1YW4A

Crystal structure of the succinylglutamate desuccinylase from chromobacterium violaceum, northeast structural genomics target cvr22.
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
331
structure length
319
Chain Sequence
THSPSFLQHALSSSDTRAEWPLPGGLAARWLAPGCVELNGDARGADSVLLSCGVHGNETAPIEVVDGMLTDIAAGQLALNCRLLVMFANLDAIRQGVRYGNYDMNRLFNGAHARHPELPESVRAAELETLAAEFFAGARARKLHYDLHTAIRGSVFEKFAIYPFLHRTHKREQLAWLQRCGIEAVLLHTQPANTFSYFTSQYCEADAFTLELGKARPFGQNDLSRFSGIDGALRGLLSNPQANVPDLDEDKLPLFRAKYDLVKHSFKLNLADSVENFTLLPDGMLIAATGGEERILFPNPAVKPGLRAGIVVEPARLPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Succinylglutamate Desuccinylase from Chromobacterium violaceum, Northeast Structural Genomics Target CvR22.
rcsb
source organism Chromobacterium violaceum
molecule tags Hydrolase
molecule keywords Succinylglutamate desuccinylase
total genus 86
structure length 319
sequence length 331
chains with identical sequence B
ec nomenclature ec 3.5.1.96: Succinylglutamate desuccinylase.
pdb deposition date 2005-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1yw4A00
2ZEHA 2AFSA 3CPAA 2ZOFA 3FMCA 4MHPA 4UF4A 4FAIA 1VGYA 4NJRA 3D7FA 1F2PA 1HDUA 4W9YA 3S9NA 3WC6A 1BLLE 3IC1A 1XRYA 4OC4A 1TF8A 1QQ9A 4UEZA 1KWMA 2XEIA 3NA6A 1LOKA 8CPAA 4P45A 4NGQA 3MRUA 4OC2A 4DJLA 1AYEA 3T8WA 1IGBA 2Q51A 4NFRA 2ZEDA 2OR4A 5LRGA 4ZI6A 4DUKA 3KHXA 2GLJA 4FUUA 3HUVA 2CF4A 4IHMA 3KASA 3IWWA 2PJ7A 3RAMA 3NH5A 4JZ0A 4PXDA 4A37A 4TNUA 1DE4C 4OIWA 4PPZA 1Y7EA 1ARLA 4R76A 3B3TA 1NSAA 1DTDA 3KI9A 1XFOA 3SI1A 3RZAA 1Z5RA 4ZY1A 4P4JA 4MHZA 3DLJA 4P4BA 1VHOA 2ZOGA 2PJBA 2RFHA 4Z65A 2ZEOA 3TX8A 1HDQA 2CTBA 3KR5A 3KZWA 4NGPA 4OKOA 2AFWA 4MCQA 4ZX8A 1CPXA 4P10A 2V8VA 2XEJA 5HVFA 4GM5A 4NGMA 4PXEA 2AFUA 4AXVA 3N5FA 2PE3A 1ARMA 2PJ2A 2JEWA 3FVLA 5HVGA 1Z8LA 1BPMA 2QYVA 3PFEA 4OC0A 4OC1A 4FBEA 1VIXA 2IJZA 1BPNA 3PBEA 4MMOA 4ZYQA 1YSJA 3IJ3A 1GYTA 4F8ZA 4K3NA 3CT9A 4FWUA 1HEEA 2ZEEA 1H8LA 1CP7A 1VHEA 4OMEA 3NH8A 3KGQA 2AFOA 3FH4A 4IAVA 3JRUA 4P4EA 3LMSA 2WYRA 5LYIA 5F09A 4PQAA 1AMPA 4UIAA 2C6PA 3PB9X 3D7HA 4WWVA 4OC3A 1QMUA 3V7ZA 3KQZA 2J9AA 4MHNA 4MCSA 2PJ5A 3FJUA 4JYWA 4CPAA 3VATA 2XEFA 2PJ4A 2CTCA 1TXRA 1OBRA 3PRTA 2GLFA 3IFEA 2BCOA 3KHZA 1CX8A 1EE3P 1CG2A 4P4DA 1RTQA 1XBUA 1XJOA 3SJGA 2V77A 1ZG9A 1CP6A 2V8HA 2NYQA 1YW4A 2PJ6A 4A38A 2AFMA 3WC7A 2PJ8A 3NH4A 2XEGA 4NGNA 4Q7AA 3WABA 5LYFA 4PXBA 4KSIA 2VL1A 2IQ6A 1M4LA 2PJCA 3FEDA 1CPSA 1YLOA 2IMOA 2C6GA 3D4UA 4H2KA 1LCPA 3TC8A 3LWUA 6CPAA 2O4HA 2ZENA 3KR4A 4P4FA 3PEIA 1R3NA 2I3CA 2EK8A 3D7DA 5LYLA 4YU9A 2QVPA 5D8NA 2Q4ZA 2Q43A 1Q7LA 1PYTB 4OC5A 5I4MA 4R7MA 4BD9A 3PB8X 2EK9A 2FVGA 4EWTA 1TKFA 5LYDA 2RB7A 4EFDA 3IIBA 1TKJA 2C6CA 3BHXA 5JGFA 3D68A 4NGSA 3GB0A 3BI0A 1LANA 1LAMA 1R43A 2PIZA 1ZLIA 2HB6A 5JM6A 4X2TA 2AFXA 1ZLHA 4UEEA 5JH9A 1LAPA 4X8IA 3D7GA 4NGRA 2CIJA 4MHYA 3WC5A 3GUXA 3PFOA 1UWYA 1LFWA 1JQGA 5HXDA 3B3VA 3BXMA 3SJFA 3B7IA 3K2KA 4RUHA 4B6ZA 2F7VA 2PJ9A 3SI2A 3B3SA 4F9VA 3PBBA 1PCAA 2PVVA 3RBUA 3S9MA 3H8GA 2WZNA 2ABZA 1TF9A 4UEFA 7CPAA 4TWEA 5K8OA 1ELMP 2PCUA 1Z2LA 2POKA 2ZELA 3KL9A 3IEHA 2PVWA 1XMBA 3V38A 1Y0RA 2PRQA 1IY7A 4DYOA 5CBMA 3SJEA 2AFZA 3GLJA 3FF3A 3QNVA 3FECA 2PJAA 5D29A 5IB9A 2DEAA 3CDXA 4WJBA 3FX6A 4G1PA 3I1UA 2ANPA 3B3CA 3VH9A 3B2YA 2EWBA 1Y0YA 4ZX9A 4P6YA 2OOTA 4IK2A 4OIDA 4A39A 5K8PA 2QJ8A 4A94A 4MCPA 1BAVA 5K8MA 3PB4X 4P4IA 5DS0A 5J1QA 1FNOA 1ELLP 1YW6A 2BOAA 5HVHA 3PB6X 4NGTA 3KQXA 2ZEMA 2ZEFA 2HC9A 1CBXA 1YMEA 2PJ0A 3B35A 2V8DA 4P44A 3IO1A 2G9DA 2ZEGA 2GU2A 1ZG7A 5LRKA 4ONWA 3DGVA 3HLPA 5THWA 3PB7X 2JBKA 5ELYA 3FEEA 4F9UA 1TKHA 5LRJA 3VARA 1F57A 1F2OA 4PXCA 4ZY0A 2ZEPA 2JBJA 4R8FA 2BO9A 4NJQA 2C1CA 3WT4A 4X3RA 3S9LA 4UIBA 2PJ1A 4LQGA 3H8FA 3BI1A 4OP4A 4MXUA 2PJ3A 3D66A 4EMEA 3K9TA 1ZG8A 4R6TA 3D67A 2V8GA 2O53A 3H8EA 2GREA 1FT7A 3B3WA 5CPAA 3SI0A 2PIYA 3CPXA 3ISXA 4O23A 5K8NA 4ZY2A 3NFZA 2NSMA 3L2NA 3MN8A 4MRIA 4YWYA 3ISZA 2F8HA 4MCRA 3SJXA
chains in the Genus database with same CATH superfamily
1YVOA 2ZEHA 2AFSA 2P6GA 3CPAA 3IWEA 5H84A 2ZOFA 3FMCA 4E8OA 4MHPA 4MY3A 4UF4A 4FAIA 4CGNA 1VGYA 3GYAA 4NJRA 3D7FA 1F2PA 1HDUA 4UCNA 4W9YA 5EC4A 4A30A 3S9NA 4JXQA 3FXTA 3WC6A 4FD6A 1S5KA 4CYQA 1XIXA 4CAFA 3DR6A 3P2HA 1BLLE 3R1KA 5ISVA 3IC1A 1XRYA 3CXPA 4PSXA 4OC4A 3FYNA 5KTAA 4UBRA 1TF8A 3MGDA 2AJ6A 1QQ9A 4UEZA 1KWMA 4UFVA 2XEIA 4C7IA 3NA6A 1LOKA 8CPAA 4P45A 3KKWA 3LD2A 4GS4A 2VZYA 3BJ8A 3MRUA 4NGQA 4OC2A 5EMIA 3T90A 1AYEA 2BEIA 3T8WA 4B12A 3H5ZA 4DJLA 1IGBA 2Q51A 4M85A 4NFRA 4KVXA 2Z3MA 2ZEDA 2OR4A 1ZO0A 5LRGA 4ZI6A 4KOVA 4DUKA 2CNMA 3KHXA 2GLJA 2Q7SA 4FUUA 3TTHA 2B4BA 1Q2CA 3HUVA 3VWEA 2CF4A 1IOFA 4IHMA 2VZZA 3KASA 3IWWA 2PJ7A 4AVCA 2VXKA 3EO4A 1YK3A 3RAMA 2Z3OA 1NE9A 2QECA 5F49A 3W6XA 5A27A 3NH5A 4Q38A 4JZ0A 5I0CA 4PXDA 3RO0A 4A37A 2KCWA 4TNUA 4YFJA 3P2FA 4CYNA 1DE4C 3CXQA 4CGLA 3K9UA 4OIWA 4PPZA 1Y7EA 2WSAA 1ARLA 1MJAA 4R76A 3B3TA 1NSAA 4U9ZA 1DTDA 3KI9A 1XFOA 4HPSA 3SI1A 4B5OA 3RZAA 1Z5RA 4ZY1A 4P4JA 5AGEA 2JEVA 2I00A 3E0KA 4MHZA 2QIRA 3DLJA 3R96A 1Z4EA 3W6SA 4C2ZA 4P4BA 1VHOA 3V8IA 4K30A 3S6FA 2ZOGA 2YNDA 1Z8TA 4QB9A 2PJBA 1Z4RA 5F48A 4KZTA 2RFHA 2FT0A 3DDDA 4Z65A 2ZEOA 4A33A 4IUSA 3ZZIA 3TX8A 2VBQA 4LQ6A 1HDQA 1X12A 2CTBA 3KR5A 3KZWA 3C26A 4NGPA 2ZXVA 4OKOA 4B14A 2AFWA 4MCQA 4ZX8A 1PUAA 1CPXA 1I21A 4P10A 4R3LA 4E2AA 5DWNA 2V8VA 2ZPAA 3T9YA 2XEJA 5HVFA 1VHSA 4GM5A 2WPWA 2OU2A 1Y9WA 1UFHA 4KUAA 4NGMA 4PXEA 2AFUA 4AXVA 3N5FA 5AG5A 2PE3A 4CRZB 1S7NA 2D4OA 1ARMA 3RNZA 2PJ2A 2JEWA 3FVLA 1VKCA 4YGOA 2Z3KA 5HVGA 1Z8LA 1IOIA 1BPMA 2QYVA 4RN7A 3PFEA 4OC0A 5KTDA 4OC1A 4FBEA 3D3SA 1VIXA 2IJZA 4ZGYB 4A31A 4QUSA 4MY0A 3SXOA 5G22A 2EUIA 4B10A 2BSWA 1BPNA 1B87A 3SXNA 3PBEA 2PRBA 2B5GB 4MMOA 4ZYQA 1YSJA 3IJ3A 3R9EA 1GYTA 4F8ZA 4U9YA 4K3NA 3CT9A 3FRMA 2FIAA 4FWUA 1NMTA 1HEEA 2PQ8A 1S7LA 2ZEEA 3R95A 3IU2A 1H8LA 5J8FA 1CP7A 1VHEA 4OMEA 3NH8A 2GIVA 2AFOA 3KGQA 3FH4A 4IAVA 3JRUA 4P4EA 3LMSA 2WYRA 5LYIA 3TO9A 1M44A 2Z3NA 5AG6A 5F09A 4PQAA 3EXNA 4AVAA 1AMPA 4UIAA 3OWCA 2C6PA 3PB9X 4X5KA 2J8MA 3D7HA 1Q2DA 2Z0ZA 5GCNA 2VQYA 2F5IA 4WWVA 2CY2A 2DXQA 2J8NA 4OC3A 4OLLA 2JLMA 3FBUA 1QMUA 3V7ZA 2WPXA 4KOSA 3KQZA 2J9AA 2G0BA 4MHNA 1SQHA 4MCSA 2PJ5A 2B5GA 4OAEA 1OZPA 2Z11A 3FJUA 4JYWA 4CPAA 1KUVA 3S6KA 3VATA 4B5PB 2XEFA 2PJ4A 2CTCA 4BBHA 1TXRA 1OBRA 1YREA 3PRTA 4FD7A 3N7ZA 2GLFA 3IFEA 2FE7A 3I3GA 2BCOA 1S7KA 2B3UA 1YX0A 1CX8A 1EE3P 3KHZA 5AG4A 1CG2A 4P4DA 4XNHB 4CGMA 1RTQA 1MJBA 1XBUA 1XJOA 3SJGA 5HH1A 1M4DA 3UY5A 2Q0YA 2G3AA 4H6UA 2V77A 1ZG9A 2PDOA 3TE4A 1Q2YA 2ZW7A 4A95A 1CP6A 1YR0A 2V8HA 3LODA 2NYQA 2OB0A 1YW4A 4LUAA 1YLEA 2PJ6A 2FXFA 2PR8A 4KLWA 4KVME 5AG7A 4A38A 2JDDA 2AFMA 2GANA 2R8VA 3WC7A 2CNSA 1QSMA 2D4PA 2PJ8A 3F0AA 2ZW6A 3NH4A 2RC4A 2XEGA 4NGNA 5C82A 4DNCA 4ONUA 1RO5A 1YGHA 3CZXA 4Q7AA 4QC6A 3WABA 4F6AA 5LYFA 3LACA 4XNHC 4PXBA 5HMNA 4HNXB 4KSIA 4BINA 2VL1A 2IQ6A 3TOBA 1M4LA 4CYOA 2ZW5A 5G1ZA 2PJCA 4M6GA 3FEDA 1TIQA 4EVYA 1CPSA 1YLOA 4F0XA 2IMOA 2C6GA 3D4UA 4H2KA 1LCPA 3TC8A 3ZJ0A 1QSNA 1IICA 1A2ZA 3LWUA 4MFZA 6CPAA 1AUGA 2O4HA 1S3ZA 3WR7A 2PSWA 4KVOE 1QSOA 4MJ8A 3I9SA 2ZENA 4F0YA 1YQEA 2Y0MA 3KR4A 4KOYA 4JWPA 2PR1A 1CJWA 3PEIA 1R3NA 4P4FA 4NF1A 3TOAA 2I3CA 3QAHA 2EK8A 4CAEA 4U5YA 3D7DA 5LYLA 4YU9A 2QVPA 5D8NA 2DF5A 2Q4ZA 2Q43A 1GHEA 1Q7LA 1PYTB 4OC5A 5I4MA 2P6EA 4MFLA 4R7MA 4CGOA 4BD9A 2OZUA 4NXYA 2GFQA 3PB8X 2EK9A 3TT2A 3H4QA 2FVGA 4AG9A 1XEBA 4UFXA 1S7FA 3CXSA 1IU8A 1TKFA 2PC1A 3D8PA 1Y9KA 3JUWA 3TO7A 4EWTA 4BMHA 4FD5A 2HQYA 3PP9A 5LYDA 2AE6A 2RB7A 4EFDA 2YNEA 1RXTA 5A28A 3IIBA 3EFAA 4NCZA 1TKJA 2C6CA 1XE4A 2FS5A 4FD4A 4Q36A 3BHXA 5JGFA 2QMLA 3D68A 3A9LA 4NGSA 3GB0A 3BI0A 1LANA 1LAMA 2NMTA 3B8GA 5E96A 1R43A 2PIZA 1P4NA 1ZLIA 2P6FA 1Y7RA 3QAYA 2HB6A 3IU1A 5JM6A 4AVBA 4R87A 3SHPA 4II9A 1I1DA 4X2TA 2AFXA 1ZLHA 4UEEA 5JH9A 1LAPA 2YGWA 4M6HA 3D7GA 4X8IA 4NEXA 4NGRA 1KZFA 4C2YA 2CIJA 3GKRA 4QVTA 2REFA 4CS0B 4MHYA 1MK4A 4RI1A 3WC5A 3GUXA 1K4JA 3NE8A 4ZBGA 4KSFA 3PFOA 5H86A 4C68A 1UWYA 1LFWA 1JQGA 5HXDA 2DPTA 3B3VA 3BXMA 1V0CA 3IGRA 3S6HA 3SJFA 3B7IA 3K2KA 5DWMA 4IF5A 3PGPA 4RS2A 3JVNA 4RUHA 4B6ZA 2REEA 2F7VA 2IL4A 2PJ9A 4KOTA 3SI2A 3B3SA 4F9VA 3PBBA 1PCAA 2Q4YA 2PVVA 5IB0A 3RBUA 4KS9A 4LX9A 3S9MA 3H8GA 2WZNA 4CYPA 2B4DA 2WUUA 5KTCA 3PZJA 4MFQA 2ABZA 1TF9A 4OADA 4PK3A 4QBJA 4MFPA 4UEFA 2HV2A 7CPAA 4TWEA 4CRYB 5K8OA 2EBJA 1ELMP 4KOXA 2PCUA 4GXHA 4UFWA 1Z2LA 2POKA 3TO6A 2ZELA 1Z8XA 2K5TA 1R57A 2J8RA 3EC4A 3IEHA 3KL9A 2PVWA 4KORA 4R3KA 4HNWB 5F46A 2VI7A 1QSRA 1XMBA 3V38A 2OZHA 3DR8A 2JDCA 4AB7A 1Y0RA 2Z3LA 2PRQA 2G3TA 1M1DA 1IY7A 2ZW4A 3VWDA 4DYOA 2YNCC 4XPKA 5CBMA 3SJEA 2AFZA 3GLJA 3FF3A 2CNTA 1I12A 2I79A 3GY9A 1PU9A 2BUEA 4XPDC 4HKFA 4R57A 2Q44A 4CGPA 2FSRA 3QNVA 4E0AA 3FECA 2PJAA 5D29A 5IB9A 2DEAA 1MJ9A 3DNSA 2B4DB 3CDXA 4WJBA 4JLYA 5JQ4A 4B5PA 3FX6A 5F47A 3TFYA 4UCMA 4CAXA 3D2MA 4G1PA 3NE7A 2C27A 1XMTA 3I1UA 4H89A 1L0CA 4XPLA 4ORFA 2ANPA 2ODFA 3B3CA 3VH9A 4KOWA 4JD6A 3B2YA 2EWBA 4J3GA 1Y0YA 1Z9UA 1KUYA 2VEZA 4Y49C 4P6YA 4ZX9A 2OOTA 5FVJA 4IK2A 4OIDA 5G21A 4HNYB 4A39A 5K8PA 2QJ8A 4A94A 3RYOA 2H5MA 4MCPA 1N71A 1BAVA 5BWAB 5K8MA 2FL4A 3PB4X 4KOUA 4PV6A 2Q7BA 4P4IA 5DS0A 5J1QA 2Q04A 3QB8A 1FNOA 2BL1A 4YRHA 2A4NA 1ELLP 1YW6A 2BOAA 2Z10A 3BJ7A 5HVHA 3PB6X 3FIXA 3IWGA 3TCVA 5IV0A 1IYKA 3W91A 1P0HA 4NGTA 3KQXA 1NSLA 1JWQA 1KUXA 2FCKA 1IIDA 2ZEMA 2GE3A 2EO8A 1U6MA 4L8AA 2OZGA 2HUZA 2ZEFA 1ON0A 2HC9A 1CBXA 1J4JA 1XOVA 4CAVA 4PK2A 1YMEA 5J8CA 2PJ0A 3B35A 2V8DA 3FB3A 4P44A 3IO1A 2G9DA 2ZEGA 2R1IA 3G3SA 1IYLA 2GU2A 2ATRA 3F5BA 1ZG7A 3G8WA 3GIUA 4M6IA 2EVNA 4MI4A 4ONWA 3DGVA 5LRKA 2ARHA 3HLPA 5THWA 3BLNA 4UWJA 4L89A 3PB7X 1M4GA 1X10A 4AG7A 1M4IA 2JBKA 4JXRA 4NSQA 4A2ZA 4Y49B 4UCPA 4B11A 5ELYA 3FEEA 4I49A 5CNPA 4F9UA 1TKHA 5LRJA 4H6ZA 3VARA 1F57A 2DPSA 1F2OA 4PXCA 1S60A 4ZY0A 2ZEPA 3DSBA 3JTKA 2CXAA 2JBJA 4KUBA 4C2XA 4PSWA 4R8FA 2O28A 1XF8A 2BO9A 4NJQA 1CM0A 2YNCA 4CAWA 2C1CA 3WT4A 4X3RA 3S9LA 4UIBA 2PJ1A 4KLVA 4LQGA 2OH1A 4MHDA 2X7BA 3H8FA 3BI1A 3D2PA 4OP4A 4XPDB 1WK4A 4MXUA 2PJ3A 3D66A 2Z3PA 3R9FA 4EMEA 3K9TA 5JPHA 1BO4A 1ZG8A 4R6TA 3D67A 2FIWA 2V8GA 4MFJA 1QSTA 5C88A 4UWIA 1IB1E 2O53A 4M3SA 4R9MA 2B3VA 3S6GA 3H8EA 4MBUA 4A32A 3EY5A 2GREA 1FT7A 3B3WA 5CPAA 5G20A 3SI0A 1FY7A 1YVKA 2PIYA 3F8KA 3FNCA 4B13A 2B58A 2Q4VA 1Z8WA 3CPXA 3ISXA 4MFKA 4O23A 5EBVA 4ZY2A 5IX3A 5K8NA 2P0WA 4JJXA 1WWZA 3NFZA 2R98A 2NSMA 1LRZA 3L2NA 4UA3A 3MN8A 4MRIA 4YWYA 2R7HA 3ISZA 1B6BA 4KSAA 2F8HA 4MCRA 1BOBA 4C7HA 3R9GA 3SJXA
chains in the Genus database with same CATH topology
2ZEHA 2AFSA 3CPAA 2ZOFA 3FMCA 4MHPA 4UF4A 4FAIA 1VGYA 4NJRA 3D7FA 1F2PA 1HDUA 4W9YA 3S9NA 3WC6A 1BLLE 3IC1A 1XRYA 4OC4A 1TF8A 1QQ9A 4UEZA 1KWMA 2XEIA 3NA6A 1LOKA 8CPAA 4P45A 4NGQA 3MRUA 4OC2A 4DJLA 1AYEA 3T8WA 1IGBA 2Q51A 4NFRA 2ZEDA 2OR4A 5LRGA 4ZI6A 4DUKA 3KHXA 2GLJA 4FUUA 3HUVA 2CF4A 4IHMA 3KASA 3IWWA 2PJ7A 3RAMA 3NH5A 4JZ0A 4PXDA 4A37A 4TNUA 1DE4C 4OIWA 4PPZA 1Y7EA 1ARLA 4R76A 3B3TA 1NSAA 1DTDA 3KI9A 1XFOA 3SI1A 3RZAA 1Z5RA 4ZY1A 4P4JA 4MHZA 3DLJA 4P4BA 1VHOA 2ZOGA 2PJBA 2RFHA 4Z65A 2ZEOA 3TX8A 1HDQA 2CTBA 3KR5A 3KZWA 4NGPA 4OKOA 2AFWA 4MCQA 4ZX8A 1CPXA 4P10A 2V8VA 2XEJA 5HVFA 4GM5A 4NGMA 4PXEA 2AFUA 4AXVA 3N5FA 2PE3A 1ARMA 2PJ2A 2JEWA 3FVLA 5HVGA 1Z8LA 1BPMA 2QYVA 3PFEA 4OC0A 4OC1A 4FBEA 1VIXA 2IJZA 1BPNA 3PBEA 4MMOA 4ZYQA 1YSJA 3IJ3A 1GYTA 4F8ZA 4K3NA 3CT9A 4FWUA 1HEEA 2ZEEA 1H8LA 1CP7A 1VHEA 4OMEA 3NH8A 3KGQA 2AFOA 3FH4A 4IAVA 3JRUA 4P4EA 3LMSA 2WYRA 5LYIA 5F09A 4PQAA 1AMPA 4UIAA 2C6PA 3PB9X 3D7HA 4WWVA 4OC3A 1QMUA 3V7ZA 3KQZA 2J9AA 4MHNA 4MCSA 2PJ5A 3FJUA 4JYWA 4CPAA 3VATA 2XEFA 2PJ4A 2CTCA 1TXRA 1OBRA 3PRTA 2GLFA 3IFEA 2BCOA 3KHZA 1CX8A 1EE3P 1CG2A 4P4DA 1RTQA 1XBUA 1XJOA 3SJGA 2V77A 1ZG9A 1CP6A 2V8HA 2NYQA 1YW4A 2PJ6A 4A38A 2AFMA 3WC7A 2PJ8A 3NH4A 2XEGA 4NGNA 4Q7AA 3WABA 5LYFA 4PXBA 4KSIA 2VL1A 2IQ6A 1M4LA 2PJCA 3FEDA 1CPSA 1YLOA 2IMOA 2C6GA 3D4UA 4H2KA 1LCPA 3TC8A 3LWUA 6CPAA 2O4HA 2ZENA 3KR4A 4P4FA 3PEIA 1R3NA 2I3CA 2EK8A 3D7DA 5LYLA 4YU9A 2QVPA 5D8NA 2Q4ZA 2Q43A 1Q7LA 1PYTB 4OC5A 5I4MA 4R7MA 4BD9A 3PB8X 2EK9A 2FVGA 4EWTA 1TKFA 5LYDA 2RB7A 4EFDA 3IIBA 1TKJA 2C6CA 3BHXA 5JGFA 3D68A 4NGSA 3GB0A 3BI0A 1LANA 1LAMA 1R43A 2PIZA 1ZLIA 2HB6A 5JM6A 4X2TA 2AFXA 1ZLHA 4UEEA 5JH9A 1LAPA 4X8IA 3D7GA 4NGRA 2CIJA 4MHYA 3WC5A 3GUXA 3PFOA 1UWYA 1LFWA 1JQGA 5HXDA 3B3VA 3BXMA 3SJFA 3B7IA 3K2KA 4RUHA 4B6ZA 2F7VA 2PJ9A 3SI2A 3B3SA 4F9VA 3PBBA 1PCAA 2PVVA 3RBUA 3S9MA 3H8GA 2WZNA 2ABZA 1TF9A 4UEFA 7CPAA 4TWEA 5K8OA 1ELMP 2PCUA 1Z2LA 2POKA 2ZELA 3KL9A 3IEHA 2PVWA 1XMBA 3V38A 1Y0RA 2PRQA 1IY7A 4DYOA 5CBMA 3SJEA 2AFZA 3GLJA 3FF3A 3QNVA 3FECA 2PJAA 5D29A 5IB9A 2DEAA 3CDXA 4WJBA 3FX6A 4G1PA 3I1UA 2ANPA 3B3CA 3VH9A 3B2YA 2EWBA 1Y0YA 4ZX9A 4P6YA 2OOTA 4IK2A 4OIDA 4A39A 5K8PA 2QJ8A 4A94A 4MCPA 1BAVA 5K8MA 3PB4X 4P4IA 5DS0A 5J1QA 1FNOA 1ELLP 1YW6A 2BOAA 5HVHA 3PB6X 4NGTA 3KQXA 2ZEMA 2ZEFA 2HC9A 1CBXA 1YMEA 2PJ0A 3B35A 2V8DA 4P44A 3IO1A 2G9DA 2ZEGA 2GU2A 1ZG7A 5LRKA 4ONWA 3DGVA 3HLPA 5THWA 3PB7X 2JBKA 5ELYA 3FEEA 4F9UA 1TKHA 5LRJA 3VARA 1F57A 1F2OA 4PXCA 4ZY0A 2ZEPA 2JBJA 4R8FA 2BO9A 4NJQA 2C1CA 3WT4A 4X3RA 3S9LA 4UIBA 2PJ1A 4LQGA 3H8FA 3BI1A 4OP4A 4MXUA 2PJ3A 3D66A 4EMEA 3K9TA 1ZG8A 4R6TA 3D67A 2V8GA 2O53A 3H8EA 2GREA 1FT7A 3B3WA 5CPAA 3SI0A 2PIYA 3CPXA 3ISXA 4O23A 5K8NA 4ZY2A 3NFZA 2NSMA 3L2NA 3MN8A 4MRIA 4YWYA 3ISZA 2F8HA 4MCRA 3SJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZEH A;  2AFS A;  3CPA A;  2ZOF A;  3FMC A;  4MHP A;  4UF4 A;  4FAI A;  1VGY A;  4NJR A;  3D7F A;  1F2P A;  1HDU A;  4W9Y A;  3S9N A;  3WC6 A;  1BLL E;  3IC1 A;  1XRY A;  4OC4 A;  1TF8 A;  1QQ9 A;  4UEZ A;  1KWM A;  2XEI A;  3NA6 A;  1LOK A;  8CPA A;  4P45 A;  4NGQ A;  3MRU A;  4OC2 A;  4DJL A;  1AYE A;  3T8W A;  1IGB A;  2Q51 A;  4NFR A;  2ZED A;  2OR4 A;  5LRG A;  4ZI6 A;  4DUK A;  3KHX A;  2GLJ A;  4FUU A;  3HUV A;  2CF4 A;  4IHM A;  3KAS A;  3IWW A;  2PJ7 A;  3RAM A;  3NH5 A;  4JZ0 A;  4PXD A;  4A37 A;  4TNU A;  1DE4 C;  4OIW A;  4PPZ A;  1Y7E A;  1ARL A;  4R76 A;  3B3T A;  1NSA A;  1DTD A;  3KI9 A;  1XFO A;  3SI1 A;  3RZA A;  1Z5R A;  4ZY1 A;  4P4J A;  4MHZ A;  3DLJ A;  4P4B A;  1VHO A;  2ZOG A;  2PJB A;  2RFH A;  4Z65 A;  2ZEO A;  3TX8 A;  1HDQ A;  2CTB A;  3KR5 A;  3KZW A;  4NGP A;  4OKO A;  2AFW A;  4MCQ A;  4ZX8 A;  1CPX A;  4P10 A;  2V8V A;  2XEJ A;  5HVF A;  4GM5 A;  4NGM A;  4PXE A;  2AFU A;  4AXV A;  3N5F A;  2PE3 A;  1ARM A;  2PJ2 A;  2JEW A;  3FVL A;  5HVG A;  1Z8L A;  1BPM A;  2QYV A;  3PFE A;  4OC0 A;  4OC1 A;  4FBE A;  1VIX A;  2IJZ A;  1BPN A;  3PBE A;  4MMO A;  4ZYQ A;  1YSJ A;  3IJ3 A;  1GYT A;  4F8Z A;  4K3N A;  3CT9 A;  4FWU A;  1HEE A;  2ZEE A;  1H8L A;  1CP7 A;  1VHE A;  4OME A;  3NH8 A;  3KGQ A;  2AFO A;  3FH4 A;  4IAV A;  3JRU A;  4P4E A;  3LMS A;  2WYR A;  5LYI A;  5F09 A;  4PQA A;  1AMP A;  4UIA A;  2C6P A;  3PB9 X;  3D7H A;  4WWV A;  4OC3 A;  1QMU A;  3V7Z A;  3KQZ A;  2J9A A;  4MHN A;  4MCS A;  2PJ5 A;  3FJU A;  4JYW A;  4CPA A;  3VAT A;  2XEF A;  2PJ4 A;  2CTC A;  1TXR A;  1OBR A;  3PRT A;  2GLF A;  3IFE A;  2BCO A;  3KHZ A;  1CX8 A;  1EE3 P;  1CG2 A;  4P4D A;  1RTQ A;  1XBU A;  1XJO A;  3SJG A;  2V77 A;  1ZG9 A;  1CP6 A;  2V8H A;  2NYQ A;  1YW4 A;  2PJ6 A;  4A38 A;  2AFM A;  3WC7 A;  2PJ8 A;  3NH4 A;  2XEG A;  4NGN A;  4Q7A A;  3WAB A;  5LYF A;  4PXB A;  4KSI A;  2VL1 A;  2IQ6 A;  1M4L A;  2PJC A;  3FED A;  1CPS A;  1YLO A;  2IMO A;  2C6G A;  3D4U A;  4H2K A;  1LCP A;  3TC8 A;  3LWU A;  6CPA A;  2O4H A;  2ZEN A;  3KR4 A;  4P4F A;  3PEI A;  1R3N A;  2I3C A;  2EK8 A;  3D7D A;  5LYL A;  4YU9 A;  2QVP A;  5D8N A;  2Q4Z A;  2Q43 A;  1Q7L A;  1PYT B;  4OC5 A;  5I4M A;  4R7M A;  4BD9 A;  3PB8 X;  2EK9 A;  2FVG A;  4EWT A;  1TKF A;  5LYD A;  2RB7 A;  4EFD A;  3IIB A;  1TKJ A;  2C6C A;  3BHX A;  5JGF A;  3D68 A;  4NGS A;  3GB0 A;  3BI0 A;  1LAN A;  1LAM A;  1R43 A;  2PIZ A;  1ZLI A;  2HB6 A;  5JM6 A;  4X2T A;  2AFX A;  1ZLH A;  4UEE A;  5JH9 A;  1LAP A;  4X8I A;  3D7G A;  4NGR A;  2CIJ A;  4MHY A;  3WC5 A;  3GUX A;  3PFO A;  1UWY A;  1LFW A;  1JQG A;  5HXD A;  3B3V A;  3BXM A;  3SJF A;  3B7I A;  3K2K A;  4RUH A;  4B6Z A;  2F7V A;  2PJ9 A;  3SI2 A;  3B3S A;  4F9V A;  3PBB A;  1PCA A;  2PVV A;  3RBU A;  3S9M A;  3H8G A;  2WZN A;  2ABZ A;  1TF9 A;  4UEF A;  7CPA A;  4TWE A;  5K8O A;  1ELM P;  2PCU A;  1Z2L A;  2POK A;  2ZEL A;  3KL9 A;  3IEH A;  2PVW A;  1XMB A;  3V38 A;  1Y0R A;  2PRQ A;  1IY7 A;  4DYO A;  5CBM A;  3SJE A;  2AFZ A;  3GLJ A;  3FF3 A;  3QNV A;  3FEC A;  2PJA A;  5D29 A;  5IB9 A;  2DEA A;  3CDX A;  4WJB A;  3FX6 A;  4G1P A;  3I1U A;  2ANP A;  3B3C A;  3VH9 A;  3B2Y A;  2EWB A;  1Y0Y A;  4ZX9 A;  4P6Y A;  2OOT A;  4IK2 A;  4OID A;  4A39 A;  5K8P A;  2QJ8 A;  4A94 A;  4MCP A;  1BAV A;  5K8M A;  3PB4 X;  4P4I A;  5DS0 A;  5J1Q A;  1FNO A;  1ELL P;  1YW6 A;  2BOA A;  5HVH A;  3PB6 X;  4NGT A;  3KQX A;  2ZEM A;  2ZEF A;  2HC9 A;  1CBX A;  1YME A;  2PJ0 A;  3B35 A;  2V8D A;  4P44 A;  3IO1 A;  2G9D A;  2ZEG A;  2GU2 A;  1ZG7 A;  5LRK A;  4ONW A;  3DGV A;  3HLP A;  5THW A;  3PB7 X;  2JBK A;  5ELY A;  3FEE A;  4F9U A;  1TKH A;  5LRJ A;  3VAR A;  1F57 A;  1F2O A;  4PXC A;  4ZY0 A;  2ZEP A;  2JBJ A;  4R8F A;  2BO9 A;  4NJQ A;  2C1C A;  3WT4 A;  4X3R A;  3S9L A;  4UIB A;  2PJ1 A;  4LQG A;  3H8F A;  3BI1 A;  4OP4 A;  4MXU A;  2PJ3 A;  3D66 A;  4EME A;  3K9T A;  1ZG8 A;  4R6T A;  3D67 A;  2V8G A;  2O53 A;  3H8E A;  2GRE A;  1FT7 A;  3B3W A;  5CPA A;  3SI0 A;  2PIY A;  3CPX A;  3ISX A;  4O23 A;  5K8N A;  4ZY2 A;  3NFZ A;  2NSM A;  3L2N A;  3MN8 A;  4MRI A;  4YWY A;  3ISZ A;  2F8H A;  4MCR A;  3SJX A; 
#chains in the Genus database with same CATH topology
 1YVO A;  2ZEH A;  2AFS A;  2P6G A;  3CPA A;  3IWE A;  5H84 A;  2ZOF A;  3FMC A;  4E8O A;  4MHP A;  4MY3 A;  4UF4 A;  4FAI A;  4CGN A;  1VGY A;  3GYA A;  4NJR A;  3D7F A;  1F2P A;  1HDU A;  4UCN A;  4W9Y A;  5EC4 A;  4A30 A;  3S9N A;  4JXQ A;  3FXT A;  3WC6 A;  4FD6 A;  1S5K A;  4CYQ A;  1XIX A;  4CAF A;  3DR6 A;  3P2H A;  1BLL E;  3R1K A;  5ISV A;  3IC1 A;  1XRY A;  3CXP A;  4PSX A;  4OC4 A;  3FYN A;  5KTA A;  4UBR A;  1TF8 A;  3MGD A;  2AJ6 A;  1QQ9 A;  4UEZ A;  1KWM A;  4UFV A;  2XEI A;  4C7I A;  3NA6 A;  1LOK A;  8CPA A;  4P45 A;  3KKW A;  3LD2 A;  4GS4 A;  2VZY A;  3BJ8 A;  3MRU A;  4NGQ A;  4OC2 A;  5EMI A;  3T90 A;  1AYE A;  2BEI A;  3T8W A;  4B12 A;  3H5Z A;  4DJL A;  1IGB A;  2Q51 A;  4M85 A;  4NFR A;  4KVX A;  2Z3M A;  2ZED A;  2OR4 A;  1ZO0 A;  5LRG A;  4ZI6 A;  4KOV A;  4DUK A;  2CNM A;  3KHX A;  2GLJ A;  2Q7S A;  4FUU A;  3TTH A;  2B4B A;  1Q2C A;  3HUV A;  3VWE A;  2CF4 A;  1IOF A;  4IHM A;  2VZZ A;  3KAS A;  3IWW A;  2PJ7 A;  4AVC A;  2VXK A;  3EO4 A;  1YK3 A;  3RAM A;  2Z3O A;  1NE9 A;  2QEC A;  5F49 A;  3W6X A;  5A27 A;  3NH5 A;  4Q38 A;  4JZ0 A;  5I0C A;  4PXD A;  3RO0 A;  4A37 A;  2KCW A;  4TNU A;  4YFJ A;  3P2F A;  4CYN A;  1DE4 C;  3CXQ A;  4CGL A;  3K9U A;  4OIW A;  4PPZ A;  1Y7E A;  2WSA A;  1ARL A;  1MJA A;  4R76 A;  3B3T A;  1NSA A;  4U9Z A;  1DTD A;  3KI9 A;  1XFO A;  4HPS A;  3SI1 A;  4B5O A;  3RZA A;  1Z5R A;  4ZY1 A;  4P4J A;  5AGE A;  2JEV A;  2I00 A;  3E0K A;  4MHZ A;  2QIR A;  3DLJ A;  3R96 A;  1Z4E A;  3W6S A;  4C2Z A;  4P4B A;  1VHO A;  3V8I A;  4K30 A;  3S6F A;  2ZOG A;  2YND A;  1Z8T A;  4QB9 A;  2PJB A;  1Z4R A;  5F48 A;  4KZT A;  2RFH A;  2FT0 A;  3DDD A;  4Z65 A;  2ZEO A;  4A33 A;  4IUS A;  3ZZI A;  3TX8 A;  2VBQ A;  4LQ6 A;  1HDQ A;  1X12 A;  2CTB A;  3KR5 A;  3KZW A;  3C26 A;  4NGP A;  2ZXV A;  4OKO A;  4B14 A;  2AFW A;  4MCQ A;  4ZX8 A;  1PUA A;  1CPX A;  1I21 A;  4P10 A;  4R3L A;  4E2A A;  5DWN A;  2V8V A;  2ZPA A;  3T9Y A;  2XEJ A;  5HVF A;  1VHS A;  4GM5 A;  2WPW A;  2OU2 A;  1Y9W A;  1UFH A;  4KUA A;  4NGM A;  4PXE A;  2AFU A;  4AXV A;  3N5F A;  5AG5 A;  2PE3 A;  4CRZ B;  1S7N A;  2D4O A;  1ARM A;  3RNZ A;  2PJ2 A;  2JEW A;  3FVL A;  1VKC A;  4YGO A;  2Z3K A;  5HVG A;  1Z8L A;  1IOI A;  1BPM A;  2QYV A;  4RN7 A;  3PFE A;  4OC0 A;  5KTD A;  4OC1 A;  4FBE A;  3D3S A;  1VIX A;  2IJZ A;  4ZGY B;  4A31 A;  4QUS A;  4MY0 A;  3SXO A;  5G22 A;  2EUI A;  4B10 A;  2BSW A;  1BPN A;  1B87 A;  3SXN A;  3PBE A;  2PRB A;  2B5G B;  4MMO A;  4ZYQ A;  1YSJ A;  3IJ3 A;  3R9E A;  1GYT A;  4F8Z A;  4U9Y A;  4K3N A;  3CT9 A;  3FRM A;  2FIA A;  4FWU A;  1NMT A;  1HEE A;  2PQ8 A;  1S7L A;  2ZEE A;  3R95 A;  3IU2 A;  1H8L A;  5J8F A;  1CP7 A;  1VHE A;  4OME A;  3NH8 A;  2GIV A;  2AFO A;  3KGQ A;  3FH4 A;  4IAV A;  3JRU A;  4P4E A;  3LMS A;  2WYR A;  5LYI A;  3TO9 A;  1M44 A;  2Z3N A;  5AG6 A;  5F09 A;  4PQA A;  3EXN A;  4AVA A;  1AMP A;  4UIA A;  3OWC A;  2C6P A;  3PB9 X;  4X5K A;  2J8M A;  3D7H A;  1Q2D A;  2Z0Z A;  5GCN A;  2VQY A;  2F5I A;  4WWV A;  2CY2 A;  2DXQ A;  2J8N A;  4OC3 A;  4OLL A;  2JLM A;  3FBU A;  1QMU A;  3V7Z A;  2WPX A;  4KOS A;  3KQZ A;  2J9A A;  2G0B A;  4MHN A;  1SQH A;  4MCS A;  2PJ5 A;  2B5G A;  4OAE A;  1OZP A;  2Z11 A;  3FJU A;  4JYW A;  4CPA A;  1KUV A;  3S6K A;  3VAT A;  4B5P B;  2XEF A;  2PJ4 A;  2CTC A;  4BBH A;  1TXR A;  1OBR A;  1YRE A;  3PRT A;  4FD7 A;  3N7Z A;  2GLF A;  3IFE A;  2FE7 A;  3I3G A;  2BCO A;  1S7K A;  2B3U A;  1YX0 A;  1CX8 A;  1EE3 P;  3KHZ A;  5AG4 A;  1CG2 A;  4P4D A;  4XNH B;  4CGM A;  1RTQ A;  1MJB A;  1XBU A;  1XJO A;  3SJG A;  5HH1 A;  1M4D A;  3UY5 A;  2Q0Y A;  2G3A A;  4H6U A;  2V77 A;  1ZG9 A;  2PDO A;  3TE4 A;  1Q2Y A;  2ZW7 A;  4A95 A;  1CP6 A;  1YR0 A;  2V8H A;  3LOD A;  2NYQ A;  2OB0 A;  1YW4 A;  4LUA A;  1YLE A;  2PJ6 A;  2FXF A;  2PR8 A;  4KLW A;  4KVM E;  5AG7 A;  4A38 A;  2JDD A;  2AFM A;  2GAN A;  2R8V A;  3WC7 A;  2CNS A;  1QSM A;  2D4P A;  2PJ8 A;  3F0A A;  2ZW6 A;  3NH4 A;  2RC4 A;  2XEG A;  4NGN A;  5C82 A;  4DNC A;  4ONU A;  1RO5 A;  1YGH A;  3CZX A;  4Q7A A;  4QC6 A;  3WAB A;  4F6A A;  5LYF A;  3LAC A;  4XNH C;  4PXB A;  5HMN A;  4HNX B;  4KSI A;  4BIN A;  2VL1 A;  2IQ6 A;  3TOB A;  1M4L A;  4CYO A;  2ZW5 A;  5G1Z A;  2PJC A;  4M6G A;  3FED A;  1TIQ A;  4EVY A;  1CPS A;  1YLO A;  4F0X A;  2IMO A;  2C6G A;  3D4U A;  4H2K A;  1LCP A;  3TC8 A;  3ZJ0 A;  1QSN A;  1IIC A;  1A2Z A;  3LWU A;  4MFZ A;  6CPA A;  1AUG A;  2O4H A;  1S3Z A;  3WR7 A;  2PSW A;  4KVO E;  1QSO A;  4MJ8 A;  3I9S A;  2ZEN A;  4F0Y A;  1YQE A;  2Y0M A;  3KR4 A;  4KOY A;  4JWP A;  2PR1 A;  1CJW A;  3PEI A;  1R3N A;  4P4F A;  4NF1 A;  3TOA A;  2I3C A;  3QAH A;  2EK8 A;  4CAE A;  4U5Y A;  3D7D A;  5LYL A;  4YU9 A;  2QVP A;  5D8N A;  2DF5 A;  2Q4Z A;  2Q43 A;  1GHE A;  1Q7L A;  1PYT B;  4OC5 A;  5I4M A;  2P6E A;  4MFL A;  4R7M A;  4CGO A;  4BD9 A;  2OZU A;  4NXY A;  2GFQ A;  3PB8 X;  2EK9 A;  3TT2 A;  3H4Q A;  2FVG A;  4AG9 A;  1XEB A;  4UFX A;  1S7F A;  3CXS A;  1IU8 A;  1TKF A;  2PC1 A;  3D8P A;  1Y9K A;  3JUW A;  3TO7 A;  4EWT A;  4BMH A;  4FD5 A;  2HQY A;  3PP9 A;  5LYD A;  2AE6 A;  2RB7 A;  4EFD A;  2YNE A;  1RXT A;  5A28 A;  3IIB A;  3EFA A;  4NCZ A;  1TKJ A;  2C6C A;  1XE4 A;  2FS5 A;  4FD4 A;  4Q36 A;  3BHX A;  5JGF A;  2QML A;  3D68 A;  3A9L A;  4NGS A;  3GB0 A;  3BI0 A;  1LAN A;  1LAM A;  2NMT A;  3B8G A;  5E96 A;  1R43 A;  2PIZ A;  1P4N A;  1ZLI A;  2P6F A;  1Y7R A;  3QAY A;  2HB6 A;  3IU1 A;  5JM6 A;  4AVB A;  4R87 A;  3SHP A;  4II9 A;  1I1D A;  4X2T A;  2AFX A;  1ZLH A;  4UEE A;  5JH9 A;  1LAP A;  2YGW A;  4M6H A;  3D7G A;  4X8I A;  4NEX A;  4NGR A;  1KZF A;  4C2Y A;  2CIJ A;  3GKR A;  4QVT A;  2REF A;  4CS0 B;  4MHY A;  1MK4 A;  4RI1 A;  3WC5 A;  3GUX A;  1K4J A;  3NE8 A;  4ZBG A;  4KSF A;  3PFO A;  5H86 A;  4C68 A;  1UWY A;  1LFW A;  1JQG A;  5HXD A;  2DPT A;  3B3V A;  3BXM A;  1V0C A;  3IGR A;  3S6H A;  3SJF A;  3B7I A;  3K2K A;  5DWM A;  4IF5 A;  3PGP A;  4RS2 A;  3JVN A;  4RUH A;  4B6Z A;  2REE A;  2F7V A;  2IL4 A;  2PJ9 A;  4KOT A;  3SI2 A;  3B3S A;  4F9V A;  3PBB A;  1PCA A;  2Q4Y A;  2PVV A;  5IB0 A;  3RBU A;  4KS9 A;  4LX9 A;  3S9M A;  3H8G A;  2WZN A;  4CYP A;  2B4D A;  2WUU A;  5KTC A;  3PZJ A;  4MFQ A;  2ABZ A;  1TF9 A;  4OAD A;  4PK3 A;  4QBJ A;  4MFP A;  4UEF A;  2HV2 A;  7CPA A;  4TWE A;  4CRY B;  5K8O A;  2EBJ A;  1ELM P;  4KOX A;  2PCU A;  4GXH A;  4UFW A;  1Z2L A;  2POK A;  3TO6 A;  2ZEL A;  1Z8X A;  2K5T A;  1R57 A;  2J8R A;  3EC4 A;  3IEH A;  3KL9 A;  2PVW A;  4KOR A;  4R3K A;  4HNW B;  5F46 A;  2VI7 A;  1QSR A;  1XMB A;  3V38 A;  2OZH A;  3DR8 A;  2JDC A;  4AB7 A;  1Y0R A;  2Z3L A;  2PRQ A;  2G3T A;  1M1D A;  1IY7 A;  2ZW4 A;  3VWD A;  4DYO A;  2YNC C;  4XPK A;  5CBM A;  3SJE A;  2AFZ A;  3GLJ A;  3FF3 A;  2CNT A;  1I12 A;  2I79 A;  3GY9 A;  1PU9 A;  2BUE A;  4XPD C;  4HKF A;  4R57 A;  2Q44 A;  4CGP A;  2FSR A;  3QNV A;  4E0A A;  3FEC A;  2PJA A;  5D29 A;  5IB9 A;  2DEA A;  1MJ9 A;  3DNS A;  2B4D B;  3CDX A;  4WJB A;  4JLY A;  5JQ4 A;  4B5P A;  3FX6 A;  5F47 A;  3TFY A;  4UCM A;  4CAX A;  3D2M A;  4G1P A;  3NE7 A;  2C27 A;  1XMT A;  3I1U A;  4H89 A;  1L0C A;  4XPL A;  4ORF A;  2ANP A;  2ODF A;  3B3C A;  3VH9 A;  4KOW A;  4JD6 A;  3B2Y A;  2EWB A;  4J3G A;  1Y0Y A;  1Z9U A;  1KUY A;  2VEZ A;  4Y49 C;  4P6Y A;  4ZX9 A;  2OOT A;  5FVJ A;  4IK2 A;  4OID A;  5G21 A;  4HNY B;  4A39 A;  5K8P A;  2QJ8 A;  4A94 A;  3RYO A;  2H5M A;  4MCP A;  1N71 A;  1BAV A;  5BWA B;  5K8M A;  2FL4 A;  3PB4 X;  4KOU A;  4PV6 A;  2Q7B A;  4P4I A;  5DS0 A;  5J1Q A;  2Q04 A;  3QB8 A;  1FNO A;  2BL1 A;  4YRH A;  2A4N A;  1ELL P;  1YW6 A;  2BOA A;  2Z10 A;  3BJ7 A;  5HVH A;  3PB6 X;  3FIX A;  3IWG A;  3TCV A;  5IV0 A;  1IYK A;  3W91 A;  1P0H A;  4NGT A;  3KQX A;  1NSL A;  1JWQ A;  1KUX A;  2FCK A;  1IID A;  2ZEM A;  2GE3 A;  2EO8 A;  1U6M A;  4L8A A;  2OZG A;  2HUZ A;  2ZEF A;  1ON0 A;  2HC9 A;  1CBX A;  1J4J A;  1XOV A;  4CAV A;  4PK2 A;  1YME A;  5J8C A;  2PJ0 A;  3B35 A;  2V8D A;  3FB3 A;  4P44 A;  3IO1 A;  2G9D A;  2ZEG A;  2R1I A;  3G3S A;  1IYL A;  2GU2 A;  2ATR A;  3F5B A;  1ZG7 A;  3G8W A;  3GIU A;  4M6I A;  2EVN A;  4MI4 A;  4ONW A;  3DGV A;  5LRK A;  2ARH A;  3HLP A;  5THW A;  3BLN A;  4UWJ A;  4L89 A;  3PB7 X;  1M4G A;  1X10 A;  4AG7 A;  1M4I A;  2JBK A;  4JXR A;  4NSQ A;  4A2Z A;  4Y49 B;  4UCP A;  4B11 A;  5ELY A;  3FEE A;  4I49 A;  5CNP A;  4F9U A;  1TKH A;  5LRJ A;  4H6Z A;  3VAR A;  1F57 A;  2DPS A;  1F2O A;  4PXC A;  1S60 A;  4ZY0 A;  2ZEP A;  3DSB A;  3JTK A;  2CXA A;  2JBJ A;  4KUB A;  4C2X A;  4PSW A;  4R8F A;  2O28 A;  1XF8 A;  2BO9 A;  4NJQ A;  1CM0 A;  2YNC A;  4CAW A;  2C1C A;  3WT4 A;  4X3R A;  3S9L A;  4UIB A;  2PJ1 A;  4KLV A;  4LQG A;  2OH1 A;  4MHD A;  2X7B A;  3H8F A;  3BI1 A;  3D2P A;  4OP4 A;  4XPD B;  1WK4 A;  4MXU A;  2PJ3 A;  3D66 A;  2Z3P A;  3R9F A;  4EME A;  3K9T A;  5JPH A;  1BO4 A;  1ZG8 A;  4R6T A;  3D67 A;  2FIW A;  2V8G A;  4MFJ A;  1QST A;  5C88 A;  4UWI A;  1IB1 E;  2O53 A;  4M3S A;  4R9M A;  2B3V A;  3S6G A;  3H8E A;  4MBU A;  4A32 A;  3EY5 A;  2GRE A;  1FT7 A;  3B3W A;  5CPA A;  5G20 A;  3SI0 A;  1FY7 A;  1YVK A;  2PIY A;  3F8K A;  3FNC A;  4B13 A;  2B58 A;  2Q4V A;  1Z8W A;  3CPX A;  3ISX A;  4MFK A;  4O23 A;  5EBV A;  4ZY2 A;  5IX3 A;  5K8N A;  2P0W A;  4JJX A;  1WWZ A;  3NFZ A;  2R98 A;  2NSM A;  1LRZ A;  3L2N A;  4UA3 A;  3MN8 A;  4MRI A;  4YWY A;  2R7H A;  3ISZ A;  1B6B A;  4KSA A;  2F8H A;  4MCR A;  1BOB A;  4C7H A;  3R9G A;  3SJX A; 
#chains in the Genus database with same CATH homology
 2ZEH A;  2AFS A;  3CPA A;  2ZOF A;  3FMC A;  4MHP A;  4UF4 A;  4FAI A;  1VGY A;  4NJR A;  3D7F A;  1F2P A;  1HDU A;  4W9Y A;  3S9N A;  3WC6 A;  1BLL E;  3IC1 A;  1XRY A;  4OC4 A;  1TF8 A;  1QQ9 A;  4UEZ A;  1KWM A;  2XEI A;  3NA6 A;  1LOK A;  8CPA A;  4P45 A;  4NGQ A;  3MRU A;  4OC2 A;  4DJL A;  1AYE A;  3T8W A;  1IGB A;  2Q51 A;  4NFR A;  2ZED A;  2OR4 A;  5LRG A;  4ZI6 A;  4DUK A;  3KHX A;  2GLJ A;  4FUU A;  3HUV A;  2CF4 A;  4IHM A;  3KAS A;  3IWW A;  2PJ7 A;  3RAM A;  3NH5 A;  4JZ0 A;  4PXD A;  4A37 A;  4TNU A;  1DE4 C;  4OIW A;  4PPZ A;  1Y7E A;  1ARL A;  4R76 A;  3B3T A;  1NSA A;  1DTD A;  3KI9 A;  1XFO A;  3SI1 A;  3RZA A;  1Z5R A;  4ZY1 A;  4P4J A;  4MHZ A;  3DLJ A;  4P4B A;  1VHO A;  2ZOG A;  2PJB A;  2RFH A;  4Z65 A;  2ZEO A;  3TX8 A;  1HDQ A;  2CTB A;  3KR5 A;  3KZW A;  4NGP A;  4OKO A;  2AFW A;  4MCQ A;  4ZX8 A;  1CPX A;  4P10 A;  2V8V A;  2XEJ A;  5HVF A;  4GM5 A;  4NGM A;  4PXE A;  2AFU A;  4AXV A;  3N5F A;  2PE3 A;  1ARM A;  2PJ2 A;  2JEW A;  3FVL A;  5HVG A;  1Z8L A;  1BPM A;  2QYV A;  3PFE A;  4OC0 A;  4OC1 A;  4FBE A;  1VIX A;  2IJZ A;  1BPN A;  3PBE A;  4MMO A;  4ZYQ A;  1YSJ A;  3IJ3 A;  1GYT A;  4F8Z A;  4K3N A;  3CT9 A;  4FWU A;  1HEE A;  2ZEE A;  1H8L A;  1CP7 A;  1VHE A;  4OME A;  3NH8 A;  3KGQ A;  2AFO A;  3FH4 A;  4IAV A;  3JRU A;  4P4E A;  3LMS A;  2WYR A;  5LYI A;  5F09 A;  4PQA A;  1AMP A;  4UIA A;  2C6P A;  3PB9 X;  3D7H A;  4WWV A;  4OC3 A;  1QMU A;  3V7Z A;  3KQZ A;  2J9A A;  4MHN A;  4MCS A;  2PJ5 A;  3FJU A;  4JYW A;  4CPA A;  3VAT A;  2XEF A;  2PJ4 A;  2CTC A;  1TXR A;  1OBR A;  3PRT A;  2GLF A;  3IFE A;  2BCO A;  3KHZ A;  1CX8 A;  1EE3 P;  1CG2 A;  4P4D A;  1RTQ A;  1XBU A;  1XJO A;  3SJG A;  2V77 A;  1ZG9 A;  1CP6 A;  2V8H A;  2NYQ A;  1YW4 A;  2PJ6 A;  4A38 A;  2AFM A;  3WC7 A;  2PJ8 A;  3NH4 A;  2XEG A;  4NGN A;  4Q7A A;  3WAB A;  5LYF A;  4PXB A;  4KSI A;  2VL1 A;  2IQ6 A;  1M4L A;  2PJC A;  3FED A;  1CPS A;  1YLO A;  2IMO A;  2C6G A;  3D4U A;  4H2K A;  1LCP A;  3TC8 A;  3LWU A;  6CPA A;  2O4H A;  2ZEN A;  3KR4 A;  4P4F A;  3PEI A;  1R3N A;  2I3C A;  2EK8 A;  3D7D A;  5LYL A;  4YU9 A;  2QVP A;  5D8N A;  2Q4Z A;  2Q43 A;  1Q7L A;  1PYT B;  4OC5 A;  5I4M A;  4R7M A;  4BD9 A;  3PB8 X;  2EK9 A;  2FVG A;  4EWT A;  1TKF A;  5LYD A;  2RB7 A;  4EFD A;  3IIB A;  1TKJ A;  2C6C A;  3BHX A;  5JGF A;  3D68 A;  4NGS A;  3GB0 A;  3BI0 A;  1LAN A;  1LAM A;  1R43 A;  2PIZ A;  1ZLI A;  2HB6 A;  5JM6 A;  4X2T A;  2AFX A;  1ZLH A;  4UEE A;  5JH9 A;  1LAP A;  4X8I A;  3D7G A;  4NGR A;  2CIJ A;  4MHY A;  3WC5 A;  3GUX A;  3PFO A;  1UWY A;  1LFW A;  1JQG A;  5HXD A;  3B3V A;  3BXM A;  3SJF A;  3B7I A;  3K2K A;  4RUH A;  4B6Z A;  2F7V A;  2PJ9 A;  3SI2 A;  3B3S A;  4F9V A;  3PBB A;  1PCA A;  2PVV A;  3RBU A;  3S9M A;  3H8G A;  2WZN A;  2ABZ A;  1TF9 A;  4UEF A;  7CPA A;  4TWE A;  5K8O A;  1ELM P;  2PCU A;  1Z2L A;  2POK A;  2ZEL A;  3KL9 A;  3IEH A;  2PVW A;  1XMB A;  3V38 A;  1Y0R A;  2PRQ A;  1IY7 A;  4DYO A;  5CBM A;  3SJE A;  2AFZ A;  3GLJ A;  3FF3 A;  3QNV A;  3FEC A;  2PJA A;  5D29 A;  5IB9 A;  2DEA A;  3CDX A;  4WJB A;  3FX6 A;  4G1P A;  3I1U A;  2ANP A;  3B3C A;  3VH9 A;  3B2Y A;  2EWB A;  1Y0Y A;  4ZX9 A;  4P6Y A;  2OOT A;  4IK2 A;  4OID A;  4A39 A;  5K8P A;  2QJ8 A;  4A94 A;  4MCP A;  1BAV A;  5K8M A;  3PB4 X;  4P4I A;  5DS0 A;  5J1Q A;  1FNO A;  1ELL P;  1YW6 A;  2BOA A;  5HVH A;  3PB6 X;  4NGT A;  3KQX A;  2ZEM A;  2ZEF A;  2HC9 A;  1CBX A;  1YME A;  2PJ0 A;  3B35 A;  2V8D A;  4P44 A;  3IO1 A;  2G9D A;  2ZEG A;  2GU2 A;  1ZG7 A;  5LRK A;  4ONW A;  3DGV A;  3HLP A;  5THW A;  3PB7 X;  2JBK A;  5ELY A;  3FEE A;  4F9U A;  1TKH A;  5LRJ A;  3VAR A;  1F57 A;  1F2O A;  4PXC A;  4ZY0 A;  2ZEP A;  2JBJ A;  4R8F A;  2BO9 A;  4NJQ A;  2C1C A;  3WT4 A;  4X3R A;  3S9L A;  4UIB A;  2PJ1 A;  4LQG A;  3H8F A;  3BI1 A;  4OP4 A;  4MXU A;  2PJ3 A;  3D66 A;  4EME A;  3K9T A;  1ZG8 A;  4R6T A;  3D67 A;  2V8G A;  2O53 A;  3H8E A;  2GRE A;  1FT7 A;  3B3W A;  5CPA A;  3SI0 A;  2PIY A;  3CPX A;  3ISX A;  4O23 A;  5K8N A;  4ZY2 A;  3NFZ A;  2NSM A;  3L2N A;  3MN8 A;  4MRI A;  4YWY A;  3ISZ A;  2F8H A;  4MCR A;  3SJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...