4KOUA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with cefixime
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
159
structure length
159
Chain Sequence
MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structural, Functional, and Inhibition Studies of a Gcn5-related N-Acetyltransferase (GNAT) Superfamily Protein PA4794: A NEW C-TERMINAL LYSINE PROTEIN ACETYLTRANSFERASE FROM PSEUDOMONAS AERUGINOSA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 45
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2013-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4kouA00
4H6UA 4E8OA 4KOXA 4KVME 4LUAA 4KZTA 2IL4A 4KOTA 1M1DA 4JXQA 2VZYA 1S60A 1YVOA 3ZZIA 3D2PA 3CXPA 4KVXA 3R96A 4KLVA 1RO5A 5IV0A 4E2AA 3DDDA 2EVNA 3QAHA 4Y49C 3CXSA 5EC4A 3UY5A 4CAVA 3DR6A 2D4OA 2B4BA 2P6GA 2Q4YA 3C26A 4XPDB 2OB0A 3W6SA 2H5MA 1S7FA 4BMHA 5KTDA 2EUIA 2NMTA 4IUSA 1M4DA 1YGHA 2Q4VA 4XPKA 4F0YA 2BEIA 1S7KA 3V8IA 3TO7A 2PC1A 2FT0A 4B5OA 4MI4A 2OZUA 4UWIA 4XPDC 2P0WA 1XE4A 2CNSA 1XIXA 1J4JA 2J8NA 4KVOE 2G0BA 4UBRA 1LRZA 2JLMA 1QSTA 1KUXA 2OZGA 3E0KA 2FSRA 4MHDA 3EFAA 3SXNA 3LODA 4QUSA 2VBQA 2CY2A 3JUWA 4YFJA 5JPHA 3S6FA 4B5PB 2Y0MA 4ZBGA 1P0HA 2R1IA 4FD7A 2PSWA 2FL4A 5J8CA 5F47A 3EY5A 5DWNA 1NMTA 4AVAA 4JJXA 1MJBA 4FD5A 1IYLA 4OAEA 1PU9A 4R87A 2VI7A 2Q04A 1ON0A 1WK4A 1L0CA 2R7HA 4EVYA 3FIXA 3TOAA 4II9A 2PRBA 1U6MA 3GY9A 1YK3A 3DSBA 2HQYA 4J3GA 1Y9KA 3R1KA 2WPXA 1KZFA 4KUBA 1YLEA 4PSXA 4AG7A 4KOYA 1MJ9A 2K5TA 1Y7RA 2B58A 3TE4A 1S3ZA 1XMTA 2GE3A 4FD6A 4U9YA 4H6ZA 2Q0YA 1UFHA 5F49A 3QB8A 2B5GA 1YX0A 2AJ6A 4QVTA 2ARHA 2BL1A 5CNPA 4ONUA 5FVJA 4JLYA 4YGOA 3TOBA 4KOSA 3IWGA 1QSRA 3I9SA 2JDDA 5H86A 5HH1A 1S7LA 3PGPA 2G3AA 1Q2DA 3LD2A 4PK2A 2Z0ZA 4KOUA 2ZPAA 4KORA 3G3SA 4U5YA 2JDCA 2ZXVA 4HNYB 2HUZA 3P2HA 2VQYA 2B4DB 1PUAA 2WPWA 1M4IA 2REEA 4NSQA 5C82A 2PR1A 3VWEA 2QMLA 2BSWA 4QB9A 2VXKA 2I79A 1Q2YA 3I3GA 3DR8A 1IICA 2Q44A 4CS0B 1NSLA 4PSWA 1FY7A 2HV2A 2B3UA 2X7BA 2DXQA 4KUAA 3R95A 3NE7A 2PQ8A 2KCWA 3D2MA 3F0AA 2REFA 4I49A 5GCNA 2Z11A 2B4DA 4RS2A 1P4NA 1GHEA 3TO9A 3CXQA 4K30A 2ZW5A 2ZW4A 3G8WA 2F5IA 4MY0A 3FB3A 3T90A 3TTHA 4UA3A 3SHPA 3PZJA 1RXTA 4MJ8A 3WR7A 4MY3A 4IF5A 5I0CA 3MGDA 1IB1E 3N7ZA 4KLWA 2GANA 1MJAA 3VWDA 1QSNA 3BJ7A 1BO4A 5ISVA 1MK4A 4L89A 4LX9A 1Z4RA 2FE7A 4B5PA 3K9UA 4CRZB 2CNTA 1S5KA 4XNHB 5IB0A 5F48A 4HNXB 2AE6A 2ZW7A 2O28A 2Q7BA 1I21A 4NF1A 4M85A 1CM0A 4GS4A 3D8PA 1Z4EA 2R8VA 3ZJ0A 4X5KA 1I1DA 3FRMA 2OU2A 1YREA 4NEXA 3IGRA 4CRYB 5H84A 5KTCA 1Q2CA 3TO6A 3R9EA 1TIQA 2QECA 2J8MA 2BUEA 3KKWA 4H89A 1N71A 3JVNA 4CAWA 2OZHA 2I00A 1V0CA 1SQHA 1Y9WA 1Z9UA 3SXOA 3TT2A 5DWMA 3S6GA 1XEBA 4JD6A 4Y49B 4OADA 2D4PA 2FIWA 3TFYA 2P6EA 4HKFA 1KUVA 3EO4A 4R9MA 2ZW6A 1YR0A 2Z10A 3EXNA 5IX3A 4JXRA 2FIAA 3OWCA 5F46A 4MBUA 4CAXA 1IYKA 1M44A 3TCVA 2FXFA 4R3KA 4YRHA 2FS5A 3W6XA 3EC4A 4F6AA 2PDOA 2VZZA 2C27A 1CJWA 1QSMA 2QIRA 1M4GA 4UWJA 2FCKA 1NE9A 3F5BA 1B6BA 3R9GA 2VEZA 1XF8A 3FBUA 1S7NA 1K4JA 4NXYA 3B8GA 2OH1A 3GKRA 1IIDA 4L8AA 4QBJA 1B87A 5J8FA 4E0AA 4QC6A 2JEVA 3RYOA 3D3SA 4FD4A 3PP9A 1KUYA 5C88A 3T9YA 3W91A 3R9FA 3S6HA 4R57A 5JQ4A 3BJ8A 1I12A 3FYNA 1R57A 4ORFA 2CNMA 3F8KA 3BLNA 4DNCA 1VHSA 2G3TA 2R98A 4JWPA 1BOBA 3DNSA 4PK3A 2P6FA 4PV6A 3FNCA 2ATRA 5HMNA 1OZPA 4AVBA 1VKCA 2A4NA 2GIVA 4KOVA 4R3LA 4M3SA 2J8RA 4KOWA 5KTAA 2B3VA 1YVKA 4XNHC 4XPLA 1WWZA 4RI1A 3H4QA 4AG9A 3S6KA 4AVCA 3GYAA 2RC4A 3P2FA 5EBVA 2B5GB 4AB7A 2PR8A 3FXTA 5E96A 4OLLA 4HNWB 1QSOA 4U9ZA 4NCZA
chains in the Genus database with same CATH superfamily
4H6UA 4E8OA 4KOXA 3FH4A 4UF4A 4KVME 4AXVA 4LUAA 2GFQA 4KZTA 2IL4A 4KOTA 2J9AA 1M1DA 3QNVA 2BCOA 2PJ9A 1XMBA 4JXQA 2VZYA 1S60A 4ZY0A 1YVOA 3ZZIA 1XFOA 4MFKA 2AFSA 2DPSA 3H8EA 3D2PA 3CXPA 2QJ8A 5AG4A 4KVXA 2C6CA 3R96A 3LACA 3B3CA 1RO5A 4KLVA 5K8OA 4UCMA 3FF3A 5IV0A 3N5FA 4E2AA 3DDDA 2EVNA 3QAHA 4Y49C 1IU8A 2ZEDA 1X12A 3CXSA 5EC4A 4UFVA 3UY5A 4CAVA 4CPAA 3DR6A 1XOVA 2D4OA 2B4BA 2P6GA 2Q4YA 3C26A 2Z3PA 3GUXA 4IHMA 2JBKA 1PCAA 4CYOA 3B3VA 4XPDB 3PRTA 5D8NA 2OB0A 3CDXA 3W6SA 2H5MA 1S7FA 3V7ZA 4NGPA 4BMHA 5KTDA 4KSFA 1JWQA 2EUIA 2NMTA 2V8GA 4IUSA 4Q38A 5HVGA 1M4DA 1YGHA 2Q4VA 2PE3A 3D68A 3NH4A 4XPKA 4F0YA 2BEIA 3H8GA 2NSMA 1S7KA 3V8IA 3TO7A 1F2OA 1Z8LA 2AFWA 3RO0A 2ABZA 5THWA 2PC1A 4LQGA 2FT0A 4WJBA 5JGFA 4UFXA 4B5OA 1BAVA 4MI4A 4DUKA 2OZUA 4EMEA 4UWIA 3IFEA 2C6GA 4XPDC 2P0WA 1LCPA 4OC3A 3KR5A 1XE4A 5EMIA 1NSAA 2CNSA 2PCUA 2ZOGA 5LYLA 2AFMA 1XIXA 1J4JA 4A95A 1ELLP 2PJ1A 4X3RA 2J8NA 1XJOA 3KL9A 3MRUA 4KVOE 5D29A 4K3NA 2G0BA 4UBRA 1LRZA 2JLMA 1QSTA 3PFOA 1BPNA 1KUXA 2DF5A 2OZGA 3E0KA 3RAMA 3KQZA 5LRJA 2CIJA 1VHOA 2FSRA 4MHDA 8CPAA 3EFAA 3PBBA 2IJZA 3SXNA 3IU1A 4MXUA 3LODA 4QUSA 3BHXA 3CPXA 2VBQA 4GM5A 2CY2A 3JUWA 4YFJA 1JQGA 5JPHA 4MMOA 1KWMA 3S6FA 3KASA 4B5PB 2Y0MA 4ZBGA 4OC2A 2ZEFA 4OC0A 1P0HA 2CTCA 2R1IA 2PJAA 1Z2LA 2F8HA 1LANA 1ZO0A 4FD7A 3CZXA 1YMEA 2PSWA 1ARLA 4C68A 2FL4A 5J8CA 5F47A 3NH5A 5ELYA 4F8ZA 2ANPA 3EY5A 5DWNA 4CYPA 1NMTA 4P44A 4AVAA 2BO9A 4JJXA 5CPAA 1MJBA 1VIXA 3PB9X 4FD5A 1IYLA 2GLJA 2VL1A 4OAEA 1PU9A 4NFRA 4R87A 5LRGA 2O53A 6CPAA 2VI7A 4KSIA 5CBMA 2Q04A 3IEHA 3TC8A 1ON0A 2EO8A 4YU9A 3V38A 1WK4A 1L0CA 3FMCA 2R7HA 1PYTB 4EVYA 3FIXA 4PPZA 3TOAA 4P45A 4II9A 2PRBA 2Z3LA 1U6MA 3GY9A 2EBJA 4DYOA 1YK3A 4CGNA 1VHEA 3DSBA 2YNCA 2PJ2A 2HQYA 3D7GA 3K2KA 2YNCC 4J3GA 3I1UA 4B6ZA 1Y9KA 4KS9A 4FAIA 3R1KA 2PIYA 1KZFA 2WPXA 4KUBA 4R7MA 1YLEA 4BD9A 3DLJA 4PSXA 4AG7A 4C7IA 4HPSA 3KHXA 1MJ9A 4KOYA 3WC5A 2EK8A 5A28A 2K5TA 2F7VA 3SI0A 2FVGA 4Q36A 1Y7RA 2V77A 4JZ0A 2B58A 1YW6A 3KHZA 4WWVA 1S3ZA 3RZAA 1XMTA 3TE4A 2GE3A 4FD6A 4U9YA 1YSJA 5AGEA 1Z8WA 5HVHA 4H6ZA 2Q0YA 1UFHA 4PQAA 3NH8A 3BI1A 2C6PA 3D67A 5F49A 4NJRA 2CTBA 3QB8A 1ZG7A 2B5GA 3JTKA 1YX0A 2AJ6A 1M4LA 4IK2A 1HDQA 4P4DA 4QVTA 5LYIA 1ZG9A 2ARHA 5LRKA 2BL1A 5CNPA 4ONUA 2QVPA 5FVJA 4JLYA 4YGOA 1TKJA 3FVLA 3TOBA 4Z65A 4KOSA 3IWGA 1QSRA 4W9YA 2PVVA 4TNUA 3I9SA 1CG2A 3QAYA 4A30A 4B10A 2Q51A 5K8PA 4C2ZA 2JDDA 1QMUA 5H86A 5HH1A 1F57A 1UWYA 1QQ9A 1YQEA 2AFZA 4OKOA 4ZX8A 3RBUA 4A38A 5IB9A 1S7LA 3PGPA 4P6YA 2G3AA 3PB4X 4CGLA 4MFLA 1Q2DA 4C2YA 4B13A 3LD2A 4PK2A 3D7HA 5K8MA 3GB0A 2PJ6A 4MFQA 2Z0ZA 4KOUA 2ZPAA 3IWWA 4KORA 4B12A 3G3SA 3B2YA 4U5YA 2CF4A 2AFOA 2JDCA 2ZXVA 4HNYB 2HUZA 1EE3P 4PXCA 3P2HA 2VQYA 2Q4ZA 2B4DB 4O23A 1PUAA 2WPWA 1M4IA 1BPMA 2REEA 2YGWA 2PR1A 3PB8X 4NSQA 2QMLA 3VWEA 2BSWA 5C82A 3NE8A 4QB9A 2VXKA 1CPXA 1Q2YA 2I79A 3I3GA 3DR8A 1IICA 2Q44A 2I3CA 2PJ4A 4CS0B 2XEIA 1NSLA 4PSWA 1FY7A 3SJGA 2HV2A 2B3UA 3B35A 2WZNA 2HC9A 2DXQA 2IMOA 2X7BA 4KUAA 4GXHA 5LYDA 3R95A 3NE7A 2PQ8A 3B3SA 4MRIA 2EK9A 4JYWA 1TXRA 2KCWA 4MHNA 3D2MA 3F0AA 2REFA 4I49A 4UIAA 1CPSA 2Z11A 5GCNA 2B4DA 4A32A 2Q7SA 4RS2A 1HDUA 1P4NA 1GHEA 3TO9A 3FEDA 2OR4A 3CXQA 4NGMA 1TF8A 2Z3NA 3H8FA 3PEIA 4K30A 3FX6A 2ZW5A 2PJ8A 3T8WA 2ZW4A 3G8WA 2F5IA 4MY0A 3FB3A 4M6HA 3T90A 3TTHA 4UA3A 4MFZA 3SHPA 3PZJA 1RXTA 1Z8XA 4MJ8A 3WR7A 2IQ6A 4MY3A 4IF5A 4A39A 5I0CA 3MGDA 4UCNA 1IB1E 3N7ZA 1Y7EA 1YLOA 4KLWA 4FUUA 3K9TA 2GANA 2NYQA 1MJAA 1FT7A 4MFPA 4P4EA 4R76A 4TWEA 3VWDA 1QSNA 3BJ7A 3PB7X 4R8FA 1BO4A 5ISVA 1MK4A 4OC5A 4L89A 4LX9A 1Z4RA 2FE7A 4MHPA 4B5PA 3FEEA 3K9UA 4CRZB 4UEEA 2WYRA 2CNTA 2Q43A 4C2XA 5LYFA 1S5KA 3GLJA 1GYTA 4XNHB 5IB0A 5F48A 1R3NA 4HNXB 3LMSA 3CT9A 2AE6A 5BWAB 5JM6A 1XRYA 1DE4C 3B3TA 4MFJA 4P4IA 2ZW7A 1DTDA 2V8DA 2DEAA 4YWYA 5I4MA 2O28A 2Q7BA 1I21A 4NF1A 2GLFA 1CM0A 4GS4A 4M85A 1F2PA 3D8PA 1Z4EA 4OIWA 4ZY1A 1HEEA 2R8VA 2Z3OA 4R6TA 5K8NA 3ZJ0A 4ZI6A 5AG7A 1VGYA 4C7HA 3GIUA 1TF9A 4X5KA 4NGTA 1I1DA 3FRMA 1ZLIA 1YREA 2OU2A 4NEXA 3SJFA 3IGRA 3IIBA 4CRYB 2C1CA 1ARMA 5H84A 4A31A 5KTCA 1Q2CA 3SJEA 3TO6A 3R9EA 5JH9A 1TIQA 2QECA 1OBRA 2J8MA 2BUEA 3IJ3A 3B3WA 3KGQA 3KZWA 5J1QA 3S9NA 3KKWA 1XBUA 2RFHA 3WT4A 2XEFA 3L2NA 3VH9A 3S9MA 4H89A 4OIDA 1N71A 1ZG8A 3JVNA 1IOFA 2OZHA 2I00A 4CAWA 4CGMA 1V0CA 1SQHA 3WABA 1Y9WA 1Z9UA 3SXOA 4ZY2A 3TT2A 5DWMA 3S6GA 1XEBA 4JD6A 4Y49B 2O4HA 3WC7A 4OADA 4UCPA 2D4PA 4NGRA 3MN8A 4ZX9A 3NA6A 2FIWA 3TFYA 2P6EA 4CYQA 3WC6A 4HKFA 1KUVA 3EO4A 2XEGA 4B14A 4R9MA 2ZW6A 2EWBA 3D7DA 1YR0A 4B11A 4P4JA 3KQXA 3FECA 2Z10A 3EXNA 2ZEHA 5IX3A 3NFZA 4OC1A 4JXRA 4MCQA 4X8IA 3HUVA 2FIAA 3OWCA 5F46A 4MBUA 4CAXA 1IYKA 1M44A 2POKA 4FWUA 3TCVA 2FXFA 4A33A 3DGVA 1Y0YA 1ZLHA 5HVFA 2DPTA 4RUHA 4R3KA 2GU2A 2QYVA 1CP7A 3A9LA 2AFXA 4DJLA 3LWUA 4YRHA 4A2ZA 4NJQA 4UIBA 2FS5A 3SI1A 3B7IA 3W6XA 4CAFA 2AFUA 3EC4A 4MHZA 4BBHA 4OMEA 4F6AA 4P4FA 3BI0A 1LAMA 2PDOA 4M6GA 4MCPA 2VZZA 3S9LA 3IO1A 4M6IA 2Z3KA 2C27A 4IAVA 1CJWA 1QSMA 4NGQA 2QIRA 1M4GA 4UWJA 2ZEPA 2FCKA 4CGPA 3IU2A 2XEJA 2PJCA 4X2TA 1NE9A 2JBJA 4BINA 3F5BA 1B6BA 3R9GA 2ZEOA 1Y0RA 4ONWA 5F09A 3PFEA 2ODFA 4G1PA 2VEZA 1XF8A 3IWEA 3TX8A 3FBUA 1S7NA 1K4JA 2CXAA 4LQ6A 4NXYA 1TKFA 2ZELA 3B8GA 2OH1A 2ZEMA 2V8VA 3GKRA 4CGOA 4NGSA 1IIDA 2PJ0A 4L8AA 4QBJA 2G9DA 1B87A 1CX8A 1R43A 5AG5A 4H2KA 4NGNA 4ZYQA 3RNZA 1BLLE 2PJ5A 5J8FA 4E0AA 4QC6A 1X10A 4F0XA 2JEVA 3RYOA 2JEWA 1H8LA 2ZOFA 4MCSA 2Z3MA 3D3SA 1AYEA 4FD4A 3PP9A 1KUYA 4P4BA 5AG6A 5C88A 3T9YA 3W91A 4CAEA 3R9FA 1RTQA 2WUUA 1LFWA 3S6HA 5G22A 4R57A 5JQ4A 3FJUA 3BJ8A 3PB6X 1I12A 4KSAA 1CBXA 2OOTA 2PJBA 3FYNA 1AMPA 1ELMP 4A37A 2PVWA 2ZEEA 1R57A 3IC1A 2YNEA 2PIZA 4ORFA 2CNMA 3F8KA 3BLNA 3JRUA 4DNCA 1VHSA 4OC4A 1IGBA 5DS0A 4PXBA 2YNDA 3VARA 2G3TA 4A94A 2R98A 4EWTA 4JWPA 4Q7AA 2GREA 1BOBA 4PXDA 5G21A 4CYNA 4ZGYB 1FNOA 3DNSA 3KR4A 3H5ZA 4PK3A 2P6FA 3BXMA 4PV6A 1A2ZA 1LOKA 1CP6A 3FNCA 1AUGA 2PJ3A 2V8HA 3ISXA 5A27A 2ATRA 4EFDA 3KI9A 3D66A 5HMNA 2RB7A 2ZEGA 4PXEA 1OZPA 4UEZA 4AVBA 3SJXA 3SI2A 1VKCA 4UFWA 4MCRA 5HXDA 2A4NA 3D4UA 4F9UA 2GIVA 4KOVA 4R3LA 7CPAA 1YW4A 4M3SA 2J8RA 4KOWA 5KTAA 2B3VA 2PRQA 1IOIA 1YVKA 4XNHC 1Z5RA 4FBEA 2BOAA 1Z8TA 4F9VA 1IY7A 4XPLA 2HB6A 1WWZA 4RI1A 3H4QA 3PBEA 4AG9A 5G1ZA 3ISZA 4UEFA 4P10A 3VATA 1LAPA 3S6KA 4RN7A 4AVCA 3GYAA 2RC4A 3P2FA 4OP4A 5EBVA 5G20A 2B5GB 4AB7A 2PR8A 3FXTA 2WSAA 2ZENA 4MHYA 1Q7LA 1TKHA 3D7FA 3HLPA 5E96A 4OLLA 4HNWB 1QSOA 4U9ZA 3CPAA 2PJ7A 4NCZA
chains in the Genus database with same CATH topology
4H6UA 4E8OA 4KOXA 4KVME 4LUAA 4KZTA 2IL4A 4KOTA 1M1DA 4JXQA 2VZYA 1S60A 1YVOA 3ZZIA 4MFKA 2DPSA 3D2PA 3CXPA 5AG4A 4KVXA 3R96A 4KLVA 1RO5A 4UCMA 5IV0A 4E2AA 3DDDA 2EVNA 3QAHA 4Y49C 3CXSA 5EC4A 4UFVA 3UY5A 4CAVA 3DR6A 2D4OA 2B4BA 2P6GA 2Q4YA 3C26A 2Z3PA 4CYOA 4XPDB 2OB0A 3W6SA 2H5MA 1S7FA 4BMHA 5KTDA 4KSFA 2EUIA 2NMTA 4IUSA 4Q38A 1M4DA 1YGHA 2Q4VA 4XPKA 4F0YA 2BEIA 1S7KA 3V8IA 3TO7A 2PC1A 2FT0A 4UFXA 4B5OA 4MI4A 2OZUA 4UWIA 4XPDC 2P0WA 1XE4A 2CNSA 1XIXA 1J4JA 4A95A 2J8NA 4KVOE 2G0BA 4UBRA 1LRZA 2JLMA 1QSTA 1KUXA 2OZGA 3E0KA 2FSRA 4MHDA 3EFAA 3SXNA 3IU1A 3LODA 4QUSA 2VBQA 2CY2A 3JUWA 4YFJA 5JPHA 3S6FA 4B5PB 2Y0MA 4ZBGA 1P0HA 2R1IA 4FD7A 1ZO0A 2PSWA 4C68A 2FL4A 5J8CA 5F47A 3EY5A 5DWNA 4CYPA 1NMTA 4AVAA 4JJXA 1MJBA 4FD5A 1IYLA 4OAEA 1PU9A 4R87A 2VI7A 2Q04A 1ON0A 1WK4A 1L0CA 2R7HA 4EVYA 3FIXA 3TOAA 4II9A 2PRBA 2Z3LA 1U6MA 3GY9A 1YK3A 4CGNA 3DSBA 2YNCA 2HQYA 2YNCC 4J3GA 1Y9KA 4KS9A 3R1KA 2WPXA 1KZFA 4KUBA 1YLEA 4PSXA 4AG7A 4C7IA 4KOYA 1MJ9A 5A28A 2K5TA 4Q36A 1Y7RA 2B58A 3TE4A 1S3ZA 1XMTA 2GE3A 4FD6A 4U9YA 5AGEA 4H6ZA 2Q0YA 1UFHA 5F49A 3QB8A 2B5GA 3JTKA 1YX0A 2AJ6A 4QVTA 2ARHA 2BL1A 5CNPA 4ONUA 5FVJA 4JLYA 4YGOA 3TOBA 4KOSA 3IWGA 1QSRA 3I9SA 4A30A 4B10A 4C2ZA 2JDDA 5H86A 5HH1A 1S7LA 3PGPA 2G3AA 4CGLA 4MFLA 1Q2DA 4C2YA 4B13A 3LD2A 4PK2A 4MFQA 2Z0ZA 4KOUA 2ZPAA 4KORA 4B12A 3G3SA 4U5YA 2JDCA 2ZXVA 4HNYB 2HUZA 3P2HA 2VQYA 2B4DB 1PUAA 2WPWA 1M4IA 2REEA 4NSQA 2YGWA 2PR1A 3VWEA 5C82A 2QMLA 2BSWA 4QB9A 2VXKA 2I79A 1Q2YA 3I3GA 3DR8A 1IICA 2Q44A 4CS0B 1NSLA 4PSWA 1FY7A 2HV2A 2B3UA 2X7BA 2DXQA 4KUAA 3R95A 3NE7A 2PQ8A 2KCWA 3D2MA 3F0AA 2REFA 4I49A 5GCNA 2Z11A 4A32A 2B4DA 4RS2A 1P4NA 1GHEA 3TO9A 3CXQA 2Z3NA 4K30A 2ZW5A 2ZW4A 3G8WA 2F5IA 4MY0A 3FB3A 3T90A 3TTHA 4UA3A 4MFZA 3SHPA 3PZJA 1RXTA 4MJ8A 3WR7A 4MY3A 4IF5A 5I0CA 3MGDA 4UCNA 1IB1E 3N7ZA 4KLWA 2GANA 1MJAA 4MFPA 3VWDA 1QSNA 3BJ7A 1BO4A 5ISVA 1MK4A 4L89A 4LX9A 1Z4RA 2FE7A 4B5PA 3K9UA 4CRZB 2CNTA 4C2XA 1S5KA 4XNHB 5IB0A 5F48A 4HNXB 5BWAB 2AE6A 4MFJA 2ZW7A 2O28A 2Q7BA 1I21A 4NF1A 1CM0A 4GS4A 4M85A 3D8PA 1Z4EA 2R8VA 2Z3OA 3ZJ0A 5AG7A 4C7HA 4X5KA 1I1DA 3FRMA 2OU2A 1YREA 4NEXA 3IGRA 4CRYB 5H84A 4A31A 5KTCA 1Q2CA 3TO6A 3R9EA 1TIQA 2QECA 2J8MA 2BUEA 3KKWA 4H89A 1N71A 3JVNA 4CAWA 2OZHA 2I00A 4CGMA 1V0CA 1SQHA 1Y9WA 1Z9UA 3SXOA 3TT2A 5DWMA 3S6GA 1XEBA 4JD6A 4Y49B 4OADA 4UCPA 2D4PA 2FIWA 3TFYA 2P6EA 4CYQA 4HKFA 1KUVA 3EO4A 4B14A 4R9MA 2ZW6A 1YR0A 4B11A 2Z10A 3EXNA 5IX3A 4JXRA 2FIAA 3OWCA 5F46A 4MBUA 4CAXA 1IYKA 1M44A 3TCVA 2FXFA 4A33A 2DPTA 4R3KA 3A9LA 4YRHA 4A2ZA 4CAFA 2FS5A 3W6XA 3EC4A 4BBHA 4F6AA 2PDOA 2VZZA 2Z3KA 2C27A 1CJWA 1QSMA 2QIRA 1M4GA 4UWJA 2FCKA 4CGPA 3IU2A 1NE9A 3F5BA 1B6BA 3R9GA 2VEZA 1XF8A 3IWEA 3FBUA 1S7NA 1K4JA 2CXAA 4NXYA 3B8GA 2OH1A 3GKRA 4CGOA 1IIDA 4L8AA 4QBJA 1B87A 5AG5A 5J8FA 4E0AA 4QC6A 4F0XA 2JEVA 3RYOA 2Z3MA 3D3SA 4FD4A 3PP9A 1KUYA 5AG6A 5C88A 3T9YA 3W91A 4CAEA 3R9FA 2WUUA 3S6HA 5G22A 4R57A 5JQ4A 3BJ8A 4KSAA 1I12A 3FYNA 1R57A 2YNEA 4ORFA 2CNMA 3F8KA 3BLNA 4DNCA 1VHSA 2YNDA 2G3TA 2R98A 4JWPA 1BOBA 5G21A 4CYNA 4ZGYB 3DNSA 3H5ZA 4PK3A 2P6FA 4PV6A 3FNCA 5A27A 2ATRA 5HMNA 1OZPA 4AVBA 1VKCA 4UFWA 2A4NA 2GIVA 4KOVA 4R3LA 4M3SA 2J8RA 4KOWA 5KTAA 2B3VA 1YVKA 4XNHC 4XPLA 1WWZA 4RI1A 3H4QA 4AG9A 5G1ZA 3S6KA 4AVCA 3GYAA 2RC4A 3P2FA 5EBVA 5G20A 2B5GB 4AB7A 2PR8A 3FXTA 2WSAA 5E96A 4OLLA 4HNWB 1QSOA 4U9ZA 4NCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H6U A;  4E8O A;  4KOX A;  4KVM E;  4LUA A;  4KZT A;  2IL4 A;  4KOT A;  1M1D A;  4JXQ A;  2VZY A;  1S60 A;  1YVO A;  3ZZI A;  3D2P A;  3CXP A;  4KVX A;  3R96 A;  4KLV A;  1RO5 A;  5IV0 A;  4E2A A;  3DDD A;  2EVN A;  3QAH A;  4Y49 C;  3CXS A;  5EC4 A;  3UY5 A;  4CAV A;  3DR6 A;  2D4O A;  2B4B A;  2P6G A;  2Q4Y A;  3C26 A;  4XPD B;  2OB0 A;  3W6S A;  2H5M A;  1S7F A;  4BMH A;  5KTD A;  2EUI A;  2NMT A;  4IUS A;  1M4D A;  1YGH A;  2Q4V A;  4XPK A;  4F0Y A;  2BEI A;  1S7K A;  3V8I A;  3TO7 A;  2PC1 A;  2FT0 A;  4B5O A;  4MI4 A;  2OZU A;  4UWI A;  4XPD C;  2P0W A;  1XE4 A;  2CNS A;  1XIX A;  1J4J A;  2J8N A;  4KVO E;  2G0B A;  4UBR A;  1LRZ A;  2JLM A;  1QST A;  1KUX A;  2OZG A;  3E0K A;  2FSR A;  4MHD A;  3EFA A;  3SXN A;  3LOD A;  4QUS A;  2VBQ A;  2CY2 A;  3JUW A;  4YFJ A;  5JPH A;  3S6F A;  4B5P B;  2Y0M A;  4ZBG A;  1P0H A;  2R1I A;  4FD7 A;  2PSW A;  2FL4 A;  5J8C A;  5F47 A;  3EY5 A;  5DWN A;  1NMT A;  4AVA A;  4JJX A;  1MJB A;  4FD5 A;  1IYL A;  4OAE A;  1PU9 A;  4R87 A;  2VI7 A;  2Q04 A;  1ON0 A;  1WK4 A;  1L0C A;  2R7H A;  4EVY A;  3FIX A;  3TOA A;  4II9 A;  2PRB A;  1U6M A;  3GY9 A;  1YK3 A;  3DSB A;  2HQY A;  4J3G A;  1Y9K A;  3R1K A;  2WPX A;  1KZF A;  4KUB A;  1YLE A;  4PSX A;  4AG7 A;  4KOY A;  1MJ9 A;  2K5T A;  1Y7R A;  2B58 A;  3TE4 A;  1S3Z A;  1XMT A;  2GE3 A;  4FD6 A;  4U9Y A;  4H6Z A;  2Q0Y A;  1UFH A;  5F49 A;  3QB8 A;  2B5G A;  1YX0 A;  2AJ6 A;  4QVT A;  2ARH A;  2BL1 A;  5CNP A;  4ONU A;  5FVJ A;  4JLY A;  4YGO A;  3TOB A;  4KOS A;  3IWG A;  1QSR A;  3I9S A;  2JDD A;  5H86 A;  5HH1 A;  1S7L A;  3PGP A;  2G3A A;  1Q2D A;  3LD2 A;  4PK2 A;  2Z0Z A;  4KOU A;  2ZPA A;  4KOR A;  3G3S A;  4U5Y A;  2JDC A;  2ZXV A;  4HNY B;  2HUZ A;  3P2H A;  2VQY A;  2B4D B;  1PUA A;  2WPW A;  1M4I A;  2REE A;  4NSQ A;  5C82 A;  2PR1 A;  3VWE A;  2QML A;  2BSW A;  4QB9 A;  2VXK A;  2I79 A;  1Q2Y A;  3I3G A;  3DR8 A;  1IIC A;  2Q44 A;  4CS0 B;  1NSL A;  4PSW A;  1FY7 A;  2HV2 A;  2B3U A;  2X7B A;  2DXQ A;  4KUA A;  3R95 A;  3NE7 A;  2PQ8 A;  2KCW A;  3D2M A;  3F0A A;  2REF A;  4I49 A;  5GCN A;  2Z11 A;  2B4D A;  4RS2 A;  1P4N A;  1GHE A;  3TO9 A;  3CXQ A;  4K30 A;  2ZW5 A;  2ZW4 A;  3G8W A;  2F5I A;  4MY0 A;  3FB3 A;  3T90 A;  3TTH A;  4UA3 A;  3SHP A;  3PZJ A;  1RXT A;  4MJ8 A;  3WR7 A;  4MY3 A;  4IF5 A;  5I0C A;  3MGD A;  1IB1 E;  3N7Z A;  4KLW A;  2GAN A;  1MJA A;  3VWD A;  1QSN A;  3BJ7 A;  1BO4 A;  5ISV A;  1MK4 A;  4L89 A;  4LX9 A;  1Z4R A;  2FE7 A;  4B5P A;  3K9U A;  4CRZ B;  2CNT A;  1S5K A;  4XNH B;  5IB0 A;  5F48 A;  4HNX B;  2AE6 A;  2ZW7 A;  2O28 A;  2Q7B A;  1I21 A;  4NF1 A;  4M85 A;  1CM0 A;  4GS4 A;  3D8P A;  1Z4E A;  2R8V A;  3ZJ0 A;  4X5K A;  1I1D A;  3FRM A;  2OU2 A;  1YRE A;  4NEX A;  3IGR A;  4CRY B;  5H84 A;  5KTC A;  1Q2C A;  3TO6 A;  3R9E A;  1TIQ A;  2QEC A;  2J8M A;  2BUE A;  3KKW A;  4H89 A;  1N71 A;  3JVN A;  4CAW A;  2OZH A;  2I00 A;  1V0C A;  1SQH A;  1Y9W A;  1Z9U A;  3SXO A;  3TT2 A;  5DWM A;  3S6G A;  1XEB A;  4JD6 A;  4Y49 B;  4OAD A;  2D4P A;  2FIW A;  3TFY A;  2P6E A;  4HKF A;  1KUV A;  3EO4 A;  4R9M A;  2ZW6 A;  1YR0 A;  2Z10 A;  3EXN A;  5IX3 A;  4JXR A;  2FIA A;  3OWC A;  5F46 A;  4MBU A;  4CAX A;  1IYK A;  1M44 A;  3TCV A;  2FXF A;  4R3K A;  4YRH A;  2FS5 A;  3W6X A;  3EC4 A;  4F6A A;  2PDO A;  2VZZ A;  2C27 A;  1CJW A;  1QSM A;  2QIR A;  1M4G A;  4UWJ A;  2FCK A;  1NE9 A;  3F5B A;  1B6B A;  3R9G A;  2VEZ A;  1XF8 A;  3FBU A;  1S7N A;  1K4J A;  4NXY A;  3B8G A;  2OH1 A;  3GKR A;  1IID A;  4L8A A;  4QBJ A;  1B87 A;  5J8F A;  4E0A A;  4QC6 A;  2JEV A;  3RYO A;  3D3S A;  4FD4 A;  3PP9 A;  1KUY A;  5C88 A;  3T9Y A;  3W91 A;  3R9F A;  3S6H A;  4R57 A;  5JQ4 A;  3BJ8 A;  1I12 A;  3FYN A;  1R57 A;  4ORF A;  2CNM A;  3F8K A;  3BLN A;  4DNC A;  1VHS A;  2G3T A;  2R98 A;  4JWP A;  1BOB A;  3DNS A;  4PK3 A;  2P6F A;  4PV6 A;  3FNC A;  2ATR A;  5HMN A;  1OZP A;  4AVB A;  1VKC A;  2A4N A;  2GIV A;  4KOV A;  4R3L A;  4M3S A;  2J8R A;  4KOW A;  5KTA A;  2B3V A;  1YVK A;  4XNH C;  4XPL A;  1WWZ A;  4RI1 A;  3H4Q A;  4AG9 A;  3S6K A;  4AVC A;  3GYA A;  2RC4 A;  3P2F A;  5EBV A;  2B5G B;  4AB7 A;  2PR8 A;  3FXT A;  5E96 A;  4OLL A;  4HNW B;  1QSO A;  4U9Z A;  4NCZ A; 
#chains in the Genus database with same CATH topology
 4H6U A;  4E8O A;  4KOX A;  3FH4 A;  4UF4 A;  4KVM E;  4AXV A;  4LUA A;  2GFQ A;  4KZT A;  2IL4 A;  4KOT A;  2J9A A;  1M1D A;  3QNV A;  2BCO A;  2PJ9 A;  1XMB A;  4JXQ A;  2VZY A;  1S60 A;  4ZY0 A;  1YVO A;  3ZZI A;  1XFO A;  4MFK A;  2AFS A;  2DPS A;  3H8E A;  3D2P A;  3CXP A;  2QJ8 A;  5AG4 A;  4KVX A;  2C6C A;  3R96 A;  3LAC A;  3B3C A;  1RO5 A;  4KLV A;  5K8O A;  4UCM A;  3FF3 A;  5IV0 A;  3N5F A;  4E2A A;  3DDD A;  2EVN A;  3QAH A;  4Y49 C;  1IU8 A;  2ZED A;  1X12 A;  3CXS A;  5EC4 A;  4UFV A;  3UY5 A;  4CAV A;  4CPA A;  3DR6 A;  1XOV A;  2D4O A;  2B4B A;  2P6G A;  2Q4Y A;  3C26 A;  2Z3P A;  3GUX A;  4IHM A;  2JBK A;  1PCA A;  4CYO A;  3B3V A;  4XPD B;  3PRT A;  5D8N A;  2OB0 A;  3CDX A;  3W6S A;  2H5M A;  1S7F A;  3V7Z A;  4NGP A;  4BMH A;  5KTD A;  4KSF A;  1JWQ A;  2EUI A;  2NMT A;  2V8G A;  4IUS A;  4Q38 A;  5HVG A;  1M4D A;  1YGH A;  2Q4V A;  2PE3 A;  3D68 A;  3NH4 A;  4XPK A;  4F0Y A;  2BEI A;  3H8G A;  2NSM A;  1S7K A;  3V8I A;  3TO7 A;  1F2O A;  1Z8L A;  2AFW A;  3RO0 A;  2ABZ A;  5THW A;  2PC1 A;  4LQG A;  2FT0 A;  4WJB A;  5JGF A;  4UFX A;  4B5O A;  1BAV A;  4MI4 A;  4DUK A;  2OZU A;  4EME A;  4UWI A;  3IFE A;  2C6G A;  4XPD C;  2P0W A;  1LCP A;  4OC3 A;  3KR5 A;  1XE4 A;  5EMI A;  1NSA A;  2CNS A;  2PCU A;  2ZOG A;  5LYL A;  2AFM A;  1XIX A;  1J4J A;  4A95 A;  1ELL P;  2PJ1 A;  4X3R A;  2J8N A;  1XJO A;  3KL9 A;  3MRU A;  4KVO E;  5D29 A;  4K3N A;  2G0B A;  4UBR A;  1LRZ A;  2JLM A;  1QST A;  3PFO A;  1BPN A;  1KUX A;  2DF5 A;  2OZG A;  3E0K A;  3RAM A;  3KQZ A;  5LRJ A;  2CIJ A;  1VHO A;  2FSR A;  4MHD A;  8CPA A;  3EFA A;  3PBB A;  2IJZ A;  3SXN A;  3IU1 A;  4MXU A;  3LOD A;  4QUS A;  3BHX A;  3CPX A;  2VBQ A;  4GM5 A;  2CY2 A;  3JUW A;  4YFJ A;  1JQG A;  5JPH A;  4MMO A;  1KWM A;  3S6F A;  3KAS A;  4B5P B;  2Y0M A;  4ZBG A;  4OC2 A;  2ZEF A;  4OC0 A;  1P0H A;  2CTC A;  2R1I A;  2PJA A;  1Z2L A;  2F8H A;  1LAN A;  1ZO0 A;  4FD7 A;  3CZX A;  1YME A;  2PSW A;  1ARL A;  4C68 A;  2FL4 A;  5J8C A;  5F47 A;  3NH5 A;  5ELY A;  4F8Z A;  2ANP A;  3EY5 A;  5DWN A;  4CYP A;  1NMT A;  4P44 A;  4AVA A;  2BO9 A;  4JJX A;  5CPA A;  1MJB A;  1VIX A;  3PB9 X;  4FD5 A;  1IYL A;  2GLJ A;  2VL1 A;  4OAE A;  1PU9 A;  4NFR A;  4R87 A;  5LRG A;  2O53 A;  6CPA A;  2VI7 A;  4KSI A;  5CBM A;  2Q04 A;  3IEH A;  3TC8 A;  1ON0 A;  2EO8 A;  4YU9 A;  3V38 A;  1WK4 A;  1L0C A;  3FMC A;  2R7H A;  1PYT B;  4EVY A;  3FIX A;  4PPZ A;  3TOA A;  4P45 A;  4II9 A;  2PRB A;  2Z3L A;  1U6M A;  3GY9 A;  2EBJ A;  4DYO A;  1YK3 A;  4CGN A;  1VHE A;  3DSB A;  2YNC A;  2PJ2 A;  2HQY A;  3D7G A;  3K2K A;  2YNC C;  4J3G A;  3I1U A;  4B6Z A;  1Y9K A;  4KS9 A;  4FAI A;  3R1K A;  2PIY A;  1KZF A;  2WPX A;  4KUB A;  4R7M A;  1YLE A;  4BD9 A;  3DLJ A;  4PSX A;  4AG7 A;  4C7I A;  4HPS A;  3KHX A;  1MJ9 A;  4KOY A;  3WC5 A;  2EK8 A;  5A28 A;  2K5T A;  2F7V A;  3SI0 A;  2FVG A;  4Q36 A;  1Y7R A;  2V77 A;  4JZ0 A;  2B58 A;  1YW6 A;  3KHZ A;  4WWV A;  1S3Z A;  3RZA A;  1XMT A;  3TE4 A;  2GE3 A;  4FD6 A;  4U9Y A;  1YSJ A;  5AGE A;  1Z8W A;  5HVH A;  4H6Z A;  2Q0Y A;  1UFH A;  4PQA A;  3NH8 A;  3BI1 A;  2C6P A;  3D67 A;  5F49 A;  4NJR A;  2CTB A;  3QB8 A;  1ZG7 A;  2B5G A;  3JTK A;  1YX0 A;  2AJ6 A;  1M4L A;  4IK2 A;  1HDQ A;  4P4D A;  4QVT A;  5LYI A;  1ZG9 A;  2ARH A;  5LRK A;  2BL1 A;  5CNP A;  4ONU A;  2QVP A;  5FVJ A;  4JLY A;  4YGO A;  1TKJ A;  3FVL A;  3TOB A;  4Z65 A;  4KOS A;  3IWG A;  1QSR A;  4W9Y A;  2PVV A;  4TNU A;  3I9S A;  1CG2 A;  3QAY A;  4A30 A;  4B10 A;  2Q51 A;  5K8P A;  4C2Z A;  2JDD A;  1QMU A;  5H86 A;  5HH1 A;  1F57 A;  1UWY A;  1QQ9 A;  1YQE A;  2AFZ A;  4OKO A;  4ZX8 A;  3RBU A;  4A38 A;  5IB9 A;  1S7L A;  3PGP A;  4P6Y A;  2G3A A;  3PB4 X;  4CGL A;  4MFL A;  1Q2D A;  4C2Y A;  4B13 A;  3LD2 A;  4PK2 A;  3D7H A;  5K8M A;  3GB0 A;  2PJ6 A;  4MFQ A;  2Z0Z A;  4KOU A;  2ZPA A;  3IWW A;  4KOR A;  4B12 A;  3G3S A;  3B2Y A;  4U5Y A;  2CF4 A;  2AFO A;  2JDC A;  2ZXV A;  4HNY B;  2HUZ A;  1EE3 P;  4PXC A;  3P2H A;  2VQY A;  2Q4Z A;  2B4D B;  4O23 A;  1PUA A;  2WPW A;  1M4I A;  1BPM A;  2REE A;  2YGW A;  2PR1 A;  3PB8 X;  4NSQ A;  2QML A;  3VWE A;  2BSW A;  5C82 A;  3NE8 A;  4QB9 A;  2VXK A;  1CPX A;  1Q2Y A;  2I79 A;  3I3G A;  3DR8 A;  1IIC A;  2Q44 A;  2I3C A;  2PJ4 A;  4CS0 B;  2XEI A;  1NSL A;  4PSW A;  1FY7 A;  3SJG A;  2HV2 A;  2B3U A;  3B35 A;  2WZN A;  2HC9 A;  2DXQ A;  2IMO A;  2X7B A;  4KUA A;  4GXH A;  5LYD A;  3R95 A;  3NE7 A;  2PQ8 A;  3B3S A;  4MRI A;  2EK9 A;  4JYW A;  1TXR A;  2KCW A;  4MHN A;  3D2M A;  3F0A A;  2REF A;  4I49 A;  4UIA A;  1CPS A;  2Z11 A;  5GCN A;  2B4D A;  4A32 A;  2Q7S A;  4RS2 A;  1HDU A;  1P4N A;  1GHE A;  3TO9 A;  3FED A;  2OR4 A;  3CXQ A;  4NGM A;  1TF8 A;  2Z3N A;  3H8F A;  3PEI A;  4K30 A;  3FX6 A;  2ZW5 A;  2PJ8 A;  3T8W A;  2ZW4 A;  3G8W A;  2F5I A;  4MY0 A;  3FB3 A;  4M6H A;  3T90 A;  3TTH A;  4UA3 A;  4MFZ A;  3SHP A;  3PZJ A;  1RXT A;  1Z8X A;  4MJ8 A;  3WR7 A;  2IQ6 A;  4MY3 A;  4IF5 A;  4A39 A;  5I0C A;  3MGD A;  4UCN A;  1IB1 E;  3N7Z A;  1Y7E A;  1YLO A;  4KLW A;  4FUU A;  3K9T A;  2GAN A;  2NYQ A;  1MJA A;  1FT7 A;  4MFP A;  4P4E A;  4R76 A;  4TWE A;  3VWD A;  1QSN A;  3BJ7 A;  3PB7 X;  4R8F A;  1BO4 A;  5ISV A;  1MK4 A;  4OC5 A;  4L89 A;  4LX9 A;  1Z4R A;  2FE7 A;  4MHP A;  4B5P A;  3FEE A;  3K9U A;  4CRZ B;  4UEE A;  2WYR A;  2CNT A;  2Q43 A;  4C2X A;  5LYF A;  1S5K A;  3GLJ A;  1GYT A;  4XNH B;  5IB0 A;  5F48 A;  1R3N A;  4HNX B;  3LMS A;  3CT9 A;  2AE6 A;  5BWA B;  5JM6 A;  1XRY A;  1DE4 C;  3B3T A;  4MFJ A;  4P4I A;  2ZW7 A;  1DTD A;  2V8D A;  2DEA A;  4YWY A;  5I4M A;  2O28 A;  2Q7B A;  1I21 A;  4NF1 A;  2GLF A;  1CM0 A;  4GS4 A;  4M85 A;  1F2P A;  3D8P A;  1Z4E A;  4OIW A;  4ZY1 A;  1HEE A;  2R8V A;  2Z3O A;  4R6T A;  5K8N A;  3ZJ0 A;  4ZI6 A;  5AG7 A;  1VGY A;  4C7H A;  3GIU A;  1TF9 A;  4X5K A;  4NGT A;  1I1D A;  3FRM A;  1ZLI A;  1YRE A;  2OU2 A;  4NEX A;  3SJF A;  3IGR A;  3IIB A;  4CRY B;  2C1C A;  1ARM A;  5H84 A;  4A31 A;  5KTC A;  1Q2C A;  3SJE A;  3TO6 A;  3R9E A;  5JH9 A;  1TIQ A;  2QEC A;  1OBR A;  2J8M A;  2BUE A;  3IJ3 A;  3B3W A;  3KGQ A;  3KZW A;  5J1Q A;  3S9N A;  3KKW A;  1XBU A;  2RFH A;  3WT4 A;  2XEF A;  3L2N A;  3VH9 A;  3S9M A;  4H89 A;  4OID A;  1N71 A;  1ZG8 A;  3JVN A;  1IOF A;  2OZH A;  2I00 A;  4CAW A;  4CGM A;  1V0C A;  1SQH A;  3WAB A;  1Y9W A;  1Z9U A;  3SXO A;  4ZY2 A;  3TT2 A;  5DWM A;  3S6G A;  1XEB A;  4JD6 A;  4Y49 B;  2O4H A;  3WC7 A;  4OAD A;  4UCP A;  2D4P A;  4NGR A;  3MN8 A;  4ZX9 A;  3NA6 A;  2FIW A;  3TFY A;  2P6E A;  4CYQ A;  3WC6 A;  4HKF A;  1KUV A;  3EO4 A;  2XEG A;  4B14 A;  4R9M A;  2ZW6 A;  2EWB A;  3D7D A;  1YR0 A;  4B11 A;  4P4J A;  3KQX A;  3FEC A;  2Z10 A;  3EXN A;  2ZEH A;  5IX3 A;  3NFZ A;  4OC1 A;  4JXR A;  4MCQ A;  4X8I A;  3HUV A;  2FIA A;  3OWC A;  5F46 A;  4MBU A;  4CAX A;  1IYK A;  1M44 A;  2POK A;  4FWU A;  3TCV A;  2FXF A;  4A33 A;  3DGV A;  1Y0Y A;  1ZLH A;  5HVF A;  2DPT A;  4RUH A;  4R3K A;  2GU2 A;  2QYV A;  1CP7 A;  3A9L A;  2AFX A;  4DJL A;  3LWU A;  4YRH A;  4A2Z A;  4NJQ A;  4UIB A;  2FS5 A;  3SI1 A;  3B7I A;  3W6X A;  4CAF A;  2AFU A;  3EC4 A;  4MHZ A;  4BBH A;  4OME A;  4F6A A;  4P4F A;  3BI0 A;  1LAM A;  2PDO A;  4M6G A;  4MCP A;  2VZZ A;  3S9L A;  3IO1 A;  4M6I A;  2Z3K A;  2C27 A;  4IAV A;  1CJW A;  1QSM A;  4NGQ A;  2QIR A;  1M4G A;  4UWJ A;  2ZEP A;  2FCK A;  4CGP A;  3IU2 A;  2XEJ A;  2PJC A;  4X2T A;  1NE9 A;  2JBJ A;  4BIN A;  3F5B A;  1B6B A;  3R9G A;  2ZEO A;  1Y0R A;  4ONW A;  5F09 A;  3PFE A;  2ODF A;  4G1P A;  2VEZ A;  1XF8 A;  3IWE A;  3TX8 A;  3FBU A;  1S7N A;  1K4J A;  2CXA A;  4LQ6 A;  4NXY A;  1TKF A;  2ZEL A;  3B8G A;  2OH1 A;  2ZEM A;  2V8V A;  3GKR A;  4CGO A;  4NGS A;  1IID A;  2PJ0 A;  4L8A A;  4QBJ A;  2G9D A;  1B87 A;  1CX8 A;  1R43 A;  5AG5 A;  4H2K A;  4NGN A;  4ZYQ A;  3RNZ A;  1BLL E;  2PJ5 A;  5J8F A;  4E0A A;  4QC6 A;  1X10 A;  4F0X A;  2JEV A;  3RYO A;  2JEW A;  1H8L A;  2ZOF A;  4MCS A;  2Z3M A;  3D3S A;  1AYE A;  4FD4 A;  3PP9 A;  1KUY A;  4P4B A;  5AG6 A;  5C88 A;  3T9Y A;  3W91 A;  4CAE A;  3R9F A;  1RTQ A;  2WUU A;  1LFW A;  3S6H A;  5G22 A;  4R57 A;  5JQ4 A;  3FJU A;  3BJ8 A;  3PB6 X;  1I12 A;  4KSA A;  1CBX A;  2OOT A;  2PJB A;  3FYN A;  1AMP A;  1ELM P;  4A37 A;  2PVW A;  2ZEE A;  1R57 A;  3IC1 A;  2YNE A;  2PIZ A;  4ORF A;  2CNM A;  3F8K A;  3BLN A;  3JRU A;  4DNC A;  1VHS A;  4OC4 A;  1IGB A;  5DS0 A;  4PXB A;  2YND A;  3VAR A;  2G3T A;  4A94 A;  2R98 A;  4EWT A;  4JWP A;  4Q7A A;  2GRE A;  1BOB A;  4PXD A;  5G21 A;  4CYN A;  4ZGY B;  1FNO A;  3DNS A;  3KR4 A;  3H5Z A;  4PK3 A;  2P6F A;  3BXM A;  4PV6 A;  1A2Z A;  1LOK A;  1CP6 A;  3FNC A;  1AUG A;  2PJ3 A;  2V8H A;  3ISX A;  5A27 A;  2ATR A;  4EFD A;  3KI9 A;  3D66 A;  5HMN A;  2RB7 A;  2ZEG A;  4PXE A;  1OZP A;  4UEZ A;  4AVB A;  3SJX A;  3SI2 A;  1VKC A;  4UFW A;  4MCR A;  5HXD A;  2A4N A;  3D4U A;  4F9U A;  2GIV A;  4KOV A;  4R3L A;  7CPA A;  1YW4 A;  4M3S A;  2J8R A;  4KOW A;  5KTA A;  2B3V A;  2PRQ A;  1IOI A;  1YVK A;  4XNH C;  1Z5R A;  4FBE A;  2BOA A;  1Z8T A;  4F9V A;  1IY7 A;  4XPL A;  2HB6 A;  1WWZ A;  4RI1 A;  3H4Q A;  3PBE A;  4AG9 A;  5G1Z A;  3ISZ A;  4UEF A;  4P10 A;  3VAT A;  1LAP A;  3S6K A;  4RN7 A;  4AVC A;  3GYA A;  2RC4 A;  3P2F A;  4OP4 A;  5EBV A;  5G20 A;  2B5G B;  4AB7 A;  2PR8 A;  3FXT A;  2WSA A;  2ZEN A;  4MHY A;  1Q7L A;  1TKH A;  3D7F A;  3HLP A;  5E96 A;  4OLL A;  4HNW B;  1QSO A;  4U9Z A;  3CPA A;  2PJ7 A;  4NCZ A; 
#chains in the Genus database with same CATH homology
 4H6U A;  4E8O A;  4KOX A;  4KVM E;  4LUA A;  4KZT A;  2IL4 A;  4KOT A;  1M1D A;  4JXQ A;  2VZY A;  1S60 A;  1YVO A;  3ZZI A;  4MFK A;  2DPS A;  3D2P A;  3CXP A;  5AG4 A;  4KVX A;  3R96 A;  4KLV A;  1RO5 A;  4UCM A;  5IV0 A;  4E2A A;  3DDD A;  2EVN A;  3QAH A;  4Y49 C;  3CXS A;  5EC4 A;  4UFV A;  3UY5 A;  4CAV A;  3DR6 A;  2D4O A;  2B4B A;  2P6G A;  2Q4Y A;  3C26 A;  2Z3P A;  4CYO A;  4XPD B;  2OB0 A;  3W6S A;  2H5M A;  1S7F A;  4BMH A;  5KTD A;  4KSF A;  2EUI A;  2NMT A;  4IUS A;  4Q38 A;  1M4D A;  1YGH A;  2Q4V A;  4XPK A;  4F0Y A;  2BEI A;  1S7K A;  3V8I A;  3TO7 A;  2PC1 A;  2FT0 A;  4UFX A;  4B5O A;  4MI4 A;  2OZU A;  4UWI A;  4XPD C;  2P0W A;  1XE4 A;  2CNS A;  1XIX A;  1J4J A;  4A95 A;  2J8N A;  4KVO E;  2G0B A;  4UBR A;  1LRZ A;  2JLM A;  1QST A;  1KUX A;  2OZG A;  3E0K A;  2FSR A;  4MHD A;  3EFA A;  3SXN A;  3IU1 A;  3LOD A;  4QUS A;  2VBQ A;  2CY2 A;  3JUW A;  4YFJ A;  5JPH A;  3S6F A;  4B5P B;  2Y0M A;  4ZBG A;  1P0H A;  2R1I A;  4FD7 A;  1ZO0 A;  2PSW A;  4C68 A;  2FL4 A;  5J8C A;  5F47 A;  3EY5 A;  5DWN A;  4CYP A;  1NMT A;  4AVA A;  4JJX A;  1MJB A;  4FD5 A;  1IYL A;  4OAE A;  1PU9 A;  4R87 A;  2VI7 A;  2Q04 A;  1ON0 A;  1WK4 A;  1L0C A;  2R7H A;  4EVY A;  3FIX A;  3TOA A;  4II9 A;  2PRB A;  2Z3L A;  1U6M A;  3GY9 A;  1YK3 A;  4CGN A;  3DSB A;  2YNC A;  2HQY A;  2YNC C;  4J3G A;  1Y9K A;  4KS9 A;  3R1K A;  2WPX A;  1KZF A;  4KUB A;  1YLE A;  4PSX A;  4AG7 A;  4C7I A;  4KOY A;  1MJ9 A;  5A28 A;  2K5T A;  4Q36 A;  1Y7R A;  2B58 A;  3TE4 A;  1S3Z A;  1XMT A;  2GE3 A;  4FD6 A;  4U9Y A;  5AGE A;  4H6Z A;  2Q0Y A;  1UFH A;  5F49 A;  3QB8 A;  2B5G A;  3JTK A;  1YX0 A;  2AJ6 A;  4QVT A;  2ARH A;  2BL1 A;  5CNP A;  4ONU A;  5FVJ A;  4JLY A;  4YGO A;  3TOB A;  4KOS A;  3IWG A;  1QSR A;  3I9S A;  4A30 A;  4B10 A;  4C2Z A;  2JDD A;  5H86 A;  5HH1 A;  1S7L A;  3PGP A;  2G3A A;  4CGL A;  4MFL A;  1Q2D A;  4C2Y A;  4B13 A;  3LD2 A;  4PK2 A;  4MFQ A;  2Z0Z A;  4KOU A;  2ZPA A;  4KOR A;  4B12 A;  3G3S A;  4U5Y A;  2JDC A;  2ZXV A;  4HNY B;  2HUZ A;  3P2H A;  2VQY A;  2B4D B;  1PUA A;  2WPW A;  1M4I A;  2REE A;  4NSQ A;  2YGW A;  2PR1 A;  3VWE A;  5C82 A;  2QML A;  2BSW A;  4QB9 A;  2VXK A;  2I79 A;  1Q2Y A;  3I3G A;  3DR8 A;  1IIC A;  2Q44 A;  4CS0 B;  1NSL A;  4PSW A;  1FY7 A;  2HV2 A;  2B3U A;  2X7B A;  2DXQ A;  4KUA A;  3R95 A;  3NE7 A;  2PQ8 A;  2KCW A;  3D2M A;  3F0A A;  2REF A;  4I49 A;  5GCN A;  2Z11 A;  4A32 A;  2B4D A;  4RS2 A;  1P4N A;  1GHE A;  3TO9 A;  3CXQ A;  2Z3N A;  4K30 A;  2ZW5 A;  2ZW4 A;  3G8W A;  2F5I A;  4MY0 A;  3FB3 A;  3T90 A;  3TTH A;  4UA3 A;  4MFZ A;  3SHP A;  3PZJ A;  1RXT A;  4MJ8 A;  3WR7 A;  4MY3 A;  4IF5 A;  5I0C A;  3MGD A;  4UCN A;  1IB1 E;  3N7Z A;  4KLW A;  2GAN A;  1MJA A;  4MFP A;  3VWD A;  1QSN A;  3BJ7 A;  1BO4 A;  5ISV A;  1MK4 A;  4L89 A;  4LX9 A;  1Z4R A;  2FE7 A;  4B5P A;  3K9U A;  4CRZ B;  2CNT A;  4C2X A;  1S5K A;  4XNH B;  5IB0 A;  5F48 A;  4HNX B;  5BWA B;  2AE6 A;  4MFJ A;  2ZW7 A;  2O28 A;  2Q7B A;  1I21 A;  4NF1 A;  1CM0 A;  4GS4 A;  4M85 A;  3D8P A;  1Z4E A;  2R8V A;  2Z3O A;  3ZJ0 A;  5AG7 A;  4C7H A;  4X5K A;  1I1D A;  3FRM A;  2OU2 A;  1YRE A;  4NEX A;  3IGR A;  4CRY B;  5H84 A;  4A31 A;  5KTC A;  1Q2C A;  3TO6 A;  3R9E A;  1TIQ A;  2QEC A;  2J8M A;  2BUE A;  3KKW A;  4H89 A;  1N71 A;  3JVN A;  4CAW A;  2OZH A;  2I00 A;  4CGM A;  1V0C A;  1SQH A;  1Y9W A;  1Z9U A;  3SXO A;  3TT2 A;  5DWM A;  3S6G A;  1XEB A;  4JD6 A;  4Y49 B;  4OAD A;  4UCP A;  2D4P A;  2FIW A;  3TFY A;  2P6E A;  4CYQ A;  4HKF A;  1KUV A;  3EO4 A;  4B14 A;  4R9M A;  2ZW6 A;  1YR0 A;  4B11 A;  2Z10 A;  3EXN A;  5IX3 A;  4JXR A;  2FIA A;  3OWC A;  5F46 A;  4MBU A;  4CAX A;  1IYK A;  1M44 A;  3TCV A;  2FXF A;  4A33 A;  2DPT A;  4R3K A;  3A9L A;  4YRH A;  4A2Z A;  4CAF A;  2FS5 A;  3W6X A;  3EC4 A;  4BBH A;  4F6A A;  2PDO A;  2VZZ A;  2Z3K A;  2C27 A;  1CJW A;  1QSM A;  2QIR A;  1M4G A;  4UWJ A;  2FCK A;  4CGP A;  3IU2 A;  1NE9 A;  3F5B A;  1B6B A;  3R9G A;  2VEZ A;  1XF8 A;  3IWE A;  3FBU A;  1S7N A;  1K4J A;  2CXA A;  4NXY A;  3B8G A;  2OH1 A;  3GKR A;  4CGO A;  1IID A;  4L8A A;  4QBJ A;  1B87 A;  5AG5 A;  5J8F A;  4E0A A;  4QC6 A;  4F0X A;  2JEV A;  3RYO A;  2Z3M A;  3D3S A;  4FD4 A;  3PP9 A;  1KUY A;  5AG6 A;  5C88 A;  3T9Y A;  3W91 A;  4CAE A;  3R9F A;  2WUU A;  3S6H A;  5G22 A;  4R57 A;  5JQ4 A;  3BJ8 A;  4KSA A;  1I12 A;  3FYN A;  1R57 A;  2YNE A;  4ORF A;  2CNM A;  3F8K A;  3BLN A;  4DNC A;  1VHS A;  2YND A;  2G3T A;  2R98 A;  4JWP A;  1BOB A;  5G21 A;  4CYN A;  4ZGY B;  3DNS A;  3H5Z A;  4PK3 A;  2P6F A;  4PV6 A;  3FNC A;  5A27 A;  2ATR A;  5HMN A;  1OZP A;  4AVB A;  1VKC A;  4UFW A;  2A4N A;  2GIV A;  4KOV A;  4R3L A;  4M3S A;  2J8R A;  4KOW A;  5KTA A;  2B3V A;  1YVK A;  4XNH C;  4XPL A;  1WWZ A;  4RI1 A;  3H4Q A;  4AG9 A;  5G1Z A;  3S6K A;  4AVC A;  3GYA A;  2RC4 A;  3P2F A;  5EBV A;  5G20 A;  2B5G B;  4AB7 A;  2PR8 A;  3FXT A;  2WSA A;  5E96 A;  4OLL A;  4HNW B;  1QSO A;  4U9Z A;  4NCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...