4OADA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with chloramphenicol
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
160
structure length
160
Chain Sequence
HMQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a GNAT superfamily acetyltransferase PA4794 in complex with chloramphenicol
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
molecule keywords GNAT superfamily acetyltransferase PA4794
total genus 44
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2014-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4oadA00
1Q2CA 1OZPA 4M3SA 5HMNA 3S6HA 4CAVA 3G3SA 2Y0MA 4JJXA 4E2AA 4JD6A 3EY5A 1YVKA 2VXKA 3TE4A 2P6EA 2B4DA 4B5PA 4ZBGA 4KUAA 4PSXA 3R1KA 1M4IA 2R8VA 1CJWA 2VZYA 2BEIA 2FSRA 2ARHA 1B87A 2VQYA 4RI1A 5I0CA 2OU2A 4R3KA 2FL4A 3W6XA 4GS4A 2FXFA 3R9FA 2CNMA 1R57A 3P2HA 4KVME 2REFA 3DDDA 3S6FA 1BOBA 2OZHA 3FBUA 1RO5A 5GCNA 4R87A 4KOWA 1S7KA 2JLMA 2Z10A 3GY9A 5KTAA 3SHPA 5F49A 2ZW7A 4KVXA 4NXYA 4YRHA 2EUIA 5F46A 2JDDA 2R98A 5JQ4A 4H89A 2G3AA 3N7ZA 2PDOA 3R9GA 2WPWA 2P6FA 2VBQA 3JVNA 3D8PA 4PK2A 2J8MA 3SXNA 2AJ6A 2G0BA 2ZPAA 4U5YA 2O28A 1UFHA 5J8FA 1M1DA 5IV0A 3C26A 4MJ8A 4AG9A 4X5KA 4KLWA 2CY2A 2GANA 3VWEA 4YGOA 3T9YA 3V8IA 2J8NA 1SQHA 3DR8A 1PUAA 2AE6A 4MY3A 5E96A 1QSTA 3CXPA 2B58A 2OB0A 1KUXA 3G8WA 2PQ8A 4UBRA 3QB8A 4AVCA 4FD4A 1LRZA 4OAEA 3TTHA 4HNXB 2PSWA 4E8OA 2Q44A 2GIVA 2NMTA 4UWIA 4PV6A 3QAHA 4AB7A 2VI7A 1Q2YA 1J4JA 1XMTA 4KOXA 1S3ZA 2B4DB 4II9A 3TO6A 5HH1A 3PP9A 1IYLA 4KUBA 1M4DA 2H5MA 3BLNA 4FD6A 1S7FA 4MY0A 2I00A 2CNTA 2DXQA 4CRYB 2KCWA 4XPLA 5EBVA 1MJAA 1Z4RA 3F0AA 4LUAA 4ORFA 3EC4A 1YREA 3H4QA 2PC1A 2JDCA 4AG7A 4KOYA 3R96A 4F6AA 3UY5A 3FYNA 4L89A 4B5OA 2I79A 4QVTA 1XF8A 2Q7BA 3DSBA 3PGPA 2B5GA 3MGDA 1B6BA 4YFJA 2HUZA 4XPKA 3K9UA 4QC6A 1Y7RA 5FVJA 3NE7A 1Y9WA 4JXQA 4Y49C 3F8KA 2BSWA 5H86A 5JPHA 1V0CA 4PK3A 2RC4A 3TT2A 5F48A 3DNSA 1Y9KA 4OLLA 3VWDA 4CAWA 3CXQA 2OZGA 3LODA 4BMHA 2BUEA 2K5TA 4I49A 2Q04A 2ZW6A 3TOAA 3EXNA 2FIWA 4AVBA 4E0AA 3D2PA 1K4JA 1QSNA 4M85A 4R3LA 3FNCA 3EFAA 4NCZA 3R9EA 4XPDB 4NF1A 3E0KA 4KORA 1S60A 1WWZA 5EC4A 4F0YA 3TCVA 3D2MA 5DWNA 2VZZA 2Z0ZA 1IICA 2ZXVA 3T90A 2HQYA 1I12A 2X7BA 1IB1E 1NSLA 1IIDA 3B8GA 3F5BA 1QSMA 1N71A 3JUWA 1GHEA 1YK3A 2OZUA 1PU9A 1VKCA 4U9ZA 2QIRA 4QBJA 1BO4A 5C88A 4KOUA 1KUVA 2R7HA 2ATRA 5DWMA 4KOTA 3LD2A 4UA3A 4AVAA 1TIQA 3TOBA 1YR0A 3IGRA 1XE4A 4CAXA 4MHDA 1QSOA 2FIAA 3ZZIA 3TO7A 1I21A 2FS5A 3I9SA 4JWPA 4QUSA 1NE9A 3OWCA 2Q4YA 1IYKA 2G3TA 4FD7A 2PR1A 2BL1A 4DNCA 4Y49B 2A4NA 4CRZB 4EVYA 2B5GB 5F47A 2ZW5A 2J8RA 4R9MA 1KUYA 1MJ9A 4KOVA 1CM0A 2QECA 4J3GA 2C27A 2WPXA 2HV2A 3I3GA 2EVNA 3GYAA 2FCKA 2P0WA 1Z9UA 2IL4A 2R1IA 1YVOA 2PRBA 3FXTA 3PZJA 1P4NA 1I1DA 3DR6A 1VHSA 4ONUA 5KTCA 4PSWA 2Z11A 4XNHB 3KKWA 1NMTA 4XPDC 2QMLA 1S5KA 2FT0A 4IF5A 4B5PB 5C82A 1FY7A 2D4OA 1XEBA 1MJBA 1YLEA 2Q0YA 4MI4A 4XNHC 3D3SA 3CXSA 3P2FA 4NEXA 5J8CA 3SXOA 3W91A 4K30A 1WK4A 4KZTA 1YX0A 1U6MA 2B4BA 1YGHA 1Q2DA 2OH1A 2B3UA 3IWGA 4JXRA 4KLVA 3R95A 3W6SA 4UWJA 4KVOE 2PR8A 3S6KA 4H6UA 2Q4VA 5H84A 4HNYB 1M4GA 5IX3A 3BJ8A 1L0CA 2D4PA 2B3VA 2REEA 1P0HA 4FD5A 2P6GA 4LX9A 3TO9A 2CNSA 4QB9A 1Z4EA 1XIXA 1MK4A 1RXTA 3TFYA 4JLYA 4HKFA 4KOSA 4U9YA 1ON0A 4IUSA 5IB0A 3EO4A 4HNWB 2F5IA 3GKRA 1KZFA 1QSRA 4MBUA 2FE7A 3FB3A 5KTDA 3FRMA 3FIXA 4RS2A 5CNPA 5ISVA 4NSQA 2ZW4A 1S7LA 1M44A 4H6ZA 4CS0B 3S6GA 3ZJ0A 1S7NA 2JEVA 2GE3A 2VEZA 3WR7A 3BJ7A 4R57A 3RYOA 4OADA 4L8AA
chains in the Genus database with same CATH superfamily
1Q2CA 2V8VA 5AG6A 5K8MA 1OZPA 4M3SA 1BLLE 5HMNA 3PFOA 3S6HA 4CAVA 3G3SA 4PXDA 3PFEA 2Y0MA 3D7DA 4JJXA 4E2AA 4MHYA 4C7HA 4NJQA 4A94A 4CPAA 4JD6A 4OP4A 4P44A 4M6GA 1ZG9A 3EY5A 1YVKA 2VXKA 3TE4A 2P6EA 3S9LA 1HDQA 2B4DA 3GB0A 4ZBGA 4KUAA 4B5PA 4WWVA 3SI0A 3NH4A 4OC5A 4F8ZA 4PSXA 4PXBA 2C6PA 3KR4A 5AG7A 3R1KA 4NGTA 3MRUA 5LRJA 1M4IA 1FNOA 2R8VA 1CJWA 2VZYA 2BEIA 1AYEA 1Z8LA 2PIZA 2FSRA 2QVPA 2ARHA 3NE8A 3QAYA 1B87A 4BD9A 2VQYA 4ZGYB 2YNDA 4RI1A 5I0CA 2OU2A 4R3KA 2FL4A 3W6XA 4GS4A 1EE3P 1ZLIA 2FXFA 3R9FA 2PJ1A 2PJAA 1LANA 3S9NA 4OC2A 2CNMA 1R57A 2O4HA 3P2HA 1A2ZA 2RFHA 4M6HA 2PJ3A 4KVME 2REFA 3IC1A 3TC8A 3DDDA 3S6FA 1BOBA 2OZHA 3FBUA 1RO5A 5GCNA 2CTCA 4R87A 4KOWA 1S7KA 2FVGA 2JLMA 2XEJA 2Z10A 3GY9A 2PE3A 3JTKA 1CP7A 5KTAA 3SHPA 4MFJA 2ZEGA 5F49A 2ZW7A 2OOTA 1ZO0A 4KVXA 4NXYA 4YRHA 4MHZA 2EUIA 5LYLA 5F46A 2JDDA 2R98A 5THWA 5JQ4A 4H89A 2G3AA 3N7ZA 2PDOA 3H8FA 4CYPA 3R9GA 2WPWA 4R6TA 1YLOA 4O23A 2P6FA 2VBQA 3JVNA 4MMOA 3D8PA 3BHXA 2J8MA 4PK2A 3PB6X 3SXNA 3V38A 2AJ6A 4MFPA 2G0BA 1BPNA 1XFOA 1ZG7A 2ZPAA 4U5YA 2O28A 3D7GA 6CPAA 1X10A 3D67A 4UF4A 1UFHA 4OIWA 1F57A 3WT4A 2PJBA 3WC7A 4CAFA 3IFEA 4MCSA 1YQEA 5J8FA 1M1DA 2WYRA 3RAMA 3B3VA 1XRYA 5EMIA 4AXVA 5HVGA 5IV0A 3C26A 2F8HA 4MJ8A 2ZOGA 2QYVA 4AG9A 4X5KA 4KLWA 3GIUA 4R7MA 2CY2A 2GANA 3VWEA 2PJ6A 4YGOA 5LYDA 3T9YA 3V8IA 2J8NA 1SQHA 4P4IA 4IAVA 5JGFA 3DR8A 5LRGA 1F2PA 3RO0A 4DUKA 2AFMA 4MHPA 4ZX9A 1PUAA 2AE6A 3RBUA 1VIXA 1YSJA 4ZY2A 3HLPA 4MY3A 2GFQA 3PB9X 3KHZA 5E96A 1QSTA 3CXPA 2B58A 2OB0A 1KUXA 2PVWA 3G8WA 4ONWA 8CPAA 2WZNA 3I1UA 4MFKA 4OIDA 2AFUA 2JBKA 2PQ8A 4UBRA 4A32A 3QB8A 5AGEA 4AVCA 1IY7A 3B35A 3WABA 4FD4A 4UCMA 1LRZA 4OAEA 5AG5A 4KSFA 1OBRA 4FWUA 3TTHA 2YGWA 4CAEA 4HNXB 1XBUA 2GU2A 3CPAA 4MFQA 4NGMA 4C2YA 2PSWA 1TF8A 3ISZA 4E8OA 2Q44A 4P6YA 4CGPA 2GIVA 2NMTA 4UWIA 4PV6A 2O53A 2G9DA 3QAHA 2XEGA 2VI7A 4AB7A 5I4MA 1Q2YA 4LQ6A 1J4JA 1XMTA 4KOXA 1S3ZA 2B4DB 3VH9A 1TKHA 3KR5A 3PB7X 4MFZA 4II9A 4F0XA 3TO6A 3K9TA 4EFDA 5HH1A 3PP9A 3H8EA 1IYLA 4KUBA 1GYTA 1M4DA 1Y0YA 2C6GA 4ZYQA 5G20A 2AFZA 2H5MA 3BLNA 4FD6A 1S7FA 4MY0A 2I00A 2CNTA 3FF3A 2Q4ZA 2DXQA 3HUVA 2KCWA 1XOVA 4CRYB 4XPLA 5IB9A 3H5ZA 4NGSA 1ARLA 5EBVA 1MJAA 4CYQA 4DJLA 1Z4RA 3F0AA 4LUAA 1M4LA 4PPZA 3KGQA 4ORFA 4C68A 5J1QA 2PJ0A 3EC4A 1YREA 1VHOA 3H4QA 2YNEA 5A27A 2PC1A 4A31A 2PJ5A 2GREA 1HEEA 2JDCA 4MFLA 4AG7A 3S9MA 5JM6A 1XJOA 4KOYA 3R96A 3BXMA 4F6AA 4FUUA 3CZXA 3UY5A 1CBXA 3FYNA 4P10A 4L89A 4B5OA 2ABZA 2I79A 2ZEDA 4QVTA 1XF8A 4MHNA 2Q7BA 4CYOA 3L2NA 1Z8XA 3DSBA 2PVVA 2PJ9A 3RNZA 3PGPA 2B5GA 2I3CA 1B6BA 2CF4A 3MGDA 4MRIA 4YFJA 4ZI6A 1HDUA 4OMEA 1BPMA 2HUZA 4UFVA 1LOKA 3K9UA 3D7FA 4QC6A 3KASA 4GXHA 4XPKA 1Y7RA 5FVJA 4UEFA 4K3NA 4NGQA 4Q38A 3WC5A 3NE7A 1YW6A 1LFWA 1Y9WA 4JXQA 1KWMA 1IOFA 3D68A 4WJBA 3IJ3A 2AFWA 1RTQA 4Y49C 3RZAA 5G21A 3T8WA 3F8KA 4RUHA 2PIYA 2BSWA 5H86A 4C2XA 2EO8A 5JPHA 1V0CA 4PK3A 2RC4A 4RN7A 2ZEMA 3TT2A 5F48A 3DNSA 1TKJA 4JYWA 1VGYA 3SJEA 1Y9KA 4OLLA 4TNUA 3VWDA 4CAWA 3CXQA 4CGLA 2OZGA 2RB7A 3LODA 4CYNA 3GUXA 4UEZA 4BMHA 3IEHA 1IGBA 2HB6A 2BUEA 2K5TA 2V8HA 3D4UA 3B3SA 4I49A 2Q04A 2ZW6A 2NYQA 3TOAA 3EXNA 2FIWA 3DLJA 4MCRA 4AVBA 5CBMA 1Z5RA 2PJ8A 4E0AA 4YU9A 3D2PA 1K4JA 1QSNA 4M85A 2JEWA 3B3WA 4R3LA 1CX8A 3FNCA 3IU2A 3EFAA 4IHMA 3A9LA 4NCZA 5AG4A 4C2ZA 2EBJA 3LMSA 3R9EA 1LAPA 3GLJA 4NF1A 3B3TA 4XPDB 1CG2A 2CXAA 3E0KA 4KORA 4B13A 3VARA 4X2TA 5HXDA 1S60A 1WWZA 5EC4A 4F0YA 3KQXA 4EWTA 3B7IA 3TCVA 3SJGA 3D2MA 4P4BA 3IWWA 1TXRA 3DGVA 5DWNA 4B11A 2VZZA 2PJ7A 2Z0ZA 1IICA 2ZXVA 3LWUA 5HVFA 3T90A 2HQYA 1I12A 2X7BA 1R3NA 4NGRA 1IB1E 1Z8WA 3B2YA 2V8DA 1NSLA 1IIDA 3B8GA 3F5BA 1QSMA 2ZELA 1N71A 3JUWA 1GHEA 1LAMA 3FMCA 1YK3A 2OZUA 1BAVA 1PU9A 3IO1A 4FAIA 1VKCA 2Z3MA 4U9ZA 4Z65A 4ZY1A 2ZEFA 1X12A 1YMEA 3KQZA 1CPSA 2WUUA 2XEFA 2GLJA 3KZWA 2QIRA 5ELYA 4QBJA 1BO4A 5C88A 3N5FA 1KUVA 4KOUA 5CPAA 3FVLA 2R7HA 3NH8A 2EWBA 3FECA 4P45A 4UIAA 2ATRA 5DWMA 4KOTA 1F2OA 2J9AA 3V7ZA 1IOIA 3LD2A 4UA3A 5D29A 4AVAA 5A28A 1TIQA 1Z2LA 2F7VA 5LRKA 2IMOA 4F9VA 3TOBA 4R76A 4HPSA 1TKFA 1YR0A 3IGRA 1XE4A 4CAXA 5F09A 4A30A 1AUGA 4MHDA 3QNVA 4M6IA 4JZ0A 4P4EA 1Y7EA 2C1CA 1QSOA 2BOAA 2FIAA 3ZZIA 3TO7A 3FEDA 1I21A 2CIJA 2FS5A 3FEEA 3I9SA 4JWPA 1H8LA 1NE9A 4QUSA 3D7HA 3TX8A 4TWEA 3OWCA 2Q4YA 2HC9A 5K8OA 1TF9A 2V77A 2Q7SA 1IYKA 2G3TA 4FD7A 2PR1A 2BL1A 4H2KA 4ZX8A 4DNCA 3ISXA 4CGOA 1JWQA 4UEEA 4Y49B 1XMBA 2A4NA 3CPXA 2ZEEA 1IU8A 2XEIA 3SJXA 3VATA 4CRZB 4EVYA 2B5GB 3NFZA 2ZW5A 4OC1A 2BO9A 5F47A 4NGNA 2J8RA 2WSAA 4CGNA 4R9MA 1KUYA 1MJ9A 2ZOFA 4KOVA 4KS9A 2ZEHA 3PBBA 2Z3NA 3W6SA 7CPAA 2DPTA 1CM0A 2QECA 4OC0A 2VL1A 4DYOA 4J3GA 2C27A 2WPXA 4MCQA 2HV2A 3I3GA 2EVNA 1ELLP 3GYAA 2IJZA 2FCKA 2Q43A 2DPSA 2P0WA 1Z9UA 2IL4A 3SI1A 1YW4A 2R1IA 1YVOA 4A95A 2PRBA 1CPXA 3FXTA 4YWYA 4MCPA 1DTDA 1P4NA 3BI0A 3PZJA 1I1DA 1CP6A 4G1PA 2AFOA 3DR6A 1VHSA 4ONUA 5KTCA 4PSWA 2AFSA 2Z11A 2PJCA 3KKWA 4XNHB 3CT9A 1NMTA 2ZEPA 4XPDC 2QMLA 2AFXA 1S5KA 2FT0A 4IF5A 4B14A 2NSMA 4B5PB 5C82A 1FY7A 2D4OA 2Z3KA 1XEBA 1MJBA 1YLEA 4A39A 2Q0YA 2Z3LA 3NA6A 4B12A 3FJUA 3PB8X 3PRTA 4Q7AA 4MI4A 4XNHC 1FT7A 2V8GA 1Y0RA 4MXUA 1NSAA 3D3SA 3CXSA 4OC3A 1LCPA 3SJFA 3P2FA 4NEXA 4PXEA 4ZY0A 3LACA 4OC4A 5J8CA 4A33A 4W9YA 4B10A 3SXOA 3JRUA 3W91A 2Z3OA 4K30A 4UCNA 3PBEA 1WK4A 3D66A 2ZENA 4KZTA 1YX0A 1U6MA 2B4BA 2POKA 1YGHA 1Q2DA 2OH1A 2B3UA 3IWGA 2Z3PA 4JXRA 4KLVA 3R95A 4UWJA 4KVOE 4B6ZA 3PEIA 5K8PA 2PR8A 4PXCA 4UFWA 3S6KA 1ELMP 4H6UA 3WC6A 2Q4VA 3IWEA 5H84A 4HNYB 1M4GA 3K2KA 4BINA 2EK8A 5IX3A 3BJ8A 4P4JA 1L0CA 2D4PA 2B3VA 2REEA 3SI2A 1P0HA 4F9UA 4FD5A 5K8NA 2P6GA 3KL9A 4LX9A 3TO9A 2CNSA 4QB9A 1VHEA 3PB4X 4NFRA 1Z4EA 2PJ4A 5DS0A 1QQ9A 1R43A 1ZG8A 1XIXA 3CDXA 3H8GA 5G22A 3FH4A 1MK4A 1RXTA 2C6CA 3TFYA 5HVHA 1PCAA 1PYTB 4JLYA 2EK9A 4HKFA 4NJRA 3B3CA 5LYFA 2PJ2A 4KOSA 2BCOA 1ZLHA 4R8FA 4U9YA 2PCUA 1ON0A 3IIBA 4IK2A 2GLFA 4IUSA 5IB0A 5JH9A 4A38A 2QJ8A 3EO4A 4HNWB 4A37A 2IQ6A 2F5IA 3GKRA 4UFXA 4C7IA 1ARMA 1Z8TA 2JBJA 1JQGA 3FX6A 4KSIA 4X8IA 1KZFA 1QSRA 4MBUA 2FE7A 1DE4C 1Q7LA 4PQAA 1QMUA 3FB3A 2OR4A 4UIBA 5KTDA 5LYIA 2DF5A 3KHXA 4NGPA 3FRMA 3FIXA 4RS2A 2ANPA 2YNCC 5CNPA 4OKOA 5ISVA 4GM5A 4X3RA 4NSQA 2PRQA 4A2ZA 2ZW4A 2ODFA 1S7LA 2CTBA 3BI1A 5D8NA 4FBEA 4KSAA 4P4DA 1M44A 2DEAA 4H6ZA 5G1ZA 4BBHA 4CGMA 4CS0B 5BWAB 3S6GA 1AMPA 3ZJ0A 1S7NA 4P4FA 4UCPA 3IU1A 2JEVA 3MN8A 4Q36A 3KI9A 2GE3A 1UWYA 2VEZA 4LQGA 3WR7A 3BJ7A 2YNCA 4R57A 2Q51A 2ZEOA 3RYOA 3NH5A 4EMEA 4OADA 4L8AA
chains in the Genus database with same CATH topology
1Q2CA 5AG6A 1OZPA 4M3SA 5HMNA 3S6HA 4CAVA 3G3SA 2Y0MA 4JJXA 4E2AA 4C7HA 4JD6A 3EY5A 1YVKA 2VXKA 3TE4A 2P6EA 2B4DA 4B5PA 4ZBGA 4KUAA 4PSXA 5AG7A 3R1KA 1M4IA 2R8VA 1CJWA 2VZYA 2BEIA 2FSRA 2ARHA 1B87A 4ZGYB 2VQYA 2YNDA 4RI1A 5I0CA 2OU2A 4R3KA 2FL4A 3W6XA 4GS4A 2FXFA 3R9FA 2CNMA 1R57A 3P2HA 4KVME 2REFA 3DDDA 3S6FA 1BOBA 2OZHA 3FBUA 1RO5A 5GCNA 4R87A 4KOWA 1S7KA 2JLMA 2Z10A 3GY9A 3JTKA 5KTAA 3SHPA 4MFJA 5F49A 2ZW7A 1ZO0A 4KVXA 4NXYA 4YRHA 2EUIA 5F46A 2JDDA 2R98A 5JQ4A 4H89A 2G3AA 3N7ZA 2PDOA 4CYPA 3R9GA 2WPWA 2P6FA 2VBQA 3JVNA 3D8PA 4PK2A 2J8MA 3SXNA 2AJ6A 4MFPA 2G0BA 2ZPAA 4U5YA 2O28A 1UFHA 4CAFA 5J8FA 1M1DA 5IV0A 3C26A 4MJ8A 4AG9A 4X5KA 4KLWA 2CY2A 2GANA 3VWEA 4YGOA 3T9YA 3V8IA 2J8NA 1SQHA 3DR8A 1PUAA 2AE6A 4MY3A 5E96A 1QSTA 3CXPA 2B58A 2OB0A 1KUXA 3G8WA 4MFKA 2PQ8A 4UBRA 4A32A 3QB8A 5AGEA 4AVCA 4FD4A 4UCMA 1LRZA 4OAEA 5AG5A 4KSFA 3TTHA 2YGWA 4CAEA 4HNXB 4MFQA 4C2YA 2PSWA 4E8OA 2Q44A 4CGPA 2GIVA 2NMTA 4UWIA 4PV6A 3QAHA 4AB7A 2VI7A 1Q2YA 1J4JA 1XMTA 4KOXA 1S3ZA 2B4DB 4MFZA 4II9A 4F0XA 3TO6A 5HH1A 3PP9A 1IYLA 4KUBA 1M4DA 5G20A 2H5MA 3BLNA 4FD6A 1S7FA 4MY0A 2I00A 2CNTA 2DXQA 4CRYB 2KCWA 4XPLA 3H5ZA 5EBVA 4CYQA 1MJAA 1Z4RA 3F0AA 4LUAA 4ORFA 4C68A 3EC4A 1YREA 3H4QA 2YNEA 5A27A 2PC1A 4A31A 2JDCA 4MFLA 4AG7A 4KOYA 3R96A 4F6AA 3UY5A 3FYNA 4L89A 4B5OA 2I79A 4QVTA 1XF8A 2Q7BA 4CYOA 3DSBA 3PGPA 2B5GA 3MGDA 1B6BA 4YFJA 2HUZA 4UFVA 4XPKA 3K9UA 4QC6A 1Y7RA 5FVJA 4Q38A 3NE7A 1Y9WA 4JXQA 4Y49C 5G21A 3F8KA 2BSWA 5H86A 4C2XA 5JPHA 1V0CA 4PK3A 2RC4A 3TT2A 5F48A 3DNSA 1Y9KA 4OLLA 3VWDA 4CAWA 3CXQA 4CGLA 2OZGA 3LODA 4CYNA 4BMHA 2BUEA 2K5TA 4I49A 2Q04A 2ZW6A 3TOAA 3EXNA 2FIWA 4AVBA 4E0AA 3D2PA 1K4JA 1QSNA 4M85A 4R3LA 3FNCA 3IU2A 3EFAA 3A9LA 4NCZA 5AG4A 4C2ZA 3R9EA 4XPDB 4NF1A 2CXAA 3E0KA 4KORA 4B13A 1S60A 1WWZA 5EC4A 4F0YA 3TCVA 3D2MA 5DWNA 4B11A 2VZZA 2Z0ZA 1IICA 2ZXVA 3T90A 2HQYA 1I12A 2X7BA 1IB1E 1NSLA 1IIDA 3F5BA 3B8GA 1QSMA 1N71A 3JUWA 1GHEA 1YK3A 2OZUA 1PU9A 1VKCA 2Z3MA 4U9ZA 2WUUA 2QIRA 4QBJA 1BO4A 5C88A 4KOUA 1KUVA 2R7HA 2ATRA 5DWMA 4KOTA 3LD2A 4UA3A 4AVAA 5A28A 1TIQA 3TOBA 1YR0A 3IGRA 1XE4A 4CAXA 4A30A 4MHDA 1QSOA 2FIAA 3ZZIA 3TO7A 1I21A 2FS5A 3I9SA 4JWPA 4QUSA 1NE9A 3OWCA 2Q4YA 1IYKA 2G3TA 4FD7A 2PR1A 2BL1A 4DNCA 4CGOA 4Y49B 2A4NA 4CRZB 4EVYA 2B5GB 5F47A 2ZW5A 2J8RA 2WSAA 4CGNA 4R9MA 1KUYA 1MJ9A 4KS9A 4KOVA 3W6SA 2Z3NA 2DPTA 1CM0A 2QECA 4J3GA 2C27A 2WPXA 2HV2A 3I3GA 2EVNA 3GYAA 2FCKA 2DPSA 2P0WA 1Z9UA 2IL4A 2R1IA 4A95A 1YVOA 2PRBA 3FXTA 3PZJA 1P4NA 1I1DA 3DR6A 1VHSA 4ONUA 5KTCA 4PSWA 2Z11A 4XNHB 3KKWA 1NMTA 4XPDC 2QMLA 1S5KA 2FT0A 4IF5A 4B14A 4B5PB 5C82A 1FY7A 2D4OA 2Z3KA 1XEBA 1MJBA 1YLEA 2Q0YA 2Z3LA 4B12A 4MI4A 4XNHC 3D3SA 3CXSA 3P2FA 4NEXA 5J8CA 4A33A 4B10A 3SXOA 3W91A 4K30A 2Z3OA 4UCNA 1WK4A 4KZTA 1YX0A 1U6MA 2B4BA 1YGHA 1Q2DA 2OH1A 2B3UA 4JXRA 2Z3PA 4KLVA 3IWGA 3R95A 4UWJA 4KVOE 2PR8A 4UFWA 3S6KA 4H6UA 2Q4VA 3IWEA 5H84A 4HNYB 1M4GA 5IX3A 3BJ8A 1L0CA 2D4PA 2B3VA 2REEA 1P0HA 4FD5A 2P6GA 4LX9A 3TO9A 2CNSA 4QB9A 1Z4EA 1XIXA 5G22A 1MK4A 1RXTA 3TFYA 4JLYA 4HKFA 4KOSA 4U9YA 1ON0A 4IUSA 5IB0A 3EO4A 4HNWB 2F5IA 3GKRA 4UFXA 4C7IA 1KZFA 1QSRA 4MBUA 2FE7A 3FB3A 5KTDA 3FRMA 3FIXA 4RS2A 2YNCC 5CNPA 5ISVA 4NSQA 4A2ZA 2ZW4A 1S7LA 4KSAA 1M44A 4H6ZA 5G1ZA 4BBHA 4CGMA 4CS0B 5BWAB 3S6GA 3ZJ0A 1S7NA 4UCPA 3IU1A 2JEVA 4Q36A 2GE3A 2VEZA 3WR7A 3BJ7A 2YNCA 4R57A 3RYOA 4OADA 4L8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q2C A;  1OZP A;  4M3S A;  5HMN A;  3S6H A;  4CAV A;  3G3S A;  2Y0M A;  4JJX A;  4E2A A;  4JD6 A;  3EY5 A;  1YVK A;  2VXK A;  3TE4 A;  2P6E A;  2B4D A;  4B5P A;  4ZBG A;  4KUA A;  4PSX A;  3R1K A;  1M4I A;  2R8V A;  1CJW A;  2VZY A;  2BEI A;  2FSR A;  2ARH A;  1B87 A;  2VQY A;  4RI1 A;  5I0C A;  2OU2 A;  4R3K A;  2FL4 A;  3W6X A;  4GS4 A;  2FXF A;  3R9F A;  2CNM A;  1R57 A;  3P2H A;  4KVM E;  2REF A;  3DDD A;  3S6F A;  1BOB A;  2OZH A;  3FBU A;  1RO5 A;  5GCN A;  4R87 A;  4KOW A;  1S7K A;  2JLM A;  2Z10 A;  3GY9 A;  5KTA A;  3SHP A;  5F49 A;  2ZW7 A;  4KVX A;  4NXY A;  4YRH A;  2EUI A;  5F46 A;  2JDD A;  2R98 A;  5JQ4 A;  4H89 A;  2G3A A;  3N7Z A;  2PDO A;  3R9G A;  2WPW A;  2P6F A;  2VBQ A;  3JVN A;  3D8P A;  4PK2 A;  2J8M A;  3SXN A;  2AJ6 A;  2G0B A;  2ZPA A;  4U5Y A;  2O28 A;  1UFH A;  5J8F A;  1M1D A;  5IV0 A;  3C26 A;  4MJ8 A;  4AG9 A;  4X5K A;  4KLW A;  2CY2 A;  2GAN A;  3VWE A;  4YGO A;  3T9Y A;  3V8I A;  2J8N A;  1SQH A;  3DR8 A;  1PUA A;  2AE6 A;  4MY3 A;  5E96 A;  1QST A;  3CXP A;  2B58 A;  2OB0 A;  1KUX A;  3G8W A;  2PQ8 A;  4UBR A;  3QB8 A;  4AVC A;  4FD4 A;  1LRZ A;  4OAE A;  3TTH A;  4HNX B;  2PSW A;  4E8O A;  2Q44 A;  2GIV A;  2NMT A;  4UWI A;  4PV6 A;  3QAH A;  4AB7 A;  2VI7 A;  1Q2Y A;  1J4J A;  1XMT A;  4KOX A;  1S3Z A;  2B4D B;  4II9 A;  3TO6 A;  5HH1 A;  3PP9 A;  1IYL A;  4KUB A;  1M4D A;  2H5M A;  3BLN A;  4FD6 A;  1S7F A;  4MY0 A;  2I00 A;  2CNT A;  2DXQ A;  4CRY B;  2KCW A;  4XPL A;  5EBV A;  1MJA A;  1Z4R A;  3F0A A;  4LUA A;  4ORF A;  3EC4 A;  1YRE A;  3H4Q A;  2PC1 A;  2JDC A;  4AG7 A;  4KOY A;  3R96 A;  4F6A A;  3UY5 A;  3FYN A;  4L89 A;  4B5O A;  2I79 A;  4QVT A;  1XF8 A;  2Q7B A;  3DSB A;  3PGP A;  2B5G A;  3MGD A;  1B6B A;  4YFJ A;  2HUZ A;  4XPK A;  3K9U A;  4QC6 A;  1Y7R A;  5FVJ A;  3NE7 A;  1Y9W A;  4JXQ A;  4Y49 C;  3F8K A;  2BSW A;  5H86 A;  5JPH A;  1V0C A;  4PK3 A;  2RC4 A;  3TT2 A;  5F48 A;  3DNS A;  1Y9K A;  4OLL A;  3VWD A;  4CAW A;  3CXQ A;  2OZG A;  3LOD A;  4BMH A;  2BUE A;  2K5T A;  4I49 A;  2Q04 A;  2ZW6 A;  3TOA A;  3EXN A;  2FIW A;  4AVB A;  4E0A A;  3D2P A;  1K4J A;  1QSN A;  4M85 A;  4R3L A;  3FNC A;  3EFA A;  4NCZ A;  3R9E A;  4XPD B;  4NF1 A;  3E0K A;  4KOR A;  1S60 A;  1WWZ A;  5EC4 A;  4F0Y A;  3TCV A;  3D2M A;  5DWN A;  2VZZ A;  2Z0Z A;  1IIC A;  2ZXV A;  3T90 A;  2HQY A;  1I12 A;  2X7B A;  1IB1 E;  1NSL A;  1IID A;  3B8G A;  3F5B A;  1QSM A;  1N71 A;  3JUW A;  1GHE A;  1YK3 A;  2OZU A;  1PU9 A;  1VKC A;  4U9Z A;  2QIR A;  4QBJ A;  1BO4 A;  5C88 A;  4KOU A;  1KUV A;  2R7H A;  2ATR A;  5DWM A;  4KOT A;  3LD2 A;  4UA3 A;  4AVA A;  1TIQ A;  3TOB A;  1YR0 A;  3IGR A;  1XE4 A;  4CAX A;  4MHD A;  1QSO A;  2FIA A;  3ZZI A;  3TO7 A;  1I21 A;  2FS5 A;  3I9S A;  4JWP A;  4QUS A;  1NE9 A;  3OWC A;  2Q4Y A;  1IYK A;  2G3T A;  4FD7 A;  2PR1 A;  2BL1 A;  4DNC A;  4Y49 B;  2A4N A;  4CRZ B;  4EVY A;  2B5G B;  5F47 A;  2ZW5 A;  2J8R A;  4R9M A;  1KUY A;  1MJ9 A;  4KOV A;  1CM0 A;  2QEC A;  4J3G A;  2C27 A;  2WPX A;  2HV2 A;  3I3G A;  2EVN A;  3GYA A;  2FCK A;  2P0W A;  1Z9U A;  2IL4 A;  2R1I A;  1YVO A;  2PRB A;  3FXT A;  3PZJ A;  1P4N A;  1I1D A;  3DR6 A;  1VHS A;  4ONU A;  5KTC A;  4PSW A;  2Z11 A;  4XNH B;  3KKW A;  1NMT A;  4XPD C;  2QML A;  1S5K A;  2FT0 A;  4IF5 A;  4B5P B;  5C82 A;  1FY7 A;  2D4O A;  1XEB A;  1MJB A;  1YLE A;  2Q0Y A;  4MI4 A;  4XNH C;  3D3S A;  3CXS A;  3P2F A;  4NEX A;  5J8C A;  3SXO A;  3W91 A;  4K30 A;  1WK4 A;  4KZT A;  1YX0 A;  1U6M A;  2B4B A;  1YGH A;  1Q2D A;  2OH1 A;  2B3U A;  3IWG A;  4JXR A;  4KLV A;  3R95 A;  3W6S A;  4UWJ A;  4KVO E;  2PR8 A;  3S6K A;  4H6U A;  2Q4V A;  5H84 A;  4HNY B;  1M4G A;  5IX3 A;  3BJ8 A;  1L0C A;  2D4P A;  2B3V A;  2REE A;  1P0H A;  4FD5 A;  2P6G A;  4LX9 A;  3TO9 A;  2CNS A;  4QB9 A;  1Z4E A;  1XIX A;  1MK4 A;  1RXT A;  3TFY A;  4JLY A;  4HKF A;  4KOS A;  4U9Y A;  1ON0 A;  4IUS A;  5IB0 A;  3EO4 A;  4HNW B;  2F5I A;  3GKR A;  1KZF A;  1QSR A;  4MBU A;  2FE7 A;  3FB3 A;  5KTD A;  3FRM A;  3FIX A;  4RS2 A;  5CNP A;  5ISV A;  4NSQ A;  2ZW4 A;  1S7L A;  1M44 A;  4H6Z A;  4CS0 B;  3S6G A;  3ZJ0 A;  1S7N A;  2JEV A;  2GE3 A;  2VEZ A;  3WR7 A;  3BJ7 A;  4R57 A;  3RYO A;  4OAD A;  4L8A A; 
#chains in the Genus database with same CATH topology
 1Q2C A;  2V8V A;  5AG6 A;  5K8M A;  1OZP A;  4M3S A;  1BLL E;  5HMN A;  3PFO A;  3S6H A;  4CAV A;  3G3S A;  4PXD A;  3PFE A;  2Y0M A;  3D7D A;  4JJX A;  4E2A A;  4MHY A;  4C7H A;  4NJQ A;  4A94 A;  4CPA A;  4JD6 A;  4OP4 A;  4P44 A;  4M6G A;  1ZG9 A;  3EY5 A;  1YVK A;  2VXK A;  3TE4 A;  2P6E A;  3S9L A;  1HDQ A;  2B4D A;  3GB0 A;  4ZBG A;  4KUA A;  4B5P A;  4WWV A;  3SI0 A;  3NH4 A;  4OC5 A;  4F8Z A;  4PSX A;  4PXB A;  2C6P A;  3KR4 A;  5AG7 A;  3R1K A;  4NGT A;  3MRU A;  5LRJ A;  1M4I A;  1FNO A;  2R8V A;  1CJW A;  2VZY A;  2BEI A;  1AYE A;  1Z8L A;  2PIZ A;  2FSR A;  2QVP A;  2ARH A;  3NE8 A;  3QAY A;  1B87 A;  4BD9 A;  2VQY A;  4ZGY B;  2YND A;  4RI1 A;  5I0C A;  2OU2 A;  4R3K A;  2FL4 A;  3W6X A;  4GS4 A;  1EE3 P;  1ZLI A;  2FXF A;  3R9F A;  2PJ1 A;  2PJA A;  1LAN A;  3S9N A;  4OC2 A;  2CNM A;  1R57 A;  2O4H A;  3P2H A;  1A2Z A;  2RFH A;  4M6H A;  2PJ3 A;  4KVM E;  2REF A;  3IC1 A;  3TC8 A;  3DDD A;  3S6F A;  1BOB A;  2OZH A;  3FBU A;  1RO5 A;  5GCN A;  2CTC A;  4R87 A;  4KOW A;  1S7K A;  2FVG A;  2JLM A;  2XEJ A;  2Z10 A;  3GY9 A;  2PE3 A;  3JTK A;  1CP7 A;  5KTA A;  3SHP A;  4MFJ A;  2ZEG A;  5F49 A;  2ZW7 A;  2OOT A;  1ZO0 A;  4KVX A;  4NXY A;  4YRH A;  4MHZ A;  2EUI A;  5LYL A;  5F46 A;  2JDD A;  2R98 A;  5THW A;  5JQ4 A;  4H89 A;  2G3A A;  3N7Z A;  2PDO A;  3H8F A;  4CYP A;  3R9G A;  2WPW A;  4R6T A;  1YLO A;  4O23 A;  2P6F A;  2VBQ A;  3JVN A;  4MMO A;  3D8P A;  3BHX A;  2J8M A;  4PK2 A;  3PB6 X;  3SXN A;  3V38 A;  2AJ6 A;  4MFP A;  2G0B A;  1BPN A;  1XFO A;  1ZG7 A;  2ZPA A;  4U5Y A;  2O28 A;  3D7G A;  6CPA A;  1X10 A;  3D67 A;  4UF4 A;  1UFH A;  4OIW A;  1F57 A;  3WT4 A;  2PJB A;  3WC7 A;  4CAF A;  3IFE A;  4MCS A;  1YQE A;  5J8F A;  1M1D A;  2WYR A;  3RAM A;  3B3V A;  1XRY A;  5EMI A;  4AXV A;  5HVG A;  5IV0 A;  3C26 A;  2F8H A;  4MJ8 A;  2ZOG A;  2QYV A;  4AG9 A;  4X5K A;  4KLW A;  3GIU A;  4R7M A;  2CY2 A;  2GAN A;  3VWE A;  2PJ6 A;  4YGO A;  5LYD A;  3T9Y A;  3V8I A;  2J8N A;  1SQH A;  4P4I A;  4IAV A;  5JGF A;  3DR8 A;  5LRG A;  1F2P A;  3RO0 A;  4DUK A;  2AFM A;  4MHP A;  4ZX9 A;  1PUA A;  2AE6 A;  3RBU A;  1VIX A;  1YSJ A;  4ZY2 A;  3HLP A;  4MY3 A;  2GFQ A;  3PB9 X;  3KHZ A;  5E96 A;  1QST A;  3CXP A;  2B58 A;  2OB0 A;  1KUX A;  2PVW A;  3G8W A;  4ONW A;  8CPA A;  2WZN A;  3I1U A;  4MFK A;  4OID A;  2AFU A;  2JBK A;  2PQ8 A;  4UBR A;  4A32 A;  3QB8 A;  5AGE A;  4AVC A;  1IY7 A;  3B35 A;  3WAB A;  4FD4 A;  4UCM A;  1LRZ A;  4OAE A;  5AG5 A;  4KSF A;  1OBR A;  4FWU A;  3TTH A;  2YGW A;  4CAE A;  4HNX B;  1XBU A;  2GU2 A;  3CPA A;  4MFQ A;  4NGM A;  4C2Y A;  2PSW A;  1TF8 A;  3ISZ A;  4E8O A;  2Q44 A;  4P6Y A;  4CGP A;  2GIV A;  2NMT A;  4UWI A;  4PV6 A;  2O53 A;  2G9D A;  3QAH A;  2XEG A;  2VI7 A;  4AB7 A;  5I4M A;  1Q2Y A;  4LQ6 A;  1J4J A;  1XMT A;  4KOX A;  1S3Z A;  2B4D B;  3VH9 A;  1TKH A;  3KR5 A;  3PB7 X;  4MFZ A;  4II9 A;  4F0X A;  3TO6 A;  3K9T A;  4EFD A;  5HH1 A;  3PP9 A;  3H8E A;  1IYL A;  4KUB A;  1GYT A;  1M4D A;  1Y0Y A;  2C6G A;  4ZYQ A;  5G20 A;  2AFZ A;  2H5M A;  3BLN A;  4FD6 A;  1S7F A;  4MY0 A;  2I00 A;  2CNT A;  3FF3 A;  2Q4Z A;  2DXQ A;  3HUV A;  2KCW A;  1XOV A;  4CRY B;  4XPL A;  5IB9 A;  3H5Z A;  4NGS A;  1ARL A;  5EBV A;  1MJA A;  4CYQ A;  4DJL A;  1Z4R A;  3F0A A;  4LUA A;  1M4L A;  4PPZ A;  3KGQ A;  4ORF A;  4C68 A;  5J1Q A;  2PJ0 A;  3EC4 A;  1YRE A;  1VHO A;  3H4Q A;  2YNE A;  5A27 A;  2PC1 A;  4A31 A;  2PJ5 A;  2GRE A;  1HEE A;  2JDC A;  4MFL A;  4AG7 A;  3S9M A;  5JM6 A;  1XJO A;  4KOY A;  3R96 A;  3BXM A;  4F6A A;  4FUU A;  3CZX A;  3UY5 A;  1CBX A;  3FYN A;  4P10 A;  4L89 A;  4B5O A;  2ABZ A;  2I79 A;  2ZED A;  4QVT A;  1XF8 A;  4MHN A;  2Q7B A;  4CYO A;  3L2N A;  1Z8X A;  3DSB A;  2PVV A;  2PJ9 A;  3RNZ A;  3PGP A;  2B5G A;  2I3C A;  1B6B A;  2CF4 A;  3MGD A;  4MRI A;  4YFJ A;  4ZI6 A;  1HDU A;  4OME A;  1BPM A;  2HUZ A;  4UFV A;  1LOK A;  3K9U A;  3D7F A;  4QC6 A;  3KAS A;  4GXH A;  4XPK A;  1Y7R A;  5FVJ A;  4UEF A;  4K3N A;  4NGQ A;  4Q38 A;  3WC5 A;  3NE7 A;  1YW6 A;  1LFW A;  1Y9W A;  4JXQ A;  1KWM A;  1IOF A;  3D68 A;  4WJB A;  3IJ3 A;  2AFW A;  1RTQ A;  4Y49 C;  3RZA A;  5G21 A;  3T8W A;  3F8K A;  4RUH A;  2PIY A;  2BSW A;  5H86 A;  4C2X A;  2EO8 A;  5JPH A;  1V0C A;  4PK3 A;  2RC4 A;  4RN7 A;  2ZEM A;  3TT2 A;  5F48 A;  3DNS A;  1TKJ A;  4JYW A;  1VGY A;  3SJE A;  1Y9K A;  4OLL A;  4TNU A;  3VWD A;  4CAW A;  3CXQ A;  4CGL A;  2OZG A;  2RB7 A;  3LOD A;  4CYN A;  3GUX A;  4UEZ A;  4BMH A;  3IEH A;  1IGB A;  2HB6 A;  2BUE A;  2K5T A;  2V8H A;  3D4U A;  3B3S A;  4I49 A;  2Q04 A;  2ZW6 A;  2NYQ A;  3TOA A;  3EXN A;  2FIW A;  3DLJ A;  4MCR A;  4AVB A;  5CBM A;  1Z5R A;  2PJ8 A;  4E0A A;  4YU9 A;  3D2P A;  1K4J A;  1QSN A;  4M85 A;  2JEW A;  3B3W A;  4R3L A;  1CX8 A;  3FNC A;  3IU2 A;  3EFA A;  4IHM A;  3A9L A;  4NCZ A;  5AG4 A;  4C2Z A;  2EBJ A;  3LMS A;  3R9E A;  1LAP A;  3GLJ A;  4NF1 A;  3B3T A;  4XPD B;  1CG2 A;  2CXA A;  3E0K A;  4KOR A;  4B13 A;  3VAR A;  4X2T A;  5HXD A;  1S60 A;  1WWZ A;  5EC4 A;  4F0Y A;  3KQX A;  4EWT A;  3B7I A;  3TCV A;  3SJG A;  3D2M A;  4P4B A;  3IWW A;  1TXR A;  3DGV A;  5DWN A;  4B11 A;  2VZZ A;  2PJ7 A;  2Z0Z A;  1IIC A;  2ZXV A;  3LWU A;  5HVF A;  3T90 A;  2HQY A;  1I12 A;  2X7B A;  1R3N A;  4NGR A;  1IB1 E;  1Z8W A;  3B2Y A;  2V8D A;  1NSL A;  1IID A;  3B8G A;  3F5B A;  1QSM A;  2ZEL A;  1N71 A;  3JUW A;  1GHE A;  1LAM A;  3FMC A;  1YK3 A;  2OZU A;  1BAV A;  1PU9 A;  3IO1 A;  4FAI A;  1VKC A;  2Z3M A;  4U9Z A;  4Z65 A;  4ZY1 A;  2ZEF A;  1X12 A;  1YME A;  3KQZ A;  1CPS A;  2WUU A;  2XEF A;  2GLJ A;  3KZW A;  2QIR A;  5ELY A;  4QBJ A;  1BO4 A;  5C88 A;  3N5F A;  1KUV A;  4KOU A;  5CPA A;  3FVL A;  2R7H A;  3NH8 A;  2EWB A;  3FEC A;  4P45 A;  4UIA A;  2ATR A;  5DWM A;  4KOT A;  1F2O A;  2J9A A;  3V7Z A;  1IOI A;  3LD2 A;  4UA3 A;  5D29 A;  4AVA A;  5A28 A;  1TIQ A;  1Z2L A;  2F7V A;  5LRK A;  2IMO A;  4F9V A;  3TOB A;  4R76 A;  4HPS A;  1TKF A;  1YR0 A;  3IGR A;  1XE4 A;  4CAX A;  5F09 A;  4A30 A;  1AUG A;  4MHD A;  3QNV A;  4M6I A;  4JZ0 A;  4P4E A;  1Y7E A;  2C1C A;  1QSO A;  2BOA A;  2FIA A;  3ZZI A;  3TO7 A;  3FED A;  1I21 A;  2CIJ A;  2FS5 A;  3FEE A;  3I9S A;  4JWP A;  1H8L A;  1NE9 A;  4QUS A;  3D7H A;  3TX8 A;  4TWE A;  3OWC A;  2Q4Y A;  2HC9 A;  5K8O A;  1TF9 A;  2V77 A;  2Q7S A;  1IYK A;  2G3T A;  4FD7 A;  2PR1 A;  2BL1 A;  4H2K A;  4ZX8 A;  4DNC A;  3ISX A;  4CGO A;  1JWQ A;  4UEE A;  4Y49 B;  1XMB A;  2A4N A;  3CPX A;  2ZEE A;  1IU8 A;  2XEI A;  3SJX A;  3VAT A;  4CRZ B;  4EVY A;  2B5G B;  3NFZ A;  2ZW5 A;  4OC1 A;  2BO9 A;  5F47 A;  4NGN A;  2J8R A;  2WSA A;  4CGN A;  4R9M A;  1KUY A;  1MJ9 A;  2ZOF A;  4KOV A;  4KS9 A;  2ZEH A;  3PBB A;  2Z3N A;  3W6S A;  7CPA A;  2DPT A;  1CM0 A;  2QEC A;  4OC0 A;  2VL1 A;  4DYO A;  4J3G A;  2C27 A;  2WPX A;  4MCQ A;  2HV2 A;  3I3G A;  2EVN A;  1ELL P;  3GYA A;  2IJZ A;  2FCK A;  2Q43 A;  2DPS A;  2P0W A;  1Z9U A;  2IL4 A;  3SI1 A;  1YW4 A;  2R1I A;  1YVO A;  4A95 A;  2PRB A;  1CPX A;  3FXT A;  4YWY A;  4MCP A;  1DTD A;  1P4N A;  3BI0 A;  3PZJ A;  1I1D A;  1CP6 A;  4G1P A;  2AFO A;  3DR6 A;  1VHS A;  4ONU A;  5KTC A;  4PSW A;  2AFS A;  2Z11 A;  2PJC A;  3KKW A;  4XNH B;  3CT9 A;  1NMT A;  2ZEP A;  4XPD C;  2QML A;  2AFX A;  1S5K A;  2FT0 A;  4IF5 A;  4B14 A;  2NSM A;  4B5P B;  5C82 A;  1FY7 A;  2D4O A;  2Z3K A;  1XEB A;  1MJB A;  1YLE A;  4A39 A;  2Q0Y A;  2Z3L A;  3NA6 A;  4B12 A;  3FJU A;  3PB8 X;  3PRT A;  4Q7A A;  4MI4 A;  4XNH C;  1FT7 A;  2V8G A;  1Y0R A;  4MXU A;  1NSA A;  3D3S A;  3CXS A;  4OC3 A;  1LCP A;  3SJF A;  3P2F A;  4NEX A;  4PXE A;  4ZY0 A;  3LAC A;  4OC4 A;  5J8C A;  4A33 A;  4W9Y A;  4B10 A;  3SXO A;  3JRU A;  3W91 A;  2Z3O A;  4K30 A;  4UCN A;  3PBE A;  1WK4 A;  3D66 A;  2ZEN A;  4KZT A;  1YX0 A;  1U6M A;  2B4B A;  2POK A;  1YGH A;  1Q2D A;  2OH1 A;  2B3U A;  3IWG A;  2Z3P A;  4JXR A;  4KLV A;  3R95 A;  4UWJ A;  4KVO E;  4B6Z A;  3PEI A;  5K8P A;  2PR8 A;  4PXC A;  4UFW A;  3S6K A;  1ELM P;  4H6U A;  3WC6 A;  2Q4V A;  3IWE A;  5H84 A;  4HNY B;  1M4G A;  3K2K A;  4BIN A;  2EK8 A;  5IX3 A;  3BJ8 A;  4P4J A;  1L0C A;  2D4P A;  2B3V A;  2REE A;  3SI2 A;  1P0H A;  4F9U A;  4FD5 A;  5K8N A;  2P6G A;  3KL9 A;  4LX9 A;  3TO9 A;  2CNS A;  4QB9 A;  1VHE A;  3PB4 X;  4NFR A;  1Z4E A;  2PJ4 A;  5DS0 A;  1QQ9 A;  1R43 A;  1ZG8 A;  1XIX A;  3CDX A;  3H8G A;  5G22 A;  3FH4 A;  1MK4 A;  1RXT A;  2C6C A;  3TFY A;  5HVH A;  1PCA A;  1PYT B;  4JLY A;  2EK9 A;  4HKF A;  4NJR A;  3B3C A;  5LYF A;  2PJ2 A;  4KOS A;  2BCO A;  1ZLH A;  4R8F A;  4U9Y A;  2PCU A;  1ON0 A;  3IIB A;  4IK2 A;  2GLF A;  4IUS A;  5IB0 A;  5JH9 A;  4A38 A;  2QJ8 A;  3EO4 A;  4HNW B;  4A37 A;  2IQ6 A;  2F5I A;  3GKR A;  4UFX A;  4C7I A;  1ARM A;  1Z8T A;  2JBJ A;  1JQG A;  3FX6 A;  4KSI A;  4X8I A;  1KZF A;  1QSR A;  4MBU A;  2FE7 A;  1DE4 C;  1Q7L A;  4PQA A;  1QMU A;  3FB3 A;  2OR4 A;  4UIB A;  5KTD A;  5LYI A;  2DF5 A;  3KHX A;  4NGP A;  3FRM A;  3FIX A;  4RS2 A;  2ANP A;  2YNC C;  5CNP A;  4OKO A;  5ISV A;  4GM5 A;  4X3R A;  4NSQ A;  2PRQ A;  4A2Z A;  2ZW4 A;  2ODF A;  1S7L A;  2CTB A;  3BI1 A;  5D8N A;  4FBE A;  4KSA A;  4P4D A;  1M44 A;  2DEA A;  4H6Z A;  5G1Z A;  4BBH A;  4CGM A;  4CS0 B;  5BWA B;  3S6G A;  1AMP A;  3ZJ0 A;  1S7N A;  4P4F A;  4UCP A;  3IU1 A;  2JEV A;  3MN8 A;  4Q36 A;  3KI9 A;  2GE3 A;  1UWY A;  2VEZ A;  4LQG A;  3WR7 A;  3BJ7 A;  2YNC A;  4R57 A;  2Q51 A;  2ZEO A;  3RYO A;  3NH5 A;  4EME A;  4OAD A;  4L8A A; 
#chains in the Genus database with same CATH homology
 1Q2C A;  5AG6 A;  1OZP A;  4M3S A;  5HMN A;  3S6H A;  4CAV A;  3G3S A;  2Y0M A;  4JJX A;  4E2A A;  4C7H A;  4JD6 A;  3EY5 A;  1YVK A;  2VXK A;  3TE4 A;  2P6E A;  2B4D A;  4B5P A;  4ZBG A;  4KUA A;  4PSX A;  5AG7 A;  3R1K A;  1M4I A;  2R8V A;  1CJW A;  2VZY A;  2BEI A;  2FSR A;  2ARH A;  1B87 A;  4ZGY B;  2VQY A;  2YND A;  4RI1 A;  5I0C A;  2OU2 A;  4R3K A;  2FL4 A;  3W6X A;  4GS4 A;  2FXF A;  3R9F A;  2CNM A;  1R57 A;  3P2H A;  4KVM E;  2REF A;  3DDD A;  3S6F A;  1BOB A;  2OZH A;  3FBU A;  1RO5 A;  5GCN A;  4R87 A;  4KOW A;  1S7K A;  2JLM A;  2Z10 A;  3GY9 A;  3JTK A;  5KTA A;  3SHP A;  4MFJ A;  5F49 A;  2ZW7 A;  1ZO0 A;  4KVX A;  4NXY A;  4YRH A;  2EUI A;  5F46 A;  2JDD A;  2R98 A;  5JQ4 A;  4H89 A;  2G3A A;  3N7Z A;  2PDO A;  4CYP A;  3R9G A;  2WPW A;  2P6F A;  2VBQ A;  3JVN A;  3D8P A;  4PK2 A;  2J8M A;  3SXN A;  2AJ6 A;  4MFP A;  2G0B A;  2ZPA A;  4U5Y A;  2O28 A;  1UFH A;  4CAF A;  5J8F A;  1M1D A;  5IV0 A;  3C26 A;  4MJ8 A;  4AG9 A;  4X5K A;  4KLW A;  2CY2 A;  2GAN A;  3VWE A;  4YGO A;  3T9Y A;  3V8I A;  2J8N A;  1SQH A;  3DR8 A;  1PUA A;  2AE6 A;  4MY3 A;  5E96 A;  1QST A;  3CXP A;  2B58 A;  2OB0 A;  1KUX A;  3G8W A;  4MFK A;  2PQ8 A;  4UBR A;  4A32 A;  3QB8 A;  5AGE A;  4AVC A;  4FD4 A;  4UCM A;  1LRZ A;  4OAE A;  5AG5 A;  4KSF A;  3TTH A;  2YGW A;  4CAE A;  4HNX B;  4MFQ A;  4C2Y A;  2PSW A;  4E8O A;  2Q44 A;  4CGP A;  2GIV A;  2NMT A;  4UWI A;  4PV6 A;  3QAH A;  4AB7 A;  2VI7 A;  1Q2Y A;  1J4J A;  1XMT A;  4KOX A;  1S3Z A;  2B4D B;  4MFZ A;  4II9 A;  4F0X A;  3TO6 A;  5HH1 A;  3PP9 A;  1IYL A;  4KUB A;  1M4D A;  5G20 A;  2H5M A;  3BLN A;  4FD6 A;  1S7F A;  4MY0 A;  2I00 A;  2CNT A;  2DXQ A;  4CRY B;  2KCW A;  4XPL A;  3H5Z A;  5EBV A;  4CYQ A;  1MJA A;  1Z4R A;  3F0A A;  4LUA A;  4ORF A;  4C68 A;  3EC4 A;  1YRE A;  3H4Q A;  2YNE A;  5A27 A;  2PC1 A;  4A31 A;  2JDC A;  4MFL A;  4AG7 A;  4KOY A;  3R96 A;  4F6A A;  3UY5 A;  3FYN A;  4L89 A;  4B5O A;  2I79 A;  4QVT A;  1XF8 A;  2Q7B A;  4CYO A;  3DSB A;  3PGP A;  2B5G A;  3MGD A;  1B6B A;  4YFJ A;  2HUZ A;  4UFV A;  4XPK A;  3K9U A;  4QC6 A;  1Y7R A;  5FVJ A;  4Q38 A;  3NE7 A;  1Y9W A;  4JXQ A;  4Y49 C;  5G21 A;  3F8K A;  2BSW A;  5H86 A;  4C2X A;  5JPH A;  1V0C A;  4PK3 A;  2RC4 A;  3TT2 A;  5F48 A;  3DNS A;  1Y9K A;  4OLL A;  3VWD A;  4CAW A;  3CXQ A;  4CGL A;  2OZG A;  3LOD A;  4CYN A;  4BMH A;  2BUE A;  2K5T A;  4I49 A;  2Q04 A;  2ZW6 A;  3TOA A;  3EXN A;  2FIW A;  4AVB A;  4E0A A;  3D2P A;  1K4J A;  1QSN A;  4M85 A;  4R3L A;  3FNC A;  3IU2 A;  3EFA A;  3A9L A;  4NCZ A;  5AG4 A;  4C2Z A;  3R9E A;  4XPD B;  4NF1 A;  2CXA A;  3E0K A;  4KOR A;  4B13 A;  1S60 A;  1WWZ A;  5EC4 A;  4F0Y A;  3TCV A;  3D2M A;  5DWN A;  4B11 A;  2VZZ A;  2Z0Z A;  1IIC A;  2ZXV A;  3T90 A;  2HQY A;  1I12 A;  2X7B A;  1IB1 E;  1NSL A;  1IID A;  3F5B A;  3B8G A;  1QSM A;  1N71 A;  3JUW A;  1GHE A;  1YK3 A;  2OZU A;  1PU9 A;  1VKC A;  2Z3M A;  4U9Z A;  2WUU A;  2QIR A;  4QBJ A;  1BO4 A;  5C88 A;  4KOU A;  1KUV A;  2R7H A;  2ATR A;  5DWM A;  4KOT A;  3LD2 A;  4UA3 A;  4AVA A;  5A28 A;  1TIQ A;  3TOB A;  1YR0 A;  3IGR A;  1XE4 A;  4CAX A;  4A30 A;  4MHD A;  1QSO A;  2FIA A;  3ZZI A;  3TO7 A;  1I21 A;  2FS5 A;  3I9S A;  4JWP A;  4QUS A;  1NE9 A;  3OWC A;  2Q4Y A;  1IYK A;  2G3T A;  4FD7 A;  2PR1 A;  2BL1 A;  4DNC A;  4CGO A;  4Y49 B;  2A4N A;  4CRZ B;  4EVY A;  2B5G B;  5F47 A;  2ZW5 A;  2J8R A;  2WSA A;  4CGN A;  4R9M A;  1KUY A;  1MJ9 A;  4KS9 A;  4KOV A;  3W6S A;  2Z3N A;  2DPT A;  1CM0 A;  2QEC A;  4J3G A;  2C27 A;  2WPX A;  2HV2 A;  3I3G A;  2EVN A;  3GYA A;  2FCK A;  2DPS A;  2P0W A;  1Z9U A;  2IL4 A;  2R1I A;  4A95 A;  1YVO A;  2PRB A;  3FXT A;  3PZJ A;  1P4N A;  1I1D A;  3DR6 A;  1VHS A;  4ONU A;  5KTC A;  4PSW A;  2Z11 A;  4XNH B;  3KKW A;  1NMT A;  4XPD C;  2QML A;  1S5K A;  2FT0 A;  4IF5 A;  4B14 A;  4B5P B;  5C82 A;  1FY7 A;  2D4O A;  2Z3K A;  1XEB A;  1MJB A;  1YLE A;  2Q0Y A;  2Z3L A;  4B12 A;  4MI4 A;  4XNH C;  3D3S A;  3CXS A;  3P2F A;  4NEX A;  5J8C A;  4A33 A;  4B10 A;  3SXO A;  3W91 A;  4K30 A;  2Z3O A;  4UCN A;  1WK4 A;  4KZT A;  1YX0 A;  1U6M A;  2B4B A;  1YGH A;  1Q2D A;  2OH1 A;  2B3U A;  4JXR A;  2Z3P A;  4KLV A;  3IWG A;  3R95 A;  4UWJ A;  4KVO E;  2PR8 A;  4UFW A;  3S6K A;  4H6U A;  2Q4V A;  3IWE A;  5H84 A;  4HNY B;  1M4G A;  5IX3 A;  3BJ8 A;  1L0C A;  2D4P A;  2B3V A;  2REE A;  1P0H A;  4FD5 A;  2P6G A;  4LX9 A;  3TO9 A;  2CNS A;  4QB9 A;  1Z4E A;  1XIX A;  5G22 A;  1MK4 A;  1RXT A;  3TFY A;  4JLY A;  4HKF A;  4KOS A;  4U9Y A;  1ON0 A;  4IUS A;  5IB0 A;  3EO4 A;  4HNW B;  2F5I A;  3GKR A;  4UFX A;  4C7I A;  1KZF A;  1QSR A;  4MBU A;  2FE7 A;  3FB3 A;  5KTD A;  3FRM A;  3FIX A;  4RS2 A;  2YNC C;  5CNP A;  5ISV A;  4NSQ A;  4A2Z A;  2ZW4 A;  1S7L A;  4KSA A;  1M44 A;  4H6Z A;  5G1Z A;  4BBH A;  4CGM A;  4CS0 B;  5BWA B;  3S6G A;  3ZJ0 A;  1S7N A;  4UCP A;  3IU1 A;  2JEV A;  4Q36 A;  2GE3 A;  2VEZ A;  3WR7 A;  3BJ7 A;  2YNC A;  4R57 A;  3RYO A;  4OAD A;  4L8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...