1J4JA

Crystal structure of tabtoxin resistance protein (form ii) complexed with an acyl coenzyme a
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
170
structure length
170
Chain Sequence
b'AQLRRVTAESFAHYRHGLAQLLFETVHGGASVGFMADLDMQQAYAWCDGLKADIAAGSLLLWVVAEDDNVLASAQLSLCQKPNGLNRAEVQKLMVLPSARGRGLGRQLMDEVEQVAVKHKRGLLHLDTEAGSVAEAFYSALAYTRVGELPGYCATPDGRLHPTAIYFKTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TABTOXIN RESISTANCE PROTEIN
publication title Crystal structure of tabtoxin resistance protein complexed with acetyl coenzyme A reveals the mechanism for beta-lactam acetylation.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tabaci
molecule tags Transferase
total genus 45
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2001-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1j4jA00
4R3KA 1LRZA 4GS4A 1IICA 2HUZA 3ZJ0A 2FSRA 3CXSA 2Q04A 4E0AA 3EO4A 4NSQA 3C26A 1R57A 3P2FA 1KUYA 3S6HA 3TT2A 3NE7A 4JWPA 4ZBGA 3EFAA 2VBQA 3EC4A 4H6ZA 1YGHA 2BL1A 3KKWA 3R9EA 2REEA 4AVBA 2Z10A 4XNHC 4NEXA 3W91A 4Y49B 2OU2A 3ZZIA 1XEBA 4KOVA 2CNMA 4KUAA 4IUSA 3TO9A 5DWMA 4JD6A 4QB9A 4XPDC 1IYLA 4H89A 5F46A 3W6XA 2AJ6A 2OZGA 2I00A 1QSNA 4L8AA 4NXYA 4B5PA 2OZUA 4E8OA 1YREA 4KOWA 2Q4VA 1KZFA 5JPHA 4HNWB 3F5BA 2DXQA 4AG7A 2VZYA 4L89A 2JDCA 1M44A 4IF5A 3PGPA 3FRMA 1P0HA 4LX9A 1Z4RA 2H5MA 4B5OA 4KORA 3B8GA 5C88A 3K9UA 3R9GA 1N71A 3QAHA 2Z11A 2VEZA 3R9FA 5HMNA 1TIQA 5EBVA 1SQHA 1QSMA 1S7FA 2AE6A 4UWJA 3D3SA 4KOXA 1L0CA 2JDDA 2WPXA 4FD5A 4KVME 2R1IA 1IB1E 3IWGA 4JJXA 3N7ZA 2FT0A 1S7NA 1IYKA 2G3AA 4YFJA 2ZW4A 4U9YA 2D4PA 4CAXA 2FIAA 1IIDA 2ZW7A 1I21A 2Q4YA 5IV0A 2B5GA 4KVXA 4KUBA 2QECA 5F48A 5IX3A 1KUXA 5J8CA 4AB7A 3TFYA 3EY5A 3RYOA 4R9MA 1NMTA 2CY2A 2GANA 3DR6A 4FD6A 2ZW5A 1RXTA 4R87A 4J3GA 4XPLA 3TTHA 5ISVA 1B6BA 2PQ8A 3TCVA 3D2MA 3H4QA 3PP9A 3LODA 2HV2A 2Q44A 1QSTA 1M4GA 4QC6A 3I9SA 4KOUA 3P2HA 4NF1A 1PU9A 2GE3A 2VXKA 1V0CA 1MJBA 4DNCA 4NCZA 3E0KA 1B87A 3G8WA 5EC4A 5F49A 4XPKA 4RS2A 1RO5A 2FE7A 4CS0B 3V8IA 4B5PB 1CJWA 3D2PA 4PSXA 4MBUA 5IB0A 2Q7BA 1NE9A 3VWDA 4MJ8A 3WR7A 3R1KA 1QSOA 1J4JA 2D4OA 2PR8A 2P6EA 2B4DB 4PSWA 2OB0A 3FYNA 5E96A 2WPWA 2CNTA 2FCKA 4CAWA 2JLMA 4YRHA 3OWCA 2A4NA 1S3ZA 4KVOE 4RI1A 3S6GA 2K5TA 4KOYA 3FB3A 4MY3A 5FVJA 4I49A 2J8NA 2R8VA 5H86A 3TOBA 1BOBA 4Y49C 2NMTA 3JUWA 2B5GB 3BLNA 1Q2YA 5C82A 2VZZA 2OZHA 2C27A 4UBRA 1VHSA 4E2AA 2G0BA 3CXQA 1S60A 2PC1A 2VQYA 4MHDA 1MJAA 3QB8A 2QMLA 1MK4A 1I1DA 4QUSA 2R98A 2EUIA 4UWIA 1Y7RA 1Y9WA 3FNCA 3GYAA 4OADA 4K30A 4MY0A 2HQYA 1CM0A 1YR0A 4LUAA 1QSRA 3LD2A 1M4IA 3F0AA 4PK3A 2GIVA 4HKFA 5KTDA 3R96A 3TO7A 5HH1A 1U6MA 5F47A 4UA3A 1XE4A 1P4NA 4JLYA 4JXRA 2JEVA 4FD7A 1Z9UA 3S6FA 4HNYB 4PK2A 4XNHB 4HNXB 5GCNA 2FS5A 4ORFA 3UY5A 1S7KA 5J8FA 2PRBA 3DNSA 4CRZB 3R95A 4QBJA 2PDOA 3GY9A 3SXOA 2BEIA 5I0CA 3SXNA 4QVTA 4XPDB 3G3SA 4EVYA 2FIWA 1Q2DA 3TO6A 1I12A 4M85A 3T90A 4AVCA 3FXTA 4F6AA 2R7HA 2P6GA 2F5IA 3GKRA 3I3GA 2P0WA 4FD4A 5H84A 1MJ9A 3PZJA 4AG9A 2B58A 2KCWA 1UFHA 3T9YA 4X5KA 1XF8A 3FBUA 1XMTA 2B3VA 2O28A 1ON0A 1OZPA 2FXFA 1Y9KA 3TE4A 1YVOA 1S7LA 3W6SA 2ARHA 2ZXVA 2RC4A 1WK4A 2REFA 5KTAA 1WWZA 4KLWA 4KLVA 2ATRA 3IGRA 4CRYB 1PUAA 1YVKA 4KOTA 3D8PA 4U9ZA 2Z0ZA 3VWEA 1Q2CA 4BMHA 4CAVA 4ONUA 2Y0MA 2IL4A 4R57A 5JQ4A 3EXNA 4R3LA 2BUEA 3DDDA 2B4DA 1VKCA 4KZTA 2ZPAA 3SHPA 4JXQA 2I79A 1YX0A 5KTCA 2G3TA 3DR8A 1KUVA 3S6KA 4MI4A 3DSBA 1Z4EA 2PR1A 1XIXA 4PV6A 4II9A 2FL4A 3BJ8A 2PSWA 4M3SA 4AVAA 4OAEA 5DWNA 3BJ7A 2B3UA 2QIRA 4F0YA 3FIXA 1M1DA 2CNSA 1NSLA 2VI7A 2ZW6A 2OH1A 2BSWA 2EVNA 2J8MA 2X7BA 3MGDA 4KOSA 3F8KA 1S5KA 4H6UA 4U5YA 1GHEA 1YLEA 1K4JA 4OLLA 3CXPA 5CNPA 2Q0YA 4YGOA 2J8RA 2P6FA 3JVNA 1BO4A 1FY7A 1M4DA 3TOAA 2B4BA 1YK3A
chains in the Genus database with same CATH superfamily
7CPAA 4R3KA 4ONWA 4JZ0A 1LRZA 4C2YA 2CF4A 4GS4A 1ZLIA 1IICA 3B2YA 2HUZA 3BI1A 3ZJ0A 4A33A 2FSRA 3CXSA 2Q04A 4E0AA 3EO4A 3NH8A 4P4DA 3H8FA 3IC1A 4NSQA 3C26A 1HDUA 1R57A 1KUYA 3P2FA 4OP4A 5G1ZA 3S6HA 2JBKA 4P6YA 4R7MA 2ZEHA 2Z3LA 3NE7A 4M6HA 2AFSA 3D66A 3TT2A 4FBEA 4JWPA 3KI9A 4ZBGA 3B3VA 3EFAA 2VBQA 2EO8A 2PE3A 2WUUA 3EC4A 1CX8A 4B14A 4MFJA 4H6ZA 1YGHA 5JGFA 2BL1A 3KKWA 3R9EA 2REEA 1Y0RA 4WJBA 4AVBA 2ZOFA 4F8ZA 2PIZA 1ARMA 2Z10A 5HVGA 4EWTA 4XNHC 3PB4X 4A2ZA 4NEXA 1Y0YA 3FECA 3W91A 2PVWA 2ZEFA 4KSIA 4Y49B 1EE3P 2OU2A 2AFZA 3ZZIA 1YQEA 4NFRA 1XEBA 4KOVA 1TKHA 4P4FA 3CPAA 2CNMA 4M6IA 4KUAA 4OC0A 3SJEA 1ZG9A 4BD9A 5HVFA 1IOFA 4IUSA 3B7IA 5D29A 3TO9A 2AFWA 5DWMA 1Z8LA 4JD6A 4QB9A 5CPAA 2GLFA 4XPDC 1CP6A 3KGQA 1IYLA 1Y7EA 3D67A 1VHEA 4H89A 5F46A 3T8WA 2WZNA 1BAVA 3W6XA 2AJ6A 2OZGA 3GB0A 3WT4A 2I00A 1QSNA 1DE4C 2WSAA 4L8AA 4NXYA 4B5PA 2PIYA 3PBBA 2OZUA 3V7ZA 1YREA 4E8OA 1VHOA 4FUUA 4KOWA 2Q4VA 3IU2A 4UFXA 1KZFA 4F9VA 5A27A 5JPHA 4HNWB 3F5BA 2DXQA 3KASA 4AG7A 2VZYA 4L89A 2JDCA 1M44A 4A30A 4IF5A 1YLOA 5EMIA 3PGPA 3RNZA 3FRMA 1P0HA 4LX9A 2WYRA 1Z4RA 4NGTA 2Q7SA 2F8HA 2H5MA 4UCPA 3K2KA 4B5OA 5I4MA 4KORA 2PJ1A 3B8GA 3K9UA 3R9GA 4B6ZA 4CPAA 5C88A 5D8NA 1OBRA 1N71A 5G21A 1IU8A 4OC1A 2EK8A 2DEAA 3QAHA 4FAIA 2Z11A 2VEZA 2ZEOA 3R9FA 2QVPA 1TIQA 2ABZA 2V8DA 1SQHA 5EBVA 5HMNA 1QSMA 1S7FA 3KHZA 2AE6A 4UWJA 3FMCA 1Z8TA 3D3SA 4F9UA 1X10A 1L0CA 1HEEA 2JDDA 2WPXA 4FD5A 4KOXA 4KVME 5LRGA 2PJAA 2R1IA 4RUHA 2V8HA 3WC6A 1IB1E 1BLLE 3IWGA 4JJXA 3N7ZA 2FT0A 1S7NA 3PFOA 4Q7AA 4X3RA 1ZLHA 1IYKA 2G3AA 4JYWA 4A32A 4YFJA 2ZW4A 4CGLA 1BPNA 2YNCA 4U9YA 3H8GA 2CXAA 2PVVA 2D4PA 2OR4A 1Q7LA 1H8LA 4CYNA 4CAXA 2FIAA 2J9AA 1IIDA 1TF9A 2BO9A 2JEWA 3V38A 2ZW7A 1I21A 2Q4YA 3CDXA 2AFOA 3K9TA 2B5GA 4TWEA 5IV0A 2POKA 4MMOA 4KVXA 4A37A 4KUBA 5LRJA 1A2ZA 1ELMP 4G1PA 2Z3MA 1NSAA 4KSAA 4UFVA 2QECA 5F48A 2JBJA 5IX3A 1KUXA 3PB8X 5J8CA 2YNEA 4AB7A 2CIJA 4R8FA 4UEFA 3MN8A 3TFYA 1XMBA 2PJ9A 3EY5A 3RYOA 4R9MA 4UCMA 3KR5A 2VL1A 1NMTA 2CY2A 2GANA 3FH4A 3DR6A 4OMEA 5DS0A 4FD6A 2ZW5A 1LOKA 1ARLA 1RXTA 4R87A 4J3GA 4XPLA 1AMPA 3NFZA 3TTHA 5ISVA 1LAPA 1UWYA 1B6BA 1AUGA 2PQ8A 4MHNA 2EBJA 8CPAA 4OIWA 1LFWA 3TCVA 5G22A 2ZEEA 4WWVA 3D2MA 3H4QA 3PP9A 3LODA 4X2TA 4P45A 4W9YA 2HV2A 1HDQA 2Q44A 1QSTA 4CGPA 2AFMA 1M4GA 3D7HA 4QC6A 3I9SA 4KOUA 3PEIA 2IMOA 4B10A 3P2HA 4NF1A 1PU9A 3B3CA 2GE3A 3SJGA 2VXKA 4IAVA 1V0CA 5LYIA 1MJBA 4NGSA 4DNCA 4NCZA 3E0KA 1KWMA 1B87A 3G8WA 5EC4A 4MFLA 5F49A 2PJCA 3B3SA 4XPKA 2EK9A 3D7GA 4RS2A 1RO5A 2FE7A 3RBUA 4M6GA 2Z3NA 3PB6X 3V8IA 3IWWA 4B13A 4CS0B 4B5PB 1CJWA 3D2PA 1IGBA 3PB9X 4PSXA 2ODFA 4MBUA 5IB0A 2PJ2A 3KL9A 4CGNA 1YSJA 2Q7BA 3SI2A 4UEZA 1NE9A 3RO0A 5BWAB 2YNDA 2C6GA 3VWDA 4MJ8A 3WR7A 4R76A 1LCPA 4MFZA 3R1KA 1QSOA 1J4JA 4NJQA 4RN7A 2D4OA 3HLPA 2PR8A 2P6EA 1M4LA 2QJ8A 2V8GA 3NH4A 2B4DB 4PSWA 4PXEA 2OB0A 3FYNA 1CG2A 3NA6A 5AG6A 5E96A 3IWEA 2WPWA 2CNTA 4GXHA 2FCKA 2GU2A 4YU9A 4CAWA 2ZOGA 2JLMA 3TX8A 3IIBA 4YRHA 2CTCA 5K8OA 4B12A 1LAMA 3OWCA 3GIUA 3KQZA 2A4NA 1S3ZA 4KVOE 3ISXA 1LANA 4RI1A 3BHXA 3S6GA 2K5TA 4NGNA 1BPMA 4KOYA 4CYPA 4UEEA 3FB3A 4MY3A 4YWYA 5FVJA 4I49A 3PRTA 4A94A 1F2OA 2BCOA 2J8NA 2R8VA 3DLJA 5H86A 1DTDA 3KHXA 4IK2A 4ZY2A 3TOBA 4ZY0A 1BOBA 4Y49C 4MCSA 4KSFA 1TKJA 2NMTA 2V77A 2Q4ZA 1JQGA 2ZENA 3JUWA 1R43A 2B5GB 3BLNA 1Q2YA 5C82A 3S9LA 1ZO0A 4C2XA 2VZZA 1F2PA 1Z8XA 2C27A 2OZHA 5F09A 4UBRA 1VHSA 3S9MA 4E2AA 1FT7A 2GLJA 2G0BA 3LACA 3CXQA 3IJ3A 1S60A 2PC1A 2VQYA 4MHDA 1MJAA 3QB8A 2QMLA 4C7IA 1MK4A 3IU1A 4MFQA 1I1DA 4QUSA 2R98A 2EUIA 4UWIA 1XOVA 1Y7RA 2PJ8A 4MRIA 3SI0A 2C1CA 1Y9WA 4DYOA 1YW6A 3FNCA 4NJRA 2IQ6A 2HB6A 3GYAA 5AG7A 4CGOA 4OADA 5J1QA 4K30A 4MY0A 4LQGA 2HQYA 4C7HA 1RTQA 4CYQA 2BOAA 2PCUA 3MRUA 4UF4A 4MFPA 1CM0A 2RFHA 5JM6A 1YR0A 4LUAA 1QSRA 2AFUA 3LD2A 6CPAA 1M4IA 3F0AA 4PK3A 2XEJA 4OC3A 2PJ5A 3B35A 3VARA 2GIVA 1XBUA 2Z3KA 5K8NA 5HVHA 4HKFA 5HXDA 3R96A 1PCAA 5G20A 3TO7A 5HH1A 5KTDA 1U6MA 3CT9A 5A28A 2C6PA 5F47A 4UA3A 3JRUA 3VH9A 1XE4A 1P4NA 4JLYA 4JXRA 5LYLA 2JEVA 3SJFA 4FD7A 1GYTA 2QYVA 5IB9A 4PXDA 2PJ3A 1Z9UA 3S6FA 4UCNA 4HNYB 4PK2A 4PPZA 4XNHB 4HNXB 3KR4A 5JH9A 4OC5A 4OC2A 5GCNA 2FS5A 4ORFA 4PXBA 3UY5A 1VIXA 1S7KA 5J8FA 2PRBA 3VATA 4A95A 1QQ9A 3FEDA 3DNSA 2ZEGA 4CRZB 3R95A 1AYEA 4QBJA 2PDOA 3GY9A 4MHYA 1CP7A 2DPSA 3SXOA 2BEIA 5I0CA 3SXNA 4MCRA 4QVTA 4XPDB 3G3SA 4EVYA 3KZWA 2O53A 2FIWA 1Q2DA 3D7DA 1Z5RA 3FVLA 3TO6A 1I12A 3S9NA 4M85A 1Z8WA 5LRKA 3T90A 4AVCA 3FXTA 1Z2LA 3FF3A 3LWUA 4UIBA 4F6AA 4ZGYB 2PJBA 2R7HA 2Q51A 2P6GA 2Q43A 3PBEA 2ZEDA 2F5IA 3GKRA 3DGVA 3I3GA 4CAEA 1CPSA 2IJZA 2P0WA 3PB7X 2XEFA 4FD4A 5H84A 4C2ZA 4Z65A 5ELYA 2ANPA 1ELLP 1MJ9A 3PZJA 4X8IA 4AG9A 1VGYA 4GM5A 3IO1A 2GFQA 2B58A 1CBXA 1TF8A 1UFHA 2HC9A 2KCWA 4CGMA 1PYTB 3HUVA 4X5KA 4MCQA 3T9YA 1XF8A 1XMTA 3FBUA 2B3VA 3FX6A 3ISZA 1JWQA 2O28A 2OOTA 3IEHA 3GLJA 4C68A 2PJ6A 4PXCA 1ON0A 1OZPA 2PRQA 2F7VA 2V8VA 2FXFA 4OIDA 4MXUA 1Y9KA 3TE4A 3A9LA 1YVOA 2Z3OA 3CPXA 4EFDA 4KS9A 4P4BA 4P44A 1S7LA 4AXVA 5AG4A 3W6SA 2ARHA 4IHMA 2Z3PA 2ZXVA 4FWUA 4MHPA 2RC4A 1WK4A 2FVGA 2REFA 5KTAA 3LMSA 1WWZA 2I3CA 1YMEA 2C6CA 5CBMA 4P4IA 4NGRA 4PQAA 4KLWA 4A31A 4KLVA 4CYOA 1XRYA 2ATRA 3IGRA 4EMEA 4CRYB 3KQXA 5THWA 1PUAA 2NYQA 1YVKA 2GREA 3D8PA 4KOTA 4P4JA 4U9ZA 4DJLA 4DUKA 1XFOA 1X12A 4MHZA 2Z0ZA 4NGPA 3JTKA 3VWEA 1Q2CA 4TNUA 4BBHA 2DF5A 4BMHA 4CAVA 5LYDA 3RAMA 4ONUA 2Y0MA 2ZEPA 2ZEMA 2IL4A 1ZG8A 4R57A 4ZX8A 4NGMA 5JQ4A 3EXNA 1QMUA 4R3LA 3FJUA 2G9DA 2CTBA 2BUEA 1IOIA 3WABA 3DDDA 3D68A 2O4HA 3I1UA 2B4DA 4NGQA 1VKCA 2ZPAA 4KZTA 3SHPA 4JXQA 2I79A 3B3WA 4A38A 4P10A 1R3NA 1YX0A 4Q38A 3N5FA 5K8PA 3NE8A 5KTCA 1TKFA 2G3TA 1IY7A 4UIAA 3DR8A 1KUVA 4ZX9A 2PJ4A 2PJ7A 3GUXA 4MI4A 1F57A 5AGEA 3S6KA 3DSBA 1XJOA 3BI0A 4ZI6A 1Z4EA 2PR1A 1XIXA 4PV6A 4B11A 4II9A 4LQ6A 2FL4A 1FNOA 3BJ8A 4BINA 2PSWA 4M3SA 4AVAA 4MCPA 1YW4A 3PFEA 4OAEA 3L2NA 3BJ7A 5DWNA 3SJXA 2B3UA 2QIRA 4F0YA 3B3TA 3NH5A 1TXRA 2XEGA 2YNCC 3FIXA 1M1DA 2CNSA 1NSLA 3WC5A 2VI7A 4OC4A 4K3NA 5LYFA 2ZW6A 4OKOA 2XEIA 2OH1A 2BSWA 4R6TA 2AFXA 2EVNA 4P4EA 2J8MA 2X7BA 1CPXA 3CZXA 3FEEA 4Q36A 3MGDA 4H2KA 2NSMA 2YGWA 3F8KA 2EWBA 4KOSA 4F0XA 5K8MA 1S5KA 4H6UA 3D7FA 4U5YA 1GHEA 1YLEA 4MFKA 4O23A 3IFEA 1K4JA 3H5ZA 3WC7A 4OLLA 3CXPA 5CNPA 4UFWA 2ZELA 4A39A 3QNVA 2Q0YA 4YGOA 2DPTA 2J8RA 2P6FA 3JVNA 1BO4A 3D4UA 3SI1A 4CAFA 4ZYQA 1FY7A 3H8EA 3TC8A 1M4DA 3TOAA 5AG5A 2RB7A 4ZY1A 3QAYA 4HPSA 2B4BA 1YK3A 3RZAA 1ZG7A 3BXMA 2PJ0A
chains in the Genus database with same CATH topology
4R3KA 1LRZA 4C2YA 4GS4A 1IICA 2HUZA 3ZJ0A 4A33A 2FSRA 3CXSA 2Q04A 4E0AA 3EO4A 4NSQA 3C26A 1R57A 3P2FA 1KUYA 5G1ZA 3S6HA 3TT2A 2Z3LA 3NE7A 4JWPA 4ZBGA 3EFAA 2VBQA 2WUUA 3EC4A 4B14A 4MFJA 4H6ZA 1YGHA 2BL1A 3KKWA 3R9EA 2REEA 4AVBA 2Z10A 4XNHC 4A2ZA 4NEXA 3W91A 4Y49B 2OU2A 3ZZIA 1XEBA 4KOVA 2CNMA 4KUAA 4IUSA 3TO9A 5DWMA 4JD6A 4QB9A 4XPDC 1IYLA 4H89A 5F46A 3W6XA 2AJ6A 2OZGA 2I00A 1QSNA 4L8AA 2WSAA 4NXYA 4B5PA 2OZUA 4E8OA 1YREA 4KOWA 2Q4VA 3IU2A 4UFXA 1KZFA 5A27A 5JPHA 4HNWB 3F5BA 2DXQA 4AG7A 2VZYA 4L89A 2JDCA 1M44A 4A30A 4IF5A 3PGPA 3FRMA 1P0HA 4LX9A 1Z4RA 2H5MA 4UCPA 4B5OA 4KORA 3B8GA 5C88A 3K9UA 3R9GA 1N71A 5G21A 3QAHA 2Z11A 2VEZA 3R9FA 5HMNA 1TIQA 5EBVA 1SQHA 1QSMA 1S7FA 2AE6A 4UWJA 3D3SA 4KOXA 1L0CA 2JDDA 2WPXA 4FD5A 4KVME 2R1IA 1IB1E 3IWGA 4JJXA 3N7ZA 2FT0A 1S7NA 1IYKA 2G3AA 4A32A 4YFJA 2ZW4A 4CGLA 4U9YA 2YNCA 2CXAA 2D4PA 4CYNA 4CAXA 2FIAA 1IIDA 2ZW7A 1I21A 2Q4YA 5IV0A 2B5GA 4KVXA 4KUBA 2Z3MA 4KSAA 4UFVA 2QECA 5F48A 5IX3A 1KUXA 5J8CA 2YNEA 4AB7A 3TFYA 3EY5A 3RYOA 4R9MA 4UCMA 1NMTA 2CY2A 2GANA 3DR6A 4FD6A 2ZW5A 1RXTA 4R87A 4J3GA 4XPLA 3TTHA 5ISVA 1B6BA 2PQ8A 3TCVA 5G22A 3D2MA 3H4QA 3PP9A 3LODA 2HV2A 2Q44A 1QSTA 4CGPA 1M4GA 4QC6A 3I9SA 4KOUA 4B10A 3P2HA 4NF1A 1PU9A 2GE3A 2VXKA 1V0CA 1MJBA 4DNCA 4NCZA 3E0KA 1B87A 3G8WA 5EC4A 4MFLA 5F49A 4XPKA 4RS2A 1RO5A 2FE7A 2Z3NA 4CS0B 3V8IA 4B13A 4B5PB 1CJWA 3D2PA 4PSXA 4MBUA 5IB0A 4CGNA 2Q7BA 1NE9A 5BWAB 2YNDA 3VWDA 4MJ8A 3WR7A 4MFZA 3R1KA 1QSOA 1J4JA 2D4OA 2PR8A 2P6EA 2B4DB 4PSWA 2OB0A 3FYNA 5AG6A 5E96A 3IWEA 2WPWA 2CNTA 2FCKA 4CAWA 2JLMA 4YRHA 4B12A 3OWCA 2A4NA 1S3ZA 4KVOE 4RI1A 3S6GA 2K5TA 4KOYA 4CYPA 3FB3A 4MY3A 5FVJA 4I49A 2J8NA 2R8VA 5H86A 3TOBA 1BOBA 4Y49C 4KSFA 2NMTA 3JUWA 2B5GB 3BLNA 1Q2YA 5C82A 1ZO0A 4C2XA 2VZZA 2OZHA 2C27A 4UBRA 1VHSA 4E2AA 2G0BA 3CXQA 1S60A 2PC1A 2VQYA 4MHDA 1MJAA 3QB8A 2QMLA 4C7IA 1MK4A 3IU1A 4MFQA 1I1DA 4QUSA 2R98A 2EUIA 4UWIA 1Y7RA 1Y9WA 3FNCA 4CGOA 3GYAA 5AG7A 4OADA 4K30A 4MY0A 2HQYA 4C7HA 4CYQA 4MFPA 1CM0A 1YR0A 4LUAA 1QSRA 3LD2A 1M4IA 3F0AA 4PK3A 2GIVA 2Z3KA 4HKFA 5KTDA 3R96A 5G20A 3TO7A 5HH1A 1U6MA 5A28A 5F47A 4UA3A 1XE4A 1P4NA 4JLYA 4JXRA 2JEVA 4FD7A 1Z9UA 3S6FA 4UCNA 4HNYB 4PK2A 4XNHB 4HNXB 5GCNA 2FS5A 4ORFA 3UY5A 1S7KA 5J8FA 2PRBA 4A95A 3DNSA 4CRZB 3R95A 4QBJA 2PDOA 3GY9A 2DPSA 3SXOA 2BEIA 5I0CA 3SXNA 4QVTA 4XPDB 3G3SA 4EVYA 2FIWA 1Q2DA 3TO6A 1I12A 4M85A 3T90A 4AVCA 3FXTA 4ZGYB 4F6AA 2R7HA 2P6GA 2F5IA 3GKRA 3I3GA 4CAEA 2P0WA 4FD4A 4C2ZA 5H84A 1MJ9A 3PZJA 4AG9A 2B58A 2KCWA 1UFHA 4CGMA 3T9YA 4X5KA 1XF8A 3FBUA 1XMTA 2B3VA 2O28A 4C68A 1ON0A 1OZPA 2FXFA 1Y9KA 3TE4A 3A9LA 1YVOA 2Z3OA 4KS9A 1S7LA 5AG4A 3W6SA 2ARHA 2Z3PA 2ZXVA 2RC4A 1WK4A 2REFA 5KTAA 1WWZA 4KLWA 4A31A 4KLVA 4CYOA 2ATRA 3IGRA 4CRYB 1PUAA 1YVKA 4KOTA 3D8PA 4U9ZA 2Z0ZA 3JTKA 3VWEA 1Q2CA 4BBHA 4BMHA 4CAVA 4ONUA 2Y0MA 2IL4A 4R57A 5JQ4A 3EXNA 4R3LA 2BUEA 3DDDA 2B4DA 1VKCA 2ZPAA 4KZTA 3SHPA 4JXQA 2I79A 1YX0A 4Q38A 5KTCA 2G3TA 3DR8A 1KUVA 3S6KA 4MI4A 5AGEA 3DSBA 1Z4EA 2PR1A 1XIXA 4PV6A 4B11A 4II9A 2FL4A 3BJ8A 2PSWA 4M3SA 4AVAA 4OAEA 5DWNA 3BJ7A 2B3UA 2QIRA 4F0YA 2YNCC 3FIXA 1M1DA 2CNSA 1NSLA 2VI7A 2ZW6A 2OH1A 2BSWA 2EVNA 2J8MA 2X7BA 4Q36A 3MGDA 4KOSA 3F8KA 2YGWA 4F0XA 1S5KA 4H6UA 4U5YA 1GHEA 1YLEA 4MFKA 1K4JA 3H5ZA 4OLLA 3CXPA 5CNPA 4UFWA 2Q0YA 4YGOA 2DPTA 2J8RA 2P6FA 3JVNA 1BO4A 4CAFA 1FY7A 1M4DA 3TOAA 5AG5A 2B4BA 1YK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R3K A;  1LRZ A;  4GS4 A;  1IIC A;  2HUZ A;  3ZJ0 A;  2FSR A;  3CXS A;  2Q04 A;  4E0A A;  3EO4 A;  4NSQ A;  3C26 A;  1R57 A;  3P2F A;  1KUY A;  3S6H A;  3TT2 A;  3NE7 A;  4JWP A;  4ZBG A;  3EFA A;  2VBQ A;  3EC4 A;  4H6Z A;  1YGH A;  2BL1 A;  3KKW A;  3R9E A;  2REE A;  4AVB A;  2Z10 A;  4XNH C;  4NEX A;  3W91 A;  4Y49 B;  2OU2 A;  3ZZI A;  1XEB A;  4KOV A;  2CNM A;  4KUA A;  4IUS A;  3TO9 A;  5DWM A;  4JD6 A;  4QB9 A;  4XPD C;  1IYL A;  4H89 A;  5F46 A;  3W6X A;  2AJ6 A;  2OZG A;  2I00 A;  1QSN A;  4L8A A;  4NXY A;  4B5P A;  2OZU A;  4E8O A;  1YRE A;  4KOW A;  2Q4V A;  1KZF A;  5JPH A;  4HNW B;  3F5B A;  2DXQ A;  4AG7 A;  2VZY A;  4L89 A;  2JDC A;  1M44 A;  4IF5 A;  3PGP A;  3FRM A;  1P0H A;  4LX9 A;  1Z4R A;  2H5M A;  4B5O A;  4KOR A;  3B8G A;  5C88 A;  3K9U A;  3R9G A;  1N71 A;  3QAH A;  2Z11 A;  2VEZ A;  3R9F A;  5HMN A;  1TIQ A;  5EBV A;  1SQH A;  1QSM A;  1S7F A;  2AE6 A;  4UWJ A;  3D3S A;  4KOX A;  1L0C A;  2JDD A;  2WPX A;  4FD5 A;  4KVM E;  2R1I A;  1IB1 E;  3IWG A;  4JJX A;  3N7Z A;  2FT0 A;  1S7N A;  1IYK A;  2G3A A;  4YFJ A;  2ZW4 A;  4U9Y A;  2D4P A;  4CAX A;  2FIA A;  1IID A;  2ZW7 A;  1I21 A;  2Q4Y A;  5IV0 A;  2B5G A;  4KVX A;  4KUB A;  2QEC A;  5F48 A;  5IX3 A;  1KUX A;  5J8C A;  4AB7 A;  3TFY A;  3EY5 A;  3RYO A;  4R9M A;  1NMT A;  2CY2 A;  2GAN A;  3DR6 A;  4FD6 A;  2ZW5 A;  1RXT A;  4R87 A;  4J3G A;  4XPL A;  3TTH A;  5ISV A;  1B6B A;  2PQ8 A;  3TCV A;  3D2M A;  3H4Q A;  3PP9 A;  3LOD A;  2HV2 A;  2Q44 A;  1QST A;  1M4G A;  4QC6 A;  3I9S A;  4KOU A;  3P2H A;  4NF1 A;  1PU9 A;  2GE3 A;  2VXK A;  1V0C A;  1MJB A;  4DNC A;  4NCZ A;  3E0K A;  1B87 A;  3G8W A;  5EC4 A;  5F49 A;  4XPK A;  4RS2 A;  1RO5 A;  2FE7 A;  4CS0 B;  3V8I A;  4B5P B;  1CJW A;  3D2P A;  4PSX A;  4MBU A;  5IB0 A;  2Q7B A;  1NE9 A;  3VWD A;  4MJ8 A;  3WR7 A;  3R1K A;  1QSO A;  1J4J A;  2D4O A;  2PR8 A;  2P6E A;  2B4D B;  4PSW A;  2OB0 A;  3FYN A;  5E96 A;  2WPW A;  2CNT A;  2FCK A;  4CAW A;  2JLM A;  4YRH A;  3OWC A;  2A4N A;  1S3Z A;  4KVO E;  4RI1 A;  3S6G A;  2K5T A;  4KOY A;  3FB3 A;  4MY3 A;  5FVJ A;  4I49 A;  2J8N A;  2R8V A;  5H86 A;  3TOB A;  1BOB A;  4Y49 C;  2NMT A;  3JUW A;  2B5G B;  3BLN A;  1Q2Y A;  5C82 A;  2VZZ A;  2OZH A;  2C27 A;  4UBR A;  1VHS A;  4E2A A;  2G0B A;  3CXQ A;  1S60 A;  2PC1 A;  2VQY A;  4MHD A;  1MJA A;  3QB8 A;  2QML A;  1MK4 A;  1I1D A;  4QUS A;  2R98 A;  2EUI A;  4UWI A;  1Y7R A;  1Y9W A;  3FNC A;  3GYA A;  4OAD A;  4K30 A;  4MY0 A;  2HQY A;  1CM0 A;  1YR0 A;  4LUA A;  1QSR A;  3LD2 A;  1M4I A;  3F0A A;  4PK3 A;  2GIV A;  4HKF A;  5KTD A;  3R96 A;  3TO7 A;  5HH1 A;  1U6M A;  5F47 A;  4UA3 A;  1XE4 A;  1P4N A;  4JLY A;  4JXR A;  2JEV A;  4FD7 A;  1Z9U A;  3S6F A;  4HNY B;  4PK2 A;  4XNH B;  4HNX B;  5GCN A;  2FS5 A;  4ORF A;  3UY5 A;  1S7K A;  5J8F A;  2PRB A;  3DNS A;  4CRZ B;  3R95 A;  4QBJ A;  2PDO A;  3GY9 A;  3SXO A;  2BEI A;  5I0C A;  3SXN A;  4QVT A;  4XPD B;  3G3S A;  4EVY A;  2FIW A;  1Q2D A;  3TO6 A;  1I12 A;  4M85 A;  3T90 A;  4AVC A;  3FXT A;  4F6A A;  2R7H A;  2P6G A;  2F5I A;  3GKR A;  3I3G A;  2P0W A;  4FD4 A;  5H84 A;  1MJ9 A;  3PZJ A;  4AG9 A;  2B58 A;  2KCW A;  1UFH A;  3T9Y A;  4X5K A;  1XF8 A;  3FBU A;  1XMT A;  2B3V A;  2O28 A;  1ON0 A;  1OZP A;  2FXF A;  1Y9K A;  3TE4 A;  1YVO A;  1S7L A;  3W6S A;  2ARH A;  2ZXV A;  2RC4 A;  1WK4 A;  2REF A;  5KTA A;  1WWZ A;  4KLW A;  4KLV A;  2ATR A;  3IGR A;  4CRY B;  1PUA A;  1YVK A;  4KOT A;  3D8P A;  4U9Z A;  2Z0Z A;  3VWE A;  1Q2C A;  4BMH A;  4CAV A;  4ONU A;  2Y0M A;  2IL4 A;  4R57 A;  5JQ4 A;  3EXN A;  4R3L A;  2BUE A;  3DDD A;  2B4D A;  1VKC A;  4KZT A;  2ZPA A;  3SHP A;  4JXQ A;  2I79 A;  1YX0 A;  5KTC A;  2G3T A;  3DR8 A;  1KUV A;  3S6K A;  4MI4 A;  3DSB A;  1Z4E A;  2PR1 A;  1XIX A;  4PV6 A;  4II9 A;  2FL4 A;  3BJ8 A;  2PSW A;  4M3S A;  4AVA A;  4OAE A;  5DWN A;  3BJ7 A;  2B3U A;  2QIR A;  4F0Y A;  3FIX A;  1M1D A;  2CNS A;  1NSL A;  2VI7 A;  2ZW6 A;  2OH1 A;  2BSW A;  2EVN A;  2J8M A;  2X7B A;  3MGD A;  4KOS A;  3F8K A;  1S5K A;  4H6U A;  4U5Y A;  1GHE A;  1YLE A;  1K4J A;  4OLL A;  3CXP A;  5CNP A;  2Q0Y A;  4YGO A;  2J8R A;  2P6F A;  3JVN A;  1BO4 A;  1FY7 A;  1M4D A;  3TOA A;  2B4B A;  1YK3 A; 
#chains in the Genus database with same CATH topology
 7CPA A;  4R3K A;  4ONW A;  4JZ0 A;  1LRZ A;  4C2Y A;  2CF4 A;  4GS4 A;  1ZLI A;  1IIC A;  3B2Y A;  2HUZ A;  3BI1 A;  3ZJ0 A;  4A33 A;  2FSR A;  3CXS A;  2Q04 A;  4E0A A;  3EO4 A;  3NH8 A;  4P4D A;  3H8F A;  3IC1 A;  4NSQ A;  3C26 A;  1HDU A;  1R57 A;  1KUY A;  3P2F A;  4OP4 A;  5G1Z A;  3S6H A;  2JBK A;  4P6Y A;  4R7M A;  2ZEH A;  2Z3L A;  3NE7 A;  4M6H A;  2AFS A;  3D66 A;  3TT2 A;  4FBE A;  4JWP A;  3KI9 A;  4ZBG A;  3B3V A;  3EFA A;  2VBQ A;  2EO8 A;  2PE3 A;  2WUU A;  3EC4 A;  1CX8 A;  4B14 A;  4MFJ A;  4H6Z A;  1YGH A;  5JGF A;  2BL1 A;  3KKW A;  3R9E A;  2REE A;  1Y0R A;  4WJB A;  4AVB A;  2ZOF A;  4F8Z A;  2PIZ A;  1ARM A;  2Z10 A;  5HVG A;  4EWT A;  4XNH C;  3PB4 X;  4A2Z A;  4NEX A;  1Y0Y A;  3FEC A;  3W91 A;  2PVW A;  2ZEF A;  4KSI A;  4Y49 B;  1EE3 P;  2OU2 A;  2AFZ A;  3ZZI A;  1YQE A;  4NFR A;  1XEB A;  4KOV A;  1TKH A;  4P4F A;  3CPA A;  2CNM A;  4M6I A;  4KUA A;  4OC0 A;  3SJE A;  1ZG9 A;  4BD9 A;  5HVF A;  1IOF A;  4IUS A;  3B7I A;  5D29 A;  3TO9 A;  2AFW A;  5DWM A;  1Z8L A;  4JD6 A;  4QB9 A;  5CPA A;  2GLF A;  4XPD C;  1CP6 A;  3KGQ A;  1IYL A;  1Y7E A;  3D67 A;  1VHE A;  4H89 A;  5F46 A;  3T8W A;  2WZN A;  1BAV A;  3W6X A;  2AJ6 A;  2OZG A;  3GB0 A;  3WT4 A;  2I00 A;  1QSN A;  1DE4 C;  2WSA A;  4L8A A;  4NXY A;  4B5P A;  2PIY A;  3PBB A;  2OZU A;  3V7Z A;  1YRE A;  4E8O A;  1VHO A;  4FUU A;  4KOW A;  2Q4V A;  3IU2 A;  4UFX A;  1KZF A;  4F9V A;  5A27 A;  5JPH A;  4HNW B;  3F5B A;  2DXQ A;  3KAS A;  4AG7 A;  2VZY A;  4L89 A;  2JDC A;  1M44 A;  4A30 A;  4IF5 A;  1YLO A;  5EMI A;  3PGP A;  3RNZ A;  3FRM A;  1P0H A;  4LX9 A;  2WYR A;  1Z4R A;  4NGT A;  2Q7S A;  2F8H A;  2H5M A;  4UCP A;  3K2K A;  4B5O A;  5I4M A;  4KOR A;  2PJ1 A;  3B8G A;  3K9U A;  3R9G A;  4B6Z A;  4CPA A;  5C88 A;  5D8N A;  1OBR A;  1N71 A;  5G21 A;  1IU8 A;  4OC1 A;  2EK8 A;  2DEA A;  3QAH A;  4FAI A;  2Z11 A;  2VEZ A;  2ZEO A;  3R9F A;  2QVP A;  1TIQ A;  2ABZ A;  2V8D A;  1SQH A;  5EBV A;  5HMN A;  1QSM A;  1S7F A;  3KHZ A;  2AE6 A;  4UWJ A;  3FMC A;  1Z8T A;  3D3S A;  4F9U A;  1X10 A;  1L0C A;  1HEE A;  2JDD A;  2WPX A;  4FD5 A;  4KOX A;  4KVM E;  5LRG A;  2PJA A;  2R1I A;  4RUH A;  2V8H A;  3WC6 A;  1IB1 E;  1BLL E;  3IWG A;  4JJX A;  3N7Z A;  2FT0 A;  1S7N A;  3PFO A;  4Q7A A;  4X3R A;  1ZLH A;  1IYK A;  2G3A A;  4JYW A;  4A32 A;  4YFJ A;  2ZW4 A;  4CGL A;  1BPN A;  2YNC A;  4U9Y A;  3H8G A;  2CXA A;  2PVV A;  2D4P A;  2OR4 A;  1Q7L A;  1H8L A;  4CYN A;  4CAX A;  2FIA A;  2J9A A;  1IID A;  1TF9 A;  2BO9 A;  2JEW A;  3V38 A;  2ZW7 A;  1I21 A;  2Q4Y A;  3CDX A;  2AFO A;  3K9T A;  2B5G A;  4TWE A;  5IV0 A;  2POK A;  4MMO A;  4KVX A;  4A37 A;  4KUB A;  5LRJ A;  1A2Z A;  1ELM P;  4G1P A;  2Z3M A;  1NSA A;  4KSA A;  4UFV A;  2QEC A;  5F48 A;  2JBJ A;  5IX3 A;  1KUX A;  3PB8 X;  5J8C A;  2YNE A;  4AB7 A;  2CIJ A;  4R8F A;  4UEF A;  3MN8 A;  3TFY A;  1XMB A;  2PJ9 A;  3EY5 A;  3RYO A;  4R9M A;  4UCM A;  3KR5 A;  2VL1 A;  1NMT A;  2CY2 A;  2GAN A;  3FH4 A;  3DR6 A;  4OME A;  5DS0 A;  4FD6 A;  2ZW5 A;  1LOK A;  1ARL A;  1RXT A;  4R87 A;  4J3G A;  4XPL A;  1AMP A;  3NFZ A;  3TTH A;  5ISV A;  1LAP A;  1UWY A;  1B6B A;  1AUG A;  2PQ8 A;  4MHN A;  2EBJ A;  8CPA A;  4OIW A;  1LFW A;  3TCV A;  5G22 A;  2ZEE A;  4WWV A;  3D2M A;  3H4Q A;  3PP9 A;  3LOD A;  4X2T A;  4P45 A;  4W9Y A;  2HV2 A;  1HDQ A;  2Q44 A;  1QST A;  4CGP A;  2AFM A;  1M4G A;  3D7H A;  4QC6 A;  3I9S A;  4KOU A;  3PEI A;  2IMO A;  4B10 A;  3P2H A;  4NF1 A;  1PU9 A;  3B3C A;  2GE3 A;  3SJG A;  2VXK A;  4IAV A;  1V0C A;  5LYI A;  1MJB A;  4NGS A;  4DNC A;  4NCZ A;  3E0K A;  1KWM A;  1B87 A;  3G8W A;  5EC4 A;  4MFL A;  5F49 A;  2PJC A;  3B3S A;  4XPK A;  2EK9 A;  3D7G A;  4RS2 A;  1RO5 A;  2FE7 A;  3RBU A;  4M6G A;  2Z3N A;  3PB6 X;  3V8I A;  3IWW A;  4B13 A;  4CS0 B;  4B5P B;  1CJW A;  3D2P A;  1IGB A;  3PB9 X;  4PSX A;  2ODF A;  4MBU A;  5IB0 A;  2PJ2 A;  3KL9 A;  4CGN A;  1YSJ A;  2Q7B A;  3SI2 A;  4UEZ A;  1NE9 A;  3RO0 A;  5BWA B;  2YND A;  2C6G A;  3VWD A;  4MJ8 A;  3WR7 A;  4R76 A;  1LCP A;  4MFZ A;  3R1K A;  1QSO A;  1J4J A;  4NJQ A;  4RN7 A;  2D4O A;  3HLP A;  2PR8 A;  2P6E A;  1M4L A;  2QJ8 A;  2V8G A;  3NH4 A;  2B4D B;  4PSW A;  4PXE A;  2OB0 A;  3FYN A;  1CG2 A;  3NA6 A;  5AG6 A;  5E96 A;  3IWE A;  2WPW A;  2CNT A;  4GXH A;  2FCK A;  2GU2 A;  4YU9 A;  4CAW A;  2ZOG A;  2JLM A;  3TX8 A;  3IIB A;  4YRH A;  2CTC A;  5K8O A;  4B12 A;  1LAM A;  3OWC A;  3GIU A;  3KQZ A;  2A4N A;  1S3Z A;  4KVO E;  3ISX A;  1LAN A;  4RI1 A;  3BHX A;  3S6G A;  2K5T A;  4NGN A;  1BPM A;  4KOY A;  4CYP A;  4UEE A;  3FB3 A;  4MY3 A;  4YWY A;  5FVJ A;  4I49 A;  3PRT A;  4A94 A;  1F2O A;  2BCO A;  2J8N A;  2R8V A;  3DLJ A;  5H86 A;  1DTD A;  3KHX A;  4IK2 A;  4ZY2 A;  3TOB A;  4ZY0 A;  1BOB A;  4Y49 C;  4MCS A;  4KSF A;  1TKJ A;  2NMT A;  2V77 A;  2Q4Z A;  1JQG A;  2ZEN A;  3JUW A;  1R43 A;  2B5G B;  3BLN A;  1Q2Y A;  5C82 A;  3S9L A;  1ZO0 A;  4C2X A;  2VZZ A;  1F2P A;  1Z8X A;  2C27 A;  2OZH A;  5F09 A;  4UBR A;  1VHS A;  3S9M A;  4E2A A;  1FT7 A;  2GLJ A;  2G0B A;  3LAC A;  3CXQ A;  3IJ3 A;  1S60 A;  2PC1 A;  2VQY A;  4MHD A;  1MJA A;  3QB8 A;  2QML A;  4C7I A;  1MK4 A;  3IU1 A;  4MFQ A;  1I1D A;  4QUS A;  2R98 A;  2EUI A;  4UWI A;  1XOV A;  1Y7R A;  2PJ8 A;  4MRI A;  3SI0 A;  2C1C A;  1Y9W A;  4DYO A;  1YW6 A;  3FNC A;  4NJR A;  2IQ6 A;  2HB6 A;  3GYA A;  5AG7 A;  4CGO A;  4OAD A;  5J1Q A;  4K30 A;  4MY0 A;  4LQG A;  2HQY A;  4C7H A;  1RTQ A;  4CYQ A;  2BOA A;  2PCU A;  3MRU A;  4UF4 A;  4MFP A;  1CM0 A;  2RFH A;  5JM6 A;  1YR0 A;  4LUA A;  1QSR A;  2AFU A;  3LD2 A;  6CPA A;  1M4I A;  3F0A A;  4PK3 A;  2XEJ A;  4OC3 A;  2PJ5 A;  3B35 A;  3VAR A;  2GIV A;  1XBU A;  2Z3K A;  5K8N A;  5HVH A;  4HKF A;  5HXD A;  3R96 A;  1PCA A;  5G20 A;  3TO7 A;  5HH1 A;  5KTD A;  1U6M A;  3CT9 A;  5A28 A;  2C6P A;  5F47 A;  4UA3 A;  3JRU A;  3VH9 A;  1XE4 A;  1P4N A;  4JLY A;  4JXR A;  5LYL A;  2JEV A;  3SJF A;  4FD7 A;  1GYT A;  2QYV A;  5IB9 A;  4PXD A;  2PJ3 A;  1Z9U A;  3S6F A;  4UCN A;  4HNY B;  4PK2 A;  4PPZ A;  4XNH B;  4HNX B;  3KR4 A;  5JH9 A;  4OC5 A;  4OC2 A;  5GCN A;  2FS5 A;  4ORF A;  4PXB A;  3UY5 A;  1VIX A;  1S7K A;  5J8F A;  2PRB A;  3VAT A;  4A95 A;  1QQ9 A;  3FED A;  3DNS A;  2ZEG A;  4CRZ B;  3R95 A;  1AYE A;  4QBJ A;  2PDO A;  3GY9 A;  4MHY A;  1CP7 A;  2DPS A;  3SXO A;  2BEI A;  5I0C A;  3SXN A;  4MCR A;  4QVT A;  4XPD B;  3G3S A;  4EVY A;  3KZW A;  2O53 A;  2FIW A;  1Q2D A;  3D7D A;  1Z5R A;  3FVL A;  3TO6 A;  1I12 A;  3S9N A;  4M85 A;  1Z8W A;  5LRK A;  3T90 A;  4AVC A;  3FXT A;  1Z2L A;  3FF3 A;  3LWU A;  4UIB A;  4F6A A;  4ZGY B;  2PJB A;  2R7H A;  2Q51 A;  2P6G A;  2Q43 A;  3PBE A;  2ZED A;  2F5I A;  3GKR A;  3DGV A;  3I3G A;  4CAE A;  1CPS A;  2IJZ A;  2P0W A;  3PB7 X;  2XEF A;  4FD4 A;  5H84 A;  4C2Z A;  4Z65 A;  5ELY A;  2ANP A;  1ELL P;  1MJ9 A;  3PZJ A;  4X8I A;  4AG9 A;  1VGY A;  4GM5 A;  3IO1 A;  2GFQ A;  2B58 A;  1CBX A;  1TF8 A;  1UFH A;  2HC9 A;  2KCW A;  4CGM A;  1PYT B;  3HUV A;  4X5K A;  4MCQ A;  3T9Y A;  1XF8 A;  1XMT A;  3FBU A;  2B3V A;  3FX6 A;  3ISZ A;  1JWQ A;  2O28 A;  2OOT A;  3IEH A;  3GLJ A;  4C68 A;  2PJ6 A;  4PXC A;  1ON0 A;  1OZP A;  2PRQ A;  2F7V A;  2V8V A;  2FXF A;  4OID A;  4MXU A;  1Y9K A;  3TE4 A;  3A9L A;  1YVO A;  2Z3O A;  3CPX A;  4EFD A;  4KS9 A;  4P4B A;  4P44 A;  1S7L A;  4AXV A;  5AG4 A;  3W6S A;  2ARH A;  4IHM A;  2Z3P A;  2ZXV A;  4FWU A;  4MHP A;  2RC4 A;  1WK4 A;  2FVG A;  2REF A;  5KTA A;  3LMS A;  1WWZ A;  2I3C A;  1YME A;  2C6C A;  5CBM A;  4P4I A;  4NGR A;  4PQA A;  4KLW A;  4A31 A;  4KLV A;  4CYO A;  1XRY A;  2ATR A;  3IGR A;  4EME A;  4CRY B;  3KQX A;  5THW A;  1PUA A;  2NYQ A;  1YVK A;  2GRE A;  3D8P A;  4KOT A;  4P4J A;  4U9Z A;  4DJL A;  4DUK A;  1XFO A;  1X12 A;  4MHZ A;  2Z0Z A;  4NGP A;  3JTK A;  3VWE A;  1Q2C A;  4TNU A;  4BBH A;  2DF5 A;  4BMH A;  4CAV A;  5LYD A;  3RAM A;  4ONU A;  2Y0M A;  2ZEP A;  2ZEM A;  2IL4 A;  1ZG8 A;  4R57 A;  4ZX8 A;  4NGM A;  5JQ4 A;  3EXN A;  1QMU A;  4R3L A;  3FJU A;  2G9D A;  2CTB A;  2BUE A;  1IOI A;  3WAB A;  3DDD A;  3D68 A;  2O4H A;  3I1U A;  2B4D A;  4NGQ A;  1VKC A;  2ZPA A;  4KZT A;  3SHP A;  4JXQ A;  2I79 A;  3B3W A;  4A38 A;  4P10 A;  1R3N A;  1YX0 A;  4Q38 A;  3N5F A;  5K8P A;  3NE8 A;  5KTC A;  1TKF A;  2G3T A;  1IY7 A;  4UIA A;  3DR8 A;  1KUV A;  4ZX9 A;  2PJ4 A;  2PJ7 A;  3GUX A;  4MI4 A;  1F57 A;  5AGE A;  3S6K A;  3DSB A;  1XJO A;  3BI0 A;  4ZI6 A;  1Z4E A;  2PR1 A;  1XIX A;  4PV6 A;  4B11 A;  4II9 A;  4LQ6 A;  2FL4 A;  1FNO A;  3BJ8 A;  4BIN A;  2PSW A;  4M3S A;  4AVA A;  4MCP A;  1YW4 A;  3PFE A;  4OAE A;  3L2N A;  3BJ7 A;  5DWN A;  3SJX A;  2B3U A;  2QIR A;  4F0Y A;  3B3T A;  3NH5 A;  1TXR A;  2XEG A;  2YNC C;  3FIX A;  1M1D A;  2CNS A;  1NSL A;  3WC5 A;  2VI7 A;  4OC4 A;  4K3N A;  5LYF A;  2ZW6 A;  4OKO A;  2XEI A;  2OH1 A;  2BSW A;  4R6T A;  2AFX A;  2EVN A;  4P4E A;  2J8M A;  2X7B A;  1CPX A;  3CZX A;  3FEE A;  4Q36 A;  3MGD A;  4H2K A;  2NSM A;  2YGW A;  3F8K A;  2EWB A;  4KOS A;  4F0X A;  5K8M A;  1S5K A;  4H6U A;  3D7F A;  4U5Y A;  1GHE A;  1YLE A;  4MFK A;  4O23 A;  3IFE A;  1K4J A;  3H5Z A;  3WC7 A;  4OLL A;  3CXP A;  5CNP A;  4UFW A;  2ZEL A;  4A39 A;  3QNV A;  2Q0Y A;  4YGO A;  2DPT A;  2J8R A;  2P6F A;  3JVN A;  1BO4 A;  3D4U A;  3SI1 A;  4CAF A;  4ZYQ A;  1FY7 A;  3H8E A;  3TC8 A;  1M4D A;  3TOA A;  5AG5 A;  2RB7 A;  4ZY1 A;  3QAY A;  4HPS A;  2B4B A;  1YK3 A;  3RZA A;  1ZG7 A;  3BXM A;  2PJ0 A; 
#chains in the Genus database with same CATH homology
 4R3K A;  1LRZ A;  4C2Y A;  4GS4 A;  1IIC A;  2HUZ A;  3ZJ0 A;  4A33 A;  2FSR A;  3CXS A;  2Q04 A;  4E0A A;  3EO4 A;  4NSQ A;  3C26 A;  1R57 A;  3P2F A;  1KUY A;  5G1Z A;  3S6H A;  3TT2 A;  2Z3L A;  3NE7 A;  4JWP A;  4ZBG A;  3EFA A;  2VBQ A;  2WUU A;  3EC4 A;  4B14 A;  4MFJ A;  4H6Z A;  1YGH A;  2BL1 A;  3KKW A;  3R9E A;  2REE A;  4AVB A;  2Z10 A;  4XNH C;  4A2Z A;  4NEX A;  3W91 A;  4Y49 B;  2OU2 A;  3ZZI A;  1XEB A;  4KOV A;  2CNM A;  4KUA A;  4IUS A;  3TO9 A;  5DWM A;  4JD6 A;  4QB9 A;  4XPD C;  1IYL A;  4H89 A;  5F46 A;  3W6X A;  2AJ6 A;  2OZG A;  2I00 A;  1QSN A;  4L8A A;  2WSA A;  4NXY A;  4B5P A;  2OZU A;  4E8O A;  1YRE A;  4KOW A;  2Q4V A;  3IU2 A;  4UFX A;  1KZF A;  5A27 A;  5JPH A;  4HNW B;  3F5B A;  2DXQ A;  4AG7 A;  2VZY A;  4L89 A;  2JDC A;  1M44 A;  4A30 A;  4IF5 A;  3PGP A;  3FRM A;  1P0H A;  4LX9 A;  1Z4R A;  2H5M A;  4UCP A;  4B5O A;  4KOR A;  3B8G A;  5C88 A;  3K9U A;  3R9G A;  1N71 A;  5G21 A;  3QAH A;  2Z11 A;  2VEZ A;  3R9F A;  5HMN A;  1TIQ A;  5EBV A;  1SQH A;  1QSM A;  1S7F A;  2AE6 A;  4UWJ A;  3D3S A;  4KOX A;  1L0C A;  2JDD A;  2WPX A;  4FD5 A;  4KVM E;  2R1I A;  1IB1 E;  3IWG A;  4JJX A;  3N7Z A;  2FT0 A;  1S7N A;  1IYK A;  2G3A A;  4A32 A;  4YFJ A;  2ZW4 A;  4CGL A;  4U9Y A;  2YNC A;  2CXA A;  2D4P A;  4CYN A;  4CAX A;  2FIA A;  1IID A;  2ZW7 A;  1I21 A;  2Q4Y A;  5IV0 A;  2B5G A;  4KVX A;  4KUB A;  2Z3M A;  4KSA A;  4UFV A;  2QEC A;  5F48 A;  5IX3 A;  1KUX A;  5J8C A;  2YNE A;  4AB7 A;  3TFY A;  3EY5 A;  3RYO A;  4R9M A;  4UCM A;  1NMT A;  2CY2 A;  2GAN A;  3DR6 A;  4FD6 A;  2ZW5 A;  1RXT A;  4R87 A;  4J3G A;  4XPL A;  3TTH A;  5ISV A;  1B6B A;  2PQ8 A;  3TCV A;  5G22 A;  3D2M A;  3H4Q A;  3PP9 A;  3LOD A;  2HV2 A;  2Q44 A;  1QST A;  4CGP A;  1M4G A;  4QC6 A;  3I9S A;  4KOU A;  4B10 A;  3P2H A;  4NF1 A;  1PU9 A;  2GE3 A;  2VXK A;  1V0C A;  1MJB A;  4DNC A;  4NCZ A;  3E0K A;  1B87 A;  3G8W A;  5EC4 A;  4MFL A;  5F49 A;  4XPK A;  4RS2 A;  1RO5 A;  2FE7 A;  2Z3N A;  4CS0 B;  3V8I A;  4B13 A;  4B5P B;  1CJW A;  3D2P A;  4PSX A;  4MBU A;  5IB0 A;  4CGN A;  2Q7B A;  1NE9 A;  5BWA B;  2YND A;  3VWD A;  4MJ8 A;  3WR7 A;  4MFZ A;  3R1K A;  1QSO A;  1J4J A;  2D4O A;  2PR8 A;  2P6E A;  2B4D B;  4PSW A;  2OB0 A;  3FYN A;  5AG6 A;  5E96 A;  3IWE A;  2WPW A;  2CNT A;  2FCK A;  4CAW A;  2JLM A;  4YRH A;  4B12 A;  3OWC A;  2A4N A;  1S3Z A;  4KVO E;  4RI1 A;  3S6G A;  2K5T A;  4KOY A;  4CYP A;  3FB3 A;  4MY3 A;  5FVJ A;  4I49 A;  2J8N A;  2R8V A;  5H86 A;  3TOB A;  1BOB A;  4Y49 C;  4KSF A;  2NMT A;  3JUW A;  2B5G B;  3BLN A;  1Q2Y A;  5C82 A;  1ZO0 A;  4C2X A;  2VZZ A;  2OZH A;  2C27 A;  4UBR A;  1VHS A;  4E2A A;  2G0B A;  3CXQ A;  1S60 A;  2PC1 A;  2VQY A;  4MHD A;  1MJA A;  3QB8 A;  2QML A;  4C7I A;  1MK4 A;  3IU1 A;  4MFQ A;  1I1D A;  4QUS A;  2R98 A;  2EUI A;  4UWI A;  1Y7R A;  1Y9W A;  3FNC A;  4CGO A;  3GYA A;  5AG7 A;  4OAD A;  4K30 A;  4MY0 A;  2HQY A;  4C7H A;  4CYQ A;  4MFP A;  1CM0 A;  1YR0 A;  4LUA A;  1QSR A;  3LD2 A;  1M4I A;  3F0A A;  4PK3 A;  2GIV A;  2Z3K A;  4HKF A;  5KTD A;  3R96 A;  5G20 A;  3TO7 A;  5HH1 A;  1U6M A;  5A28 A;  5F47 A;  4UA3 A;  1XE4 A;  1P4N A;  4JLY A;  4JXR A;  2JEV A;  4FD7 A;  1Z9U A;  3S6F A;  4UCN A;  4HNY B;  4PK2 A;  4XNH B;  4HNX B;  5GCN A;  2FS5 A;  4ORF A;  3UY5 A;  1S7K A;  5J8F A;  2PRB A;  4A95 A;  3DNS A;  4CRZ B;  3R95 A;  4QBJ A;  2PDO A;  3GY9 A;  2DPS A;  3SXO A;  2BEI A;  5I0C A;  3SXN A;  4QVT A;  4XPD B;  3G3S A;  4EVY A;  2FIW A;  1Q2D A;  3TO6 A;  1I12 A;  4M85 A;  3T90 A;  4AVC A;  3FXT A;  4ZGY B;  4F6A A;  2R7H A;  2P6G A;  2F5I A;  3GKR A;  3I3G A;  4CAE A;  2P0W A;  4FD4 A;  4C2Z A;  5H84 A;  1MJ9 A;  3PZJ A;  4AG9 A;  2B58 A;  2KCW A;  1UFH A;  4CGM A;  3T9Y A;  4X5K A;  1XF8 A;  3FBU A;  1XMT A;  2B3V A;  2O28 A;  4C68 A;  1ON0 A;  1OZP A;  2FXF A;  1Y9K A;  3TE4 A;  3A9L A;  1YVO A;  2Z3O A;  4KS9 A;  1S7L A;  5AG4 A;  3W6S A;  2ARH A;  2Z3P A;  2ZXV A;  2RC4 A;  1WK4 A;  2REF A;  5KTA A;  1WWZ A;  4KLW A;  4A31 A;  4KLV A;  4CYO A;  2ATR A;  3IGR A;  4CRY B;  1PUA A;  1YVK A;  4KOT A;  3D8P A;  4U9Z A;  2Z0Z A;  3JTK A;  3VWE A;  1Q2C A;  4BBH A;  4BMH A;  4CAV A;  4ONU A;  2Y0M A;  2IL4 A;  4R57 A;  5JQ4 A;  3EXN A;  4R3L A;  2BUE A;  3DDD A;  2B4D A;  1VKC A;  2ZPA A;  4KZT A;  3SHP A;  4JXQ A;  2I79 A;  1YX0 A;  4Q38 A;  5KTC A;  2G3T A;  3DR8 A;  1KUV A;  3S6K A;  4MI4 A;  5AGE A;  3DSB A;  1Z4E A;  2PR1 A;  1XIX A;  4PV6 A;  4B11 A;  4II9 A;  2FL4 A;  3BJ8 A;  2PSW A;  4M3S A;  4AVA A;  4OAE A;  5DWN A;  3BJ7 A;  2B3U A;  2QIR A;  4F0Y A;  2YNC C;  3FIX A;  1M1D A;  2CNS A;  1NSL A;  2VI7 A;  2ZW6 A;  2OH1 A;  2BSW A;  2EVN A;  2J8M A;  2X7B A;  4Q36 A;  3MGD A;  4KOS A;  3F8K A;  2YGW A;  4F0X A;  1S5K A;  4H6U A;  4U5Y A;  1GHE A;  1YLE A;  4MFK A;  1K4J A;  3H5Z A;  4OLL A;  3CXP A;  5CNP A;  4UFW A;  2Q0Y A;  4YGO A;  2DPT A;  2J8R A;  2P6F A;  3JVN A;  1BO4 A;  4CAF A;  1FY7 A;  1M4D A;  3TOA A;  5AG5 A;  2B4B A;  1YK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...