1YW4A

Crystal structure of the succinylglutamate desuccinylase from chromobacterium violaceum, northeast structural genomics target cvr22.
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
331
structure length
319
Chain Sequence
THSPSFLQHALSSSDTRAEWPLPGGLAARWLAPGCVELNGDARGADSVLLSCGVHGNETAPIEVVDGMLTDIAAGQLALNCRLLVMFANLDAIRQGVRYGNYDMNRLFNGAHARHPELPESVRAAELETLAAEFFAGARARKLHYDLHTAIRGSVFEKFAIYPFLHRTHKREQLAWLQRCGIEAVLLHTQPANTFSYFTSQYCEADAFTLELGKARPFGQNDLSRFSGIDGALRGLLSNPQANVPDLDEDKLPLFRAKYDLVKHSFKLNLADSVENFTLLPDGMLIAATGGEERILFPNPAVKPGLRAGIVVEPARLPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Succinylglutamate desuccinylase
publication title Crystal Structure of the Succinylglutamate Desuccinylase from Chromobacterium violaceum, Northeast Structural Genomics Target CvR22.
rcsb
source organism Chromobacterium violaceum
total genus 86
structure length 319
sequence length 331
chains with identical sequence B
ec nomenclature ec 3.5.1.96: Succinylglutamate desuccinylase.
pdb deposition date 2005-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1yw4A00
3GLJA 3ISZA 3B3VA 3NH5A 1F57A 1M4LA 1XMBA 2C6PA 3PB4X 2PVWA 5LYLA 2PJ7A 4MRIA 3D4UA 4OP4A 2Q51A 3BHXA 4IAVA 5JGFA 5D8NA 1UWYA 2O4HA 3BI1A 2ABZA 2I3CA 4P4JA 2C1CA 3QNVA 2XEJA 2G9DA 3KR4A 4ONWA 3PEIA 1VIXA 1QMUA 3D7DA 2C6CA 3D67A 4MCSA 3H8EA 2PE3A 1FT7A 3S9LA 3KZWA 1Z5RA 3HLPA 4WJBA 4MCRA 1ZG9A 1AYEA 2BO9A 3VARA 1PCAA 1BPMA 1HDQA 2GLJA 2PJAA 3PRTA 5K8OA 2DEAA 2AFZA 2OR4A 1ARLA 4IHMA 3SI1A 2PJ2A 5K8MA 3PB6X 1Y7EA 5JH9A 4A37A 3K9TA 3SJFA 2PCUA 2ZEOA 3PB8X 2PJ4A 3S9NA 3FMCA 3B3TA 4OC3A 4P4DA 3V38A 2CTCA 4G1PA 1F2PA 1LAPA 3D7GA 3KR5A 1YW4A 4NGRA 4NJRA 3KQZA 2V8GA 4UEEA 3D7HA 4JZ0A 2VL1A 4A94A 3NH8A 4OMEA 3FJUA 2PJ5A 1XRYA 4CPAA 4TWEA 4UF4A 4UEZA 4NGMA 4DJLA 3SJXA 2FVGA 4A39A 2XEFA 3N5FA 2IMOA 4EFDA 1DE4C 2AFOA 3PFEA 1CBXA 2ZEPA 4ZY2A 3TX8A 4NJQA 2V8DA 5K8PA 3B3SA 4A38A 4JYWA 4PXCA 3FEDA 4X8IA 1LAMA 1Q7LA 4UIBA 3LWUA 1QQ9A 1YMEA 3TC8A 3FVLA 1Y0RA 5LRJA 2C6GA 1XJOA 1HDUA 4MXUA 3B7IA 2V77A 1YW6A 1ZG7A 2EK9A 2NYQA 4X3RA 1PYTB 5LYDA 1NSAA 4OKOA 4X2TA 4P4BA 1TXRA 5LRKA 3BI0A 5IB9A 3KHXA 2PIYA 3SJGA 2WYRA 1TF9A 1VHOA 4NGNA 2JBJA 1JQGA 3CDXA 1DTDA 1HEEA 3B3CA 2PJ8A 2HC9A 4OIDA 1ELLP 3IJ3A 3GB0A 2ZELA 1CPSA 1LCPA 4F9UA 2PJ3A 3S9MA 2V8HA 3RBUA 4NFRA 3FECA 1IY7A 4ZY1A 1R3NA 1Z2LA 3BXMA 3K2KA 1LOKA 2ZEHA 3KI9A 4OC1A 4ZX8A 3MN8A 3KHZA 1CG2A 2F8HA 4P44A 3WC6A 2BCOA 3NA6A 3L2NA 4Q7AA 4FWUA 2RB7A 4W9YA 4K3NA 1BLLE 3CT9A 4F8ZA 3FEEA 1ZLHA 2CIJA 4MHYA 4OC2A 2Q43A 1TKFA 2QJ8A 4WWVA 2JBKA 2RFHA 1XFOA 2GREA 3IIBA 2ZEEA 4PQAA 3RAMA 3JRUA 5DS0A 2QVPA 3WC5A 1XBUA 3PB9X 4IK2A 4PXEA 4DYOA 4R76A 1LFWA 4NGQA 4ZI6A 4FAIA 4OIWA 2PJ9A 3PBEA 5ELYA 1Z8LA 2F7VA 2O53A 4MMOA 4TNUA 3CPXA 4P45A 2AFUA 3LMSA 3KQXA 3PBBA 3WC7A 3D68A 2ZOGA 1GYTA 4B6ZA 5K8NA 2PVVA 5JM6A 4MHPA 4PXBA 3FH4A 2J9AA 2POKA 3DLJA 2ANPA 3B2YA 4O23A 1KWMA 2PRQA 2PJBA 5CBMA 5LRGA 4GM5A 4R6TA 2PJ0A 2IJZA 2ZEFA 4MHNA 3T8WA 4PXDA 3H8FA 4F9VA 4UEFA 3FX6A 3IC1A 5F09A 3SI2A 1TKJA 1YLOA 3CPAA 4FUUA 4DUKA 4OC0A 1BAVA 4Z65A 1ZLIA 2PJ1A 4R8FA 4OC4A 3IEHA 2GU2A 6CPAA 2BOAA 5CPAA 4BD9A 2ZEMA 3MRUA 4AXVA 3IFEA 4P4EA 3HUVA 2ZENA 3ISXA 3KGQA 1Y0YA 5HVFA 2IQ6A 4YU9A 2ZEGA 1F2OA 1ZG8A 1R43A 4ZYQA 2GLFA 2V8VA 4EMEA 3NFZA 2ZOFA 1ELMP 1FNOA 7CPAA 2CTBA 3D66A 1AMPA 1VHEA 3SI0A 4NGTA 4R7MA 4FBEA 1YSJA 1BPNA 1OBRA 2EWBA 4P4IA 2PJ6A 5THWA 3SJEA 3B3WA 1CP6A 2QYVA 3NH4A 1TKHA 1IGBA 2OOTA 3KASA 2JEWA 2WZNA 1H8LA 3WABA 4P4FA 3B35A 1CPXA 1VGYA 4YWYA 4NGPA 5LYFA 2AFMA 5HVHA 3IO1A 2AFWA 1RTQA 2Q4ZA 3H8GA 4EWTA 4NGSA 1ARMA 2HB6A 5HXDA 3VH9A 2CF4A 3FF3A 3PFOA 2NSMA 3RZAA 2AFXA 4P10A 1TF8A 3KL9A 4ZX9A 2PJCA 1EE3P 1LANA 5LYIA 2PIZA 3VATA 3IWWA 5HVGA 4UIAA 4MCQA 5D29A 1CP7A 4RUHA 3D7FA 4OC5A 4PPZA 3PB7X 4MCPA 3DGVA 4KSIA 2AFSA 2XEGA 3V7ZA 5J1QA 1CX8A 2EK8A 4LQGA 2ZEDA 2XEIA 5I4MA 3GUXA 3WT4A 4MHZA 4H2KA 4P6YA 8CPAA 3I1UA 4ZY0A
chains in the Genus database with same CATH superfamily
2Q4VA 1X12A 1SQHA 3GLJA 3LD2A 3G8WA 3ZZIA 2K5TA 3ISZA 3B3VA 3NH5A 1F57A 3PGPA 5EMIA 4KLWA 1M4LA 1XMBA 2C6PA 3GYAA 3H4QA 3PB4X 5EC4A 3QAYA 2PVWA 5F48A 5HH1A 5LYLA 2PJ7A 4MRIA 4R3LA 3A9LA 3D4UA 4OP4A 2Q51A 4BINA 3BHXA 4IAVA 5JGFA 4FD5A 2FT0A 4MFPA 4U5YA 5D8NA 3IGRA 1IOIA 1UWYA 2O4HA 3BI1A 2ABZA 2I3CA 5FVJA 4P4JA 2C1CA 2D4PA 3QNVA 3DSBA 4LUAA 2VEZA 2XEJA 4OAEA 2PDOA 1B87A 2G9DA 3EFAA 3KR4A 4ONWA 4CAXA 4U9ZA 4H6ZA 2Z10A 3QB8A 3PEIA 1VIXA 5DWMA 2FSRA 2OH1A 1QMUA 3D7DA 3OWCA 5JPHA 2C6CA 2JDDA 4MFQA 4C68A 3D67A 4MCSA 3FIXA 3H8EA 2PE3A 1FT7A 4OADA 3S9LA 3TCVA 3KZWA 4IUSA 3IWGA 1Z5RA 3HLPA 2REEA 1BO4A 4NEXA 4OLLA 4MCRA 1ZG9A 2ZPAA 4WJBA 5AG6A 3SXOA 4CS0B 2QIRA 1AYEA 2BO9A 3CXSA 1IYKA 4KOUA 3TO7A 3TT2A 3VARA 1PCAA 1BPMA 5A28A 1HDQA 4J3GA 2GLJA 5HMNA 4XPDC 2PJAA 1J4JA 3PRTA 5C82A 2OZHA 5K8OA 2YGWA 2DEAA 2AFZA 2OR4A 1ARLA 2B5GA 4ORFA 3TFYA 4IHMA 1TIQA 2Z3LA 3SI1A 2PJ2A 2QMLA 1Q2DA 1XF8A 4QB9A 5K8MA 1Z8XA 2FL4A 2P0WA 2R7HA 4IF5A 3PB6X 1Y7EA 5JH9A 2B58A 4A37A 3K9TA 4MHDA 3TO9A 3SJFA 2PCUA 2ZEOA 3PB8X 1QSNA 1U6MA 2PJ4A 2PR1A 2DPTA 3W6SA 3S9NA 3FMCA 3B3TA 4OC3A 4P4DA 4F6AA 3V38A 2CTCA 3PZJA 1P0HA 4G1PA 1F2PA 4I49A 1LAPA 3D7GA 1M4DA 1NE9A 1YW4A 2X7BA 3KR5A 4B13A 2P6FA 4II9A 4NGRA 4NJRA 3KQZA 5I0CA 3EO4A 2G3TA 3IWEA 4HPSA 2V8GA 4Y49C 4UEEA 3D7HA 4JZ0A 4CAVA 1Q2CA 2VL1A 3NH8A 2HV2A 3EXNA 4QUSA 4A94A 4OMEA 4AG9A 3FJUA 2EO8A 1RO5A 4UWIA 2PJ5A 1P4NA 4RN7A 1X10A 3G3SA 1XRYA 4CPAA 4MFLA 4TWEA 2JEVA 4UF4A 4UEZA 4NGMA 4DJLA 2YNDA 2P6EA 4A95A 4PK2A 3S6KA 5ISVA 3SJXA 3F5BA 2FVGA 1ZO0A 3PP9A 3R9EA 4A39A 5H86A 2XEFA 4MFJA 1YX0A 3N5FA 2IMOA 2G3AA 4NCZA 4RI1A 4AVBA 2R1IA 2J8RA 1L0CA 4EFDA 1DE4C 2AFOA 3PFEA 1CBXA 3JTKA 2ZEPA 1QSTA 4ZY2A 3TX8A 4NJQA 2V8DA 1UFHA 5K8PA 2Z3OA 3B3SA 4A38A 2VI7A 4XNHB 2H5MA 1YR0A 4YFJA 5A27A 2KCWA 4JYWA 3F0AA 4PXCA 3FEDA 4X8IA 1LAMA 1Q7LA 2CY2A 4UIBA 3T9YA 1N71A 3RO0A 4E0AA 1I12A 5AG5A 3LWUA 3WR7A 1QQ9A 1YGHA 1YMEA 4X5KA 3TC8A 3FVLA 1M1DA 1MK4A 1Y0RA 2YNEA 4JWPA 4KLVA 5LRJA 2R98A 4KUBA 1IICA 3DNSA 2C6GA 1XJOA 2Q7SA 1HDUA 4MXUA 4CAWA 1IU8A 4QC6A 3R9GA 2J8MA 2VZYA 3B7IA 2V77A 4AVCA 4R57A 1YW6A 2B4DB 2FXFA 5KTCA 4AG7A 1ZG7A 2EK9A 1S60A 2NYQA 3I9SA 4X3RA 4CAEA 1PYTB 5LYDA 4L89A 1IOFA 4MFZA 3V8IA 5KTDA 2B4BA 4C2YA 3B8GA 1NSAA 3BJ8A 4OKOA 4X2TA 4P4BA 1TXRA 5LRKA 3BI0A 4UFVA 4F0XA 5JQ4A 4C7IA 2PSWA 1PU9A 4CGOA 5IB9A 3KHXA 2PIYA 2RC4A 3SJGA 4CRZB 3F8KA 2WYRA 1TF9A 2ZW5A 1VHOA 4NGNA 2Z3PA 4QBJA 1ON0A 2JBJA 1JQGA 4MY0A 3T90A 3CDXA 3H5ZA 4KVOE 3KKWA 2BSWA 1DTDA 1HEEA 3B3CA 2PJ8A 4XPLA 2HC9A 4OIDA 1ELLP 2NMTA 3IJ3A 3R1KA 3GB0A 4HNWB 2Z3NA 4M6HA 2ZELA 1CPSA 1LCPA 4F9UA 2PJ3A 3S9MA 2V8HA 1VKCA 3GKRA 4RS2A 3RBUA 4GS4A 1JWQA 4NFRA 3FECA 2JLMA 1IY7A 2B3UA 1YLEA 1R3NA 1Z2LA 2EUIA 2Z3KA 3BXMA 3I3GA 4LX9A 5H84A 4ZY1A 4KZTA 1NMTA 3K2KA 1QSRA 1LOKA 2ZEHA 4LQ6A 2DXQA 1IIDA 4C2ZA 1CM0A 4KOTA 3KI9A 3SXNA 1RXTA 2B4DA 4OC1A 4ZX8A 3MN8A 3KHZA 1S7LA 5J8CA 1CG2A 2F8HA 2YNCA 4P44A 2PQ8A 3DR8A 3FNCA 3WC6A 2EBJA 2BCOA 2J8NA 5AG7A 2ARHA 2P6GA 4AB7A 3NA6A 4CGLA 3L2NA 4CYPA 2I79A 4Q7AA 3FRMA 1M4IA 4FWUA 2RB7A 3W91A 3TE4A 4W9YA 4K3NA 4PV6A 2JDCA 4A30A 1YVKA 1BLLE 3CT9A 4KSFA 4PSWA 4CRYB 4BBHA 4F8ZA 3FEEA 4K30A 3TOBA 1ZLHA 2CIJA 4MHYA 4OC2A 2Q43A 2CNSA 1TKFA 2O28A 1Y7RA 2QJ8A 4WWVA 2JBKA 5C88A 2RFHA 1XFOA 2GREA 2WSAA 3IIBA 2Q44A 2ZEEA 4PQAA 2ZW7A 4PSXA 5J8FA 1YREA 3BLNA 3D2MA 2F5IA 5G22A 3RAMA 1M4GA 1XE4A 3JRUA 5DS0A 2QVPA 3WC5A 1XBUA 1Q2YA 2PRBA 2FIAA 3PB9X 4IK2A 4PXEA 4A31A 4ONUA 1S3ZA 4DYOA 5AG4A 5IB0A 4R76A 3RYOA 4JLYA 1LFWA 1S5KA 2VBQA 4NGQA 4BMHA 5EBVA 4ZI6A 4FAIA 3TTHA 4UCPA 4XPKA 1CJWA 4JXRA 4OIWA 3EC4A 2PJ9A 3PBEA 5ELYA 4B5OA 1Z8LA 2F7VA 4AVAA 1S7FA 2O53A 4MMOA 4TNUA 1A2ZA 4KOYA 4KSAA 4DNCA 2OZUA 3CPXA 4P45A 2AFUA 4MFKA 1YQEA 3D3SA 1KZFA 3LMSA 3KQXA 3PBBA 3WC7A 2VXKA 2ZOGA 3D68A 4UFXA 4CGMA 4CYQA 1GHEA 1GYTA 1WWZA 1V0CA 4B6ZA 2WPWA 5K8NA 2ATRA 2PVVA 5JM6A 1YVOA 4MHPA 4PXBA 3FH4A 5G1ZA 2J9AA 4UFWA 1QSMA 3R95A 1IB1E 2B3VA 1Z8TA 2OB0A 4YRHA 4A2ZA 2POKA 3DLJA 2ANPA 4B14A 3B2YA 4O23A 1KWMA 2PRQA 2PJBA 3C26A 2OZGA 5CBMA 5LRGA 3N7ZA 4GM5A 1NSLA 4QVTA 3FBUA 4R6TA 3TO6A 5F46A 2Z0ZA 1MJBA 2PJ0A 2IJZA 2ZEFA 1MJ9A 1AUGA 4C7HA 4MHNA 2D4OA 4H6UA 4PXDA 3H8FA 3T8WA 4B5PB 2GIVA 4UEFA 1MJAA 4F9VA 4E2AA 3FYNA 4FD4A 4HNYB 3FX6A 2HQYA 3IC1A 4UA3A 5F09A 4A33A 3SI2A 4R9MA 1TKJA 1YLOA 3S6HA 3CPAA 4FUUA 2G0BA 2ODFA 2WPXA 2R8VA 3DR6A 4DUKA 4OC0A 2PR8A 4XPDB 5F47A 1BAVA 2C27A 4NF1A 1YK3A 1K4JA 4Z65A 3UY5A 1ZLIA 4KOXA 4UCNA 2PJ1A 4XNHC 5DWNA 2PC1A 4R8FA 4OC4A 4F0YA 3IEHA 2CXAA 2AJ6A 4HKFA 2GU2A 4CYNA 4U9YA 1Z4RA 5IV0A 4UWJA 2EVNA 3MGDA 3FB3A 1Z9UA 6CPAA 4M3SA 5G21A 1WK4A 2WUUA 4R3KA 2BOAA 2VZZA 5CPAA 4BD9A 2ZEMA 4JD6A 3MRUA 4AXVA 1OZPA 3W6XA 5G20A 3ZJ0A 3IFEA 4MI4A 5IX3A 3K9UA 4R87A 3VWDA 2IL4A 4Y49B 4JXQA 4P4EA 2YNCC 2ZENA 3HUVA 1M44A 1FY7A 3ISXA 3KGQA 1Y0YA 5HVFA 2Q4YA 4B5PA 2IQ6A 4FD6A 4UCMA 4YU9A 2ZEGA 5BWAB 1B6BA 1VHSA 3GY9A 1F2OA 3CXPA 4Q36A 1ZG8A 3D2PA 1R43A 4ZYQA 4B10A 2GLFA 3CXQA 2V8VA 4EMEA 2OU2A 3NFZA 4PK3A 2ZOFA 1ELMP 3S6GA 1FNOA 2Z3MA 7CPAA 2CTBA 1XEBA 4CYOA 3D66A 1AMPA 1VHEA 2BUEA 4UBRA 2Z11A 1KUVA 3SI0A 4NGTA 4R7MA 2DF5A 2REFA 4CGPA 2AE6A 4FBEA 1Z8WA 1YSJA 3RNZA 3LACA 1BPNA 1XIXA 2ZXVA 1OBRA 2EWBA 4P4IA 3R96A 2PJ6A 5F49A 4KORA 5THWA 4KOSA 1XMTA 4B12A 3SJEA 1XOVA 3IU2A 2ZW4A 1CP6A 2QYVA 3B3WA 1TKHA 3NH4A 4M85A 2CNTA 3E0KA 3CZXA 1I1DA 3LODA 1KUYA 2CNMA 4NSQA 3FXTA 1IGBA 2BEIA 4MY3A 3BJ7A 2OOTA 3KASA 2GFQA 4EVYA 3NE8A 2JEWA 1Y9WA 2A4NA 5E96A 2WZNA 1H8LA 3WABA 3D8PA 4L8AA 4B11A 4E8OA 4P4FA 3B35A 4M6GA 2ZW6A 1CPXA 1VGYA 3R9FA 4YGOA 4YWYA 2FE7A 4NGPA 3IU1A 4M6IA 3TOAA 5LYFA 2VQYA 1Z4EA 2FS5A 2AFMA 4KVME 5HVHA 3IO1A 5CNPA 2AFWA 1RTQA 2Q4ZA 3H8GA 4EWTA 4NGSA 2I00A 1ARMA 2HB6A 4MBUA 5HXDA 4KVXA 3VH9A 5AGEA 1IYLA 2CF4A 3FF3A 3PFOA 2NSMA 3S6FA 2BL1A 3GIUA 2AFXA 3P2FA 3RZAA 4P10A 5GCNA 1TF8A 3KL9A 1Y9KA 2QECA 3NE7A 4ZX9A 2PJCA 1EE3P 4CAFA 4JJXA 1LANA 5LYIA 2PIZA 4KOVA 3VATA 3IWWA 1R57A 5HVGA 4UIAA 4MCQA 5D29A 1BOBA 1CP7A 4RUHA 2DPSA 3EY5A 3VWEA 4KUAA 5KTAA 1S7KA 4KS9A 3D7FA 4Q38A 2GANA 4OC5A 2Q04A 3PB7X 2GE3A 4MCPA 4PPZA 4NXYA 4GXHA 4HNXB 1LRZA 3DGVA 3JVNA 4MJ8A 2Y0MA 4KOWA 1PUAA 2AFSA 2XEGA 3DDDA 4FD7A 4KSIA 4A32A 2HUZA 3V7ZA 4CGNA 5J1QA 3P2HA 2Q0YA 1CX8A 1KUXA 4ZGYB 2EK8A 4H89A 3JUWA 3QAHA 4LQGA 2ZEDA 2XEIA 1S7NA 2FCKA 1QSOA 1I21A 2B5GB 3GUXA 5I4MA 2Q7BA 4ZBGA 3WT4A 4MHZA 4H2KA 4P6YA 3SHPA 3I1UA 4C2XA 2FIWA 4ZY0A 8CPAA
chains in the Genus database with same CATH topology
3GLJA 3ISZA 3B3VA 3NH5A 1F57A 1M4LA 1XMBA 2C6PA 3PB4X 2PVWA 5LYLA 2PJ7A 4MRIA 3D4UA 4OP4A 2Q51A 3BHXA 4IAVA 5JGFA 5D8NA 1UWYA 2O4HA 3BI1A 2ABZA 2I3CA 4P4JA 2C1CA 3QNVA 2XEJA 2G9DA 3KR4A 4ONWA 3PEIA 1VIXA 1QMUA 3D7DA 2C6CA 3D67A 4MCSA 3H8EA 2PE3A 1FT7A 3S9LA 3KZWA 1Z5RA 3HLPA 4WJBA 4MCRA 1ZG9A 1AYEA 2BO9A 3VARA 1PCAA 1BPMA 1HDQA 2GLJA 2PJAA 3PRTA 5K8OA 2DEAA 2AFZA 2OR4A 1ARLA 4IHMA 3SI1A 2PJ2A 5K8MA 3PB6X 1Y7EA 5JH9A 4A37A 3K9TA 3SJFA 2PCUA 2ZEOA 3PB8X 2PJ4A 3S9NA 3FMCA 3B3TA 4OC3A 4P4DA 3V38A 2CTCA 4G1PA 1F2PA 1LAPA 3D7GA 3KR5A 1YW4A 4NGRA 4NJRA 3KQZA 2V8GA 4UEEA 3D7HA 4JZ0A 2VL1A 4A94A 3NH8A 4OMEA 3FJUA 2PJ5A 1XRYA 4CPAA 4TWEA 4UF4A 4UEZA 4NGMA 4DJLA 3SJXA 2FVGA 4A39A 2XEFA 3N5FA 2IMOA 4EFDA 1DE4C 2AFOA 3PFEA 1CBXA 2ZEPA 4ZY2A 3TX8A 4NJQA 2V8DA 5K8PA 3B3SA 4A38A 4JYWA 4PXCA 3FEDA 4X8IA 1LAMA 1Q7LA 4UIBA 3LWUA 1QQ9A 1YMEA 3TC8A 3FVLA 1Y0RA 5LRJA 2C6GA 1XJOA 1HDUA 4MXUA 3B7IA 2V77A 1YW6A 1ZG7A 2EK9A 2NYQA 4X3RA 1PYTB 5LYDA 1NSAA 4OKOA 4X2TA 4P4BA 1TXRA 5LRKA 3BI0A 5IB9A 3KHXA 2PIYA 3SJGA 2WYRA 1TF9A 1VHOA 4NGNA 2JBJA 1JQGA 3CDXA 1DTDA 1HEEA 3B3CA 2PJ8A 2HC9A 4OIDA 1ELLP 3IJ3A 3GB0A 2ZELA 1CPSA 1LCPA 4F9UA 2PJ3A 3S9MA 2V8HA 3RBUA 4NFRA 3FECA 1IY7A 4ZY1A 1R3NA 1Z2LA 3BXMA 3K2KA 1LOKA 2ZEHA 3KI9A 4OC1A 4ZX8A 3MN8A 3KHZA 1CG2A 2F8HA 4P44A 3WC6A 2BCOA 3NA6A 3L2NA 4Q7AA 4FWUA 2RB7A 4W9YA 4K3NA 1BLLE 3CT9A 4F8ZA 3FEEA 1ZLHA 2CIJA 4MHYA 4OC2A 2Q43A 1TKFA 2QJ8A 4WWVA 2JBKA 2RFHA 1XFOA 2GREA 3IIBA 2ZEEA 4PQAA 3RAMA 3JRUA 5DS0A 2QVPA 3WC5A 1XBUA 3PB9X 4IK2A 4PXEA 4DYOA 4R76A 1LFWA 4NGQA 4ZI6A 4FAIA 4OIWA 2PJ9A 3PBEA 5ELYA 1Z8LA 2F7VA 2O53A 4MMOA 4TNUA 3CPXA 4P45A 2AFUA 3LMSA 3KQXA 3PBBA 3WC7A 3D68A 2ZOGA 1GYTA 4B6ZA 5K8NA 2PVVA 5JM6A 4MHPA 4PXBA 3FH4A 2J9AA 2POKA 3DLJA 2ANPA 3B2YA 4O23A 1KWMA 2PRQA 2PJBA 5CBMA 5LRGA 4GM5A 4R6TA 2PJ0A 2IJZA 2ZEFA 4MHNA 3T8WA 4PXDA 3H8FA 4F9VA 4UEFA 3FX6A 3IC1A 5F09A 3SI2A 1TKJA 1YLOA 3CPAA 4FUUA 4DUKA 4OC0A 1BAVA 4Z65A 1ZLIA 2PJ1A 4R8FA 4OC4A 3IEHA 2GU2A 6CPAA 2BOAA 5CPAA 4BD9A 2ZEMA 3MRUA 4AXVA 3IFEA 4P4EA 3HUVA 2ZENA 3ISXA 3KGQA 1Y0YA 5HVFA 2IQ6A 4YU9A 2ZEGA 1F2OA 1ZG8A 1R43A 4ZYQA 2GLFA 2V8VA 4EMEA 3NFZA 2ZOFA 1ELMP 1FNOA 7CPAA 2CTBA 3D66A 1AMPA 1VHEA 3SI0A 4NGTA 4R7MA 4FBEA 1YSJA 1BPNA 1OBRA 2EWBA 4P4IA 2PJ6A 5THWA 3SJEA 3B3WA 1CP6A 2QYVA 3NH4A 1TKHA 1IGBA 2OOTA 3KASA 2JEWA 2WZNA 1H8LA 3WABA 4P4FA 3B35A 1CPXA 1VGYA 4YWYA 4NGPA 5LYFA 2AFMA 5HVHA 3IO1A 2AFWA 1RTQA 2Q4ZA 3H8GA 4EWTA 4NGSA 1ARMA 2HB6A 5HXDA 3VH9A 2CF4A 3FF3A 3PFOA 2NSMA 3RZAA 2AFXA 4P10A 1TF8A 3KL9A 4ZX9A 2PJCA 1EE3P 1LANA 5LYIA 2PIZA 3VATA 3IWWA 5HVGA 4UIAA 4MCQA 5D29A 1CP7A 4RUHA 3D7FA 4OC5A 4PPZA 3PB7X 4MCPA 3DGVA 4KSIA 2AFSA 2XEGA 3V7ZA 5J1QA 1CX8A 2EK8A 4LQGA 2ZEDA 2XEIA 5I4MA 3GUXA 3WT4A 4MHZA 4H2KA 4P6YA 8CPAA 3I1UA 4ZY0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GLJ A;  3ISZ A;  3B3V A;  3NH5 A;  1F57 A;  1M4L A;  1XMB A;  2C6P A;  3PB4 X;  2PVW A;  5LYL A;  2PJ7 A;  4MRI A;  3D4U A;  4OP4 A;  2Q51 A;  3BHX A;  4IAV A;  5JGF A;  5D8N A;  1UWY A;  2O4H A;  3BI1 A;  2ABZ A;  2I3C A;  4P4J A;  2C1C A;  3QNV A;  2XEJ A;  2G9D A;  3KR4 A;  4ONW A;  3PEI A;  1VIX A;  1QMU A;  3D7D A;  2C6C A;  3D67 A;  4MCS A;  3H8E A;  2PE3 A;  1FT7 A;  3S9L A;  3KZW A;  1Z5R A;  3HLP A;  4WJB A;  4MCR A;  1ZG9 A;  1AYE A;  2BO9 A;  3VAR A;  1PCA A;  1BPM A;  1HDQ A;  2GLJ A;  2PJA A;  3PRT A;  5K8O A;  2DEA A;  2AFZ A;  2OR4 A;  1ARL A;  4IHM A;  3SI1 A;  2PJ2 A;  5K8M A;  3PB6 X;  1Y7E A;  5JH9 A;  4A37 A;  3K9T A;  3SJF A;  2PCU A;  2ZEO A;  3PB8 X;  2PJ4 A;  3S9N A;  3FMC A;  3B3T A;  4OC3 A;  4P4D A;  3V38 A;  2CTC A;  4G1P A;  1F2P A;  1LAP A;  3D7G A;  3KR5 A;  1YW4 A;  4NGR A;  4NJR A;  3KQZ A;  2V8G A;  4UEE A;  3D7H A;  4JZ0 A;  2VL1 A;  4A94 A;  3NH8 A;  4OME A;  3FJU A;  2PJ5 A;  1XRY A;  4CPA A;  4TWE A;  4UF4 A;  4UEZ A;  4NGM A;  4DJL A;  3SJX A;  2FVG A;  4A39 A;  2XEF A;  3N5F A;  2IMO A;  4EFD A;  1DE4 C;  2AFO A;  3PFE A;  1CBX A;  2ZEP A;  4ZY2 A;  3TX8 A;  4NJQ A;  2V8D A;  5K8P A;  3B3S A;  4A38 A;  4JYW A;  4PXC A;  3FED A;  4X8I A;  1LAM A;  1Q7L A;  4UIB A;  3LWU A;  1QQ9 A;  1YME A;  3TC8 A;  3FVL A;  1Y0R A;  5LRJ A;  2C6G A;  1XJO A;  1HDU A;  4MXU A;  3B7I A;  2V77 A;  1YW6 A;  1ZG7 A;  2EK9 A;  2NYQ A;  4X3R A;  1PYT B;  5LYD A;  1NSA A;  4OKO A;  4X2T A;  4P4B A;  1TXR A;  5LRK A;  3BI0 A;  5IB9 A;  3KHX A;  2PIY A;  3SJG A;  2WYR A;  1TF9 A;  1VHO A;  4NGN A;  2JBJ A;  1JQG A;  3CDX A;  1DTD A;  1HEE A;  3B3C A;  2PJ8 A;  2HC9 A;  4OID A;  1ELL P;  3IJ3 A;  3GB0 A;  2ZEL A;  1CPS A;  1LCP A;  4F9U A;  2PJ3 A;  3S9M A;  2V8H A;  3RBU A;  4NFR A;  3FEC A;  1IY7 A;  4ZY1 A;  1R3N A;  1Z2L A;  3BXM A;  3K2K A;  1LOK A;  2ZEH A;  3KI9 A;  4OC1 A;  4ZX8 A;  3MN8 A;  3KHZ A;  1CG2 A;  2F8H A;  4P44 A;  3WC6 A;  2BCO A;  3NA6 A;  3L2N A;  4Q7A A;  4FWU A;  2RB7 A;  4W9Y A;  4K3N A;  1BLL E;  3CT9 A;  4F8Z A;  3FEE A;  1ZLH A;  2CIJ A;  4MHY A;  4OC2 A;  2Q43 A;  1TKF A;  2QJ8 A;  4WWV A;  2JBK A;  2RFH A;  1XFO A;  2GRE A;  3IIB A;  2ZEE A;  4PQA A;  3RAM A;  3JRU A;  5DS0 A;  2QVP A;  3WC5 A;  1XBU A;  3PB9 X;  4IK2 A;  4PXE A;  4DYO A;  4R76 A;  1LFW A;  4NGQ A;  4ZI6 A;  4FAI A;  4OIW A;  2PJ9 A;  3PBE A;  5ELY A;  1Z8L A;  2F7V A;  2O53 A;  4MMO A;  4TNU A;  3CPX A;  4P45 A;  2AFU A;  3LMS A;  3KQX A;  3PBB A;  3WC7 A;  3D68 A;  2ZOG A;  1GYT A;  4B6Z A;  5K8N A;  2PVV A;  5JM6 A;  4MHP A;  4PXB A;  3FH4 A;  2J9A A;  2POK A;  3DLJ A;  2ANP A;  3B2Y A;  4O23 A;  1KWM A;  2PRQ A;  2PJB A;  5CBM A;  5LRG A;  4GM5 A;  4R6T A;  2PJ0 A;  2IJZ A;  2ZEF A;  4MHN A;  3T8W A;  4PXD A;  3H8F A;  4F9V A;  4UEF A;  3FX6 A;  3IC1 A;  5F09 A;  3SI2 A;  1TKJ A;  1YLO A;  3CPA A;  4FUU A;  4DUK A;  4OC0 A;  1BAV A;  4Z65 A;  1ZLI A;  2PJ1 A;  4R8F A;  4OC4 A;  3IEH A;  2GU2 A;  6CPA A;  2BOA A;  5CPA A;  4BD9 A;  2ZEM A;  3MRU A;  4AXV A;  3IFE A;  4P4E A;  3HUV A;  2ZEN A;  3ISX A;  3KGQ A;  1Y0Y A;  5HVF A;  2IQ6 A;  4YU9 A;  2ZEG A;  1F2O A;  1ZG8 A;  1R43 A;  4ZYQ A;  2GLF A;  2V8V A;  4EME A;  3NFZ A;  2ZOF A;  1ELM P;  1FNO A;  7CPA A;  2CTB A;  3D66 A;  1AMP A;  1VHE A;  3SI0 A;  4NGT A;  4R7M A;  4FBE A;  1YSJ A;  1BPN A;  1OBR A;  2EWB A;  4P4I A;  2PJ6 A;  5THW A;  3SJE A;  3B3W A;  1CP6 A;  2QYV A;  3NH4 A;  1TKH A;  1IGB A;  2OOT A;  3KAS A;  2JEW A;  2WZN A;  1H8L A;  3WAB A;  4P4F A;  3B35 A;  1CPX A;  1VGY A;  4YWY A;  4NGP A;  5LYF A;  2AFM A;  5HVH A;  3IO1 A;  2AFW A;  1RTQ A;  2Q4Z A;  3H8G A;  4EWT A;  4NGS A;  1ARM A;  2HB6 A;  5HXD A;  3VH9 A;  2CF4 A;  3FF3 A;  3PFO A;  2NSM A;  3RZA A;  2AFX A;  4P10 A;  1TF8 A;  3KL9 A;  4ZX9 A;  2PJC A;  1EE3 P;  1LAN A;  5LYI A;  2PIZ A;  3VAT A;  3IWW A;  5HVG A;  4UIA A;  4MCQ A;  5D29 A;  1CP7 A;  4RUH A;  3D7F A;  4OC5 A;  4PPZ A;  3PB7 X;  4MCP A;  3DGV A;  4KSI A;  2AFS A;  2XEG A;  3V7Z A;  5J1Q A;  1CX8 A;  2EK8 A;  4LQG A;  2ZED A;  2XEI A;  5I4M A;  3GUX A;  3WT4 A;  4MHZ A;  4H2K A;  4P6Y A;  8CPA A;  3I1U A;  4ZY0 A; 
#chains in the Genus database with same CATH topology
 2Q4V A;  1X12 A;  1SQH A;  3GLJ A;  3LD2 A;  3G8W A;  3ZZI A;  2K5T A;  3ISZ A;  3B3V A;  3NH5 A;  1F57 A;  3PGP A;  5EMI A;  4KLW A;  1M4L A;  1XMB A;  2C6P A;  3GYA A;  3H4Q A;  3PB4 X;  5EC4 A;  3QAY A;  2PVW A;  5F48 A;  5HH1 A;  5LYL A;  2PJ7 A;  4MRI A;  4R3L A;  3A9L A;  3D4U A;  4OP4 A;  2Q51 A;  4BIN A;  3BHX A;  4IAV A;  5JGF A;  4FD5 A;  2FT0 A;  4MFP A;  4U5Y A;  5D8N A;  3IGR A;  1IOI A;  1UWY A;  2O4H A;  3BI1 A;  2ABZ A;  2I3C A;  5FVJ A;  4P4J A;  2C1C A;  2D4P A;  3QNV A;  3DSB A;  4LUA A;  2VEZ A;  2XEJ A;  4OAE A;  2PDO A;  1B87 A;  2G9D A;  3EFA A;  3KR4 A;  4ONW A;  4CAX A;  4U9Z A;  4H6Z A;  2Z10 A;  3QB8 A;  3PEI A;  1VIX A;  5DWM A;  2FSR A;  2OH1 A;  1QMU A;  3D7D A;  3OWC A;  5JPH A;  2C6C A;  2JDD A;  4MFQ A;  4C68 A;  3D67 A;  4MCS A;  3FIX A;  3H8E A;  2PE3 A;  1FT7 A;  4OAD A;  3S9L A;  3TCV A;  3KZW A;  4IUS A;  3IWG A;  1Z5R A;  3HLP A;  2REE A;  1BO4 A;  4NEX A;  4OLL A;  4MCR A;  1ZG9 A;  2ZPA A;  4WJB A;  5AG6 A;  3SXO A;  4CS0 B;  2QIR A;  1AYE A;  2BO9 A;  3CXS A;  1IYK A;  4KOU A;  3TO7 A;  3TT2 A;  3VAR A;  1PCA A;  1BPM A;  5A28 A;  1HDQ A;  4J3G A;  2GLJ A;  5HMN A;  4XPD C;  2PJA A;  1J4J A;  3PRT A;  5C82 A;  2OZH A;  5K8O A;  2YGW A;  2DEA A;  2AFZ A;  2OR4 A;  1ARL A;  2B5G A;  4ORF A;  3TFY A;  4IHM A;  1TIQ A;  2Z3L A;  3SI1 A;  2PJ2 A;  2QML A;  1Q2D A;  1XF8 A;  4QB9 A;  5K8M A;  1Z8X A;  2FL4 A;  2P0W A;  2R7H A;  4IF5 A;  3PB6 X;  1Y7E A;  5JH9 A;  2B58 A;  4A37 A;  3K9T A;  4MHD A;  3TO9 A;  3SJF A;  2PCU A;  2ZEO A;  3PB8 X;  1QSN A;  1U6M A;  2PJ4 A;  2PR1 A;  2DPT A;  3W6S A;  3S9N A;  3FMC A;  3B3T A;  4OC3 A;  4P4D A;  4F6A A;  3V38 A;  2CTC A;  3PZJ A;  1P0H A;  4G1P A;  1F2P A;  4I49 A;  1LAP A;  3D7G A;  1M4D A;  1NE9 A;  1YW4 A;  2X7B A;  3KR5 A;  4B13 A;  2P6F A;  4II9 A;  4NGR A;  4NJR A;  3KQZ A;  5I0C A;  3EO4 A;  2G3T A;  3IWE A;  4HPS A;  2V8G A;  4Y49 C;  4UEE A;  3D7H A;  4JZ0 A;  4CAV A;  1Q2C A;  2VL1 A;  3NH8 A;  2HV2 A;  3EXN A;  4QUS A;  4A94 A;  4OME A;  4AG9 A;  3FJU A;  2EO8 A;  1RO5 A;  4UWI A;  2PJ5 A;  1P4N A;  4RN7 A;  1X10 A;  3G3S A;  1XRY A;  4CPA A;  4MFL A;  4TWE A;  2JEV A;  4UF4 A;  4UEZ A;  4NGM A;  4DJL A;  2YND A;  2P6E A;  4A95 A;  4PK2 A;  3S6K A;  5ISV A;  3SJX A;  3F5B A;  2FVG A;  1ZO0 A;  3PP9 A;  3R9E A;  4A39 A;  5H86 A;  2XEF A;  4MFJ A;  1YX0 A;  3N5F A;  2IMO A;  2G3A A;  4NCZ A;  4RI1 A;  4AVB A;  2R1I A;  2J8R A;  1L0C A;  4EFD A;  1DE4 C;  2AFO A;  3PFE A;  1CBX A;  3JTK A;  2ZEP A;  1QST A;  4ZY2 A;  3TX8 A;  4NJQ A;  2V8D A;  1UFH A;  5K8P A;  2Z3O A;  3B3S A;  4A38 A;  2VI7 A;  4XNH B;  2H5M A;  1YR0 A;  4YFJ A;  5A27 A;  2KCW A;  4JYW A;  3F0A A;  4PXC A;  3FED A;  4X8I A;  1LAM A;  1Q7L A;  2CY2 A;  4UIB A;  3T9Y A;  1N71 A;  3RO0 A;  4E0A A;  1I12 A;  5AG5 A;  3LWU A;  3WR7 A;  1QQ9 A;  1YGH A;  1YME A;  4X5K A;  3TC8 A;  3FVL A;  1M1D A;  1MK4 A;  1Y0R A;  2YNE A;  4JWP A;  4KLV A;  5LRJ A;  2R98 A;  4KUB A;  1IIC A;  3DNS A;  2C6G A;  1XJO A;  2Q7S A;  1HDU A;  4MXU A;  4CAW A;  1IU8 A;  4QC6 A;  3R9G A;  2J8M A;  2VZY A;  3B7I A;  2V77 A;  4AVC A;  4R57 A;  1YW6 A;  2B4D B;  2FXF A;  5KTC A;  4AG7 A;  1ZG7 A;  2EK9 A;  1S60 A;  2NYQ A;  3I9S A;  4X3R A;  4CAE A;  1PYT B;  5LYD A;  4L89 A;  1IOF A;  4MFZ A;  3V8I A;  5KTD A;  2B4B A;  4C2Y A;  3B8G A;  1NSA A;  3BJ8 A;  4OKO A;  4X2T A;  4P4B A;  1TXR A;  5LRK A;  3BI0 A;  4UFV A;  4F0X A;  5JQ4 A;  4C7I A;  2PSW A;  1PU9 A;  4CGO A;  5IB9 A;  3KHX A;  2PIY A;  2RC4 A;  3SJG A;  4CRZ B;  3F8K A;  2WYR A;  1TF9 A;  2ZW5 A;  1VHO A;  4NGN A;  2Z3P A;  4QBJ A;  1ON0 A;  2JBJ A;  1JQG A;  4MY0 A;  3T90 A;  3CDX A;  3H5Z A;  4KVO E;  3KKW A;  2BSW A;  1DTD A;  1HEE A;  3B3C A;  2PJ8 A;  4XPL A;  2HC9 A;  4OID A;  1ELL P;  2NMT A;  3IJ3 A;  3R1K A;  3GB0 A;  4HNW B;  2Z3N A;  4M6H A;  2ZEL A;  1CPS A;  1LCP A;  4F9U A;  2PJ3 A;  3S9M A;  2V8H A;  1VKC A;  3GKR A;  4RS2 A;  3RBU A;  4GS4 A;  1JWQ A;  4NFR A;  3FEC A;  2JLM A;  1IY7 A;  2B3U A;  1YLE A;  1R3N A;  1Z2L A;  2EUI A;  2Z3K A;  3BXM A;  3I3G A;  4LX9 A;  5H84 A;  4ZY1 A;  4KZT A;  1NMT A;  3K2K A;  1QSR A;  1LOK A;  2ZEH A;  4LQ6 A;  2DXQ A;  1IID A;  4C2Z A;  1CM0 A;  4KOT A;  3KI9 A;  3SXN A;  1RXT A;  2B4D A;  4OC1 A;  4ZX8 A;  3MN8 A;  3KHZ A;  1S7L A;  5J8C A;  1CG2 A;  2F8H A;  2YNC A;  4P44 A;  2PQ8 A;  3DR8 A;  3FNC A;  3WC6 A;  2EBJ A;  2BCO A;  2J8N A;  5AG7 A;  2ARH A;  2P6G A;  4AB7 A;  3NA6 A;  4CGL A;  3L2N A;  4CYP A;  2I79 A;  4Q7A A;  3FRM A;  1M4I A;  4FWU A;  2RB7 A;  3W91 A;  3TE4 A;  4W9Y A;  4K3N A;  4PV6 A;  2JDC A;  4A30 A;  1YVK A;  1BLL E;  3CT9 A;  4KSF A;  4PSW A;  4CRY B;  4BBH A;  4F8Z A;  3FEE A;  4K30 A;  3TOB A;  1ZLH A;  2CIJ A;  4MHY A;  4OC2 A;  2Q43 A;  2CNS A;  1TKF A;  2O28 A;  1Y7R A;  2QJ8 A;  4WWV A;  2JBK A;  5C88 A;  2RFH A;  1XFO A;  2GRE A;  2WSA A;  3IIB A;  2Q44 A;  2ZEE A;  4PQA A;  2ZW7 A;  4PSX A;  5J8F A;  1YRE A;  3BLN A;  3D2M A;  2F5I A;  5G22 A;  3RAM A;  1M4G A;  1XE4 A;  3JRU A;  5DS0 A;  2QVP A;  3WC5 A;  1XBU A;  1Q2Y A;  2PRB A;  2FIA A;  3PB9 X;  4IK2 A;  4PXE A;  4A31 A;  4ONU A;  1S3Z A;  4DYO A;  5AG4 A;  5IB0 A;  4R76 A;  3RYO A;  4JLY A;  1LFW A;  1S5K A;  2VBQ A;  4NGQ A;  4BMH A;  5EBV A;  4ZI6 A;  4FAI A;  3TTH A;  4UCP A;  4XPK A;  1CJW A;  4JXR A;  4OIW A;  3EC4 A;  2PJ9 A;  3PBE A;  5ELY A;  4B5O A;  1Z8L A;  2F7V A;  4AVA A;  1S7F A;  2O53 A;  4MMO A;  4TNU A;  1A2Z A;  4KOY A;  4KSA A;  4DNC A;  2OZU A;  3CPX A;  4P45 A;  2AFU A;  4MFK A;  1YQE A;  3D3S A;  1KZF A;  3LMS A;  3KQX A;  3PBB A;  3WC7 A;  2VXK A;  2ZOG A;  3D68 A;  4UFX A;  4CGM A;  4CYQ A;  1GHE A;  1GYT A;  1WWZ A;  1V0C A;  4B6Z A;  2WPW A;  5K8N A;  2ATR A;  2PVV A;  5JM6 A;  1YVO A;  4MHP A;  4PXB A;  3FH4 A;  5G1Z A;  2J9A A;  4UFW A;  1QSM A;  3R95 A;  1IB1 E;  2B3V A;  1Z8T A;  2OB0 A;  4YRH A;  4A2Z A;  2POK A;  3DLJ A;  2ANP A;  4B14 A;  3B2Y A;  4O23 A;  1KWM A;  2PRQ A;  2PJB A;  3C26 A;  2OZG A;  5CBM A;  5LRG A;  3N7Z A;  4GM5 A;  1NSL A;  4QVT A;  3FBU A;  4R6T A;  3TO6 A;  5F46 A;  2Z0Z A;  1MJB A;  2PJ0 A;  2IJZ A;  2ZEF A;  1MJ9 A;  1AUG A;  4C7H A;  4MHN A;  2D4O A;  4H6U A;  4PXD A;  3H8F A;  3T8W A;  4B5P B;  2GIV A;  4UEF A;  1MJA A;  4F9V A;  4E2A A;  3FYN A;  4FD4 A;  4HNY B;  3FX6 A;  2HQY A;  3IC1 A;  4UA3 A;  5F09 A;  4A33 A;  3SI2 A;  4R9M A;  1TKJ A;  1YLO A;  3S6H A;  3CPA A;  4FUU A;  2G0B A;  2ODF A;  2WPX A;  2R8V A;  3DR6 A;  4DUK A;  4OC0 A;  2PR8 A;  4XPD B;  5F47 A;  1BAV A;  2C27 A;  4NF1 A;  1YK3 A;  1K4J A;  4Z65 A;  3UY5 A;  1ZLI A;  4KOX A;  4UCN A;  2PJ1 A;  4XNH C;  5DWN A;  2PC1 A;  4R8F A;  4OC4 A;  4F0Y A;  3IEH A;  2CXA A;  2AJ6 A;  4HKF A;  2GU2 A;  4CYN A;  4U9Y A;  1Z4R A;  5IV0 A;  4UWJ A;  2EVN A;  3MGD A;  3FB3 A;  1Z9U A;  6CPA A;  4M3S A;  5G21 A;  1WK4 A;  2WUU A;  4R3K A;  2BOA A;  2VZZ A;  5CPA A;  4BD9 A;  2ZEM A;  4JD6 A;  3MRU A;  4AXV A;  1OZP A;  3W6X A;  5G20 A;  3ZJ0 A;  3IFE A;  4MI4 A;  5IX3 A;  3K9U A;  4R87 A;  3VWD A;  2IL4 A;  4Y49 B;  4JXQ A;  4P4E A;  2YNC C;  2ZEN A;  3HUV A;  1M44 A;  1FY7 A;  3ISX A;  3KGQ A;  1Y0Y A;  5HVF A;  2Q4Y A;  4B5P A;  2IQ6 A;  4FD6 A;  4UCM A;  4YU9 A;  2ZEG A;  5BWA B;  1B6B A;  1VHS A;  3GY9 A;  1F2O A;  3CXP A;  4Q36 A;  1ZG8 A;  3D2P A;  1R43 A;  4ZYQ A;  4B10 A;  2GLF A;  3CXQ A;  2V8V A;  4EME A;  2OU2 A;  3NFZ A;  4PK3 A;  2ZOF A;  1ELM P;  3S6G A;  1FNO A;  2Z3M A;  7CPA A;  2CTB A;  1XEB A;  4CYO A;  3D66 A;  1AMP A;  1VHE A;  2BUE A;  4UBR A;  2Z11 A;  1KUV A;  3SI0 A;  4NGT A;  4R7M A;  2DF5 A;  2REF A;  4CGP A;  2AE6 A;  4FBE A;  1Z8W A;  1YSJ A;  3RNZ A;  3LAC A;  1BPN A;  1XIX A;  2ZXV A;  1OBR A;  2EWB A;  4P4I A;  3R96 A;  2PJ6 A;  5F49 A;  4KOR A;  5THW A;  4KOS A;  1XMT A;  4B12 A;  3SJE A;  1XOV A;  3IU2 A;  2ZW4 A;  1CP6 A;  2QYV A;  3B3W A;  1TKH A;  3NH4 A;  4M85 A;  2CNT A;  3E0K A;  3CZX A;  1I1D A;  3LOD A;  1KUY A;  2CNM A;  4NSQ A;  3FXT A;  1IGB A;  2BEI A;  4MY3 A;  3BJ7 A;  2OOT A;  3KAS A;  2GFQ A;  4EVY A;  3NE8 A;  2JEW A;  1Y9W A;  2A4N A;  5E96 A;  2WZN A;  1H8L A;  3WAB A;  3D8P A;  4L8A A;  4B11 A;  4E8O A;  4P4F A;  3B35 A;  4M6G A;  2ZW6 A;  1CPX A;  1VGY A;  3R9F A;  4YGO A;  4YWY A;  2FE7 A;  4NGP A;  3IU1 A;  4M6I A;  3TOA A;  5LYF A;  2VQY A;  1Z4E A;  2FS5 A;  2AFM A;  4KVM E;  5HVH A;  3IO1 A;  5CNP A;  2AFW A;  1RTQ A;  2Q4Z A;  3H8G A;  4EWT A;  4NGS A;  2I00 A;  1ARM A;  2HB6 A;  4MBU A;  5HXD A;  4KVX A;  3VH9 A;  5AGE A;  1IYL A;  2CF4 A;  3FF3 A;  3PFO A;  2NSM A;  3S6F A;  2BL1 A;  3GIU A;  2AFX A;  3P2F A;  3RZA A;  4P10 A;  5GCN A;  1TF8 A;  3KL9 A;  1Y9K A;  2QEC A;  3NE7 A;  4ZX9 A;  2PJC A;  1EE3 P;  4CAF A;  4JJX A;  1LAN A;  5LYI A;  2PIZ A;  4KOV A;  3VAT A;  3IWW A;  1R57 A;  5HVG A;  4UIA A;  4MCQ A;  5D29 A;  1BOB A;  1CP7 A;  4RUH A;  2DPS A;  3EY5 A;  3VWE A;  4KUA A;  5KTA A;  1S7K A;  4KS9 A;  3D7F A;  4Q38 A;  2GAN A;  4OC5 A;  2Q04 A;  3PB7 X;  2GE3 A;  4MCP A;  4PPZ A;  4NXY A;  4GXH A;  4HNX B;  1LRZ A;  3DGV A;  3JVN A;  4MJ8 A;  2Y0M A;  4KOW A;  1PUA A;  2AFS A;  2XEG A;  3DDD A;  4FD7 A;  4KSI A;  4A32 A;  2HUZ A;  3V7Z A;  4CGN A;  5J1Q A;  3P2H A;  2Q0Y A;  1CX8 A;  1KUX A;  4ZGY B;  2EK8 A;  4H89 A;  3JUW A;  3QAH A;  4LQG A;  2ZED A;  2XEI A;  1S7N A;  2FCK A;  1QSO A;  1I21 A;  2B5G B;  3GUX A;  5I4M A;  2Q7B A;  4ZBG A;  3WT4 A;  4MHZ A;  4H2K A;  4P6Y A;  3SHP A;  3I1U A;  4C2X A;  2FIW A;  4ZY0 A;  8CPA A; 
#chains in the Genus database with same CATH homology
 3GLJ A;  3ISZ A;  3B3V A;  3NH5 A;  1F57 A;  1M4L A;  1XMB A;  2C6P A;  3PB4 X;  2PVW A;  5LYL A;  2PJ7 A;  4MRI A;  3D4U A;  4OP4 A;  2Q51 A;  3BHX A;  4IAV A;  5JGF A;  5D8N A;  1UWY A;  2O4H A;  3BI1 A;  2ABZ A;  2I3C A;  4P4J A;  2C1C A;  3QNV A;  2XEJ A;  2G9D A;  3KR4 A;  4ONW A;  3PEI A;  1VIX A;  1QMU A;  3D7D A;  2C6C A;  3D67 A;  4MCS A;  3H8E A;  2PE3 A;  1FT7 A;  3S9L A;  3KZW A;  1Z5R A;  3HLP A;  4WJB A;  4MCR A;  1ZG9 A;  1AYE A;  2BO9 A;  3VAR A;  1PCA A;  1BPM A;  1HDQ A;  2GLJ A;  2PJA A;  3PRT A;  5K8O A;  2DEA A;  2AFZ A;  2OR4 A;  1ARL A;  4IHM A;  3SI1 A;  2PJ2 A;  5K8M A;  3PB6 X;  1Y7E A;  5JH9 A;  4A37 A;  3K9T A;  3SJF A;  2PCU A;  2ZEO A;  3PB8 X;  2PJ4 A;  3S9N A;  3FMC A;  3B3T A;  4OC3 A;  4P4D A;  3V38 A;  2CTC A;  4G1P A;  1F2P A;  1LAP A;  3D7G A;  3KR5 A;  1YW4 A;  4NGR A;  4NJR A;  3KQZ A;  2V8G A;  4UEE A;  3D7H A;  4JZ0 A;  2VL1 A;  4A94 A;  3NH8 A;  4OME A;  3FJU A;  2PJ5 A;  1XRY A;  4CPA A;  4TWE A;  4UF4 A;  4UEZ A;  4NGM A;  4DJL A;  3SJX A;  2FVG A;  4A39 A;  2XEF A;  3N5F A;  2IMO A;  4EFD A;  1DE4 C;  2AFO A;  3PFE A;  1CBX A;  2ZEP A;  4ZY2 A;  3TX8 A;  4NJQ A;  2V8D A;  5K8P A;  3B3S A;  4A38 A;  4JYW A;  4PXC A;  3FED A;  4X8I A;  1LAM A;  1Q7L A;  4UIB A;  3LWU A;  1QQ9 A;  1YME A;  3TC8 A;  3FVL A;  1Y0R A;  5LRJ A;  2C6G A;  1XJO A;  1HDU A;  4MXU A;  3B7I A;  2V77 A;  1YW6 A;  1ZG7 A;  2EK9 A;  2NYQ A;  4X3R A;  1PYT B;  5LYD A;  1NSA A;  4OKO A;  4X2T A;  4P4B A;  1TXR A;  5LRK A;  3BI0 A;  5IB9 A;  3KHX A;  2PIY A;  3SJG A;  2WYR A;  1TF9 A;  1VHO A;  4NGN A;  2JBJ A;  1JQG A;  3CDX A;  1DTD A;  1HEE A;  3B3C A;  2PJ8 A;  2HC9 A;  4OID A;  1ELL P;  3IJ3 A;  3GB0 A;  2ZEL A;  1CPS A;  1LCP A;  4F9U A;  2PJ3 A;  3S9M A;  2V8H A;  3RBU A;  4NFR A;  3FEC A;  1IY7 A;  4ZY1 A;  1R3N A;  1Z2L A;  3BXM A;  3K2K A;  1LOK A;  2ZEH A;  3KI9 A;  4OC1 A;  4ZX8 A;  3MN8 A;  3KHZ A;  1CG2 A;  2F8H A;  4P44 A;  3WC6 A;  2BCO A;  3NA6 A;  3L2N A;  4Q7A A;  4FWU A;  2RB7 A;  4W9Y A;  4K3N A;  1BLL E;  3CT9 A;  4F8Z A;  3FEE A;  1ZLH A;  2CIJ A;  4MHY A;  4OC2 A;  2Q43 A;  1TKF A;  2QJ8 A;  4WWV A;  2JBK A;  2RFH A;  1XFO A;  2GRE A;  3IIB A;  2ZEE A;  4PQA A;  3RAM A;  3JRU A;  5DS0 A;  2QVP A;  3WC5 A;  1XBU A;  3PB9 X;  4IK2 A;  4PXE A;  4DYO A;  4R76 A;  1LFW A;  4NGQ A;  4ZI6 A;  4FAI A;  4OIW A;  2PJ9 A;  3PBE A;  5ELY A;  1Z8L A;  2F7V A;  2O53 A;  4MMO A;  4TNU A;  3CPX A;  4P45 A;  2AFU A;  3LMS A;  3KQX A;  3PBB A;  3WC7 A;  3D68 A;  2ZOG A;  1GYT A;  4B6Z A;  5K8N A;  2PVV A;  5JM6 A;  4MHP A;  4PXB A;  3FH4 A;  2J9A A;  2POK A;  3DLJ A;  2ANP A;  3B2Y A;  4O23 A;  1KWM A;  2PRQ A;  2PJB A;  5CBM A;  5LRG A;  4GM5 A;  4R6T A;  2PJ0 A;  2IJZ A;  2ZEF A;  4MHN A;  3T8W A;  4PXD A;  3H8F A;  4F9V A;  4UEF A;  3FX6 A;  3IC1 A;  5F09 A;  3SI2 A;  1TKJ A;  1YLO A;  3CPA A;  4FUU A;  4DUK A;  4OC0 A;  1BAV A;  4Z65 A;  1ZLI A;  2PJ1 A;  4R8F A;  4OC4 A;  3IEH A;  2GU2 A;  6CPA A;  2BOA A;  5CPA A;  4BD9 A;  2ZEM A;  3MRU A;  4AXV A;  3IFE A;  4P4E A;  3HUV A;  2ZEN A;  3ISX A;  3KGQ A;  1Y0Y A;  5HVF A;  2IQ6 A;  4YU9 A;  2ZEG A;  1F2O A;  1ZG8 A;  1R43 A;  4ZYQ A;  2GLF A;  2V8V A;  4EME A;  3NFZ A;  2ZOF A;  1ELM P;  1FNO A;  7CPA A;  2CTB A;  3D66 A;  1AMP A;  1VHE A;  3SI0 A;  4NGT A;  4R7M A;  4FBE A;  1YSJ A;  1BPN A;  1OBR A;  2EWB A;  4P4I A;  2PJ6 A;  5THW A;  3SJE A;  3B3W A;  1CP6 A;  2QYV A;  3NH4 A;  1TKH A;  1IGB A;  2OOT A;  3KAS A;  2JEW A;  2WZN A;  1H8L A;  3WAB A;  4P4F A;  3B35 A;  1CPX A;  1VGY A;  4YWY A;  4NGP A;  5LYF A;  2AFM A;  5HVH A;  3IO1 A;  2AFW A;  1RTQ A;  2Q4Z A;  3H8G A;  4EWT A;  4NGS A;  1ARM A;  2HB6 A;  5HXD A;  3VH9 A;  2CF4 A;  3FF3 A;  3PFO A;  2NSM A;  3RZA A;  2AFX A;  4P10 A;  1TF8 A;  3KL9 A;  4ZX9 A;  2PJC A;  1EE3 P;  1LAN A;  5LYI A;  2PIZ A;  3VAT A;  3IWW A;  5HVG A;  4UIA A;  4MCQ A;  5D29 A;  1CP7 A;  4RUH A;  3D7F A;  4OC5 A;  4PPZ A;  3PB7 X;  4MCP A;  3DGV A;  4KSI A;  2AFS A;  2XEG A;  3V7Z A;  5J1Q A;  1CX8 A;  2EK8 A;  4LQG A;  2ZED A;  2XEI A;  5I4M A;  3GUX A;  3WT4 A;  4MHZ A;  4H2K A;  4P6Y A;  8CPA A;  3I1U A;  4ZY0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...