4OADA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with chloramphenicol
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
160
structure length
160
Chain Sequence
HMQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GNAT superfamily acetyltransferase PA4794
publication title Crystal structure of a GNAT superfamily acetyltransferase PA4794 in complex with chloramphenicol
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 44
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2014-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4oadA00
4KVME 3S6GA 2ZXVA 4OAEA 4MJ8A 3BJ8A 4KZTA 2PC1A 2FT0A 2KCWA 1GHEA 4KOWA 2I79A 2OH1A 1Q2YA 3MGDA 4HNXB 5IB0A 2PR1A 1J4JA 2FS5A 2OZGA 1YR0A 1L0CA 4Y49C 3EY5A 2G0BA 4NEXA 3IWGA 1S60A 4FD6A 4AVCA 2OZHA 4QBJA 4QVTA 3R96A 1YK3A 1M4IA 3OWCA 4KLVA 2BSWA 5F48A 1M1DA 1SQHA 4QB9A 2P0WA 4R9MA 4UWJA 1S5KA 3F0AA 1QSMA 3TE4A 1I1DA 3VWEA 4Y49B 1IB1E 5KTAA 3CXQA 2R98A 4H89A 4JLYA 2CNSA 4OLLA 1YREA 2C27A 2Q4VA 2A4NA 3F5BA 2WPWA 3LODA 3DR8A 4E2AA 1S7NA 5F46A 3LD2A 1ON0A 3R1KA 4RI1A 4KOUA 1FY7A 1CM0A 2VZZA 1XMTA 1QSOA 1MK4A 1Y7RA 3G3SA 4AVAA 2QECA 1KUVA 4KOXA 5KTDA 3CXPA 2JLMA 1Y9KA 4L8AA 2I00A 3FRMA 2PRBA 1BO4A 1M44A 3P2FA 3EFAA 3DNSA 5HH1A 4L89A 2Z0ZA 3P2HA 2VBQA 2JDDA 1N71A 3TTHA 4ZBGA 1Y9WA 1YVKA 4J3GA 4JJXA 2VQYA 2Q7BA 4KUBA 3EO4A 4IF5A 4CAWA 4AG9A 3BLNA 2EVNA 2FE7A 2J8RA 2AJ6A 4GS4A 3VWDA 3R9EA 5IV0A 2GIVA 4JXQA 4XPLA 2Q44A 2PQ8A 3F8KA 4FD4A 2VI7A 4MY0A 4AG7A 3D2PA 1IICA 3N7ZA 2FL4A 4CRYB 2FIWA 4JXRA 4KVXA 3T9YA 2Z11A 5C82A 1KZFA 3FYNA 4UWIA 5IX3A 3TFYA 3FNCA 4R57A 1TIQA 2B5GB 5I0CA 4QC6A 5GCNA 1NSLA 3TO7A 2F5IA 2HQYA 4CRZB 4YFJA 5ISVA 4YGOA 4MHDA 4KOSA 4XPDC 4KLWA 1WWZA 3NE7A 3K9UA 4PSWA 1XF8A 2GANA 3PGPA 1R57A 2B3UA 3CXSA 2ZPAA 4KUAA 4H6ZA 4MI4A 3ZZIA 1NMTA 2WPXA 1RXTA 1S7LA 1BOBA 2CY2A 3SHPA 4PSXA 4XPDB 4PV6A 3TOBA 3DR6A 2VXKA 4AB7A 3B8GA 2EUIA 3RYOA 1YX0A 3S6HA 2D4PA 1OZPA 4NCZA 4BMHA 3R9FA 2K5TA 4DNCA 3DDDA 4JD6A 3TO6A 3QAHA 3SXOA 1WK4A 5J8CA 1I12A 1MJAA 2B5GA 1S7FA 1KUYA 3EXNA 5C88A 2G3AA 2FCKA 3TCVA 1LRZA 2OU2A 3W91A 3KKWA 1MJBA 2OB0A 2P6GA 4F6AA 4M3SA 1YLEA 2Q04A 3GY9A 4FD7A 4X5KA 2ZW5A 5H86A 4KVOE 1XEBA 2PSWA 2ZW4A 4OADA 4CAVA 4CAXA 2ZW6A 2PR8A 2R7HA 4U9ZA 5F47A 4QUSA 4XNHC 5F49A 5JPHA 3FB3A 2REFA 3W6SA 4KOTA 1P0HA 3UY5A 2CNMA 1VKCA 3V8IA 2BEIA 2B4DB 5EBVA 2QIRA 2VEZA 4R3LA 1M4GA 2VZYA 4MY3A 2P6FA 5HMNA 3S6FA 4NF1A 1IIDA 5DWMA 2B4BA 1I21A 1YGHA 4PK3A 3H4QA 2FXFA 1Z9UA 4U9YA 1MJ9A 4XNHB 4EVYA 4KOYA 4FD5A 3PZJA 1UFHA 2BL1A 2Z10A 5FVJA 1YVOA 3D2MA 4NSQA 1B6BA 3G8WA 2R1IA 3SXNA 5KTCA 3BJ7A 4ONUA 4U5YA 4CS0B 2B58A 5J8FA 4MBUA 1M4DA 1P4NA 2B3VA 3JVNA 3GYAA 3S6KA 4E0AA 3DSBA 2JEVA 5CNPA 1Z4RA 4E8OA 3JUWA 4II9A 1IYKA 1VHSA 3C26A 2Q0YA 3IGRA 4IUSA 3D3SA 4HNYB 2IL4A 2AE6A 2B4DA 2BUEA 2Q4YA 1IYLA 1CJWA 3FIXA 4UA3A 4UBRA 3FBUA 1K4JA 4PK2A 5EC4A 1S7KA 2G3TA 1QSRA 3WR7A 1V0CA 3W6XA 1PU9A 3D8PA 4RS2A 1XIXA 2HV2A 1RO5A 2J8NA 2CNTA 1QSNA 4K30A 4M85A 4B5PB 2QMLA 4LX9A 5JQ4A 3QB8A 3T90A 3R95A 4YRHA 1Q2CA 3TT2A 4R3KA 1Z4EA 3TO9A 2R8VA 2NMTA 2Y0MA 1KUXA 3R9GA 5DWNA 1S3ZA 4NXYA 3I3GA 4AVBA 4KOVA 4I49A 5H84A 2ZW7A 2FSRA 1QSTA 4LUAA 2DXQA 1Q2DA 4R87A 3EC4A 4H6UA 2RC4A 1PUAA 2FIAA 4HKFA 4B5OA 2PDOA 3TOAA 3PP9A 4KORA 4XPKA 2REEA 2JDCA 1U6MA 1B87A 2H5MA 4JWPA 2HUZA 2P6EA 3I9SA 2OZUA 1NE9A 2D4OA 2GE3A 2ARHA 3ZJ0A 4B5PA 4ORFA 3FXTA 3GKRA 4HNWB 2ATRA 4F0YA 3E0KA 2J8MA 5E96A 1XE4A 2O28A 2X7BA
chains in the Genus database with same CATH superfamily
4AXVA 4KVME 4OIDA 4EFDA 3S6GA 4CYNA 2ZXVA 4OAEA 4PXBA 1FT7A 1TKFA 4MJ8A 3BJ8A 1Z8XA 3IEHA 4KZTA 1FNOA 2RB7A 4MCPA 2PC1A 3QAYA 4GM5A 2FT0A 2KCWA 1GHEA 4KOWA 4KSFA 3FJUA 2Q51A 2I79A 1TKJA 1LCPA 2OH1A 1Q2YA 2ABZA 3B3VA 3IC1A 2F7VA 3MGDA 4F8ZA 4HNXB 5IB0A 2PR1A 5G21A 1KWMA 1J4JA 2OR4A 2FS5A 2OZGA 1YR0A 1F2OA 2V77A 2GLJA 1L0CA 4Y49C 3K9TA 3EY5A 1R3NA 4B11A 1Q7LA 2G0BA 2O53A 4NEXA 2G9DA 2I3CA 3IWGA 4X3RA 4FBEA 3D68A 1IOIA 4KSAA 1S60A 2PJBA 4MCSA 4MFPA 4FD6A 4AVCA 4MFQA 2OZHA 4QBJA 4Z65A 4QVTA 4P45A 4BD9A 3R96A 1CX8A 1YK3A 1M4IA 3OWCA 2YNCC 4KLVA 2BSWA 5F48A 1M1DA 1SQHA 4QB9A 3K2KA 2P0WA 2J9AA 2PJ2A 4R9MA 4UWJA 2ZOFA 1DTDA 4LQ6A 1S5KA 4CGNA 3F0AA 1QSMA 1R43A 3TE4A 5AGEA 1I1DA 3VWEA 4MHNA 1IB1E 4Y49B 5KTAA 2V8GA 3CXQA 2R98A 4H89A 4JLYA 2CNSA 3FX6A 4OLLA 1YREA 8CPAA 1JWQA 5G1ZA 2PJCA 2C27A 2Q4VA 3PBEA 4MFZA 2O4HA 2A4NA 3F5BA 5K8OA 2WPWA 3LODA 4TWEA 1QMUA 3DR8A 2POKA 2PJ0A 1VIXA 4E2AA 1S7NA 4PXCA 5F46A 3LD2A 4MCRA 1ON0A 4Q7AA 2PJ5A 3R1KA 3SJEA 4RI1A 4KOUA 1ZG9A 4OC1A 1FY7A 3D7DA 4TNUA 1CM0A 4A38A 2VZZA 4UIAA 1XMTA 4RUHA 4MXUA 2PJ4A 4ZX8A 2PRQA 1MK4A 1QSOA 2WYRA 3CDXA 1Y7RA 3G3SA 2HC9A 4C7IA 2C6CA 4AVAA 2QECA 3B2YA 4C2YA 1KUVA 3V38A 4MHZA 4FAIA 1Z8TA 4C2XA 4KOXA 4P6YA 1BPNA 4OC4A 2FVGA 5HVHA 5KTDA 3CXPA 3ISXA 5EMIA 2JLMA 1Y9KA 3B3CA 3PFOA 4L8AA 4NGTA 2I00A 2CXAA 3FRMA 2PRBA 3GUXA 4CGMA 4RN7A 2ZOGA 3H5ZA 4OC2A 3S9LA 1BO4A 1M44A 2QJ8A 5HVGA 1F2PA 1YSJA 2BOAA 3EFAA 1ELLP 3P2FA 3DNSA 4B13A 5HH1A 4MHYA 4IK2A 4M6HA 4OIWA 5D8NA 4L89A 3NFZA 3RZAA 2Z0ZA 3P2HA 4R7MA 1QQ9A 4B6ZA 4B12A 2VBQA 2JDDA 1N71A 3TTHA 4ZBGA 4F9VA 1Y9WA 1YVKA 3IO1A 4J3GA 2GLFA 4JJXA 3CZXA 4NGRA 4UCNA 2VQYA 3LWUA 3PRTA 2PIYA 2Q7BA 4KUBA 3EO4A 4IF5A 4CAWA 4AG9A 4F0XA 2Z3MA 5LYFA 6CPAA 3VARA 3BLNA 2EVNA 4OP4A 2FE7A 4PPZA 1AYEA 2J8RA 5A27A 2AJ6A 4GS4A 1Y0RA 3VWDA 3R9EA 5LRGA 5IV0A 3RBUA 3B35A 4B10A 2GIVA 4JXQA 4XPLA 2PJ8A 2GU2A 4A32A 2Q44A 3D7FA 2ZEOA 2ODFA 2PQ8A 3F8KA 4FD4A 3FMCA 3KR5A 2VI7A 3PFEA 4MY0A 2AFSA 3T8WA 4AG7A 3D2PA 2QYVA 5JGFA 1BPMA 1IICA 3N7ZA 2FL4A 4CRYB 2FIWA 4JXRA 4KVXA 3T9YA 2Z11A 5BWAB 4A33A 5C82A 1KZFA 3FYNA 4UWIA 5IX3A 3TFYA 2ZEMA 3FNCA 4R57A 1TIQA 2B5GB 5I0CA 4QC6A 5GCNA 1NSLA 2AFUA 3RNZA 4MRIA 3KQXA 3TO7A 2F5IA 2HQYA 4CRZB 4YFJA 5ISVA 4YGOA 4NGPA 1YW6A 3PB6X 3VATA 3QNVA 4A39A 4MHDA 4KOSA 4XPDC 4KLWA 2AFOA 1XOVA 1WWZA 2DPSA 1ELMP 4R6TA 2IMOA 4A2ZA 1RTQA 3NE7A 2QVPA 2YNEA 3K9UA 3IIBA 2WUUA 4PSWA 1XF8A 4UCPA 1ZLIA 4UFWA 2GANA 3PGPA 2NYQA 1R57A 1XBUA 5THWA 2B3UA 3MRUA 4YU9A 3CXSA 2ZPAA 4MFLA 4ZYQA 4KUAA 3WC6A 4H6ZA 4MI4A 3ZZIA 1DE4C 1HEEA 3KI9A 1NMTA 2WPXA 3PB7X 1ZO0A 3WT4A 1RXTA 1S7LA 2Z3KA 3HUVA 1IU8A 1BOBA 2CY2A 3I1UA 3H8GA 2V8DA 3SHPA 4EMEA 5LYLA 4PSXA 5ELYA 4XPDB 1JQGA 4PV6A 4FWUA 3B3TA 3DR6A 3TOBA 2VXKA 3PB4X 4AB7A 7CPAA 3B8GA 2EUIA 2PJ9A 3RYOA 4ZI6A 1YX0A 1TF8A 3S6HA 2D4PA 1OZPA 3NA6A 1Z5RA 2IQ6A 1F57A 1IGBA 4NCZA 4BMHA 5LRKA 3R9FA 1XRYA 3SJFA 2EK9A 2K5TA 3FECA 4ONWA 4DNCA 3DDDA 4JD6A 3NH4A 4NJRA 3TO6A 3QAHA 2RFHA 4P4DA 1Y7EA 4UF4A 3SXOA 1WK4A 3BI0A 3KHXA 1I12A 1XJOA 5J8CA 4P4JA 1MJAA 2GFQA 3D7GA 4P4IA 4G1PA 1LAMA 2B5GA 4NGQA 1ZLHA 3WABA 1YMEA 1S7FA 1KUYA 1YLOA 2EBJA 4PXDA 1ARLA 3SJXA 3EXNA 4UEFA 3S9MA 3GB0A 3TX8A 2EWBA 5C88A 4CAFA 2G3AA 2FCKA 1HDUA 3D4UA 1LRZA 2OU2A 3TCVA 4C2ZA 2ZEEA 3CPAA 1CBXA 3W91A 2AFWA 4CGOA 2YGWA 3KKWA 1MJBA 5CPAA 3D67A 4OC5A 2ZEDA 3IJ3A 2OB0A 4BINA 3DLJA 2P6GA 4A30A 4F6AA 5LYIA 4M3SA 5K8PA 1X10A 4DJLA 5G20A 4B14A 1YLEA 4PXEA 3RO0A 3H8EA 2Q04A 3GY9A 4FD7A 1TF9A 4X5KA 2ZW5A 5H86A 5K8NA 4KVOE 1XEBA 3IWWA 3V7ZA 2PSWA 3FVLA 2ZW4A 4BBHA 2BO9A 2JBJA 1HDQA 2PCUA 4OADA 4CAVA 4CAXA 2ZW6A 1VHEA 4F9UA 2XEJA 2PR8A 2R7HA 4U9ZA 5F47A 3WC5A 4QUSA 3PB8X 4XNHC 5F49A 5JPHA 3FB3A 2REFA 4MFKA 2EO8A 2Z3PA 1Y0YA 4ZX9A 3W6SA 4KOTA 1P0HA 1EE3P 1X12A 2ZEHA 2CNMA 3UY5A 1VKCA 2ZEPA 1LFWA 4GXHA 3V8IA 2BEIA 2B4DB 5EBVA 1LANA 1M4LA 2PJ3A 2QIRA 1AMPA 2VEZA 4R3LA 1Z8WA 1M4GA 3DGVA 3PEIA 4C7HA 5F09A 2VZYA 1YQEA 2PJAA 4MCQA 4CYQA 4K3NA 1BAVA 4MY3A 2YNCA 2P6FA 5HMNA 2OOTA 4MMOA 3S6FA 4NF1A 2CIJA 1IIDA 2B4BA 3MN8A 5DWMA 2CTCA 1I21A 1YGHA 2ANPA 3LMSA 4PQAA 2EK8A 4M6IA 4PK3A 3KL9A 2Q7SA 3H4QA 4O23A 2FXFA 1Z9UA 4U9YA 1MJ9A 4XNHB 4EVYA 4KOYA 5IB9A 3S9NA 4FD5A 1LAPA 3PZJA 1AUGA 5AG7A 4ZY0A 4CGLA 1UFHA 2ZENA 3A9LA 3B7IA 3BI1A 2BL1A 2AFMA 2HB6A 3N5FA 2Z10A 4WWVA 5DS0A 5FVJA 4EWTA 1YVOA 4UFXA 4IHMA 2XEIA 3D2MA 2Z3NA 2WZNA 2C1CA 2PJ1A 4Q38A 4UFVA 4X8IA 4NSQA 1B6BA 3G8WA 4JZ0A 3KGQA 3SI1A 3NH8A 1ARMA 2R1IA 3FEDA 3SXNA 4NFRA 4UEZA 5KTCA 3BJ7A 4ONUA 4U5YA 4ZY2A 4CS0B 2AFZA 2B58A 1XMBA 5J8FA 3JTKA 4MBUA 1M4DA 2JBKA 2PIZA 2WSAA 1P4NA 3JRUA 4ZGYB 4Q36A 2B3VA 4R8FA 3SI2A 1A2ZA 3JVNA 3GYAA 3S6KA 2Q4ZA 4E0AA 3DSBA 2JEVA 1OBRA 1Z4RA 5CNPA 2V8VA 4E8OA 3JUWA 4OKOA 4II9A 1IYKA 1VHSA 3C26A 2Q0YA 2PVVA 3IGRA 1VGYA 5AG5A 4CAEA 4DUKA 3KR4A 4IUSA 3D3SA 2XEGA 4HNYB 5J1QA 2IL4A 2AE6A 2B4DA 2BUEA 3WC7A 2Q4YA 1PYTB 1IYLA 5I4MA 1CJWA 3IU1A 2Q43A 2GREA 3FIXA 3FEEA 4UA3A 3LACA 3FBUA 4UBRA 4A95A 5K8MA 4NGMA 3GIUA 1K4JA 2NSMA 4OMEA 4PK2A 5EC4A 5A28A 1S7KA 2G3TA 1IOFA 1QSRA 2ZELA 4A94A 3WR7A 5LYDA 5JM6A 1V0CA 1BLLE 2V8HA 1VHOA 3KASA 1PU9A 4UEEA 3W6XA 3D8PA 3NE8A 1XIXA 4P4EA 4RS2A 2HV2A 1RO5A 2J8NA 4NGSA 2CNTA 1QSNA 2XEFA 3CPXA 4K30A 5CBMA 4P4FA 2CF4A 2PE3A 4M85A 3BHXA 4B5PB 1NSAA 2C6PA 2QMLA 1TXRA 1CPSA 4ZY1A 4H2KA 4W9YA 1Z8LA 3D7HA 3B3WA 1CP6A 4A37A 4LX9A 4UCMA 5JQ4A 3QB8A 3H8FA 4X2TA 2ZEGA 3T90A 3R95A 1ZG7A 2CTBA 3ISZA 4YRHA 1Q2CA 4IAVA 3TT2A 3KZWA 4JYWA 3IFEA 4R3KA 1PCAA 2PVWA 1Z4EA 4M6GA 4WJBA 3TO9A 2R8VA 2JEWA 2NMTA 2Y0MA 1KUXA 3R9GA 3GLJA 1IY7A 5DWNA 5AG4A 1S3ZA 3FH4A 3TC8A 4P10A 1GYTA 3RAMA 2DPTA 3VH9A 4NXYA 3I3GA 3B3SA 4A31A 1H8LA 1LOKA 4KOVA 4MHPA 4AVBA 4I49A 4CGPA 5H84A 4DYOA 2ZW7A 3D66A 2FSRA 1QSTA 4LUAA 2DXQA 2AFXA 4HPSA 1Q2DA 5LRJA 4R87A 1UWYA 3FF3A 3EC4A 3HLPA 4H6UA 2RC4A 1ZG8A 3KHZA 1CP7A 1PUAA 3SJGA 4MFJA 1XFOA 3SI0A 4P4BA 1Z2LA 2FIAA 2YNDA 4HKFA 4B5OA 2IJZA 4LQGA 5HVFA 2PJ7A 2ZEFA 4CYPA 2PDOA 3TOAA 3PP9A 4KORA 5AG6A 3CT9A 4XPKA 2REEA 3PB9X 3NH5A 2JDCA 4CPAA 2Z3LA 4NJQA 5HXDA 4P44A 1U6MA 1B87A 4NGNA 2H5MA 4JWPA 3PBBA 2DEAA 2HUZA 2P6EA 4C68A 3IWEA 3I9SA 4CYOA 3L2NA 1TKHA 1NE9A 2OZUA 2D4OA 2BCOA 2GE3A 2VL1A 2Z3OA 1CPXA 2ARHA 4KSIA 4KS9A 4R76A 3ZJ0A 4B5PA 4ORFA 4OC0A 1CG2A 2DF5A 3FXTA 3GKRA 2C6GA 4HNWB 3IU2A 3BXMA 2F8HA 2ATRA 4YWYA 5JH9A 4F0YA 3KQZA 5G22A 3E0KA 2J8MA 4UIBA 1YW4A 5D29A 5E96A 4FUUA 1XE4A 2PJ6A 4OC3A 2O28A 2X7BA
chains in the Genus database with same CATH topology
4KVME 3S6GA 4CYNA 2ZXVA 4OAEA 4MJ8A 3BJ8A 4KZTA 2PC1A 2FT0A 2KCWA 1GHEA 4KOWA 4KSFA 2I79A 2OH1A 1Q2YA 3MGDA 4HNXB 5IB0A 2PR1A 5G21A 1J4JA 2FS5A 2OZGA 1YR0A 1L0CA 4Y49C 3EY5A 4B11A 2G0BA 4NEXA 3IWGA 4KSAA 1S60A 4MFPA 4FD6A 4AVCA 4MFQA 2OZHA 4QBJA 4QVTA 3R96A 1YK3A 1M4IA 3OWCA 2YNCC 4KLVA 2BSWA 5F48A 1M1DA 1SQHA 4QB9A 2P0WA 4R9MA 4UWJA 1S5KA 4CGNA 3F0AA 1QSMA 3TE4A 5AGEA 1I1DA 3VWEA 4Y49B 1IB1E 5KTAA 3CXQA 4H89A 2R98A 4JLYA 2CNSA 4OLLA 1YREA 5G1ZA 2C27A 2Q4VA 4MFZA 2A4NA 3F5BA 2WPWA 3LODA 3DR8A 4E2AA 1S7NA 5F46A 3LD2A 1ON0A 3R1KA 4RI1A 4KOUA 1FY7A 1CM0A 2VZZA 1XMTA 1QSOA 1MK4A 1Y7RA 3G3SA 4C7IA 4AVAA 2QECA 4C2YA 1KUVA 4C2XA 4KOXA 5KTDA 3CXPA 2JLMA 1Y9KA 4L8AA 2I00A 2CXAA 3FRMA 2PRBA 4CGMA 3H5ZA 1BO4A 1M44A 3P2FA 3EFAA 4B13A 3DNSA 5HH1A 4L89A 2Z0ZA 3P2HA 4B12A 2VBQA 2JDDA 1N71A 3TTHA 4ZBGA 1Y9WA 1YVKA 4J3GA 4JJXA 4UCNA 2VQYA 2Q7BA 4KUBA 3EO4A 4IF5A 4CAWA 4AG9A 4F0XA 2Z3MA 3BLNA 2EVNA 2FE7A 2J8RA 5A27A 2AJ6A 4GS4A 3VWDA 3R9EA 5IV0A 4B10A 2GIVA 4JXQA 4XPLA 4A32A 2Q44A 2PQ8A 3F8KA 4FD4A 2VI7A 4MY0A 4AG7A 3D2PA 1IICA 3N7ZA 2FL4A 4CRYB 2FIWA 4JXRA 4KVXA 3T9YA 2Z11A 5BWAB 4A33A 5C82A 1KZFA 3FYNA 4UWIA 5IX3A 3TFYA 3FNCA 4R57A 1TIQA 2B5GB 5I0CA 4QC6A 5GCNA 1NSLA 3TO7A 2F5IA 2HQYA 4CRZB 4YFJA 5ISVA 4YGOA 4MHDA 4KOSA 4XPDC 4KLWA 1WWZA 2DPSA 4A2ZA 3NE7A 2YNEA 3K9UA 2WUUA 4PSWA 1XF8A 4UCPA 4UFWA 2GANA 3PGPA 1R57A 2B3UA 3CXSA 2ZPAA 4MFLA 4KUAA 4H6ZA 4MI4A 3ZZIA 1NMTA 2WPXA 1ZO0A 1RXTA 1S7LA 2Z3KA 1BOBA 2CY2A 3SHPA 4PSXA 4XPDB 4PV6A 3TOBA 3DR6A 2VXKA 4AB7A 3B8GA 2EUIA 3RYOA 1YX0A 3S6HA 2D4PA 1OZPA 4NCZA 4BMHA 3R9FA 2K5TA 4DNCA 3DDDA 4JD6A 3TO6A 3QAHA 3SXOA 1WK4A 5J8CA 1I12A 1MJAA 2B5GA 1S7FA 1KUYA 3EXNA 5C88A 4CAFA 2G3AA 2FCKA 3TCVA 1LRZA 2OU2A 4C2ZA 3W91A 4CGOA 2YGWA 3KKWA 1MJBA 2OB0A 2P6GA 4A30A 4F6AA 4M3SA 5G20A 4B14A 1YLEA 2Q04A 3GY9A 4FD7A 4X5KA 2ZW5A 5H86A 4KVOE 1XEBA 2PSWA 2ZW4A 4BBHA 4OADA 4CAVA 4CAXA 2ZW6A 2PR8A 2R7HA 4U9ZA 5F47A 4QUSA 4XNHC 5F49A 5JPHA 3FB3A 2REFA 4MFKA 2Z3PA 3W6SA 4KOTA 1P0HA 3UY5A 2CNMA 1VKCA 3V8IA 2BEIA 2B4DB 5EBVA 2QIRA 2VEZA 4R3LA 1M4GA 4C7HA 2VZYA 4CYQA 4MY3A 2YNCA 2P6FA 5HMNA 3S6FA 4NF1A 1IIDA 5DWMA 2B4BA 1I21A 1YGHA 4PK3A 3H4QA 2FXFA 1Z9UA 4U9YA 1MJ9A 4XNHB 4EVYA 4KOYA 4FD5A 3PZJA 5AG7A 4CGLA 1UFHA 3A9LA 2BL1A 2Z10A 5FVJA 1YVOA 4UFXA 3D2MA 2Z3NA 4UFVA 4Q38A 4NSQA 1B6BA 3G8WA 2R1IA 3SXNA 5KTCA 3BJ7A 4ONUA 4U5YA 4CS0B 2B58A 5J8FA 3JTKA 4MBUA 1M4DA 2WSAA 1P4NA 4ZGYB 4Q36A 2B3VA 3JVNA 3GYAA 3S6KA 4E0AA 3DSBA 2JEVA 5CNPA 1Z4RA 4E8OA 3JUWA 4II9A 1IYKA 1VHSA 3C26A 2Q0YA 3IGRA 5AG5A 4CAEA 4IUSA 3D3SA 4HNYB 2IL4A 2AE6A 2B4DA 2BUEA 2Q4YA 1IYLA 1CJWA 3IU1A 3FIXA 4UA3A 4UBRA 3FBUA 4A95A 1K4JA 4PK2A 5EC4A 5A28A 1S7KA 2G3TA 1QSRA 3WR7A 1V0CA 3W6XA 1PU9A 3D8PA 4RS2A 1XIXA 2HV2A 1RO5A 2J8NA 2CNTA 1QSNA 4K30A 4M85A 4B5PB 2QMLA 4LX9A 4UCMA 5JQ4A 3QB8A 3T90A 3R95A 4YRHA 1Q2CA 3TT2A 4R3KA 1Z4EA 3TO9A 2R8VA 2NMTA 2Y0MA 1KUXA 3R9GA 5DWNA 5AG4A 1S3ZA 2DPTA 4NXYA 3I3GA 4A31A 4AVBA 4KOVA 4I49A 4CGPA 5H84A 2ZW7A 2FSRA 1QSTA 4LUAA 2DXQA 1Q2DA 4R87A 3EC4A 4H6UA 2RC4A 1PUAA 4MFJA 2FIAA 2YNDA 4HKFA 4B5OA 4CYPA 2PDOA 3TOAA 3PP9A 4KORA 5AG6A 4XPKA 2REEA 2JDCA 2Z3LA 1U6MA 1B87A 2H5MA 4JWPA 2HUZA 2P6EA 4C68A 3IWEA 3I9SA 4CYOA 2OZUA 1NE9A 2D4OA 2GE3A 2Z3OA 2ARHA 3ZJ0A 4KS9A 4B5PA 4ORFA 3FXTA 3GKRA 4HNWB 3IU2A 2ATRA 4F0YA 5G22A 3E0KA 2J8MA 5E96A 1XE4A 2O28A 2X7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KVM E;  3S6G A;  2ZXV A;  4OAE A;  4MJ8 A;  3BJ8 A;  4KZT A;  2PC1 A;  2FT0 A;  2KCW A;  1GHE A;  4KOW A;  2I79 A;  2OH1 A;  1Q2Y A;  3MGD A;  4HNX B;  5IB0 A;  2PR1 A;  1J4J A;  2FS5 A;  2OZG A;  1YR0 A;  1L0C A;  4Y49 C;  3EY5 A;  2G0B A;  4NEX A;  3IWG A;  1S60 A;  4FD6 A;  4AVC A;  2OZH A;  4QBJ A;  4QVT A;  3R96 A;  1YK3 A;  1M4I A;  3OWC A;  4KLV A;  2BSW A;  5F48 A;  1M1D A;  1SQH A;  4QB9 A;  2P0W A;  4R9M A;  4UWJ A;  1S5K A;  3F0A A;  1QSM A;  3TE4 A;  1I1D A;  3VWE A;  4Y49 B;  1IB1 E;  5KTA A;  3CXQ A;  2R98 A;  4H89 A;  4JLY A;  2CNS A;  4OLL A;  1YRE A;  2C27 A;  2Q4V A;  2A4N A;  3F5B A;  2WPW A;  3LOD A;  3DR8 A;  4E2A A;  1S7N A;  5F46 A;  3LD2 A;  1ON0 A;  3R1K A;  4RI1 A;  4KOU A;  1FY7 A;  1CM0 A;  2VZZ A;  1XMT A;  1QSO A;  1MK4 A;  1Y7R A;  3G3S A;  4AVA A;  2QEC A;  1KUV A;  4KOX A;  5KTD A;  3CXP A;  2JLM A;  1Y9K A;  4L8A A;  2I00 A;  3FRM A;  2PRB A;  1BO4 A;  1M44 A;  3P2F A;  3EFA A;  3DNS A;  5HH1 A;  4L89 A;  2Z0Z A;  3P2H A;  2VBQ A;  2JDD A;  1N71 A;  3TTH A;  4ZBG A;  1Y9W A;  1YVK A;  4J3G A;  4JJX A;  2VQY A;  2Q7B A;  4KUB A;  3EO4 A;  4IF5 A;  4CAW A;  4AG9 A;  3BLN A;  2EVN A;  2FE7 A;  2J8R A;  2AJ6 A;  4GS4 A;  3VWD A;  3R9E A;  5IV0 A;  2GIV A;  4JXQ A;  4XPL A;  2Q44 A;  2PQ8 A;  3F8K A;  4FD4 A;  2VI7 A;  4MY0 A;  4AG7 A;  3D2P A;  1IIC A;  3N7Z A;  2FL4 A;  4CRY B;  2FIW A;  4JXR A;  4KVX A;  3T9Y A;  2Z11 A;  5C82 A;  1KZF A;  3FYN A;  4UWI A;  5IX3 A;  3TFY A;  3FNC A;  4R57 A;  1TIQ A;  2B5G B;  5I0C A;  4QC6 A;  5GCN A;  1NSL A;  3TO7 A;  2F5I A;  2HQY A;  4CRZ B;  4YFJ A;  5ISV A;  4YGO A;  4MHD A;  4KOS A;  4XPD C;  4KLW A;  1WWZ A;  3NE7 A;  3K9U A;  4PSW A;  1XF8 A;  2GAN A;  3PGP A;  1R57 A;  2B3U A;  3CXS A;  2ZPA A;  4KUA A;  4H6Z A;  4MI4 A;  3ZZI A;  1NMT A;  2WPX A;  1RXT A;  1S7L A;  1BOB A;  2CY2 A;  3SHP A;  4PSX A;  4XPD B;  4PV6 A;  3TOB A;  3DR6 A;  2VXK A;  4AB7 A;  3B8G A;  2EUI A;  3RYO A;  1YX0 A;  3S6H A;  2D4P A;  1OZP A;  4NCZ A;  4BMH A;  3R9F A;  2K5T A;  4DNC A;  3DDD A;  4JD6 A;  3TO6 A;  3QAH A;  3SXO A;  1WK4 A;  5J8C A;  1I12 A;  1MJA A;  2B5G A;  1S7F A;  1KUY A;  3EXN A;  5C88 A;  2G3A A;  2FCK A;  3TCV A;  1LRZ A;  2OU2 A;  3W91 A;  3KKW A;  1MJB A;  2OB0 A;  2P6G A;  4F6A A;  4M3S A;  1YLE A;  2Q04 A;  3GY9 A;  4FD7 A;  4X5K A;  2ZW5 A;  5H86 A;  4KVO E;  1XEB A;  2PSW A;  2ZW4 A;  4OAD A;  4CAV A;  4CAX A;  2ZW6 A;  2PR8 A;  2R7H A;  4U9Z A;  5F47 A;  4QUS A;  4XNH C;  5F49 A;  5JPH A;  3FB3 A;  2REF A;  3W6S A;  4KOT A;  1P0H A;  3UY5 A;  2CNM A;  1VKC A;  3V8I A;  2BEI A;  2B4D B;  5EBV A;  2QIR A;  2VEZ A;  4R3L A;  1M4G A;  2VZY A;  4MY3 A;  2P6F A;  5HMN A;  3S6F A;  4NF1 A;  1IID A;  5DWM A;  2B4B A;  1I21 A;  1YGH A;  4PK3 A;  3H4Q A;  2FXF A;  1Z9U A;  4U9Y A;  1MJ9 A;  4XNH B;  4EVY A;  4KOY A;  4FD5 A;  3PZJ A;  1UFH A;  2BL1 A;  2Z10 A;  5FVJ A;  1YVO A;  3D2M A;  4NSQ A;  1B6B A;  3G8W A;  2R1I A;  3SXN A;  5KTC A;  3BJ7 A;  4ONU A;  4U5Y A;  4CS0 B;  2B58 A;  5J8F A;  4MBU A;  1M4D A;  1P4N A;  2B3V A;  3JVN A;  3GYA A;  3S6K A;  4E0A A;  3DSB A;  2JEV A;  5CNP A;  1Z4R A;  4E8O A;  3JUW A;  4II9 A;  1IYK A;  1VHS A;  3C26 A;  2Q0Y A;  3IGR A;  4IUS A;  3D3S A;  4HNY B;  2IL4 A;  2AE6 A;  2B4D A;  2BUE A;  2Q4Y A;  1IYL A;  1CJW A;  3FIX A;  4UA3 A;  4UBR A;  3FBU A;  1K4J A;  4PK2 A;  5EC4 A;  1S7K A;  2G3T A;  1QSR A;  3WR7 A;  1V0C A;  3W6X A;  1PU9 A;  3D8P A;  4RS2 A;  1XIX A;  2HV2 A;  1RO5 A;  2J8N A;  2CNT A;  1QSN A;  4K30 A;  4M85 A;  4B5P B;  2QML A;  4LX9 A;  5JQ4 A;  3QB8 A;  3T90 A;  3R95 A;  4YRH A;  1Q2C A;  3TT2 A;  4R3K A;  1Z4E A;  3TO9 A;  2R8V A;  2NMT A;  2Y0M A;  1KUX A;  3R9G A;  5DWN A;  1S3Z A;  4NXY A;  3I3G A;  4AVB A;  4KOV A;  4I49 A;  5H84 A;  2ZW7 A;  2FSR A;  1QST A;  4LUA A;  2DXQ A;  1Q2D A;  4R87 A;  3EC4 A;  4H6U A;  2RC4 A;  1PUA A;  2FIA A;  4HKF A;  4B5O A;  2PDO A;  3TOA A;  3PP9 A;  4KOR A;  4XPK A;  2REE A;  2JDC A;  1U6M A;  1B87 A;  2H5M A;  4JWP A;  2HUZ A;  2P6E A;  3I9S A;  2OZU A;  1NE9 A;  2D4O A;  2GE3 A;  2ARH A;  3ZJ0 A;  4B5P A;  4ORF A;  3FXT A;  3GKR A;  4HNW B;  2ATR A;  4F0Y A;  3E0K A;  2J8M A;  5E96 A;  1XE4 A;  2O28 A;  2X7B A; 
#chains in the Genus database with same CATH topology
 4AXV A;  4KVM E;  4OID A;  4EFD A;  3S6G A;  4CYN A;  2ZXV A;  4OAE A;  4PXB A;  1FT7 A;  1TKF A;  4MJ8 A;  3BJ8 A;  1Z8X A;  3IEH A;  4KZT A;  1FNO A;  2RB7 A;  4MCP A;  2PC1 A;  3QAY A;  4GM5 A;  2FT0 A;  2KCW A;  1GHE A;  4KOW A;  4KSF A;  3FJU A;  2Q51 A;  2I79 A;  1TKJ A;  1LCP A;  2OH1 A;  1Q2Y A;  2ABZ A;  3B3V A;  3IC1 A;  2F7V A;  3MGD A;  4F8Z A;  4HNX B;  5IB0 A;  2PR1 A;  5G21 A;  1KWM A;  1J4J A;  2OR4 A;  2FS5 A;  2OZG A;  1YR0 A;  1F2O A;  2V77 A;  2GLJ A;  1L0C A;  4Y49 C;  3K9T A;  3EY5 A;  1R3N A;  4B11 A;  1Q7L A;  2G0B A;  2O53 A;  4NEX A;  2G9D A;  2I3C A;  3IWG A;  4X3R A;  4FBE A;  3D68 A;  1IOI A;  4KSA A;  1S60 A;  2PJB A;  4MCS A;  4MFP A;  4FD6 A;  4AVC A;  4MFQ A;  2OZH A;  4QBJ A;  4Z65 A;  4QVT A;  4P45 A;  4BD9 A;  3R96 A;  1CX8 A;  1YK3 A;  1M4I A;  3OWC A;  2YNC C;  4KLV A;  2BSW A;  5F48 A;  1M1D A;  1SQH A;  4QB9 A;  3K2K A;  2P0W A;  2J9A A;  2PJ2 A;  4R9M A;  4UWJ A;  2ZOF A;  1DTD A;  4LQ6 A;  1S5K A;  4CGN A;  3F0A A;  1QSM A;  1R43 A;  3TE4 A;  5AGE A;  1I1D A;  3VWE A;  4MHN A;  1IB1 E;  4Y49 B;  5KTA A;  2V8G A;  3CXQ A;  2R98 A;  4H89 A;  4JLY A;  2CNS A;  3FX6 A;  4OLL A;  1YRE A;  8CPA A;  1JWQ A;  5G1Z A;  2PJC A;  2C27 A;  2Q4V A;  3PBE A;  4MFZ A;  2O4H A;  2A4N A;  3F5B A;  5K8O A;  2WPW A;  3LOD A;  4TWE A;  1QMU A;  3DR8 A;  2POK A;  2PJ0 A;  1VIX A;  4E2A A;  1S7N A;  4PXC A;  5F46 A;  3LD2 A;  4MCR A;  1ON0 A;  4Q7A A;  2PJ5 A;  3R1K A;  3SJE A;  4RI1 A;  4KOU A;  1ZG9 A;  4OC1 A;  1FY7 A;  3D7D A;  4TNU A;  1CM0 A;  4A38 A;  2VZZ A;  4UIA A;  1XMT A;  4RUH A;  4MXU A;  2PJ4 A;  4ZX8 A;  2PRQ A;  1MK4 A;  1QSO A;  2WYR A;  3CDX A;  1Y7R A;  3G3S A;  2HC9 A;  4C7I A;  2C6C A;  4AVA A;  2QEC A;  3B2Y A;  4C2Y A;  1KUV A;  3V38 A;  4MHZ A;  4FAI A;  1Z8T A;  4C2X A;  4KOX A;  4P6Y A;  1BPN A;  4OC4 A;  2FVG A;  5HVH A;  5KTD A;  3CXP A;  3ISX A;  5EMI A;  2JLM A;  1Y9K A;  3B3C A;  3PFO A;  4L8A A;  4NGT A;  2I00 A;  2CXA A;  3FRM A;  2PRB A;  3GUX A;  4CGM A;  4RN7 A;  2ZOG A;  3H5Z A;  4OC2 A;  3S9L A;  1BO4 A;  1M44 A;  2QJ8 A;  5HVG A;  1F2P A;  1YSJ A;  2BOA A;  3EFA A;  1ELL P;  3P2F A;  3DNS A;  4B13 A;  5HH1 A;  4MHY A;  4IK2 A;  4M6H A;  4OIW A;  5D8N A;  4L89 A;  3NFZ A;  3RZA A;  2Z0Z A;  3P2H A;  4R7M A;  1QQ9 A;  4B6Z A;  4B12 A;  2VBQ A;  2JDD A;  1N71 A;  3TTH A;  4ZBG A;  4F9V A;  1Y9W A;  1YVK A;  3IO1 A;  4J3G A;  2GLF A;  4JJX A;  3CZX A;  4NGR A;  4UCN A;  2VQY A;  3LWU A;  3PRT A;  2PIY A;  2Q7B A;  4KUB A;  3EO4 A;  4IF5 A;  4CAW A;  4AG9 A;  4F0X A;  2Z3M A;  5LYF A;  6CPA A;  3VAR A;  3BLN A;  2EVN A;  4OP4 A;  2FE7 A;  4PPZ A;  1AYE A;  2J8R A;  5A27 A;  2AJ6 A;  4GS4 A;  1Y0R A;  3VWD A;  3R9E A;  5LRG A;  5IV0 A;  3RBU A;  3B35 A;  4B10 A;  2GIV A;  4JXQ A;  4XPL A;  2PJ8 A;  2GU2 A;  4A32 A;  2Q44 A;  3D7F A;  2ZEO A;  2ODF A;  2PQ8 A;  3F8K A;  4FD4 A;  3FMC A;  3KR5 A;  2VI7 A;  3PFE A;  4MY0 A;  2AFS A;  3T8W A;  4AG7 A;  3D2P A;  2QYV A;  5JGF A;  1BPM A;  1IIC A;  3N7Z A;  2FL4 A;  4CRY B;  2FIW A;  4JXR A;  4KVX A;  3T9Y A;  2Z11 A;  5BWA B;  4A33 A;  5C82 A;  1KZF A;  3FYN A;  4UWI A;  5IX3 A;  3TFY A;  2ZEM A;  3FNC A;  4R57 A;  1TIQ A;  2B5G B;  5I0C A;  4QC6 A;  5GCN A;  1NSL A;  2AFU A;  3RNZ A;  4MRI A;  3KQX A;  3TO7 A;  2F5I A;  2HQY A;  4CRZ B;  4YFJ A;  5ISV A;  4YGO A;  4NGP A;  1YW6 A;  3PB6 X;  3VAT A;  3QNV A;  4A39 A;  4MHD A;  4KOS A;  4XPD C;  4KLW A;  2AFO A;  1XOV A;  1WWZ A;  2DPS A;  1ELM P;  4R6T A;  2IMO A;  4A2Z A;  1RTQ A;  3NE7 A;  2QVP A;  2YNE A;  3K9U A;  3IIB A;  2WUU A;  4PSW A;  1XF8 A;  4UCP A;  1ZLI A;  4UFW A;  2GAN A;  3PGP A;  2NYQ A;  1R57 A;  1XBU A;  5THW A;  2B3U A;  3MRU A;  4YU9 A;  3CXS A;  2ZPA A;  4MFL A;  4ZYQ A;  4KUA A;  3WC6 A;  4H6Z A;  4MI4 A;  3ZZI A;  1DE4 C;  1HEE A;  3KI9 A;  1NMT A;  2WPX A;  3PB7 X;  1ZO0 A;  3WT4 A;  1RXT A;  1S7L A;  2Z3K A;  3HUV A;  1IU8 A;  1BOB A;  2CY2 A;  3I1U A;  3H8G A;  2V8D A;  3SHP A;  4EME A;  5LYL A;  4PSX A;  5ELY A;  4XPD B;  1JQG A;  4PV6 A;  4FWU A;  3B3T A;  3DR6 A;  3TOB A;  2VXK A;  3PB4 X;  4AB7 A;  7CPA A;  3B8G A;  2EUI A;  2PJ9 A;  3RYO A;  4ZI6 A;  1YX0 A;  1TF8 A;  3S6H A;  2D4P A;  1OZP A;  3NA6 A;  1Z5R A;  2IQ6 A;  1F57 A;  1IGB A;  4NCZ A;  4BMH A;  5LRK A;  3R9F A;  1XRY A;  3SJF A;  2EK9 A;  2K5T A;  3FEC A;  4ONW A;  4DNC A;  3DDD A;  4JD6 A;  3NH4 A;  4NJR A;  3TO6 A;  3QAH A;  2RFH A;  4P4D A;  1Y7E A;  4UF4 A;  3SXO A;  1WK4 A;  3BI0 A;  3KHX A;  1I12 A;  1XJO A;  5J8C A;  4P4J A;  1MJA A;  2GFQ A;  3D7G A;  4P4I A;  4G1P A;  1LAM A;  2B5G A;  4NGQ A;  1ZLH A;  3WAB A;  1YME A;  1S7F A;  1KUY A;  1YLO A;  2EBJ A;  4PXD A;  1ARL A;  3SJX A;  3EXN A;  4UEF A;  3S9M A;  3GB0 A;  3TX8 A;  2EWB A;  5C88 A;  4CAF A;  2G3A A;  2FCK A;  1HDU A;  3D4U A;  1LRZ A;  2OU2 A;  3TCV A;  4C2Z A;  2ZEE A;  3CPA A;  1CBX A;  3W91 A;  2AFW A;  4CGO A;  2YGW A;  3KKW A;  1MJB A;  5CPA A;  3D67 A;  4OC5 A;  2ZED A;  3IJ3 A;  2OB0 A;  4BIN A;  3DLJ A;  2P6G A;  4A30 A;  4F6A A;  5LYI A;  4M3S A;  5K8P A;  1X10 A;  4DJL A;  5G20 A;  4B14 A;  1YLE A;  4PXE A;  3RO0 A;  3H8E A;  2Q04 A;  3GY9 A;  4FD7 A;  1TF9 A;  4X5K A;  2ZW5 A;  5H86 A;  5K8N A;  4KVO E;  1XEB A;  3IWW A;  3V7Z A;  2PSW A;  3FVL A;  2ZW4 A;  4BBH A;  2BO9 A;  2JBJ A;  1HDQ A;  2PCU A;  4OAD A;  4CAV A;  4CAX A;  2ZW6 A;  1VHE A;  4F9U A;  2XEJ A;  2PR8 A;  2R7H A;  4U9Z A;  5F47 A;  3WC5 A;  4QUS A;  3PB8 X;  4XNH C;  5F49 A;  5JPH A;  3FB3 A;  2REF A;  4MFK A;  2EO8 A;  2Z3P A;  1Y0Y A;  4ZX9 A;  3W6S A;  4KOT A;  1P0H A;  1EE3 P;  1X12 A;  2ZEH A;  2CNM A;  3UY5 A;  1VKC A;  2ZEP A;  1LFW A;  4GXH A;  3V8I A;  2BEI A;  2B4D B;  5EBV A;  1LAN A;  1M4L A;  2PJ3 A;  2QIR A;  1AMP A;  2VEZ A;  4R3L A;  1Z8W A;  1M4G A;  3DGV A;  3PEI A;  4C7H A;  5F09 A;  2VZY A;  1YQE A;  2PJA A;  4MCQ A;  4CYQ A;  4K3N A;  1BAV A;  4MY3 A;  2YNC A;  2P6F A;  5HMN A;  2OOT A;  4MMO A;  3S6F A;  4NF1 A;  2CIJ A;  1IID A;  2B4B A;  3MN8 A;  5DWM A;  2CTC A;  1I21 A;  1YGH A;  2ANP A;  3LMS A;  4PQA A;  2EK8 A;  4M6I A;  4PK3 A;  3KL9 A;  2Q7S A;  3H4Q A;  4O23 A;  2FXF A;  1Z9U A;  4U9Y A;  1MJ9 A;  4XNH B;  4EVY A;  4KOY A;  5IB9 A;  3S9N A;  4FD5 A;  1LAP A;  3PZJ A;  1AUG A;  5AG7 A;  4ZY0 A;  4CGL A;  1UFH A;  2ZEN A;  3A9L A;  3B7I A;  3BI1 A;  2BL1 A;  2AFM A;  2HB6 A;  3N5F A;  2Z10 A;  4WWV A;  5DS0 A;  5FVJ A;  4EWT A;  1YVO A;  4UFX A;  4IHM A;  2XEI A;  3D2M A;  2Z3N A;  2WZN A;  2C1C A;  2PJ1 A;  4Q38 A;  4UFV A;  4X8I A;  4NSQ A;  1B6B A;  3G8W A;  4JZ0 A;  3KGQ A;  3SI1 A;  3NH8 A;  1ARM A;  2R1I A;  3FED A;  3SXN A;  4NFR A;  4UEZ A;  5KTC A;  3BJ7 A;  4ONU A;  4U5Y A;  4ZY2 A;  4CS0 B;  2AFZ A;  2B58 A;  1XMB A;  5J8F A;  3JTK A;  4MBU A;  1M4D A;  2JBK A;  2PIZ A;  2WSA A;  1P4N A;  3JRU A;  4ZGY B;  4Q36 A;  2B3V A;  4R8F A;  3SI2 A;  1A2Z A;  3JVN A;  3GYA A;  3S6K A;  2Q4Z A;  4E0A A;  3DSB A;  2JEV A;  1OBR A;  1Z4R A;  5CNP A;  2V8V A;  4E8O A;  3JUW A;  4OKO A;  4II9 A;  1IYK A;  1VHS A;  3C26 A;  2Q0Y A;  2PVV A;  3IGR A;  1VGY A;  5AG5 A;  4CAE A;  4DUK A;  3KR4 A;  4IUS A;  3D3S A;  2XEG A;  4HNY B;  5J1Q A;  2IL4 A;  2AE6 A;  2B4D A;  2BUE A;  3WC7 A;  2Q4Y A;  1PYT B;  1IYL A;  5I4M A;  1CJW A;  3IU1 A;  2Q43 A;  2GRE A;  3FIX A;  3FEE A;  4UA3 A;  3LAC A;  3FBU A;  4UBR A;  4A95 A;  5K8M A;  4NGM A;  3GIU A;  1K4J A;  2NSM A;  4OME A;  4PK2 A;  5EC4 A;  5A28 A;  1S7K A;  2G3T A;  1IOF A;  1QSR A;  2ZEL A;  4A94 A;  3WR7 A;  5LYD A;  5JM6 A;  1V0C A;  1BLL E;  2V8H A;  1VHO A;  3KAS A;  1PU9 A;  4UEE A;  3W6X A;  3D8P A;  3NE8 A;  1XIX A;  4P4E A;  4RS2 A;  2HV2 A;  1RO5 A;  2J8N A;  4NGS A;  2CNT A;  1QSN A;  2XEF A;  3CPX A;  4K30 A;  5CBM A;  4P4F A;  2CF4 A;  2PE3 A;  4M85 A;  3BHX A;  4B5P B;  1NSA A;  2C6P A;  2QML A;  1TXR A;  1CPS A;  4ZY1 A;  4H2K A;  4W9Y A;  1Z8L A;  3D7H A;  3B3W A;  1CP6 A;  4A37 A;  4LX9 A;  4UCM A;  5JQ4 A;  3QB8 A;  3H8F A;  4X2T A;  2ZEG A;  3T90 A;  3R95 A;  1ZG7 A;  2CTB A;  3ISZ A;  4YRH A;  1Q2C A;  4IAV A;  3TT2 A;  3KZW A;  4JYW A;  3IFE A;  4R3K A;  1PCA A;  2PVW A;  1Z4E A;  4M6G A;  4WJB A;  3TO9 A;  2R8V A;  2JEW A;  2NMT A;  2Y0M A;  1KUX A;  3R9G A;  3GLJ A;  1IY7 A;  5DWN A;  5AG4 A;  1S3Z A;  3FH4 A;  3TC8 A;  4P10 A;  1GYT A;  3RAM A;  2DPT A;  3VH9 A;  4NXY A;  3I3G A;  3B3S A;  4A31 A;  1H8L A;  1LOK A;  4KOV A;  4MHP A;  4AVB A;  4I49 A;  4CGP A;  5H84 A;  4DYO A;  2ZW7 A;  3D66 A;  2FSR A;  1QST A;  4LUA A;  2DXQ A;  2AFX A;  4HPS A;  1Q2D A;  5LRJ A;  4R87 A;  1UWY A;  3FF3 A;  3EC4 A;  3HLP A;  4H6U A;  2RC4 A;  1ZG8 A;  3KHZ A;  1CP7 A;  1PUA A;  3SJG A;  4MFJ A;  1XFO A;  3SI0 A;  4P4B A;  1Z2L A;  2FIA A;  2YND A;  4HKF A;  4B5O A;  2IJZ A;  4LQG A;  5HVF A;  2PJ7 A;  2ZEF A;  4CYP A;  2PDO A;  3TOA A;  3PP9 A;  4KOR A;  5AG6 A;  3CT9 A;  4XPK A;  2REE A;  3PB9 X;  3NH5 A;  2JDC A;  4CPA A;  2Z3L A;  4NJQ A;  5HXD A;  4P44 A;  1U6M A;  1B87 A;  4NGN A;  2H5M A;  4JWP A;  3PBB A;  2DEA A;  2HUZ A;  2P6E A;  4C68 A;  3IWE A;  3I9S A;  4CYO A;  3L2N A;  1TKH A;  1NE9 A;  2OZU A;  2D4O A;  2BCO A;  2GE3 A;  2VL1 A;  2Z3O A;  1CPX A;  2ARH A;  4KSI A;  4KS9 A;  4R76 A;  3ZJ0 A;  4B5P A;  4ORF A;  4OC0 A;  1CG2 A;  2DF5 A;  3FXT A;  3GKR A;  2C6G A;  4HNW B;  3IU2 A;  3BXM A;  2F8H A;  2ATR A;  4YWY A;  5JH9 A;  4F0Y A;  3KQZ A;  5G22 A;  3E0K A;  2J8M A;  4UIB A;  1YW4 A;  5D29 A;  5E96 A;  4FUU A;  1XE4 A;  2PJ6 A;  4OC3 A;  2O28 A;  2X7B A; 
#chains in the Genus database with same CATH homology
 4KVM E;  3S6G A;  4CYN A;  2ZXV A;  4OAE A;  4MJ8 A;  3BJ8 A;  4KZT A;  2PC1 A;  2FT0 A;  2KCW A;  1GHE A;  4KOW A;  4KSF A;  2I79 A;  2OH1 A;  1Q2Y A;  3MGD A;  4HNX B;  5IB0 A;  2PR1 A;  5G21 A;  1J4J A;  2FS5 A;  2OZG A;  1YR0 A;  1L0C A;  4Y49 C;  3EY5 A;  4B11 A;  2G0B A;  4NEX A;  3IWG A;  4KSA A;  1S60 A;  4MFP A;  4FD6 A;  4AVC A;  4MFQ A;  2OZH A;  4QBJ A;  4QVT A;  3R96 A;  1YK3 A;  1M4I A;  3OWC A;  2YNC C;  4KLV A;  2BSW A;  5F48 A;  1M1D A;  1SQH A;  4QB9 A;  2P0W A;  4R9M A;  4UWJ A;  1S5K A;  4CGN A;  3F0A A;  1QSM A;  3TE4 A;  5AGE A;  1I1D A;  3VWE A;  4Y49 B;  1IB1 E;  5KTA A;  3CXQ A;  4H89 A;  2R98 A;  4JLY A;  2CNS A;  4OLL A;  1YRE A;  5G1Z A;  2C27 A;  2Q4V A;  4MFZ A;  2A4N A;  3F5B A;  2WPW A;  3LOD A;  3DR8 A;  4E2A A;  1S7N A;  5F46 A;  3LD2 A;  1ON0 A;  3R1K A;  4RI1 A;  4KOU A;  1FY7 A;  1CM0 A;  2VZZ A;  1XMT A;  1QSO A;  1MK4 A;  1Y7R A;  3G3S A;  4C7I A;  4AVA A;  2QEC A;  4C2Y A;  1KUV A;  4C2X A;  4KOX A;  5KTD A;  3CXP A;  2JLM A;  1Y9K A;  4L8A A;  2I00 A;  2CXA A;  3FRM A;  2PRB A;  4CGM A;  3H5Z A;  1BO4 A;  1M44 A;  3P2F A;  3EFA A;  4B13 A;  3DNS A;  5HH1 A;  4L89 A;  2Z0Z A;  3P2H A;  4B12 A;  2VBQ A;  2JDD A;  1N71 A;  3TTH A;  4ZBG A;  1Y9W A;  1YVK A;  4J3G A;  4JJX A;  4UCN A;  2VQY A;  2Q7B A;  4KUB A;  3EO4 A;  4IF5 A;  4CAW A;  4AG9 A;  4F0X A;  2Z3M A;  3BLN A;  2EVN A;  2FE7 A;  2J8R A;  5A27 A;  2AJ6 A;  4GS4 A;  3VWD A;  3R9E A;  5IV0 A;  4B10 A;  2GIV A;  4JXQ A;  4XPL A;  4A32 A;  2Q44 A;  2PQ8 A;  3F8K A;  4FD4 A;  2VI7 A;  4MY0 A;  4AG7 A;  3D2P A;  1IIC A;  3N7Z A;  2FL4 A;  4CRY B;  2FIW A;  4JXR A;  4KVX A;  3T9Y A;  2Z11 A;  5BWA B;  4A33 A;  5C82 A;  1KZF A;  3FYN A;  4UWI A;  5IX3 A;  3TFY A;  3FNC A;  4R57 A;  1TIQ A;  2B5G B;  5I0C A;  4QC6 A;  5GCN A;  1NSL A;  3TO7 A;  2F5I A;  2HQY A;  4CRZ B;  4YFJ A;  5ISV A;  4YGO A;  4MHD A;  4KOS A;  4XPD C;  4KLW A;  1WWZ A;  2DPS A;  4A2Z A;  3NE7 A;  2YNE A;  3K9U A;  2WUU A;  4PSW A;  1XF8 A;  4UCP A;  4UFW A;  2GAN A;  3PGP A;  1R57 A;  2B3U A;  3CXS A;  2ZPA A;  4MFL A;  4KUA A;  4H6Z A;  4MI4 A;  3ZZI A;  1NMT A;  2WPX A;  1ZO0 A;  1RXT A;  1S7L A;  2Z3K A;  1BOB A;  2CY2 A;  3SHP A;  4PSX A;  4XPD B;  4PV6 A;  3TOB A;  3DR6 A;  2VXK A;  4AB7 A;  3B8G A;  2EUI A;  3RYO A;  1YX0 A;  3S6H A;  2D4P A;  1OZP A;  4NCZ A;  4BMH A;  3R9F A;  2K5T A;  4DNC A;  3DDD A;  4JD6 A;  3TO6 A;  3QAH A;  3SXO A;  1WK4 A;  5J8C A;  1I12 A;  1MJA A;  2B5G A;  1S7F A;  1KUY A;  3EXN A;  5C88 A;  4CAF A;  2G3A A;  2FCK A;  3TCV A;  1LRZ A;  2OU2 A;  4C2Z A;  3W91 A;  4CGO A;  2YGW A;  3KKW A;  1MJB A;  2OB0 A;  2P6G A;  4A30 A;  4F6A A;  4M3S A;  5G20 A;  4B14 A;  1YLE A;  2Q04 A;  3GY9 A;  4FD7 A;  4X5K A;  2ZW5 A;  5H86 A;  4KVO E;  1XEB A;  2PSW A;  2ZW4 A;  4BBH A;  4OAD A;  4CAV A;  4CAX A;  2ZW6 A;  2PR8 A;  2R7H A;  4U9Z A;  5F47 A;  4QUS A;  4XNH C;  5F49 A;  5JPH A;  3FB3 A;  2REF A;  4MFK A;  2Z3P A;  3W6S A;  4KOT A;  1P0H A;  3UY5 A;  2CNM A;  1VKC A;  3V8I A;  2BEI A;  2B4D B;  5EBV A;  2QIR A;  2VEZ A;  4R3L A;  1M4G A;  4C7H A;  2VZY A;  4CYQ A;  4MY3 A;  2YNC A;  2P6F A;  5HMN A;  3S6F A;  4NF1 A;  1IID A;  5DWM A;  2B4B A;  1I21 A;  1YGH A;  4PK3 A;  3H4Q A;  2FXF A;  1Z9U A;  4U9Y A;  1MJ9 A;  4XNH B;  4EVY A;  4KOY A;  4FD5 A;  3PZJ A;  5AG7 A;  4CGL A;  1UFH A;  3A9L A;  2BL1 A;  2Z10 A;  5FVJ A;  1YVO A;  4UFX A;  3D2M A;  2Z3N A;  4UFV A;  4Q38 A;  4NSQ A;  1B6B A;  3G8W A;  2R1I A;  3SXN A;  5KTC A;  3BJ7 A;  4ONU A;  4U5Y A;  4CS0 B;  2B58 A;  5J8F A;  3JTK A;  4MBU A;  1M4D A;  2WSA A;  1P4N A;  4ZGY B;  4Q36 A;  2B3V A;  3JVN A;  3GYA A;  3S6K A;  4E0A A;  3DSB A;  2JEV A;  5CNP A;  1Z4R A;  4E8O A;  3JUW A;  4II9 A;  1IYK A;  1VHS A;  3C26 A;  2Q0Y A;  3IGR A;  5AG5 A;  4CAE A;  4IUS A;  3D3S A;  4HNY B;  2IL4 A;  2AE6 A;  2B4D A;  2BUE A;  2Q4Y A;  1IYL A;  1CJW A;  3IU1 A;  3FIX A;  4UA3 A;  4UBR A;  3FBU A;  4A95 A;  1K4J A;  4PK2 A;  5EC4 A;  5A28 A;  1S7K A;  2G3T A;  1QSR A;  3WR7 A;  1V0C A;  3W6X A;  1PU9 A;  3D8P A;  4RS2 A;  1XIX A;  2HV2 A;  1RO5 A;  2J8N A;  2CNT A;  1QSN A;  4K30 A;  4M85 A;  4B5P B;  2QML A;  4LX9 A;  4UCM A;  5JQ4 A;  3QB8 A;  3T90 A;  3R95 A;  4YRH A;  1Q2C A;  3TT2 A;  4R3K A;  1Z4E A;  3TO9 A;  2R8V A;  2NMT A;  2Y0M A;  1KUX A;  3R9G A;  5DWN A;  5AG4 A;  1S3Z A;  2DPT A;  4NXY A;  3I3G A;  4A31 A;  4AVB A;  4KOV A;  4I49 A;  4CGP A;  5H84 A;  2ZW7 A;  2FSR A;  1QST A;  4LUA A;  2DXQ A;  1Q2D A;  4R87 A;  3EC4 A;  4H6U A;  2RC4 A;  1PUA A;  4MFJ A;  2FIA A;  2YND A;  4HKF A;  4B5O A;  4CYP A;  2PDO A;  3TOA A;  3PP9 A;  4KOR A;  5AG6 A;  4XPK A;  2REE A;  2JDC A;  2Z3L A;  1U6M A;  1B87 A;  2H5M A;  4JWP A;  2HUZ A;  2P6E A;  4C68 A;  3IWE A;  3I9S A;  4CYO A;  2OZU A;  1NE9 A;  2D4O A;  2GE3 A;  2Z3O A;  2ARH A;  3ZJ0 A;  4KS9 A;  4B5P A;  4ORF A;  3FXT A;  3GKR A;  4HNW B;  3IU2 A;  2ATR A;  4F0Y A;  5G22 A;  3E0K A;  2J8M A;  5E96 A;  1XE4 A;  2O28 A;  2X7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...