1J4JA

Crystal structure of tabtoxin resistance protein (form ii) complexed with an acyl coenzyme a
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
170
structure length
170
Chain Sequence
AQLRRVTAESFAHYRHGLAQLLFETVHGGASVGFMADLDMQQAYAWCDGLKADIAAGSLLLWVVAEDDNVLASAQLSLCQKPNGLNRAEVQKLMVLPSARGRGLGRQLMDEVEQVAVKHKRGLLHLDTEAGSVAEAFYSALAYTRVGELPGYCATPDGRLHPTAIYFKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TABTOXIN RESISTANCE PROTEIN
publication title Crystal structure of tabtoxin resistance protein complexed with acetyl coenzyme A reveals the mechanism for beta-lactam acetylation.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tabaci
molecule tags Transferase
total genus 45
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2001-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1j4jA00
1B87A 3DR8A 2JDCA 3NE7A 4H6ZA 4II9A 3BLNA 1FY7A 1Z4RA 2Q04A 1L0CA 5ISVA 1YR0A 3ZZIA 1S5KA 1YVOA 4KVXA 4XPDB 2PC1A 2BEIA 2ZXVA 5IB0A 4PSXA 4HNWB 3T9YA 2JEVA 2CNSA 4KZTA 1VKCA 4MHDA 3DR6A 4J3GA 4F0YA 4KLWA 3FIXA 2HUZA 4UWJA 2J8NA 4ONUA 1BOBA 2P6FA 1Y9KA 2CY2A 1N71A 1BO4A 2D4PA 4QBJA 1PU9A 3PZJA 2FCKA 2CNTA 4UWIA 2RC4A 4LUAA 1U6MA 2R98A 2VZZA 4AG9A 4JXQA 1QSNA 3RYOA 1MJBA 4B5PA 4KORA 2PR1A 1MK4A 4IF5A 1CJWA 2R7HA 1IIDA 2ATRA 2VI7A 4FD6A 2FT0A 3C26A 3IWGA 2ZW7A 4FD5A 3S6GA 4LX9A 3FBUA 4AVAA 4U9ZA 2WPWA 3SHPA 4X5KA 2ARHA 1YK3A 2A4NA 2Z0ZA 4CAVA 3JVNA 4IUSA 1CM0A 5GCNA 3PP9A 2G3AA 3D8PA 4EVYA 4H6UA 2B3VA 1M4GA 1B6BA 3E0KA 4KOUA 1S7LA 1Q2DA 1XF8A 3TTHA 3EC4A 2VEZA 3R1KA 1KUYA 5C88A 1Y7RA 2PDOA 2WPXA 5KTAA 4XNHC 2R8VA 2OZGA 5H84A 4B5OA 3VWDA 3V8IA 2JDDA 4KVME 2EUIA 3LD2A 2PR8A 4KOSA 3F0AA 2JLMA 4U9YA 3D2PA 1S7NA 2ZPAA 5KTDA 1WK4A 3GKRA 1KUVA 3SXNA 1XMTA 3ZJ0A 1IYKA 4QB9A 4NCZA 4M85A 2X7BA 1QSTA 4HKFA 4KUAA 2VQYA 3F8KA 3CXSA 1ON0A 2Z10A 4MY0A 3OWCA 4R3LA 3IGRA 4PK2A 3LODA 5I0CA 1IB1E 4AVCA 3W91A 4OADA 4QC6A 4BMHA 4JXRA 2VBQA 1YVKA 4YGOA 1XIXA 1RXTA 2PRBA 2B4DB 5IX3A 2B5GA 1I21A 4KOTA 4Y49C 1Q2YA 3UY5A 1OZPA 1KUXA 2OU2A 5E96A 3TO9A 5HH1A 2ZW6A 4KOWA 5F49A 1J4JA 5HMNA 4OLLA 4CAWA 4QUSA 3FXTA 3G8WA 4NEXA 4KLVA 4MBUA 3R95A 2Z11A 3F5BA 1M4IA 1Q2CA 2J8RA 5EBVA 5J8FA 1K4JA 2AJ6A 1S60A 2VXKA 4KOYA 3TT2A 3DNSA 1NE9A 2OB0A 2FSRA 3EO4A 5KTCA 4H89A 3TO7A 2G3TA 3TOAA 1MJ9A 4FD7A 4XPDC 3W6SA 1Z9UA 5DWMA 4QVTA 2FL4A 4NF1A 2B58A 1LRZA 2REEA 3TCVA 2PQ8A 4MY3A 4HNXB 4CRZB 2B5GB 1VHSA 3FYNA 2IL4A 3FRMA 4I49A 1XE4A 2B3UA 2BUEA 3GY9A 3N7ZA 2GANA 3TE4A 1KZFA 1RO5A 2VZYA 4PK3A 3CXQA 3TOBA 2C27A 3SXOA 2Q4VA 2EVNA 4L89A 4JD6A 2BL1A 4L8AA 4B5PB 1IYLA 2OH1A 4JJXA 4RI1A 1SQHA 2D4OA 4AVBA 4NSQA 4ZBGA 3D3SA 3TFYA 1QSRA 4KVOE 1TIQA 4F6AA 3BJ7A 4RS2A 5F48A 5C82A 3KKWA 1YX0A 4R9MA 1M1DA 5IV0A 3QAHA 1QSOA 2FE7A 4NXYA 2OZUA 1S7FA 2I79A 2Y0MA 3S6KA 2HV2A 3T90A 2H5MA 3B8GA 2KCWA 4FD4A 2ZW5A 1I12A 3EY5A 2Q44A 3PGPA 2NMTA 3FNCA 1NMTA 1Y9WA 5CNPA 1YREA 1QSMA 3EFAA 3TO6A 4HNYB 2O28A 2P6EA 1NSLA 4R3KA 4PV6A 1R57A 4AG7A 1IICA 1YGHA 4YFJA 2FXFA 4GS4A 3K9UA 4XNHB 1S3ZA 2Q0YA 4R87A 2FS5A 2REFA 2QIRA 2GE3A 4M3SA 2Q4YA 5H86A 2GIVA 1M44A 4E8OA 1P4NA 3DSBA 3P2FA 1GHEA 3GYAA 1YLEA 5F47A 2B4BA 4ORFA 4JWPA 1S7KA 2OZHA 2K5TA 4E0AA 1WWZA 4KUBA 4CS0B 2CNMA 3CXPA 3R9GA 1M4DA 2QECA 2R1IA 3G3SA 3FB3A 4PSWA 4XPLA 5DWNA 4KOVA 2AE6A 1Z4EA 1MJAA 2J8MA 4MI4A 1I1DA 2PSWA 1P0HA 3VWEA 4MJ8A 3JUWA 3QB8A 3DDDA 3R9EA 4JLYA 5FVJA 4U5YA 4DNCA 4XPKA 2F5IA 2FIAA 5J8CA 2B4DA 3R9FA 4KOXA 3MGDA 3I3GA 4K30A 2ZW4A 4UBRA 4AB7A 3S6FA 4E2AA 4Y49B 2DXQA 5EC4A 3D2MA 2I00A 3H4QA 2FIWA 2G0BA 3EXNA 1XEBA 3WR7A 1PUAA 5JQ4A 2P6GA 5F46A 1UFHA 2P0WA 2QMLA 2Q7BA 3I9SA 3R96A 5JPHA 4UA3A 3W6XA 4OAEA 4R57A 4CRYB 4YRHA 2HQYA 3P2HA 1V0CA 3BJ8A 3S6HA 2BSWA 4CAXA
chains in the Genus database with same CATH superfamily
3N5FA 2PVWA 1B87A 3DR8A 3NFZA 2JDCA 2NSMA 3FECA 3NE7A 4H6ZA 4P4BA 4MFPA 2JBKA 4MHYA 2V8DA 4DUKA 3BLNA 4II9A 1FY7A 1Z4RA 3SI1A 2PJ1A 2Q04A 1L0CA 4MCQA 5ISVA 3D7GA 4AXVA 4BD9A 4NGPA 3B2YA 1YR0A 3IEHA 1CPXA 2PVVA 3ZZIA 1S5KA 1YVOA 2PRQA 4KVXA 4G1PA 4M6HA 4XPDB 2PC1A 2BEIA 2PJ0A 2ZXVA 3ISZA 1IOIA 5LYIA 5IB0A 4PSXA 3FH4A 2ZEEA 4HNWB 3VARA 3T9YA 1Z8XA 1BPMA 3H8GA 3B3VA 2JEVA 1ZG7A 4FUUA 4MFKA 2CNSA 4KZTA 1VKCA 1KWMA 2CF4A 2EBJA 5HVGA 1TF9A 4MHDA 3DR6A 4J3GA 1EE3P 4KLWA 3FIXA 4F0YA 4F9UA 3JRUA 2HUZA 4RN7A 4UWJA 2J8NA 4ONUA 1BOBA 2P6FA 1Y9KA 2CY2A 1N71A 2PJ6A 3SJEA 1BO4A 1Z2LA 2D4PA 4QBJA 4R8FA 3KR5A 1PU9A 1IOFA 1TKJA 1FT7A 1YQEA 3PZJA 2FCKA 2PJ4A 5J1QA 2CNTA 1AMPA 2C6PA 4UWIA 5G1ZA 3H8EA 2RC4A 4NJRA 4LUAA 2J9AA 2Z3OA 1U6MA 1VGYA 2R98A 1M4LA 2VZZA 4AG9A 2XEJA 1QSNA 2Q7SA 4JXQA 3CZXA 1MJBA 3RYOA 4B5PA 4KORA 4OKOA 4P45A 2PR1A 4P4JA 1MK4A 3TC8A 4IF5A 1CJWA 2R7HA 4LQ6A 5A28A 1YSJA 2GFQA 3D7HA 1IIDA 4A32A 4B12A 4TNUA 2ATRA 2VI7A 4FD6A 4ZY2A 1H8LA 4OP4A 2FT0A 3VATA 3C26A 3IWGA 2ZW7A 1TF8A 1ZLHA 1IGBA 3FMCA 4FD5A 3S6GA 1DTDA 2PE3A 4P10A 4LX9A 3FBUA 3LWUA 2DPSA 4OC2A 2EWBA 4AVAA 2V77A 4U9ZA 2ODFA 2WPWA 2IJZA 4NJQA 3SHPA 2PJ3A 2ZEDA 4X5KA 2HC9A 2YNDA 1R43A 2ARHA 4LQGA 4F8ZA 1YK3A 2A4NA 2Z0ZA 4CAVA 3JVNA 4IUSA 4OC1A 4ZI6A 5BWAB 4CYNA 1CM0A 5GCNA 2ZENA 3PP9A 2G3AA 3D8PA 4NGQA 4JYWA 4EVYA 3WC7A 4H6UA 1X12A 2B3VA 2WSAA 1M4GA 2IMOA 1B6BA 3E0KA 4KOUA 1S7LA 1Q2DA 4PPZA 1XF8A 3SJXA 1Z5RA 2GLFA 3TTHA 5F09A 4YU9A 4B11A 2GU2A 1CP7A 2AFUA 2VEZA 3EC4A 3FEEA 3PBEA 3R1KA 4ZGYB 1KUYA 4KS9A 3B35A 2EK8A 5C88A 1Y7RA 4H2KA 4UFVA 2PDOA 2YNCC 2WPXA 3KHZA 5KTAA 4UCMA 1Z8WA 1XBUA 4XNHC 5AGEA 2R8VA 5CPAA 5LRGA 5JGFA 2OZGA 2XEGA 5H84A 4B5OA 3VH9A 3VWDA 3V8IA 3FVLA 4B13A 2JDDA 5AG5A 1BPNA 4KVME 4KSAA 4ZY0A 2CTBA 2EUIA 2ZELA 4CGPA 3LD2A 1ARMA 1XJOA 2PR8A 3D68A 3S9MA 4KOSA 2PCUA 1X10A 1A2ZA 3F0AA 2JLMA 4U9YA 4UEFA 3D2PA 4R7MA 4A39A 1S7NA 2HB6A 2YNCA 2ZPAA 4FWUA 5KTDA 8CPAA 1WK4A 3GKRA 1KUVA 3BI0A 5A27A 5LYDA 1Z8LA 1PYTB 1XFOA 3SXNA 1VIXA 4A2ZA 1XMTA 3ZJ0A 3KQZA 1QMUA 2Z3PA 1IYKA 3PRTA 3BHXA 3D7DA 4QB9A 4NCZA 4M85A 5G21A 2X7BA 1IY7A 4B6ZA 3KASA 1F2PA 1ARLA 1QSTA 2NYQA 1Y7EA 2PJ9A 4HKFA 4KUAA 4ZYQA 3BI1A 2VQYA 3F8KA 3CXSA 1ON0A 1LFWA 2Z10A 4CYQA 3D66A 4MY0A 3OWCA 2C1CA 3KI9A 4R3LA 4UFWA 3IGRA 4PK2A 2ZEPA 4A95A 3LODA 2C6GA 5K8OA 5I0CA 1IB1E 4EWTA 4AVCA 4MXUA 2PIYA 3W91A 4OADA 2Q43A 4QC6A 4BMHA 4JXRA 2QVPA 2VBQA 4JZ0A 2IQ6A 1YVKA 2PJ5A 4YGOA 1XIXA 3BXMA 1RXTA 2PRBA 2WYRA 2PIZA 4X2TA 1CPSA 1F2OA 2AFXA 2B4DB 4M6GA 4OIDA 2Z3KA 5IX3A 3SJGA 2B5GA 3D4UA 3QAYA 1I21A 3RBUA 3A9LA 4KOTA 2PJAA 4C7IA 4MFLA 4Y49C 4P44A 1Q2YA 1LAPA 3UY5A 2RFHA 2V8GA 1OZPA 2F8HA 1KUXA 2OU2A 4GM5A 5E96A 3TO9A 1CBXA 5HH1A 4MCPA 2ZW6A 3PBBA 4KOWA 5F49A 4DJLA 3IU2A 3IIBA 3MN8A 3RZAA 1Q7LA 1J4JA 3PFOA 5HMNA 3ISXA 4OLLA 3V7ZA 4CAWA 4QUSA 3FXTA 3B7IA 2GREA 2XEIA 3G8WA 4NEXA 4A37A 4KLVA 4MBUA 4IK2A 4UFXA 3R95A 2Z11A 1HEEA 4R6TA 4X3RA 3F5BA 1M4IA 1Q2CA 2J8RA 5EBVA 5J8FA 3GB0A 4C2ZA 4CGLA 1K4JA 2AJ6A 2ANPA 1S60A 1FNOA 3FJUA 4MHZA 2VXKA 3GLJA 4KOYA 4IAVA 5D8NA 3TT2A 1AYEA 3DNSA 3JTKA 1NE9A 2OB0A 2FSRA 4A33A 3EO4A 2RB7A 4NGNA 5KTCA 4P4DA 3IWWA 4C2YA 4UEZA 4H89A 3TO7A 2YNEA 4MHNA 2CIJA 2G3TA 3TOAA 2WUUA 2G9DA 1MJ9A 2ABZA 3B3WA 4FD7A 4XPDC 3V38A 2ZOGA 3DGVA 3W6SA 1Z9UA 5DWMA 4Z65A 3S9LA 3L2NA 1VHOA 3K2KA 4QVTA 1JQGA 4CAFA 2FL4A 4Q7AA 4FAIA 4NF1A 3HLPA 2PJ2A 2B58A 1LRZA 2REEA 3TCVA 2PQ8A 3CPXA 3WC5A 3B3CA 1LCPA 3NH4A 4MHPA 4CPAA 4MY3A 4HNXB 4EMEA 3IJ3A 2B5GB 4WWVA 1VHSA 3FYNA 4CRZB 4OC5A 1YMEA 5IB9A 1DE4C 5THWA 2IL4A 4UCNA 5HVFA 3FRMA 4I49A 1XE4A 2GLJA 3LACA 1TKHA 2B3UA 4A94A 2BUEA 3GY9A 2WZNA 3B3TA 3N7ZA 2GANA 2XEFA 1KZFA 1RO5A 2VZYA 4PK3A 3TE4A 3CXQA 3TOBA 2Z3LA 2C27A 4KSFA 3SXOA 2Q4VA 1ZLIA 4C68A 2EVNA 3PB6X 3K9TA 3S9NA 1ELMP 4L89A 4P4EA 1BLLE 4JD6A 2BL1A 2YGWA 4L8AA 2AFZA 4BBHA 3GIUA 4B5PB 2AFOA 1IYLA 3HUVA 4ONWA 2OH1A 4JJXA 4RI1A 3SI2A 1ZO0A 1LAMA 1SQHA 1YW4A 2D4OA 2V8HA 2Z3NA 1OBRA 4AVBA 2O4HA 4MFJA 3SJFA 4NSQA 3WABA 4ZBGA 3IC1A 2PJCA 3D3SA 2Q51A 3TFYA 3D7FA 4M6IA 1QSRA 4KVOE 1TIQA 3KHXA 3RO0A 3SI0A 1CX8A 1NSAA 1Y0YA 2C6CA 3KZWA 4F6AA 4CGNA 4DYOA 1QQ9A 4B10A 3BJ7A 4NGMA 3KQXA 4RS2A 5F48A 5C82A 3KKWA 1YX0A 4R9MA 3NH5A 3NA6A 4GXHA 4Q38A 2OOTA 5K8PA 4W9YA 6CPAA 1M1DA 3H5ZA 5IV0A 3QAHA 2AFWA 2BO9A 1QSOA 2FE7A 2ZEOA 3GUXA 4NXYA 3RAMA 2OZUA 1S7FA 4ZY1A 2I79A 2Y0MA 4ZX9A 3NH8A 3S6KA 5JH9A 3LMSA 2HV2A 3T90A 2H5MA 1LOKA 2AFSA 4EFDA 4F0XA 3B8GA 2QYVA 2KCWA 4FD4A 2ZW5A 4B14A 1I12A 2JEWA 3WC6A 3FX6A 3EY5A 2Q44A 3PB9X 3PGPA 1Z8TA 2BOAA 2NMTA 4PXBA 2Q4ZA 1JWQA 2DPTA 3FNCA 4UF4A 4X8IA 5AG4A 2VL1A 3I1UA 3KR4A 1NMTA 1Y9WA 5CNPA 1YREA 1QSMA 3EFAA 4ZX8A 2Z3MA 2I3CA 3TO6A 4MMOA 1BAVA 1XRYA 4HNYB 5AG7A 2O28A 2P6EA 4UIBA 2BCOA 4IHMA 4R3KA 2ZEFA 1NSLA 1Y0RA 2DF5A 4PV6A 4OC0A 1R57A 3PB4X 4TWEA 4AG7A 1IICA 1YGHA 4P4IA 4YFJA 1LANA 2FXFA 4YWYA 4P6YA 2EO8A 4GS4A 3PB7X 3K9UA 4PQAA 4UEEA 1XMBA 4HPSA 3PEIA 4XNHB 1S3ZA 1CG2A 1ZG8A 2Q0YA 4R87A 5CBMA 2FS5A 2REFA 2QIRA 2GE3A 2QJ8A 3CT9A 4M3SA 3D67A 4A31A 2Q4YA 1XOVA 5H86A 1F57A 2GIVA 1M44A 4E8OA 3NE8A 1P4NA 3DSBA 3P2FA 2PJ7A 1GHEA 3FF3A 3GYAA 4PXDA 1YLEA 5F47A 2B4BA 4BINA 2EK9A 2PJBA 4ORFA 4PXCA 4CGMA 1RTQA 4JWPA 1S7KA 2OZHA 2K5TA 4E0AA 5LRKA 1WWZA 4KUBA 4CS0B 2CNMA 3CXPA 4Q36A 3R9GA 1M4DA 3MRUA 2FVGA 5D29A 4CGOA 5DS0A 4NGRA 2O53A 4PXEA 2QECA 2R1IA 4C2XA 3G3SA 4P4FA 3IO1A 3FB3A 5G22A 4PSWA 1CP6A 3B3SA 3QNVA 4XPLA 5DWNA 4A30A 4KOVA 2AE6A 1Z4EA 4KSIA 4CAEA 1MJAA 2J8MA 4K3NA 2POKA 4MI4A 1I1DA 4MRIA 7CPAA 4NFRA 1YLOA 4OC4A 3H8FA 2PSWA 1P0HA 3VWEA 4MJ8A 3JUWA 5JM6A 3QB8A 2DEAA 1VHEA 3DDDA 1R3NA 1TXRA 5ELYA 4JLYA 3R9EA 5LYFA 5FVJA 2JBJA 2ZOFA 4OIWA 3KGQA 1PCAA 4U5YA 4DNCA 3PB8X 4XPKA 2CXAA 2F5IA 2PJ8A 3PFEA 4R76A 4MCSA 2FIAA 1ZG9A 5J8CA 1UWYA 3RNZA 3IU1A 1HDUA 4UIAA 4F9VA 5K8MA 2B4DA 5HXDA 3WT4A 5HVHA 4MFZA 3R9FA 4KOXA 3MGDA 4RUHA 3FEDA 3I3GA 3CPAA 4K30A 2ZW4A 4A38A 4CYOA 1YW6A 4UBRA 4AB7A 4MFQA 3S6FA 2ZEGA 4E2AA 4Y49B 4CYPA 2DXQA 1ELLP 5EC4A 4NGSA 2CTCA 3D2MA 2I00A 5LYLA 5I4MA 3H4QA 2OR4A 2FIWA 4C7HA 2F7VA 2G0BA 1IU8A 4UCPA 3EXNA 3CDXA 4OC3A 1XEBA 2ZEHA 2ZEMA 3WR7A 1PUAA 4OMEA 5JQ4A 5G20A 5K8NA 4NGTA 2P6GA 3IFEA 3TX8A 5F46A 1UFHA 2P0WA 5EMIA 1AUGA 2QMLA 2Q7BA 3I9SA 1GYTA 3R96A 5JPHA 4UA3A 5AG6A 4WJBA 4O23A 4MCRA 4OAEA 4R57A 5LRJA 3W6XA 4YRHA 4CRYB 3DLJA 2V8VA 3KL9A 2AFMA 1HDQA 2HQYA 3T8WA 4FBEA 3P2HA 1V0CA 3IWEA 3BJ8A 3S6HA 2BSWA 1TKFA 4CAXA
chains in the Genus database with same CATH topology
1B87A 3DR8A 2JDCA 3NE7A 4H6ZA 4MFPA 4II9A 3BLNA 1FY7A 1Z4RA 2Q04A 1L0CA 5ISVA 1YR0A 3ZZIA 1S5KA 1YVOA 4KVXA 4XPDB 2PC1A 2BEIA 2ZXVA 5IB0A 4PSXA 4HNWB 3T9YA 2JEVA 4MFKA 2CNSA 4KZTA 1VKCA 4MHDA 3DR6A 4J3GA 4F0YA 4KLWA 3FIXA 2HUZA 4UWJA 2J8NA 4ONUA 1BOBA 2P6FA 1Y9KA 2CY2A 1N71A 1BO4A 2D4PA 4QBJA 1PU9A 3PZJA 2FCKA 2CNTA 4UWIA 5G1ZA 2RC4A 4LUAA 2Z3OA 1U6MA 2R98A 2VZZA 4AG9A 4JXQA 1QSNA 3RYOA 1MJBA 4B5PA 4KORA 2PR1A 1MK4A 4IF5A 1CJWA 2R7HA 5A28A 1IIDA 4A32A 4B12A 2ATRA 2VI7A 4FD6A 2FT0A 3C26A 3IWGA 2ZW7A 4FD5A 3S6GA 4LX9A 3FBUA 2DPSA 4AVAA 4U9ZA 2WPWA 3SHPA 4X5KA 2YNDA 2ARHA 1YK3A 2A4NA 2Z0ZA 4CAVA 3JVNA 4IUSA 5BWAB 4CYNA 1CM0A 5GCNA 3PP9A 2G3AA 3D8PA 4EVYA 4H6UA 2B3VA 2WSAA 1M4GA 1B6BA 3E0KA 4KOUA 1S7LA 1Q2DA 1XF8A 3TTHA 4B11A 3EC4A 2VEZA 3R1KA 4ZGYB 1KUYA 4KS9A 5C88A 1Y7RA 4UFVA 2PDOA 2YNCC 2WPXA 5KTAA 4UCMA 4XNHC 5AGEA 2R8VA 2OZGA 5H84A 4B5OA 3VWDA 3V8IA 4B13A 2JDDA 5AG5A 4KVME 4KSAA 2EUIA 4CGPA 3LD2A 2PR8A 4KOSA 3F0AA 2JLMA 4U9YA 3D2PA 1S7NA 2YNCA 2ZPAA 5KTDA 1WK4A 3GKRA 1KUVA 5A27A 3SXNA 4A2ZA 1XMTA 3ZJ0A 2Z3PA 1IYKA 4QB9A 4NCZA 4M85A 5G21A 2X7BA 1QSTA 4HKFA 4KUAA 2VQYA 3F8KA 3CXSA 1ON0A 2Z10A 4CYQA 4MY0A 3OWCA 4R3LA 4UFWA 3IGRA 4PK2A 4A95A 3LODA 5I0CA 1IB1E 4AVCA 3W91A 4OADA 4QC6A 4BMHA 4JXRA 2VBQA 1YVKA 4YGOA 1XIXA 1RXTA 2PRBA 2B4DB 2Z3KA 5IX3A 2B5GA 1I21A 3A9LA 4KOTA 4C7IA 4MFLA 4Y49C 1Q2YA 3UY5A 1OZPA 1KUXA 2OU2A 5E96A 3TO9A 5HH1A 2ZW6A 4KOWA 5F49A 3IU2A 1J4JA 5HMNA 4OLLA 4CAWA 4QUSA 3FXTA 3G8WA 4NEXA 4KLVA 4MBUA 4UFXA 3R95A 2Z11A 3F5BA 1M4IA 1Q2CA 2J8RA 5EBVA 5J8FA 4C2ZA 4CGLA 1K4JA 2AJ6A 1S60A 2VXKA 4KOYA 3TT2A 3JTKA 3DNSA 1NE9A 2OB0A 2FSRA 4A33A 3EO4A 5KTCA 4C2YA 4H89A 3TO7A 2YNEA 2G3TA 3TOAA 2WUUA 1MJ9A 4FD7A 4XPDC 3W6SA 1Z9UA 5DWMA 4QVTA 4CAFA 2FL4A 4NF1A 2B58A 1LRZA 2REEA 3TCVA 2PQ8A 4MY3A 4HNXB 4CRZB 2B5GB 1VHSA 3FYNA 2IL4A 4UCNA 3FRMA 4I49A 1XE4A 2B3UA 2BUEA 3GY9A 3N7ZA 2GANA 3TE4A 1KZFA 1RO5A 2VZYA 4PK3A 3CXQA 3TOBA 2Z3LA 2C27A 4KSFA 3SXOA 2Q4VA 4C68A 2EVNA 4L89A 4JD6A 2BL1A 2YGWA 4L8AA 4BBHA 4B5PB 1IYLA 2OH1A 4JJXA 4RI1A 1ZO0A 1SQHA 2D4OA 2Z3NA 4AVBA 4MFJA 4NSQA 4ZBGA 3D3SA 3TFYA 1QSRA 4KVOE 1TIQA 4F6AA 4CGNA 4B10A 3BJ7A 4RS2A 5F48A 5C82A 3KKWA 1YX0A 4R9MA 4Q38A 1M1DA 3H5ZA 5IV0A 3QAHA 1QSOA 2FE7A 4NXYA 2OZUA 1S7FA 2I79A 2Y0MA 3S6KA 2HV2A 3T90A 2H5MA 4F0XA 3B8GA 2KCWA 4FD4A 2ZW5A 4B14A 1I12A 3EY5A 2Q44A 3PGPA 2NMTA 2DPTA 3FNCA 5AG4A 1NMTA 1Y9WA 5CNPA 1YREA 1QSMA 3EFAA 2Z3MA 3TO6A 4HNYB 5AG7A 2O28A 2P6EA 1NSLA 4R3KA 4PV6A 1R57A 4AG7A 1IICA 1YGHA 4YFJA 2FXFA 4GS4A 3K9UA 4XNHB 1S3ZA 2Q0YA 4R87A 2FS5A 2REFA 2QIRA 2GE3A 4M3SA 4A31A 2Q4YA 5H86A 2GIVA 1M44A 4E8OA 1P4NA 3DSBA 3P2FA 1GHEA 3GYAA 1YLEA 5F47A 2B4BA 4ORFA 4CGMA 4JWPA 1S7KA 2OZHA 2K5TA 4E0AA 1WWZA 4KUBA 4CS0B 2CNMA 3CXPA 4Q36A 3R9GA 1M4DA 4CGOA 2QECA 2R1IA 4C2XA 3G3SA 3FB3A 5G22A 4PSWA 4XPLA 5DWNA 4A30A 4KOVA 2AE6A 1Z4EA 4CAEA 1MJAA 2J8MA 4MI4A 1I1DA 2PSWA 1P0HA 3VWEA 4MJ8A 3JUWA 3QB8A 3DDDA 3R9EA 4JLYA 5FVJA 4U5YA 4DNCA 4XPKA 2CXAA 2F5IA 2FIAA 5J8CA 3IU1A 2B4DA 4MFZA 3R9FA 4KOXA 3MGDA 3I3GA 4K30A 2ZW4A 4CYOA 4UBRA 4AB7A 4MFQA 3S6FA 4E2AA 4Y49B 4CYPA 2DXQA 5EC4A 3D2MA 2I00A 3H4QA 2FIWA 4C7HA 2G0BA 4UCPA 3EXNA 1XEBA 3WR7A 1PUAA 5JQ4A 5G20A 2P6GA 5F46A 1UFHA 2P0WA 2QMLA 2Q7BA 3I9SA 3R96A 5JPHA 4UA3A 5AG6A 3W6XA 4OAEA 4R57A 4CRYB 4YRHA 2HQYA 3P2HA 1V0CA 3IWEA 3BJ8A 3S6HA 2BSWA 4CAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B87 A;  3DR8 A;  2JDC A;  3NE7 A;  4H6Z A;  4II9 A;  3BLN A;  1FY7 A;  1Z4R A;  2Q04 A;  1L0C A;  5ISV A;  1YR0 A;  3ZZI A;  1S5K A;  1YVO A;  4KVX A;  4XPD B;  2PC1 A;  2BEI A;  2ZXV A;  5IB0 A;  4PSX A;  4HNW B;  3T9Y A;  2JEV A;  2CNS A;  4KZT A;  1VKC A;  4MHD A;  3DR6 A;  4J3G A;  4F0Y A;  4KLW A;  3FIX A;  2HUZ A;  4UWJ A;  2J8N A;  4ONU A;  1BOB A;  2P6F A;  1Y9K A;  2CY2 A;  1N71 A;  1BO4 A;  2D4P A;  4QBJ A;  1PU9 A;  3PZJ A;  2FCK A;  2CNT A;  4UWI A;  2RC4 A;  4LUA A;  1U6M A;  2R98 A;  2VZZ A;  4AG9 A;  4JXQ A;  1QSN A;  3RYO A;  1MJB A;  4B5P A;  4KOR A;  2PR1 A;  1MK4 A;  4IF5 A;  1CJW A;  2R7H A;  1IID A;  2ATR A;  2VI7 A;  4FD6 A;  2FT0 A;  3C26 A;  3IWG A;  2ZW7 A;  4FD5 A;  3S6G A;  4LX9 A;  3FBU A;  4AVA A;  4U9Z A;  2WPW A;  3SHP A;  4X5K A;  2ARH A;  1YK3 A;  2A4N A;  2Z0Z A;  4CAV A;  3JVN A;  4IUS A;  1CM0 A;  5GCN A;  3PP9 A;  2G3A A;  3D8P A;  4EVY A;  4H6U A;  2B3V A;  1M4G A;  1B6B A;  3E0K A;  4KOU A;  1S7L A;  1Q2D A;  1XF8 A;  3TTH A;  3EC4 A;  2VEZ A;  3R1K A;  1KUY A;  5C88 A;  1Y7R A;  2PDO A;  2WPX A;  5KTA A;  4XNH C;  2R8V A;  2OZG A;  5H84 A;  4B5O A;  3VWD A;  3V8I A;  2JDD A;  4KVM E;  2EUI A;  3LD2 A;  2PR8 A;  4KOS A;  3F0A A;  2JLM A;  4U9Y A;  3D2P A;  1S7N A;  2ZPA A;  5KTD A;  1WK4 A;  3GKR A;  1KUV A;  3SXN A;  1XMT A;  3ZJ0 A;  1IYK A;  4QB9 A;  4NCZ A;  4M85 A;  2X7B A;  1QST A;  4HKF A;  4KUA A;  2VQY A;  3F8K A;  3CXS A;  1ON0 A;  2Z10 A;  4MY0 A;  3OWC A;  4R3L A;  3IGR A;  4PK2 A;  3LOD A;  5I0C A;  1IB1 E;  4AVC A;  3W91 A;  4OAD A;  4QC6 A;  4BMH A;  4JXR A;  2VBQ A;  1YVK A;  4YGO A;  1XIX A;  1RXT A;  2PRB A;  2B4D B;  5IX3 A;  2B5G A;  1I21 A;  4KOT A;  4Y49 C;  1Q2Y A;  3UY5 A;  1OZP A;  1KUX A;  2OU2 A;  5E96 A;  3TO9 A;  5HH1 A;  2ZW6 A;  4KOW A;  5F49 A;  1J4J A;  5HMN A;  4OLL A;  4CAW A;  4QUS A;  3FXT A;  3G8W A;  4NEX A;  4KLV A;  4MBU A;  3R95 A;  2Z11 A;  3F5B A;  1M4I A;  1Q2C A;  2J8R A;  5EBV A;  5J8F A;  1K4J A;  2AJ6 A;  1S60 A;  2VXK A;  4KOY A;  3TT2 A;  3DNS A;  1NE9 A;  2OB0 A;  2FSR A;  3EO4 A;  5KTC A;  4H89 A;  3TO7 A;  2G3T A;  3TOA A;  1MJ9 A;  4FD7 A;  4XPD C;  3W6S A;  1Z9U A;  5DWM A;  4QVT A;  2FL4 A;  4NF1 A;  2B58 A;  1LRZ A;  2REE A;  3TCV A;  2PQ8 A;  4MY3 A;  4HNX B;  4CRZ B;  2B5G B;  1VHS A;  3FYN A;  2IL4 A;  3FRM A;  4I49 A;  1XE4 A;  2B3U A;  2BUE A;  3GY9 A;  3N7Z A;  2GAN A;  3TE4 A;  1KZF A;  1RO5 A;  2VZY A;  4PK3 A;  3CXQ A;  3TOB A;  2C27 A;  3SXO A;  2Q4V A;  2EVN A;  4L89 A;  4JD6 A;  2BL1 A;  4L8A A;  4B5P B;  1IYL A;  2OH1 A;  4JJX A;  4RI1 A;  1SQH A;  2D4O A;  4AVB A;  4NSQ A;  4ZBG A;  3D3S A;  3TFY A;  1QSR A;  4KVO E;  1TIQ A;  4F6A A;  3BJ7 A;  4RS2 A;  5F48 A;  5C82 A;  3KKW A;  1YX0 A;  4R9M A;  1M1D A;  5IV0 A;  3QAH A;  1QSO A;  2FE7 A;  4NXY A;  2OZU A;  1S7F A;  2I79 A;  2Y0M A;  3S6K A;  2HV2 A;  3T90 A;  2H5M A;  3B8G A;  2KCW A;  4FD4 A;  2ZW5 A;  1I12 A;  3EY5 A;  2Q44 A;  3PGP A;  2NMT A;  3FNC A;  1NMT A;  1Y9W A;  5CNP A;  1YRE A;  1QSM A;  3EFA A;  3TO6 A;  4HNY B;  2O28 A;  2P6E A;  1NSL A;  4R3K A;  4PV6 A;  1R57 A;  4AG7 A;  1IIC A;  1YGH A;  4YFJ A;  2FXF A;  4GS4 A;  3K9U A;  4XNH B;  1S3Z A;  2Q0Y A;  4R87 A;  2FS5 A;  2REF A;  2QIR A;  2GE3 A;  4M3S A;  2Q4Y A;  5H86 A;  2GIV A;  1M44 A;  4E8O A;  1P4N A;  3DSB A;  3P2F A;  1GHE A;  3GYA A;  1YLE A;  5F47 A;  2B4B A;  4ORF A;  4JWP A;  1S7K A;  2OZH A;  2K5T A;  4E0A A;  1WWZ A;  4KUB A;  4CS0 B;  2CNM A;  3CXP A;  3R9G A;  1M4D A;  2QEC A;  2R1I A;  3G3S A;  3FB3 A;  4PSW A;  4XPL A;  5DWN A;  4KOV A;  2AE6 A;  1Z4E A;  1MJA A;  2J8M A;  4MI4 A;  1I1D A;  2PSW A;  1P0H A;  3VWE A;  4MJ8 A;  3JUW A;  3QB8 A;  3DDD A;  3R9E A;  4JLY A;  5FVJ A;  4U5Y A;  4DNC A;  4XPK A;  2F5I A;  2FIA A;  5J8C A;  2B4D A;  3R9F A;  4KOX A;  3MGD A;  3I3G A;  4K30 A;  2ZW4 A;  4UBR A;  4AB7 A;  3S6F A;  4E2A A;  4Y49 B;  2DXQ A;  5EC4 A;  3D2M A;  2I00 A;  3H4Q A;  2FIW A;  2G0B A;  3EXN A;  1XEB A;  3WR7 A;  1PUA A;  5JQ4 A;  2P6G A;  5F46 A;  1UFH A;  2P0W A;  2QML A;  2Q7B A;  3I9S A;  3R96 A;  5JPH A;  4UA3 A;  3W6X A;  4OAE A;  4R57 A;  4CRY B;  4YRH A;  2HQY A;  3P2H A;  1V0C A;  3BJ8 A;  3S6H A;  2BSW A;  4CAX A; 
#chains in the Genus database with same CATH topology
 3N5F A;  2PVW A;  1B87 A;  3DR8 A;  3NFZ A;  2JDC A;  2NSM A;  3FEC A;  3NE7 A;  4H6Z A;  4P4B A;  4MFP A;  2JBK A;  4MHY A;  2V8D A;  4DUK A;  3BLN A;  4II9 A;  1FY7 A;  1Z4R A;  3SI1 A;  2PJ1 A;  2Q04 A;  1L0C A;  4MCQ A;  5ISV A;  3D7G A;  4AXV A;  4BD9 A;  4NGP A;  3B2Y A;  1YR0 A;  3IEH A;  1CPX A;  2PVV A;  3ZZI A;  1S5K A;  1YVO A;  2PRQ A;  4KVX A;  4G1P A;  4M6H A;  4XPD B;  2PC1 A;  2BEI A;  2PJ0 A;  2ZXV A;  3ISZ A;  1IOI A;  5LYI A;  5IB0 A;  4PSX A;  3FH4 A;  2ZEE A;  4HNW B;  3VAR A;  3T9Y A;  1Z8X A;  1BPM A;  3H8G A;  3B3V A;  2JEV A;  1ZG7 A;  4FUU A;  4MFK A;  2CNS A;  4KZT A;  1VKC A;  1KWM A;  2CF4 A;  2EBJ A;  5HVG A;  1TF9 A;  4MHD A;  3DR6 A;  4J3G A;  1EE3 P;  4KLW A;  3FIX A;  4F0Y A;  4F9U A;  3JRU A;  2HUZ A;  4RN7 A;  4UWJ A;  2J8N A;  4ONU A;  1BOB A;  2P6F A;  1Y9K A;  2CY2 A;  1N71 A;  2PJ6 A;  3SJE A;  1BO4 A;  1Z2L A;  2D4P A;  4QBJ A;  4R8F A;  3KR5 A;  1PU9 A;  1IOF A;  1TKJ A;  1FT7 A;  1YQE A;  3PZJ A;  2FCK A;  2PJ4 A;  5J1Q A;  2CNT A;  1AMP A;  2C6P A;  4UWI A;  5G1Z A;  3H8E A;  2RC4 A;  4NJR A;  4LUA A;  2J9A A;  2Z3O A;  1U6M A;  1VGY A;  2R98 A;  1M4L A;  2VZZ A;  4AG9 A;  2XEJ A;  1QSN A;  2Q7S A;  4JXQ A;  3CZX A;  1MJB A;  3RYO A;  4B5P A;  4KOR A;  4OKO A;  4P45 A;  2PR1 A;  4P4J A;  1MK4 A;  3TC8 A;  4IF5 A;  1CJW A;  2R7H A;  4LQ6 A;  5A28 A;  1YSJ A;  2GFQ A;  3D7H A;  1IID A;  4A32 A;  4B12 A;  4TNU A;  2ATR A;  2VI7 A;  4FD6 A;  4ZY2 A;  1H8L A;  4OP4 A;  2FT0 A;  3VAT A;  3C26 A;  3IWG A;  2ZW7 A;  1TF8 A;  1ZLH A;  1IGB A;  3FMC A;  4FD5 A;  3S6G A;  1DTD A;  2PE3 A;  4P10 A;  4LX9 A;  3FBU A;  3LWU A;  2DPS A;  4OC2 A;  2EWB A;  4AVA A;  2V77 A;  4U9Z A;  2ODF A;  2WPW A;  2IJZ A;  4NJQ A;  3SHP A;  2PJ3 A;  2ZED A;  4X5K A;  2HC9 A;  2YND A;  1R43 A;  2ARH A;  4LQG A;  4F8Z A;  1YK3 A;  2A4N A;  2Z0Z A;  4CAV A;  3JVN A;  4IUS A;  4OC1 A;  4ZI6 A;  5BWA B;  4CYN A;  1CM0 A;  5GCN A;  2ZEN A;  3PP9 A;  2G3A A;  3D8P A;  4NGQ A;  4JYW A;  4EVY A;  3WC7 A;  4H6U A;  1X12 A;  2B3V A;  2WSA A;  1M4G A;  2IMO A;  1B6B A;  3E0K A;  4KOU A;  1S7L A;  1Q2D A;  4PPZ A;  1XF8 A;  3SJX A;  1Z5R A;  2GLF A;  3TTH A;  5F09 A;  4YU9 A;  4B11 A;  2GU2 A;  1CP7 A;  2AFU A;  2VEZ A;  3EC4 A;  3FEE A;  3PBE A;  3R1K A;  4ZGY B;  1KUY A;  4KS9 A;  3B35 A;  2EK8 A;  5C88 A;  1Y7R A;  4H2K A;  4UFV A;  2PDO A;  2YNC C;  2WPX A;  3KHZ A;  5KTA A;  4UCM A;  1Z8W A;  1XBU A;  4XNH C;  5AGE A;  2R8V A;  5CPA A;  5LRG A;  5JGF A;  2OZG A;  2XEG A;  5H84 A;  4B5O A;  3VH9 A;  3VWD A;  3V8I A;  3FVL A;  4B13 A;  2JDD A;  5AG5 A;  1BPN A;  4KVM E;  4KSA A;  4ZY0 A;  2CTB A;  2EUI A;  2ZEL A;  4CGP A;  3LD2 A;  1ARM A;  1XJO A;  2PR8 A;  3D68 A;  3S9M A;  4KOS A;  2PCU A;  1X10 A;  1A2Z A;  3F0A A;  2JLM A;  4U9Y A;  4UEF A;  3D2P A;  4R7M A;  4A39 A;  1S7N A;  2HB6 A;  2YNC A;  2ZPA A;  4FWU A;  5KTD A;  8CPA A;  1WK4 A;  3GKR A;  1KUV A;  3BI0 A;  5A27 A;  5LYD A;  1Z8L A;  1PYT B;  1XFO A;  3SXN A;  1VIX A;  4A2Z A;  1XMT A;  3ZJ0 A;  3KQZ A;  1QMU A;  2Z3P A;  1IYK A;  3PRT A;  3BHX A;  3D7D A;  4QB9 A;  4NCZ A;  4M85 A;  5G21 A;  2X7B A;  1IY7 A;  4B6Z A;  3KAS A;  1F2P A;  1ARL A;  1QST A;  2NYQ A;  1Y7E A;  2PJ9 A;  4HKF A;  4KUA A;  4ZYQ A;  3BI1 A;  2VQY A;  3F8K A;  3CXS A;  1ON0 A;  1LFW A;  2Z10 A;  4CYQ A;  3D66 A;  4MY0 A;  3OWC A;  2C1C A;  3KI9 A;  4R3L A;  4UFW A;  3IGR A;  4PK2 A;  2ZEP A;  4A95 A;  3LOD A;  2C6G A;  5K8O A;  5I0C A;  1IB1 E;  4EWT A;  4AVC A;  4MXU A;  2PIY A;  3W91 A;  4OAD A;  2Q43 A;  4QC6 A;  4BMH A;  4JXR A;  2QVP A;  2VBQ A;  4JZ0 A;  2IQ6 A;  1YVK A;  2PJ5 A;  4YGO A;  1XIX A;  3BXM A;  1RXT A;  2PRB A;  2WYR A;  2PIZ A;  4X2T A;  1CPS A;  1F2O A;  2AFX A;  2B4D B;  4M6G A;  4OID A;  2Z3K A;  5IX3 A;  3SJG A;  2B5G A;  3D4U A;  3QAY A;  1I21 A;  3RBU A;  3A9L A;  4KOT A;  2PJA A;  4C7I A;  4MFL A;  4Y49 C;  4P44 A;  1Q2Y A;  1LAP A;  3UY5 A;  2RFH A;  2V8G A;  1OZP A;  2F8H A;  1KUX A;  2OU2 A;  4GM5 A;  5E96 A;  3TO9 A;  1CBX A;  5HH1 A;  4MCP A;  2ZW6 A;  3PBB A;  4KOW A;  5F49 A;  4DJL A;  3IU2 A;  3IIB A;  3MN8 A;  3RZA A;  1Q7L A;  1J4J A;  3PFO A;  5HMN A;  3ISX A;  4OLL A;  3V7Z A;  4CAW A;  4QUS A;  3FXT A;  3B7I A;  2GRE A;  2XEI A;  3G8W A;  4NEX A;  4A37 A;  4KLV A;  4MBU A;  4IK2 A;  4UFX A;  3R95 A;  2Z11 A;  1HEE A;  4R6T A;  4X3R A;  3F5B A;  1M4I A;  1Q2C A;  2J8R A;  5EBV A;  5J8F A;  3GB0 A;  4C2Z A;  4CGL A;  1K4J A;  2AJ6 A;  2ANP A;  1S60 A;  1FNO A;  3FJU A;  4MHZ A;  2VXK A;  3GLJ A;  4KOY A;  4IAV A;  5D8N A;  3TT2 A;  1AYE A;  3DNS A;  3JTK A;  1NE9 A;  2OB0 A;  2FSR A;  4A33 A;  3EO4 A;  2RB7 A;  4NGN A;  5KTC A;  4P4D A;  3IWW A;  4C2Y A;  4UEZ A;  4H89 A;  3TO7 A;  2YNE A;  4MHN A;  2CIJ A;  2G3T A;  3TOA A;  2WUU A;  2G9D A;  1MJ9 A;  2ABZ A;  3B3W A;  4FD7 A;  4XPD C;  3V38 A;  2ZOG A;  3DGV A;  3W6S A;  1Z9U A;  5DWM A;  4Z65 A;  3S9L A;  3L2N A;  1VHO A;  3K2K A;  4QVT A;  1JQG A;  4CAF A;  2FL4 A;  4Q7A A;  4FAI A;  4NF1 A;  3HLP A;  2PJ2 A;  2B58 A;  1LRZ A;  2REE A;  3TCV A;  2PQ8 A;  3CPX A;  3WC5 A;  3B3C A;  1LCP A;  3NH4 A;  4MHP A;  4CPA A;  4MY3 A;  4HNX B;  4EME A;  3IJ3 A;  2B5G B;  4WWV A;  1VHS A;  3FYN A;  4CRZ B;  4OC5 A;  1YME A;  5IB9 A;  1DE4 C;  5THW A;  2IL4 A;  4UCN A;  5HVF A;  3FRM A;  4I49 A;  1XE4 A;  2GLJ A;  3LAC A;  1TKH A;  2B3U A;  4A94 A;  2BUE A;  3GY9 A;  2WZN A;  3B3T A;  3N7Z A;  2GAN A;  2XEF A;  1KZF A;  1RO5 A;  2VZY A;  4PK3 A;  3TE4 A;  3CXQ A;  3TOB A;  2Z3L A;  2C27 A;  4KSF A;  3SXO A;  2Q4V A;  1ZLI A;  4C68 A;  2EVN A;  3PB6 X;  3K9T A;  3S9N A;  1ELM P;  4L89 A;  4P4E A;  1BLL E;  4JD6 A;  2BL1 A;  2YGW A;  4L8A A;  2AFZ A;  4BBH A;  3GIU A;  4B5P B;  2AFO A;  1IYL A;  3HUV A;  4ONW A;  2OH1 A;  4JJX A;  4RI1 A;  3SI2 A;  1ZO0 A;  1LAM A;  1SQH A;  1YW4 A;  2D4O A;  2V8H A;  2Z3N A;  1OBR A;  4AVB A;  2O4H A;  4MFJ A;  3SJF A;  4NSQ A;  3WAB A;  4ZBG A;  3IC1 A;  2PJC A;  3D3S A;  2Q51 A;  3TFY A;  3D7F A;  4M6I A;  1QSR A;  4KVO E;  1TIQ A;  3KHX A;  3RO0 A;  3SI0 A;  1CX8 A;  1NSA A;  1Y0Y A;  2C6C A;  3KZW A;  4F6A A;  4CGN A;  4DYO A;  1QQ9 A;  4B10 A;  3BJ7 A;  4NGM A;  3KQX A;  4RS2 A;  5F48 A;  5C82 A;  3KKW A;  1YX0 A;  4R9M A;  3NH5 A;  3NA6 A;  4GXH A;  4Q38 A;  2OOT A;  5K8P A;  4W9Y A;  6CPA A;  1M1D A;  3H5Z A;  5IV0 A;  3QAH A;  2AFW A;  2BO9 A;  1QSO A;  2FE7 A;  2ZEO A;  3GUX A;  4NXY A;  3RAM A;  2OZU A;  1S7F A;  4ZY1 A;  2I79 A;  2Y0M A;  4ZX9 A;  3NH8 A;  3S6K A;  5JH9 A;  3LMS A;  2HV2 A;  3T90 A;  2H5M A;  1LOK A;  2AFS A;  4EFD A;  4F0X A;  3B8G A;  2QYV A;  2KCW A;  4FD4 A;  2ZW5 A;  4B14 A;  1I12 A;  2JEW A;  3WC6 A;  3FX6 A;  3EY5 A;  2Q44 A;  3PB9 X;  3PGP A;  1Z8T A;  2BOA A;  2NMT A;  4PXB A;  2Q4Z A;  1JWQ A;  2DPT A;  3FNC A;  4UF4 A;  4X8I A;  5AG4 A;  2VL1 A;  3I1U A;  3KR4 A;  1NMT A;  1Y9W A;  5CNP A;  1YRE A;  1QSM A;  3EFA A;  4ZX8 A;  2Z3M A;  2I3C A;  3TO6 A;  4MMO A;  1BAV A;  1XRY A;  4HNY B;  5AG7 A;  2O28 A;  2P6E A;  4UIB A;  2BCO A;  4IHM A;  4R3K A;  2ZEF A;  1NSL A;  1Y0R A;  2DF5 A;  4PV6 A;  4OC0 A;  1R57 A;  3PB4 X;  4TWE A;  4AG7 A;  1IIC A;  1YGH A;  4P4I A;  4YFJ A;  1LAN A;  2FXF A;  4YWY A;  4P6Y A;  2EO8 A;  4GS4 A;  3PB7 X;  3K9U A;  4PQA A;  4UEE A;  1XMB A;  4HPS A;  3PEI A;  4XNH B;  1S3Z A;  1CG2 A;  1ZG8 A;  2Q0Y A;  4R87 A;  5CBM A;  2FS5 A;  2REF A;  2QIR A;  2GE3 A;  2QJ8 A;  3CT9 A;  4M3S A;  3D67 A;  4A31 A;  2Q4Y A;  1XOV A;  5H86 A;  1F57 A;  2GIV A;  1M44 A;  4E8O A;  3NE8 A;  1P4N A;  3DSB A;  3P2F A;  2PJ7 A;  1GHE A;  3FF3 A;  3GYA A;  4PXD A;  1YLE A;  5F47 A;  2B4B A;  4BIN A;  2EK9 A;  2PJB A;  4ORF A;  4PXC A;  4CGM A;  1RTQ A;  4JWP A;  1S7K A;  2OZH A;  2K5T A;  4E0A A;  5LRK A;  1WWZ A;  4KUB A;  4CS0 B;  2CNM A;  3CXP A;  4Q36 A;  3R9G A;  1M4D A;  3MRU A;  2FVG A;  5D29 A;  4CGO A;  5DS0 A;  4NGR A;  2O53 A;  4PXE A;  2QEC A;  2R1I A;  4C2X A;  3G3S A;  4P4F A;  3IO1 A;  3FB3 A;  5G22 A;  4PSW A;  1CP6 A;  3B3S A;  3QNV A;  4XPL A;  5DWN A;  4A30 A;  4KOV A;  2AE6 A;  1Z4E A;  4KSI A;  4CAE A;  1MJA A;  2J8M A;  4K3N A;  2POK A;  4MI4 A;  1I1D A;  4MRI A;  7CPA A;  4NFR A;  1YLO A;  4OC4 A;  3H8F A;  2PSW A;  1P0H A;  3VWE A;  4MJ8 A;  3JUW A;  5JM6 A;  3QB8 A;  2DEA A;  1VHE A;  3DDD A;  1R3N A;  1TXR A;  5ELY A;  4JLY A;  3R9E A;  5LYF A;  5FVJ A;  2JBJ A;  2ZOF A;  4OIW A;  3KGQ A;  1PCA A;  4U5Y A;  4DNC A;  3PB8 X;  4XPK A;  2CXA A;  2F5I A;  2PJ8 A;  3PFE A;  4R76 A;  4MCS A;  2FIA A;  1ZG9 A;  5J8C A;  1UWY A;  3RNZ A;  3IU1 A;  1HDU A;  4UIA A;  4F9V A;  5K8M A;  2B4D A;  5HXD A;  3WT4 A;  5HVH A;  4MFZ A;  3R9F A;  4KOX A;  3MGD A;  4RUH A;  3FED A;  3I3G A;  3CPA A;  4K30 A;  2ZW4 A;  4A38 A;  4CYO A;  1YW6 A;  4UBR A;  4AB7 A;  4MFQ A;  3S6F A;  2ZEG A;  4E2A A;  4Y49 B;  4CYP A;  2DXQ A;  1ELL P;  5EC4 A;  4NGS A;  2CTC A;  3D2M A;  2I00 A;  5LYL A;  5I4M A;  3H4Q A;  2OR4 A;  2FIW A;  4C7H A;  2F7V A;  2G0B A;  1IU8 A;  4UCP A;  3EXN A;  3CDX A;  4OC3 A;  1XEB A;  2ZEH A;  2ZEM A;  3WR7 A;  1PUA A;  4OME A;  5JQ4 A;  5G20 A;  5K8N A;  4NGT A;  2P6G A;  3IFE A;  3TX8 A;  5F46 A;  1UFH A;  2P0W A;  5EMI A;  1AUG A;  2QML A;  2Q7B A;  3I9S A;  1GYT A;  3R96 A;  5JPH A;  4UA3 A;  5AG6 A;  4WJB A;  4O23 A;  4MCR A;  4OAE A;  4R57 A;  5LRJ A;  3W6X A;  4YRH A;  4CRY B;  3DLJ A;  2V8V A;  3KL9 A;  2AFM A;  1HDQ A;  2HQY A;  3T8W A;  4FBE A;  3P2H A;  1V0C A;  3IWE A;  3BJ8 A;  3S6H A;  2BSW A;  1TKF A;  4CAX A; 
#chains in the Genus database with same CATH homology
 1B87 A;  3DR8 A;  2JDC A;  3NE7 A;  4H6Z A;  4MFP A;  4II9 A;  3BLN A;  1FY7 A;  1Z4R A;  2Q04 A;  1L0C A;  5ISV A;  1YR0 A;  3ZZI A;  1S5K A;  1YVO A;  4KVX A;  4XPD B;  2PC1 A;  2BEI A;  2ZXV A;  5IB0 A;  4PSX A;  4HNW B;  3T9Y A;  2JEV A;  4MFK A;  2CNS A;  4KZT A;  1VKC A;  4MHD A;  3DR6 A;  4J3G A;  4F0Y A;  4KLW A;  3FIX A;  2HUZ A;  4UWJ A;  2J8N A;  4ONU A;  1BOB A;  2P6F A;  1Y9K A;  2CY2 A;  1N71 A;  1BO4 A;  2D4P A;  4QBJ A;  1PU9 A;  3PZJ A;  2FCK A;  2CNT A;  4UWI A;  5G1Z A;  2RC4 A;  4LUA A;  2Z3O A;  1U6M A;  2R98 A;  2VZZ A;  4AG9 A;  4JXQ A;  1QSN A;  3RYO A;  1MJB A;  4B5P A;  4KOR A;  2PR1 A;  1MK4 A;  4IF5 A;  1CJW A;  2R7H A;  5A28 A;  1IID A;  4A32 A;  4B12 A;  2ATR A;  2VI7 A;  4FD6 A;  2FT0 A;  3C26 A;  3IWG A;  2ZW7 A;  4FD5 A;  3S6G A;  4LX9 A;  3FBU A;  2DPS A;  4AVA A;  4U9Z A;  2WPW A;  3SHP A;  4X5K A;  2YND A;  2ARH A;  1YK3 A;  2A4N A;  2Z0Z A;  4CAV A;  3JVN A;  4IUS A;  5BWA B;  4CYN A;  1CM0 A;  5GCN A;  3PP9 A;  2G3A A;  3D8P A;  4EVY A;  4H6U A;  2B3V A;  2WSA A;  1M4G A;  1B6B A;  3E0K A;  4KOU A;  1S7L A;  1Q2D A;  1XF8 A;  3TTH A;  4B11 A;  3EC4 A;  2VEZ A;  3R1K A;  4ZGY B;  1KUY A;  4KS9 A;  5C88 A;  1Y7R A;  4UFV A;  2PDO A;  2YNC C;  2WPX A;  5KTA A;  4UCM A;  4XNH C;  5AGE A;  2R8V A;  2OZG A;  5H84 A;  4B5O A;  3VWD A;  3V8I A;  4B13 A;  2JDD A;  5AG5 A;  4KVM E;  4KSA A;  2EUI A;  4CGP A;  3LD2 A;  2PR8 A;  4KOS A;  3F0A A;  2JLM A;  4U9Y A;  3D2P A;  1S7N A;  2YNC A;  2ZPA A;  5KTD A;  1WK4 A;  3GKR A;  1KUV A;  5A27 A;  3SXN A;  4A2Z A;  1XMT A;  3ZJ0 A;  2Z3P A;  1IYK A;  4QB9 A;  4NCZ A;  4M85 A;  5G21 A;  2X7B A;  1QST A;  4HKF A;  4KUA A;  2VQY A;  3F8K A;  3CXS A;  1ON0 A;  2Z10 A;  4CYQ A;  4MY0 A;  3OWC A;  4R3L A;  4UFW A;  3IGR A;  4PK2 A;  4A95 A;  3LOD A;  5I0C A;  1IB1 E;  4AVC A;  3W91 A;  4OAD A;  4QC6 A;  4BMH A;  4JXR A;  2VBQ A;  1YVK A;  4YGO A;  1XIX A;  1RXT A;  2PRB A;  2B4D B;  2Z3K A;  5IX3 A;  2B5G A;  1I21 A;  3A9L A;  4KOT A;  4C7I A;  4MFL A;  4Y49 C;  1Q2Y A;  3UY5 A;  1OZP A;  1KUX A;  2OU2 A;  5E96 A;  3TO9 A;  5HH1 A;  2ZW6 A;  4KOW A;  5F49 A;  3IU2 A;  1J4J A;  5HMN A;  4OLL A;  4CAW A;  4QUS A;  3FXT A;  3G8W A;  4NEX A;  4KLV A;  4MBU A;  4UFX A;  3R95 A;  2Z11 A;  3F5B A;  1M4I A;  1Q2C A;  2J8R A;  5EBV A;  5J8F A;  4C2Z A;  4CGL A;  1K4J A;  2AJ6 A;  1S60 A;  2VXK A;  4KOY A;  3TT2 A;  3JTK A;  3DNS A;  1NE9 A;  2OB0 A;  2FSR A;  4A33 A;  3EO4 A;  5KTC A;  4C2Y A;  4H89 A;  3TO7 A;  2YNE A;  2G3T A;  3TOA A;  2WUU A;  1MJ9 A;  4FD7 A;  4XPD C;  3W6S A;  1Z9U A;  5DWM A;  4QVT A;  4CAF A;  2FL4 A;  4NF1 A;  2B58 A;  1LRZ A;  2REE A;  3TCV A;  2PQ8 A;  4MY3 A;  4HNX B;  4CRZ B;  2B5G B;  1VHS A;  3FYN A;  2IL4 A;  4UCN A;  3FRM A;  4I49 A;  1XE4 A;  2B3U A;  2BUE A;  3GY9 A;  3N7Z A;  2GAN A;  3TE4 A;  1KZF A;  1RO5 A;  2VZY A;  4PK3 A;  3CXQ A;  3TOB A;  2Z3L A;  2C27 A;  4KSF A;  3SXO A;  2Q4V A;  4C68 A;  2EVN A;  4L89 A;  4JD6 A;  2BL1 A;  2YGW A;  4L8A A;  4BBH A;  4B5P B;  1IYL A;  2OH1 A;  4JJX A;  4RI1 A;  1ZO0 A;  1SQH A;  2D4O A;  2Z3N A;  4AVB A;  4MFJ A;  4NSQ A;  4ZBG A;  3D3S A;  3TFY A;  1QSR A;  4KVO E;  1TIQ A;  4F6A A;  4CGN A;  4B10 A;  3BJ7 A;  4RS2 A;  5F48 A;  5C82 A;  3KKW A;  1YX0 A;  4R9M A;  4Q38 A;  1M1D A;  3H5Z A;  5IV0 A;  3QAH A;  1QSO A;  2FE7 A;  4NXY A;  2OZU A;  1S7F A;  2I79 A;  2Y0M A;  3S6K A;  2HV2 A;  3T90 A;  2H5M A;  4F0X A;  3B8G A;  2KCW A;  4FD4 A;  2ZW5 A;  4B14 A;  1I12 A;  3EY5 A;  2Q44 A;  3PGP A;  2NMT A;  2DPT A;  3FNC A;  5AG4 A;  1NMT A;  1Y9W A;  5CNP A;  1YRE A;  1QSM A;  3EFA A;  2Z3M A;  3TO6 A;  4HNY B;  5AG7 A;  2O28 A;  2P6E A;  1NSL A;  4R3K A;  4PV6 A;  1R57 A;  4AG7 A;  1IIC A;  1YGH A;  4YFJ A;  2FXF A;  4GS4 A;  3K9U A;  4XNH B;  1S3Z A;  2Q0Y A;  4R87 A;  2FS5 A;  2REF A;  2QIR A;  2GE3 A;  4M3S A;  4A31 A;  2Q4Y A;  5H86 A;  2GIV A;  1M44 A;  4E8O A;  1P4N A;  3DSB A;  3P2F A;  1GHE A;  3GYA A;  1YLE A;  5F47 A;  2B4B A;  4ORF A;  4CGM A;  4JWP A;  1S7K A;  2OZH A;  2K5T A;  4E0A A;  1WWZ A;  4KUB A;  4CS0 B;  2CNM A;  3CXP A;  4Q36 A;  3R9G A;  1M4D A;  4CGO A;  2QEC A;  2R1I A;  4C2X A;  3G3S A;  3FB3 A;  5G22 A;  4PSW A;  4XPL A;  5DWN A;  4A30 A;  4KOV A;  2AE6 A;  1Z4E A;  4CAE A;  1MJA A;  2J8M A;  4MI4 A;  1I1D A;  2PSW A;  1P0H A;  3VWE A;  4MJ8 A;  3JUW A;  3QB8 A;  3DDD A;  3R9E A;  4JLY A;  5FVJ A;  4U5Y A;  4DNC A;  4XPK A;  2CXA A;  2F5I A;  2FIA A;  5J8C A;  3IU1 A;  2B4D A;  4MFZ A;  3R9F A;  4KOX A;  3MGD A;  3I3G A;  4K30 A;  2ZW4 A;  4CYO A;  4UBR A;  4AB7 A;  4MFQ A;  3S6F A;  4E2A A;  4Y49 B;  4CYP A;  2DXQ A;  5EC4 A;  3D2M A;  2I00 A;  3H4Q A;  2FIW A;  4C7H A;  2G0B A;  4UCP A;  3EXN A;  1XEB A;  3WR7 A;  1PUA A;  5JQ4 A;  5G20 A;  2P6G A;  5F46 A;  1UFH A;  2P0W A;  2QML A;  2Q7B A;  3I9S A;  3R96 A;  5JPH A;  4UA3 A;  5AG6 A;  3W6X A;  4OAE A;  4R57 A;  4CRY B;  4YRH A;  2HQY A;  3P2H A;  1V0C A;  3IWE A;  3BJ8 A;  3S6H A;  2BSW A;  4CAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...