1J4JA

Crystal structure of tabtoxin resistance protein (form ii) complexed with an acyl coenzyme a
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
170
structure length
170
Chain Sequence
AQLRRVTAESFAHYRHGLAQLLFETVHGGASVGFMADLDMQQAYAWCDGLKADIAAGSLLLWVVAEDDNVLASAQLSLCQKPNGLNRAEVQKLMVLPSARGRGLGRQLMDEVEQVAVKHKRGLLHLDTEAGSVAEAFYSALAYTRVGELPGYCATPDGRLHPTAIYFKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords TABTOXIN RESISTANCE PROTEIN
publication title Crystal structure of tabtoxin resistance protein complexed with acetyl coenzyme A reveals the mechanism for beta-lactam acetylation.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tabaci
total genus 45
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2001-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1j4jA00
4Y49B 4BMHA 1B87A 3PZJA 2R8VA 3R9EA 3FXTA 2Q4YA 2J8RA 1Z4EA 5F47A 4U9YA 1J4JA 2ZW7A 2FE7A 4Y49C 2AE6A 1FY7A 2VI7A 5H84A 3IWGA 1KZFA 1I1DA 3TO9A 3S6KA 3G8WA 4OAEA 2B58A 4XNHC 3FB3A 2B5GB 1KUVA 5EC4A 2ZPAA 2BEIA 2HUZA 2P6FA 4H6ZA 2A4NA 2GE3A 1WK4A 1MJBA 2B5GA 5J8CA 2B3VA 2O28A 1IIDA 5DWNA 1UFHA 3QB8A 5GCNA 1ON0A 4FD6A 4YGOA 2ZW4A 1S5KA 3SXOA 5EBVA 1Y7RA 2Q0YA 3TTHA 3R95A 3CXQA 1B6BA 2BSWA 2NMTA 1PUAA 1CM0A 1XMTA 3SXNA 4KOYA 3N7ZA 1BOBA 2Q4VA 1Q2CA 2VZZA 4E2AA 2VQYA 2I79A 3W6XA 5F46A 4LX9A 4IUSA 5J8FA 3EY5A 1RO5A 4NXYA 4JD6A 4K30A 2EUIA 1WWZA 1I21A 4KOSA 2J8NA 3FRMA 3GY9A 3QAHA 4ONUA 2B4DB 4XPKA 2AJ6A 4RI1A 1MJ9A 5IX3A 3EO4A 3PP9A 2B4DA 2F5IA 4KZTA 3D8PA 3OWCA 4QB9A 1LRZA 1S60A 3EXNA 2WPWA 2KCWA 4M3SA 4LUAA 2CNMA 2ZW5A 1IYLA 1VHSA 4AG7A 2ATRA 1YREA 4CAVA 5FVJA 4I49A 1OZPA 5C82A 3B8GA 2CNTA 5H86A 2D4PA 1YGHA 2HV2A 1QSOA 4MI4A 5I0CA 1Z9UA 3LODA 3R9GA 2Q44A 4KVOE 1NMTA 2GANA 1KUYA 3V8IA 2FIWA 2RC4A 4ZBGA 3R9FA 4NF1A 2CNSA 2REFA 3DDDA 1S7LA 1YR0A 1MK4A 3BJ8A 2JDDA 4HNXB 1S7FA 2CY2A 4XPDB 3TO7A 1Z4RA 3VWEA 4KUBA 3R1KA 2PDOA 1S7KA 4AB7A 4KVME 3I9SA 1CJWA 4XPDC 4QUSA 4IF5A 1QSNA 4R9MA 2JDCA 4UBRA 3D2MA 4KVXA 5CNPA 1NSLA 2I00A 1M4IA 4AVCA 3TT2A 1QSTA 4L8AA 4CAXA 4OLLA 3CXPA 4NEXA 2OZGA 4FD4A 1Y9WA 4UA3A 2OZUA 5KTCA 4U5YA 1NE9A 2HQYA 4CS0B 2Q7BA 3SHPA 4FD5A 3F5BA 2PR1A 2BL1A 5F48A 1YK3A 2PR8A 2BUEA 3D3SA 4OADA 1SQHA 4PSWA 1I12A 4E0AA 3W91A 2FCKA 2P6GA 1YVKA 3S6GA 2JLMA 1QSRA 3FNCA 3T90A 4MY0A 3ZZIA 4X5KA 3K9UA 2Q04A 5KTDA 3R96A 1V0CA 1Q2YA 2OU2A 1IB1E 3S6FA 3DSBA 3KKWA 4F0YA 4NSQA 3EC4A 1VKCA 1M4GA 2B3UA 3TO6A 3TE4A 4UWJA 1M1DA 4AG9A 2Y0MA 3UY5A 1MJAA 2IL4A 1TIQA 4KOWA 2OB0A 3E0KA 4FD7A 3EFAA 4KLVA 4YRHA 3GYAA 4QVTA 4HKFA 4H89A 2P6EA 3NE7A 4CRYB 4II9A 4KORA 1IICA 3T9YA 2QMLA 3JVNA 2FXFA 2R7HA 2K5TA 1R57A 2DXQA 3PGPA 4R87A 4JJXA 4PSXA 4KOUA 2REEA 1P0HA 1K4JA 4R57A 2Z0ZA 1L0CA 3TCVA 2ZXVA 1GHEA 2OH1A 5IV0A 2J8MA 1PU9A 4R3KA 3P2HA 3S6HA 4XNHB 4KLWA 4B5PB 1P4NA 2QIRA 4H6UA 4B5OA 1XE4A 2FSRA 4MJ8A 5DWMA 3LD2A 2GIVA 4JWPA 4EVYA 5IB0A 2QECA 4B5PA 2H5MA 4J3GA 2EVNA 3BLNA 4PK2A 4XPLA 4QBJA 2FIAA 1XF8A 4HNYB 1XIXA 2Z11A 5HH1A 4L89A 2G0BA 3G3SA 2P0WA 4QC6A 4RS2A 3FYNA 3FBUA 3RYOA 3BJ7A 4R3LA 2B4BA 4PV6A 3P2FA 4HNWB 4MBUA 1KUXA 4KOXA 2PC1A 4CRZB 1S7NA 4GS4A 1XEBA 1IYKA 4KOVA 3F0AA 2ZW6A 2R98A 2X7BA 2PQ8A 3VWDA 3H4QA 1YVOA 3FIXA 5C88A 4YFJA 4JLYA 1M4DA 3ZJ0A 2D4OA 4AVAA 2G3TA 4AVBA 2VXKA 4KOTA 3I3GA 5JPHA 4MHDA 4E8OA 2PSWA 2VBQA 3GKRA 4MY3A 1M44A 4DNCA 4CAWA 4NCZA 5ISVA 5F49A 2FS5A 2R1IA 3D2PA 4JXQA 2Z10A 2JEVA 3DR6A 2FL4A 2PRBA 3IGRA 3C26A 2OZHA 4ORFA 1Q2DA 1RXTA 2G3AA 5E96A 3WR7A 3MGDA 2VEZA 2WPXA 3F8KA 1YX0A 3JUWA 2ARHA 5JQ4A 3TOAA 3W6SA 4JXRA 4U9ZA 1N71A 4KUAA 4F6AA 1QSMA 3CXSA 3TFYA 4M85A 3TOBA 5HMNA 1BO4A 4UWIA 3DR8A 4PK3A 1U6MA 2C27A 2VZYA 1S3ZA 1YLEA 2FT0A 3DNSA 1Y9KA 5KTAA
chains in the Genus database with same CATH superfamily
2EO8A 1F57A 3V38A 3LWUA 4Y49B 5I4MA 1CPSA 2CTBA 4BMHA 1B87A 3PZJA 2R8VA 4B13A 1TF9A 3R9EA 1ARMA 3D4UA 1YW4A 3FXTA 5K8PA 2Q4YA 2VL1A 2Z3KA 2J8RA 1Z4EA 4M6HA 4U9YA 5F47A 1J4JA 3FECA 2ZW7A 2OR4A 3B7IA 2GLJA 1IGBA 2FE7A 4G1PA 4O23A 3KASA 4Y49C 3V7ZA 2AE6A 4P4JA 2ZEEA 3D7DA 4OC2A 1FY7A 2VI7A 2CIJA 2EWBA 4MFJA 4MFLA 5H84A 4OC3A 3IWGA 2V8GA 1KZFA 1I1DA 2RB7A 1QQ9A 2PVVA 3B3CA 3NH5A 5LYDA 3TO9A 5LRKA 1PYTB 2G9DA 3HLPA 1XJOA 3B3VA 4UCPA 3S6KA 3G8WA 4OAEA 2B58A 4XNHC 1QMUA 2ZEPA 3FB3A 2B5GB 1KUVA 5EC4A 2ZPAA 4A30A 3CPAA 2BEIA 4DYOA 1IU8A 4B14A 2HUZA 2P6FA 5JM6A 1ZG9A 3T8WA 2IJZA 3BXMA 4H6ZA 2A4NA 1NSAA 2GE3A 4ZX9A 4BINA 1WK4A 1MJBA 2B5GA 4MCPA 4WWVA 5J8CA 2B3VA 3NA6A 2O28A 1IIDA 1FT7A 5DWNA 1DTDA 1UFHA 3QB8A 5GCNA 1Z2LA 4A33A 1ON0A 4FD6A 4P4FA 4YGOA 2ZW4A 1CX8A 1S5KA 3SXOA 5EBVA 1Y7RA 2Q0YA 3TTHA 2ZELA 3R95A 3CXQA 3WC6A 4F0XA 1B6BA 2BSWA 2NMTA 1PUAA 4F8ZA 1CM0A 1KWMA 1XMTA 3SXNA 3MN8A 5HVHA 4KOYA 4OKOA 1Y7EA 2F7VA 3N7ZA 5AG4A 5LYFA 1BOBA 2Q4VA 3K9TA 5JH9A 1Q2CA 2VZZA 5AGEA 1CP7A 1X12A 3WC5A 3D68A 4E2AA 2VQYA 2I79A 3W6XA 5F46A 4LX9A 4IUSA 5J8FA 3EY5A 1RO5A 4NXYA 4JD6A 4GXHA 4ZYQA 4K30A 2AFUA 4UF4A 4EFDA 5IB9A 1VIXA 2EUIA 3CDXA 4UEEA 4OP4A 1ZG7A 1WWZA 2V8DA 1I21A 4MXUA 5AG7A 2J8NA 1OBRA 3FRMA 4KOSA 4ZY0A 3GY9A 3QAHA 1IY7A 4ONUA 2B4DB 6CPAA 5K8NA 5G22A 4C68A 4XPKA 2AJ6A 1M4LA 4RI1A 1MJ9A 2ZEHA 3SJXA 3CZXA 2JEWA 4MRIA 3RO0A 5G21A 5IX3A 3EO4A 1X10A 2ZEMA 3PP9A 2PVWA 4GM5A 2B4DA 2F5IA 3HUVA 4YU9A 2PRQA 4KZTA 1VHEA 2XEJA 3D8PA 3OWCA 4KSAA 4QB9A 1TKFA 1LRZA 4A2ZA 1S60A 3H5ZA 3PRTA 3EXNA 2WPWA 1FNOA 2ZOFA 2KCWA 4M3SA 4FBEA 4C7HA 4LUAA 4K3NA 4TWEA 2CNMA 2PJ0A 2ZW5A 1IYLA 1VHSA 1YLOA 1Z5RA 2PJ2A 3S9LA 2BOAA 4W9YA 4P6YA 4AG7A 2ATRA 2V8HA 4RUHA 3WC7A 1YREA 2PJ5A 4CAVA 4IHMA 4I49A 4NJQA 1OZPA 5FVJA 5BWAB 3PB8X 2C6CA 5C82A 3B8GA 3D7HA 3H8FA 4EWTA 2CNTA 5H86A 3IFEA 2D4PA 1YGHA 2AFMA 4EMEA 2HV2A 1QSOA 1XFOA 3VATA 8CPAA 3FEEA 3IIBA 1Q7LA 4LQGA 4MI4A 5A28A 2CXAA 2YGWA 3ISXA 1Z9UA 3KZWA 3LODA 4PXBA 3NFZA 4UIAA 3R9GA 2Q44A 4KVOE 4F9VA 2WYRA 2WSAA 3KHXA 4M6IA 1NMTA 2GANA 4MFZA 2PIZA 1KUYA 3FX6A 3GB0A 3V8IA 2FIWA 2RC4A 4ZBGA 4NGPA 3R9FA 1XRYA 1ARLA 4NF1A 4CAEA 4CGPA 2OOTA 2Z3MA 2Z3NA 2CNSA 2Q51A 2REFA 3H8EA 2QYVA 4NGMA 4OMEA 1UWYA 3DDDA 1CPXA 1S7LA 1YR0A 1MK4A 3BJ8A 3LACA 4A95A 4A39A 2WZNA 2JDDA 3MRUA 4HNXB 1S7FA 4P4BA 4CGMA 2YNEA 1AMPA 3PBEA 1LOKA 3I1UA 4P4DA 3DLJA 5HVFA 3RZAA 2CY2A 4MMOA 4XPDB 3NH4A 2PJ4A 3TO7A 3S9NA 2Q4ZA 2POKA 4WJBA 1Z4RA 3VWEA 4B11A 4CGNA 1TXRA 3D67A 3KQZA 4KUBA 2FVGA 3R1KA 3S9MA 2GLFA 2PDOA 1Y0RA 2V77A 1S7KA 4OC4A 4AB7A 4CAFA 4DJLA 4HPSA 3SJFA 4KVME 3PB4X 3I9SA 1CJWA 3RNZA 3SI2A 2GREA 4XPDC 2WUUA 4CYNA 4QUSA 4BBHA 2CTCA 4IF5A 2DPTA 4M6GA 1QSNA 1CG2A 4R9MA 4CGOA 4ONWA 2JDCA 4UBRA 3D2MA 5AG5A 4KVXA 5CNPA 1IOIA 1NSLA 2I00A 1M4IA 4KS9A 4NJRA 2IMOA 1TF8A 3CT9A 5LYLA 3PEIA 4ZX8A 2O4HA 3PB9X 2DPSA 4AVCA 1AYEA 3TT2A 2AFWA 1QSTA 4CYPA 3GLJA 1RTQA 4L8AA 3IU2A 4CAXA 4OLLA 3CXPA 2PJ8A 1DE4C 1LFWA 2OZGA 4NEXA 3RAMA 5A27A 4FD4A 3L2NA 1Z8TA 1Y9WA 4UA3A 4YWYA 1ZLHA 2QJ8A 4MHNA 1LAMA 1BPMA 1Z8WA 2OZUA 4OIDA 5KTCA 4PPZA 1CBXA 1F2OA 4U5YA 4UCMA 3TX8A 1NE9A 2HQYA 2BCOA 4CS0B 3KL9A 2PJAA 4MHPA 2Q7BA 2QVPA 2YNCA 4MHYA 4FD5A 3SHPA 4OC0A 3B3TA 2NSMA 4MFKA 3F5BA 2PR1A 2CF4A 4C7IA 2PJ3A 4R7MA 2V8VA 4Q38A 1EE3P 2BL1A 4Z65A 1YW6A 1XMBA 1YK3A 5F48A 2ZEOA 4UFXA 4PXEA 1LANA 2PR8A 2BUEA 2XEGA 3D3SA 1SQHA 3QAYA 1I12A 4NGTA 4OADA 4PSWA 4E0AA 4FAIA 3W91A 2FCKA 3KHZA 2P6GA 4B6ZA 4Q7AA 4NGSA 1YVKA 4UFVA 3S6GA 2PJ1A 5K8MA 2EBJA 4X2TA 4PQAA 4MFQA 2JLMA 4BD9A 1QSRA 3K2KA 3FNCA 3B3WA 3T90A 3QNVA 1ZLIA 4MY0A 3TC8A 3ZZIA 4X5KA 2DF5A 3K9UA 2Q04A 1LCPA 2ANPA 5D8NA 3KR4A 1V0CA 3R96A 5KTDA 1HEEA 4OC1A 1Q2YA 2OU2A 1JQGA 4CYOA 5D29A 1IB1E 4C2ZA 3S6FA 3DSBA 3KKWA 5CPAA 4F0YA 4NSQA 4CGLA 2ZENA 3EC4A 1VKCA 1M4GA 2B3UA 3VH9A 5K8OA 4C2XA 5AG6A 1AUGA 4X3RA 3TO6A 4AXVA 3TE4A 4UWJA 1M1DA 4AG9A 4RN7A 2Y0MA 3UY5A 3WT4A 5G1ZA 1MJAA 3FJUA 4NGNA 5EMIA 2IL4A 3FH4A 2PJCA 1TIQA 4KOWA 2OB0A 3E0KA 3FVLA 1XOVA 4FD7A 3EFAA 3NH8A 4KLVA 4YRHA 1R43A 2C1CA 3GYAA 7CPAA 4QVTA 4HKFA 4H89A 4MCQA 5LYIA 4NGRA 2P6EA 1GYTA 3NE7A 4CRYB 4II9A 3B35A 2ZEGA 4P4IA 4IK2A 4KORA 4FWUA 1BAVA 1IICA 3KGQA 1LAPA 3T9YA 4MCSA 1TKHA 2QMLA 3BHXA 2C6PA 3JVNA 2FXFA 1ELLP 2R7HA 2K5TA 4R8FA 1R57A 2DXQA 2HC9A 3PGPA 4OC5A 4B10A 2GU2A 4JJXA 4R87A 3IO1A 4PSXA 4KOUA 2REEA 2F8HA 1P0HA 3KI9A 4MFPA 2ZEDA 1K4JA 4OIWA 4R57A 2Z0ZA 2Z3PA 5I0CA 1L0CA 3D7FA 3TCVA 4ZY2A 2ZXVA 1GHEA 4ZY1A 2AFZA 2ODFA 2OH1A 5IV0A 3BI1A 2J8MA 1Z8LA 1PU9A 4R3KA 3VARA 3P2HA 3KR5A 3S6HA 3N5FA 4R6TA 4XNHB 3CPXA 4KLWA 4DUKA 5F09A 3GUXA 4B5PB 1P4NA 2QIRA 3FMCA 4H6UA 4B5OA 3B2YA 4MHZA 1XE4A 3BI0A 2FSRA 4C2YA 4MJ8A 5DWMA 4IAVA 1ELMP 3LD2A 2GIVA 3SJGA 4JWPA 4EVYA 5IB0A 3IJ3A 2QECA 4PXCA 4B5PA 2H5MA 4J3GA 1YQEA 2PE3A 2EVNA 4KSFA 5HVGA 3BLNA 4PK2A 4XPLA 1H8LA 4QBJA 5THWA 1IOFA 3SI0A 4UCNA 2FIAA 3GIUA 1XF8A 2PJ6A 1XIXA 4HNYB 2Z11A 3RBUA 4R76A 1HDUA 2XEFA 4L89A 1A2ZA 4P45A 2G0BA 5HH1A 3G3SA 2P0WA 4F9UA 4QC6A 4CPAA 4RS2A 3FYNA 2ZOGA 3PBBA 3A9LA 1BLLE 3FBUA 5HXDA 2EK8A 3RYOA 5JGFA 4P4EA 2DEAA 2C6GA 1YSJA 3SI1A 3IEHA 3BJ7A 2BO9A 4CYQA 2XEIA 2PCUA 4R3LA 2B4BA 4PV6A 3NE8A 3PB7X 3P2FA 3SJEA 4HNWB 4MBUA 3IWEA 1JWQA 1KUXA 4H2KA 4KOXA 3LMSA 2GFQA 2PJ7A 2PC1A 4Q36A 4CRZB 3ISZA 4MCRA 1S7NA 5DS0A 2Q7SA 4A31A 4GS4A 1XEBA 1IYKA 4KOVA 4ZI6A 2AFSA 3F0AA 2YNCC 2EK9A 3KQXA 4P44A 3H8GA 2ZW6A 2R98A 2ABZA 2X7BA 2Q43A 2PQ8A 3VWDA 2JBKA 3H4QA 3PFOA 3IWWA 1YVOA 4FUUA 2I3CA 1Y0YA 2AFOA 2IQ6A 3FIXA 5C88A 4B12A 4YFJA 3IC1A 4JLYA 1M4DA 3ZJ0A 2D4OA 5J1QA 3JTKA 4AVAA 1HDQA 2O53A 2AFXA 2G3TA 4AVBA 4A37A 1ZG8A 2VXKA 4A32A 4NGQA 2J9AA 5G20A 4UEZA 5CBMA 4KOTA 3I3GA 5JPHA 1XBUA 4MHDA 4E8OA 2PSWA 2VBQA 3GKRA 4MY3A 1M44A 4UEFA 4DNCA 4X8IA 4NCZA 4CAWA 2RFHA 5F49A 5ISVA 2FS5A 2R1IA 4P10A 4JZ0A 4NFRA 4KSIA 3D2PA 1VHOA 4JXQA 3IU1A 2Z10A 2JEVA 3DR6A 3FF3A 1CP6A 1R3NA 2FL4A 3DGVA 2Z3OA 4TNUA 1F2PA 2PRBA 2PIYA 3C26A 2OZHA 3IGRA 1Q2DA 3D7GA 3PB6X 4ORFA 1RXTA 4JYWA 4UFWA 2G3AA 3FEDA 5E96A 4LQ6A 1VGYA 1ZO0A 2PJ9A 3B3SA 3MGDA 5ELYA 2VEZA 3WR7A 4A94A 2YNDA 2WPXA 3F8KA 3PFEA 1YX0A 3JUWA 4A38A 2ARHA 5JQ4A 1BPNA 3TOAA 3W6SA 4JXRA 1TKJA 1Z8XA 4U9ZA 1N71A 1YMEA 4KUAA 4F6AA 2PJBA 3WABA 2Z3LA 1QSMA 3JRUA 3CXSA 3TFYA 2ZEFA 4M85A 3TOBA 5HMNA 4PXDA 1BO4A 2JBJA 4UWIA 4ZGYB 3DR8A 4PK3A 2HB6A 1U6MA 2C27A 5LRJA 2VZYA 3D66A 4UIBA 5LRGA 1S3ZA 1YLEA 2FT0A 3DNSA 2NYQA 1Y9KA 1PCAA 5KTAA
chains in the Genus database with same CATH topology
4Y49B 4BMHA 1B87A 3PZJA 2R8VA 4B13A 3R9EA 3FXTA 2Q4YA 2Z3KA 2J8RA 1Z4EA 5F47A 4U9YA 1J4JA 2ZW7A 2FE7A 4Y49C 2AE6A 1FY7A 2VI7A 4MFJA 4MFLA 5H84A 3IWGA 1KZFA 1I1DA 3TO9A 4UCPA 3S6KA 3G8WA 4OAEA 2B58A 4XNHC 3FB3A 2B5GB 1KUVA 5EC4A 2ZPAA 4A30A 2BEIA 4B14A 2HUZA 2P6FA 4H6ZA 2A4NA 2GE3A 1WK4A 1MJBA 2B5GA 5J8CA 2B3VA 2O28A 1IIDA 5DWNA 1UFHA 3QB8A 5GCNA 4A33A 1ON0A 4FD6A 4YGOA 2ZW4A 1S5KA 3SXOA 5EBVA 1Y7RA 2Q0YA 3TTHA 3R95A 3CXQA 4F0XA 1B6BA 2BSWA 2NMTA 1PUAA 1CM0A 1XMTA 3SXNA 4KOYA 3N7ZA 5AG4A 1BOBA 2Q4VA 1Q2CA 2VZZA 5AGEA 4E2AA 2VQYA 2I79A 3W6XA 5F46A 4LX9A 4IUSA 5J8FA 3EY5A 1RO5A 4NXYA 4JD6A 4K30A 2EUIA 1WWZA 1I21A 5AG7A 2J8NA 4KOSA 3FRMA 3GY9A 3QAHA 4ONUA 2B4DB 5G22A 4C68A 4XPKA 2AJ6A 4RI1A 1MJ9A 5IX3A 5G21A 3EO4A 3PP9A 2B4DA 2F5IA 4KZTA 3D8PA 3OWCA 4KSAA 4QB9A 1LRZA 4A2ZA 1S60A 3H5ZA 3EXNA 2WPWA 2KCWA 4M3SA 4C7HA 4LUAA 2CNMA 2ZW5A 1IYLA 1VHSA 4AG7A 2ATRA 1YREA 4CAVA 5FVJA 4I49A 5BWAB 1OZPA 5C82A 3B8GA 2CNTA 5H86A 2D4PA 1YGHA 2HV2A 1QSOA 4MI4A 5A28A 2CXAA 2YGWA 5I0CA 1Z9UA 3LODA 3R9GA 2Q44A 4KVOE 2WSAA 4MFZA 1NMTA 2GANA 1KUYA 3V8IA 2FIWA 2RC4A 4ZBGA 3R9FA 4NF1A 4CAEA 4CGPA 2Z3MA 2Z3NA 2CNSA 2REFA 3DDDA 1S7LA 1YR0A 1MK4A 3BJ8A 4A95A 2JDDA 4HNXB 1S7FA 4CGMA 2YNEA 2CY2A 4XPDB 3TO7A 4B11A 4CGNA 1Z4RA 3VWEA 4KUBA 3R1KA 2PDOA 4CAFA 1S7KA 4AB7A 4KVME 3I9SA 1CJWA 4XPDC 2WUUA 4CYNA 4QUSA 4BBHA 4IF5A 2DPTA 1QSNA 4CGOA 4R9MA 2JDCA 4UBRA 3D2MA 5AG5A 4KVXA 5CNPA 1NSLA 2I00A 1M4IA 4KS9A 2DPSA 4AVCA 3TT2A 1QSTA 4CYPA 4L8AA 3IU2A 4CAXA 4OLLA 3CXPA 4NEXA 2OZGA 5A27A 4FD4A 1Y9WA 4UA3A 2OZUA 5KTCA 4U5YA 4UCMA 1NE9A 2HQYA 4CS0B 2Q7BA 2YNCA 3SHPA 4FD5A 4MFKA 3F5BA 2PR1A 4C7IA 4Q38A 2BL1A 5F48A 1YK3A 4UFXA 2PR8A 2BUEA 3D3SA 4OADA 1SQHA 4PSWA 1I12A 4E0AA 3W91A 2FCKA 2P6GA 1YVKA 4UFVA 3S6GA 4MFQA 2JLMA 1QSRA 3FNCA 3T90A 4MY0A 3ZZIA 4X5KA 3K9UA 2Q04A 5KTDA 3R96A 1V0CA 1Q2YA 2OU2A 4CYOA 4C2ZA 1IB1E 3S6FA 3DSBA 3KKWA 4F0YA 4NSQA 4CGLA 3EC4A 1VKCA 1M4GA 2B3UA 4C2XA 5AG6A 3TO6A 3TE4A 4UWJA 1M1DA 4AG9A 2Y0MA 3UY5A 5G1ZA 1MJAA 2IL4A 1TIQA 4KOWA 2OB0A 3E0KA 4FD7A 3EFAA 4KLVA 4YRHA 3GYAA 4QVTA 4HKFA 4H89A 2P6EA 3NE7A 4CRYB 4II9A 4KORA 1IICA 3T9YA 2QMLA 3JVNA 2FXFA 2R7HA 2K5TA 1R57A 3PGPA 2DXQA 4B10A 4R87A 4JJXA 4PSXA 4KOUA 2REEA 1P0HA 4MFPA 1K4JA 4R57A 2Z0ZA 2Z3PA 1L0CA 3TCVA 2ZXVA 1GHEA 2OH1A 5IV0A 2J8MA 1PU9A 4R3KA 3P2HA 3S6HA 4XNHB 4KLWA 4B5PB 1P4NA 2QIRA 4H6UA 4B5OA 1XE4A 2FSRA 4C2YA 4MJ8A 5DWMA 3LD2A 2GIVA 4JWPA 4EVYA 5IB0A 2QECA 4B5PA 2H5MA 4J3GA 2EVNA 4KSFA 3BLNA 4PK2A 4XPLA 4QBJA 4UCNA 2FIAA 1XF8A 4HNYB 1XIXA 2Z11A 5HH1A 4L89A 2G0BA 3G3SA 2P0WA 4QC6A 4RS2A 3FYNA 3A9LA 3FBUA 3RYOA 3BJ7A 4CYQA 4R3LA 2B4BA 4PV6A 3P2FA 4HNWB 4MBUA 3IWEA 1KUXA 4KOXA 4Q36A 2PC1A 4CRZB 1S7NA 4A31A 4GS4A 1XEBA 1IYKA 4KOVA 3F0AA 2YNCC 2ZW6A 2R98A 2X7BA 2PQ8A 3VWDA 3H4QA 1YVOA 3FIXA 5C88A 4B12A 4YFJA 4JLYA 1M4DA 3ZJ0A 2D4OA 3JTKA 4AVAA 2G3TA 4AVBA 2VXKA 4A32A 5G20A 4KOTA 3I3GA 5JPHA 4MHDA 4E8OA 2PSWA 2VBQA 3GKRA 4MY3A 1M44A 4DNCA 4CAWA 4NCZA 5ISVA 5F49A 2FS5A 2R1IA 3D2PA 4JXQA 3IU1A 2Z10A 2JEVA 3DR6A 2FL4A 2Z3OA 2PRBA 3IGRA 3C26A 2OZHA 4ORFA 1Q2DA 4UFWA 1RXTA 2G3AA 5E96A 1ZO0A 3WR7A 3MGDA 2VEZA 2YNDA 2WPXA 3F8KA 1YX0A 3JUWA 2ARHA 5JQ4A 3TOAA 3W6SA 4JXRA 4U9ZA 1N71A 4KUAA 4F6AA 2Z3LA 1QSMA 3CXSA 3TFYA 4M85A 3TOBA 5HMNA 1BO4A 4UWIA 4ZGYB 3DR8A 4PK3A 1U6MA 2C27A 2VZYA 1S3ZA 1YLEA 2FT0A 3DNSA 1Y9KA 5KTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y49 B;  4BMH A;  1B87 A;  3PZJ A;  2R8V A;  3R9E A;  3FXT A;  2Q4Y A;  2J8R A;  1Z4E A;  5F47 A;  4U9Y A;  1J4J A;  2ZW7 A;  2FE7 A;  4Y49 C;  2AE6 A;  1FY7 A;  2VI7 A;  5H84 A;  3IWG A;  1KZF A;  1I1D A;  3TO9 A;  3S6K A;  3G8W A;  4OAE A;  2B58 A;  4XNH C;  3FB3 A;  2B5G B;  1KUV A;  5EC4 A;  2ZPA A;  2BEI A;  2HUZ A;  2P6F A;  4H6Z A;  2A4N A;  2GE3 A;  1WK4 A;  1MJB A;  2B5G A;  5J8C A;  2B3V A;  2O28 A;  1IID A;  5DWN A;  1UFH A;  3QB8 A;  5GCN A;  1ON0 A;  4FD6 A;  4YGO A;  2ZW4 A;  1S5K A;  3SXO A;  5EBV A;  1Y7R A;  2Q0Y A;  3TTH A;  3R95 A;  3CXQ A;  1B6B A;  2BSW A;  2NMT A;  1PUA A;  1CM0 A;  1XMT A;  3SXN A;  4KOY A;  3N7Z A;  1BOB A;  2Q4V A;  1Q2C A;  2VZZ A;  4E2A A;  2VQY A;  2I79 A;  3W6X A;  5F46 A;  4LX9 A;  4IUS A;  5J8F A;  3EY5 A;  1RO5 A;  4NXY A;  4JD6 A;  4K30 A;  2EUI A;  1WWZ A;  1I21 A;  4KOS A;  2J8N A;  3FRM A;  3GY9 A;  3QAH A;  4ONU A;  2B4D B;  4XPK A;  2AJ6 A;  4RI1 A;  1MJ9 A;  5IX3 A;  3EO4 A;  3PP9 A;  2B4D A;  2F5I A;  4KZT A;  3D8P A;  3OWC A;  4QB9 A;  1LRZ A;  1S60 A;  3EXN A;  2WPW A;  2KCW A;  4M3S A;  4LUA A;  2CNM A;  2ZW5 A;  1IYL A;  1VHS A;  4AG7 A;  2ATR A;  1YRE A;  4CAV A;  5FVJ A;  4I49 A;  1OZP A;  5C82 A;  3B8G A;  2CNT A;  5H86 A;  2D4P A;  1YGH A;  2HV2 A;  1QSO A;  4MI4 A;  5I0C A;  1Z9U A;  3LOD A;  3R9G A;  2Q44 A;  4KVO E;  1NMT A;  2GAN A;  1KUY A;  3V8I A;  2FIW A;  2RC4 A;  4ZBG A;  3R9F A;  4NF1 A;  2CNS A;  2REF A;  3DDD A;  1S7L A;  1YR0 A;  1MK4 A;  3BJ8 A;  2JDD A;  4HNX B;  1S7F A;  2CY2 A;  4XPD B;  3TO7 A;  1Z4R A;  3VWE A;  4KUB A;  3R1K A;  2PDO A;  1S7K A;  4AB7 A;  4KVM E;  3I9S A;  1CJW A;  4XPD C;  4QUS A;  4IF5 A;  1QSN A;  4R9M A;  2JDC A;  4UBR A;  3D2M A;  4KVX A;  5CNP A;  1NSL A;  2I00 A;  1M4I A;  4AVC A;  3TT2 A;  1QST A;  4L8A A;  4CAX A;  4OLL A;  3CXP A;  4NEX A;  2OZG A;  4FD4 A;  1Y9W A;  4UA3 A;  2OZU A;  5KTC A;  4U5Y A;  1NE9 A;  2HQY A;  4CS0 B;  2Q7B A;  3SHP A;  4FD5 A;  3F5B A;  2PR1 A;  2BL1 A;  5F48 A;  1YK3 A;  2PR8 A;  2BUE A;  3D3S A;  4OAD A;  1SQH A;  4PSW A;  1I12 A;  4E0A A;  3W91 A;  2FCK A;  2P6G A;  1YVK A;  3S6G A;  2JLM A;  1QSR A;  3FNC A;  3T90 A;  4MY0 A;  3ZZI A;  4X5K A;  3K9U A;  2Q04 A;  5KTD A;  3R96 A;  1V0C A;  1Q2Y A;  2OU2 A;  1IB1 E;  3S6F A;  3DSB A;  3KKW A;  4F0Y A;  4NSQ A;  3EC4 A;  1VKC A;  1M4G A;  2B3U A;  3TO6 A;  3TE4 A;  4UWJ A;  1M1D A;  4AG9 A;  2Y0M A;  3UY5 A;  1MJA A;  2IL4 A;  1TIQ A;  4KOW A;  2OB0 A;  3E0K A;  4FD7 A;  3EFA A;  4KLV A;  4YRH A;  3GYA A;  4QVT A;  4HKF A;  4H89 A;  2P6E A;  3NE7 A;  4CRY B;  4II9 A;  4KOR A;  1IIC A;  3T9Y A;  2QML A;  3JVN A;  2FXF A;  2R7H A;  2K5T A;  1R57 A;  2DXQ A;  3PGP A;  4R87 A;  4JJX A;  4PSX A;  4KOU A;  2REE A;  1P0H A;  1K4J A;  4R57 A;  2Z0Z A;  1L0C A;  3TCV A;  2ZXV A;  1GHE A;  2OH1 A;  5IV0 A;  2J8M A;  1PU9 A;  4R3K A;  3P2H A;  3S6H A;  4XNH B;  4KLW A;  4B5P B;  1P4N A;  2QIR A;  4H6U A;  4B5O A;  1XE4 A;  2FSR A;  4MJ8 A;  5DWM A;  3LD2 A;  2GIV A;  4JWP A;  4EVY A;  5IB0 A;  2QEC A;  4B5P A;  2H5M A;  4J3G A;  2EVN A;  3BLN A;  4PK2 A;  4XPL A;  4QBJ A;  2FIA A;  1XF8 A;  4HNY B;  1XIX A;  2Z11 A;  5HH1 A;  4L89 A;  2G0B A;  3G3S A;  2P0W A;  4QC6 A;  4RS2 A;  3FYN A;  3FBU A;  3RYO A;  3BJ7 A;  4R3L A;  2B4B A;  4PV6 A;  3P2F A;  4HNW B;  4MBU A;  1KUX A;  4KOX A;  2PC1 A;  4CRZ B;  1S7N A;  4GS4 A;  1XEB A;  1IYK A;  4KOV A;  3F0A A;  2ZW6 A;  2R98 A;  2X7B A;  2PQ8 A;  3VWD A;  3H4Q A;  1YVO A;  3FIX A;  5C88 A;  4YFJ A;  4JLY A;  1M4D A;  3ZJ0 A;  2D4O A;  4AVA A;  2G3T A;  4AVB A;  2VXK A;  4KOT A;  3I3G A;  5JPH A;  4MHD A;  4E8O A;  2PSW A;  2VBQ A;  3GKR A;  4MY3 A;  1M44 A;  4DNC A;  4CAW A;  4NCZ A;  5ISV A;  5F49 A;  2FS5 A;  2R1I A;  3D2P A;  4JXQ A;  2Z10 A;  2JEV A;  3DR6 A;  2FL4 A;  2PRB A;  3IGR A;  3C26 A;  2OZH A;  4ORF A;  1Q2D A;  1RXT A;  2G3A A;  5E96 A;  3WR7 A;  3MGD A;  2VEZ A;  2WPX A;  3F8K A;  1YX0 A;  3JUW A;  2ARH A;  5JQ4 A;  3TOA A;  3W6S A;  4JXR A;  4U9Z A;  1N71 A;  4KUA A;  4F6A A;  1QSM A;  3CXS A;  3TFY A;  4M85 A;  3TOB A;  5HMN A;  1BO4 A;  4UWI A;  3DR8 A;  4PK3 A;  1U6M A;  2C27 A;  2VZY A;  1S3Z A;  1YLE A;  2FT0 A;  3DNS A;  1Y9K A;  5KTA A; 
#chains in the Genus database with same CATH topology
 2EO8 A;  1F57 A;  3V38 A;  3LWU A;  4Y49 B;  5I4M A;  1CPS A;  2CTB A;  4BMH A;  1B87 A;  3PZJ A;  2R8V A;  4B13 A;  1TF9 A;  3R9E A;  1ARM A;  3D4U A;  1YW4 A;  3FXT A;  5K8P A;  2Q4Y A;  2VL1 A;  2Z3K A;  2J8R A;  1Z4E A;  4M6H A;  4U9Y A;  5F47 A;  1J4J A;  3FEC A;  2ZW7 A;  2OR4 A;  3B7I A;  2GLJ A;  1IGB A;  2FE7 A;  4G1P A;  4O23 A;  3KAS A;  4Y49 C;  3V7Z A;  2AE6 A;  4P4J A;  2ZEE A;  3D7D A;  4OC2 A;  1FY7 A;  2VI7 A;  2CIJ A;  2EWB A;  4MFJ A;  4MFL A;  5H84 A;  4OC3 A;  3IWG A;  2V8G A;  1KZF A;  1I1D A;  2RB7 A;  1QQ9 A;  2PVV A;  3B3C A;  3NH5 A;  5LYD A;  3TO9 A;  5LRK A;  1PYT B;  2G9D A;  3HLP A;  1XJO A;  3B3V A;  4UCP A;  3S6K A;  3G8W A;  4OAE A;  2B58 A;  4XNH C;  1QMU A;  2ZEP A;  3FB3 A;  2B5G B;  1KUV A;  5EC4 A;  2ZPA A;  4A30 A;  3CPA A;  2BEI A;  4DYO A;  1IU8 A;  4B14 A;  2HUZ A;  2P6F A;  5JM6 A;  1ZG9 A;  3T8W A;  2IJZ A;  3BXM A;  4H6Z A;  2A4N A;  1NSA A;  2GE3 A;  4ZX9 A;  4BIN A;  1WK4 A;  1MJB A;  2B5G A;  4MCP A;  4WWV A;  5J8C A;  2B3V A;  3NA6 A;  2O28 A;  1IID A;  1FT7 A;  5DWN A;  1DTD A;  1UFH A;  3QB8 A;  5GCN A;  1Z2L A;  4A33 A;  1ON0 A;  4FD6 A;  4P4F A;  4YGO A;  2ZW4 A;  1CX8 A;  1S5K A;  3SXO A;  5EBV A;  1Y7R A;  2Q0Y A;  3TTH A;  2ZEL A;  3R95 A;  3CXQ A;  3WC6 A;  4F0X A;  1B6B A;  2BSW A;  2NMT A;  1PUA A;  4F8Z A;  1CM0 A;  1KWM A;  1XMT A;  3SXN A;  3MN8 A;  5HVH A;  4KOY A;  4OKO A;  1Y7E A;  2F7V A;  3N7Z A;  5AG4 A;  5LYF A;  1BOB A;  2Q4V A;  3K9T A;  5JH9 A;  1Q2C A;  2VZZ A;  5AGE A;  1CP7 A;  1X12 A;  3WC5 A;  3D68 A;  4E2A A;  2VQY A;  2I79 A;  3W6X A;  5F46 A;  4LX9 A;  4IUS A;  5J8F A;  3EY5 A;  1RO5 A;  4NXY A;  4JD6 A;  4GXH A;  4ZYQ A;  4K30 A;  2AFU A;  4UF4 A;  4EFD A;  5IB9 A;  1VIX A;  2EUI A;  3CDX A;  4UEE A;  4OP4 A;  1ZG7 A;  1WWZ A;  2V8D A;  1I21 A;  4MXU A;  5AG7 A;  2J8N A;  1OBR A;  3FRM A;  4KOS A;  4ZY0 A;  3GY9 A;  3QAH A;  1IY7 A;  4ONU A;  2B4D B;  6CPA A;  5K8N A;  5G22 A;  4C68 A;  4XPK A;  2AJ6 A;  1M4L A;  4RI1 A;  1MJ9 A;  2ZEH A;  3SJX A;  3CZX A;  2JEW A;  4MRI A;  3RO0 A;  5G21 A;  5IX3 A;  3EO4 A;  1X10 A;  2ZEM A;  3PP9 A;  2PVW A;  4GM5 A;  2B4D A;  2F5I A;  3HUV A;  4YU9 A;  2PRQ A;  4KZT A;  1VHE A;  2XEJ A;  3D8P A;  3OWC A;  4KSA A;  4QB9 A;  1TKF A;  1LRZ A;  4A2Z A;  1S60 A;  3H5Z A;  3PRT A;  3EXN A;  2WPW A;  1FNO A;  2ZOF A;  2KCW A;  4M3S A;  4FBE A;  4C7H A;  4LUA A;  4K3N A;  4TWE A;  2CNM A;  2PJ0 A;  2ZW5 A;  1IYL A;  1VHS A;  1YLO A;  1Z5R A;  2PJ2 A;  3S9L A;  2BOA A;  4W9Y A;  4P6Y A;  4AG7 A;  2ATR A;  2V8H A;  4RUH A;  3WC7 A;  1YRE A;  2PJ5 A;  4CAV A;  4IHM A;  4I49 A;  4NJQ A;  1OZP A;  5FVJ A;  5BWA B;  3PB8 X;  2C6C A;  5C82 A;  3B8G A;  3D7H A;  3H8F A;  4EWT A;  2CNT A;  5H86 A;  3IFE A;  2D4P A;  1YGH A;  2AFM A;  4EME A;  2HV2 A;  1QSO A;  1XFO A;  3VAT A;  8CPA A;  3FEE A;  3IIB A;  1Q7L A;  4LQG A;  4MI4 A;  5A28 A;  2CXA A;  2YGW A;  3ISX A;  1Z9U A;  3KZW A;  3LOD A;  4PXB A;  3NFZ A;  4UIA A;  3R9G A;  2Q44 A;  4KVO E;  4F9V A;  2WYR A;  2WSA A;  3KHX A;  4M6I A;  1NMT A;  2GAN A;  4MFZ A;  2PIZ A;  1KUY A;  3FX6 A;  3GB0 A;  3V8I A;  2FIW A;  2RC4 A;  4ZBG A;  4NGP A;  3R9F A;  1XRY A;  1ARL A;  4NF1 A;  4CAE A;  4CGP A;  2OOT A;  2Z3M A;  2Z3N A;  2CNS A;  2Q51 A;  2REF A;  3H8E A;  2QYV A;  4NGM A;  4OME A;  1UWY A;  3DDD A;  1CPX A;  1S7L A;  1YR0 A;  1MK4 A;  3BJ8 A;  3LAC A;  4A95 A;  4A39 A;  2WZN A;  2JDD A;  3MRU A;  4HNX B;  1S7F A;  4P4B A;  4CGM A;  2YNE A;  1AMP A;  3PBE A;  1LOK A;  3I1U A;  4P4D A;  3DLJ A;  5HVF A;  3RZA A;  2CY2 A;  4MMO A;  4XPD B;  3NH4 A;  2PJ4 A;  3TO7 A;  3S9N A;  2Q4Z A;  2POK A;  4WJB A;  1Z4R A;  3VWE A;  4B11 A;  4CGN A;  1TXR A;  3D67 A;  3KQZ A;  4KUB A;  2FVG A;  3R1K A;  3S9M A;  2GLF A;  2PDO A;  1Y0R A;  2V77 A;  1S7K A;  4OC4 A;  4AB7 A;  4CAF A;  4DJL A;  4HPS A;  3SJF A;  4KVM E;  3PB4 X;  3I9S A;  1CJW A;  3RNZ A;  3SI2 A;  2GRE A;  4XPD C;  2WUU A;  4CYN A;  4QUS A;  4BBH A;  2CTC A;  4IF5 A;  2DPT A;  4M6G A;  1QSN A;  1CG2 A;  4R9M A;  4CGO A;  4ONW A;  2JDC A;  4UBR A;  3D2M A;  5AG5 A;  4KVX A;  5CNP A;  1IOI A;  1NSL A;  2I00 A;  1M4I A;  4KS9 A;  4NJR A;  2IMO A;  1TF8 A;  3CT9 A;  5LYL A;  3PEI A;  4ZX8 A;  2O4H A;  3PB9 X;  2DPS A;  4AVC A;  1AYE A;  3TT2 A;  2AFW A;  1QST A;  4CYP A;  3GLJ A;  1RTQ A;  4L8A A;  3IU2 A;  4CAX A;  4OLL A;  3CXP A;  2PJ8 A;  1DE4 C;  1LFW A;  2OZG A;  4NEX A;  3RAM A;  5A27 A;  4FD4 A;  3L2N A;  1Z8T A;  1Y9W A;  4UA3 A;  4YWY A;  1ZLH A;  2QJ8 A;  4MHN A;  1LAM A;  1BPM A;  1Z8W A;  2OZU A;  4OID A;  5KTC A;  4PPZ A;  1CBX A;  1F2O A;  4U5Y A;  4UCM A;  3TX8 A;  1NE9 A;  2HQY A;  2BCO A;  4CS0 B;  3KL9 A;  2PJA A;  4MHP A;  2Q7B A;  2QVP A;  2YNC A;  4MHY A;  4FD5 A;  3SHP A;  4OC0 A;  3B3T A;  2NSM A;  4MFK A;  3F5B A;  2PR1 A;  2CF4 A;  4C7I A;  2PJ3 A;  4R7M A;  2V8V A;  4Q38 A;  1EE3 P;  2BL1 A;  4Z65 A;  1YW6 A;  1XMB A;  1YK3 A;  5F48 A;  2ZEO A;  4UFX A;  4PXE A;  1LAN A;  2PR8 A;  2BUE A;  2XEG A;  3D3S A;  1SQH A;  3QAY A;  1I12 A;  4NGT A;  4OAD A;  4PSW A;  4E0A A;  4FAI A;  3W91 A;  2FCK A;  3KHZ A;  2P6G A;  4B6Z A;  4Q7A A;  4NGS A;  1YVK A;  4UFV A;  3S6G A;  2PJ1 A;  5K8M A;  2EBJ A;  4X2T A;  4PQA A;  4MFQ A;  2JLM A;  4BD9 A;  1QSR A;  3K2K A;  3FNC A;  3B3W A;  3T90 A;  3QNV A;  1ZLI A;  4MY0 A;  3TC8 A;  3ZZI A;  4X5K A;  2DF5 A;  3K9U A;  2Q04 A;  1LCP A;  2ANP A;  5D8N A;  3KR4 A;  1V0C A;  3R96 A;  5KTD A;  1HEE A;  4OC1 A;  1Q2Y A;  2OU2 A;  1JQG A;  4CYO A;  5D29 A;  1IB1 E;  4C2Z A;  3S6F A;  3DSB A;  3KKW A;  5CPA A;  4F0Y A;  4NSQ A;  4CGL A;  2ZEN A;  3EC4 A;  1VKC A;  1M4G A;  2B3U A;  3VH9 A;  5K8O A;  4C2X A;  5AG6 A;  1AUG A;  4X3R A;  3TO6 A;  4AXV A;  3TE4 A;  4UWJ A;  1M1D A;  4AG9 A;  4RN7 A;  2Y0M A;  3UY5 A;  3WT4 A;  5G1Z A;  1MJA A;  3FJU A;  4NGN A;  5EMI A;  2IL4 A;  3FH4 A;  2PJC A;  1TIQ A;  4KOW A;  2OB0 A;  3E0K A;  3FVL A;  1XOV A;  4FD7 A;  3EFA A;  3NH8 A;  4KLV A;  4YRH A;  1R43 A;  2C1C A;  3GYA A;  7CPA A;  4QVT A;  4HKF A;  4H89 A;  4MCQ A;  5LYI A;  4NGR A;  2P6E A;  1GYT A;  3NE7 A;  4CRY B;  4II9 A;  3B35 A;  2ZEG A;  4P4I A;  4IK2 A;  4KOR A;  4FWU A;  1BAV A;  1IIC A;  3KGQ A;  1LAP A;  3T9Y A;  4MCS A;  1TKH A;  2QML A;  3BHX A;  2C6P A;  3JVN A;  2FXF A;  1ELL P;  2R7H A;  2K5T A;  4R8F A;  1R57 A;  2DXQ A;  2HC9 A;  3PGP A;  4OC5 A;  4B10 A;  2GU2 A;  4JJX A;  4R87 A;  3IO1 A;  4PSX A;  4KOU A;  2REE A;  2F8H A;  1P0H A;  3KI9 A;  4MFP A;  2ZED A;  1K4J A;  4OIW A;  4R57 A;  2Z0Z A;  2Z3P A;  5I0C A;  1L0C A;  3D7F A;  3TCV A;  4ZY2 A;  2ZXV A;  1GHE A;  4ZY1 A;  2AFZ A;  2ODF A;  2OH1 A;  5IV0 A;  3BI1 A;  2J8M A;  1Z8L A;  1PU9 A;  4R3K A;  3VAR A;  3P2H A;  3KR5 A;  3S6H A;  3N5F A;  4R6T A;  4XNH B;  3CPX A;  4KLW A;  4DUK A;  5F09 A;  3GUX A;  4B5P B;  1P4N A;  2QIR A;  3FMC A;  4H6U A;  4B5O A;  3B2Y A;  4MHZ A;  1XE4 A;  3BI0 A;  2FSR A;  4C2Y A;  4MJ8 A;  5DWM A;  4IAV A;  1ELM P;  3LD2 A;  2GIV A;  3SJG A;  4JWP A;  4EVY A;  5IB0 A;  3IJ3 A;  2QEC A;  4PXC A;  4B5P A;  2H5M A;  4J3G A;  1YQE A;  2PE3 A;  2EVN A;  4KSF A;  5HVG A;  3BLN A;  4PK2 A;  4XPL A;  1H8L A;  4QBJ A;  5THW A;  1IOF A;  3SI0 A;  4UCN A;  2FIA A;  3GIU A;  1XF8 A;  2PJ6 A;  1XIX A;  4HNY B;  2Z11 A;  3RBU A;  4R76 A;  1HDU A;  2XEF A;  4L89 A;  1A2Z A;  4P45 A;  2G0B A;  5HH1 A;  3G3S A;  2P0W A;  4F9U A;  4QC6 A;  4CPA A;  4RS2 A;  3FYN A;  2ZOG A;  3PBB A;  3A9L A;  1BLL E;  3FBU A;  5HXD A;  2EK8 A;  3RYO A;  5JGF A;  4P4E A;  2DEA A;  2C6G A;  1YSJ A;  3SI1 A;  3IEH A;  3BJ7 A;  2BO9 A;  4CYQ A;  2XEI A;  2PCU A;  4R3L A;  2B4B A;  4PV6 A;  3NE8 A;  3PB7 X;  3P2F A;  3SJE A;  4HNW B;  4MBU A;  3IWE A;  1JWQ A;  1KUX A;  4H2K A;  4KOX A;  3LMS A;  2GFQ A;  2PJ7 A;  2PC1 A;  4Q36 A;  4CRZ B;  3ISZ A;  4MCR A;  1S7N A;  5DS0 A;  2Q7S A;  4A31 A;  4GS4 A;  1XEB A;  1IYK A;  4KOV A;  4ZI6 A;  2AFS A;  3F0A A;  2YNC C;  2EK9 A;  3KQX A;  4P44 A;  3H8G A;  2ZW6 A;  2R98 A;  2ABZ A;  2X7B A;  2Q43 A;  2PQ8 A;  3VWD A;  2JBK A;  3H4Q A;  3PFO A;  3IWW A;  1YVO A;  4FUU A;  2I3C A;  1Y0Y A;  2AFO A;  2IQ6 A;  3FIX A;  5C88 A;  4B12 A;  4YFJ A;  3IC1 A;  4JLY A;  1M4D A;  3ZJ0 A;  2D4O A;  5J1Q A;  3JTK A;  4AVA A;  1HDQ A;  2O53 A;  2AFX A;  2G3T A;  4AVB A;  4A37 A;  1ZG8 A;  2VXK A;  4A32 A;  4NGQ A;  2J9A A;  5G20 A;  4UEZ A;  5CBM A;  4KOT A;  3I3G A;  5JPH A;  1XBU A;  4MHD A;  4E8O A;  2PSW A;  2VBQ A;  3GKR A;  4MY3 A;  1M44 A;  4UEF A;  4DNC A;  4X8I A;  4NCZ A;  4CAW A;  2RFH A;  5F49 A;  5ISV A;  2FS5 A;  2R1I A;  4P10 A;  4JZ0 A;  4NFR A;  4KSI A;  3D2P A;  1VHO A;  4JXQ A;  3IU1 A;  2Z10 A;  2JEV A;  3DR6 A;  3FF3 A;  1CP6 A;  1R3N A;  2FL4 A;  3DGV A;  2Z3O A;  4TNU A;  1F2P A;  2PRB A;  2PIY A;  3C26 A;  2OZH A;  3IGR A;  1Q2D A;  3D7G A;  3PB6 X;  4ORF A;  1RXT A;  4JYW A;  4UFW A;  2G3A A;  3FED A;  5E96 A;  4LQ6 A;  1VGY A;  1ZO0 A;  2PJ9 A;  3B3S A;  3MGD A;  5ELY A;  2VEZ A;  3WR7 A;  4A94 A;  2YND A;  2WPX A;  3F8K A;  3PFE A;  1YX0 A;  3JUW A;  4A38 A;  2ARH A;  5JQ4 A;  1BPN A;  3TOA A;  3W6S A;  4JXR A;  1TKJ A;  1Z8X A;  4U9Z A;  1N71 A;  1YME A;  4KUA A;  4F6A A;  2PJB A;  3WAB A;  2Z3L A;  1QSM A;  3JRU A;  3CXS A;  3TFY A;  2ZEF A;  4M85 A;  3TOB A;  5HMN A;  4PXD A;  1BO4 A;  2JBJ A;  4UWI A;  4ZGY B;  3DR8 A;  4PK3 A;  2HB6 A;  1U6M A;  2C27 A;  5LRJ A;  2VZY A;  3D66 A;  4UIB A;  5LRG A;  1S3Z A;  1YLE A;  2FT0 A;  3DNS A;  2NYQ A;  1Y9K A;  1PCA A;  5KTA A; 
#chains in the Genus database with same CATH homology
 4Y49 B;  4BMH A;  1B87 A;  3PZJ A;  2R8V A;  4B13 A;  3R9E A;  3FXT A;  2Q4Y A;  2Z3K A;  2J8R A;  1Z4E A;  5F47 A;  4U9Y A;  1J4J A;  2ZW7 A;  2FE7 A;  4Y49 C;  2AE6 A;  1FY7 A;  2VI7 A;  4MFJ A;  4MFL A;  5H84 A;  3IWG A;  1KZF A;  1I1D A;  3TO9 A;  4UCP A;  3S6K A;  3G8W A;  4OAE A;  2B58 A;  4XNH C;  3FB3 A;  2B5G B;  1KUV A;  5EC4 A;  2ZPA A;  4A30 A;  2BEI A;  4B14 A;  2HUZ A;  2P6F A;  4H6Z A;  2A4N A;  2GE3 A;  1WK4 A;  1MJB A;  2B5G A;  5J8C A;  2B3V A;  2O28 A;  1IID A;  5DWN A;  1UFH A;  3QB8 A;  5GCN A;  4A33 A;  1ON0 A;  4FD6 A;  4YGO A;  2ZW4 A;  1S5K A;  3SXO A;  5EBV A;  1Y7R A;  2Q0Y A;  3TTH A;  3R95 A;  3CXQ A;  4F0X A;  1B6B A;  2BSW A;  2NMT A;  1PUA A;  1CM0 A;  1XMT A;  3SXN A;  4KOY A;  3N7Z A;  5AG4 A;  1BOB A;  2Q4V A;  1Q2C A;  2VZZ A;  5AGE A;  4E2A A;  2VQY A;  2I79 A;  3W6X A;  5F46 A;  4LX9 A;  4IUS A;  5J8F A;  3EY5 A;  1RO5 A;  4NXY A;  4JD6 A;  4K30 A;  2EUI A;  1WWZ A;  1I21 A;  5AG7 A;  2J8N A;  4KOS A;  3FRM A;  3GY9 A;  3QAH A;  4ONU A;  2B4D B;  5G22 A;  4C68 A;  4XPK A;  2AJ6 A;  4RI1 A;  1MJ9 A;  5IX3 A;  5G21 A;  3EO4 A;  3PP9 A;  2B4D A;  2F5I A;  4KZT A;  3D8P A;  3OWC A;  4KSA A;  4QB9 A;  1LRZ A;  4A2Z A;  1S60 A;  3H5Z A;  3EXN A;  2WPW A;  2KCW A;  4M3S A;  4C7H A;  4LUA A;  2CNM A;  2ZW5 A;  1IYL A;  1VHS A;  4AG7 A;  2ATR A;  1YRE A;  4CAV A;  5FVJ A;  4I49 A;  5BWA B;  1OZP A;  5C82 A;  3B8G A;  2CNT A;  5H86 A;  2D4P A;  1YGH A;  2HV2 A;  1QSO A;  4MI4 A;  5A28 A;  2CXA A;  2YGW A;  5I0C A;  1Z9U A;  3LOD A;  3R9G A;  2Q44 A;  4KVO E;  2WSA A;  4MFZ A;  1NMT A;  2GAN A;  1KUY A;  3V8I A;  2FIW A;  2RC4 A;  4ZBG A;  3R9F A;  4NF1 A;  4CAE A;  4CGP A;  2Z3M A;  2Z3N A;  2CNS A;  2REF A;  3DDD A;  1S7L A;  1YR0 A;  1MK4 A;  3BJ8 A;  4A95 A;  2JDD A;  4HNX B;  1S7F A;  4CGM A;  2YNE A;  2CY2 A;  4XPD B;  3TO7 A;  4B11 A;  4CGN A;  1Z4R A;  3VWE A;  4KUB A;  3R1K A;  2PDO A;  4CAF A;  1S7K A;  4AB7 A;  4KVM E;  3I9S A;  1CJW A;  4XPD C;  2WUU A;  4CYN A;  4QUS A;  4BBH A;  4IF5 A;  2DPT A;  1QSN A;  4CGO A;  4R9M A;  2JDC A;  4UBR A;  3D2M A;  5AG5 A;  4KVX A;  5CNP A;  1NSL A;  2I00 A;  1M4I A;  4KS9 A;  2DPS A;  4AVC A;  3TT2 A;  1QST A;  4CYP A;  4L8A A;  3IU2 A;  4CAX A;  4OLL A;  3CXP A;  4NEX A;  2OZG A;  5A27 A;  4FD4 A;  1Y9W A;  4UA3 A;  2OZU A;  5KTC A;  4U5Y A;  4UCM A;  1NE9 A;  2HQY A;  4CS0 B;  2Q7B A;  2YNC A;  3SHP A;  4FD5 A;  4MFK A;  3F5B A;  2PR1 A;  4C7I A;  4Q38 A;  2BL1 A;  5F48 A;  1YK3 A;  4UFX A;  2PR8 A;  2BUE A;  3D3S A;  4OAD A;  1SQH A;  4PSW A;  1I12 A;  4E0A A;  3W91 A;  2FCK A;  2P6G A;  1YVK A;  4UFV A;  3S6G A;  4MFQ A;  2JLM A;  1QSR A;  3FNC A;  3T90 A;  4MY0 A;  3ZZI A;  4X5K A;  3K9U A;  2Q04 A;  5KTD A;  3R96 A;  1V0C A;  1Q2Y A;  2OU2 A;  4CYO A;  4C2Z A;  1IB1 E;  3S6F A;  3DSB A;  3KKW A;  4F0Y A;  4NSQ A;  4CGL A;  3EC4 A;  1VKC A;  1M4G A;  2B3U A;  4C2X A;  5AG6 A;  3TO6 A;  3TE4 A;  4UWJ A;  1M1D A;  4AG9 A;  2Y0M A;  3UY5 A;  5G1Z A;  1MJA A;  2IL4 A;  1TIQ A;  4KOW A;  2OB0 A;  3E0K A;  4FD7 A;  3EFA A;  4KLV A;  4YRH A;  3GYA A;  4QVT A;  4HKF A;  4H89 A;  2P6E A;  3NE7 A;  4CRY B;  4II9 A;  4KOR A;  1IIC A;  3T9Y A;  2QML A;  3JVN A;  2FXF A;  2R7H A;  2K5T A;  1R57 A;  3PGP A;  2DXQ A;  4B10 A;  4R87 A;  4JJX A;  4PSX A;  4KOU A;  2REE A;  1P0H A;  4MFP A;  1K4J A;  4R57 A;  2Z0Z A;  2Z3P A;  1L0C A;  3TCV A;  2ZXV A;  1GHE A;  2OH1 A;  5IV0 A;  2J8M A;  1PU9 A;  4R3K A;  3P2H A;  3S6H A;  4XNH B;  4KLW A;  4B5P B;  1P4N A;  2QIR A;  4H6U A;  4B5O A;  1XE4 A;  2FSR A;  4C2Y A;  4MJ8 A;  5DWM A;  3LD2 A;  2GIV A;  4JWP A;  4EVY A;  5IB0 A;  2QEC A;  4B5P A;  2H5M A;  4J3G A;  2EVN A;  4KSF A;  3BLN A;  4PK2 A;  4XPL A;  4QBJ A;  4UCN A;  2FIA A;  1XF8 A;  4HNY B;  1XIX A;  2Z11 A;  5HH1 A;  4L89 A;  2G0B A;  3G3S A;  2P0W A;  4QC6 A;  4RS2 A;  3FYN A;  3A9L A;  3FBU A;  3RYO A;  3BJ7 A;  4CYQ A;  4R3L A;  2B4B A;  4PV6 A;  3P2F A;  4HNW B;  4MBU A;  3IWE A;  1KUX A;  4KOX A;  4Q36 A;  2PC1 A;  4CRZ B;  1S7N A;  4A31 A;  4GS4 A;  1XEB A;  1IYK A;  4KOV A;  3F0A A;  2YNC C;  2ZW6 A;  2R98 A;  2X7B A;  2PQ8 A;  3VWD A;  3H4Q A;  1YVO A;  3FIX A;  5C88 A;  4B12 A;  4YFJ A;  4JLY A;  1M4D A;  3ZJ0 A;  2D4O A;  3JTK A;  4AVA A;  2G3T A;  4AVB A;  2VXK A;  4A32 A;  5G20 A;  4KOT A;  3I3G A;  5JPH A;  4MHD A;  4E8O A;  2PSW A;  2VBQ A;  3GKR A;  4MY3 A;  1M44 A;  4DNC A;  4CAW A;  4NCZ A;  5ISV A;  5F49 A;  2FS5 A;  2R1I A;  3D2P A;  4JXQ A;  3IU1 A;  2Z10 A;  2JEV A;  3DR6 A;  2FL4 A;  2Z3O A;  2PRB A;  3IGR A;  3C26 A;  2OZH A;  4ORF A;  1Q2D A;  4UFW A;  1RXT A;  2G3A A;  5E96 A;  1ZO0 A;  3WR7 A;  3MGD A;  2VEZ A;  2YND A;  2WPX A;  3F8K A;  1YX0 A;  3JUW A;  2ARH A;  5JQ4 A;  3TOA A;  3W6S A;  4JXR A;  4U9Z A;  1N71 A;  4KUA A;  4F6A A;  2Z3L A;  1QSM A;  3CXS A;  3TFY A;  4M85 A;  3TOB A;  5HMN A;  1BO4 A;  4UWI A;  4ZGY B;  3DR8 A;  4PK3 A;  1U6M A;  2C27 A;  2VZY A;  1S3Z A;  1YLE A;  2FT0 A;  3DNS A;  1Y9K A;  5KTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...