IGPA 4PSXA 1J83A 2ZENA 1GKBA 1J3PA 2FDFA 2PIZA 3GLJA 2F8HA 3MI8A 5C8WA 4AFAA 5DZFA 2D43A 4IE5A 2B5HA 2E6VA 3FHQA 3BU7A 4Y1UA 2BZDA 5J98B 3PRTA 1PX3A 4Z8BA 1XMTA 2XL9A 4KBBA 5IAXA 1S3ZA 3Q8BA 2CTCA 1MS4A 1VPHA 3H8FA 5C3PA 4ZI6A 4BINA 1ULDA 2QZ3A 3IBMA 4QDRA 1B87A 2G9DA 4IUSA 4F8ZA 2R30A 2FS5A 3D67A 5C8CC 1PZ8A 2K46A 2RDQA 2Y38A 4KOWA 5IVVA 4GWMA 1IKQA 5FPBA 2P0WA 3ACIA 3IDBB 3K51A 4IETA 1KDKA 4NEXA 2J1VA 4XFIA 3JD73 4MFQA 1COV1 2PLV1 2IXJA 5LBBA 4MHRA 3WY6A 2WZR3 5IATA 1W9TA 4HK8A 3PVNA 4UFMA 3AP7A 1AHSA 1WCUA 4CPBA 3AP4A 3MRUA 3R9GA 3I49A 4MFJA 2PJ5A 1V6IA 2JE8A 1ELMP 4QX0A 2DCZA 4JHTA 1F4HA 1PK6B 3IPVA 4XDPA 4YW1A 3MW2A 1XFOA 4AZZA 3DYMA 4TLFA 5LW9A 3IDEA 1YI7A 5T3NA 2DUPA 1Y0RA 2ZEHA 4ISRA 4CCLA 3B35A 3WR7A 3M3OA 3WQBA 5BNOC 3CZXA 2QQPA 3B01A 4XBQA 4XETA 4EWDA 3SEPA 2H0VA 4K1ZA 1SEFA 2VXRA 3U1XA 1MQTC 2DFCA 3VBOB 1YW4A 4F9VA 1RVF3 2E63A 4MUVA 5F5QA 4BMEA 2W3JA 4G4FA 5AC93 1SBDA 4QXCA 1RIRA 1W6OB 1ASJ3 3I2FA 5FMBA 3V64A 3ZYIB 1JTZX 2FDKA 3MHZA 1IZ3A 4QWNA 2A6YA 4XFFA 3B3TA 1UN1A 5DAXA 4Q27A 2OW4A 3MPBA 4GM5A 1R64A 1U5IA 1LAMA 1A8MA 3MLLA 2FCUA 3V0BA 2FBEA 3CJXA 4LITA 3GYDA 3UNPA 3AP6A 3AMNA 3MV01 1EUUA 3ACLA 1QWRA 1OLME 2ZHKA 4ZONA 2P6HA 1UY0A 5DN2A 5FPAA 4AEDA 4AXOA 2YNDA 1UY2A 2A3YA 2ZKNA 2ZEMA 2ZEDA 4XFHA 4CYQA 1UL9A 5IB9A 2QIRA 2XJVA 3KCCA 4P14A 2Q1FA 3QLQA 4QU2A 4F8AA 2GC2A 5FZKA 2D6LX 2VBQA 1AR63 2ZGTA 2BWAA 4EN6B 4B1LA 1CX8A 4Y49B 3PEIA 3R1KA 3AC0A 1V0CA 3OD0A 3RMXA 4IV3A 4ZU5A 4XHXA 3VUOA 1Z0HA 2VZQA 2WS92 4JCKA 3GM8A 4PDWC 4XAEA 4WM7C 2K9ZA 3ZIWA 1F9KA 1RUG2 4XCAA 4EN9B 3BPZA 4J1WA 1OQEA 1HX6A 4XE9A 3WINE 2JEVA 5DUUA 3ZO0B 1A78A 3MUZ1 4META 2VU9A 1SPPA 2ARCA 4XUOA 2RDNA 3IMNA 3U75A 5IFTA 1NT0A 3RZHA 3LF7A 4JAAA 2AZ5A 2HC9A 3OOXA 3VBRC 4JTNA 3IEHA 2IVJA 2PHDA 5FREA 4ATEA 1YLOA 4Y20A 3TCVA 5J8CA 4IK2A 2PHTA 4HSJA 3EC4A 4I0BA 4ARXA 2RS31 2WFF2 3WF2A 1LKNA 5J09A 2ZX2A 4NWWA 2QECA 3NA6A 1FV3A 1UY4A 3HJRA 4Y26A 4O23A 3N7MA 5H9PA 4ZXKA 4MHUA 4CAVA 1H6XA 5ACA2 1LTEA 1S1AA 3KSCA 3NE7A 5DWMA 4OLLA 2G3AA 1QJEA 4JGYC 1CX1A 1Q8PA 1KRIA 1KDMA 1AXZA 1C5HA 4IEUA 5T5JA 2ENRA 3BJ8A 2WABA 2ZW4A 4MFPA 2XBO2 3CF6E 4JKMA 4O9EA 5HCAA 3M3EA 4MCQA 4BQ5A 5H86A 2CTBA 2V4AA 4QPYA 5FLHA 4P00B 1W0OA 1WMEA 3LA7A 2Q7BA 5A7QA 1RUOA 3HD8B 2WZNA 2OVUA 3JVNA 1TF9A 4ZXEA 4LK6A 2O14A 1ZZBA 3OPZA 3POJA 5KXCA 3VBSA 5A6ZA 3PTYA 4ZBGA 3FEDA 4UFKA 3S6FA 1P8JA 5L36A 4CAEA 1YX0A 1QHDA 5D8AC 3SXWA 1TXRA 4FBEA 1QJU3 2Q1MA 1PNGA 3NNGA 3BXMA 4RS2A 5FWEA 3B00A 5JOWA 3AK0A 4MXWB 3TEWA 4P44A 4NIDA 2DWRA 4DY3A 3UETA 3RS6A 4Y4RA 5FYIA 4YW5A 4LBQD 2TUNA 4URTA 4XIKA 3FJUA 5IK7A 2VXKA 5B4NA 5KTCA 1TEIA 1JXNA 4FPKA 5LASA 4O7XA 1RVF2 4AYUA 1MQTA 1L7RA 3IIAA 4CCDA 1HRI2 1X10A 2WAOA 5FZBA 3VBHB 4CU6A 1GZWA 1DDLA 3A22A 3OYWA 1US3A 1UYYA 4OQ9A 1SMVA 4HONA 2JX9A 4NVPA 5JOZA 4CYPA 2HWF2 4K6BA 5DWNA 4LLFA 1CJWA 4JYWA 4M85A 1JU3A 1QXJA 2WL1A 4IV3C 5LY2A 3ZYFA 1OA3A 4R9MA 5LK7B 2JE9A 1HDQA 1BQPA 1QNYA 1GU3A 1JUHA 5J8FA 3WC5A 3U10A 4Q1RA 5JXJA 4QXHA 1SCRA 4XC9A 1UMHA 3UGGA 1UMIA 4FAHA 5J48A 2WZEA 1RYYA 3TTHA 1S0DA 5LK5A 3RWNA 4UFLA 2VULA 4LBMA 3T0AA 3WVJA 3PB4X 3GJAA 3N7KA 4UAPA 5IHRA 1HXS1 4IEWA 2WPXA 1A8DA 2YGWA 4QT6A 3X29B 3WNOA 2BUEA 1S2BA 2CDOA 2EXKA 4AL9A 5FO7B 4ES9A 2F4LA 2GMPA 2J42A 5IVBA 2BEIA 5FKBA 3POBA 4R87A 5I0TA 3BODA 1YMEA 4UXAA 5FKCA 4MBUA 4GH4B 1QJX2 4YWAA 4MFKA 3AMMA 1NY71 2JDNA 5F5IA 2QVSB 1CN1A 1REEA 5FZGA 5T5PA 3D3AA 1FPN3 3IM0A 1SFPA 1KFUL 2O8QA 4JVAA 2XR4A 4CCNA 4UI9L 4CCKA 3OBTA 1RXTA 4E8OA 5AFBA 1H9WA 5B4XA 4BWOA 4EJRA 2IXLA 4OCTA 1RMU3 3B94A 4N43A 4EMEA 1W9SA 2R7EB 4I3GA 4B7KA 4ZGYB 1J3QA 1DG6A 3WEZA 2A3WA 4JXRA 3IFEA 3ZMNA 5F37A 1IIDA 3QH7A 2ZZQA 2PJCA 3KV4A 2ANPA 3TC8A 2R1BA 4IV1C 1ACCA 1MJBA 5E8AA 4A45A 2J1EA 4JGZC 5FPLA 3MEPA 1LRHA 2QQUA 3N35A 1M4LA 1TKHA 2PVWA 1HJFA 2ZGKA 1UZWA 1VBB1 3LB9A 1ZBA2 2BOIA 1QNWA 1J1LA 4P9JA 4YVWA 5FQ0B 1DLLA 2P3YA 4BIFA 2V8HA 2R073 3BOWA 3AMHA 4NIHA 3ZSEA 1LHNA 2JDDA 1RJ8A 2HWC2 1N3PA 3KZ4C 4FPCA 3VV1A 5G21A 1NLSA 3A0KA 4CGNA 4Y5SA 1XSRA 2JD9A 3CZJA 1VBE1 3USUA 1CAXA 3S6PA 4ZU7A 4OI1A 3R6SA 4K30A 1W2AX 3R4UA 1WUVA 1AR92 1VRH2 2QBXA 2XDVA 3FHAA 3OEBA 2GZWA 5FY0A 2HWF3 1BK0A 1FT9A 1L7QA 4G3YC 4Q4Y2 5JXGA 1XOVA 2P1BA 4EZ4A 4RN5A 1D7PM 2PJ7A 3FBUA 3N36A 4JGZB 4BMBA 4AI2A 5C8CA 4GD4A 2PJ2A 1WGPA 1RUG1 4KGGA 1V6KA 2R0HA 1DQ6A 1KITA 4K8RB 2B4DA 3SJEA 3VBSC 1I3HA 1NUKA 1OOPC 1TQ5A 1A34A 4BU2A 4X8IA 2RS11 4FAGA 1DTDA 4DNCA 4JV4A 3KVBA 4P5YA 5GLZA 2VVDA 3TFYA 4KSAA 1BBT1 1LOKA 4QX3A 2DV9A 2ILMA 4FOVA 5C3QA 4J3GA 4NE9A 5EYXA 5AGEA 2FHRA 1VGYA 1BEV3 1ONAA 5JR2A 5L73A 4R52A 4IEYA 5ABJC 3VL8A 1CP6A 5J1QA 3BB6A 2QQLA 5E88A 1NA1C 2W52A 2ZGLA 3J7MA 3UGFA 5JAXA 2Z3MA 3SC7X 4QUSA 4XJ9A 1W2OA 3MIHA 1IQAA 1SQ4A 2R071 2VQTA 4XAAA 3A0NA 3MN8A 2JDHA 4CYDA 2HB6A 2VUAA 4L2NA 2GC0A 4P4FA 1TMF2 4NMIA 1K45A 3WNNA 4R8FA 4I01A 5FXWA 5LRRA 3THCA 2VZYA 3CKHA 1QJX1 4M4RA 1RHI3 3LOBA 1YCIA 1IOAA 4BLJA 2Q4SA 1D0GA 1JHJA 4ORFA 5CKQA 3VDBA 3CDXA 4RN7A 3QBQA 5JGFA 2RM21 4PLOA 5JWPA 3OUJA 2FZ2A 1TME2 2JG9B 2V09A 2WZ8A 2OX0A 4Q4X1 5FMOL 5FUPA 4GIQA 4RS5B 2YY1A 1W6PA 4I3PA 1QJY2 1W90A 5FJKA 4A7ZA 3GZTB 5B2GB 3C8XA 5IVEA 2XVKA 4D7YA 1BBT2 3KR5A 1NOVA 1VAVA 3MIGA 3TRSB 1XNAA 4UWDA 3CJIC 3CL1A 2JJ6A 2V73A 5BUVA 1M06G 2R062 1TNRA 4JDMA 4Y1ZA 4CEYC 4LUKA 2D97A 3T9YA 3PU3A 3JUUA 3LCPA 5FK7A 3JU9A 3I3EA 3ZFGC 5D8AA 2IFWA 2ZHMA 1OD3A 3U78A 2C6GA 1JYNA 2X53S 1FX5A 4MHZA 3J4UH 4XUPA 4CU8A 3FLRA 3TX8A 2WJSA 3F5BA 4HT1T 4LPLA 5LBFA 2FL4A 3U07A 3MZHA 1O6UA 5FY4A 4MGTA 1GQPA 2VTXA 2PMWB 2X5IB 2J1UA 1HXS3 3FBMA 3MV11 3OYWB 5A80A 3V56A 4BB3A 2WN2A 5FOBB 1ZZCA 1HRI1 3ZYRA 4ZYQA 3R0RA 2GNBA 4IL7A 1ND3B 2XJQA 4OC2A 2UY8A 3JCIA 2YHJA 2W0XA 5FZLA 5I93A 2NLRA 3FH4A 4A37A 1VB4A 3KM5A 1VB2A 5A7OA 4A44A 5LRGA 1B09A 3CXSA 3I3MA 5CIRA 4L89A 2VCBA 3E6BA 3ZSMA 3RI9A 2QQNA 2PJ8A 1YREA 2ZGQA 3D7DA 1C5IA 2Q30A 5FY9A 4R9DA 5C4WB 3O1PA 1IHMA 1WBLA 3RRDA 3B3SA 3HQXA 2VUJA 5L7OC 3P2FA 3KT1A 3K75B 3HT1A 4NRPA 1CX4A 5I0RA 2Z3NA 1FXZA 2RMU1 4ZS2A 3RFRA 5EWSA 3W58A 2HWC1 1YR0A 1JOBA 3LA2A 4H55A 3K3NA 3I3DA 5JI7A 2CGPA 3I2GA 4MV2A 1NLQA 4GH4A 1PVC2 2CHHA 2KM2A 2Z0ZA 4AG7A 2DCTA 2BDRA 1XYPA 3IO1A 4QMAA 5A3UA 2BOJA 3HQRA 4MYEA 3SH3A 2DPTA 2FDIA 2C5DA 1ASJ2 1XE8A 4M6GA 3RYOA 2PCUA 3GKRA 2QTWB 1VBA1 4CVUA 4A33A 4KLVA 4L11A 5FUNA 3VZJA 4GB31 4I09A 3DKWA 2W94A 1N71A 1C4RA 4CGLA 3L2YA 5GLVA 3MDPA 2BTVC 4Q4Y3 1DE4C 5JQ4A 3WCSA 4B13A 2ZELA 1QQP1 2WWSA 1UNBA 1BKZA 4FPLA 3FECA 4A31A 4NR1A 4WM8C 3ZYGA 2WQ8A 4IV3B 1DGWX 1K5MB 2D6MA 5TSWA 3WUCA 5J96B 1DGWA 1LODA 2G9ZA 3LA3A 4LXLA 3DR6A 1MS5A 1OFNA 1XOYA 2RS53 2WO2A 3LEGA 3VHNA 2W87A 3GY9A 5LYFA 4XFAA 4XUTA 1DHKB 4A39A 3LEIA 5AG6A 4P9WA 5FAXA 4AI8A 4E2SA 2Z4FA 1CP7A 1HXS2 2OXBA 1V9U3 3IDCB 3U11A 3TB0A 2WLPA 4LA3A 4AVVA 5A3MA 1Z5RA 2H5MA 4TZDA 4HXCA 4JQRA 3I4IA 3FRMA 1W3VA 4Z65A 2GMMA 2K2SA 5H9RA 3HQUA 2AR6A 2V8GA 2DCJA 3ZXLA 4RFRB 2J8MA 2AEYA 1W8TA 3WZ1A 3KKWA 4TWEA 4GA9A 4ZY2A 5ELYA 5BNOB 2A6WA 3KT7A 1RL3A 2RR12 3RYRA 5SV8A 2Q8DA 4ZS3A 3VZLA 3B3CA 4XJ8A 3RYKA 2VOTA 4E4HA 1V6NA 4KLWA 5LEJA 1ZG7A 4QGMA 4AWDA 1W6MB 3VD5A 4KVOE 3H7JA 5CKMA 3UY5A 2DTWA 4RQPA 3UJOA 3MYXA 3WG3A 4Q4V1 1XSQA 3ACFA 1CJDA 2AE6A 2NZ9A 1IICA 1W99A 2IZWA 2XJTA 3IIIA 4MCSA 4C7HA 3O12A 4LHSA 2GC3A 3VZKA 1IG3A 4ZKTB 1YJLA 1WW6A 4GB32 1CPXA 4CUCA 2EBJA 4AVCA 3A9LA 7CPAA 3LPFA 1ELLP 4KGQA 1RO5A 1GWKA 4JGYA 2RG4A 1ND2B 2JWPA 3ZVXA 1LOGA 5LA9A 1S0FA 5FP8A 5C33A 2X7BA 4CEWA 1F35A 4YW2A 3PBBA 3GCXA 3WXPA 5C3SA 4NGRA 2XBO3 2YV8A 5CFDB 4LO7A 4KWKA 2WWJA 3KVAA 1SBEA 1CD3G 2ZEWA 3GIUA 4KG0A 1QXRA 1YQ5A 4WM8B 4DEQA 2Q51A 3IGRA 3VD9A 2C4XA 4AI1A 4COUA 3BTXA 4AE2A 3AYAA 4N53B 1Z8TA 4YLZA 1NAEA 4Y20B 5DPNA 1GICA 4FP3A 2NN8A 2CIJA 4B5PB 3ATGA 2OPWA 3WC6A 4JC1A 1VBD2 3PUSA 2YNCC 4PXCA 1XU2A 1YUDA 5BNOA 5JSRA 5IT6A 3RNZA 2WA4A 5FMOS 2WQZC 1RUC3 3WF1A 2A4NA 3HNBM 3B3QE 3POSA 4B5PA 3J7HA 1N47A 1NCRB 3B2YA 1ZA7A 4PHZA 2AGSA 4YW3A 1MS8A 2HEVF 1FPN2 1XIXA 5LRJA 1UWYA 3IDAA 4JQTA 2ZEYA 3HR9A 5ANNA 1K12A 2Z3OA 4M00A 2DVDA 2BL1A 3M3CA 4FXKB 4TTGA 4H2AA 2FCTA 1PO12 2ZAHA 4YSFA 3QB8A 1AYM1 3DPRA 1V9U2 5IJRA 3SNMA 4EN0A 1CPNA 4XJUA 3PIJA 4NRQA 1DCSA 4W6XA 3J26N 1JZ2A 1APNA 3VBUB 2BWCA 1YQ2A 4R9AA 2LUWA 5M0TA 4UFIA 4A42A 3O1VA 1WLTA 3WUDA 3I3BA 1OSGA 3L2HA 3S6HA 1V70A 1H2KA 3I2DA 2E26A 2R98A 1HIXA 4Y1XA 3PBEA 4YG0A 1PM4A 2VG9A 2VZRA 3APBA 3OEAA 2QMLA 2P3IA 1D4M2 3AYDA 5CVRA 3UKTA 3T8WA 5GKAC 4KH9A 2IL4A 2R8VA 5IVJA 3N9NA 3RDIA 3ZFEB 4C0BA 4CXXA 1AUYA 1Q2DA 4FD4A 3P1IA 5LCWL 1C28A 3VDDA 3VD3A 4C0HA 2OOTA 4A32A 1J58A 2VMFA 1W8ZA 3M1HA 4RR3B 3SCFA 3D66A 3O5SA 5HCBA 4DB5A 4H6ZA 3EYPA 4LORA 1IOFA 1O59A 1UZ0A 1NCRA 4KSFA 3I97A 2W1UA 3WQ7A 3D4UA 4QDSA 3NFZA 4G1PA 2FT0A 2EICA 3NSTA 3BLNA 3PLQA 5EHDA 2UWCA 3IJ3A 2BV4A 2GN3A 5L9BA 3JB4C 2DYCA 4UBHA 4RHV3 2WRAA 1J1TA 5F7UA 4EYUA 1Q43A 4C68A 3FXTA 4Q2FA 1BVVA 4UFXA 4QX5A 4RS5C 2QFEA 1YSJA 1W8HA 1W2UA 4IQPA 1BMV2 1YXWA 4P02B 4FCAA 4QB2A 5LB6A 4YGOA 2ZEGA 1X9PA 5FYBA 5KHIA 5BNNC 4DXTA 1YVOA 4A95A 1KWMA 3V7ZA 5A27A 1H2LA 4YU9A 1ZVFA 3DEMA 5D1IA 5FZ8A 1MS9A 4CDUA 4P4BA 4CE8A 4M01A 5FO8B 4JJXA 4DFSA 3VN4A 1WLCA 1W06A 4RHV1 3ZYJB 5HVHA 2E9QA 5FRAA 1Z4RA 4WVMA 3B02A 2OZUA 4PSWA 2V8VA 4OI4A 3PUHA 3TN93 4NHYA 5CG8A 2DURA 3WW1A 1WMXA 2VNVA 1BYHA 3KCXA 5DUVA 3RZAA 2QNKA 5JSPA 1N3QA 5C3RA 1COV2 2PLV2 4HPSA 3BYWA 3A7QA 4QXBA 5FK8A 3IU2A 4MRIA 3PVBB 1JU4A 2W39A 2I74A 3D82A 4WZCA 4D7SA 2QZ2A 3U4XA 1KUYA 4X8NA 3VB9A 5G22A 1H1IA 2IFRA 1PHMA 4WVWA 3ZMOA 1F15A 1REDA 3H8XA 4NHXA 2QUOA 3QH6A 4FVVA 4MGKE 2HYXA 3SJXA 1UKGA 2VJXA 1ARMA 2Q5TA 3N5FA 1XNCA 1T2XA 2ATRA 1LGBA 3H8GA 3HLPA 4LQ6A 2A7AA 3E5UA 3PDQA 4MFLA 3PFEA 1FNZA 1G9FA 4Q0UA 1ZRFA 1IQDC 1OMIA 1RHI2 1XJAA 4FTSA 1F8VA 5DAWA 2NSMA 1DYOA 2OQ6A 2GSYA 4KOTA 1Z8XA 2WA3A 1Z8LA 4A94A 3KHXA 3M70A 2W46A 3INAA 4MXUA 5A32A 3AZWA 1ENQA 1Q56A 2ZCWA 1W8FA 1AMPA 2J9AA 4C1WA 1W6NB 3E1F1 2D93A 3P3PA 3C7OA 1CAUB 3OY8B 4WV8A 2GFQA 4AB7A 4GAZA 1ULOA 3H9AA 2ZGPA 1VE0A 1AYM3 8CPAA 4DXSA 5CISA 3NQHA 2XQXA 1LHUA 1XE7A 4P10A 3FIXA 3K48A 1WWYA 1S0IA 1QSNA 2H6BA 4PPZA 1NQDA 1UD1A 4WVMB 4Y24A 3WABA 1TG7A 2OUHA 3LWCA 3WR0A 2Y34A 3HWJA 5BNQA 3OGVA 1RC6A 2JIGA 3WDWA 2XWBB 5GM0A 2PHXA 2VC9A 4A30A 4UWJA 1IYKA 5A7PA 4BLIA 1DQ0A 2GU2A 4IDZA 2D3SA 3I59B 4FSJA 4XNHB 1RUC1 2WFPA 3ZXGA 2ZEEA 4XMAA 4IEXA 1GYKA 1D4M3 1UX7A 2WWUA 2YC2A 3DV8A 3OG2A 5LBCA 3ZN6B 3LFMA 3B9CA 4D6SA 2BO9A 1O3SA 2IJZA 4CCMA 3PJQA 1GZWB 4JRLA 2OB0A 4P6YA 3LIGA 5I4MA 2ZAAA 4CUGA 4PXEA 1ULPA 1DGRA 1R1A2 3P5BA 1BLLE 4KOVA 4FQ4A 2BQPA 1V6LA 1YIFA 1WW7A 2D6KA 1D4M1 3SISA 5FZ9A 1XU1A 1W3XA 4MOAA 3VBRA 3ZXFA 3IAPA 4D0QA 1UKRA 4IEOA 3S6GA 3U37A 1LESA 2XBO1 4C2ZA 5SV5A 3ZSJA 2VBPA 5APAA 4PDWB 2Z3LA 1B35B 4QQLA 3NJXA 4DRVA 4QU1A 2XUEA 4DUVA 2VMCA 1TIQA 3EO6A 1YNAA 3T30A 3WF4A 4UF0B 1RUF3 2Y6LA 3PZJA 3KWVA 3NL1A 2FVGA 5A6XA 3BTYA 3MF6A 5AG7A 3SJFA 1ST8A 1UIKA 2YZ4A 3CLPA 3NV3A 4OHZA 3S5AA 4AI3A 4CA9A 3MIDA 2XONA 1CAWB 3LWUA 2PJ1A 2XKOA 1IS4A 3NNMA 4U9ZA 3HIFA 1N1YA 3MW4A 4DRRA 4P9YA 3M3QA 3POWA 1NZCA 4CAFA 4MFZA 2ZABA 1YFXA 2VW0A 3KT4A 1OOPA 2WZPP 3WNPA 2JB4A 4LO5B 2A5ZA 3F0AA 3AP9A 2QQVA 3I9SA 4LKDA 4S2GA 1H30A 4QBJA 4UT5A 4LHNA 4RUHA 5BNPA 2Q0YA 4Y1YA 1GOGA 2E7AA 1BPNA 1WMDA 2E32A 3DYPA 1FMD1 3UV9A 2JLMA 4QVTA 1ZBA3 4YRDA 4A7KA 4XUNA 4K7JA 5IX3A 1E5HA 1V9U1 4LUMA 3T3YA 3O1OA 1FYUA 4NSQA 2ORXA 3NJVA 2BYVE 1IS3A 2DVAA 1HN1A 3H1MA 4NWVA 4OFGA 4W50A 5FQ0A 4GZ9A 2SLIA 3DDDA 1C1FA 2RS51 2ZEZA 4D7TA 4UEFA 5F3EA 3POGA 2VO5A 4Q4W3 2WR9A 4XFBA 5KHGA 3TN91 3KV9A 3KGQA 1EP0A 2WDBA 1OKOA 4Q0PA 4X6RB 4BJ0A 3K46A 4CP9A 3ZFFA 4XPLA 3LPGA 2WPWA 3VARA 2F17A 5FMCA 1XBFA 2YGLA 4RFT0 4D6QA 1CBXA 3R9FA 5A6YA 3QOPA 3SQOA 4YFZA 3H4QA 1H1MA 3AM2A 4Q4Y1 2WAAA 4KQ7A 5JOYA 1X33A 1FT7A 2F7VA 1W03A 4E8DA 2YU1A 3AFKA 1QEXA 3OGGA 4A6SA 4U5YA 4HNWB 1VBC2 3TEYA 2P37A 2BEOA 5AG5A 4HKFA 4HK9A 4XQDA 1LNSA 1W9FA 1UYZA 3FJSA 4HVOA 2P6CA 4B29A 4AVBA 2UU8A 1GHEA 3OJBA 4UW5A 3V0AA 3Q9OA 4LIVA 1KFXL 4DYOA 2FQPA 2HWC3 2VW2A 3K2OA 3GALA 3O7OA 5CYYA 5FZEA 3PTRB 3S5QA 5EPAA 2R072 4RSUA 3WP4A 2PE3A 3I54A 5FZHA 3I3GA 3ZXDA 3TO6A 3MUY1 4FWUA 4MGSA 3KV5A 4PCRA 1QU0A 1YK3A 2LALA 4QQOA 3ACGA 1SG3A 1X8EA 3FZ3A 4ASLA 1MVQA 2GALA 1NA1B 1H6YA 5LA0A 4DXZA 1LENA 1OH4A 1Y9MA 1NYWA 2ZMLA 2OZJA 3E5QA 3PMEA 1GOHA 2P3JA 4PF1A 2NMOA 1JQGA 5JH9A 2OS2A 1KXGA 1U0AA 3EJKA 3DGVA 1W6PB 4CDQA 1I21A 1BEV2 1UYXA 5A3LA 3W5MA 3L2NA 3WCRA 4PXBA 2DPSA 1Y7BA 2RR13 3KS7A 4PIZA 4QGNA 4UCPA 3EB7A 2PELA 1Y9WA 1NE6A 4JRAA 1SLBA 1WBFA 1NLRA 4QHOA 4OZOA 5FPZA 4AEKA 2G0BA 2UWAA 1O3RA 3V0BB 1WD4A 3HNMA 3L9JT 1T6GC 4B4PA 1OF3A 3FLTA 4EN7B 2IMOA 4R4ZA 5T5OA 4R8HA 3VBFA 3BTAA 3D68A 4ZZ8A 2A1XA 4YGEA 1UO9A 2AFOA 1IY7A 2K0GA 3AKSA 3UESA 3N9MA 1OPOA 4C91A 4IW3A 4ONWA 4CGOA 3AZZA 5EP9A 2JE7A 4N90A 4FD6A 2CNAA 3O1UA 4AFDA 2IQ6A 2FE7A 1OVSA 1AR71 4EV0A 4BHPA 5BNNB 4B4RA 2CNSA 4FPHA 5FFOC 4CDWA 2X8KA 4K40A 1HV0A 2XLAA 4XOGA 2XJRA 3ZFFC 1CZSA 2Q8OA 5JM6A 3LACA 3V0AB 4GWNA 3CU7A 4U2AA 3VZMA 3O1MA 3S6KA 1NXD1 3WW3A 1R57A 3J7NA 2HBTA 4W8JA 3IZOA 4YGCA 5A7WB 3T08A 3ZSLA 4WM8A 2RM23 4BQ2A 2VY0A 2D6OX 3FWEA 3JD72 5FZ1A 1YGHA 3KI9A 4UEEA 4Y33A 2Q8CA 1G9BA 2HWB1 4XILA 5CNAA 5FYHA 5IK5A 1TF8A 5J7MA 2I2SA 1J4JA 4UIAA 2ZHLA 2D5HA 5FXVA 2PHUA 2YFUA 1DZRA 4LBQB 4QPGA 3ZZIA 1URXA 1WLWA 2ET1A 4L8QA 4AR2A 1DYKA 4JGZA 3HN3A 5C8CB 2VBBA 4IF5A 2UWBA 2VCAA 2YYOA 3GBWA 1QJU2 3KLSA 4QHZA 4E27A 4FAIA 1BXHA 1EAH2 1LJ7A 4FOWA 4Y4YA 4GH4C 1PVC1 3WT4A 1HDUA 5F48A 5CEHA 1BEV1 2QQKA 3PJYA 4MH0E 1RB8G 2PR8A 2E53A 4GMP0 4Q36A 1K42A 2VXJA 2PVVA 2RS13 4K1YA 2HUZA 4QPIB 4LEJA 3TAYA 2GDFA 3R4SA 2ZW7A 4MMOA 2PHWA 4OC3A 1RUG3 2I45A 2RJKA 4AQSA 1KJLA 1EE3P 1EV13 4A38A 5DDJ1 3F2ZA 4AGGA 3B3VA 5C88A 2JDZA 1RJ7A 1ULFA 2CWMA 3D0JA 3D8CA 3ZYBA 1Q2CA 2JDCA 3QNVA 3LD2A 1CPMA 2J8NA 1YRZA 5CFDA 1DQ1A 1KQRA 3EO4A 2YBKA 4CXWA 4Y22A 2JG9A 3LQCA 1FI2A 1S4CA 4JD6A 2BUKA 4EWAA 2YROA 4PIYA 2HYKA 2PFWA 2EA7A 1W05A 1TZOA 3VBHC 1NKGA 3DECA 4XMIA 4F9UA 2B3UA 1A2ZA 4OKOA 3RSJA 4CP9B 2PXJA 3POFA 1GQHA 2B46X 4MI4A 4B5OA 4Q7AA 4HNXB 1UCXA 2YU2A 4UW3A 2A6ZA 3CMGA 4N8MA 1XNKA 4ZY9A 1WW5A 4RQPB 5KXEA 5ISLA 5HMNA 5H9SA 2PA7A 2V5DA 1LEMA 1HJGA 2FCVA 4XEZA 3BI3A 5JIAA 3BALA 2FIWA 1W9WA 1YWKA 2XGXA 2DFBA 2Z2SB 3MPPG 4HVQA 5C70A 2WYFA 4O61A 2JG8A 1RMU1 4N53C 4RR3C 4XF9A 4LK7A 4DUXA 4PLNA 1L0CA 3UKNA 1FAYA 4BQWA 1VBD1 2CGNA 4A2UA 4XF1A 3VD4A 4R9CA 2HV2A 3OGSA 1OXCA 5BWAB 2FXFA 5FPUA 5FYSA 2BBAA 4PJYA 4Z2WA 4MHYA 4OUEA 1IKPA 4MGQA 3OBRA 1VMJA 4NHLA 4YZ3A 5EV7A 4KWLA 4AAPA 4AFCA 4FFGA 1CAUA 2B7YA 3ZKUA 4FUUA 4HPKA 5DG2A 1LULA 3RZZA 3SJGA 2PJ9A 3M4FA 5C9AA 1NCQB 2HWE2 4Q29A 2REFA 2B8MA 3KQ4B 2YBPA 1Y9GA 4GB33 5HXVA 1JODA 3ZR5A 1UF2C 2B4BA 2CDPA 1KUVA 3KQXA 4XNHC 2C6SA 1VBA3 4AW7A 4CDWC 2XEGA 2PHFA 3KF3A 4C8DA 4R3KA 3ZOIA 1ON0A 1HQLA 4IHMA 2C9AA 4OI2A 3VKOA 1AL22 1AX2A 3THPA 2P6FA 2UYBA 1JMUB 4HN1A 2R043 1Z2LA 5LYDA 3B3WA 2JKXA 3I2IA 3JBG2 4W6YA 3VLBB 2VMEA 2O1QA 3CO2A 5FMDA 3PB9X 1Z8WA 4ZPIA 5A3TA 4FD7A 1QDCA 1IS5A 4Z92B 1HV1A 1OUXA 2JG8C 3ENRA 3HPNA 1O5LA 4N53A 1KS4A 3RMYA 2GREA 1Z78A 4NXYA 1L7LA 2KR2A 1QJFA 5JPHA 3ZFGA
chains in the Genus database with same CATH topology
4RL7A 4NN0A 4XBNA 4XFGA 5JPNB 3AKRA 1D2SA 3W59A 1G8WA 3OGJA 4ISQA 3IKWA 4H3WA 4PF5A 2F4PA 4J6GA 3SHRA 5KTDA 2XH6A 1I5ZA 1LOFA 1ZM1A 4OVEA 4BYYA 5DUXA 1YYNA 4COVA 2EXHA 2ZX3A 4EN8B 5ABJB 3E6DA 1JH5A 1QMJA 1ALYA 2ZKLA 4HPKB 4CRYB 2A70A 1WCKA 4AFMA 2ZGMA 1LGCA 3AKTA 1NQJA 2P6EA 2ZGNA 5CBLA 3RNSA 1C8M2 4IEVA 2XLGA 1ZZ6A 3N4MA 1FY7A 4B4QA 2OZHA 4QQ2A 2K5TA 3NW4A 3NWKA 1OLQA 1VBD3 1ND2C 2NM1A 2Y0IA 2PAMA 4IERA 2OYZA 4TWTA 1KUXA 1LB2A 4FBFA 1AR93 1VRH3 3HT2A 4R3LA 1QXPA 1LGNA 2O8OA 4N7UA 1AL0G 4CEWC 1VHSA 1QJX3 1X7NA 4Q4W2 3MIEA 4L8AA 2B58A 4A3XA 2VH9A 3PP9A 1PGL1 3UL2A 2WS93 3VBFB 4XJZA 3DGTA 2QJVA 2WT2A 5I8SA 4DQAA 5J36A 3WW4A 2VMHA 2VW1A 1M4GA 3DL3A 3BJ7A 1YFUA 4CDXB 2R0FA 3QCWA 5EC4A 1B35A 2PHRA 4CDWB 1NY72 1UPIA 1W6NA 1ZZ9A 1W6OA 1YVKA 5DDJ3 4Q8LA 1EV11 1AJKA 5C9AC 3PNAA 5GZCA 4XBLA 5IK4A 3R05A 4MXVA 2F6BA 5JSOA 3M8LA 2CAUA 3FFQA <