1YW4A

Crystal structure of the succinylglutamate desuccinylase from chromobacterium violaceum, northeast structural genomics target cvr22.
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
331
structure length
319
Chain Sequence
THSPSFLQHALSSSDTRAEWPLPGGLAARWLAPGCVELNGDARGADSVLLSCGVHGNETAPIEVVDGMLTDIAAGQLALNCRLLVMFANLDAIRQGVRYGNYDMNRLFNGAHARHPELPESVRAAELETLAAEFFAGARARKLHYDLHTAIRGSVFEKFAIYPFLHRTHKREQLAWLQRCGIEAVLLHTQPANTFSYFTSQYCEADAFTLELGKARPFGQNDLSRFSGIDGALRGLLSNPQANVPDLDEDKLPLFRAKYDLVKHSFKLNLADSVENFTLLPDGMLIAATGGEERILFPNPAVKPGLRAGIVVEPARLPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinylglutamate desuccinylase
publication title Crystal Structure of the Succinylglutamate Desuccinylase from Chromobacterium violaceum, Northeast Structural Genomics Target CvR22.
rcsb
source organism Chromobacterium violaceum
molecule tags Hydrolase
total genus 86
structure length 319
sequence length 331
chains with identical sequence B
ec nomenclature ec 3.5.1.96: Succinylglutamate desuccinylase.
pdb deposition date 2005-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1yw4A00
1PYTB 4OIWA 2OOTA 4OC4A 3ISXA 2DEAA 7CPAA 3IJ3A 2GLFA 4MHNA 3SJEA 1YW4A 1DTDA 1EE3P 2ZEPA 4JYWA 3PB4X 1Z8LA 2J9AA 1FT7A 2IMOA 2IJZA 2ZOFA 4P4BA 2PJ0A 3KGQA 3V38A 4MCQA 4YWYA 4R8FA 2ANPA 3KR4A 4IAVA 3PB8X 2ABZA 4X8IA 2PIYA 5LYDA 2FVGA 3RAMA 3FF3A 3IWWA 4A37A 3CT9A 5THWA 1TF9A 1HDUA 1LAPA 2PJ9A 1YW6A 3PEIA 2BCOA 5LRKA 3MN8A 2EK8A 1ZG9A 4X2TA 4MRIA 1ARLA 1ELMP 1H8LA 3K2KA 1VIXA 1KWMA 4MCRA 1R3NA 1ZLIA 2IQ6A 2ZENA 4PXBA 2CIJA 3D68A 3SI2A 3FX6A 2PJCA 1ZG7A 3S9NA 2C1CA 3H8EA 1TKHA 3JRUA 3SJXA 3D7FA 4A38A 3NH4A 1CPXA 2BO9A 2PJ7A 2JEWA 3S9MA 3B3VA 3IO1A 2RB7A 3H8GA 1TKJA 1F2PA 3PRTA 5F09A 2NYQA 3LWUA 3FH4A 1ARMA 2PJAA 3NFZA 3PFOA 4F8ZA 3IC1A 2XEJA 4EFDA 4ZX9A 4ZX8A 1ELLP 3H8FA 4KSIA 3PFEA 1TF8A 2V8HA 3KQZA 3SI0A 1Z5RA 3HLPA 2AFZA 3PB9X 1YLOA 2C6CA 2AFWA 4R76A 1JQGA 5J1QA 2GLJA 3DGVA 4NGTA 5K8PA 4NFRA 4MCPA 4OC1A 2AFMA 2WZNA 4NGRA 2NSMA 4RUHA 4PPZA 5ELYA 3KI9A 3KR5A 1BLLE 3ISZA 4OKOA 5K8OA 3GB0A 5CBMA 5JGFA 3NH8A 2PJ3A 1UWYA 3WC7A 8CPAA 1R43A 5IB9A 3N5FA 4ZI6A 2O53A 1VHEA 3DLJA 2AFOA 1LAMA 1ZG8A 1CG2A 4MMOA 3NA6A 1HDQA 4FAIA 4MHZA 4OC0A 2C6GA 3CPXA 4NGSA 2G9DA 2ZEHA 6CPAA 1CP7A 3KZWA 4MXUA 3SJGA 1CPSA 2OR4A 3CPAA 3IIBA 2EK9A 2EWBA 2PJ4A 4X3RA 4DJLA 4R6TA 1M4LA 3B3CA 4NGPA 5LYLA 4K3NA 3KHZA 4ONWA 3VH9A 1F2OA 4WWVA 1LOKA 5JH9A 3S9LA 3D7GA 3L2NA 1XRYA 3WABA 3WC5A 1Q7LA 5HVFA 4R7MA 2ZEDA 2QVPA 1LCPA 2F8HA 4IHMA 4ZY0A 2BOAA 3PB6X 1VGYA 4O23A 3KHXA 4FWUA 4UIBA 4PXEA 3GUXA 1FNOA 1F57A 4IK2A 4PQAA 4DYOA 2QJ8A 3B3TA 1LANA 2V77A 4FBEA 2Q51A 4ZYQA 3HUVA 3BI1A 4NGNA 3WC6A 2XEIA 3KL9A 1VHOA 4H2KA 4UEZA 1BPNA 1Y0RA 2CTBA 3B7IA 3FEEA 1IY7A 2V8GA 3SJFA 5LRGA 3CDXA 2HC9A 3RZAA 2PJBA 2GREA 3IEHA 5I4MA 5K8MA 5DS0A 5LYFA 1IGBA 2Q4ZA 5CPAA 2Q43A 4A94A 3I1UA 2QYVA 4P4DA 5LYIA 3VARA 5K8NA 1ZLHA 1QQ9A 1CBXA 1YMEA 3PBBA 3D67A 3LMSA 2PRQA 2ZEFA 4OC5A 4NJRA 4P10A 1AMPA 4GM5A 4ZY1A 4A39A 2V8VA 1TXRA 3BHXA 3D7DA 2ZEEA 2ZELA 1QMUA 2PIZA 4P6YA 4JZ0A 2WYRA 2JBKA 2PJ8A 2PVVA 4MCSA 4EWTA 2PJ2A 4OIDA 2PVWA 1CP6A 2HB6A 4WJBA 1XBUA 1TKFA 4NGMA 1LFWA 2ZEGA 2AFUA 2PE3A 2ZEMA 2PJ1A 4P4EA 1NSAA 4NJQA 4EMEA 1OBRA 1HEEA 1AYEA 3FMCA 2C6PA 3IFEA 2F7VA 3GLJA 2ZEOA 3T8WA 4F9VA 4OP4A 5HVGA 5LRJA 5D29A 3SI1A 3RBUA 3KASA 4P44A 2CF4A 2POKA 3B2YA 4B6ZA 3TX8A 1XJOA 2ZOGA 1DE4C 3BXMA 1Y0YA 4MHYA 4LQGA 3FECA 3NH5A 4UF4A 4W9YA 3TC8A 4Z65A 3WT4A 4BD9A 4UEFA 2JBJA 3MRUA 3FVLA 3FEDA 4UEEA 2PJ5A 5JM6A 4OC2A 3VATA 1XMBA 2VL1A 5HVHA 4TWEA 4AXVA 2PCUA 3FJUA 5D8NA 4OC3A 4F9UA 4PXCA 4YU9A 3V7ZA 2GU2A 4P4IA 2XEFA 4P4FA 4CPAA 3D7HA 4UIAA 4ZY2A 4G1PA 2V8DA 2AFSA 1CX8A 4OMEA 4P4JA 3B3SA 1Y7EA 4FUUA 3B35A 3D4UA 4DUKA 4P45A 3QNVA 3PB7X 1GYTA 1YSJA 4Q7AA 2O4HA 4TNUA 1PCAA 3BI0A 4NGQA 2RFHA 4PXDA 1XFOA 3D66A 1BPMA 1Z2LA 3B3WA 2XEGA 3KQXA 2AFXA 2I3CA 5HXDA 1BAVA 3PBEA 2CTCA 1RTQA 3K9TA 2PJ6A 4MHPA
chains in the Genus database with same CATH superfamily
1PYTB 4OIWA 3RNZA 3TOAA 1WWZA 2OOTA 4H89A 4OC4A 3ISXA 3LD2A 4UA3A 4E8OA 4QBJA 2DEAA 7CPAA 1BO4A 3IJ3A 2GLFA 4MHNA 3SJEA 3D3SA 4R87A 2PC1A 1YW4A 2C27A 2Y0MA 2Z3KA 1DTDA 1EE3P 2ZEPA 3H4QA 4JYWA 4M6IA 3PB4X 1Z8LA 2J9AA 1YQEA 2FIAA 1FT7A 2IMOA 1YGHA 3JTKA 2IJZA 1GHEA 4KVXA 5F49A 2ZOFA 2CXAA 4P4BA 2PJ0A 3KGQA 2PSWA 3NE7A 3V38A 1Z8WA 4KS9A 1KUVA 4MY0A 2FSRA 4MCQA 4YWYA 4R8FA 2B3VA 4R3LA 1R57A 3PZJA 5AGEA 2ANPA 3KR4A 4IAVA 3CXPA 3PB8X 1QSOA 2ABZA 4ORFA 4KVME 2FIWA 4X8IA 1YX0A 3CXSA 2PIYA 4AVAA 1Q2DA 4C7HA 5LYDA 2FVGA 3RAMA 1S7FA 3F8KA 1MJAA 4CAXA 3FF3A 3IWWA 4A37A 3CT9A 5THWA 1TF9A 1HDUA 1LAPA 2B5GA 2PJ9A 1A2ZA 1YW6A 3PEIA 2BCOA 5LRKA 2D4OA 3MN8A 5KTCA 4F0YA 1JWQA 5G21A 2EK8A 1ZG9A 4X2TA 1XIXA 1V0CA 4MRIA 1ARLA 1ELMP 1H8LA 4XPDB 2VZZA 2BUEA 3K2KA 4NEXA 4XNHC 2QECA 4JXQA 4M85A 4HNYB 1VIXA 3S6GA 3UY5A 1KWMA 4MCRA 1NSLA 2Q7BA 1R3NA 3I3GA 1ZLIA 4FD4A 2IQ6A 2ZENA 4KOXA 4PXBA 4PK2A 2CIJA 3D68A 3SI2A 3FX6A 2PJCA 1ZG7A 4A32A 4QC6A 3S9NA 3SXOA 2AE6A 2C1CA 1Z4RA 3H8EA 4CYQA 2P0WA 1TKHA 2FS5A 3DR6A 3JRUA 3SJXA 3D7FA 4A38A 3QB8A 3NH4A 1CPXA 1Z9UA 3K9UA 2BO9A 3TT2A 4CAFA 5ISVA 2PJ7A 2JEWA 3S9MA 2NMTA 3B3VA 3IO1A 2RB7A 3IU1A 4KSAA 4U9ZA 1XE4A 5G1ZA 4CYPA 3H8GA 3IGRA 4XPKA 1TKJA 1F2PA 2EO8A 2EVNA 3PRTA 4UCMA 5F09A 2NYQA 3H5ZA 4HNXB 5DWNA 3LWUA 3FH4A 5JPHA 1ARMA 2PJAA 1PUAA 4A33A 3NFZA 3PFOA 4RS2A 2ZW4A 2B4BA 2Z3PA 3TCVA 4F8ZA 3IC1A 2XEJA 4EFDA 2P6EA 4ZX9A 2CNTA 2F5IA 3CZXA 4ZX8A 2Z3LA 4MFQA 1ELLP 3H8FA 3G8WA 4KSIA 3N7ZA 3GY9A 2VZYA 3PFEA 4UCPA 2P6FA 3PGPA 1TF8A 2V8HA 3KQZA 3SI0A 2OH1A 1KUYA 4UFVA 3F0AA 1Z5RA 4PK3A 3FBUA 3HLPA 2AFZA 3PB9X 4C68A 1YLOA 4CGMA 2C6CA 2AFWA 4R76A 3SHPA 1JQGA 5J1QA 5KTAA 3V8IA 2GLJA 1KZFA 4IF5A 5F46A 3DGVA 4NGTA 5K8PA 2DPTA 3NE8A 3G3SA 4NFRA 4CRYB 2YNDA 4MCPA 3C26A 4OC1A 2AFMA 2WZNA 4NGRA 2NSMA 4AG7A 4RUHA 1B87A 4KLWA 4PPZA 4J3GA 3D8PA 2OZGA 2PDOA 2H5MA 4GXHA 4MJ8A 5ELYA 5FVJA 2DPSA 4CYOA 3KI9A 3BJ8A 1BLLE 3ISZA 3KR5A 4OKOA 3GB0A 4XPDC 5K8OA 5CBMA 5JGFA 3NH8A 2PJ3A 1UWYA 1I12A 1YREA 3FXTA 1CM0A 4Q38A 3WC7A 4CGNA 8CPAA 4MFKA 2Z10A 1IU8A 1R43A 4KLVA 5IB9A 3N5FA 4ZI6A 2ZW5A 4CAWA 2O53A 3EFAA 1SQHA 1VHEA 3DLJA 4JLYA 3T90A 2AFOA 4HPSA 3ZJ0A 4JJXA 4CYNA 1AUGA 1LAMA 2ZW6A 3R95A 5KTDA 5CNPA 1ZG8A 2FL4A 2FCKA 5F47A 4F6AA 3VWEA 4KUBA 1M4DA 1CG2A 4MMOA 3NA6A 1HDQA 4FAIA 4KOVA 2QMLA 1XMTA 4MHZA 2Q44A 4OC0A 1Y7RA 2REFA 4KORA 2ODFA 2C6GA 5G20A 3S6HA 5IB0A 3CPXA 3FYNA 3JVNA 3MGDA 4NGSA 4UCNA 1MJBA 2FT0A 4UBRA 2G3TA 4M3SA 2G9DA 4UWJA 2ZEHA 1M1DA 2OU2A 2Z3NA 6CPAA 1CP7A 4LX9A 3KZWA 4MXUA 3SJGA 1CPSA 2OR4A 3TO6A 3CPAA 3TE4A 3IIBA 3QAYA 2EK9A 2EWBA 1YK3A 1S3ZA 2CNSA 2GANA 2PJ4A 2YNCC 3CXQA 4L8AA 4X3RA 4Y49B 4DJLA 2HQYA 2OZHA 4R6TA 1M4LA 2HUZA 3TO7A 5GCNA 3B3CA 1ON0A 2R1IA 2YGWA 5EBVA 4NGPA 3R96A 5LYLA 4K3NA 3KHZA 4IUSA 4ONWA 4B5OA 4KUAA 4E0AA 3VH9A 3KKWA 1F2OA 4WWVA 1LOKA 5JH9A 3S9LA 3D7GA 3L2NA 1QSMA 2A4NA 2EBJA 4MI4A 1XRYA 2VBQA 1M44A 1WK4A 3VWDA 3WABA 3WC5A 5JQ4A 1Q7LA 5HVFA 4R7MA 5HMNA 2ZEDA 3DDDA 2QVPA 1LCPA 2F8HA 1IB1E 4IHMA 4R9MA 3R9EA 4ZY0A 3GYAA 4FD6A 4CGLA 2BOAA 3PB6X 1UFHA 1VGYA 1XEBA 3FIXA 3IWEA 1Z4EA 4O23A 4CAEA 2B5GB 5IV0A 3KHXA 4B12A 2VI7A 4FWUA 4UIBA 5BWAB 4GS4A 3GUXA 1FNOA 1IYLA 4PXEA 4DNCA 4LUAA 3R9GA 3P2HA 1F57A 4IK2A 4PQAA 3TTHA 4DYOA 2QJ8A 5AG5A 3B3TA 1L0CA 1LANA 4HNWB 2ZXVA 3R1KA 2V77A 3OWCA 2G0BA 4FBEA 4H6ZA 4QUSA 4AVCA 4C2ZA 5I0CA 1RO5A 2Q51A 4ZYQA 2OZUA 3HUVA 3TOBA 3TFYA 1ZO0A 3BI1A 3FRMA 4M6GA 4NGNA 1IOFA 4L89A 3WC6A 4C2YA 2B4DA 1P4NA 2XEIA 3KL9A 2B58A 1S7LA 4PSWA 2PQ8A 4C2XA 2JDCA 1VHOA 4H2KA 4JWPA 4NCZA 5G22A 4ZGYB 4UEZA 1VHSA 4NSQA 1BPNA 2K5TA 2BL1A 2DXQA 1Y0RA 2CTBA 3B7IA 1IYKA 4H6UA 2R7HA 3FEEA 3S6KA 1IY7A 2V8GA 3SJFA 4B14A 5LRGA 3CDXA 3B8GA 2HC9A 3DNSA 3RZAA 4B5PA 2PJBA 2GREA 3IEHA 5I4MA 1Z8TA 1P0HA 4JD6A 1YVOA 3P2FA 2B4DB 5DS0A 5K8MA 5LYFA 1IGBA 1YVKA 2Q4ZA 2YNEA 2Q04A 4Y49C 5CPAA 2FXFA 2Q43A 3BLNA 4I49A 4A94A 5C82A 3I1UA 4EVYA 4YRHA 2QYVA 5H84A 4P4DA 5LYIA 3VARA 1S7NA 5K8NA 1ZLHA 1QQ9A 1YLEA 2J8MA 4KOUA 1CBXA 1YMEA 2Q7SA 3PBBA 2R98A 4CS0B 3D67A 3LMSA 2PRQA 3QAHA 2ZEFA 2D4PA 2VEZA 2GFQA 4OC5A 4NJRA 1X10A 1AMPA 4GM5A 4P10A 1I1DA 1QSNA 4ZY1A 2FE7A 3A9LA 2Q0YA 4OADA 2O28A 4A39A 2V8VA 2AJ6A 1TXRA 2JLMA 2EUIA 5EC4A 3BHXA 4CGPA 3D7DA 2WUUA 2ZEEA 2ZELA 4PSXA 1QMUA 2PIZA 4P6YA 3DSBA 4JZ0A 4U9YA 1Q2YA 2J8NA 2WYRA 5E96A 4KVOE 1QSTA 4RI1A 2JBKA 1K4JA 2PJ8A 2QIRA 2PVVA 4MCSA 4NXYA 3W6XA 4EWTA 2GIVA 2PJ2A 4MHDA 4OIDA 3EY5A 2PVWA 1CP6A 2HB6A 2RC4A 1XBUA 4WJBA 3D2MA 1TKFA 1YR0A 4NGMA 5AG6A 1LFWA 1Y9KA 3JUWA 2ZEGA 4QVTA 1VKCA 1KUXA 2AFUA 2PE3A 2ZEMA 2JEVA 2PJ1A 4B11A 4P4EA 1NSAA 4KOSA 4NJQA 4EMEA 1BOBA 1OBRA 4U5YA 4M6HA 5C88A 1HEEA 1M4GA 1AYEA 1Y9WA 4KOYA 1S60A 3FMCA 2C6PA 4KZTA 5DWMA 3IFEA 3ZZIA 3FB3A 1QSRA 2F7VA 2BSWA 3GLJA 2ZEOA 4KOTA 3T8WA 2REEA 4F9VA 4OP4A 2HV2A 5HVGA 2G3AA 1MJ9A 1MK4A 1PU9A 5LRJA 3R9FA 4AB7A 3WR7A 5D29A 1B6BA 3BJ7A 3EXNA 1IOIA 2ARHA 4LQ6A 3SI1A 3RBUA 4ONUA 4RN7A 4QB9A 3KASA 4P44A 4R3KA 2CF4A 4KOWA 1CJWA 4MFPA 2I00A 2POKA 3B2YA 1RXTA 4A2ZA 4B6ZA 3TX8A 1XJOA 3EC4A 2ZOGA 1DE4C 3BXMA 1Y0YA 2PR1A 2BEIA 1M4IA 3FECA 3F5BA 3NH5A 4MHYA 4LQGA 4UF4A 4W9YA 3TC8A 4AG9A 4BBHA 3LACA 1S7KA 3GIUA 4Z65A 4UFWA 5F48A 3E0KA 3WT4A 4BD9A 4UEFA 3IWGA 2JBJA 3MRUA 4C7IA 2B3UA 3FEDA 3FVLA 4FD5A 4UEEA 2PJ5A 2R8VA 5AG4A 2KCWA 5JM6A 4OC2A 3VATA 1XMBA 4BMHA 4MFZA 3T9YA 2VL1A 3IU2A 1Z8XA 4MHPA 5HVHA 4R57A 2VQYA 2WPWA 3FNCA 4TWEA 4AXVA 2OB0A 2CY2A 2I79A 2X7BA 4XPLA 3RO0A 1FY7A 4A95A 4B10A 2PCUA 4CRZB 3FJUA 3W91A 2GE3A 5D8NA 4OC3A 1U6MA 4X5KA 3EO4A 4F9UA 4PXCA 4K30A 4II9A 2YNCA 2P6GA 4YU9A 2Q4VA 3V7ZA 2GU2A 4MFJA 2CNMA 2XEFA 4P4FA 4P4IA 5H86A 4CPAA 2PRBA 1IIDA 3D7HA 4UIAA 1Q2CA 4ZY2A 4F0XA 1J4JA 1NE9A 1TIQA 4G1PA 4OLLA 2V8DA 2AFSA 4HKFA 5J8CA 2Z11A 4A30A 1CX8A 3TO9A 4OMEA 2ZW7A 4P4JA 1I21A 3B3SA 1IICA 5HH1A 3S6FA 1Y7EA 4FUUA 4A31A 3B35A 3D4UA 4DUKA 4CAVA 4P45A 2Z0ZA 3PB7X 3QNVA 5EMIA 4B13A 1GYTA 1XOVA 1YSJA 4Q7AA 2O4HA 5IX3A 2IL4A 4TNUA 2WSAA 1PCAA 3BI0A 4MBUA 1LRZA 4NGQA 2RFHA 4PXDA 1NMTA 1XFOA 1S5KA 3D66A 1N71A 4OAEA 1BPMA 4Q36A 2DF5A 1Z2LA 4UFXA 4B5PB 3B3WA 4PV6A 3SXNA 4E2AA 2WPXA 4YGOA 4FD7A 3RYOA 5A28A 1OZPA 2XEGA 4KSFA 2JDDA 3KQXA 4AVBA 2AFXA 3LODA 3D2PA 2ATRA 4XNHB 2I3CA 4MY3A 4ZBGA 4YFJA 5AG7A 3DR8A 3I9SA 5HXDA 4BINA 1BAVA 1X12A 3PBEA 4JXRA 2Z3MA 5A27A 4MFLA 1XF8A 2CTCA 2Z3OA 1RTQA 3K9TA 4UWIA 3W6SA 2J8RA 2PJ6A 3PP9A 4NF1A 2Q4YA 2VXKA 3GKRA 4CGOA 2ZPAA 5J8FA 2PR8A
chains in the Genus database with same CATH topology
1PYTB 4OIWA 2OOTA 4OC4A 3ISXA 2DEAA 7CPAA 3IJ3A 2GLFA 4MHNA 3SJEA 1YW4A 1DTDA 1EE3P 2ZEPA 4JYWA 3PB4X 1Z8LA 2J9AA 1FT7A 2IMOA 2IJZA 2ZOFA 4P4BA 2PJ0A 3KGQA 3V38A 4MCQA 4YWYA 4R8FA 2ANPA 3KR4A 4IAVA 3PB8X 2ABZA 4X8IA 2PIYA 5LYDA 2FVGA 3RAMA 3FF3A 3IWWA 4A37A 3CT9A 5THWA 1TF9A 1HDUA 1LAPA 2PJ9A 1YW6A 3PEIA 2BCOA 5LRKA 3MN8A 2EK8A 1ZG9A 4X2TA 4MRIA 1ARLA 1ELMP 1H8LA 3K2KA 1VIXA 1KWMA 4MCRA 1R3NA 1ZLIA 2IQ6A 2ZENA 4PXBA 2CIJA 3D68A 3SI2A 3FX6A 2PJCA 1ZG7A 3S9NA 2C1CA 3H8EA 1TKHA 3JRUA 3SJXA 3D7FA 4A38A 3NH4A 1CPXA 2BO9A 2PJ7A 2JEWA 3S9MA 3B3VA 3IO1A 2RB7A 3H8GA 1TKJA 1F2PA 3PRTA 5F09A 2NYQA 3LWUA 3FH4A 1ARMA 2PJAA 3NFZA 3PFOA 4F8ZA 3IC1A 2XEJA 4EFDA 4ZX9A 4ZX8A 1ELLP 3H8FA 4KSIA 3PFEA 1TF8A 2V8HA 3KQZA 3SI0A 1Z5RA 3HLPA 2AFZA 3PB9X 1YLOA 2C6CA 2AFWA 4R76A 1JQGA 5J1QA 2GLJA 3DGVA 4NGTA 5K8PA 4NFRA 4MCPA 4OC1A 2AFMA 2WZNA 4NGRA 2NSMA 4RUHA 4PPZA 5ELYA 3KI9A 3KR5A 1BLLE 3ISZA 4OKOA 5K8OA 3GB0A 5CBMA 5JGFA 3NH8A 2PJ3A 1UWYA 3WC7A 8CPAA 1R43A 5IB9A 3N5FA 4ZI6A 2O53A 1VHEA 3DLJA 2AFOA 1LAMA 1ZG8A 1CG2A 4MMOA 3NA6A 1HDQA 4FAIA 4MHZA 4OC0A 2C6GA 3CPXA 4NGSA 2G9DA 2ZEHA 6CPAA 1CP7A 3KZWA 4MXUA 3SJGA 1CPSA 2OR4A 3CPAA 3IIBA 2EK9A 2EWBA 2PJ4A 4X3RA 4DJLA 4R6TA 1M4LA 3B3CA 4NGPA 5LYLA 4K3NA 3KHZA 4ONWA 3VH9A 1F2OA 4WWVA 1LOKA 5JH9A 3S9LA 3D7GA 3L2NA 1XRYA 3WABA 3WC5A 1Q7LA 5HVFA 4R7MA 2ZEDA 2QVPA 1LCPA 2F8HA 4IHMA 4ZY0A 2BOAA 3PB6X 1VGYA 4O23A 3KHXA 4FWUA 4UIBA 4PXEA 3GUXA 1FNOA 1F57A 4IK2A 4PQAA 4DYOA 2QJ8A 3B3TA 1LANA 2V77A 4FBEA 2Q51A 4ZYQA 3HUVA 3BI1A 4NGNA 3WC6A 2XEIA 3KL9A 1VHOA 4H2KA 4UEZA 1BPNA 1Y0RA 2CTBA 3B7IA 3FEEA 1IY7A 2V8GA 3SJFA 5LRGA 3CDXA 2HC9A 3RZAA 2PJBA 2GREA 3IEHA 5I4MA 5K8MA 5DS0A 5LYFA 1IGBA 2Q4ZA 5CPAA 2Q43A 4A94A 3I1UA 2QYVA 4P4DA 5LYIA 3VARA 5K8NA 1ZLHA 1QQ9A 1CBXA 1YMEA 3PBBA 3D67A 3LMSA 2PRQA 2ZEFA 4OC5A 4NJRA 4P10A 1AMPA 4GM5A 4ZY1A 4A39A 2V8VA 1TXRA 3BHXA 3D7DA 2ZEEA 2ZELA 1QMUA 2PIZA 4P6YA 4JZ0A 2WYRA 2JBKA 2PJ8A 2PVVA 4MCSA 4EWTA 2PJ2A 4OIDA 2PVWA 1CP6A 2HB6A 4WJBA 1XBUA 1TKFA 4NGMA 1LFWA 2ZEGA 2AFUA 2PE3A 2ZEMA 2PJ1A 4P4EA 1NSAA 4NJQA 4EMEA 1OBRA 1HEEA 1AYEA 3FMCA 2C6PA 3IFEA 2F7VA 3GLJA 2ZEOA 3T8WA 4F9VA 4OP4A 5HVGA 5LRJA 5D29A 3SI1A 3RBUA 3KASA 4P44A 2CF4A 2POKA 3B2YA 4B6ZA 3TX8A 1XJOA 2ZOGA 1DE4C 3BXMA 1Y0YA 4MHYA 4LQGA 3FECA 3NH5A 4UF4A 4W9YA 3TC8A 4Z65A 3WT4A 4BD9A 4UEFA 2JBJA 3MRUA 3FVLA 3FEDA 4UEEA 2PJ5A 5JM6A 4OC2A 3VATA 1XMBA 2VL1A 5HVHA 4TWEA 4AXVA 2PCUA 3FJUA 5D8NA 4OC3A 4F9UA 4PXCA 4YU9A 3V7ZA 2GU2A 4P4IA 2XEFA 4P4FA 4CPAA 3D7HA 4UIAA 4ZY2A 4G1PA 2V8DA 2AFSA 1CX8A 4OMEA 4P4JA 3B3SA 1Y7EA 4FUUA 3B35A 3D4UA 4DUKA 4P45A 3QNVA 3PB7X 1GYTA 1YSJA 4Q7AA 2O4HA 4TNUA 1PCAA 3BI0A 4NGQA 2RFHA 4PXDA 1XFOA 3D66A 1BPMA 1Z2LA 3B3WA 2XEGA 3KQXA 2AFXA 2I3CA 5HXDA 1BAVA 3PBEA 2CTCA 1RTQA 3K9TA 2PJ6A 4MHPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PYT B;  4OIW A;  2OOT A;  4OC4 A;  3ISX A;  2DEA A;  7CPA A;  3IJ3 A;  2GLF A;  4MHN A;  3SJE A;  1YW4 A;  1DTD A;  1EE3 P;  2ZEP A;  4JYW A;  3PB4 X;  1Z8L A;  2J9A A;  1FT7 A;  2IMO A;  2IJZ A;  2ZOF A;  4P4B A;  2PJ0 A;  3KGQ A;  3V38 A;  4MCQ A;  4YWY A;  4R8F A;  2ANP A;  3KR4 A;  4IAV A;  3PB8 X;  2ABZ A;  4X8I A;  2PIY A;  5LYD A;  2FVG A;  3RAM A;  3FF3 A;  3IWW A;  4A37 A;  3CT9 A;  5THW A;  1TF9 A;  1HDU A;  1LAP A;  2PJ9 A;  1YW6 A;  3PEI A;  2BCO A;  5LRK A;  3MN8 A;  2EK8 A;  1ZG9 A;  4X2T A;  4MRI A;  1ARL A;  1ELM P;  1H8L A;  3K2K A;  1VIX A;  1KWM A;  4MCR A;  1R3N A;  1ZLI A;  2IQ6 A;  2ZEN A;  4PXB A;  2CIJ A;  3D68 A;  3SI2 A;  3FX6 A;  2PJC A;  1ZG7 A;  3S9N A;  2C1C A;  3H8E A;  1TKH A;  3JRU A;  3SJX A;  3D7F A;  4A38 A;  3NH4 A;  1CPX A;  2BO9 A;  2PJ7 A;  2JEW A;  3S9M A;  3B3V A;  3IO1 A;  2RB7 A;  3H8G A;  1TKJ A;  1F2P A;  3PRT A;  5F09 A;  2NYQ A;  3LWU A;  3FH4 A;  1ARM A;  2PJA A;  3NFZ A;  3PFO A;  4F8Z A;  3IC1 A;  2XEJ A;  4EFD A;  4ZX9 A;  4ZX8 A;  1ELL P;  3H8F A;  4KSI A;  3PFE A;  1TF8 A;  2V8H A;  3KQZ A;  3SI0 A;  1Z5R A;  3HLP A;  2AFZ A;  3PB9 X;  1YLO A;  2C6C A;  2AFW A;  4R76 A;  1JQG A;  5J1Q A;  2GLJ A;  3DGV A;  4NGT A;  5K8P A;  4NFR A;  4MCP A;  4OC1 A;  2AFM A;  2WZN A;  4NGR A;  2NSM A;  4RUH A;  4PPZ A;  5ELY A;  3KI9 A;  3KR5 A;  1BLL E;  3ISZ A;  4OKO A;  5K8O A;  3GB0 A;  5CBM A;  5JGF A;  3NH8 A;  2PJ3 A;  1UWY A;  3WC7 A;  8CPA A;  1R43 A;  5IB9 A;  3N5F A;  4ZI6 A;  2O53 A;  1VHE A;  3DLJ A;  2AFO A;  1LAM A;  1ZG8 A;  1CG2 A;  4MMO A;  3NA6 A;  1HDQ A;  4FAI A;  4MHZ A;  4OC0 A;  2C6G A;  3CPX A;  4NGS A;  2G9D A;  2ZEH A;  6CPA A;  1CP7 A;  3KZW A;  4MXU A;  3SJG A;  1CPS A;  2OR4 A;  3CPA A;  3IIB A;  2EK9 A;  2EWB A;  2PJ4 A;  4X3R A;  4DJL A;  4R6T A;  1M4L A;  3B3C A;  4NGP A;  5LYL A;  4K3N A;  3KHZ A;  4ONW A;  3VH9 A;  1F2O A;  4WWV A;  1LOK A;  5JH9 A;  3S9L A;  3D7G A;  3L2N A;  1XRY A;  3WAB A;  3WC5 A;  1Q7L A;  5HVF A;  4R7M A;  2ZED A;  2QVP A;  1LCP A;  2F8H A;  4IHM A;  4ZY0 A;  2BOA A;  3PB6 X;  1VGY A;  4O23 A;  3KHX A;  4FWU A;  4UIB A;  4PXE A;  3GUX A;  1FNO A;  1F57 A;  4IK2 A;  4PQA A;  4DYO A;  2QJ8 A;  3B3T A;  1LAN A;  2V77 A;  4FBE A;  2Q51 A;  4ZYQ A;  3HUV A;  3BI1 A;  4NGN A;  3WC6 A;  2XEI A;  3KL9 A;  1VHO A;  4H2K A;  4UEZ A;  1BPN A;  1Y0R A;  2CTB A;  3B7I A;  3FEE A;  1IY7 A;  2V8G A;  3SJF A;  5LRG A;  3CDX A;  2HC9 A;  3RZA A;  2PJB A;  2GRE A;  3IEH A;  5I4M A;  5K8M A;  5DS0 A;  5LYF A;  1IGB A;  2Q4Z A;  5CPA A;  2Q43 A;  4A94 A;  3I1U A;  2QYV A;  4P4D A;  5LYI A;  3VAR A;  5K8N A;  1ZLH A;  1QQ9 A;  1CBX A;  1YME A;  3PBB A;  3D67 A;  3LMS A;  2PRQ A;  2ZEF A;  4OC5 A;  4NJR A;  4P10 A;  1AMP A;  4GM5 A;  4ZY1 A;  4A39 A;  2V8V A;  1TXR A;  3BHX A;  3D7D A;  2ZEE A;  2ZEL A;  1QMU A;  2PIZ A;  4P6Y A;  4JZ0 A;  2WYR A;  2JBK A;  2PJ8 A;  2PVV A;  4MCS A;  4EWT A;  2PJ2 A;  4OID A;  2PVW A;  1CP6 A;  2HB6 A;  4WJB A;  1XBU A;  1TKF A;  4NGM A;  1LFW A;  2ZEG A;  2AFU A;  2PE3 A;  2ZEM A;  2PJ1 A;  4P4E A;  1NSA A;  4NJQ A;  4EME A;  1OBR A;  1HEE A;  1AYE A;  3FMC A;  2C6P A;  3IFE A;  2F7V A;  3GLJ A;  2ZEO A;  3T8W A;  4F9V A;  4OP4 A;  5HVG A;  5LRJ A;  5D29 A;  3SI1 A;  3RBU A;  3KAS A;  4P44 A;  2CF4 A;  2POK A;  3B2Y A;  4B6Z A;  3TX8 A;  1XJO A;  2ZOG A;  1DE4 C;  3BXM A;  1Y0Y A;  4MHY A;  4LQG A;  3FEC A;  3NH5 A;  4UF4 A;  4W9Y A;  3TC8 A;  4Z65 A;  3WT4 A;  4BD9 A;  4UEF A;  2JBJ A;  3MRU A;  3FVL A;  3FED A;  4UEE A;  2PJ5 A;  5JM6 A;  4OC2 A;  3VAT A;  1XMB A;  2VL1 A;  5HVH A;  4TWE A;  4AXV A;  2PCU A;  3FJU A;  5D8N A;  4OC3 A;  4F9U A;  4PXC A;  4YU9 A;  3V7Z A;  2GU2 A;  4P4I A;  2XEF A;  4P4F A;  4CPA A;  3D7H A;  4UIA A;  4ZY2 A;  4G1P A;  2V8D A;  2AFS A;  1CX8 A;  4OME A;  4P4J A;  3B3S A;  1Y7E A;  4FUU A;  3B35 A;  3D4U A;  4DUK A;  4P45 A;  3QNV A;  3PB7 X;  1GYT A;  1YSJ A;  4Q7A A;  2O4H A;  4TNU A;  1PCA A;  3BI0 A;  4NGQ A;  2RFH A;  4PXD A;  1XFO A;  3D66 A;  1BPM A;  1Z2L A;  3B3W A;  2XEG A;  3KQX A;  2AFX A;  2I3C A;  5HXD A;  1BAV A;  3PBE A;  2CTC A;  1RTQ A;  3K9T A;  2PJ6 A;  4MHP A; 
#chains in the Genus database with same CATH topology
 1PYT B;  4OIW A;  3RNZ A;  3TOA A;  1WWZ A;  2OOT A;  4H89 A;  4OC4 A;  3ISX A;  3LD2 A;  4UA3 A;  4E8O A;  4QBJ A;  2DEA A;  7CPA A;  1BO4 A;  3IJ3 A;  2GLF A;  4MHN A;  3SJE A;  3D3S A;  4R87 A;  2PC1 A;  1YW4 A;  2C27 A;  2Y0M A;  2Z3K A;  1DTD A;  1EE3 P;  2ZEP A;  3H4Q A;  4JYW A;  4M6I A;  3PB4 X;  1Z8L A;  2J9A A;  1YQE A;  2FIA A;  1FT7 A;  2IMO A;  1YGH A;  3JTK A;  2IJZ A;  1GHE A;  4KVX A;  5F49 A;  2ZOF A;  2CXA A;  4P4B A;  2PJ0 A;  3KGQ A;  2PSW A;  3NE7 A;  3V38 A;  1Z8W A;  4KS9 A;  1KUV A;  4MY0 A;  2FSR A;  4MCQ A;  4YWY A;  4R8F A;  2B3V A;  4R3L A;  1R57 A;  3PZJ A;  5AGE A;  2ANP A;  3KR4 A;  4IAV A;  3CXP A;  3PB8 X;  1QSO A;  2ABZ A;  4ORF A;  4KVM E;  2FIW A;  4X8I A;  1YX0 A;  3CXS A;  2PIY A;  4AVA A;  1Q2D A;  4C7H A;  5LYD A;  2FVG A;  3RAM A;  1S7F A;  3F8K A;  1MJA A;  4CAX A;  3FF3 A;  3IWW A;  4A37 A;  3CT9 A;  5THW A;  1TF9 A;  1HDU A;  1LAP A;  2B5G A;  2PJ9 A;  1A2Z A;  1YW6 A;  3PEI A;  2BCO A;  5LRK A;  2D4O A;  3MN8 A;  5KTC A;  4F0Y A;  1JWQ A;  5G21 A;  2EK8 A;  1ZG9 A;  4X2T A;  1XIX A;  1V0C A;  4MRI A;  1ARL A;  1ELM P;  1H8L A;  4XPD B;  2VZZ A;  2BUE A;  3K2K A;  4NEX A;  4XNH C;  2QEC A;  4JXQ A;  4M85 A;  4HNY B;  1VIX A;  3S6G A;  3UY5 A;  1KWM A;  4MCR A;  1NSL A;  2Q7B A;  1R3N A;  3I3G A;  1ZLI A;  4FD4 A;  2IQ6 A;  2ZEN A;  4KOX A;  4PXB A;  4PK2 A;  2CIJ A;  3D68 A;  3SI2 A;  3FX6 A;  2PJC A;  1ZG7 A;  4A32 A;  4QC6 A;  3S9N A;  3SXO A;  2AE6 A;  2C1C A;  1Z4R A;  3H8E A;  4CYQ A;  2P0W A;  1TKH A;  2FS5 A;  3DR6 A;  3JRU A;  3SJX A;  3D7F A;  4A38 A;  3QB8 A;  3NH4 A;  1CPX A;  1Z9U A;  3K9U A;  2BO9 A;  3TT2 A;  4CAF A;  5ISV A;  2PJ7 A;  2JEW A;  3S9M A;  2NMT A;  3B3V A;  3IO1 A;  2RB7 A;  3IU1 A;  4KSA A;  4U9Z A;  1XE4 A;  5G1Z A;  4CYP A;  3H8G A;  3IGR A;  4XPK A;  1TKJ A;  1F2P A;  2EO8 A;  2EVN A;  3PRT A;  4UCM A;  5F09 A;  2NYQ A;  3H5Z A;  4HNX B;  5DWN A;  3LWU A;  3FH4 A;  5JPH A;  1ARM A;  2PJA A;  1PUA A;  4A33 A;  3NFZ A;  3PFO A;  4RS2 A;  2ZW4 A;  2B4B A;  2Z3P A;  3TCV A;  4F8Z A;  3IC1 A;  2XEJ A;  4EFD A;  2P6E A;  4ZX9 A;  2CNT A;  2F5I A;  3CZX A;  4ZX8 A;  2Z3L A;  4MFQ A;  1ELL P;  3H8F A;  3G8W A;  4KSI A;  3N7Z A;  3GY9 A;  2VZY A;  3PFE A;  4UCP A;  2P6F A;  3PGP A;  1TF8 A;  2V8H A;  3KQZ A;  3SI0 A;  2OH1 A;  1KUY A;  4UFV A;  3F0A A;  1Z5R A;  4PK3 A;  3FBU A;  3HLP A;  2AFZ A;  3PB9 X;  4C68 A;  1YLO A;  4CGM A;  2C6C A;  2AFW A;  4R76 A;  3SHP A;  1JQG A;  5J1Q A;  5KTA A;  3V8I A;  2GLJ A;  1KZF A;  4IF5 A;  5F46 A;  3DGV A;  4NGT A;  5K8P A;  2DPT A;  3NE8 A;  3G3S A;  4NFR A;  4CRY B;  2YND A;  4MCP A;  3C26 A;  4OC1 A;  2AFM A;  2WZN A;  4NGR A;  2NSM A;  4AG7 A;  4RUH A;  1B87 A;  4KLW A;  4PPZ A;  4J3G A;  3D8P A;  2OZG A;  2PDO A;  2H5M A;  4GXH A;  4MJ8 A;  5ELY A;  5FVJ A;  2DPS A;  4CYO A;  3KI9 A;  3BJ8 A;  1BLL E;  3ISZ A;  3KR5 A;  4OKO A;  3GB0 A;  4XPD C;  5K8O A;  5CBM A;  5JGF A;  3NH8 A;  2PJ3 A;  1UWY A;  1I12 A;  1YRE A;  3FXT A;  1CM0 A;  4Q38 A;  3WC7 A;  4CGN A;  8CPA A;  4MFK A;  2Z10 A;  1IU8 A;  1R43 A;  4KLV A;  5IB9 A;  3N5F A;  4ZI6 A;  2ZW5 A;  4CAW A;  2O53 A;  3EFA A;  1SQH A;  1VHE A;  3DLJ A;  4JLY A;  3T90 A;  2AFO A;  4HPS A;  3ZJ0 A;  4JJX A;  4CYN A;  1AUG A;  1LAM A;  2ZW6 A;  3R95 A;  5KTD A;  5CNP A;  1ZG8 A;  2FL4 A;  2FCK A;  5F47 A;  4F6A A;  3VWE A;  4KUB A;  1M4D A;  1CG2 A;  4MMO A;  3NA6 A;  1HDQ A;  4FAI A;  4KOV A;  2QML A;  1XMT A;  4MHZ A;  2Q44 A;  4OC0 A;  1Y7R A;  2REF A;  4KOR A;  2ODF A;  2C6G A;  5G20 A;  3S6H A;  5IB0 A;  3CPX A;  3FYN A;  3JVN A;  3MGD A;  4NGS A;  4UCN A;  1MJB A;  2FT0 A;  4UBR A;  2G3T A;  4M3S A;  2G9D A;  4UWJ A;  2ZEH A;  1M1D A;  2OU2 A;  2Z3N A;  6CPA A;  1CP7 A;  4LX9 A;  3KZW A;  4MXU A;  3SJG A;  1CPS A;  2OR4 A;  3TO6 A;  3CPA A;  3TE4 A;  3IIB A;  3QAY A;  2EK9 A;  2EWB A;  1YK3 A;  1S3Z A;  2CNS A;  2GAN A;  2PJ4 A;  2YNC C;  3CXQ A;  4L8A A;  4X3R A;  4Y49 B;  4DJL A;  2HQY A;  2OZH A;  4R6T A;  1M4L A;  2HUZ A;  3TO7 A;  5GCN A;  3B3C A;  1ON0 A;  2R1I A;  2YGW A;  5EBV A;  4NGP A;  3R96 A;  5LYL A;  4K3N A;  3KHZ A;  4IUS A;  4ONW A;  4B5O A;  4KUA A;  4E0A A;  3VH9 A;  3KKW A;  1F2O A;  4WWV A;  1LOK A;  5JH9 A;  3S9L A;  3D7G A;  3L2N A;  1QSM A;  2A4N A;  2EBJ A;  4MI4 A;  1XRY A;  2VBQ A;  1M44 A;  1WK4 A;  3VWD A;  3WAB A;  3WC5 A;  5JQ4 A;  1Q7L A;  5HVF A;  4R7M A;  5HMN A;  2ZED A;  3DDD A;  2QVP A;  1LCP A;  2F8H A;  1IB1 E;  4IHM A;  4R9M A;  3R9E A;  4ZY0 A;  3GYA A;  4FD6 A;  4CGL A;  2BOA A;  3PB6 X;  1UFH A;  1VGY A;  1XEB A;  3FIX A;  3IWE A;  1Z4E A;  4O23 A;  4CAE A;  2B5G B;  5IV0 A;  3KHX A;  4B12 A;  2VI7 A;  4FWU A;  4UIB A;  5BWA B;  4GS4 A;  3GUX A;  1FNO A;  1IYL A;  4PXE A;  4DNC A;  4LUA A;  3R9G A;  3P2H A;  1F57 A;  4IK2 A;  4PQA A;  3TTH A;  4DYO A;  2QJ8 A;  5AG5 A;  3B3T A;  1L0C A;  1LAN A;  4HNW B;  2ZXV A;  3R1K A;  2V77 A;  3OWC A;  2G0B A;  4FBE A;  4H6Z A;  4QUS A;  4AVC A;  4C2Z A;  5I0C A;  1RO5 A;  2Q51 A;  4ZYQ A;  2OZU A;  3HUV A;  3TOB A;  3TFY A;  1ZO0 A;  3BI1 A;  3FRM A;  4M6G A;  4NGN A;  1IOF A;  4L89 A;  3WC6 A;  4C2Y A;  2B4D A;  1P4N A;  2XEI A;  3KL9 A;  2B58 A;  1S7L A;  4PSW A;  2PQ8 A;  4C2X A;  2JDC A;  1VHO A;  4H2K A;  4JWP A;  4NCZ A;  5G22 A;  4ZGY B;  4UEZ A;  1VHS A;  4NSQ A;  1BPN A;  2K5T A;  2BL1 A;  2DXQ A;  1Y0R A;  2CTB A;  3B7I A;  1IYK A;  4H6U A;  2R7H A;  3FEE A;  3S6K A;  1IY7 A;  2V8G A;  3SJF A;  4B14 A;  5LRG A;  3CDX A;  3B8G A;  2HC9 A;  3DNS A;  3RZA A;  4B5P A;  2PJB A;  2GRE A;  3IEH A;  5I4M A;  1Z8T A;  1P0H A;  4JD6 A;  1YVO A;  3P2F A;  2B4D B;  5DS0 A;  5K8M A;  5LYF A;  1IGB A;  1YVK A;  2Q4Z A;  2YNE A;  2Q04 A;  4Y49 C;  5CPA A;  2FXF A;  2Q43 A;  3BLN A;  4I49 A;  4A94 A;  5C82 A;  3I1U A;  4EVY A;  4YRH A;  2QYV A;  5H84 A;  4P4D A;  5LYI A;  3VAR A;  1S7N A;  5K8N A;  1ZLH A;  1QQ9 A;  1YLE A;  2J8M A;  4KOU A;  1CBX A;  1YME A;  2Q7S A;  3PBB A;  2R98 A;  4CS0 B;  3D67 A;  3LMS A;  2PRQ A;  3QAH A;  2ZEF A;  2D4P A;  2VEZ A;  2GFQ A;  4OC5 A;  4NJR A;  1X10 A;  1AMP A;  4GM5 A;  4P10 A;  1I1D A;  1QSN A;  4ZY1 A;  2FE7 A;  3A9L A;  2Q0Y A;  4OAD A;  2O28 A;  4A39 A;  2V8V A;  2AJ6 A;  1TXR A;  2JLM A;  2EUI A;  5EC4 A;  3BHX A;  4CGP A;  3D7D A;  2WUU A;  2ZEE A;  2ZEL A;  4PSX A;  1QMU A;  2PIZ A;  4P6Y A;  3DSB A;  4JZ0 A;  4U9Y A;  1Q2Y A;  2J8N A;  2WYR A;  5E96 A;  4KVO E;  1QST A;  4RI1 A;  2JBK A;  1K4J A;  2PJ8 A;  2QIR A;  2PVV A;  4MCS A;  4NXY A;  3W6X A;  4EWT A;  2GIV A;  2PJ2 A;  4MHD A;  4OID A;  3EY5 A;  2PVW A;  1CP6 A;  2HB6 A;  2RC4 A;  1XBU A;  4WJB A;  3D2M A;  1TKF A;  1YR0 A;  4NGM A;  5AG6 A;  1LFW A;  1Y9K A;  3JUW A;  2ZEG A;  4QVT A;  1VKC A;  1KUX A;  2AFU A;  2PE3 A;  2ZEM A;  2JEV A;  2PJ1 A;  4B11 A;  4P4E A;  1NSA A;  4KOS A;  4NJQ A;  4EME A;  1BOB A;  1OBR A;  4U5Y A;  4M6H A;  5C88 A;  1HEE A;  1M4G A;  1AYE A;  1Y9W A;  4KOY A;  1S60 A;  3FMC A;  2C6P A;  4KZT A;  5DWM A;  3IFE A;  3ZZI A;  3FB3 A;  1QSR A;  2F7V A;  2BSW A;  3GLJ A;  2ZEO A;  4KOT A;  3T8W A;  2REE A;  4F9V A;  4OP4 A;  2HV2 A;  5HVG A;  2G3A A;  1MJ9 A;  1MK4 A;  1PU9 A;  5LRJ A;  3R9F A;  4AB7 A;  3WR7 A;  5D29 A;  1B6B A;  3BJ7 A;  3EXN A;  1IOI A;  2ARH A;  4LQ6 A;  3SI1 A;  3RBU A;  4ONU A;  4RN7 A;  4QB9 A;  3KAS A;  4P44 A;  4R3K A;  2CF4 A;  4KOW A;  1CJW A;  4MFP A;  2I00 A;  2POK A;  3B2Y A;  1RXT A;  4A2Z A;  4B6Z A;  3TX8 A;  1XJO A;  3EC4 A;  2ZOG A;  1DE4 C;  3BXM A;  1Y0Y A;  2PR1 A;  2BEI A;  1M4I A;  3FEC A;  3F5B A;  3NH5 A;  4MHY A;  4LQG A;  4UF4 A;  4W9Y A;  3TC8 A;  4AG9 A;  4BBH A;  3LAC A;  1S7K A;  3GIU A;  4Z65 A;  4UFW A;  5F48 A;  3E0K A;  3WT4 A;  4BD9 A;  4UEF A;  3IWG A;  2JBJ A;  3MRU A;  4C7I A;  2B3U A;  3FED A;  3FVL A;  4FD5 A;  4UEE A;  2PJ5 A;  2R8V A;  5AG4 A;  2KCW A;  5JM6 A;  4OC2 A;  3VAT A;  1XMB A;  4BMH A;  4MFZ A;  3T9Y A;  2VL1 A;  3IU2 A;  1Z8X A;  4MHP A;  5HVH A;  4R57 A;  2VQY A;  2WPW A;  3FNC A;  4TWE A;  4AXV A;  2OB0 A;  2CY2 A;  2I79 A;  2X7B A;  4XPL A;  3RO0 A;  1FY7 A;  4A95 A;  4B10 A;  2PCU A;  4CRZ B;  3FJU A;  3W91 A;  2GE3 A;  5D8N A;  4OC3 A;  1U6M A;  4X5K A;  3EO4 A;  4F9U A;  4PXC A;  4K30 A;  4II9 A;  2YNC A;  2P6G A;  4YU9 A;  2Q4V A;  3V7Z A;  2GU2 A;  4MFJ A;  2CNM A;  2XEF A;  4P4F A;  4P4I A;  5H86 A;  4CPA A;  2PRB A;  1IID A;  3D7H A;  4UIA A;  1Q2C A;  4ZY2 A;  4F0X A;  1J4J A;  1NE9 A;  1TIQ A;  4G1P A;  4OLL A;  2V8D A;  2AFS A;  4HKF A;  5J8C A;  2Z11 A;  4A30 A;  1CX8 A;  3TO9 A;  4OME A;  2ZW7 A;  4P4J A;  1I21 A;  3B3S A;  1IIC A;  5HH1 A;  3S6F A;  1Y7E A;  4FUU A;  4A31 A;  3B35 A;  3D4U A;  4DUK A;  4CAV A;  4P45 A;  2Z0Z A;  3PB7 X;  3QNV A;  5EMI A;  4B13 A;  1GYT A;  1XOV A;  1YSJ A;  4Q7A A;  2O4H A;  5IX3 A;  2IL4 A;  4TNU A;  2WSA A;  1PCA A;  3BI0 A;  4MBU A;  1LRZ A;  4NGQ A;  2RFH A;  4PXD A;  1NMT A;  1XFO A;  1S5K A;  3D66 A;  1N71 A;  4OAE A;  1BPM A;  4Q36 A;  2DF5 A;  1Z2L A;  4UFX A;  4B5P B;  3B3W A;  4PV6 A;  3SXN A;  4E2A A;  2WPX A;  4YGO A;  4FD7 A;  3RYO A;  5A28 A;  1OZP A;  2XEG A;  4KSF A;  2JDD A;  3KQX A;  4AVB A;  2AFX A;  3LOD A;  3D2P A;  2ATR A;  4XNH B;  2I3C A;  4MY3 A;  4ZBG A;  4YFJ A;  5AG7 A;  3DR8 A;  3I9S A;  5HXD A;  4BIN A;  1BAV A;  1X12 A;  3PBE A;  4JXR A;  2Z3M A;  5A27 A;  4MFL A;  1XF8 A;  2CTC A;  2Z3O A;  1RTQ A;  3K9T A;  4UWI A;  3W6S A;  2J8R A;  2PJ6 A;  3PP9 A;  4NF1 A;  2Q4Y A;  2VXK A;  3GKR A;  4CGO A;  2ZPA A;  5J8F A;  2PR8 A; 
#chains in the Genus database with same CATH homology
 1PYT B;  4OIW A;  2OOT A;  4OC4 A;  3ISX A;  2DEA A;  7CPA A;  3IJ3 A;  2GLF A;  4MHN A;  3SJE A;  1YW4 A;  1DTD A;  1EE3 P;  2ZEP A;  4JYW A;  3PB4 X;  1Z8L A;  2J9A A;  1FT7 A;  2IMO A;  2IJZ A;  2ZOF A;  4P4B A;  2PJ0 A;  3KGQ A;  3V38 A;  4MCQ A;  4YWY A;  4R8F A;  2ANP A;  3KR4 A;  4IAV A;  3PB8 X;  2ABZ A;  4X8I A;  2PIY A;  5LYD A;  2FVG A;  3RAM A;  3FF3 A;  3IWW A;  4A37 A;  3CT9 A;  5THW A;  1TF9 A;  1HDU A;  1LAP A;  2PJ9 A;  1YW6 A;  3PEI A;  2BCO A;  5LRK A;  3MN8 A;  2EK8 A;  1ZG9 A;  4X2T A;  4MRI A;  1ARL A;  1ELM P;  1H8L A;  3K2K A;  1VIX A;  1KWM A;  4MCR A;  1R3N A;  1ZLI A;  2IQ6 A;  2ZEN A;  4PXB A;  2CIJ A;  3D68 A;  3SI2 A;  3FX6 A;  2PJC A;  1ZG7 A;  3S9N A;  2C1C A;  3H8E A;  1TKH A;  3JRU A;  3SJX A;  3D7F A;  4A38 A;  3NH4 A;  1CPX A;  2BO9 A;  2PJ7 A;  2JEW A;  3S9M A;  3B3V A;  3IO1 A;  2RB7 A;  3H8G A;  1TKJ A;  1F2P A;  3PRT A;  5F09 A;  2NYQ A;  3LWU A;  3FH4 A;  1ARM A;  2PJA A;  3NFZ A;  3PFO A;  4F8Z A;  3IC1 A;  2XEJ A;  4EFD A;  4ZX9 A;  4ZX8 A;  1ELL P;  3H8F A;  4KSI A;  3PFE A;  1TF8 A;  2V8H A;  3KQZ A;  3SI0 A;  1Z5R A;  3HLP A;  2AFZ A;  3PB9 X;  1YLO A;  2C6C A;  2AFW A;  4R76 A;  1JQG A;  5J1Q A;  2GLJ A;  3DGV A;  4NGT A;  5K8P A;  4NFR A;  4MCP A;  4OC1 A;  2AFM A;  2WZN A;  4NGR A;  2NSM A;  4RUH A;  4PPZ A;  5ELY A;  3KI9 A;  3KR5 A;  1BLL E;  3ISZ A;  4OKO A;  5K8O A;  3GB0 A;  5CBM A;  5JGF A;  3NH8 A;  2PJ3 A;  1UWY A;  3WC7 A;  8CPA A;  1R43 A;  5IB9 A;  3N5F A;  4ZI6 A;  2O53 A;  1VHE A;  3DLJ A;  2AFO A;  1LAM A;  1ZG8 A;  1CG2 A;  4MMO A;  3NA6 A;  1HDQ A;  4FAI A;  4MHZ A;  4OC0 A;  2C6G A;  3CPX A;  4NGS A;  2G9D A;  2ZEH A;  6CPA A;  1CP7 A;  3KZW A;  4MXU A;  3SJG A;  1CPS A;  2OR4 A;  3CPA A;  3IIB A;  2EK9 A;  2EWB A;  2PJ4 A;  4X3R A;  4DJL A;  4R6T A;  1M4L A;  3B3C A;  4NGP A;  5LYL A;  4K3N A;  3KHZ A;  4ONW A;  3VH9 A;  1F2O A;  4WWV A;  1LOK A;  5JH9 A;  3S9L A;  3D7G A;  3L2N A;  1XRY A;  3WAB A;  3WC5 A;  1Q7L A;  5HVF A;  4R7M A;  2ZED A;  2QVP A;  1LCP A;  2F8H A;  4IHM A;  4ZY0 A;  2BOA A;  3PB6 X;  1VGY A;  4O23 A;  3KHX A;  4FWU A;  4UIB A;  4PXE A;  3GUX A;  1FNO A;  1F57 A;  4IK2 A;  4PQA A;  4DYO A;  2QJ8 A;  3B3T A;  1LAN A;  2V77 A;  4FBE A;  2Q51 A;  4ZYQ A;  3HUV A;  3BI1 A;  4NGN A;  3WC6 A;  2XEI A;  3KL9 A;  1VHO A;  4H2K A;  4UEZ A;  1BPN A;  1Y0R A;  2CTB A;  3B7I A;  3FEE A;  1IY7 A;  2V8G A;  3SJF A;  5LRG A;  3CDX A;  2HC9 A;  3RZA A;  2PJB A;  2GRE A;  3IEH A;  5I4M A;  5K8M A;  5DS0 A;  5LYF A;  1IGB A;  2Q4Z A;  5CPA A;  2Q43 A;  4A94 A;  3I1U A;  2QYV A;  4P4D A;  5LYI A;  3VAR A;  5K8N A;  1ZLH A;  1QQ9 A;  1CBX A;  1YME A;  3PBB A;  3D67 A;  3LMS A;  2PRQ A;  2ZEF A;  4OC5 A;  4NJR A;  4P10 A;  1AMP A;  4GM5 A;  4ZY1 A;  4A39 A;  2V8V A;  1TXR A;  3BHX A;  3D7D A;  2ZEE A;  2ZEL A;  1QMU A;  2PIZ A;  4P6Y A;  4JZ0 A;  2WYR A;  2JBK A;  2PJ8 A;  2PVV A;  4MCS A;  4EWT A;  2PJ2 A;  4OID A;  2PVW A;  1CP6 A;  2HB6 A;  4WJB A;  1XBU A;  1TKF A;  4NGM A;  1LFW A;  2ZEG A;  2AFU A;  2PE3 A;  2ZEM A;  2PJ1 A;  4P4E A;  1NSA A;  4NJQ A;  4EME A;  1OBR A;  1HEE A;  1AYE A;  3FMC A;  2C6P A;  3IFE A;  2F7V A;  3GLJ A;  2ZEO A;  3T8W A;  4F9V A;  4OP4 A;  5HVG A;  5LRJ A;  5D29 A;  3SI1 A;  3RBU A;  3KAS A;  4P44 A;  2CF4 A;  2POK A;  3B2Y A;  4B6Z A;  3TX8 A;  1XJO A;  2ZOG A;  1DE4 C;  3BXM A;  1Y0Y A;  4MHY A;  4LQG A;  3FEC A;  3NH5 A;  4UF4 A;  4W9Y A;  3TC8 A;  4Z65 A;  3WT4 A;  4BD9 A;  4UEF A;  2JBJ A;  3MRU A;  3FVL A;  3FED A;  4UEE A;  2PJ5 A;  5JM6 A;  4OC2 A;  3VAT A;  1XMB A;  2VL1 A;  5HVH A;  4TWE A;  4AXV A;  2PCU A;  3FJU A;  5D8N A;  4OC3 A;  4F9U A;  4PXC A;  4YU9 A;  3V7Z A;  2GU2 A;  4P4I A;  2XEF A;  4P4F A;  4CPA A;  3D7H A;  4UIA A;  4ZY2 A;  4G1P A;  2V8D A;  2AFS A;  1CX8 A;  4OME A;  4P4J A;  3B3S A;  1Y7E A;  4FUU A;  3B35 A;  3D4U A;  4DUK A;  4P45 A;  3QNV A;  3PB7 X;  1GYT A;  1YSJ A;  4Q7A A;  2O4H A;  4TNU A;  1PCA A;  3BI0 A;  4NGQ A;  2RFH A;  4PXD A;  1XFO A;  3D66 A;  1BPM A;  1Z2L A;  3B3W A;  2XEG A;  3KQX A;  2AFX A;  2I3C A;  5HXD A;  1BAV A;  3PBE A;  2CTC A;  1RTQ A;  3K9T A;  2PJ6 A;  4MHP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...