4OADA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with chloramphenicol
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
160
structure length
160
Chain Sequence
HMQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GNAT superfamily acetyltransferase PA4794
publication title Crystal structure of a GNAT superfamily acetyltransferase PA4794 in complex with chloramphenicol
rcsb
source organism Pseudomonas aeruginosa
total genus 44
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2014-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4oadA00
5GCNA 1QSOA 4NEXA 5I0CA 2HUZA 2H5MA 4KOXA 1MJBA 4FD4A 4KOSA 5EC4A 3TOAA 2OU2A 3I3GA 1B87A 4MY3A 3F5BA 3QAHA 2HQYA 2PQ8A 1M4IA 2OH1A 2J8MA 4ZBGA 2P6GA 3F8KA 1NMTA 1XF8A 4KOUA 3TCVA 3RYOA 3NE7A 3N7ZA 3ZJ0A 4B5OA 4OADA 5C88A 4CAXA 2GANA 4KLWA 4KORA 3SXNA 4R3LA 2Q44A 4XPLA 3TE4A 3GY9A 4QC6A 4R9MA 1GHEA 4GS4A 2FE7A 3DDDA 5IV0A 1MJ9A 5KTDA 2K5TA 1CJWA 3B8GA 4ORFA 5HH1A 2ZW4A 3EC4A 4XPDB 4PK3A 5DWMA 3S6HA 4L8AA 2QIRA 4R57A 1NSLA 4IF5A 2FS5A 4ONUA 5KTAA 1UFHA 2B5GB 4AVAA 2I00A 2OZGA 2DXQA 2EUIA 4KUAA 2G0BA 3D3SA 1Z9UA 5J8FA 4LUAA 2OB0A 4KOTA 2Y0MA 4KUBA 1M44A 3CXSA 3TTHA 2B4BA 3GKRA 4QB9A 2EVNA 4JXRA 1PU9A 2REFA 3DR6A 2P0WA 1YR0A 4B5PA 3FIXA 3CXPA 3C26A 3S6KA 1IYLA 5EBVA 4CS0B 4E0AA 4JXQA 3F0AA 3S6GA 2ATRA 2VI7A 4UA3A 4OLLA 1M1DA 1CM0A 3FB3A 4NF1A 3OWCA 2G3AA 2Q0YA 2B4DA 3P2HA 2G3TA 2CNSA 5F49A 5IB0A 4X5KA 2IL4A 3LD2A 3FXTA 2Q7BA 2JEVA 1IIDA 2CNMA 2ZPAA 1I12A 3TFYA 3ZZIA 1YX0A 2J8RA 3TT2A 1IICA 2J8NA 2B3VA 3W6SA 4MHDA 3P2FA 4NCZA 3T9YA 1LRZA 1QSTA 3PZJA 3TO7A 1I1DA 1MJAA 1ON0A 3R1KA 2Q04A 4FD5A 3WR7A 4NXYA 1YK3A 4KLVA 3H4QA 1Q2DA 3T90A 2NMTA 5J8CA 2BEIA 4CAVA 4AB7A 4XNHC 4OAEA 1S7LA 1YVOA 2P6FA 2VZYA 2PDOA 2ZW7A 3VWEA 4K30A 2R1IA 5E96A 5ISVA 4HKFA 3D2MA 3DR8A 3FBUA 2I79A 2BL1A 5HMNA 4PSXA 4E2AA 2C27A 3IWGA 1RXTA 5H84A 3PP9A 2B4DB 4JLYA 3GYAA 2ZW5A 1YVKA 2D4PA 3R9EA 4CRYB 1BO4A 3W6XA 4RI1A 4M3SA 3BLNA 1B6BA 3G3SA 4KOVA 1PUAA 1WK4A 4JJXA 2PC1A 4U9YA 1KUYA 1IB1E 4MJ8A 3R9FA 2R98A 3KKWA 4F0YA 4XPKA 4AG7A 2CY2A 4HNWB 1P4NA 3EY5A 2F5IA 4PSWA 1WWZA 1S7NA 1Y9WA 2B58A 1XMTA 4E8OA 4H89A 3SHPA 1Q2CA 1Y7RA 3SXOA 2KCWA 2VQYA 5DWNA 4IUSA 4JWPA 1OZPA 3W91A 3FRMA 3LODA 4MI4A 1KZFA 5JPHA 3TO9A 3MGDA 3S6FA 2B3UA 4QUSA 2VXKA 2VBQA 3BJ8A 2QECA 2ARHA 5CNPA 1S3ZA 1S7FA 1K4JA 4FD7A 3R95A 1YLEA 4M85A 3UY5A 1S5KA 4H6ZA 1FY7A 2Q4YA 3E0KA 5F47A 1QSRA 4AG9A 2PR1A 5KTCA 4KVOE 3I9SA 3TOBA 3D8PA 2ZW6A 3V8IA 4MY0A 2O28A 3EO4A 2B5GA 4R87A 2Z11A 2D4OA 4NSQA 4AVBA 2VEZA 2FT0A 1XIXA 1BOBA 4LX9A 5IX3A 3TO6A 2FIWA 4XPDC 3DNSA 4KVXA 1VKCA 2PSWA 4L89A 1KUXA 1S60A 4B5PB 4CAWA 1S7KA 3R96A 2BSWA 5C82A 4F6AA 2Z0ZA 1I21A 5JQ4A 2BUEA 2X7BA 2QMLA 4R3KA 2JDCA 2R7HA 2P6EA 1V0CA 4QVTA 1TIQA 3VWDA 4H6UA 5F48A 4RS2A 3R9GA 3K9UA 1MK4A 1J4JA 1IYKA 3PGPA 2FCKA 2A4NA 4J3GA 3FYNA 3IGRA 4DNCA 4YFJA 4Y49C 4YRHA 4HNXB 4AVCA 4KOWA 4U5YA 4QBJA 3EXNA 1Y9KA 1NE9A 4EVYA 4YGOA 1Q2YA 2GIVA 1L0CA 2OZHA 4KVME 2R8VA 1QSMA 4XNHB 2ZXVA 4II9A 2Q4VA 4PV6A 1YGHA 4UBRA 3EFAA 2JDDA 1R57A 1P0HA 2PRBA 4KZTA 2OZUA 1U6MA 4CRZB 1M4DA 4MBUA 1KUVA 1SQHA 1M4GA 1XEBA 4UWJA 5FVJA 3G8WA 4JD6A 2HV2A 4PK2A 2AJ6A 4FD6A 3FNCA 2AE6A 2CNTA 1RO5A 1QSNA 1Z4EA 4U9ZA 4HNYB 2RC4A 2FXFA 3QB8A 4Y49B 1XE4A 3JVNA 2WPXA 4UWIA 2JLMA 3CXQA 5H86A 3JUWA 2REEA 2FL4A 4BMHA 2VZZA 4I49A 1Z4RA 2GE3A 5F46A 1VHSA 2PR8A 3DSBA 4KOYA 2WPWA 3BJ7A 2Z10A 1YREA 2FIAA 2FSRA 1N71A 3D2PA
chains in the Genus database with same CATH superfamily
4MFZA 5GCNA 5LYIA 1QSOA 4ZYQA 4UIBA 4MFPA 2V8DA 4NEXA 1DE4C 5I0CA 1Z8TA 2HUZA 2H5MA 2FVGA 4KOXA 5AG7A 4B14A 6CPAA 1MJBA 3BI0A 2CTCA 2POKA 4FD4A 4KOSA 1CBXA 5EC4A 3TOAA 5CPAA 4YWYA 2F7VA 2WZNA 3CT9A 4OC1A 2VL1A 2OU2A 3I3GA 1B87A 4MY3A 3A9LA 2PJAA 3D7FA 3F5BA 3QAHA 4MXUA 2ZENA 2HQYA 4CGNA 1Y7EA 2PQ8A 2AFZA 4TWEA 1M4IA 2OH1A 2J8MA 2IJZA 3FMCA 4NGTA 4ZBGA 4M6GA 2J9AA 2P6GA 3F8KA 1NMTA 1XF8A 4KOUA 3TCVA 3RYOA 3NE7A 1HEEA 3N7ZA 3ZJ0A 4B5OA 1Y0YA 4OADA 5C88A 3RO0A 1IGBA 4CAXA 2GANA 4MCRA 4KLWA 4KORA 4KSAA 3SXNA 4DUKA 5K8PA 4MHYA 3ISZA 4R3LA 3H5ZA 2Q44A 4XPLA 3TE4A 4DYOA 3N5FA 1TKFA 3GY9A 4QC6A 4C7IA 4P4DA 4R9MA 3D7GA 5THWA 4PXBA 1GHEA 4GS4A 2FE7A 3DDDA 5IV0A 2HC9A 1MJ9A 2DEAA 2ZEDA 5KTDA 2K5TA 2YNEA 4MMOA 2PVVA 3H8FA 4MCQA 3LWUA 4UEZA 1CJWA 3B8GA 5LYLA 2PIZA 2BOAA 4ORFA 5HH1A 4GM5A 2OR4A 2Z3KA 3V8IA 2ZW4A 3NA6A 3NFZA 4OIDA 3EC4A 4XPDB 4PK3A 5DWMA 1BPNA 3S6HA 4Q36A 4L8AA 5BWAB 1EE3P 2QIRA 4R57A 1NSLA 4IF5A 1ZO0A 2FS5A 4ONUA 2ZEGA 5KTAA 1UFHA 4NGPA 2B5GB 4P4FA 2EWBA 2ODFA 4X2TA 2I00A 4AVAA 4IHMA 1UWYA 2JBKA 2OZGA 2DXQA 2EUIA 4KUAA 4MHZA 2G0BA 5HVFA 3D3SA 4OP4A 3I1UA 4ONWA 3S9MA 2OOTA 1Z9UA 5J8FA 4LUAA 1H8LA 2OB0A 2CIJA 4PPZA 3FF3A 2Y0MA 3PEIA 4KOTA 1M44A 3CXSA 3PB6X 4KUBA 3TTHA 2B4BA 1IY7A 1TKJA 1R43A 3GKRA 1HDUA 4QB9A 1YQEA 2JEWA 5I4MA 1F2OA 2EVNA 2AFXA 2ZOGA 4JXRA 1PU9A 3PB9X 4OIWA 2REFA 3DR6A 4KS9A 2P0WA 1YR0A 3V7ZA 4B5PA 3IO1A 3KQXA 4G1PA 3FIXA 3FEEA 1VHEA 3C26A 3CXPA 1PYTB 3S6KA 1IYLA 3NH8A 5EBVA 4CS0B 4CYNA 4E0AA 1Z8WA 4JXQA 5K8MA 5LYFA 3SJEA 2PVWA 1IU8A 1YLOA 2ZEHA 3F0AA 3RBUA 2ATRA 2VI7A 1CPXA 4UA3A 4OLLA 1M1DA 1CM0A 3FB3A 3FX6A 5ELYA 4NF1A 3OWCA 3PB4X 4C2XA 1YMEA 2G3AA 2Q0YA 5HVHA 2AFMA 4FWUA 2B4DA 3P2HA 4M6HA 2G3TA 4UFWA 3S9NA 2CNSA 5F49A 5IB0A 3KASA 2PJ6A 5J1QA 2V77A 1VIXA 1X10A 5IB9A 4X5KA 2IL4A 3S9LA 2Q43A 3LD2A 1XJOA 3B35A 3B3VA 4R76A 3FXTA 2Q7BA 2JEVA 1IIDA 2CNMA 2ABZA 1I12A 2ZPAA 1VGYA 3TFYA 3ZZIA 3B3TA 1XBUA 3LMSA 4ZY2A 4CAFA 1BPMA 1YX0A 1ZG7A 4F8ZA 2J8RA 3GB0A 3TT2A 1IICA 2J8NA 2B3VA 3W6SA 4ZY1A 2WYRA 2NYQA 1RTQA 1AMPA 1YSJA 4MHDA 3P2FA 5D29A 4NCZA 3T9YA 4P44A 1LRZA 4O23A 1QSTA 4NGQA 3PZJA 3TO7A 1TF8A 1I1DA 1MJAA 1ON0A 2C6CA 3R1KA 4UF4A 5AGEA 2Q04A 4FD5A 3T8WA 3WR7A 4Z65A 4NXYA 2ZEMA 1YK3A 2V8HA 4KLVA 3H4QA 3HLPA 1Q2DA 5LRJA 3KR4A 2Z3NA 4P10A 3T90A 3CPXA 1DTDA 2NMTA 4X3RA 2NSMA 3KL9A 3V38A 5J8CA 1CG2A 4CGPA 1XFOA 2BEIA 1ZG9A 3RZAA 1LAMA 4CAVA 4AB7A 4XNHC 4OAEA 4OC4A 4UFXA 1S7LA 4NGSA 5HXDA 1LFWA 1YVOA 2P6FA 4LQ6A 2Q51A 2JBJA 2V8GA 2VZYA 5G1ZA 3KQZA 3PB7X 4B12A 2PDOA 2ZW7A 3VWEA 3B3WA 4OC3A 2DPTA 3SJGA 4K30A 2R1IA 5E96A 2QJ8A 5ISVA 3DR8A 3D2MA 4HKFA 2XEFA 3FECA 4MHPA 3FBUA 4EFDA 2I79A 2BL1A 5HMNA 1ELLP 4PSXA 4E2AA 2C27A 3IWGA 4UFVA 4MFJA 5JGFA 3IIBA 1RXTA 5H84A 3PP9A 2B4DB 2GLFA 3GYAA 3IWEA 4JLYA 2ZW5A 4P4BA 4C2ZA 1YVKA 2D4PA 2EBJA 3R9EA 2EK9A 2RB7A 3KI9A 4CRYB 1BO4A 3W6XA 2XEGA 4OC2A 2YNCA 4RI1A 4CYOA 4M3SA 4UCMA 3FEDA 3BLNA 1B6BA 3G3SA 4KOVA 4EWTA 2GU2A 4IAVA 1PUAA 3TC8A 1WK4A 2PJCA 1XOVA 3D67A 4IK2A 2O4HA 3B7IA 1FNOA 4CGOA 4JJXA 4MHNA 3MN8A 4CAEA 5D8NA 1NSAA 2Z3LA 4MFQA 2PC1A 2ZELA 4B6ZA 3PBBA 4Q38A 2PJ3A 4U9YA 2YNCC 3BHXA 1KUYA 3S6GA 1IB1E 4C7HA 4A95A 4MJ8A 3R9FA 2R98A 3KKWA 4F0YA 3B2YA 4XPKA 5F09A 4AG7A 5CBMA 2PJ8A 2CY2A 4OMEA 4P45A 1R3NA 2DF5A 4HNWB 4UCNA 2PIYA 1P4NA 4PXCA 1LCPA 3EY5A 2F5IA 2CF4A 4A2ZA 4PSWA 1WWZA 1S7NA 1Y9WA 2B58A 2WSAA 1XMTA 2WUUA 4W9YA 4MFLA 4E8OA 4H89A 2C6PA 2CXAA 4LQGA 3CZXA 4H2KA 4ZGYB 4PQAA 3SHPA 1Q2CA 1Y7RA 3FH4A 3SI1A 3SXOA 2KCWA 1IOFA 3PBEA 4B10A 1CP6A 2VQYA 5AG5A 5DWNA 4IUSA 3GIUA 5LYDA 4JWPA 4A30A 1OZPA 1TKHA 2PJ7A 3D7HA 3FRMA 3LODA 4MI4A 3W91A 1Z5RA 4RN7A 3K9TA 1CPSA 2C1CA 1TXRA 3SJFA 5EMIA 1KZFA 4BBHA 5AG6A 3TO9A 5JPHA 3MGDA 4JZ0A 3SI0A 1BLLE 3BI1A 3KHXA 1ELMP 3S6FA 2B3UA 1YW6A 2VXKA 4QUSA 2VBQA 3BJ8A 5LRKA 2QECA 2ARHA 5CNPA 1S3ZA 1S7FA 1K4JA 4FD7A 2PE3A 1YLEA 4M85A 2IMOA 1S5KA 4H6ZA 3R95A 3UY5A 4EMEA 1FY7A 2EK8A 2Q4YA 3E0KA 4P4EA 5F47A 1QSRA 2HB6A 4DJLA 5G21A 3WC7A 2I3CA 4A33A 4CGLA 4AG9A 3JRUA 3KR5A 4B13A 5AG4A 2ZEEA 2O53A 2PR1A 3CDXA 4FUUA 5KTCA 1GYTA 1A2ZA 4KVOE 3I9SA 4MFKA 3TOBA 2AFWA 2PJ5A 3D8PA 2G9DA 2ZW6A 1F57A 2GFQA 1YW4A 1HDQA 1XMBA 2ZOFA 4MY0A 2O28A 2PCUA 2B5GA 3EO4A 4R87A 2Z11A 2D4OA 4AXVA 3ISXA 4NSQA 4AVBA 5G20A 5JM6A 2VEZA 1X12A 2FT0A 4NGNA 1XIXA 1BOBA 4LX9A 4P4JA 4ZI6A 5IX3A 2CTBA 3SI2A 3D4UA 3TO6A 1TF9A 3WABA 4NFRA 2FIWA 3NH5A 4XPDC 1CP7A 3DNSA 4KVXA 4A94A 1VKCA 2PSWA 4A32A 2AFSA 2GREA 4L89A 2Z3MA 1KUXA 2Z3PA 4FBEA 1S60A 1LOKA 4CYQA 2QYVA 3IU1A 2ZEFA 3RAMA 1Z8LA 4B5PB 4CGMA 4F9UA 2DPSA 4CAWA 4NGMA 2XEJA 1S7KA 4WWVA 3SJXA 3FVLA 3R96A 2BSWA 5C82A 5JH9A 1F2PA 3JTKA 4B11A 4F6AA 4R6TA 3NE8A 1Z2LA 4RUHA 2Z0ZA 1QMUA 4CPAA 3IFEA 1I21A 4A31A 1Q7LA 4C68A 3WC6A 5JQ4A 3D66A 1KWMA 2F8HA 2BUEA 2X7BA 2QMLA 2ANPA 3GLJA 4TNUA 5G22A 3IJ3A 2YGWA 4R3KA 2JDCA 2R7HA 4WJBA 2P6EA 1V0CA 3NH4A 1TIQA 4QVTA 2Q7SA 3VWDA 4BINA 4H6UA 5F48A 4RS2A 3R9GA 3VH9A 3K9UA 1MK4A 1J4JA 2PJ1A 1IYKA 3PGPA 2FCKA 1ARMA 7CPAA 2A4NA 4J3GA 3FYNA 3IGRA 1ARLA 3KGQA 3PB8X 4MRIA 4DNCA 4YFJA 4Y49C 4P6YA 2AFUA 4ZY0A 4YRHA 4HNXB 3QAYA 1CX8A 4AVCA 1M4LA 2YNDA 4KOWA 4OKOA 4A39A 4OC5A 2AFOA 4U5YA 3IWWA 4QBJA 3EXNA 1Y9KA 1NE9A 4EVYA 4YGOA 1Q2YA 2GIVA 3WT4A 1L0CA 1XRYA 1AYEA 2OZHA 3RNZA 4KVME 4F0XA 4YU9A 2R8VA 5DS0A 4CYPA 2EO8A 1QSMA 2V8VA 4F9VA 3H8GA 3D68A 4XNHB 2ZXVA 4II9A 2Q4VA 4PV6A 4FAIA 3GUXA 4PXDA 1YGHA 4UBRA 3EFAA 3LACA 2JDDA 3D7DA 1JWQA 1R57A 1P0HA 1VHOA 2PRBA 4NJQA 4UIAA 4KZTA 1LAPA 2OZUA 5A28A 5LRGA 3MRUA 4R7MA 1U6MA 3CPAA 4UCPA 3KZWA 4CRZB 1M4DA 4MBUA 1KUVA 1SQHA 1M4GA 5K8OA 4NJRA 1XEBA 4OC0A 4UWJA 5FVJA 1PCAA 3PRTA 3G8WA 1QQ9A 3IU2A 4JD6A 3WC5A 4K3NA 2HV2A 3VARA 4PK2A 2BO9A 2PJBA 2ZEPA 2PJ4A 2PJ0A 3VATA 2ZEOA 4NGRA 2GLJA 3B3CA 3KHZA 2AJ6A 4ZX9A 4JYWA 4FD6A 1AUGA 4UEEA 3FNCA 2XEIA 5K8NA 2AE6A 1Y0RA 2Z3OA 2BCOA 4ZX8A 1LANA 1ZLIA 2CNTA 2PJ2A 5HVGA 1RO5A 1QSNA 1Z4EA 1ZG8A 4U9ZA 4MCSA 4HNYB 2RC4A 3HUVA 2FXFA 3QB8A 3H8EA 4A38A 1Z8XA 4KSFA 1XE4A 4Y49B 3JVNA 1FT7A 4MCPA 2C6GA 2WPXA 4UWIA 1OBRA 2JLMA 4A37A 3CXQA 3IEHA 2RFHA 4KSIA 5H86A 4BD9A 3B3SA 3JUWA 8CPAA 2REEA 2FL4A 2QVPA 4GXHA 4BMHA 4UEFA 2PRQA 3DGVA 5A27A 2Q4ZA 2VZZA 3PFOA 3QNVA 4I49A 4R8FA 1ZLHA 4P4IA 3DLJA 3IC1A 4X8IA 3PFEA 1Z4RA 2GE3A 2PJ9A 5F46A 1VHSA 2PR8A 3DSBA 4KOYA 2IQ6A 4HPSA 3TX8A 4PXEA 2WPWA 3BJ7A 3L2NA 4M6IA 2Z10A 4Q7AA 3BXMA 3FJUA 1BAVA 3K2KA 1YREA 2FIAA 2FSRA 1IOIA 1N71A 3D2PA 1JQGA 4C2YA
chains in the Genus database with same CATH topology
4MFZA 5GCNA 1QSOA 4MFPA 4NEXA 5I0CA 2HUZA 2H5MA 4KOXA 5AG7A 4B14A 1MJBA 4FD4A 4KOSA 5EC4A 3TOAA 2OU2A 3I3GA 1B87A 4MY3A 3A9LA 3F5BA 3QAHA 2HQYA 4CGNA 2PQ8A 1M4IA 2OH1A 2J8MA 4ZBGA 2P6GA 3F8KA 1NMTA 1XF8A 4KOUA 3TCVA 3RYOA 3NE7A 3N7ZA 3ZJ0A 4B5OA 4OADA 5C88A 4CAXA 2GANA 4KLWA 4KORA 4KSAA 3SXNA 4R3LA 3H5ZA 2Q44A 4XPLA 3TE4A 4C7IA 3GY9A 4QC6A 4R9MA 1GHEA 4GS4A 2FE7A 3DDDA 5IV0A 1MJ9A 5KTDA 2K5TA 2YNEA 1CJWA 3B8GA 4ORFA 5HH1A 2Z3KA 2ZW4A 3EC4A 4XPDB 4PK3A 5DWMA 3S6HA 4Q36A 4L8AA 5BWAB 2QIRA 4R57A 1NSLA 4IF5A 1ZO0A 2FS5A 4ONUA 5KTAA 1UFHA 2B5GB 4AVAA 2I00A 2OZGA 2DXQA 2EUIA 4KUAA 2G0BA 3D3SA 1Z9UA 5J8FA 4LUAA 2OB0A 4KOTA 2Y0MA 4KUBA 1M44A 3CXSA 3TTHA 2B4BA 3GKRA 4QB9A 2EVNA 4JXRA 1PU9A 2REFA 3DR6A 4KS9A 2P0WA 1YR0A 4B5PA 3FIXA 3CXPA 3C26A 3S6KA 1IYLA 5EBVA 4CS0B 4CYNA 4E0AA 4JXQA 3F0AA 3S6GA 2ATRA 2VI7A 4UA3A 4OLLA 1M1DA 1CM0A 3FB3A 4NF1A 3OWCA 4C2XA 2G3AA 2Q0YA 2B4DA 3P2HA 2G3TA 4UFWA 2CNSA 5F49A 5IB0A 4X5KA 2IL4A 3LD2A 3FXTA 2Q7BA 2JEVA 1IIDA 2CNMA 2ZPAA 1I12A 3TFYA 3ZZIA 4CAFA 1YX0A 2J8RA 3TT2A 1IICA 2J8NA 2B3VA 3W6SA 4MHDA 3P2FA 4NCZA 3T9YA 1LRZA 1QSTA 3PZJA 3TO7A 1I1DA 1MJAA 1ON0A 5AGEA 3R1KA 2Q04A 4FD5A 3WR7A 4NXYA 1YK3A 4KLVA 3H4QA 1Q2DA 2Z3NA 3T90A 2NMTA 5J8CA 4CGPA 2BEIA 4CAVA 4AB7A 4XNHC 4OAEA 4UFXA 1S7LA 1YVOA 2P6FA 2VZYA 5G1ZA 4B12A 2PDOA 2ZW7A 3VWEA 2DPTA 4K30A 2R1IA 5E96A 5ISVA 4HKFA 3D2MA 3DR8A 3FBUA 2I79A 2BL1A 5HMNA 4PSXA 4E2AA 2C27A 3IWGA 4UFVA 4MFJA 1RXTA 5H84A 3PP9A 2B4DB 4JLYA 3GYAA 3IWEA 2ZW5A 4C2ZA 1YVKA 2D4PA 3R9EA 4CRYB 1BO4A 3W6XA 2YNCA 4RI1A 4CYOA 4M3SA 4UCMA 3BLNA 1B6BA 3G3SA 4KOVA 1PUAA 1WK4A 4CGOA 4JJXA 4CAEA 2Z3LA 4MFQA 2PC1A 4Q38A 4U9YA 2YNCC 1KUYA 1IB1E 4C7HA 4A95A 4MJ8A 3R9FA 2R98A 3KKWA 4F0YA 4XPKA 4AG7A 2CY2A 4UCNA 4HNWB 1P4NA 3EY5A 2F5IA 4A2ZA 4PSWA 1WWZA 1S7NA 1Y9WA 2B58A 2WSAA 1XMTA 2WUUA 4MFLA 4E8OA 4H89A 2CXAA 4ZGYB 3SHPA 1Q2CA 1Y7RA 3SXOA 2KCWA 4B10A 2VQYA 5AG5A 5DWNA 4IUSA 4JWPA 4A30A 1OZPA 3W91A 3FRMA 3LODA 4MI4A 1KZFA 4BBHA 5AG6A 3TO9A 5JPHA 3MGDA 3S6FA 2B3UA 4QUSA 2VXKA 2VBQA 3BJ8A 2QECA 2ARHA 5CNPA 1S3ZA 1S7FA 1K4JA 4FD7A 3R95A 1YLEA 4M85A 3UY5A 1S5KA 4H6ZA 1FY7A 2Q4YA 3E0KA 5F47A 1QSRA 5G21A 4A33A 4CGLA 4AG9A 4B13A 5AG4A 2PR1A 5KTCA 4KVOE 3I9SA 4MFKA 3TOBA 3D8PA 2ZW6A 3V8IA 4MY0A 2O28A 3EO4A 2B5GA 4R87A 2Z11A 2D4OA 4NSQA 4AVBA 5G20A 2VEZA 2FT0A 1XIXA 1BOBA 4LX9A 5IX3A 3TO6A 2FIWA 4XPDC 3DNSA 4KVXA 1VKCA 2PSWA 4A32A 4L89A 2Z3MA 1KUXA 2Z3PA 1S60A 4CYQA 3IU1A 4B5PB 4CGMA 2DPSA 4CAWA 1S7KA 3R96A 2BSWA 5C82A 3JTKA 4B11A 4F6AA 2Z0ZA 1I21A 4A31A 4C68A 5JQ4A 2BUEA 2X7BA 5G22A 2QMLA 2YGWA 4R3KA 2JDCA 2R7HA 2P6EA 1V0CA 4QVTA 1TIQA 3VWDA 4H6UA 5F48A 4RS2A 3R9GA 3K9UA 1MK4A 1J4JA 1IYKA 3PGPA 2FCKA 2A4NA 4J3GA 3FYNA 3IGRA 4DNCA 4YFJA 4Y49C 4YRHA 4HNXB 4AVCA 2YNDA 4KOWA 4U5YA 4QBJA 3EXNA 1Y9KA 1NE9A 4EVYA 4YGOA 1Q2YA 2GIVA 1L0CA 2OZHA 4KVME 4F0XA 2R8VA 4CYPA 1QSMA 4XNHB 2ZXVA 4II9A 2Q4VA 4PV6A 1YGHA 4UBRA 3EFAA 2JDDA 1R57A 1P0HA 2PRBA 4KZTA 2OZUA 5A28A 1U6MA 4UCPA 4CRZB 1M4DA 4MBUA 1KUVA 1SQHA 1M4GA 1XEBA 4UWJA 5FVJA 3G8WA 3IU2A 4JD6A 2HV2A 4PK2A 2AJ6A 4FD6A 3FNCA 2AE6A 2Z3OA 2CNTA 1RO5A 1QSNA 1Z4EA 4U9ZA 4HNYB 2RC4A 2FXFA 3QB8A 4KSFA 1XE4A 4Y49B 3JVNA 2WPXA 4UWIA 2JLMA 3CXQA 5H86A 3JUWA 2REEA 2FL4A 4BMHA 5A27A 2VZZA 4I49A 1Z4RA 2GE3A 5F46A 1VHSA 2PR8A 3DSBA 4KOYA 2WPWA 3BJ7A 2Z10A 1YREA 2FIAA 2FSRA 1N71A 3D2PA 4C2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GCN A;  1QSO A;  4NEX A;  5I0C A;  2HUZ A;  2H5M A;  4KOX A;  1MJB A;  4FD4 A;  4KOS A;  5EC4 A;  3TOA A;  2OU2 A;  3I3G A;  1B87 A;  4MY3 A;  3F5B A;  3QAH A;  2HQY A;  2PQ8 A;  1M4I A;  2OH1 A;  2J8M A;  4ZBG A;  2P6G A;  3F8K A;  1NMT A;  1XF8 A;  4KOU A;  3TCV A;  3RYO A;  3NE7 A;  3N7Z A;  3ZJ0 A;  4B5O A;  4OAD A;  5C88 A;  4CAX A;  2GAN A;  4KLW A;  4KOR A;  3SXN A;  4R3L A;  2Q44 A;  4XPL A;  3TE4 A;  3GY9 A;  4QC6 A;  4R9M A;  1GHE A;  4GS4 A;  2FE7 A;  3DDD A;  5IV0 A;  1MJ9 A;  5KTD A;  2K5T A;  1CJW A;  3B8G A;  4ORF A;  5HH1 A;  2ZW4 A;  3EC4 A;  4XPD B;  4PK3 A;  5DWM A;  3S6H A;  4L8A A;  2QIR A;  4R57 A;  1NSL A;  4IF5 A;  2FS5 A;  4ONU A;  5KTA A;  1UFH A;  2B5G B;  4AVA A;  2I00 A;  2OZG A;  2DXQ A;  2EUI A;  4KUA A;  2G0B A;  3D3S A;  1Z9U A;  5J8F A;  4LUA A;  2OB0 A;  4KOT A;  2Y0M A;  4KUB A;  1M44 A;  3CXS A;  3TTH A;  2B4B A;  3GKR A;  4QB9 A;  2EVN A;  4JXR A;  1PU9 A;  2REF A;  3DR6 A;  2P0W A;  1YR0 A;  4B5P A;  3FIX A;  3CXP A;  3C26 A;  3S6K A;  1IYL A;  5EBV A;  4CS0 B;  4E0A A;  4JXQ A;  3F0A A;  3S6G A;  2ATR A;  2VI7 A;  4UA3 A;  4OLL A;  1M1D A;  1CM0 A;  3FB3 A;  4NF1 A;  3OWC A;  2G3A A;  2Q0Y A;  2B4D A;  3P2H A;  2G3T A;  2CNS A;  5F49 A;  5IB0 A;  4X5K A;  2IL4 A;  3LD2 A;  3FXT A;  2Q7B A;  2JEV A;  1IID A;  2CNM A;  2ZPA A;  1I12 A;  3TFY A;  3ZZI A;  1YX0 A;  2J8R A;  3TT2 A;  1IIC A;  2J8N A;  2B3V A;  3W6S A;  4MHD A;  3P2F A;  4NCZ A;  3T9Y A;  1LRZ A;  1QST A;  3PZJ A;  3TO7 A;  1I1D A;  1MJA A;  1ON0 A;  3R1K A;  2Q04 A;  4FD5 A;  3WR7 A;  4NXY A;  1YK3 A;  4KLV A;  3H4Q A;  1Q2D A;  3T90 A;  2NMT A;  5J8C A;  2BEI A;  4CAV A;  4AB7 A;  4XNH C;  4OAE A;  1S7L A;  1YVO A;  2P6F A;  2VZY A;  2PDO A;  2ZW7 A;  3VWE A;  4K30 A;  2R1I A;  5E96 A;  5ISV A;  4HKF A;  3D2M A;  3DR8 A;  3FBU A;  2I79 A;  2BL1 A;  5HMN A;  4PSX A;  4E2A A;  2C27 A;  3IWG A;  1RXT A;  5H84 A;  3PP9 A;  2B4D B;  4JLY A;  3GYA A;  2ZW5 A;  1YVK A;  2D4P A;  3R9E A;  4CRY B;  1BO4 A;  3W6X A;  4RI1 A;  4M3S A;  3BLN A;  1B6B A;  3G3S A;  4KOV A;  1PUA A;  1WK4 A;  4JJX A;  2PC1 A;  4U9Y A;  1KUY A;  1IB1 E;  4MJ8 A;  3R9F A;  2R98 A;  3KKW A;  4F0Y A;  4XPK A;  4AG7 A;  2CY2 A;  4HNW B;  1P4N A;  3EY5 A;  2F5I A;  4PSW A;  1WWZ A;  1S7N A;  1Y9W A;  2B58 A;  1XMT A;  4E8O A;  4H89 A;  3SHP A;  1Q2C A;  1Y7R A;  3SXO A;  2KCW A;  2VQY A;  5DWN A;  4IUS A;  4JWP A;  1OZP A;  3W91 A;  3FRM A;  3LOD A;  4MI4 A;  1KZF A;  5JPH A;  3TO9 A;  3MGD A;  3S6F A;  2B3U A;  4QUS A;  2VXK A;  2VBQ A;  3BJ8 A;  2QEC A;  2ARH A;  5CNP A;  1S3Z A;  1S7F A;  1K4J A;  4FD7 A;  3R95 A;  1YLE A;  4M85 A;  3UY5 A;  1S5K A;  4H6Z A;  1FY7 A;  2Q4Y A;  3E0K A;  5F47 A;  1QSR A;  4AG9 A;  2PR1 A;  5KTC A;  4KVO E;  3I9S A;  3TOB A;  3D8P A;  2ZW6 A;  3V8I A;  4MY0 A;  2O28 A;  3EO4 A;  2B5G A;  4R87 A;  2Z11 A;  2D4O A;  4NSQ A;  4AVB A;  2VEZ A;  2FT0 A;  1XIX A;  1BOB A;  4LX9 A;  5IX3 A;  3TO6 A;  2FIW A;  4XPD C;  3DNS A;  4KVX A;  1VKC A;  2PSW A;  4L89 A;  1KUX A;  1S60 A;  4B5P B;  4CAW A;  1S7K A;  3R96 A;  2BSW A;  5C82 A;  4F6A A;  2Z0Z A;  1I21 A;  5JQ4 A;  2BUE A;  2X7B A;  2QML A;  4R3K A;  2JDC A;  2R7H A;  2P6E A;  1V0C A;  4QVT A;  1TIQ A;  3VWD A;  4H6U A;  5F48 A;  4RS2 A;  3R9G A;  3K9U A;  1MK4 A;  1J4J A;  1IYK A;  3PGP A;  2FCK A;  2A4N A;  4J3G A;  3FYN A;  3IGR A;  4DNC A;  4YFJ A;  4Y49 C;  4YRH A;  4HNX B;  4AVC A;  4KOW A;  4U5Y A;  4QBJ A;  3EXN A;  1Y9K A;  1NE9 A;  4EVY A;  4YGO A;  1Q2Y A;  2GIV A;  1L0C A;  2OZH A;  4KVM E;  2R8V A;  1QSM A;  4XNH B;  2ZXV A;  4II9 A;  2Q4V A;  4PV6 A;  1YGH A;  4UBR A;  3EFA A;  2JDD A;  1R57 A;  1P0H A;  2PRB A;  4KZT A;  2OZU A;  1U6M A;  4CRZ B;  1M4D A;  4MBU A;  1KUV A;  1SQH A;  1M4G A;  1XEB A;  4UWJ A;  5FVJ A;  3G8W A;  4JD6 A;  2HV2 A;  4PK2 A;  2AJ6 A;  4FD6 A;  3FNC A;  2AE6 A;  2CNT A;  1RO5 A;  1QSN A;  1Z4E A;  4U9Z A;  4HNY B;  2RC4 A;  2FXF A;  3QB8 A;  4Y49 B;  1XE4 A;  3JVN A;  2WPX A;  4UWI A;  2JLM A;  3CXQ A;  5H86 A;  3JUW A;  2REE A;  2FL4 A;  4BMH A;  2VZZ A;  4I49 A;  1Z4R A;  2GE3 A;  5F46 A;  1VHS A;  2PR8 A;  3DSB A;  4KOY A;  2WPW A;  3BJ7 A;  2Z10 A;  1YRE A;  2FIA A;  2FSR A;  1N71 A;  3D2P A; 
#chains in the Genus database with same CATH topology
 4MFZ A;  5GCN A;  5LYI A;  1QSO A;  4ZYQ A;  4UIB A;  4MFP A;  2V8D A;  4NEX A;  1DE4 C;  5I0C A;  1Z8T A;  2HUZ A;  2H5M A;  2FVG A;  4KOX A;  5AG7 A;  4B14 A;  6CPA A;  1MJB A;  3BI0 A;  2CTC A;  2POK A;  4FD4 A;  4KOS A;  1CBX A;  5EC4 A;  3TOA A;  5CPA A;  4YWY A;  2F7V A;  2WZN A;  3CT9 A;  4OC1 A;  2VL1 A;  2OU2 A;  3I3G A;  1B87 A;  4MY3 A;  3A9L A;  2PJA A;  3D7F A;  3F5B A;  3QAH A;  4MXU A;  2ZEN A;  2HQY A;  4CGN A;  1Y7E A;  2PQ8 A;  2AFZ A;  4TWE A;  1M4I A;  2OH1 A;  2J8M A;  2IJZ A;  3FMC A;  4NGT A;  4ZBG A;  4M6G A;  2J9A A;  2P6G A;  3F8K A;  1NMT A;  1XF8 A;  4KOU A;  3TCV A;  3RYO A;  3NE7 A;  1HEE A;  3N7Z A;  3ZJ0 A;  4B5O A;  1Y0Y A;  4OAD A;  5C88 A;  3RO0 A;  1IGB A;  4CAX A;  2GAN A;  4MCR A;  4KLW A;  4KOR A;  4KSA A;  3SXN A;  4DUK A;  5K8P A;  4MHY A;  3ISZ A;  4R3L A;  3H5Z A;  2Q44 A;  4XPL A;  3TE4 A;  4DYO A;  3N5F A;  1TKF A;  3GY9 A;  4QC6 A;  4C7I A;  4P4D A;  4R9M A;  3D7G A;  5THW A;  4PXB A;  1GHE A;  4GS4 A;  2FE7 A;  3DDD A;  5IV0 A;  2HC9 A;  1MJ9 A;  2DEA A;  2ZED A;  5KTD A;  2K5T A;  2YNE A;  4MMO A;  2PVV A;  3H8F A;  4MCQ A;  3LWU A;  4UEZ A;  1CJW A;  3B8G A;  5LYL A;  2PIZ A;  2BOA A;  4ORF A;  5HH1 A;  4GM5 A;  2OR4 A;  2Z3K A;  3V8I A;  2ZW4 A;  3NA6 A;  3NFZ A;  4OID A;  3EC4 A;  4XPD B;  4PK3 A;  5DWM A;  1BPN A;  3S6H A;  4Q36 A;  4L8A A;  5BWA B;  1EE3 P;  2QIR A;  4R57 A;  1NSL A;  4IF5 A;  1ZO0 A;  2FS5 A;  4ONU A;  2ZEG A;  5KTA A;  1UFH A;  4NGP A;  2B5G B;  4P4F A;  2EWB A;  2ODF A;  4X2T A;  2I00 A;  4AVA A;  4IHM A;  1UWY A;  2JBK A;  2OZG A;  2DXQ A;  2EUI A;  4KUA A;  4MHZ A;  2G0B A;  5HVF A;  3D3S A;  4OP4 A;  3I1U A;  4ONW A;  3S9M A;  2OOT A;  1Z9U A;  5J8F A;  4LUA A;  1H8L A;  2OB0 A;  2CIJ A;  4PPZ A;  3FF3 A;  2Y0M A;  3PEI A;  4KOT A;  1M44 A;  3CXS A;  3PB6 X;  4KUB A;  3TTH A;  2B4B A;  1IY7 A;  1TKJ A;  1R43 A;  3GKR A;  1HDU A;  4QB9 A;  1YQE A;  2JEW A;  5I4M A;  1F2O A;  2EVN A;  2AFX A;  2ZOG A;  4JXR A;  1PU9 A;  3PB9 X;  4OIW A;  2REF A;  3DR6 A;  4KS9 A;  2P0W A;  1YR0 A;  3V7Z A;  4B5P A;  3IO1 A;  3KQX A;  4G1P A;  3FIX A;  3FEE A;  1VHE A;  3C26 A;  3CXP A;  1PYT B;  3S6K A;  1IYL A;  3NH8 A;  5EBV A;  4CS0 B;  4CYN A;  4E0A A;  1Z8W A;  4JXQ A;  5K8M A;  5LYF A;  3SJE A;  2PVW A;  1IU8 A;  1YLO A;  2ZEH A;  3F0A A;  3RBU A;  2ATR A;  2VI7 A;  1CPX A;  4UA3 A;  4OLL A;  1M1D A;  1CM0 A;  3FB3 A;  3FX6 A;  5ELY A;  4NF1 A;  3OWC A;  3PB4 X;  4C2X A;  1YME A;  2G3A A;  2Q0Y A;  5HVH A;  2AFM A;  4FWU A;  2B4D A;  3P2H A;  4M6H A;  2G3T A;  4UFW A;  3S9N A;  2CNS A;  5F49 A;  5IB0 A;  3KAS A;  2PJ6 A;  5J1Q A;  2V77 A;  1VIX A;  1X10 A;  5IB9 A;  4X5K A;  2IL4 A;  3S9L A;  2Q43 A;  3LD2 A;  1XJO A;  3B35 A;  3B3V A;  4R76 A;  3FXT A;  2Q7B A;  2JEV A;  1IID A;  2CNM A;  2ABZ A;  1I12 A;  2ZPA A;  1VGY A;  3TFY A;  3ZZI A;  3B3T A;  1XBU A;  3LMS A;  4ZY2 A;  4CAF A;  1BPM A;  1YX0 A;  1ZG7 A;  4F8Z A;  2J8R A;  3GB0 A;  3TT2 A;  1IIC A;  2J8N A;  2B3V A;  3W6S A;  4ZY1 A;  2WYR A;  2NYQ A;  1RTQ A;  1AMP A;  1YSJ A;  4MHD A;  3P2F A;  5D29 A;  4NCZ A;  3T9Y A;  4P44 A;  1LRZ A;  4O23 A;  1QST A;  4NGQ A;  3PZJ A;  3TO7 A;  1TF8 A;  1I1D A;  1MJA A;  1ON0 A;  2C6C A;  3R1K A;  4UF4 A;  5AGE A;  2Q04 A;  4FD5 A;  3T8W A;  3WR7 A;  4Z65 A;  4NXY A;  2ZEM A;  1YK3 A;  2V8H A;  4KLV A;  3H4Q A;  3HLP A;  1Q2D A;  5LRJ A;  3KR4 A;  2Z3N A;  4P10 A;  3T90 A;  3CPX A;  1DTD A;  2NMT A;  4X3R A;  2NSM A;  3KL9 A;  3V38 A;  5J8C A;  1CG2 A;  4CGP A;  1XFO A;  2BEI A;  1ZG9 A;  3RZA A;  1LAM A;  4CAV A;  4AB7 A;  4XNH C;  4OAE A;  4OC4 A;  4UFX A;  1S7L A;  4NGS A;  5HXD A;  1LFW A;  1YVO A;  2P6F A;  4LQ6 A;  2Q51 A;  2JBJ A;  2V8G A;  2VZY A;  5G1Z A;  3KQZ A;  3PB7 X;  4B12 A;  2PDO A;  2ZW7 A;  3VWE A;  3B3W A;  4OC3 A;  2DPT A;  3SJG A;  4K30 A;  2R1I A;  5E96 A;  2QJ8 A;  5ISV A;  3DR8 A;  3D2M A;  4HKF A;  2XEF A;  3FEC A;  4MHP A;  3FBU A;  4EFD A;  2I79 A;  2BL1 A;  5HMN A;  1ELL P;  4PSX A;  4E2A A;  2C27 A;  3IWG A;  4UFV A;  4MFJ A;  5JGF A;  3IIB A;  1RXT A;  5H84 A;  3PP9 A;  2B4D B;  2GLF A;  3GYA A;  3IWE A;  4JLY A;  2ZW5 A;  4P4B A;  4C2Z A;  1YVK A;  2D4P A;  2EBJ A;  3R9E A;  2EK9 A;  2RB7 A;  3KI9 A;  4CRY B;  1BO4 A;  3W6X A;  2XEG A;  4OC2 A;  2YNC A;  4RI1 A;  4CYO A;  4M3S A;  4UCM A;  3FED A;  3BLN A;  1B6B A;  3G3S A;  4KOV A;  4EWT A;  2GU2 A;  4IAV A;  1PUA A;  3TC8 A;  1WK4 A;  2PJC A;  1XOV A;  3D67 A;  4IK2 A;  2O4H A;  3B7I A;  1FNO A;  4CGO A;  4JJX A;  4MHN A;  3MN8 A;  4CAE A;  5D8N A;  1NSA A;  2Z3L A;  4MFQ A;  2PC1 A;  2ZEL A;  4B6Z A;  3PBB A;  4Q38 A;  2PJ3 A;  4U9Y A;  2YNC C;  3BHX A;  1KUY A;  3S6G A;  1IB1 E;  4C7H A;  4A95 A;  4MJ8 A;  3R9F A;  2R98 A;  3KKW A;  4F0Y A;  3B2Y A;  4XPK A;  5F09 A;  4AG7 A;  5CBM A;  2PJ8 A;  2CY2 A;  4OME A;  4P45 A;  1R3N A;  2DF5 A;  4HNW B;  4UCN A;  2PIY A;  1P4N A;  4PXC A;  1LCP A;  3EY5 A;  2F5I A;  2CF4 A;  4A2Z A;  4PSW A;  1WWZ A;  1S7N A;  1Y9W A;  2B58 A;  2WSA A;  1XMT A;  2WUU A;  4W9Y A;  4MFL A;  4E8O A;  4H89 A;  2C6P A;  2CXA A;  4LQG A;  3CZX A;  4H2K A;  4ZGY B;  4PQA A;  3SHP A;  1Q2C A;  1Y7R A;  3FH4 A;  3SI1 A;  3SXO A;  2KCW A;  1IOF A;  3PBE A;  4B10 A;  1CP6 A;  2VQY A;  5AG5 A;  5DWN A;  4IUS A;  3GIU A;  5LYD A;  4JWP A;  4A30 A;  1OZP A;  1TKH A;  2PJ7 A;  3D7H A;  3FRM A;  3LOD A;  4MI4 A;  3W91 A;  1Z5R A;  4RN7 A;  3K9T A;  1CPS A;  2C1C A;  1TXR A;  3SJF A;  5EMI A;  1KZF A;  4BBH A;  5AG6 A;  3TO9 A;  5JPH A;  3MGD A;  4JZ0 A;  3SI0 A;  1BLL E;  3BI1 A;  3KHX A;  1ELM P;  3S6F A;  2B3U A;  1YW6 A;  2VXK A;  4QUS A;  2VBQ A;  3BJ8 A;  5LRK A;  2QEC A;  2ARH A;  5CNP A;  1S3Z A;  1S7F A;  1K4J A;  4FD7 A;  2PE3 A;  1YLE A;  4M85 A;  2IMO A;  1S5K A;  4H6Z A;  3R95 A;  3UY5 A;  4EME A;  1FY7 A;  2EK8 A;  2Q4Y A;  3E0K A;  4P4E A;  5F47 A;  1QSR A;  2HB6 A;  4DJL A;  5G21 A;  3WC7 A;  2I3C A;  4A33 A;  4CGL A;  4AG9 A;  3JRU A;  3KR5 A;  4B13 A;  5AG4 A;  2ZEE A;  2O53 A;  2PR1 A;  3CDX A;  4FUU A;  5KTC A;  1GYT A;  1A2Z A;  4KVO E;  3I9S A;  4MFK A;  3TOB A;  2AFW A;  2PJ5 A;  3D8P A;  2G9D A;  2ZW6 A;  1F57 A;  2GFQ A;  1YW4 A;  1HDQ A;  1XMB A;  2ZOF A;  4MY0 A;  2O28 A;  2PCU A;  2B5G A;  3EO4 A;  4R87 A;  2Z11 A;  2D4O A;  4AXV A;  3ISX A;  4NSQ A;  4AVB A;  5G20 A;  5JM6 A;  2VEZ A;  1X12 A;  2FT0 A;  4NGN A;  1XIX A;  1BOB A;  4LX9 A;  4P4J A;  4ZI6 A;  5IX3 A;  2CTB A;  3SI2 A;  3D4U A;  3TO6 A;  1TF9 A;  3WAB A;  4NFR A;  2FIW A;  3NH5 A;  4XPD C;  1CP7 A;  3DNS A;  4KVX A;  4A94 A;  1VKC A;  2PSW A;  4A32 A;  2AFS A;  2GRE A;  4L89 A;  2Z3M A;  1KUX A;  2Z3P A;  4FBE A;  1S60 A;  1LOK A;  4CYQ A;  2QYV A;  3IU1 A;  2ZEF A;  3RAM A;  1Z8L A;  4B5P B;  4CGM A;  4F9U A;  2DPS A;  4CAW A;  4NGM A;  2XEJ A;  1S7K A;  4WWV A;  3SJX A;  3FVL A;  3R96 A;  2BSW A;  5C82 A;  5JH9 A;  1F2P A;  3JTK A;  4B11 A;  4F6A A;  4R6T A;  3NE8 A;  1Z2L A;  4RUH A;  2Z0Z A;  1QMU A;  4CPA A;  3IFE A;  1I21 A;  4A31 A;  1Q7L A;  4C68 A;  3WC6 A;  5JQ4 A;  3D66 A;  1KWM A;  2F8H A;  2BUE A;  2X7B A;  2QML A;  2ANP A;  3GLJ A;  4TNU A;  5G22 A;  3IJ3 A;  2YGW A;  4R3K A;  2JDC A;  2R7H A;  4WJB A;  2P6E A;  1V0C A;  3NH4 A;  1TIQ A;  4QVT A;  2Q7S A;  3VWD A;  4BIN A;  4H6U A;  5F48 A;  4RS2 A;  3R9G A;  3VH9 A;  3K9U A;  1MK4 A;  1J4J A;  2PJ1 A;  1IYK A;  3PGP A;  2FCK A;  1ARM A;  7CPA A;  2A4N A;  4J3G A;  3FYN A;  3IGR A;  1ARL A;  3KGQ A;  3PB8 X;  4MRI A;  4DNC A;  4YFJ A;  4Y49 C;  4P6Y A;  2AFU A;  4ZY0 A;  4YRH A;  4HNX B;  3QAY A;  1CX8 A;  4AVC A;  1M4L A;  2YND A;  4KOW A;  4OKO A;  4A39 A;  4OC5 A;  2AFO A;  4U5Y A;  3IWW A;  4QBJ A;  3EXN A;  1Y9K A;  1NE9 A;  4EVY A;  4YGO A;  1Q2Y A;  2GIV A;  3WT4 A;  1L0C A;  1XRY A;  1AYE A;  2OZH A;  3RNZ A;  4KVM E;  4F0X A;  4YU9 A;  2R8V A;  5DS0 A;  4CYP A;  2EO8 A;  1QSM A;  2V8V A;  4F9V A;  3H8G A;  3D68 A;  4XNH B;  2ZXV A;  4II9 A;  2Q4V A;  4PV6 A;  4FAI A;  3GUX A;  4PXD A;  1YGH A;  4UBR A;  3EFA A;  3LAC A;  2JDD A;  3D7D A;  1JWQ A;  1R57 A;  1P0H A;  1VHO A;  2PRB A;  4NJQ A;  4UIA A;  4KZT A;  1LAP A;  2OZU A;  5A28 A;  5LRG A;  3MRU A;  4R7M A;  1U6M A;  3CPA A;  4UCP A;  3KZW A;  4CRZ B;  1M4D A;  4MBU A;  1KUV A;  1SQH A;  1M4G A;  5K8O A;  4NJR A;  1XEB A;  4OC0 A;  4UWJ A;  5FVJ A;  1PCA A;  3PRT A;  3G8W A;  1QQ9 A;  3IU2 A;  4JD6 A;  3WC5 A;  4K3N A;  2HV2 A;  3VAR A;  4PK2 A;  2BO9 A;  2PJB A;  2ZEP A;  2PJ4 A;  2PJ0 A;  3VAT A;  2ZEO A;  4NGR A;  2GLJ A;  3B3C A;  3KHZ A;  2AJ6 A;  4ZX9 A;  4JYW A;  4FD6 A;  1AUG A;  4UEE A;  3FNC A;  2XEI A;  5K8N A;  2AE6 A;  1Y0R A;  2Z3O A;  2BCO A;  4ZX8 A;  1LAN A;  1ZLI A;  2CNT A;  2PJ2 A;  5HVG A;  1RO5 A;  1QSN A;  1Z4E A;  1ZG8 A;  4U9Z A;  4MCS A;  4HNY B;  2RC4 A;  3HUV A;  2FXF A;  3QB8 A;  3H8E A;  4A38 A;  1Z8X A;  4KSF A;  1XE4 A;  4Y49 B;  3JVN A;  1FT7 A;  4MCP A;  2C6G A;  2WPX A;  4UWI A;  1OBR A;  2JLM A;  4A37 A;  3CXQ A;  3IEH A;  2RFH A;  4KSI A;  5H86 A;  4BD9 A;  3B3S A;  3JUW A;  8CPA A;  2REE A;  2FL4 A;  2QVP A;  4GXH A;  4BMH A;  4UEF A;  2PRQ A;  3DGV A;  5A27 A;  2Q4Z A;  2VZZ A;  3PFO A;  3QNV A;  4I49 A;  4R8F A;  1ZLH A;  4P4I A;  3DLJ A;  3IC1 A;  4X8I A;  3PFE A;  1Z4R A;  2GE3 A;  2PJ9 A;  5F46 A;  1VHS A;  2PR8 A;  3DSB A;  4KOY A;  2IQ6 A;  4HPS A;  3TX8 A;  4PXE A;  2WPW A;  3BJ7 A;  3L2N A;  4M6I A;  2Z10 A;  4Q7A A;  3BXM A;  3FJU A;  1BAV A;  3K2K A;  1YRE A;  2FIA A;  2FSR A;  1IOI A;  1N71 A;  3D2P A;  1JQG A;  4C2Y A; 
#chains in the Genus database with same CATH homology
 4MFZ A;  5GCN A;  1QSO A;  4MFP A;  4NEX A;  5I0C A;  2HUZ A;  2H5M A;  4KOX A;  5AG7 A;  4B14 A;  1MJB A;  4FD4 A;  4KOS A;  5EC4 A;  3TOA A;  2OU2 A;  3I3G A;  1B87 A;  4MY3 A;  3A9L A;  3F5B A;  3QAH A;  2HQY A;  4CGN A;  2PQ8 A;  1M4I A;  2OH1 A;  2J8M A;  4ZBG A;  2P6G A;  3F8K A;  1NMT A;  1XF8 A;  4KOU A;  3TCV A;  3RYO A;  3NE7 A;  3N7Z A;  3ZJ0 A;  4B5O A;  4OAD A;  5C88 A;  4CAX A;  2GAN A;  4KLW A;  4KOR A;  4KSA A;  3SXN A;  4R3L A;  3H5Z A;  2Q44 A;  4XPL A;  3TE4 A;  4C7I A;  3GY9 A;  4QC6 A;  4R9M A;  1GHE A;  4GS4 A;  2FE7 A;  3DDD A;  5IV0 A;  1MJ9 A;  5KTD A;  2K5T A;  2YNE A;  1CJW A;  3B8G A;  4ORF A;  5HH1 A;  2Z3K A;  2ZW4 A;  3EC4 A;  4XPD B;  4PK3 A;  5DWM A;  3S6H A;  4Q36 A;  4L8A A;  5BWA B;  2QIR A;  4R57 A;  1NSL A;  4IF5 A;  1ZO0 A;  2FS5 A;  4ONU A;  5KTA A;  1UFH A;  2B5G B;  4AVA A;  2I00 A;  2OZG A;  2DXQ A;  2EUI A;  4KUA A;  2G0B A;  3D3S A;  1Z9U A;  5J8F A;  4LUA A;  2OB0 A;  4KOT A;  2Y0M A;  4KUB A;  1M44 A;  3CXS A;  3TTH A;  2B4B A;  3GKR A;  4QB9 A;  2EVN A;  4JXR A;  1PU9 A;  2REF A;  3DR6 A;  4KS9 A;  2P0W A;  1YR0 A;  4B5P A;  3FIX A;  3CXP A;  3C26 A;  3S6K A;  1IYL A;  5EBV A;  4CS0 B;  4CYN A;  4E0A A;  4JXQ A;  3F0A A;  3S6G A;  2ATR A;  2VI7 A;  4UA3 A;  4OLL A;  1M1D A;  1CM0 A;  3FB3 A;  4NF1 A;  3OWC A;  4C2X A;  2G3A A;  2Q0Y A;  2B4D A;  3P2H A;  2G3T A;  4UFW A;  2CNS A;  5F49 A;  5IB0 A;  4X5K A;  2IL4 A;  3LD2 A;  3FXT A;  2Q7B A;  2JEV A;  1IID A;  2CNM A;  2ZPA A;  1I12 A;  3TFY A;  3ZZI A;  4CAF A;  1YX0 A;  2J8R A;  3TT2 A;  1IIC A;  2J8N A;  2B3V A;  3W6S A;  4MHD A;  3P2F A;  4NCZ A;  3T9Y A;  1LRZ A;  1QST A;  3PZJ A;  3TO7 A;  1I1D A;  1MJA A;  1ON0 A;  5AGE A;  3R1K A;  2Q04 A;  4FD5 A;  3WR7 A;  4NXY A;  1YK3 A;  4KLV A;  3H4Q A;  1Q2D A;  2Z3N A;  3T90 A;  2NMT A;  5J8C A;  4CGP A;  2BEI A;  4CAV A;  4AB7 A;  4XNH C;  4OAE A;  4UFX A;  1S7L A;  1YVO A;  2P6F A;  2VZY A;  5G1Z A;  4B12 A;  2PDO A;  2ZW7 A;  3VWE A;  2DPT A;  4K30 A;  2R1I A;  5E96 A;  5ISV A;  4HKF A;  3D2M A;  3DR8 A;  3FBU A;  2I79 A;  2BL1 A;  5HMN A;  4PSX A;  4E2A A;  2C27 A;  3IWG A;  4UFV A;  4MFJ A;  1RXT A;  5H84 A;  3PP9 A;  2B4D B;  4JLY A;  3GYA A;  3IWE A;  2ZW5 A;  4C2Z A;  1YVK A;  2D4P A;  3R9E A;  4CRY B;  1BO4 A;  3W6X A;  2YNC A;  4RI1 A;  4CYO A;  4M3S A;  4UCM A;  3BLN A;  1B6B A;  3G3S A;  4KOV A;  1PUA A;  1WK4 A;  4CGO A;  4JJX A;  4CAE A;  2Z3L A;  4MFQ A;  2PC1 A;  4Q38 A;  4U9Y A;  2YNC C;  1KUY A;  1IB1 E;  4C7H A;  4A95 A;  4MJ8 A;  3R9F A;  2R98 A;  3KKW A;  4F0Y A;  4XPK A;  4AG7 A;  2CY2 A;  4UCN A;  4HNW B;  1P4N A;  3EY5 A;  2F5I A;  4A2Z A;  4PSW A;  1WWZ A;  1S7N A;  1Y9W A;  2B58 A;  2WSA A;  1XMT A;  2WUU A;  4MFL A;  4E8O A;  4H89 A;  2CXA A;  4ZGY B;  3SHP A;  1Q2C A;  1Y7R A;  3SXO A;  2KCW A;  4B10 A;  2VQY A;  5AG5 A;  5DWN A;  4IUS A;  4JWP A;  4A30 A;  1OZP A;  3W91 A;  3FRM A;  3LOD A;  4MI4 A;  1KZF A;  4BBH A;  5AG6 A;  3TO9 A;  5JPH A;  3MGD A;  3S6F A;  2B3U A;  4QUS A;  2VXK A;  2VBQ A;  3BJ8 A;  2QEC A;  2ARH A;  5CNP A;  1S3Z A;  1S7F A;  1K4J A;  4FD7 A;  3R95 A;  1YLE A;  4M85 A;  3UY5 A;  1S5K A;  4H6Z A;  1FY7 A;  2Q4Y A;  3E0K A;  5F47 A;  1QSR A;  5G21 A;  4A33 A;  4CGL A;  4AG9 A;  4B13 A;  5AG4 A;  2PR1 A;  5KTC A;  4KVO E;  3I9S A;  4MFK A;  3TOB A;  3D8P A;  2ZW6 A;  3V8I A;  4MY0 A;  2O28 A;  3EO4 A;  2B5G A;  4R87 A;  2Z11 A;  2D4O A;  4NSQ A;  4AVB A;  5G20 A;  2VEZ A;  2FT0 A;  1XIX A;  1BOB A;  4LX9 A;  5IX3 A;  3TO6 A;  2FIW A;  4XPD C;  3DNS A;  4KVX A;  1VKC A;  2PSW A;  4A32 A;  4L89 A;  2Z3M A;  1KUX A;  2Z3P A;  1S60 A;  4CYQ A;  3IU1 A;  4B5P B;  4CGM A;  2DPS A;  4CAW A;  1S7K A;  3R96 A;  2BSW A;  5C82 A;  3JTK A;  4B11 A;  4F6A A;  2Z0Z A;  1I21 A;  4A31 A;  4C68 A;  5JQ4 A;  2BUE A;  2X7B A;  5G22 A;  2QML A;  2YGW A;  4R3K A;  2JDC A;  2R7H A;  2P6E A;  1V0C A;  4QVT A;  1TIQ A;  3VWD A;  4H6U A;  5F48 A;  4RS2 A;  3R9G A;  3K9U A;  1MK4 A;  1J4J A;  1IYK A;  3PGP A;  2FCK A;  2A4N A;  4J3G A;  3FYN A;  3IGR A;  4DNC A;  4YFJ A;  4Y49 C;  4YRH A;  4HNX B;  4AVC A;  2YND A;  4KOW A;  4U5Y A;  4QBJ A;  3EXN A;  1Y9K A;  1NE9 A;  4EVY A;  4YGO A;  1Q2Y A;  2GIV A;  1L0C A;  2OZH A;  4KVM E;  4F0X A;  2R8V A;  4CYP A;  1QSM A;  4XNH B;  2ZXV A;  4II9 A;  2Q4V A;  4PV6 A;  1YGH A;  4UBR A;  3EFA A;  2JDD A;  1R57 A;  1P0H A;  2PRB A;  4KZT A;  2OZU A;  5A28 A;  1U6M A;  4UCP A;  4CRZ B;  1M4D A;  4MBU A;  1KUV A;  1SQH A;  1M4G A;  1XEB A;  4UWJ A;  5FVJ A;  3G8W A;  3IU2 A;  4JD6 A;  2HV2 A;  4PK2 A;  2AJ6 A;  4FD6 A;  3FNC A;  2AE6 A;  2Z3O A;  2CNT A;  1RO5 A;  1QSN A;  1Z4E A;  4U9Z A;  4HNY B;  2RC4 A;  2FXF A;  3QB8 A;  4KSF A;  1XE4 A;  4Y49 B;  3JVN A;  2WPX A;  4UWI A;  2JLM A;  3CXQ A;  5H86 A;  3JUW A;  2REE A;  2FL4 A;  4BMH A;  5A27 A;  2VZZ A;  4I49 A;  1Z4R A;  2GE3 A;  5F46 A;  1VHS A;  2PR8 A;  3DSB A;  4KOY A;  2WPW A;  3BJ7 A;  2Z10 A;  1YRE A;  2FIA A;  2FSR A;  1N71 A;  3D2P A;  4C2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...