1YW4A

Crystal structure of the succinylglutamate desuccinylase from chromobacterium violaceum, northeast structural genomics target cvr22.
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
331
structure length
319
Chain Sequence
b'THSPSFLQHALSSSDTRAEWPLPGGLAARWLAPGCVELNGDARGADSVLLSCGVHGNETAPIEVVDGMLTDIAAGQLALNCRLLVMFANLDAIRQGVRYGNYDMNRLFNGAHARHPELPESVRAAELETLAAEFFAGARARKLHYDLHTAIRGSVFEKFAIYPFLHRTHKREQLAWLQRCGIEAVLLHTQPANTFSYFTSQYCEADAFTLELGKARPFGQNDLSRFSGIDGALRGLLSNPQANVPDLDEDKLPLFRAKYDLVKHSFKLNLADSVENFTLLPDGMLIAATGGEERILFPNPAVKPGLRAGIVVEPARLPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinylglutamate desuccinylase
publication title Crystal Structure of the Succinylglutamate Desuccinylase from Chromobacterium violaceum, Northeast Structural Genomics Target CvR22.
rcsb
source organism Chromobacterium violaceum
molecule tags Hydrolase
total genus 86
structure length 319
sequence length 331
chains with identical sequence B
ec nomenclature ec 3.5.1.96: Succinylglutamate desuccinylase.
pdb deposition date 2005-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1yw4A00
5K8PA 1TF8A 1DE4C 5I4MA 4NJQA 1CG2A 6CPAA 4DJLA 3WABA 1PYTB 2GU2A 3PBEA 2G9DA 1OBRA 5LRKA 2IJZA 1LFWA 2EWBA 4ZX9A 2PJ1A 1ARLA 1YSJA 1VIXA 1Z2LA 4X2TA 2ZELA 1XMBA 1FT7A 2O4HA 4IHMA 5D29A 2RB7A 4OKOA 3NH5A 3B3SA 4ZI6A 2ZEGA 3PRTA 4PPZA 2WZNA 4OC2A 1HEEA 5LYDA 4GM5A 2IQ6A 4P4BA 3WC6A 3VH9A 2ZEMA 4FWUA 5ELYA 4UIAA 4IK2A 4MXUA 3SJFA 1ZLIA 2XEJA 2QJ8A 3B3VA 2Q51A 3PB9X 4EMEA 3SJXA 7CPAA 1AMPA 4MMOA 4O23A 3D66A 3IJ3A 3TX8A 1Z8LA 1XRYA 4FUUA 2CIJA 1RTQA 3FH4A 4Z65A 4WJBA 1AYEA 1CPSA 4OC4A 3S9NA 4KSIA 3TC8A 1VHEA 2CTBA 5K8MA 1ELLP 4ZY0A 2F8HA 3BI0A 3SI1A 4MHZA 4YWYA 3D4UA 3FVLA 1R43A 2GLFA 5THWA 1LAMA 2PJ4A 1ZG9A 3IEHA 2ZOGA 2C6CA 4P4DA 5K8OA 3H8EA 8CPAA 4PXEA 1YLOA 3FX6A 2QYVA 4W9YA 3DGVA 1FNOA 4DYOA 4MCSA 1XFOA 4DUKA 2ZENA 3D7DA 3B2YA 3GLJA 4ZY1A 3KGQA 2OOTA 3SJGA 4MCRA 1CBXA 2C6PA 3K9TA 3B3WA 2PJAA 1LAPA 4OC0A 5D8NA 5JM6A 4EWTA 4P44A 4FBEA 3CPXA 4P4FA 1F57A 3H8GA 1LANA 5LYIA 4ZYQA 3KQXA 2PJ9A 5HVGA 1Y0YA 1DTDA 2V77A 2XEIA 4G1PA 1Z5RA 4NJRA 3LMSA 1CP6A 1LOKA 4MCPA 4UEZA 5LYLA 3GB0A 5HVFA 2VL1A 1F2PA 5K8NA 2BCOA 2EK8A 4P10A 4TNUA 4NGPA 1UWYA 3I1UA 2XEGA 3PB8X 4UIBA 3KHZA 5HXDA 4PQAA 4NGRA 2BOAA 2PJ2A 1TF9A 1BLLE 1ARMA 1XBUA 3GUXA 3DLJA 2WYRA 4Q7AA 2AFXA 2PVWA 2RFHA 4R6TA 3SJEA 2V8HA 2PJ6A 2F7VA 4X3RA 3PB4X 3FEEA 2AFMA 2AFUA 1CPXA 4CPAA 5CBMA 4UEEA 3SI0A 3KR5A 2ANPA 3KHXA 2PJ7A 4P45A 2BO9A 3B7IA 3FF3A 3WT4A 3ISXA 1BPMA 2PJ8A 2ZEEA 5J1QA 1H8LA 2GREA 4A37A 3S9LA 2V8GA 3CPAA 4F8ZA 5HVHA 3KL9A 4F9VA 5F09A 2V8VA 1BAVA 1ZG8A 2PVVA 5JH9A 2PJ0A 3PFEA 4JYWA 3NH8A 1PCAA 4K3NA 1VHOA 3RAMA 4H2KA 3ISZA 4UF4A 3B3TA 4OIDA 2I3CA 2AFOA 3D7HA 4A94A 2ZEDA 2OR4A 3NA6A 3PFOA 3IO1A 2CTCA 3HUVA 1EE3P 3CDXA 3H8FA 2CF4A 3RBUA 3BI1A 3QNVA 2PIZA 2ZEHA 5LYFA 2Q43A 3RZAA 4MHNA 5CPAA 4EFDA 3PB7X 3NH4A 3PBBA 2ZEPA 2FVGA 4R76A 4NGTA 3PEIA 1JQGA 4WWVA 4LQGA 4NGNA 1TXRA 3B35A 3FEDA 4PXBA 3NFZA 1GYTA 3IIBA 3L2NA 2PRQA 4UEFA 3VARA 2PCUA 4ZY2A 2IMOA 3KI9A 4OC1A 3BHXA 4NGMA 3BXMA 2PIYA 1IY7A 2AFSA 2PJCA 2ZEFA 2PJ5A 3B3CA 2HB6A 4AXVA 2PE3A 3KQZA 4PXCA 1Q7LA 4R8FA 1F2OA 2O53A 1HDUA 2XEFA 3WC7A 4NGQA 1NSAA 4MRIA 4ONWA 4MCQA 1XJOA 2AFWA 3V38A 3LWUA 1VGYA 3FECA 1ELMP 3KR4A 4OC5A 3WC5A 5IB9A 1YW6A 3D7FA 4P6YA 4TWEA 3MN8A 1HDQA 5LRGA 1Y7EA 1M4LA 4OP4A 4YU9A 4B6ZA 1IGBA 2HC9A 3FMCA 4FAIA 2QVPA 3K2KA 3IFEA 2JBKA 3N5FA 3KZWA 2JEWA 2ZOFA 4A39A 3PB6X 2Q4ZA 3V7ZA 4BD9A 4P4JA 4MHPA 3D68A 3IWWA 2NYQA 2DEAA 3FJUA 4F9UA 2ZEOA 2ABZA 1TKJA 5JGFA 1BPNA 1LCPA 4NFRA 3D67A 1CP7A 4OMEA 2C6GA 2J9AA 1TKFA 4IAVA 1TKHA 2GLJA 4NGSA 4PXDA 4JZ0A 1YW4A 1R3NA 2NSMA 2AFZA 2V8DA 3SI2A 3CT9A 4R7MA 1QMUA 2PJBA 3MRUA 5LRJA 4X8IA 1KWMA 4P4EA 4ZX8A 3VATA 1Y0RA 2POKA 3IC1A 3JRUA 4RUHA 3HLPA 1ZG7A 2PJ3A 5DS0A 4OC3A 3T8WA 1QQ9A 1YMEA 4OIWA 3S9MA 3D7GA 1ZLHA 4MHYA 2C1CA 3KASA 4A38A 1CX8A 2JBJA 2EK9A 4P4IA
chains in the Genus database with same CATH superfamily
5K8PA 1TF8A 1DE4C 2YNDA 5I4MA 4NJQA 1CG2A 3TO9A 6CPAA 1NSLA 4UCPA 3D2MA 4DJLA 3IU2A 3VWDA 1RXTA 3RYOA 2X7BA 1PYTB 3BLNA 2YNCA 3JUWA 1JWQA 2GU2A 3PBEA 4R3LA 4YRHA 2G9DA 1M44A 2Q7BA 1OBRA 4MFLA 3A9LA 4CYNA 5LRKA 1XF8A 2IJZA 1LFWA 2EWBA 1P0HA 2Q0YA 4ZX9A 3SXOA 4B5PB 2PJ1A 1ZO0A 4DNCA 1ARLA 2A4NA 1IOIA 1VIXA 1YSJA 1Z2LA 3K9UA 4X2TA 2ZELA 1XMBA 1FT7A 2O4HA 4IHMA 2PR8A 1RO5A 2RB7A 3H4QA 3I3GA 4OKOA 2WPWA 5D29A 3NH5A 3B3SA 4NF1A 1PU9A 2ZEGA 4M3SA 3PRTA 4PPZA 4X5KA 4KOWA 2WZNA 2FIWA 5C88A 1I1DA 4OC2A 4HPSA 3R1KA 1M4IA 4A32A 1HEEA 3WABA 5LYDA 4GM5A 2IQ6A 1I21A 4P4BA 4F0XA 2Q04A 3WC6A 3VH9A 2ZEMA 4FWUA 3FRMA 4B11A 5F47A 5ELYA 4UIAA 4IK2A 2REFA 3GYAA 4PK2A 2EUIA 4MXUA 4FD6A 1AUGA 5KTCA 4QVTA 3LD2A 3SJFA 1ZLIA 2XEJA 2QJ8A 2CNSA 2EBJA 2Q51A 3B3VA 4BINA 3PB9X 4EMEA 5EMIA 1S5KA 3SJXA 7CPAA 4U9YA 1AMPA 4MMOA 3D66A 4O23A 3IJ3A 3TX8A 1Z8LA 1XRYA 4M6HA 4MHDA 4FUUA 5FVJA 2BL1A 1I12A 2DF5A 3OWCA 3PZJA 1LRZA 4ZBGA 2J8MA 5CNPA 2CIJA 2D4PA 1RTQA 2I79A 2P0WA 3FH4A 3PGPA 4UA3A 4Z65A 3DSBA 4WJBA 4AVBA 1AYEA 3WR7A 1M4DA 4OLLA 1CPSA 4OC4A 4C7IA 4AVAA 2ZPAA 4JXRA 3V8IA 3GY9A 3IGRA 1V0CA 4B5PA 4KSIA 3S9NA 2FCKA 2PR1A 2WSAA 2Z3LA 3TC8A 1VHEA 2CTBA 5K8MA 1X10A 1ELLP 2OZGA 2F8HA 4ZY0A 4ZI6A 3F8KA 3BI0A 4YGOA 4JXQA 3S6FA 1IICA 1YVKA 2FT0A 4QB9A 3SI1A 4MHZA 4YWYA 3SXNA 5I0CA 3D4UA 3FVLA 1ON0A 1R43A 1NE9A 2GLFA 5THWA 4HNWB 1LAMA 3H5ZA 2PJ4A 1ZG9A 2B5GA 3IEHA 5DWMA 2ZOGA 1Q2DA 3CXSA 1UFHA 2C6CA 3EXNA 1MJ9A 2G3TA 2ARHA 2ZW4A 4P4DA 4XPLA 3FXTA 1YR0A 1XMTA 4UBRA 4B10A 5K8OA 3FBUA 3H8EA 4KLWA 8CPAA 2REEA 1YLOA 4PXEA 2GFQA 2H5MA 2QYVA 3FX6A 4W9YA 3DGVA 1FNOA 5H86A 4DYOA 1Y9KA 4MCSA 1XFOA 4DUKA 1L0CA 4Q38A 2ZENA 2JDCA 1U6MA 3D7DA 3CZXA 4A33A 3B2YA 3GLJA 4CAWA 4ZY1A 3KGQA 2VEZA 3T90A 3FNCA 2OOTA 4R9MA 3SJGA 4MCRA 1CBXA 5IV0A 2C6PA 4KOUA 3K9TA 3B3WA 2PJAA 1LAPA 4MY3A 4OC0A 1Z4EA 2BSWA 4L8AA 5D8NA 1Z8WA 4EWTA 5JM6A 4P44A 3EY5A 2Z0ZA 4KOVA 4FBEA 4YFJA 3CPXA 4P4FA 4PSXA 1F57A 3H8GA 5AG7A 1LANA 4B14A 5LYIA 5EC4A 4RN7A 3KQXA 3NE8A 4M6IA 4ZYQA 2PJ9A 5J8FA 5HVGA 2PQ8A 1Y0YA 1DTDA 1S7KA 2Q44A 2V77A 2XEIA 3IWGA 4G1PA 1Z5RA 2DXQA 4NJRA 3IWEA 3KKWA 3LMSA 1QSTA 2ZXVA 2I00A 1CP6A 1LOKA 3F5BA 4MCPA 4UEZA 4H6UA 4OAEA 4XNHB 1YK3A 1Z4RA 2EO8A 2Z3PA 2DPSA 3QAYA 5LYLA 3GB0A 5HVFA 4PV6A 1VHSA 2VL1A 1M4GA 2B4BA 2C27A 1F2PA 5F46A 5K8NA 4U9ZA 4KUBA 4AB7A 2BCOA 2EK8A 4P10A 4TNUA 4NEXA 5ISVA 2HQYA 3G8WA 4NGPA 1UWYA 3R9GA 2JDDA 3I1UA 2XEGA 3PB8X 4UWJA 2FSRA 3S6GA 1S7NA 3KHZA 4UIBA 5C82A 5HXDA 4PQAA 5J8CA 1J4JA 1Y9WA 2GIVA 3FYNA 1BO4A 2HV2A 4NGRA 2BOAA 2PJ2A 2GE3A 1TF9A 4CGOA 3IU1A 4XNHC 4QUSA 3D2PA 2DPTA 2K5TA 1BLLE 1ARMA 2B4DB 1XBUA 4R3KA 3TOAA 3GUXA 3LODA 1IYKA 1B87A 2Z11A 2VXKA 3DLJA 3TE4A 3UY5A 4U5YA 1MJBA 3R9FA 2WYRA 3TO7A 4EVYA 4B5OA 4A31A 4Q7AA 4C68A 4JWPA 2FIAA 2AFXA 2PVWA 1IYLA 5GCNA 2RFHA 4R6TA 3SJEA 2V8HA 4UFVA 2PJ6A 2VZYA 2PRBA 5AGEA 2F7VA 5F48A 4MFKA 4X3RA 3RNZA 3PB4X 3FEEA 2AFMA 4RI1A 1S3ZA 4NXYA 4IF5A 2AFUA 1CPXA 1IIDA 4AG7A 4CPAA 3W6SA 4ORFA 4HKFA 5AG5A 2WPXA 3RO0A 1KUXA 2ZW5A 4KUAA 3TCVA 5CBMA 4KZTA 4CGLA 3QAHA 4OADA 3BJ8A 2HUZA 4E0AA 4UEEA 3SI0A 2FE7A 3KR5A 2ANPA 3KHXA 2PJ7A 4P45A 2BO9A 3B7IA 3FF3A 4MFZA 4J3GA 4UFWA 4AVCA 2VI7A 3WT4A 3ISXA 1BPMA 2PJ8A 2ZEEA 2R8VA 4CGMA 4NCZA 1NMTA 3W6XA 5J1QA 1H8LA 1Z9UA 2GREA 4KOYA 4A37A 2VBQA 2O28A 4AG9A 3S9LA 1XEBA 3FB3A 4M85A 2YGWA 1QSNA 1MK4A 2V8GA 3CPAA 3DR8A 4IUSA 4QC6A 4F8ZA 3R96A 5HVHA 2AE6A 3KL9A 4UFXA 1YVOA 4F9VA 5F09A 3R9EA 1KZFA 2QMLA 1BAVA 2V8VA 4BBHA 2JLMA 4B13A 3LACA 1ZG8A 2FS5A 2PVVA 5JH9A 2PJ0A 3PFEA 4JYWA 3NH8A 1PCAA 4UCNA 3N7ZA 4LUAA 1Q2CA 2GANA 1YLEA 1VHOA 4K3NA 1QSMA 4GS4A 1P4NA 1R57A 4H89A 2CNMA 3RAMA 3JVNA 2Z10A 2CY2A 4H2KA 2YNEA 2QECA 4CRZB 1B6BA 4MJ8A 3ISZA 5H84A 4UF4A 3BJ7A 2BEIA 3B3TA 4OIDA 4KVXA 5IX3A 1X12A 2I3CA 2AFOA 3D7HA 4KVME 4A94A 4KSAA 2ZEDA 4L89A 1Z8TA 4CGNA 2OR4A 3NA6A 4MFPA 3PFOA 1FY7A 3IO1A 3QB8A 1M1DA 3EC4A 4KLVA 2CTCA 2P6EA 3HUVA 1EE3P 3JTKA 3T9YA 3CDXA 3H8FA 2IL4A 2PSWA 2CF4A 3D3SA 4A95A 3RBUA 3BI1A 1IU8A 3QNVA 2PIZA 2ZEHA 5LYFA 1Z8XA 2Q43A 5EBVA 2ODFA 5BWAB 3ZJ0A 3RZAA 4H6ZA 4MHNA 5CPAA 4HNYB 2NMTA 2Q4YA 4B12A 2Z3KA 4EFDA 3PB7X 3NH4A 3PBBA 1A2ZA 2ZEPA 2FVGA 4C2YA 1YGHA 4CAXA 4R76A 4ONUA 2Z3MA 1CM0A 2Z3OA 4JD6A 4NGTA 3PEIA 1JQGA 4I49A 4CYOA 4ZGYB 2VZZA 1S7FA 4E8OA 4WWVA 4C2ZA 3NE7A 4Q36A 4LQGA 3EFAA 2QIRA 4NGNA 1TXRA 2J8NA 3B35A 3FEDA 1KUVA 2KCWA 4PXBA 3R95A 3NFZA 1QSOA 2ZW7A 4MFQA 4C7HA 1GYTA 2P6GA 3IIBA 3L2NA 2PRQA 4UEFA 4LX9A 3VARA 2PCUA 3CXQA 4CYQA 2PC1A 4ZY2A 2IMOA 3KI9A 4OC1A 5E96A 1KUYA 1VKCA 2B58A 3SHPA 2FXFA 3BHXA 4NGMA 4E2AA 3BXMA 4CRYB 4MY0A 1Y7RA 2PIYA 1IY7A 4PSWA 2BUEA 3S6HA 4FD4A 2AFSA 2PJCA 2ZEFA 5AG6A 2PJ5A 2Q7SA 2G3AA 3B3CA 1YREA 2HB6A 4AXVA 3G3SA 2OU2A 2PE3A 2RC4A 3KQZA 4KOTA 4PXCA 4A2ZA 1Q7LA 4R8FA 3TT2A 1F2OA 2O53A 2JEVA 1XE4A 4FD5A 1HDUA 2B5GB 2OB0A 4XPKA 2XEFA 3WC7A 4KOSA 4NGQA 5JQ4A 1NSAA 1S7LA 2R1IA 3CXPA 4MRIA 4ONWA 4MCQA 5G20A 3D8PA 4PK3A 1XJOA 2AFWA 2CXAA 3DNSA 5HH1A 3V38A 4FD7A 1K4JA 1VGYA 3LWUA 3P2FA 4QBJA 3FECA 1ELMP 4KSFA 3KR4A 4OC5A 3WC5A 2R98A 5IB9A 2D4OA 4K30A 3B8GA 2Q4VA 1YW6A 2P6FA 3D7FA 4P6YA 4TWEA 5AG4A 3C26A 5KTDA 3MN8A 1HDQA 5LRGA 1WK4A 4GXHA 1SQHA 1Y7EA 5KTAA 1M4LA 4OP4A 4YU9A 4UCMA 4B6ZA 4CAEA 3I9SA 1IGBA 4UWIA 2HC9A 2R7HA 1PUAA 4M6GA 3FMCA 5JPHA 4FAIA 2F5IA 1MJAA 2QVPA 1N71A 2OZUA 3K2KA 4CAFA 3IFEA 3GKRA 4KOXA 2JBKA 4LQ6A 1QSRA 3N5FA 1IB1E 3KZWA 5A27A 2CNTA 2FL4A 1YQEA 2OZHA 2JEWA 2J8RA 3TTHA 2VQYA 2ZOFA 4RS2A 4A39A 1TIQA 3DDDA 2Q4ZA 1IOFA 1CJWA 3PB6X 3V7ZA 4BD9A 4P4JA 4MHPA 3D68A 3IWWA 2NYQA 4A30A 4NSQA 2B4DA 3FIXA 4C2XA 4MBUA 2DEAA 3FJUA 4XPDB 3S6KA 4F9UA 3EO4A 5DWNA 2ATRA 2ZEOA 2ABZA 1TKJA 4BMHA 4F0YA 5JGFA 1BPNA 1LCPA 3VWEA 2ZW6A 5F49A 4NFRA 3DR6A 3D67A 1WWZA 1CP7A 3P2HA 4Y49B 4OMEA 4KVOE 2C6GA 2J9AA 1TKFA 1OZPA 3GIUA 2OH1A 1TKHA 4IAVA 2GLJA 2EVNA 1XOVA 1BOBA 4NGSA 4PXDA 4JZ0A 5IB0A 1YW4A 4R57A 4JLYA 1R3NA 2NSMA 4CAVA 5G21A 2AFZA 2V8DA 4KORA 1S60A 5A28A 3SI2A 3CT9A 2YNCC 1QMUA 2Y0MA 4R7MA 4JJXA 5G22A 2PJBA 4XPDC 3MRUA 2Z3NA 5LRJA 4X8IA 4MFJA 1KWMA 4KS9A 5G1ZA 2B3UA 4P4EA 4ZX8A 3ZZIA 2PDOA 3MGDA 2WUUA 4HNXB 4MI4A 1GHEA 4Y49C 1Y0RA 3VATA 2POKA 3F0AA 4CGPA 3E0KA 4R87A 3TOBA 1XIXA 3IC1A 2AJ6A 3JRUA 4RUHA 3TO6A 3HLPA 4F6AA 3TFYA 1ZG7A 2PJ3A 5DS0A 4OC3A 4II9A 3T8WA 5HMNA 3PP9A 1QQ9A 1Q2YA 1YMEA 4CYPA 4OIWA 1YX0A 2G0BA 3S9MA 3W91A 3D7GA 1ZLHA 4MHYA 2C1CA 3KASA 4A38A 2B3VA 1CX8A 2JBJA 2EK9A 4P4IA 4CS0B
chains in the Genus database with same CATH topology
5K8PA 1TF8A 1DE4C 5I4MA 4NJQA 1CG2A 6CPAA 4DJLA 3WABA 1PYTB 2GU2A 3PBEA 2G9DA 1OBRA 5LRKA 2IJZA 1LFWA 2EWBA 4ZX9A 2PJ1A 1ARLA 1YSJA 1VIXA 1Z2LA 4X2TA 2ZELA 1XMBA 1FT7A 2O4HA 4IHMA 5D29A 2RB7A 4OKOA 3NH5A 3B3SA 4ZI6A 2ZEGA 3PRTA 4PPZA 2WZNA 4OC2A 1HEEA 5LYDA 4GM5A 2IQ6A 4P4BA 3WC6A 3VH9A 2ZEMA 4FWUA 5ELYA 4UIAA 4IK2A 4MXUA 3SJFA 1ZLIA 2XEJA 2QJ8A 3B3VA 2Q51A 3PB9X 4EMEA 3SJXA 7CPAA 1AMPA 4MMOA 4O23A 3D66A 3IJ3A 3TX8A 1Z8LA 1XRYA 4FUUA 2CIJA 1RTQA 3FH4A 4Z65A 4WJBA 1AYEA 1CPSA 4OC4A 3S9NA 4KSIA 3TC8A 1VHEA 2CTBA 5K8MA 1ELLP 4ZY0A 2F8HA 3BI0A 3SI1A 4MHZA 4YWYA 3D4UA 3FVLA 1R43A 2GLFA 5THWA 1LAMA 2PJ4A 1ZG9A 3IEHA 2ZOGA 2C6CA 4P4DA 5K8OA 3H8EA 8CPAA 4PXEA 1YLOA 3FX6A 2QYVA 4W9YA 3DGVA 1FNOA 4DYOA 4MCSA 1XFOA 4DUKA 2ZENA 3D7DA 3B2YA 3GLJA 4ZY1A 3KGQA 2OOTA 3SJGA 4MCRA 1CBXA 2C6PA 3K9TA 3B3WA 2PJAA 1LAPA 4OC0A 5D8NA 5JM6A 4EWTA 4P44A 4FBEA 3CPXA 4P4FA 1F57A 3H8GA 1LANA 5LYIA 4ZYQA 3KQXA 2PJ9A 5HVGA 1Y0YA 1DTDA 2V77A 2XEIA 4G1PA 1Z5RA 4NJRA 3LMSA 1CP6A 1LOKA 4MCPA 4UEZA 5LYLA 3GB0A 5HVFA 2VL1A 1F2PA 5K8NA 2BCOA 2EK8A 4P10A 4TNUA 4NGPA 1UWYA 3I1UA 2XEGA 3PB8X 4UIBA 3KHZA 5HXDA 4PQAA 4NGRA 2BOAA 2PJ2A 1TF9A 1BLLE 1ARMA 1XBUA 3GUXA 3DLJA 2WYRA 4Q7AA 2AFXA 2PVWA 2RFHA 4R6TA 3SJEA 2V8HA 2PJ6A 2F7VA 4X3RA 3PB4X 3FEEA 2AFMA 2AFUA 1CPXA 4CPAA 5CBMA 4UEEA 3SI0A 3KR5A 2ANPA 3KHXA 2PJ7A 4P45A 2BO9A 3B7IA 3FF3A 3WT4A 3ISXA 1BPMA 2PJ8A 2ZEEA 5J1QA 1H8LA 2GREA 4A37A 3S9LA 2V8GA 3CPAA 4F8ZA 5HVHA 3KL9A 4F9VA 5F09A 2V8VA 1BAVA 1ZG8A 2PVVA 5JH9A 2PJ0A 3PFEA 4JYWA 3NH8A 1PCAA 4K3NA 1VHOA 3RAMA 4H2KA 3ISZA 4UF4A 3B3TA 4OIDA 2I3CA 2AFOA 3D7HA 4A94A 2ZEDA 2OR4A 3NA6A 3PFOA 3IO1A 2CTCA 3HUVA 1EE3P 3CDXA 3H8FA 2CF4A 3RBUA 3BI1A 3QNVA 2PIZA 2ZEHA 5LYFA 2Q43A 3RZAA 4MHNA 5CPAA 4EFDA 3PB7X 3NH4A 3PBBA 2ZEPA 2FVGA 4R76A 4NGTA 3PEIA 1JQGA 4WWVA 4LQGA 4NGNA 1TXRA 3B35A 3FEDA 4PXBA 3NFZA 1GYTA 3IIBA 3L2NA 2PRQA 4UEFA 3VARA 2PCUA 4ZY2A 2IMOA 3KI9A 4OC1A 3BHXA 4NGMA 3BXMA 2PIYA 1IY7A 2AFSA 2PJCA 2ZEFA 2PJ5A 3B3CA 2HB6A 4AXVA 2PE3A 3KQZA 4PXCA 1Q7LA 4R8FA 1F2OA 2O53A 1HDUA 2XEFA 3WC7A 4NGQA 1NSAA 4MRIA 4ONWA 4MCQA 1XJOA 2AFWA 3V38A 3LWUA 1VGYA 3FECA 1ELMP 3KR4A 4OC5A 3WC5A 5IB9A 1YW6A 3D7FA 4P6YA 4TWEA 3MN8A 1HDQA 5LRGA 1Y7EA 1M4LA 4OP4A 4YU9A 4B6ZA 1IGBA 2HC9A 3FMCA 4FAIA 2QVPA 3K2KA 3IFEA 2JBKA 3N5FA 3KZWA 2JEWA 2ZOFA 4A39A 3PB6X 2Q4ZA 3V7ZA 4BD9A 4P4JA 4MHPA 3D68A 3IWWA 2NYQA 2DEAA 3FJUA 4F9UA 2ZEOA 2ABZA 1TKJA 5JGFA 1BPNA 1LCPA 4NFRA 3D67A 1CP7A 4OMEA 2C6GA 2J9AA 1TKFA 4IAVA 1TKHA 2GLJA 4NGSA 4PXDA 4JZ0A 1YW4A 1R3NA 2NSMA 2AFZA 2V8DA 3SI2A 3CT9A 4R7MA 1QMUA 2PJBA 3MRUA 5LRJA 4X8IA 1KWMA 4P4EA 4ZX8A 3VATA 1Y0RA 2POKA 3IC1A 3JRUA 4RUHA 3HLPA 1ZG7A 2PJ3A 5DS0A 4OC3A 3T8WA 1QQ9A 1YMEA 4OIWA 3S9MA 3D7GA 1ZLHA 4MHYA 2C1CA 3KASA 4A38A 1CX8A 2JBJA 2EK9A 4P4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K8P A;  1TF8 A;  1DE4 C;  5I4M A;  4NJQ A;  1CG2 A;  6CPA A;  4DJL A;  3WAB A;  1PYT B;  2GU2 A;  3PBE A;  2G9D A;  1OBR A;  5LRK A;  2IJZ A;  1LFW A;  2EWB A;  4ZX9 A;  2PJ1 A;  1ARL A;  1YSJ A;  1VIX A;  1Z2L A;  4X2T A;  2ZEL A;  1XMB A;  1FT7 A;  2O4H A;  4IHM A;  5D29 A;  2RB7 A;  4OKO A;  3NH5 A;  3B3S A;  4ZI6 A;  2ZEG A;  3PRT A;  4PPZ A;  2WZN A;  4OC2 A;  1HEE A;  5LYD A;  4GM5 A;  2IQ6 A;  4P4B A;  3WC6 A;  3VH9 A;  2ZEM A;  4FWU A;  5ELY A;  4UIA A;  4IK2 A;  4MXU A;  3SJF A;  1ZLI A;  2XEJ A;  2QJ8 A;  3B3V A;  2Q51 A;  3PB9 X;  4EME A;  3SJX A;  7CPA A;  1AMP A;  4MMO A;  4O23 A;  3D66 A;  3IJ3 A;  3TX8 A;  1Z8L A;  1XRY A;  4FUU A;  2CIJ A;  1RTQ A;  3FH4 A;  4Z65 A;  4WJB A;  1AYE A;  1CPS A;  4OC4 A;  3S9N A;  4KSI A;  3TC8 A;  1VHE A;  2CTB A;  5K8M A;  1ELL P;  4ZY0 A;  2F8H A;  3BI0 A;  3SI1 A;  4MHZ A;  4YWY A;  3D4U A;  3FVL A;  1R43 A;  2GLF A;  5THW A;  1LAM A;  2PJ4 A;  1ZG9 A;  3IEH A;  2ZOG A;  2C6C A;  4P4D A;  5K8O A;  3H8E A;  8CPA A;  4PXE A;  1YLO A;  3FX6 A;  2QYV A;  4W9Y A;  3DGV A;  1FNO A;  4DYO A;  4MCS A;  1XFO A;  4DUK A;  2ZEN A;  3D7D A;  3B2Y A;  3GLJ A;  4ZY1 A;  3KGQ A;  2OOT A;  3SJG A;  4MCR A;  1CBX A;  2C6P A;  3K9T A;  3B3W A;  2PJA A;  1LAP A;  4OC0 A;  5D8N A;  5JM6 A;  4EWT A;  4P44 A;  4FBE A;  3CPX A;  4P4F A;  1F57 A;  3H8G A;  1LAN A;  5LYI A;  4ZYQ A;  3KQX A;  2PJ9 A;  5HVG A;  1Y0Y A;  1DTD A;  2V77 A;  2XEI A;  4G1P A;  1Z5R A;  4NJR A;  3LMS A;  1CP6 A;  1LOK A;  4MCP A;  4UEZ A;  5LYL A;  3GB0 A;  5HVF A;  2VL1 A;  1F2P A;  5K8N A;  2BCO A;  2EK8 A;  4P10 A;  4TNU A;  4NGP A;  1UWY A;  3I1U A;  2XEG A;  3PB8 X;  4UIB A;  3KHZ A;  5HXD A;  4PQA A;  4NGR A;  2BOA A;  2PJ2 A;  1TF9 A;  1BLL E;  1ARM A;  1XBU A;  3GUX A;  3DLJ A;  2WYR A;  4Q7A A;  2AFX A;  2PVW A;  2RFH A;  4R6T A;  3SJE A;  2V8H A;  2PJ6 A;  2F7V A;  4X3R A;  3PB4 X;  3FEE A;  2AFM A;  2AFU A;  1CPX A;  4CPA A;  5CBM A;  4UEE A;  3SI0 A;  3KR5 A;  2ANP A;  3KHX A;  2PJ7 A;  4P45 A;  2BO9 A;  3B7I A;  3FF3 A;  3WT4 A;  3ISX A;  1BPM A;  2PJ8 A;  2ZEE A;  5J1Q A;  1H8L A;  2GRE A;  4A37 A;  3S9L A;  2V8G A;  3CPA A;  4F8Z A;  5HVH A;  3KL9 A;  4F9V A;  5F09 A;  2V8V A;  1BAV A;  1ZG8 A;  2PVV A;  5JH9 A;  2PJ0 A;  3PFE A;  4JYW A;  3NH8 A;  1PCA A;  4K3N A;  1VHO A;  3RAM A;  4H2K A;  3ISZ A;  4UF4 A;  3B3T A;  4OID A;  2I3C A;  2AFO A;  3D7H A;  4A94 A;  2ZED A;  2OR4 A;  3NA6 A;  3PFO A;  3IO1 A;  2CTC A;  3HUV A;  1EE3 P;  3CDX A;  3H8F A;  2CF4 A;  3RBU A;  3BI1 A;  3QNV A;  2PIZ A;  2ZEH A;  5LYF A;  2Q43 A;  3RZA A;  4MHN A;  5CPA A;  4EFD A;  3PB7 X;  3NH4 A;  3PBB A;  2ZEP A;  2FVG A;  4R76 A;  4NGT A;  3PEI A;  1JQG A;  4WWV A;  4LQG A;  4NGN A;  1TXR A;  3B35 A;  3FED A;  4PXB A;  3NFZ A;  1GYT A;  3IIB A;  3L2N A;  2PRQ A;  4UEF A;  3VAR A;  2PCU A;  4ZY2 A;  2IMO A;  3KI9 A;  4OC1 A;  3BHX A;  4NGM A;  3BXM A;  2PIY A;  1IY7 A;  2AFS A;  2PJC A;  2ZEF A;  2PJ5 A;  3B3C A;  2HB6 A;  4AXV A;  2PE3 A;  3KQZ A;  4PXC A;  1Q7L A;  4R8F A;  1F2O A;  2O53 A;  1HDU A;  2XEF A;  3WC7 A;  4NGQ A;  1NSA A;  4MRI A;  4ONW A;  4MCQ A;  1XJO A;  2AFW A;  3V38 A;  3LWU A;  1VGY A;  3FEC A;  1ELM P;  3KR4 A;  4OC5 A;  3WC5 A;  5IB9 A;  1YW6 A;  3D7F A;  4P6Y A;  4TWE A;  3MN8 A;  1HDQ A;  5LRG A;  1Y7E A;  1M4L A;  4OP4 A;  4YU9 A;  4B6Z A;  1IGB A;  2HC9 A;  3FMC A;  4FAI A;  2QVP A;  3K2K A;  3IFE A;  2JBK A;  3N5F A;  3KZW A;  2JEW A;  2ZOF A;  4A39 A;  3PB6 X;  2Q4Z A;  3V7Z A;  4BD9 A;  4P4J A;  4MHP A;  3D68 A;  3IWW A;  2NYQ A;  2DEA A;  3FJU A;  4F9U A;  2ZEO A;  2ABZ A;  1TKJ A;  5JGF A;  1BPN A;  1LCP A;  4NFR A;  3D67 A;  1CP7 A;  4OME A;  2C6G A;  2J9A A;  1TKF A;  4IAV A;  1TKH A;  2GLJ A;  4NGS A;  4PXD A;  4JZ0 A;  1YW4 A;  1R3N A;  2NSM A;  2AFZ A;  2V8D A;  3SI2 A;  3CT9 A;  4R7M A;  1QMU A;  2PJB A;  3MRU A;  5LRJ A;  4X8I A;  1KWM A;  4P4E A;  4ZX8 A;  3VAT A;  1Y0R A;  2POK A;  3IC1 A;  3JRU A;  4RUH A;  3HLP A;  1ZG7 A;  2PJ3 A;  5DS0 A;  4OC3 A;  3T8W A;  1QQ9 A;  1YME A;  4OIW A;  3S9M A;  3D7G A;  1ZLH A;  4MHY A;  2C1C A;  3KAS A;  4A38 A;  1CX8 A;  2JBJ A;  2EK9 A;  4P4I A; 
#chains in the Genus database with same CATH topology
 5K8P A;  1TF8 A;  1DE4 C;  2YND A;  5I4M A;  4NJQ A;  1CG2 A;  3TO9 A;  6CPA A;  1NSL A;  4UCP A;  3D2M A;  4DJL A;  3IU2 A;  3VWD A;  1RXT A;  3RYO A;  2X7B A;  1PYT B;  3BLN A;  2YNC A;  3JUW A;  1JWQ A;  2GU2 A;  3PBE A;  4R3L A;  4YRH A;  2G9D A;  1M44 A;  2Q7B A;  1OBR A;  4MFL A;  3A9L A;  4CYN A;  5LRK A;  1XF8 A;  2IJZ A;  1LFW A;  2EWB A;  1P0H A;  2Q0Y A;  4ZX9 A;  3SXO A;  4B5P B;  2PJ1 A;  1ZO0 A;  4DNC A;  1ARL A;  2A4N A;  1IOI A;  1VIX A;  1YSJ A;  1Z2L A;  3K9U A;  4X2T A;  2ZEL A;  1XMB A;  1FT7 A;  2O4H A;  4IHM A;  2PR8 A;  1RO5 A;  2RB7 A;  3H4Q A;  3I3G A;  4OKO A;  2WPW A;  5D29 A;  3NH5 A;  3B3S A;  4NF1 A;  1PU9 A;  2ZEG A;  4M3S A;  3PRT A;  4PPZ A;  4X5K A;  4KOW A;  2WZN A;  2FIW A;  5C88 A;  1I1D A;  4OC2 A;  4HPS A;  3R1K A;  1M4I A;  4A32 A;  1HEE A;  3WAB A;  5LYD A;  4GM5 A;  2IQ6 A;  1I21 A;  4P4B A;  4F0X A;  2Q04 A;  3WC6 A;  3VH9 A;  2ZEM A;  4FWU A;  3FRM A;  4B11 A;  5F47 A;  5ELY A;  4UIA A;  4IK2 A;  2REF A;  3GYA A;  4PK2 A;  2EUI A;  4MXU A;  4FD6 A;  1AUG A;  5KTC A;  4QVT A;  3LD2 A;  3SJF A;  1ZLI A;  2XEJ A;  2QJ8 A;  2CNS A;  2EBJ A;  2Q51 A;  3B3V A;  4BIN A;  3PB9 X;  4EME A;  5EMI A;  1S5K A;  3SJX A;  7CPA A;  4U9Y A;  1AMP A;  4MMO A;  3D66 A;  4O23 A;  3IJ3 A;  3TX8 A;  1Z8L A;  1XRY A;  4M6H A;  4MHD A;  4FUU A;  5FVJ A;  2BL1 A;  1I12 A;  2DF5 A;  3OWC A;  3PZJ A;  1LRZ A;  4ZBG A;  2J8M A;  5CNP A;  2CIJ A;  2D4P A;  1RTQ A;  2I79 A;  2P0W A;  3FH4 A;  3PGP A;  4UA3 A;  4Z65 A;  3DSB A;  4WJB A;  4AVB A;  1AYE A;  3WR7 A;  1M4D A;  4OLL A;  1CPS A;  4OC4 A;  4C7I A;  4AVA A;  2ZPA A;  4JXR A;  3V8I A;  3GY9 A;  3IGR A;  1V0C A;  4B5P A;  4KSI A;  3S9N A;  2FCK A;  2PR1 A;  2WSA A;  2Z3L A;  3TC8 A;  1VHE A;  2CTB A;  5K8M A;  1X10 A;  1ELL P;  2OZG A;  2F8H A;  4ZY0 A;  4ZI6 A;  3F8K A;  3BI0 A;  4YGO A;  4JXQ A;  3S6F A;  1IIC A;  1YVK A;  2FT0 A;  4QB9 A;  3SI1 A;  4MHZ A;  4YWY A;  3SXN A;  5I0C A;  3D4U A;  3FVL A;  1ON0 A;  1R43 A;  1NE9 A;  2GLF A;  5THW A;  4HNW B;  1LAM A;  3H5Z A;  2PJ4 A;  1ZG9 A;  2B5G A;  3IEH A;  5DWM A;  2ZOG A;  1Q2D A;  3CXS A;  1UFH A;  2C6C A;  3EXN A;  1MJ9 A;  2G3T A;  2ARH A;  2ZW4 A;  4P4D A;  4XPL A;  3FXT A;  1YR0 A;  1XMT A;  4UBR A;  4B10 A;  5K8O A;  3FBU A;  3H8E A;  4KLW A;  8CPA A;  2REE A;  1YLO A;  4PXE A;  2GFQ A;  2H5M A;  2QYV A;  3FX6 A;  4W9Y A;  3DGV A;  1FNO A;  5H86 A;  4DYO A;  1Y9K A;  4MCS A;  1XFO A;  4DUK A;  1L0C A;  4Q38 A;  2ZEN A;  2JDC A;  1U6M A;  3D7D A;  3CZX A;  4A33 A;  3B2Y A;  3GLJ A;  4CAW A;  4ZY1 A;  3KGQ A;  2VEZ A;  3T90 A;  3FNC A;  2OOT A;  4R9M A;  3SJG A;  4MCR A;  1CBX A;  5IV0 A;  2C6P A;  4KOU A;  3K9T A;  3B3W A;  2PJA A;  1LAP A;  4MY3 A;  4OC0 A;  1Z4E A;  2BSW A;  4L8A A;  5D8N A;  1Z8W A;  4EWT A;  5JM6 A;  4P44 A;  3EY5 A;  2Z0Z A;  4KOV A;  4FBE A;  4YFJ A;  3CPX A;  4P4F A;  4PSX A;  1F57 A;  3H8G A;  5AG7 A;  1LAN A;  4B14 A;  5LYI A;  5EC4 A;  4RN7 A;  3KQX A;  3NE8 A;  4M6I A;  4ZYQ A;  2PJ9 A;  5J8F A;  5HVG A;  2PQ8 A;  1Y0Y A;  1DTD A;  1S7K A;  2Q44 A;  2V77 A;  2XEI A;  3IWG A;  4G1P A;  1Z5R A;  2DXQ A;  4NJR A;  3IWE A;  3KKW A;  3LMS A;  1QST A;  2ZXV A;  2I00 A;  1CP6 A;  1LOK A;  3F5B A;  4MCP A;  4UEZ A;  4H6U A;  4OAE A;  4XNH B;  1YK3 A;  1Z4R A;  2EO8 A;  2Z3P A;  2DPS A;  3QAY A;  5LYL A;  3GB0 A;  5HVF A;  4PV6 A;  1VHS A;  2VL1 A;  1M4G A;  2B4B A;  2C27 A;  1F2P A;  5F46 A;  5K8N A;  4U9Z A;  4KUB A;  4AB7 A;  2BCO A;  2EK8 A;  4P10 A;  4TNU A;  4NEX A;  5ISV A;  2HQY A;  3G8W A;  4NGP A;  1UWY A;  3R9G A;  2JDD A;  3I1U A;  2XEG A;  3PB8 X;  4UWJ A;  2FSR A;  3S6G A;  1S7N A;  3KHZ A;  4UIB A;  5C82 A;  5HXD A;  4PQA A;  5J8C A;  1J4J A;  1Y9W A;  2GIV A;  3FYN A;  1BO4 A;  2HV2 A;  4NGR A;  2BOA A;  2PJ2 A;  2GE3 A;  1TF9 A;  4CGO A;  3IU1 A;  4XNH C;  4QUS A;  3D2P A;  2DPT A;  2K5T A;  1BLL E;  1ARM A;  2B4D B;  1XBU A;  4R3K A;  3TOA A;  3GUX A;  3LOD A;  1IYK A;  1B87 A;  2Z11 A;  2VXK A;  3DLJ A;  3TE4 A;  3UY5 A;  4U5Y A;  1MJB A;  3R9F A;  2WYR A;  3TO7 A;  4EVY A;  4B5O A;  4A31 A;  4Q7A A;  4C68 A;  4JWP A;  2FIA A;  2AFX A;  2PVW A;  1IYL A;  5GCN A;  2RFH A;  4R6T A;  3SJE A;  2V8H A;  4UFV A;  2PJ6 A;  2VZY A;  2PRB A;  5AGE A;  2F7V A;  5F48 A;  4MFK A;  4X3R A;  3RNZ A;  3PB4 X;  3FEE A;  2AFM A;  4RI1 A;  1S3Z A;  4NXY A;  4IF5 A;  2AFU A;  1CPX A;  1IID A;  4AG7 A;  4CPA A;  3W6S A;  4ORF A;  4HKF A;  5AG5 A;  2WPX A;  3RO0 A;  1KUX A;  2ZW5 A;  4KUA A;  3TCV A;  5CBM A;  4KZT A;  4CGL A;  3QAH A;  4OAD A;  3BJ8 A;  2HUZ A;  4E0A A;  4UEE A;  3SI0 A;  2FE7 A;  3KR5 A;  2ANP A;  3KHX A;  2PJ7 A;  4P45 A;  2BO9 A;  3B7I A;  3FF3 A;  4MFZ A;  4J3G A;  4UFW A;  4AVC A;  2VI7 A;  3WT4 A;  3ISX A;  1BPM A;  2PJ8 A;  2ZEE A;  2R8V A;  4CGM A;  4NCZ A;  1NMT A;  3W6X A;  5J1Q A;  1H8L A;  1Z9U A;  2GRE A;  4KOY A;  4A37 A;  2VBQ A;  2O28 A;  4AG9 A;  3S9L A;  1XEB A;  3FB3 A;  4M85 A;  2YGW A;  1QSN A;  1MK4 A;  2V8G A;  3CPA A;  3DR8 A;  4IUS A;  4QC6 A;  4F8Z A;  3R96 A;  5HVH A;  2AE6 A;  3KL9 A;  4UFX A;  1YVO A;  4F9V A;  5F09 A;  3R9E A;  1KZF A;  2QML A;  1BAV A;  2V8V A;  4BBH A;  2JLM A;  4B13 A;  3LAC A;  1ZG8 A;  2FS5 A;  2PVV A;  5JH9 A;  2PJ0 A;  3PFE A;  4JYW A;  3NH8 A;  1PCA A;  4UCN A;  3N7Z A;  4LUA A;  1Q2C A;  2GAN A;  1YLE A;  1VHO A;  4K3N A;  1QSM A;  4GS4 A;  1P4N A;  1R57 A;  4H89 A;  2CNM A;  3RAM A;  3JVN A;  2Z10 A;  2CY2 A;  4H2K A;  2YNE A;  2QEC A;  4CRZ B;  1B6B A;  4MJ8 A;  3ISZ A;  5H84 A;  4UF4 A;  3BJ7 A;  2BEI A;  3B3T A;  4OID A;  4KVX A;  5IX3 A;  1X12 A;  2I3C A;  2AFO A;  3D7H A;  4KVM E;  4A94 A;  4KSA A;  2ZED A;  4L89 A;  1Z8T A;  4CGN A;  2OR4 A;  3NA6 A;  4MFP A;  3PFO A;  1FY7 A;  3IO1 A;  3QB8 A;  1M1D A;  3EC4 A;  4KLV A;  2CTC A;  2P6E A;  3HUV A;  1EE3 P;  3JTK A;  3T9Y A;  3CDX A;  3H8F A;  2IL4 A;  2PSW A;  2CF4 A;  3D3S A;  4A95 A;  3RBU A;  3BI1 A;  1IU8 A;  3QNV A;  2PIZ A;  2ZEH A;  5LYF A;  1Z8X A;  2Q43 A;  5EBV A;  2ODF A;  5BWA B;  3ZJ0 A;  3RZA A;  4H6Z A;  4MHN A;  5CPA A;  4HNY B;  2NMT A;  2Q4Y A;  4B12 A;  2Z3K A;  4EFD A;  3PB7 X;  3NH4 A;  3PBB A;  1A2Z A;  2ZEP A;  2FVG A;  4C2Y A;  1YGH A;  4CAX A;  4R76 A;  4ONU A;  2Z3M A;  1CM0 A;  2Z3O A;  4JD6 A;  4NGT A;  3PEI A;  1JQG A;  4I49 A;  4CYO A;  4ZGY B;  2VZZ A;  1S7F A;  4E8O A;  4WWV A;  4C2Z A;  3NE7 A;  4Q36 A;  4LQG A;  3EFA A;  2QIR A;  4NGN A;  1TXR A;  2J8N A;  3B35 A;  3FED A;  1KUV A;  2KCW A;  4PXB A;  3R95 A;  3NFZ A;  1QSO A;  2ZW7 A;  4MFQ A;  4C7H A;  1GYT A;  2P6G A;  3IIB A;  3L2N A;  2PRQ A;  4UEF A;  4LX9 A;  3VAR A;  2PCU A;  3CXQ A;  4CYQ A;  2PC1 A;  4ZY2 A;  2IMO A;  3KI9 A;  4OC1 A;  5E96 A;  1KUY A;  1VKC A;  2B58 A;  3SHP A;  2FXF A;  3BHX A;  4NGM A;  4E2A A;  3BXM A;  4CRY B;  4MY0 A;  1Y7R A;  2PIY A;  1IY7 A;  4PSW A;  2BUE A;  3S6H A;  4FD4 A;  2AFS A;  2PJC A;  2ZEF A;  5AG6 A;  2PJ5 A;  2Q7S A;  2G3A A;  3B3C A;  1YRE A;  2HB6 A;  4AXV A;  3G3S A;  2OU2 A;  2PE3 A;  2RC4 A;  3KQZ A;  4KOT A;  4PXC A;  4A2Z A;  1Q7L A;  4R8F A;  3TT2 A;  1F2O A;  2O53 A;  2JEV A;  1XE4 A;  4FD5 A;  1HDU A;  2B5G B;  2OB0 A;  4XPK A;  2XEF A;  3WC7 A;  4KOS A;  4NGQ A;  5JQ4 A;  1NSA A;  1S7L A;  2R1I A;  3CXP A;  4MRI A;  4ONW A;  4MCQ A;  5G20 A;  3D8P A;  4PK3 A;  1XJO A;  2AFW A;  2CXA A;  3DNS A;  5HH1 A;  3V38 A;  4FD7 A;  1K4J A;  1VGY A;  3LWU A;  3P2F A;  4QBJ A;  3FEC A;  1ELM P;  4KSF A;  3KR4 A;  4OC5 A;  3WC5 A;  2R98 A;  5IB9 A;  2D4O A;  4K30 A;  3B8G A;  2Q4V A;  1YW6 A;  2P6F A;  3D7F A;  4P6Y A;  4TWE A;  5AG4 A;  3C26 A;  5KTD A;  3MN8 A;  1HDQ A;  5LRG A;  1WK4 A;  4GXH A;  1SQH A;  1Y7E A;  5KTA A;  1M4L A;  4OP4 A;  4YU9 A;  4UCM A;  4B6Z A;  4CAE A;  3I9S A;  1IGB A;  4UWI A;  2HC9 A;  2R7H A;  1PUA A;  4M6G A;  3FMC A;  5JPH A;  4FAI A;  2F5I A;  1MJA A;  2QVP A;  1N71 A;  2OZU A;  3K2K A;  4CAF A;  3IFE A;  3GKR A;  4KOX A;  2JBK A;  4LQ6 A;  1QSR A;  3N5F A;  1IB1 E;  3KZW A;  5A27 A;  2CNT A;  2FL4 A;  1YQE A;  2OZH A;  2JEW A;  2J8R A;  3TTH A;  2VQY A;  2ZOF A;  4RS2 A;  4A39 A;  1TIQ A;  3DDD A;  2Q4Z A;  1IOF A;  1CJW A;  3PB6 X;  3V7Z A;  4BD9 A;  4P4J A;  4MHP A;  3D68 A;  3IWW A;  2NYQ A;  4A30 A;  4NSQ A;  2B4D A;  3FIX A;  4C2X A;  4MBU A;  2DEA A;  3FJU A;  4XPD B;  3S6K A;  4F9U A;  3EO4 A;  5DWN A;  2ATR A;  2ZEO A;  2ABZ A;  1TKJ A;  4BMH A;  4F0Y A;  5JGF A;  1BPN A;  1LCP A;  3VWE A;  2ZW6 A;  5F49 A;  4NFR A;  3DR6 A;  3D67 A;  1WWZ A;  1CP7 A;  3P2H A;  4Y49 B;  4OME A;  4KVO E;  2C6G A;  2J9A A;  1TKF A;  1OZP A;  3GIU A;  2OH1 A;  1TKH A;  4IAV A;  2GLJ A;  2EVN A;  1XOV A;  1BOB A;  4NGS A;  4PXD A;  4JZ0 A;  5IB0 A;  1YW4 A;  4R57 A;  4JLY A;  1R3N A;  2NSM A;  4CAV A;  5G21 A;  2AFZ A;  2V8D A;  4KOR A;  1S60 A;  5A28 A;  3SI2 A;  3CT9 A;  2YNC C;  1QMU A;  2Y0M A;  4R7M A;  4JJX A;  5G22 A;  2PJB A;  4XPD C;  3MRU A;  2Z3N A;  5LRJ A;  4X8I A;  4MFJ A;  1KWM A;  4KS9 A;  5G1Z A;  2B3U A;  4P4E A;  4ZX8 A;  3ZZI A;  2PDO A;  3MGD A;  2WUU A;  4HNX B;  4MI4 A;  1GHE A;  4Y49 C;  1Y0R A;  3VAT A;  2POK A;  3F0A A;  4CGP A;  3E0K A;  4R87 A;  3TOB A;  1XIX A;  3IC1 A;  2AJ6 A;  3JRU A;  4RUH A;  3TO6 A;  3HLP A;  4F6A A;  3TFY A;  1ZG7 A;  2PJ3 A;  5DS0 A;  4OC3 A;  4II9 A;  3T8W A;  5HMN A;  3PP9 A;  1QQ9 A;  1Q2Y A;  1YME A;  4CYP A;  4OIW A;  1YX0 A;  2G0B A;  3S9M A;  3W91 A;  3D7G A;  1ZLH A;  4MHY A;  2C1C A;  3KAS A;  4A38 A;  2B3V A;  1CX8 A;  2JBJ A;  2EK9 A;  4P4I A;  4CS0 B; 
#chains in the Genus database with same CATH homology
 5K8P A;  1TF8 A;  1DE4 C;  5I4M A;  4NJQ A;  1CG2 A;  6CPA A;  4DJL A;  3WAB A;  1PYT B;  2GU2 A;  3PBE A;  2G9D A;  1OBR A;  5LRK A;  2IJZ A;  1LFW A;  2EWB A;  4ZX9 A;  2PJ1 A;  1ARL A;  1YSJ A;  1VIX A;  1Z2L A;  4X2T A;  2ZEL A;  1XMB A;  1FT7 A;  2O4H A;  4IHM A;  5D29 A;  2RB7 A;  4OKO A;  3NH5 A;  3B3S A;  4ZI6 A;  2ZEG A;  3PRT A;  4PPZ A;  2WZN A;  4OC2 A;  1HEE A;  5LYD A;  4GM5 A;  2IQ6 A;  4P4B A;  3WC6 A;  3VH9 A;  2ZEM A;  4FWU A;  5ELY A;  4UIA A;  4IK2 A;  4MXU A;  3SJF A;  1ZLI A;  2XEJ A;  2QJ8 A;  3B3V A;  2Q51 A;  3PB9 X;  4EME A;  3SJX A;  7CPA A;  1AMP A;  4MMO A;  4O23 A;  3D66 A;  3IJ3 A;  3TX8 A;  1Z8L A;  1XRY A;  4FUU A;  2CIJ A;  1RTQ A;  3FH4 A;  4Z65 A;  4WJB A;  1AYE A;  1CPS A;  4OC4 A;  3S9N A;  4KSI A;  3TC8 A;  1VHE A;  2CTB A;  5K8M A;  1ELL P;  4ZY0 A;  2F8H A;  3BI0 A;  3SI1 A;  4MHZ A;  4YWY A;  3D4U A;  3FVL A;  1R43 A;  2GLF A;  5THW A;  1LAM A;  2PJ4 A;  1ZG9 A;  3IEH A;  2ZOG A;  2C6C A;  4P4D A;  5K8O A;  3H8E A;  8CPA A;  4PXE A;  1YLO A;  3FX6 A;  2QYV A;  4W9Y A;  3DGV A;  1FNO A;  4DYO A;  4MCS A;  1XFO A;  4DUK A;  2ZEN A;  3D7D A;  3B2Y A;  3GLJ A;  4ZY1 A;  3KGQ A;  2OOT A;  3SJG A;  4MCR A;  1CBX A;  2C6P A;  3K9T A;  3B3W A;  2PJA A;  1LAP A;  4OC0 A;  5D8N A;  5JM6 A;  4EWT A;  4P44 A;  4FBE A;  3CPX A;  4P4F A;  1F57 A;  3H8G A;  1LAN A;  5LYI A;  4ZYQ A;  3KQX A;  2PJ9 A;  5HVG A;  1Y0Y A;  1DTD A;  2V77 A;  2XEI A;  4G1P A;  1Z5R A;  4NJR A;  3LMS A;  1CP6 A;  1LOK A;  4MCP A;  4UEZ A;  5LYL A;  3GB0 A;  5HVF A;  2VL1 A;  1F2P A;  5K8N A;  2BCO A;  2EK8 A;  4P10 A;  4TNU A;  4NGP A;  1UWY A;  3I1U A;  2XEG A;  3PB8 X;  4UIB A;  3KHZ A;  5HXD A;  4PQA A;  4NGR A;  2BOA A;  2PJ2 A;  1TF9 A;  1BLL E;  1ARM A;  1XBU A;  3GUX A;  3DLJ A;  2WYR A;  4Q7A A;  2AFX A;  2PVW A;  2RFH A;  4R6T A;  3SJE A;  2V8H A;  2PJ6 A;  2F7V A;  4X3R A;  3PB4 X;  3FEE A;  2AFM A;  2AFU A;  1CPX A;  4CPA A;  5CBM A;  4UEE A;  3SI0 A;  3KR5 A;  2ANP A;  3KHX A;  2PJ7 A;  4P45 A;  2BO9 A;  3B7I A;  3FF3 A;  3WT4 A;  3ISX A;  1BPM A;  2PJ8 A;  2ZEE A;  5J1Q A;  1H8L A;  2GRE A;  4A37 A;  3S9L A;  2V8G A;  3CPA A;  4F8Z A;  5HVH A;  3KL9 A;  4F9V A;  5F09 A;  2V8V A;  1BAV A;  1ZG8 A;  2PVV A;  5JH9 A;  2PJ0 A;  3PFE A;  4JYW A;  3NH8 A;  1PCA A;  4K3N A;  1VHO A;  3RAM A;  4H2K A;  3ISZ A;  4UF4 A;  3B3T A;  4OID A;  2I3C A;  2AFO A;  3D7H A;  4A94 A;  2ZED A;  2OR4 A;  3NA6 A;  3PFO A;  3IO1 A;  2CTC A;  3HUV A;  1EE3 P;  3CDX A;  3H8F A;  2CF4 A;  3RBU A;  3BI1 A;  3QNV A;  2PIZ A;  2ZEH A;  5LYF A;  2Q43 A;  3RZA A;  4MHN A;  5CPA A;  4EFD A;  3PB7 X;  3NH4 A;  3PBB A;  2ZEP A;  2FVG A;  4R76 A;  4NGT A;  3PEI A;  1JQG A;  4WWV A;  4LQG A;  4NGN A;  1TXR A;  3B35 A;  3FED A;  4PXB A;  3NFZ A;  1GYT A;  3IIB A;  3L2N A;  2PRQ A;  4UEF A;  3VAR A;  2PCU A;  4ZY2 A;  2IMO A;  3KI9 A;  4OC1 A;  3BHX A;  4NGM A;  3BXM A;  2PIY A;  1IY7 A;  2AFS A;  2PJC A;  2ZEF A;  2PJ5 A;  3B3C A;  2HB6 A;  4AXV A;  2PE3 A;  3KQZ A;  4PXC A;  1Q7L A;  4R8F A;  1F2O A;  2O53 A;  1HDU A;  2XEF A;  3WC7 A;  4NGQ A;  1NSA A;  4MRI A;  4ONW A;  4MCQ A;  1XJO A;  2AFW A;  3V38 A;  3LWU A;  1VGY A;  3FEC A;  1ELM P;  3KR4 A;  4OC5 A;  3WC5 A;  5IB9 A;  1YW6 A;  3D7F A;  4P6Y A;  4TWE A;  3MN8 A;  1HDQ A;  5LRG A;  1Y7E A;  1M4L A;  4OP4 A;  4YU9 A;  4B6Z A;  1IGB A;  2HC9 A;  3FMC A;  4FAI A;  2QVP A;  3K2K A;  3IFE A;  2JBK A;  3N5F A;  3KZW A;  2JEW A;  2ZOF A;  4A39 A;  3PB6 X;  2Q4Z A;  3V7Z A;  4BD9 A;  4P4J A;  4MHP A;  3D68 A;  3IWW A;  2NYQ A;  2DEA A;  3FJU A;  4F9U A;  2ZEO A;  2ABZ A;  1TKJ A;  5JGF A;  1BPN A;  1LCP A;  4NFR A;  3D67 A;  1CP7 A;  4OME A;  2C6G A;  2J9A A;  1TKF A;  4IAV A;  1TKH A;  2GLJ A;  4NGS A;  4PXD A;  4JZ0 A;  1YW4 A;  1R3N A;  2NSM A;  2AFZ A;  2V8D A;  3SI2 A;  3CT9 A;  4R7M A;  1QMU A;  2PJB A;  3MRU A;  5LRJ A;  4X8I A;  1KWM A;  4P4E A;  4ZX8 A;  3VAT A;  1Y0R A;  2POK A;  3IC1 A;  3JRU A;  4RUH A;  3HLP A;  1ZG7 A;  2PJ3 A;  5DS0 A;  4OC3 A;  3T8W A;  1QQ9 A;  1YME A;  4OIW A;  3S9M A;  3D7G A;  1ZLH A;  4MHY A;  2C1C A;  3KAS A;  4A38 A;  1CX8 A;  2JBJ A;  2EK9 A;  4P4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...