1J4JA

Crystal structure of tabtoxin resistance protein (form ii) complexed with an acyl coenzyme a
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
170
structure length
170
Chain Sequence
AQLRRVTAESFAHYRHGLAQLLFETVHGGASVGFMADLDMQQAYAWCDGLKADIAAGSLLLWVVAEDDNVLASAQLSLCQKPNGLNRAEVQKLMVLPSARGRGLGRQLMDEVEQVAVKHKRGLLHLDTEAGSVAEAFYSALAYTRVGELPGYCATPDGRLHPTAIYFKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TABTOXIN RESISTANCE PROTEIN
publication title Crystal structure of tabtoxin resistance protein complexed with acetyl coenzyme A reveals the mechanism for beta-lactam acetylation.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tabaci
molecule tags Transferase
total genus 45
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2001-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1j4jA00
4BMHA 5CNPA 2OZGA 3D2MA 2F5IA 4KUBA 3R1KA 2Q04A 1S60A 1S7KA 2WPWA 4CRYB 4K30A 2OB0A 2ZW6A 4II9A 4QC6A 2WPXA 1YK3A 5DWMA 2QIRA 1MJ9A 4NXYA 4JLYA 3DSBA 2Q0YA 5F47A 4KUAA 1Q2CA 2B4BA 1Z4RA 3VWEA 4KOSA 3C26A 3H4QA 4FD7A 4OLLA 2ATRA 4HNXB 2IL4A 1SQHA 3IWGA 1QSOA 4MY3A 4NEXA 2R1IA 4YRHA 1N71A 2JEVA 2K5TA 3PP9A 2FIWA 3EY5A 3UY5A 3DR8A 2P6GA 2B3VA 1S5KA 3FXTA 3PGPA 1MJAA 2FS5A 1XMTA 2BUEA 2P0WA 4AVCA 3TO7A 4UA3A 2Z10A 2FCKA 4I49A 3G8WA 1I1DA 1TIQA 2HUZA 3W6SA 2OZUA 3TTHA 4XPLA 2GANA 4PK2A 2X7BA 2CNSA 4YGOA 2FL4A 4ONUA 5JPHA 1R57A 3DDDA 1VKCA 4QUSA 2VBQA 4JD6A 1M4IA 1NSLA 2VXKA 1P4NA 3TO6A 4CAVA 1S7NA 4QBJA 4GS4A 3RYOA 2EUIA 4E2AA 2OU2A 4XNHC 4RS2A 4OADA 3S6KA 2Y0MA 5EBVA 4PSWA 3CXSA 3K9UA 3B8GA 2R7HA 4ORFA 1Z9UA 2O28A 3F0AA 1V0CA 2I00A 2I79A 4R3LA 5F46A 1VHSA 4UBRA 1IYLA 4E0AA 2AJ6A 1RO5A 4H6UA 2QMLA 1YREA 2ZXVA 2VQYA 1QSRA 3EO4A 4ZBGA 3EXNA 1OZPA 1IICA 4MBUA 1RXTA 4F0YA 4CS0B 3DNSA 1I21A 1CJWA 4KOVA 2RC4A 2D4OA 4KLVA 4HKFA 2ZW5A 1YR0A 4JJXA 2CNTA 2PRBA 5EC4A 5FVJA 4PK3A 4MY0A 3TT2A 3ZZIA 5E96A 2Q4YA 1M4GA 5KTCA 4CAXA 1PUAA 2A4NA 4R57A 4R87A 2FSRA 1KZFA 4Y49B 3TOBA 3S6HA 3G3SA 4PV6A 3P2FA 3W91A 1S3ZA 2D4PA 1XEBA 1I12A 2PR8A 4NF1A 4XNHB 3ZJ0A 4B5OA 5I0CA 2R8VA 5GCNA 1Q2DA 3FYNA 3R9GA 2P6EA 5J8FA 4AG7A 2NMTA 2Z0ZA 2REEA 4XPDB 3SXOA 1IYKA 2Q4VA 4CRZB 4MJ8A 4AVBA 3TFYA 4KZTA 5JQ4A 1Y7RA 1YLEA 5DWNA 3TO9A 1NMTA 3SHPA 4M3SA 4H89A 1BOBA 4KOWA 4H6ZA 3MGDA 4JXRA 1UFHA 1FY7A 2PC1A 4LX9A 3TE4A 4U9ZA 2FE7A 2Q7BA 1J4JA 4B5PB 1U6MA 3DR6A 5IV0A 4Y49C 5J8CA 2VI7A 1Y9WA 4AB7A 4CAWA 4U9YA 1KUVA 4KVXA 4HNYB 1P0HA 3VWDA 2Q44A 2PR1A 1S7LA 2ARHA 4AVAA 5HH1A 2ZW4A 3I9SA 4JWPA 4U5YA 2FXFA 1WWZA 1GHEA 4MI4A 4XPDC 3FBUA 4YFJA 2DXQA 3GYAA 4JXQA 3D8PA 1XE4A 4HNWB 2FIAA 3OWCA 1ON0A 3FRMA 4RI1A 3R96A 3SXNA 3CXQA 4F6AA 3S6FA 3KKWA 3F5BA 2HV2A 3R9FA 1KUXA 2C27A 3QAHA 4KVME 3D3SA 2OZHA 4KORA 1BO4A 4J3GA 2J8RA 2GE3A 3EC4A 3F8KA 2FT0A 3T90A 4FD4A 4AG9A 2CNMA 3GKRA 4KOUA 1M4DA 4L8AA 2P6FA 2VZYA 2BEIA 4X5KA 2QECA 4B5PA 5H84A 1M44A 2REFA 3BJ7A 3JVNA 2B4DB 3LD2A 5IX3A 4QVTA 4R3KA 4NCZA 2B5GB 2R98A 1MJBA 2J8NA 4EVYA 4L89A 4IF5A 1LRZA 3FB3A 3GY9A 2ZW7A 5C82A 1YVOA 3TCVA 3IGRA 4R9MA 1NE9A 2H5MA 2HQYA 3W6XA 3D2PA 4LUAA 1XF8A 3FNCA 2PDOA 1YX0A 4M85A 4IUSA 4KOXA 2KCWA 4QB9A 3R9EA 3PZJA 3JUWA 2PQ8A 3I3GA 4FD5A 2PSWA 2JDDA 3CXPA 2VZZA 1YGHA 4NSQA 4FD6A 1M1DA 1MK4A 1S7FA 1QSMA 3BJ8A 1IB1E 3T9YA 2ZPAA 4UWIA 5C88A 1XIXA 1K4JA 3LODA 3E0KA 1WK4A 1B87A 3NE7A 1IIDA 1YVKA 1KUYA 2JDCA 2EVNA 2B4DA 5IB0A 2OH1A 4DNCA 2G0BA 1PU9A 5F48A 2B5GA 5KTAA 3P2HA 1Z4EA 4KOYA 3V8IA 2G3AA 2J8MA 5ISVA 4XPKA 4KVOE 1L0CA 2B58A 2VEZA 5F49A 2BSWA 1CM0A 3FIXA 4MHDA 3WR7A 4PSXA 4OAEA 2AE6A 3R95A 3S6GA 1QSNA 3BLNA 4E8OA 3QB8A 2CY2A 2GIVA 5H86A 5KTDA 4KLWA 1B6BA 2B3UA 2G3TA 1Y9KA 1Q2YA 4KOTA 3EFAA 4UWJA 1QSTA 5HMNA 2BL1A 2Z11A 3TOAA 3N7ZA 2JLMA
chains in the Genus database with same CATH superfamily
1VGYA 4UFVA 2AFSA 4BMHA 5CNPA 3QNVA 4NGSA 3B3CA 1Q7LA 2OZGA 4P4BA 1ELLP 3D2MA 2GLFA 4A95A 2CTCA 2F5IA 2Q4ZA 2ZENA 4MHZA 7CPAA 3PFOA 4OC1A 4KUBA 1Y0RA 3R1KA 2Q04A 1GYTA 1S60A 1S7KA 2WPWA 4BD9A 4CRYB 4MRIA 2C6CA 4K30A 1LOKA 2OB0A 2ZW6A 4II9A 4QC6A 4MFLA 2CIJA 3SJXA 1IOIA 1Z8XA 5LRJA 2WPXA 1YK3A 2Z3OA 5DWMA 2QIRA 3FF3A 3IFEA 4G1PA 1MJ9A 3B2YA 2ZOFA 3CDXA 3K9TA 3WC7A 4NXYA 1R43A 1JWQA 4JLYA 3DSBA 1TKHA 2Q0YA 5F47A 4KUAA 2Z3NA 4GM5A 4Q36A 3D7HA 3N5FA 1Q2CA 2B4BA 1Z4RA 3B3TA 3CPAA 3KI9A 3VWEA 4KOSA 3C26A 3H4QA 4FD7A 4OLLA 4ONWA 5G1ZA 4MCRA 2ATRA 1A2ZA 3KZWA 4HNXB 2IL4A 4K3NA 1SQHA 3IWGA 5LRKA 2HC9A 2HB6A 4CGPA 1QSOA 1F2OA 4F9VA 4MY3A 2ZEHA 4NEXA 2O53A 4A33A 4C2XA 5CPAA 2NYQA 2R1IA 4YRHA 1N71A 2JEVA 2K5TA 3CT9A 3PP9A 4P4FA 2FIWA 4IAVA 3EY5A 3UY5A 3DR8A 1VHEA 2P6GA 2B3VA 2DPTA 1S5KA 3FXTA 3PGPA 4UFWA 4F8ZA 2YNCA 3SJEA 1MJAA 3KR5A 1H8LA 2FS5A 2QJ8A 1XMTA 2BUEA 2P0WA 4AVCA 2PJBA 3TO7A 4MFJA 5LYLA 3FMCA 3FEEA 3BI0A 4OC4A 4UA3A 2Z10A 2FCKA 2Z3MA 4MFZA 3PBBA 3LACA 4A38A 1CBXA 2ZEEA 4I49A 2ZEGA 1LAPA 3G8WA 2PVWA 1I1DA 1XMBA 2OOTA 1BLLE 3S9MA 1TIQA 4MCSA 2AFXA 2YNEA 4Q38A 3PFEA 2HUZA 3W6SA 4OC5A 2OZUA 3KGQA 3TTHA 4XPLA 1Z5RA 2GANA 3FJUA 4PK2A 2X7BA 2CNSA 4UEEA 4YGOA 2FL4A 4CYNA 4ONUA 4CYQA 5JPHA 1R57A 3DDDA 3SJGA 1VKCA 4QUSA 1R3NA 1Z8TA 4YU9A 1VIXA 2VBQA 4JD6A 1M4IA 1NSLA 4OIWA 2VXKA 4DJLA 1P4NA 4UCNA 3TO6A 3D67A 4CAVA 1S7NA 1IGBA 4QBJA 4P44A 4GS4A 3DGVA 3RYOA 3VARA 2EUIA 4E2AA 2OU2A 3NE8A 4XNHC 4F0XA 4PPZA 4RS2A 4OADA 3S6KA 2Y0MA 4B12A 2PIZA 5EBVA 4PSWA 3CXSA 3K9UA 3B8GA 2R7HA 5JM6A 4ORFA 4P4EA 1Z9UA 1ZO0A 5F09A 2O28A 3F0AA 2POKA 5LYFA 2ODFA 1V0CA 1ZG8A 3IJ3A 1TXRA 2I00A 2I79A 4R3LA 1AMPA 2PJ6A 2PVVA 4ZI6A 1TF9A 1VHSA 1IYLA 1PYTB 2PJ2A 4UBRA 4TWEA 4E0AA 3PB6X 1XBUA 2RB7A 2AJ6A 1RO5A 3VH9A 4OC0A 3FVLA 4H6UA 1VHOA 2QMLA 4C7IA 4EFDA 1YREA 4CGNA 4JZ0A 2ZXVA 1BPMA 2VQYA 1QSRA 3EO4A 3IU2A 4ZBGA 3EXNA 1OZPA 3NA6A 3SI2A 3NFZA 3PB4X 1IICA 2PCUA 2PJ7A 3D4UA 5D29A 4MBUA 1RXTA 4F0YA 4CS0B 3DNSA 1Z2LA 2ZEOA 3FECA 3D7GA 1I21A 5D8NA 2I3CA 2NSMA 4NGTA 1CJWA 2EWBA 1UWYA 2PE3A 4KOVA 2PRQA 3KL9A 4KSFA 5AG6A 5AG5A 4C2ZA 2RC4A 4ZGYB 3PB9X 3IWWA 4PXCA 2D4OA 4KLVA 2ZEFA 5K8NA 4HKFA 1LAMA 1CP7A 2ZW5A 4JYWA 5HVHA 1YR0A 1F2PA 4JJXA 3RAMA 3JTKA 4DUKA 3JRUA 2CNTA 2PRBA 5EC4A 5FVJA 2V8HA 2XEGA 2GREA 4PK3A 5ELYA 2AFWA 4MY0A 3TT2A 4MHPA 3ZZIA 1TF8A 3CPXA 5E96A 2EK8A 3SI0A 2Q4YA 1M4GA 5KTCA 2YNDA 4CAXA 1PUAA 4ZY2A 2A4NA 4R57A 4R87A 4EWTA 3PRTA 2FSRA 1JQGA 3PB7X 1KZFA 4Y49B 3TOBA 4WJBA 3PB8X 2PJAA 3G3SA 4PV6A 3P2FA 3S6HA 3TC8A 3W91A 1S3ZA 3IIBA 4P4DA 2D4PA 1XEBA 3V7ZA 1YSJA 2C6GA 1I12A 1ZLIA 2PR8A 1HDUA 4NF1A 4P45A 4UCMA 4XNHB 3ZJ0A 4B5OA 2ZELA 3GIUA 5I0CA 2R8VA 5GCNA 3VATA 1Q2DA 3PEIA 4F9UA 5I4MA 2DEAA 3FYNA 3R9GA 2P6EA 3BXMA 4OIDA 4R7MA 4CYPA 5AG4A 5J8FA 4AG7A 2BO9A 2ABZA 2NMTA 1TKJA 2Z0ZA 2PJ8A 2REEA 4XPDB 1Y7EA 4M6HA 1HEEA 2PJ0A 5EMIA 3SXOA 1IYKA 2Q4VA 2QYVA 4M6IA 4CRZB 1X12A 3KQZA 4P10A 4MJ8A 4AVBA 4FAIA 2Z3PA 4KZTA 5JQ4A 3TFYA 2CTBA 3WC5A 1Y7RA 1YLEA 5DWNA 3D68A 3TO9A 4FUUA 1X10A 1NMTA 3RNZA 3SHPA 2XEIA 3IWEA 2PJ1A 4M3SA 4H89A 1BOBA 4KSIA 4M6GA 4ZYQA 4KOWA 4H6ZA 4MFQA 3MGDA 4JXRA 1UFHA 1FY7A 2PC1A 4LX9A 4CAFA 4FBEA 3H8FA 4ZX9A 1ARMA 4IK2A 2GFQA 1LCPA 4U9ZA 2FE7A 4UIAA 4X8IA 2DF5A 2Q7BA 5HXDA 1J4JA 3H8GA 4B5PB 4ZX8A 1U6MA 2PJ5A 3KASA 4UCPA 3DR6A 5IV0A 3TX8A 4Y49C 5J8CA 2VI7A 4NGPA 1Y9WA 4AB7A 4BBHA 3NH8A 4BINA 1EE3P 3RZAA 1FNOA 3RO0A 1QQ9A 3SJFA 4U9YA 4CAWA 1CPXA 1KUVA 3H8EA 1IY7A 2ANPA 1P0HA 3B35A 3KQXA 4HNYB 3BHXA 4KVXA 3VWDA 4FWUA 2F7VA 2PR1A 2Q44A 1S7LA 4P6YA 3PBEA 2ARHA 4AVAA 5HH1A 4A94A 2V8VA 4NGMA 4CAEA 2ZW4A 3I9SA 4JWPA 3KHZA 4MMOA 4OC3A 4U5YA 2FXFA 4LQGA 1PCAA 1WWZA 5AG7A 3FH4A 1GHEA 4MI4A 2AFZA 5BWAB 2BOAA 3B7IA 4UIBA 3ISXA 1F57A 3L2NA 4XPDC 2VL1A 3FBUA 3IO1A 3H5ZA 4CYOA 4MFPA 4YFJA 2DXQA 3DLJA 3GB0A 1XJOA 4O23A 3GYAA 4JXQA 2O4HA 4OP4A 5G22A 3D8PA 1XE4A 2EBJA 2FIAA 2V77A 3OWCA 2RFHA 4HNWB 4MHYA 2IMOA 4R6TA 1ON0A 3FRMA 2JBJA 4RI1A 3R96A 3SXNA 1Z8WA 3CXQA 5LYDA 4P4JA 4F6AA 2PIYA 3S6FA 2IJZA 2PJ9A 2ZEMA 3KKWA 1YW6A 2JEWA 3GUXA 3F5BA 3SI1A 5A27A 2HV2A 3R9FA 2EK9A 1KUXA 1YMEA 2C27A 2J9AA 3QAHA 1TKFA 4KVME 5AGEA 3D3SA 3MRUA 4NGQA 4LQ6A 4A37A 3S9LA 1YQEA 2C1CA 2OZHA 1BO4A 4GXHA 4KORA 4J3GA 4A39A 4MXUA 3MN8A 3V38A 2J8RA 2PJ4A 1CX8A 2GE3A 3EC4A 3F8KA 4X2TA 2FT0A 3T90A 3B3SA 4FD4A 4AG9A 2CNMA 3GKRA 4KOUA 1M4DA 1Z8LA 4H2KA 4L8AA 2IQ6A 3IC1A 2P6FA 2VZYA 4Q7AA 2BEIA 3A9LA 2QECA 4X5KA 3B3WA 4B5PA 4TNUA 5H84A 1M44A 2REFA 3BJ7A 2F8HA 3D7DA 4P4IA 4B6ZA 3ISZA 3D66A 5LYIA 2XEFA 4UF4A 3JVNA 2CXAA 2B4DB 5F46A 2DPSA 2Q7SA 3LD2A 5IX3A 2OR4A 4HPSA 4QVTA 1YW4A 4R3KA 2FVGA 2V8DA 4B14A 3FEDA 3WT4A 4NCZA 4CGOA 2B5GB 5DS0A 5G20A 4RUHA 2R98A 4CGMA 4AXVA 4CPAA 1MJBA 4A32A 2J8NA 5J1QA 4EVYA 3NH4A 2JBKA 1M4LA 4IF5A 3CZXA 1LRZA 2ZOGA 3FB3A 3GY9A 3B3VA 4L89A 4A2ZA 5JH9A 2ZW7A 5IB9A 5C82A 1YVOA 1ZLHA 2GU2A 3TCVA 3IGRA 4R9MA 3RBUA 1NE9A 1CG2A 2H5MA 4KSAA 2HQYA 2BCOA 3W6XA 1LFWA 1XFOA 1CP6A 3D2PA 4OC2A 2Z3KA 2WYRA 4LUAA 1XF8A 3FNCA 1DE4C 2YNCC 1AUGA 2PDOA 4NFRA 4OKOA 1YX0A 4NGNA 4M85A 5LRGA 1OBRA 4UEFA 4IUSA 4KOXA 2KCWA 2Q43A 4WWVA 4PXDA 4NJRA 4UFXA 1Y0YA 4OMEA 4QB9A 1DTDA 4C2YA 6CPAA 1ZG9A 3PZJA 3R9EA 3WABA 4A31A 3JUWA 2AFUA 5HVGA 2PQ8A 3I3GA 1BPNA 2YGWA 4X3RA 1FT7A 4FD5A 2ZEPA 2PSWA 4KS9A 3NH5A 4W9YA 2C6PA 2AFMA 3QAYA 4C68A 2JDDA 3CXPA 2VZZA 1YGHA 2AFOA 4MCQA 4NSQA 2G9DA 4FD6A 3TE4A 1M1DA 2PJCA 1LANA 5CBMA 5K8MA 5THWA 1MK4A 3T8WA 1S7FA 1QSMA 3BJ8A 2WSAA 1IB1E 4PXBA 3K2KA 3FX6A 3HLPA 4NJQA 2ZPAA 3T9YA 4UWIA 3KHXA 4MCPA 5K8PA 2PJ3A 5C88A 4UEZA 1YLOA 1NSAA 1XIXA 2WZNA 1K4JA 2QVPA 2Z3LA 3LODA 4B10A 3E0KA 3KR4A 1WK4A 1B87A 3NE7A 3S9NA 4B11A 1IIDA 1YVKA 1KUYA 2EO8A 2JDCA 4A30A 1IOFA 2EVNA 2B4DA 4PQAA 5IB0A 1AYEA 2OH1A 4DNCA 3IEHA 2Q51A 2G0BA 1PU9A 3D7FA 4EMEA 5F48A 2B5GA 1KWMA 4R8FA 5KTAA 3P2HA 1Z4EA 4KOYA 3V8IA 2G3AA 1XOVA 2J8MA 5JGFA 4YWYA 4PXEA 5ISVA 1ELMP 2ZEDA 4XPKA 4Z65A 4KVOE 4DYOA 1HDQA 3IU1A 3WC6A 1L0CA 2B58A 2VEZA 5F49A 4B13A 8CPAA 4C7HA 4NGRA 2BSWA 3LMSA 1CM0A 1CPSA 3FIXA 4MHDA 3WR7A 4PSXA 3HUVA 5A28A 4OAEA 2AE6A 4ZY0A 5G21A 3R95A 4MFKA 5HVFA 3S6GA 2WUUA 1ZG7A 2V8GA 2XEJA 2GLJA 1QSNA 3BLNA 4IHMA 4E8OA 1IU8A 3QB8A 2CY2A 2GIVA 5H86A 5KTDA 4KLWA 1B6BA 4CGLA 4R76A 1BAVA 2B3UA 2G3TA 1XRYA 1Y9KA 2CF4A 3BI1A 1Q2YA 3LWUA 1ARLA 4KOTA 4MHNA 3EFAA 1QMUA 4UWJA 4ZY1A 3GLJA 1QSTA 3I1UA 5HMNA 5K8OA 2BL1A 2Z11A 4RN7A 3TOAA 3N7ZA 1RTQA 2JLMA
chains in the Genus database with same CATH topology
4UFVA 4BMHA 5CNPA 2OZGA 3D2MA 4A95A 2F5IA 4KUBA 3R1KA 2Q04A 1S60A 1S7KA 2WPWA 4CRYB 4K30A 2OB0A 2ZW6A 4II9A 4QC6A 4MFLA 2WPXA 1YK3A 2Z3OA 5DWMA 2QIRA 1MJ9A 4NXYA 4JLYA 3DSBA 2Q0YA 5F47A 4KUAA 2Z3NA 4Q36A 1Q2CA 2B4BA 1Z4RA 3VWEA 4KOSA 3C26A 3H4QA 4FD7A 4OLLA 5G1ZA 2ATRA 4HNXB 2IL4A 1SQHA 3IWGA 4CGPA 1QSOA 4MY3A 4A33A 4NEXA 4C2XA 2R1IA 4YRHA 1N71A 2JEVA 2K5TA 3PP9A 2FIWA 3EY5A 3UY5A 3DR8A 2P6GA 2B3VA 2DPTA 1S5KA 3FXTA 3PGPA 4UFWA 2YNCA 1MJAA 2FS5A 1XMTA 2BUEA 2P0WA 4AVCA 3TO7A 4MFJA 4UA3A 2Z10A 2FCKA 2Z3MA 4MFZA 4I49A 3G8WA 1I1DA 1TIQA 2YNEA 4Q38A 2HUZA 3W6SA 2OZUA 3TTHA 4XPLA 2GANA 4PK2A 2X7BA 2CNSA 4YGOA 2FL4A 4CYNA 4ONUA 4CYQA 5JPHA 1R57A 3DDDA 1VKCA 4QUSA 2VBQA 4JD6A 1M4IA 1NSLA 2VXKA 1P4NA 4UCNA 3TO6A 4CAVA 1S7NA 4QBJA 4GS4A 3RYOA 2EUIA 4E2AA 2OU2A 4XNHC 4F0XA 4RS2A 4OADA 3S6KA 2Y0MA 4B12A 5EBVA 4PSWA 3CXSA 3K9UA 3B8GA 2R7HA 4ORFA 1Z9UA 1ZO0A 2O28A 3F0AA 1V0CA 2I00A 2I79A 4R3LA 5F46A 1VHSA 4UBRA 1IYLA 4E0AA 2AJ6A 1RO5A 4H6UA 2QMLA 4C7IA 1YREA 4CGNA 2ZXVA 2VQYA 3IU2A 1QSRA 3EO4A 4ZBGA 3EXNA 1OZPA 1IICA 4MBUA 1RXTA 4F0YA 4CS0B 3DNSA 1I21A 1CJWA 4KSFA 4KOVA 5AG6A 5AG5A 4C2ZA 2RC4A 4ZGYB 2D4OA 4KLVA 4HKFA 2ZW5A 1YR0A 4JJXA 3JTKA 2CNTA 2PRBA 5EC4A 5FVJA 4PK3A 4MY0A 3TT2A 3ZZIA 5E96A 2Q4YA 1M4GA 5KTCA 2YNDA 4CAXA 1PUAA 2A4NA 4R57A 4R87A 2FSRA 1KZFA 4Y49B 3TOBA 3S6HA 3G3SA 4PV6A 3P2FA 3W91A 1S3ZA 2D4PA 1XEBA 1I12A 2PR8A 4NF1A 4UCMA 4XNHB 3ZJ0A 4B5OA 5I0CA 2R8VA 5GCNA 1Q2DA 3FYNA 3R9GA 2P6EA 4CYPA 5AG4A 5J8FA 4AG7A 2NMTA 2Z0ZA 2REEA 4XPDB 3SXOA 1IYKA 2Q4VA 4CRZB 4MJ8A 4AVBA 2Z3PA 4KZTA 5JQ4A 3TFYA 1Y7RA 1YLEA 5DWNA 3TO9A 1NMTA 3SHPA 3IWEA 4M3SA 4H89A 1BOBA 4KOWA 4H6ZA 4MFQA 3MGDA 4JXRA 1UFHA 1FY7A 2PC1A 4LX9A 4CAFA 3TE4A 4U9ZA 2FE7A 2Q7BA 1J4JA 4B5PB 1U6MA 4UCPA 3DR6A 5IV0A 4Y49C 5J8CA 2VI7A 1Y9WA 4AB7A 4BBHA 4CAWA 4U9YA 1KUVA 4KVXA 4HNYB 1P0HA 3VWDA 2Q44A 2PR1A 1S7LA 2ARHA 4AVAA 5HH1A 4CAEA 2ZW4A 3I9SA 4JWPA 4U5YA 2FXFA 1WWZA 5AG7A 1GHEA 4MI4A 5BWAB 4XPDC 4CYOA 3FBUA 3H5ZA 4MFPA 4YFJA 2DXQA 3GYAA 4JXQA 5G22A 3D8PA 1XE4A 4HNWB 2FIAA 3OWCA 1ON0A 3FRMA 4RI1A 3R96A 3SXNA 3CXQA 4F6AA 3S6FA 3KKWA 3F5BA 5A27A 2HV2A 3R9FA 1KUXA 2C27A 3QAHA 4KVME 5AGEA 3D3SA 2OZHA 4KORA 1BO4A 4J3GA 2J8RA 2GE3A 3EC4A 3F8KA 2FT0A 3T90A 4FD4A 4AG9A 2CNMA 3GKRA 4KOUA 1M4DA 4L8AA 2P6FA 2VZYA 2BEIA 3A9LA 2QECA 4X5KA 4B5PA 5H84A 1M44A 2REFA 3BJ7A 3JVNA 2CXAA 2B4DB 2DPSA 3LD2A 5IX3A 4QVTA 4R3KA 4B14A 4NCZA 4CGOA 2B5GB 5G20A 2R98A 4CGMA 1MJBA 4A32A 2J8NA 4EVYA 4IF5A 4L89A 1LRZA 3FB3A 3GY9A 4A2ZA 2ZW7A 5C82A 1YVOA 3TCVA 3IGRA 4R9MA 1NE9A 2H5MA 4KSAA 2HQYA 3W6XA 3D2PA 2Z3KA 4LUAA 1XF8A 3FNCA 2YNCC 2PDOA 1YX0A 4M85A 4IUSA 4KOXA 2KCWA 4UFXA 4QB9A 4C2YA 3R9EA 3PZJA 4A31A 3JUWA 2PQ8A 3I3GA 2YGWA 4FD5A 4KS9A 2PSWA 4C68A 2JDDA 3CXPA 2VZZA 1YGHA 4NSQA 4FD6A 1M1DA 1MK4A 1S7FA 1QSMA 3BJ8A 2WSAA 1IB1E 3T9YA 2ZPAA 4UWIA 5C88A 1XIXA 1K4JA 2Z3LA 3LODA 4B10A 3E0KA 1WK4A 1B87A 3NE7A 4B11A 1IIDA 1YVKA 1KUYA 2JDCA 4A30A 2EVNA 2B4DA 5IB0A 2OH1A 4DNCA 2G0BA 1PU9A 5F48A 2B5GA 5KTAA 3P2HA 1Z4EA 4KOYA 3V8IA 2G3AA 2J8MA 5ISVA 4XPKA 4KVOE 3IU1A 1L0CA 2B58A 2VEZA 5F49A 4B13A 4C7HA 2BSWA 1CM0A 3FIXA 4MHDA 3WR7A 4PSXA 5A28A 4OAEA 2AE6A 5G21A 3R95A 4MFKA 3S6GA 2WUUA 1QSNA 3BLNA 4E8OA 3QB8A 2CY2A 2GIVA 5H86A 5KTDA 4KLWA 1B6BA 4CGLA 2B3UA 2G3TA 1Y9KA 1Q2YA 4KOTA 3EFAA 4UWJA 1QSTA 5HMNA 2BL1A 2Z11A 3TOAA 3N7ZA 2JLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BMH A;  5CNP A;  2OZG A;  3D2M A;  2F5I A;  4KUB A;  3R1K A;  2Q04 A;  1S60 A;  1S7K A;  2WPW A;  4CRY B;  4K30 A;  2OB0 A;  2ZW6 A;  4II9 A;  4QC6 A;  2WPX A;  1YK3 A;  5DWM A;  2QIR A;  1MJ9 A;  4NXY A;  4JLY A;  3DSB A;  2Q0Y A;  5F47 A;  4KUA A;  1Q2C A;  2B4B A;  1Z4R A;  3VWE A;  4KOS A;  3C26 A;  3H4Q A;  4FD7 A;  4OLL A;  2ATR A;  4HNX B;  2IL4 A;  1SQH A;  3IWG A;  1QSO A;  4MY3 A;  4NEX A;  2R1I A;  4YRH A;  1N71 A;  2JEV A;  2K5T A;  3PP9 A;  2FIW A;  3EY5 A;  3UY5 A;  3DR8 A;  2P6G A;  2B3V A;  1S5K A;  3FXT A;  3PGP A;  1MJA A;  2FS5 A;  1XMT A;  2BUE A;  2P0W A;  4AVC A;  3TO7 A;  4UA3 A;  2Z10 A;  2FCK A;  4I49 A;  3G8W A;  1I1D A;  1TIQ A;  2HUZ A;  3W6S A;  2OZU A;  3TTH A;  4XPL A;  2GAN A;  4PK2 A;  2X7B A;  2CNS A;  4YGO A;  2FL4 A;  4ONU A;  5JPH A;  1R57 A;  3DDD A;  1VKC A;  4QUS A;  2VBQ A;  4JD6 A;  1M4I A;  1NSL A;  2VXK A;  1P4N A;  3TO6 A;  4CAV A;  1S7N A;  4QBJ A;  4GS4 A;  3RYO A;  2EUI A;  4E2A A;  2OU2 A;  4XNH C;  4RS2 A;  4OAD A;  3S6K A;  2Y0M A;  5EBV A;  4PSW A;  3CXS A;  3K9U A;  3B8G A;  2R7H A;  4ORF A;  1Z9U A;  2O28 A;  3F0A A;  1V0C A;  2I00 A;  2I79 A;  4R3L A;  5F46 A;  1VHS A;  4UBR A;  1IYL A;  4E0A A;  2AJ6 A;  1RO5 A;  4H6U A;  2QML A;  1YRE A;  2ZXV A;  2VQY A;  1QSR A;  3EO4 A;  4ZBG A;  3EXN A;  1OZP A;  1IIC A;  4MBU A;  1RXT A;  4F0Y A;  4CS0 B;  3DNS A;  1I21 A;  1CJW A;  4KOV A;  2RC4 A;  2D4O A;  4KLV A;  4HKF A;  2ZW5 A;  1YR0 A;  4JJX A;  2CNT A;  2PRB A;  5EC4 A;  5FVJ A;  4PK3 A;  4MY0 A;  3TT2 A;  3ZZI A;  5E96 A;  2Q4Y A;  1M4G A;  5KTC A;  4CAX A;  1PUA A;  2A4N A;  4R57 A;  4R87 A;  2FSR A;  1KZF A;  4Y49 B;  3TOB A;  3S6H A;  3G3S A;  4PV6 A;  3P2F A;  3W91 A;  1S3Z A;  2D4P A;  1XEB A;  1I12 A;  2PR8 A;  4NF1 A;  4XNH B;  3ZJ0 A;  4B5O A;  5I0C A;  2R8V A;  5GCN A;  1Q2D A;  3FYN A;  3R9G A;  2P6E A;  5J8F A;  4AG7 A;  2NMT A;  2Z0Z A;  2REE A;  4XPD B;  3SXO A;  1IYK A;  2Q4V A;  4CRZ B;  4MJ8 A;  4AVB A;  3TFY A;  4KZT A;  5JQ4 A;  1Y7R A;  1YLE A;  5DWN A;  3TO9 A;  1NMT A;  3SHP A;  4M3S A;  4H89 A;  1BOB A;  4KOW A;  4H6Z A;  3MGD A;  4JXR A;  1UFH A;  1FY7 A;  2PC1 A;  4LX9 A;  3TE4 A;  4U9Z A;  2FE7 A;  2Q7B A;  1J4J A;  4B5P B;  1U6M A;  3DR6 A;  5IV0 A;  4Y49 C;  5J8C A;  2VI7 A;  1Y9W A;  4AB7 A;  4CAW A;  4U9Y A;  1KUV A;  4KVX A;  4HNY B;  1P0H A;  3VWD A;  2Q44 A;  2PR1 A;  1S7L A;  2ARH A;  4AVA A;  5HH1 A;  2ZW4 A;  3I9S A;  4JWP A;  4U5Y A;  2FXF A;  1WWZ A;  1GHE A;  4MI4 A;  4XPD C;  3FBU A;  4YFJ A;  2DXQ A;  3GYA A;  4JXQ A;  3D8P A;  1XE4 A;  4HNW B;  2FIA A;  3OWC A;  1ON0 A;  3FRM A;  4RI1 A;  3R96 A;  3SXN A;  3CXQ A;  4F6A A;  3S6F A;  3KKW A;  3F5B A;  2HV2 A;  3R9F A;  1KUX A;  2C27 A;  3QAH A;  4KVM E;  3D3S A;  2OZH A;  4KOR A;  1BO4 A;  4J3G A;  2J8R A;  2GE3 A;  3EC4 A;  3F8K A;  2FT0 A;  3T90 A;  4FD4 A;  4AG9 A;  2CNM A;  3GKR A;  4KOU A;  1M4D A;  4L8A A;  2P6F A;  2VZY A;  2BEI A;  4X5K A;  2QEC A;  4B5P A;  5H84 A;  1M44 A;  2REF A;  3BJ7 A;  3JVN A;  2B4D B;  3LD2 A;  5IX3 A;  4QVT A;  4R3K A;  4NCZ A;  2B5G B;  2R98 A;  1MJB A;  2J8N A;  4EVY A;  4L89 A;  4IF5 A;  1LRZ A;  3FB3 A;  3GY9 A;  2ZW7 A;  5C82 A;  1YVO A;  3TCV A;  3IGR A;  4R9M A;  1NE9 A;  2H5M A;  2HQY A;  3W6X A;  3D2P A;  4LUA A;  1XF8 A;  3FNC A;  2PDO A;  1YX0 A;  4M85 A;  4IUS A;  4KOX A;  2KCW A;  4QB9 A;  3R9E A;  3PZJ A;  3JUW A;  2PQ8 A;  3I3G A;  4FD5 A;  2PSW A;  2JDD A;  3CXP A;  2VZZ A;  1YGH A;  4NSQ A;  4FD6 A;  1M1D A;  1MK4 A;  1S7F A;  1QSM A;  3BJ8 A;  1IB1 E;  3T9Y A;  2ZPA A;  4UWI A;  5C88 A;  1XIX A;  1K4J A;  3LOD A;  3E0K A;  1WK4 A;  1B87 A;  3NE7 A;  1IID A;  1YVK A;  1KUY A;  2JDC A;  2EVN A;  2B4D A;  5IB0 A;  2OH1 A;  4DNC A;  2G0B A;  1PU9 A;  5F48 A;  2B5G A;  5KTA A;  3P2H A;  1Z4E A;  4KOY A;  3V8I A;  2G3A A;  2J8M A;  5ISV A;  4XPK A;  4KVO E;  1L0C A;  2B58 A;  2VEZ A;  5F49 A;  2BSW A;  1CM0 A;  3FIX A;  4MHD A;  3WR7 A;  4PSX A;  4OAE A;  2AE6 A;  3R95 A;  3S6G A;  1QSN A;  3BLN A;  4E8O A;  3QB8 A;  2CY2 A;  2GIV A;  5H86 A;  5KTD A;  4KLW A;  1B6B A;  2B3U A;  2G3T A;  1Y9K A;  1Q2Y A;  4KOT A;  3EFA A;  4UWJ A;  1QST A;  5HMN A;  2BL1 A;  2Z11 A;  3TOA A;  3N7Z A;  2JLM A; 
#chains in the Genus database with same CATH topology
 1VGY A;  4UFV A;  2AFS A;  4BMH A;  5CNP A;  3QNV A;  4NGS A;  3B3C A;  1Q7L A;  2OZG A;  4P4B A;  1ELL P;  3D2M A;  2GLF A;  4A95 A;  2CTC A;  2F5I A;  2Q4Z A;  2ZEN A;  4MHZ A;  7CPA A;  3PFO A;  4OC1 A;  4KUB A;  1Y0R A;  3R1K A;  2Q04 A;  1GYT A;  1S60 A;  1S7K A;  2WPW A;  4BD9 A;  4CRY B;  4MRI A;  2C6C A;  4K30 A;  1LOK A;  2OB0 A;  2ZW6 A;  4II9 A;  4QC6 A;  4MFL A;  2CIJ A;  3SJX A;  1IOI A;  1Z8X A;  5LRJ A;  2WPX A;  1YK3 A;  2Z3O A;  5DWM A;  2QIR A;  3FF3 A;  3IFE A;  4G1P A;  1MJ9 A;  3B2Y A;  2ZOF A;  3CDX A;  3K9T A;  3WC7 A;  4NXY A;  1R43 A;  1JWQ A;  4JLY A;  3DSB A;  1TKH A;  2Q0Y A;  5F47 A;  4KUA A;  2Z3N A;  4GM5 A;  4Q36 A;  3D7H A;  3N5F A;  1Q2C A;  2B4B A;  1Z4R A;  3B3T A;  3CPA A;  3KI9 A;  3VWE A;  4KOS A;  3C26 A;  3H4Q A;  4FD7 A;  4OLL A;  4ONW A;  5G1Z A;  4MCR A;  2ATR A;  1A2Z A;  3KZW A;  4HNX B;  2IL4 A;  4K3N A;  1SQH A;  3IWG A;  5LRK A;  2HC9 A;  2HB6 A;  4CGP A;  1QSO A;  1F2O A;  4F9V A;  4MY3 A;  2ZEH A;  4NEX A;  2O53 A;  4A33 A;  4C2X A;  5CPA A;  2NYQ A;  2R1I A;  4YRH A;  1N71 A;  2JEV A;  2K5T A;  3CT9 A;  3PP9 A;  4P4F A;  2FIW A;  4IAV A;  3EY5 A;  3UY5 A;  3DR8 A;  1VHE A;  2P6G A;  2B3V A;  2DPT A;  1S5K A;  3FXT A;  3PGP A;  4UFW A;  4F8Z A;  2YNC A;  3SJE A;  1MJA A;  3KR5 A;  1H8L A;  2FS5 A;  2QJ8 A;  1XMT A;  2BUE A;  2P0W A;  4AVC A;  2PJB A;  3TO7 A;  4MFJ A;  5LYL A;  3FMC A;  3FEE A;  3BI0 A;  4OC4 A;  4UA3 A;  2Z10 A;  2FCK A;  2Z3M A;  4MFZ A;  3PBB A;  3LAC A;  4A38 A;  1CBX A;  2ZEE A;  4I49 A;  2ZEG A;  1LAP A;  3G8W A;  2PVW A;  1I1D A;  1XMB A;  2OOT A;  1BLL E;  3S9M A;  1TIQ A;  4MCS A;  2AFX A;  2YNE A;  4Q38 A;  3PFE A;  2HUZ A;  3W6S A;  4OC5 A;  2OZU A;  3KGQ A;  3TTH A;  4XPL A;  1Z5R A;  2GAN A;  3FJU A;  4PK2 A;  2X7B A;  2CNS A;  4UEE A;  4YGO A;  2FL4 A;  4CYN A;  4ONU A;  4CYQ A;  5JPH A;  1R57 A;  3DDD A;  3SJG A;  1VKC A;  4QUS A;  1R3N A;  1Z8T A;  4YU9 A;  1VIX A;  2VBQ A;  4JD6 A;  1M4I A;  1NSL A;  4OIW A;  2VXK A;  4DJL A;  1P4N A;  4UCN A;  3TO6 A;  3D67 A;  4CAV A;  1S7N A;  1IGB A;  4QBJ A;  4P44 A;  4GS4 A;  3DGV A;  3RYO A;  3VAR A;  2EUI A;  4E2A A;  2OU2 A;  3NE8 A;  4XNH C;  4F0X A;  4PPZ A;  4RS2 A;  4OAD A;  3S6K A;  2Y0M A;  4B12 A;  2PIZ A;  5EBV A;  4PSW A;  3CXS A;  3K9U A;  3B8G A;  2R7H A;  5JM6 A;  4ORF A;  4P4E A;  1Z9U A;  1ZO0 A;  5F09 A;  2O28 A;  3F0A A;  2POK A;  5LYF A;  2ODF A;  1V0C A;  1ZG8 A;  3IJ3 A;  1TXR A;  2I00 A;  2I79 A;  4R3L A;  1AMP A;  2PJ6 A;  2PVV A;  4ZI6 A;  1TF9 A;  1VHS A;  1IYL A;  1PYT B;  2PJ2 A;  4UBR A;  4TWE A;  4E0A A;  3PB6 X;  1XBU A;  2RB7 A;  2AJ6 A;  1RO5 A;  3VH9 A;  4OC0 A;  3FVL A;  4H6U A;  1VHO A;  2QML A;  4C7I A;  4EFD A;  1YRE A;  4CGN A;  4JZ0 A;  2ZXV A;  1BPM A;  2VQY A;  1QSR A;  3EO4 A;  3IU2 A;  4ZBG A;  3EXN A;  1OZP A;  3NA6 A;  3SI2 A;  3NFZ A;  3PB4 X;  1IIC A;  2PCU A;  2PJ7 A;  3D4U A;  5D29 A;  4MBU A;  1RXT A;  4F0Y A;  4CS0 B;  3DNS A;  1Z2L A;  2ZEO A;  3FEC A;  3D7G A;  1I21 A;  5D8N A;  2I3C A;  2NSM A;  4NGT A;  1CJW A;  2EWB A;  1UWY A;  2PE3 A;  4KOV A;  2PRQ A;  3KL9 A;  4KSF A;  5AG6 A;  5AG5 A;  4C2Z A;  2RC4 A;  4ZGY B;  3PB9 X;  3IWW A;  4PXC A;  2D4O A;  4KLV A;  2ZEF A;  5K8N A;  4HKF A;  1LAM A;  1CP7 A;  2ZW5 A;  4JYW A;  5HVH A;  1YR0 A;  1F2P A;  4JJX A;  3RAM A;  3JTK A;  4DUK A;  3JRU A;  2CNT A;  2PRB A;  5EC4 A;  5FVJ A;  2V8H A;  2XEG A;  2GRE A;  4PK3 A;  5ELY A;  2AFW A;  4MY0 A;  3TT2 A;  4MHP A;  3ZZI A;  1TF8 A;  3CPX A;  5E96 A;  2EK8 A;  3SI0 A;  2Q4Y A;  1M4G A;  5KTC A;  2YND A;  4CAX A;  1PUA A;  4ZY2 A;  2A4N A;  4R57 A;  4R87 A;  4EWT A;  3PRT A;  2FSR A;  1JQG A;  3PB7 X;  1KZF A;  4Y49 B;  3TOB A;  4WJB A;  3PB8 X;  2PJA A;  3G3S A;  4PV6 A;  3P2F A;  3S6H A;  3TC8 A;  3W91 A;  1S3Z A;  3IIB A;  4P4D A;  2D4P A;  1XEB A;  3V7Z A;  1YSJ A;  2C6G A;  1I12 A;  1ZLI A;  2PR8 A;  1HDU A;  4NF1 A;  4P45 A;  4UCM A;  4XNH B;  3ZJ0 A;  4B5O A;  2ZEL A;  3GIU A;  5I0C A;  2R8V A;  5GCN A;  3VAT A;  1Q2D A;  3PEI A;  4F9U A;  5I4M A;  2DEA A;  3FYN A;  3R9G A;  2P6E A;  3BXM A;  4OID A;  4R7M A;  4CYP A;  5AG4 A;  5J8F A;  4AG7 A;  2BO9 A;  2ABZ A;  2NMT A;  1TKJ A;  2Z0Z A;  2PJ8 A;  2REE A;  4XPD B;  1Y7E A;  4M6H A;  1HEE A;  2PJ0 A;  5EMI A;  3SXO A;  1IYK A;  2Q4V A;  2QYV A;  4M6I A;  4CRZ B;  1X12 A;  3KQZ A;  4P10 A;  4MJ8 A;  4AVB A;  4FAI A;  2Z3P A;  4KZT A;  5JQ4 A;  3TFY A;  2CTB A;  3WC5 A;  1Y7R A;  1YLE A;  5DWN A;  3D68 A;  3TO9 A;  4FUU A;  1X10 A;  1NMT A;  3RNZ A;  3SHP A;  2XEI A;  3IWE A;  2PJ1 A;  4M3S A;  4H89 A;  1BOB A;  4KSI A;  4M6G A;  4ZYQ A;  4KOW A;  4H6Z A;  4MFQ A;  3MGD A;  4JXR A;  1UFH A;  1FY7 A;  2PC1 A;  4LX9 A;  4CAF A;  4FBE A;  3H8F A;  4ZX9 A;  1ARM A;  4IK2 A;  2GFQ A;  1LCP A;  4U9Z A;  2FE7 A;  4UIA A;  4X8I A;  2DF5 A;  2Q7B A;  5HXD A;  1J4J A;  3H8G A;  4B5P B;  4ZX8 A;  1U6M A;  2PJ5 A;  3KAS A;  4UCP A;  3DR6 A;  5IV0 A;  3TX8 A;  4Y49 C;  5J8C A;  2VI7 A;  4NGP A;  1Y9W A;  4AB7 A;  4BBH A;  3NH8 A;  4BIN A;  1EE3 P;  3RZA A;  1FNO A;  3RO0 A;  1QQ9 A;  3SJF A;  4U9Y A;  4CAW A;  1CPX A;  1KUV A;  3H8E A;  1IY7 A;  2ANP A;  1P0H A;  3B35 A;  3KQX A;  4HNY B;  3BHX A;  4KVX A;  3VWD A;  4FWU A;  2F7V A;  2PR1 A;  2Q44 A;  1S7L A;  4P6Y A;  3PBE A;  2ARH A;  4AVA A;  5HH1 A;  4A94 A;  2V8V A;  4NGM A;  4CAE A;  2ZW4 A;  3I9S A;  4JWP A;  3KHZ A;  4MMO A;  4OC3 A;  4U5Y A;  2FXF A;  4LQG A;  1PCA A;  1WWZ A;  5AG7 A;  3FH4 A;  1GHE A;  4MI4 A;  2AFZ A;  5BWA B;  2BOA A;  3B7I A;  4UIB A;  3ISX A;  1F57 A;  3L2N A;  4XPD C;  2VL1 A;  3FBU A;  3IO1 A;  3H5Z A;  4CYO A;  4MFP A;  4YFJ A;  2DXQ A;  3DLJ A;  3GB0 A;  1XJO A;  4O23 A;  3GYA A;  4JXQ A;  2O4H A;  4OP4 A;  5G22 A;  3D8P A;  1XE4 A;  2EBJ A;  2FIA A;  2V77 A;  3OWC A;  2RFH A;  4HNW B;  4MHY A;  2IMO A;  4R6T A;  1ON0 A;  3FRM A;  2JBJ A;  4RI1 A;  3R96 A;  3SXN A;  1Z8W A;  3CXQ A;  5LYD A;  4P4J A;  4F6A A;  2PIY A;  3S6F A;  2IJZ A;  2PJ9 A;  2ZEM A;  3KKW A;  1YW6 A;  2JEW A;  3GUX A;  3F5B A;  3SI1 A;  5A27 A;  2HV2 A;  3R9F A;  2EK9 A;  1KUX A;  1YME A;  2C27 A;  2J9A A;  3QAH A;  1TKF A;  4KVM E;  5AGE A;  3D3S A;  3MRU A;  4NGQ A;  4LQ6 A;  4A37 A;  3S9L A;  1YQE A;  2C1C A;  2OZH A;  1BO4 A;  4GXH A;  4KOR A;  4J3G A;  4A39 A;  4MXU A;  3MN8 A;  3V38 A;  2J8R A;  2PJ4 A;  1CX8 A;  2GE3 A;  3EC4 A;  3F8K A;  4X2T A;  2FT0 A;  3T90 A;  3B3S A;  4FD4 A;  4AG9 A;  2CNM A;  3GKR A;  4KOU A;  1M4D A;  1Z8L A;  4H2K A;  4L8A A;  2IQ6 A;  3IC1 A;  2P6F A;  2VZY A;  4Q7A A;  2BEI A;  3A9L A;  2QEC A;  4X5K A;  3B3W A;  4B5P A;  4TNU A;  5H84 A;  1M44 A;  2REF A;  3BJ7 A;  2F8H A;  3D7D A;  4P4I A;  4B6Z A;  3ISZ A;  3D66 A;  5LYI A;  2XEF A;  4UF4 A;  3JVN A;  2CXA A;  2B4D B;  5F46 A;  2DPS A;  2Q7S A;  3LD2 A;  5IX3 A;  2OR4 A;  4HPS A;  4QVT A;  1YW4 A;  4R3K A;  2FVG A;  2V8D A;  4B14 A;  3FED A;  3WT4 A;  4NCZ A;  4CGO A;  2B5G B;  5DS0 A;  5G20 A;  4RUH A;  2R98 A;  4CGM A;  4AXV A;  4CPA A;  1MJB A;  4A32 A;  2J8N A;  5J1Q A;  4EVY A;  3NH4 A;  2JBK A;  1M4L A;  4IF5 A;  3CZX A;  1LRZ A;  2ZOG A;  3FB3 A;  3GY9 A;  3B3V A;  4L89 A;  4A2Z A;  5JH9 A;  2ZW7 A;  5IB9 A;  5C82 A;  1YVO A;  1ZLH A;  2GU2 A;  3TCV A;  3IGR A;  4R9M A;  3RBU A;  1NE9 A;  1CG2 A;  2H5M A;  4KSA A;  2HQY A;  2BCO A;  3W6X A;  1LFW A;  1XFO A;  1CP6 A;  3D2P A;  4OC2 A;  2Z3K A;  2WYR A;  4LUA A;  1XF8 A;  3FNC A;  1DE4 C;  2YNC C;  1AUG A;  2PDO A;  4NFR A;  4OKO A;  1YX0 A;  4NGN A;  4M85 A;  5LRG A;  1OBR A;  4UEF A;  4IUS A;  4KOX A;  2KCW A;  2Q43 A;  4WWV A;  4PXD A;  4NJR A;  4UFX A;  1Y0Y A;  4OME A;  4QB9 A;  1DTD A;  4C2Y A;  6CPA A;  1ZG9 A;  3PZJ A;  3R9E A;  3WAB A;  4A31 A;  3JUW A;  2AFU A;  5HVG A;  2PQ8 A;  3I3G A;  1BPN A;  2YGW A;  4X3R A;  1FT7 A;  4FD5 A;  2ZEP A;  2PSW A;  4KS9 A;  3NH5 A;  4W9Y A;  2C6P A;  2AFM A;  3QAY A;  4C68 A;  2JDD A;  3CXP A;  2VZZ A;  1YGH A;  2AFO A;  4MCQ A;  4NSQ A;  2G9D A;  4FD6 A;  3TE4 A;  1M1D A;  2PJC A;  1LAN A;  5CBM A;  5K8M A;  5THW A;  1MK4 A;  3T8W A;  1S7F A;  1QSM A;  3BJ8 A;  2WSA A;  1IB1 E;  4PXB A;  3K2K A;  3FX6 A;  3HLP A;  4NJQ A;  2ZPA A;  3T9Y A;  4UWI A;  3KHX A;  4MCP A;  5K8P A;  2PJ3 A;  5C88 A;  4UEZ A;  1YLO A;  1NSA A;  1XIX A;  2WZN A;  1K4J A;  2QVP A;  2Z3L A;  3LOD A;  4B10 A;  3E0K A;  3KR4 A;  1WK4 A;  1B87 A;  3NE7 A;  3S9N A;  4B11 A;  1IID A;  1YVK A;  1KUY A;  2EO8 A;  2JDC A;  4A30 A;  1IOF A;  2EVN A;  2B4D A;  4PQA A;  5IB0 A;  1AYE A;  2OH1 A;  4DNC A;  3IEH A;  2Q51 A;  2G0B A;  1PU9 A;  3D7F A;  4EME A;  5F48 A;  2B5G A;  1KWM A;  4R8F A;  5KTA A;  3P2H A;  1Z4E A;  4KOY A;  3V8I A;  2G3A A;  1XOV A;  2J8M A;  5JGF A;  4YWY A;  4PXE A;  5ISV A;  1ELM P;  2ZED A;  4XPK A;  4Z65 A;  4KVO E;  4DYO A;  1HDQ A;  3IU1 A;  3WC6 A;  1L0C A;  2B58 A;  2VEZ A;  5F49 A;  4B13 A;  8CPA A;  4C7H A;  4NGR A;  2BSW A;  3LMS A;  1CM0 A;  1CPS A;  3FIX A;  4MHD A;  3WR7 A;  4PSX A;  3HUV A;  5A28 A;  4OAE A;  2AE6 A;  4ZY0 A;  5G21 A;  3R95 A;  4MFK A;  5HVF A;  3S6G A;  2WUU A;  1ZG7 A;  2V8G A;  2XEJ A;  2GLJ A;  1QSN A;  3BLN A;  4IHM A;  4E8O A;  1IU8 A;  3QB8 A;  2CY2 A;  2GIV A;  5H86 A;  5KTD A;  4KLW A;  1B6B A;  4CGL A;  4R76 A;  1BAV A;  2B3U A;  2G3T A;  1XRY A;  1Y9K A;  2CF4 A;  3BI1 A;  1Q2Y A;  3LWU A;  1ARL A;  4KOT A;  4MHN A;  3EFA A;  1QMU A;  4UWJ A;  4ZY1 A;  3GLJ A;  1QST A;  3I1U A;  5HMN A;  5K8O A;  2BL1 A;  2Z11 A;  4RN7 A;  3TOA A;  3N7Z A;  1RTQ A;  2JLM A; 
#chains in the Genus database with same CATH homology
 4UFV A;  4BMH A;  5CNP A;  2OZG A;  3D2M A;  4A95 A;  2F5I A;  4KUB A;  3R1K A;  2Q04 A;  1S60 A;  1S7K A;  2WPW A;  4CRY B;  4K30 A;  2OB0 A;  2ZW6 A;  4II9 A;  4QC6 A;  4MFL A;  2WPX A;  1YK3 A;  2Z3O A;  5DWM A;  2QIR A;  1MJ9 A;  4NXY A;  4JLY A;  3DSB A;  2Q0Y A;  5F47 A;  4KUA A;  2Z3N A;  4Q36 A;  1Q2C A;  2B4B A;  1Z4R A;  3VWE A;  4KOS A;  3C26 A;  3H4Q A;  4FD7 A;  4OLL A;  5G1Z A;  2ATR A;  4HNX B;  2IL4 A;  1SQH A;  3IWG A;  4CGP A;  1QSO A;  4MY3 A;  4A33 A;  4NEX A;  4C2X A;  2R1I A;  4YRH A;  1N71 A;  2JEV A;  2K5T A;  3PP9 A;  2FIW A;  3EY5 A;  3UY5 A;  3DR8 A;  2P6G A;  2B3V A;  2DPT A;  1S5K A;  3FXT A;  3PGP A;  4UFW A;  2YNC A;  1MJA A;  2FS5 A;  1XMT A;  2BUE A;  2P0W A;  4AVC A;  3TO7 A;  4MFJ A;  4UA3 A;  2Z10 A;  2FCK A;  2Z3M A;  4MFZ A;  4I49 A;  3G8W A;  1I1D A;  1TIQ A;  2YNE A;  4Q38 A;  2HUZ A;  3W6S A;  2OZU A;  3TTH A;  4XPL A;  2GAN A;  4PK2 A;  2X7B A;  2CNS A;  4YGO A;  2FL4 A;  4CYN A;  4ONU A;  4CYQ A;  5JPH A;  1R57 A;  3DDD A;  1VKC A;  4QUS A;  2VBQ A;  4JD6 A;  1M4I A;  1NSL A;  2VXK A;  1P4N A;  4UCN A;  3TO6 A;  4CAV A;  1S7N A;  4QBJ A;  4GS4 A;  3RYO A;  2EUI A;  4E2A A;  2OU2 A;  4XNH C;  4F0X A;  4RS2 A;  4OAD A;  3S6K A;  2Y0M A;  4B12 A;  5EBV A;  4PSW A;  3CXS A;  3K9U A;  3B8G A;  2R7H A;  4ORF A;  1Z9U A;  1ZO0 A;  2O28 A;  3F0A A;  1V0C A;  2I00 A;  2I79 A;  4R3L A;  5F46 A;  1VHS A;  4UBR A;  1IYL A;  4E0A A;  2AJ6 A;  1RO5 A;  4H6U A;  2QML A;  4C7I A;  1YRE A;  4CGN A;  2ZXV A;  2VQY A;  3IU2 A;  1QSR A;  3EO4 A;  4ZBG A;  3EXN A;  1OZP A;  1IIC A;  4MBU A;  1RXT A;  4F0Y A;  4CS0 B;  3DNS A;  1I21 A;  1CJW A;  4KSF A;  4KOV A;  5AG6 A;  5AG5 A;  4C2Z A;  2RC4 A;  4ZGY B;  2D4O A;  4KLV A;  4HKF A;  2ZW5 A;  1YR0 A;  4JJX A;  3JTK A;  2CNT A;  2PRB A;  5EC4 A;  5FVJ A;  4PK3 A;  4MY0 A;  3TT2 A;  3ZZI A;  5E96 A;  2Q4Y A;  1M4G A;  5KTC A;  2YND A;  4CAX A;  1PUA A;  2A4N A;  4R57 A;  4R87 A;  2FSR A;  1KZF A;  4Y49 B;  3TOB A;  3S6H A;  3G3S A;  4PV6 A;  3P2F A;  3W91 A;  1S3Z A;  2D4P A;  1XEB A;  1I12 A;  2PR8 A;  4NF1 A;  4UCM A;  4XNH B;  3ZJ0 A;  4B5O A;  5I0C A;  2R8V A;  5GCN A;  1Q2D A;  3FYN A;  3R9G A;  2P6E A;  4CYP A;  5AG4 A;  5J8F A;  4AG7 A;  2NMT A;  2Z0Z A;  2REE A;  4XPD B;  3SXO A;  1IYK A;  2Q4V A;  4CRZ B;  4MJ8 A;  4AVB A;  2Z3P A;  4KZT A;  5JQ4 A;  3TFY A;  1Y7R A;  1YLE A;  5DWN A;  3TO9 A;  1NMT A;  3SHP A;  3IWE A;  4M3S A;  4H89 A;  1BOB A;  4KOW A;  4H6Z A;  4MFQ A;  3MGD A;  4JXR A;  1UFH A;  1FY7 A;  2PC1 A;  4LX9 A;  4CAF A;  3TE4 A;  4U9Z A;  2FE7 A;  2Q7B A;  1J4J A;  4B5P B;  1U6M A;  4UCP A;  3DR6 A;  5IV0 A;  4Y49 C;  5J8C A;  2VI7 A;  1Y9W A;  4AB7 A;  4BBH A;  4CAW A;  4U9Y A;  1KUV A;  4KVX A;  4HNY B;  1P0H A;  3VWD A;  2Q44 A;  2PR1 A;  1S7L A;  2ARH A;  4AVA A;  5HH1 A;  4CAE A;  2ZW4 A;  3I9S A;  4JWP A;  4U5Y A;  2FXF A;  1WWZ A;  5AG7 A;  1GHE A;  4MI4 A;  5BWA B;  4XPD C;  4CYO A;  3FBU A;  3H5Z A;  4MFP A;  4YFJ A;  2DXQ A;  3GYA A;  4JXQ A;  5G22 A;  3D8P A;  1XE4 A;  4HNW B;  2FIA A;  3OWC A;  1ON0 A;  3FRM A;  4RI1 A;  3R96 A;  3SXN A;  3CXQ A;  4F6A A;  3S6F A;  3KKW A;  3F5B A;  5A27 A;  2HV2 A;  3R9F A;  1KUX A;  2C27 A;  3QAH A;  4KVM E;  5AGE A;  3D3S A;  2OZH A;  4KOR A;  1BO4 A;  4J3G A;  2J8R A;  2GE3 A;  3EC4 A;  3F8K A;  2FT0 A;  3T90 A;  4FD4 A;  4AG9 A;  2CNM A;  3GKR A;  4KOU A;  1M4D A;  4L8A A;  2P6F A;  2VZY A;  2BEI A;  3A9L A;  2QEC A;  4X5K A;  4B5P A;  5H84 A;  1M44 A;  2REF A;  3BJ7 A;  3JVN A;  2CXA A;  2B4D B;  2DPS A;  3LD2 A;  5IX3 A;  4QVT A;  4R3K A;  4B14 A;  4NCZ A;  4CGO A;  2B5G B;  5G20 A;  2R98 A;  4CGM A;  1MJB A;  4A32 A;  2J8N A;  4EVY A;  4IF5 A;  4L89 A;  1LRZ A;  3FB3 A;  3GY9 A;  4A2Z A;  2ZW7 A;  5C82 A;  1YVO A;  3TCV A;  3IGR A;  4R9M A;  1NE9 A;  2H5M A;  4KSA A;  2HQY A;  3W6X A;  3D2P A;  2Z3K A;  4LUA A;  1XF8 A;  3FNC A;  2YNC C;  2PDO A;  1YX0 A;  4M85 A;  4IUS A;  4KOX A;  2KCW A;  4UFX A;  4QB9 A;  4C2Y A;  3R9E A;  3PZJ A;  4A31 A;  3JUW A;  2PQ8 A;  3I3G A;  2YGW A;  4FD5 A;  4KS9 A;  2PSW A;  4C68 A;  2JDD A;  3CXP A;  2VZZ A;  1YGH A;  4NSQ A;  4FD6 A;  1M1D A;  1MK4 A;  1S7F A;  1QSM A;  3BJ8 A;  2WSA A;  1IB1 E;  3T9Y A;  2ZPA A;  4UWI A;  5C88 A;  1XIX A;  1K4J A;  2Z3L A;  3LOD A;  4B10 A;  3E0K A;  1WK4 A;  1B87 A;  3NE7 A;  4B11 A;  1IID A;  1YVK A;  1KUY A;  2JDC A;  4A30 A;  2EVN A;  2B4D A;  5IB0 A;  2OH1 A;  4DNC A;  2G0B A;  1PU9 A;  5F48 A;  2B5G A;  5KTA A;  3P2H A;  1Z4E A;  4KOY A;  3V8I A;  2G3A A;  2J8M A;  5ISV A;  4XPK A;  4KVO E;  3IU1 A;  1L0C A;  2B58 A;  2VEZ A;  5F49 A;  4B13 A;  4C7H A;  2BSW A;  1CM0 A;  3FIX A;  4MHD A;  3WR7 A;  4PSX A;  5A28 A;  4OAE A;  2AE6 A;  5G21 A;  3R95 A;  4MFK A;  3S6G A;  2WUU A;  1QSN A;  3BLN A;  4E8O A;  3QB8 A;  2CY2 A;  2GIV A;  5H86 A;  5KTD A;  4KLW A;  1B6B A;  4CGL A;  2B3U A;  2G3T A;  1Y9K A;  1Q2Y A;  4KOT A;  3EFA A;  4UWJ A;  1QST A;  5HMN A;  2BL1 A;  2Z11 A;  3TOA A;  3N7Z A;  2JLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...