1CJWA

Serotonin n-acetyltransferase complexed with a bisubstrate analog
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
166
structure length
166
Chain Sequence
HTLPANEFRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLTLCPELSLGWFVEGRLVAFIIGSLWDEERLTQESLALHRPRGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRAVLMCEDALVPFYQRFGFHPAGPCAIVVGSLTFTEMHCSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROTEIN (SEROTONIN N-ACETYLTRANSFERASE)
publication title The structural basis of ordered substrate binding by serotonin N-acetyltransferase: enzyme complex at 1.8 A resolution with a bisubstrate analog.
pubmed doi rcsb
source organism Ovis aries
total genus 45
structure length 166
sequence length 166
ec nomenclature ec 2.3.1.87: Aralkylamine N-acetyltransferase.
pdb deposition date 1999-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1cjwA00
1KUVA 1Z4RA 5F46A 5C82A 2FIWA 4X5KA 4KLVA 2PQ8A 4XNHC 3OWCA 4KLWA 1B6BA 4B5PB 1GHEA 4F6AA 2B4DB 4NF1A 1KUYA 1OZPA 1S7FA 2FL4A 4JLYA 3F0AA 4OAEA 3TOAA 1IIDA 2BSWA 4KOUA 1Y9WA 3PGPA 1Z4EA 1NMTA 2HQYA 4AVCA 3BJ7A 4H6UA 2RC4A 3TO9A 1S7LA 1IYLA 4UWJA 1WK4A 3QAHA 3K9UA 1J4JA 1S7KA 3FBUA 1YX0A 2J8NA 2WPWA 1M44A 2FE7A 3FB3A 1WWZA 2FSRA 4H6ZA 3S6GA 4CAVA 1B87A 3FNCA 3F8KA 4KVXA 4U9ZA 2R7HA 1YLEA 3LD2A 2D4PA 3FYNA 4JD6A 2OZUA 1QSNA 2JDCA 3S6FA 2VZZA 4KOYA 1U6MA 1FY7A 3S6HA 1IYKA 4AVAA 3IGRA 2F5IA 1RO5A 3IWGA 1I21A 2JEVA 5DWMA 4KVME 2Z0ZA 2ZPAA 4F0YA 1Q2CA 1M4DA 2OU2A 4HNYB 4KZTA 2DXQA 2VZYA 5CNPA 3H4QA 2FS5A 2Q04A 1Z9UA 4KORA 3GY9A 2VXKA 5H86A 5KTCA 1S60A 1S3ZA 1LRZA 2P6EA 4NSQA 2FIAA 3D2PA 1MJAA 1VKCA 2VBQA 1YVOA 2G3TA 4IUSA 3JUWA 3R9FA 4J3GA 4QUSA 2C27A 2PR1A 4KOXA 3W6SA 1IB1E 2JDDA 2Z11A 2AE6A 1XEBA 3I3GA 2B58A 1QSOA 1M1DA 3ZJ0A 4CAXA 5I0CA 4RS2A 5GCNA 1XMTA 1YVKA 2WPXA 1L0CA 2J8MA 4R87A 2BL1A 4L89A 2G3AA 2Z10A 4U5YA 3W91A 3DR8A 2J8RA 4BMHA 3E0KA 4R57A 1SQHA 1XIXA 3EFAA 3FXTA 5FVJA 2VEZA 4KUBA 2EUIA 4KOWA 2B5GB 3PP9A 5H84A 2HV2A 3D2MA 4KOVA 4JJXA 5KTAA 4XPKA 4Y49B 3WR7A 2IL4A 1KZFA 1QSMA 3SXNA 5IB0A 1IICA 3UY5A 3R9EA 1PUAA 3CXSA 3C26A 4KUAA 2B4BA 1XF8A 1VHSA 4JWPA 3TT2A 2Y0MA 4EVYA 2H5MA 5EC4A 1CM0A 4RI1A 1YK3A 2JLMA 1UFHA 4KOSA 4JXRA 4OADA 4E2AA 1TIQA 2G0BA 5F48A 5F49A 5EBVA 4B5OA 4YFJA 1PU9A 4FD4A 4U9YA 4II9A 2REFA 2Q7BA 2B4DA 2GIVA 4YGOA 4XNHB 2OB0A 4JXQA 3VWDA 1NSLA 4M3SA 5IV0A 2ZW5A 3I9SA 3TCVA 1XE4A 5JQ4A 2PDOA 3F5BA 3R95A 2QMLA 3T9YA 3DSBA 4PK2A 4FD5A 4XPDC 1P4NA 2CY2A 1S7NA 2ZW7A 3JVNA 2ZW6A 3G3SA 4PSWA 5HH1A 5DWNA 4KOTA 2EVNA 3D3SA 2OZHA 3N7ZA 2CNSA 4NCZA 4CRYB 1I1DA 1YREA 2ZXVA 2Q4YA 2GE3A 4AB7A 4MI4A 4MY0A 4HNXB 4QC6A 3NE7A 4FD6A 3MGDA 4AG7A 1NE9A 4CRZB 3CXQA 4PV6A 4XPLA 5E96A 3FRMA 1I12A 3QB8A 2O28A 2B3UA 2VI7A 3DR6A 4QVTA 3V8IA 3BJ8A 3GKRA 4NXYA 2FCKA 3EXNA 4ONUA 2OZGA 2PR8A 4AG9A 1N71A 1YGHA 3EC4A 4ORFA 2BEIA 5J8CA 4MHDA 4GS4A 3TFYA 2R8VA 3TO7A 1MJBA 2ATRA 2B3VA 4NEXA 5C88A 1QSTA 1YR0A 4UBRA 1MJ9A 3SHPA 4LX9A 3TTHA 4R3LA 4HKFA 3LODA 4QBJA 5ISVA 3TO6A 1ON0A 2CNMA 1Y9KA 4DNCA 4PSXA 4R9MA 3DNSA 3P2HA 1MK4A 3EO4A 1K4JA 4YRHA 1RXTA 4PK3A 1CJWA 5F47A 4UA3A 1Y7RA 5JPHA 1QSRA 4L8AA 3CXPA 2X7BA 3DDDA 2I79A 4MJ8A 1Q2YA 3B8GA 4R3KA 4B5PA 3PZJA 2QIRA 3FIXA 2B5GA 2P0WA 4CS0B 2ZW4A 2FXFA 3VWEA 4E8OA 3TE4A 4IF5A 1R57A 2R98A 4OLLA 1BOBA 2REEA 3ZZIA 4QB9A 2BUEA 2CNTA 4I49A 3RYOA 4H89A 4M85A 2HUZA 2FT0A 1BO4A 4K30A 1P0HA 2D4OA 2GANA 4UWIA 3SXOA 4E0AA 2PRBA 4MY3A 4FD7A 4MBUA 1M4GA 2R1IA 3G8WA 2P6FA 2NMTA 3T90A 3EY5A 3GYAA 4Y49C 2QECA 3R9GA 3KKWA 2ARHA 2I00A 5HMNA 4CAWA 4LUAA 5IX3A 2Q44A 2A4NA 4KVOE 2PC1A 1KUXA 3S6KA 2VQYA 2PSWA 4HNWB 5KTDA 5J8FA 1Q2DA 3R1KA 3R96A 2OH1A 2P6GA 3P2FA 2KCWA 2Q0YA 3D8PA 3BLNA 4XPDB 4AVBA 2K5TA 1M4IA 2AJ6A 1S5KA 1V0CA 3TOBA 4ZBGA 3W6XA 2Q4VA
chains in the Genus database with same CATH superfamily
1YLOA 4BBHA 4P4JA 3IU2A 1ARMA 4KSFA 1KUVA 1Z4RA 3H8EA 2V77A 2FIWA 2ZEFA 5C82A 5F46A 2OOTA 4A39A 4X5KA 4KLVA 2AFUA 3VATA 4OKOA 2PQ8A 4XNHC 3OWCA 1BLLE 4KLWA 1B6BA 4UFXA 3FEDA 4B13A 4B5PB 4FWUA 4BD9A 4CYPA 1GHEA 1CPXA 4F6AA 2B4DB 2PJ5A 3L2NA 4NF1A 3D7GA 2V8HA 1KUYA 1OZPA 1LFWA 1S7FA 2FL4A 4JLYA 4MHYA 3F0AA 3KGQA 4OAEA 4UCNA 1Y0RA 4OC4A 4R8FA 2PJ2A 3TOAA 6CPAA 1IIDA 2BSWA 1EE3P 4KOUA 4EWTA 2PCUA 1Y9WA 2PJ3A 2ZENA 2JBJA 3CPXA 3PGPA 4KS9A 1Z4EA 3FH4A 1NMTA 2HQYA 2NYQA 4MMOA 3BJ7A 2PE3A 2Q4ZA 4H6UA 2RC4A 4MCSA 1S7LA 4P4EA 3TO9A 4RUHA 4P44A 1IYLA 4OC5A 4UWJA 5D29A 2C6CA 4C7IA 1WK4A 2I3CA 3PB7X 4JYWA 3D4UA 3IC1A 4PQAA 3QAHA 1Z8WA 3K9UA 2Q43A 3RNZA 1J4JA 1S7KA 3H8GA 1VHOA 4NGQA 3FBUA 1YX0A 2J8NA 2WPWA 4LQ6A 1M44A 1BPMA 2FE7A 3FB3A 1WWZA 2FSRA 4H6ZA 4ZGYB 1LOKA 5HVFA 1XJOA 3S6GA 4CAVA 3FMCA 1B87A 3FNCA 3F8KA 4R6TA 4KVXA 3HLPA 4U9ZA 2R7HA 1YLEA 3PFEA 1NSAA 3LD2A 2D4PA 5AG6A 2ZEMA 3FYNA 4JD6A 4ZYQA 2Z3LA 4UFWA 5J1QA 3SJXA 2PJ9A 3N5FA 2OZUA 1YW6A 1QSNA 4PXDA 2JDCA 5JH9A 3S6FA 2VZZA 4KOYA 4A30A 1U6MA 2ZEGA 3IWWA 2ODFA 4OMEA 5LRKA 1FY7A 3S6HA 4CAEA 1IYKA 4AVAA 3IGRA 5LYDA 4EMEA 2F5IA 1RO5A 3IWGA 1I21A 2DPTA 1CG2A 4TWEA 1ARLA 2GFQA 2JEVA 5DWMA 1CP6A 4MFQA 4KVME 2ANPA 4UFVA 2O4HA 4ZI6A 4UIBA 4UEZA 2Z0ZA 2ZPAA 5LYFA 4F0YA 4P6YA 1Q2CA 3CZXA 1M4DA 1IOIA 4KSIA 3SJFA 4IK2A 2OU2A 4HNYB 4KZTA 2DXQA 2VZYA 5CNPA 1FT7A 3NH5A 5A27A 3JTKA 3H4QA 2FS5A 1XRYA 2Q04A 1Z9UA 4CYNA 4KORA 2PJAA 3GY9A 2VXKA 2WUUA 2WYRA 5H86A 4MXUA 5KTCA 4B14A 1S60A 1S3ZA 1LRZA 4UIAA 2P6EA 4NSQA 2V8VA 2FIAA 4JZ0A 3D2PA 3V7ZA 3MN8A 2EBJA 1MJAA 5I4MA 4FAIA 2AFZA 1VKCA 2VBQA 3CT9A 3TC8A 3KHZA 1YVOA 2G3TA 4IUSA 3GB0A 2GU2A 3JUWA 3R9FA 4J3GA 2EO8A 3H5ZA 4DYOA 2Q51A 3PB9X 4QUSA 2C27A 2PR1A 1FNOA 4KOXA 1ZG7A 1QQ9A 5AGEA 1ZO0A 3W6SA 4C2YA 1IB1E 2JDDA 2Z11A 2AE6A 3NH8A 1XEBA 2ZEDA 3I3GA 2B58A 1QSOA 4AVCA 3S9NA 1M1DA 3ZJ0A 4CAXA 5CBMA 1OBRA 4LQGA 4RS2A 5I0CA 5GCNA 4NGMA 4OIDA 2XEFA 4MFLA 1AUGA 1XMTA 1YVKA 2WPXA 1L0CA 2J8MA 4R87A 2BL1A 4L89A 2V8GA 1YMEA 2G3AA 2YNEA 2Z10A 4U5YA 4R76A 4ZY0A 3W91A 4A33A 4MCRA 3DR8A 2G9DA 2J8RA 2CF4A 2YNCA 4BMHA 3E0KA 1TF9A 3PB4X 3GUXA 4R57A 1SQHA 1HDUA 1XIXA 3EFAA 5IB9A 4OC3A 3DLJA 3FXTA 5FVJA 2VEZA 4KUBA 2XEGA 4CGPA 1JWQA 4GXHA 1VIXA 2AFOA 2EUIA 4KOWA 3D68A 4NGPA 2B5GB 3PP9A 5H84A 2HV2A 1TXRA 3KI9A 3D2MA 4KOVA 4JJXA 5KTAA 4K3NA 1TKJA 4XPKA 2YNDA 4Y49B 3WR7A 2ZEOA 2Z3NA 4TNUA 2IL4A 4UCPA 1KZFA 2XEJA 1QSMA 3SXNA 5IB0A 3SJGA 1IICA 1ELLP 3R9EA 3FVLA 3K2KA 3UY5A 1PUAA 4OP4A 3WC5A 3B7IA 3CXSA 5EMIA 3C26A 4KUAA 4MHZA 2B4BA 1XF8A 2ZEHA 1VHSA 2PRQA 2ZEEA 4JWPA 4ZY2A 2Z3OA 1ZLIA 3TT2A 3LWUA 4OC1A 2Y0MA 4EVYA 4F8ZA 1VHEA 1IU8A 2H5MA 1TKFA 5HXDA 2DPSA 5EC4A 1CM0A 4RI1A 1YK3A 2JLMA 1UFHA 2Q7SA 3PB6X 2POKA 4KOSA 4MCPA 4JXRA 1CPSA 4OADA 4E2AA 1TIQA 4P10A 4CAFA 1JQGA 2YNCC 3CDXA 2G0BA 3A9LA 5F48A 5F49A 3SJEA 2PJ1A 2PJ0A 1LCPA 2QYVA 1Z2LA 5EBVA 1VGYA 4B5OA 2PJ4A 3SI0A 1XOVA 3WC6A 4YFJA 1PU9A 4FD4A 1HEEA 4P4IA 3KQZA 4U9YA 2REFA 2Q7BA 3VH9A 4II9A 2B4DA 4GM5A 4A94A 2GIVA 2J9AA 3B3SA 4YGOA 4P4DA 4XNHB 2OB0A 4JXQA 3VWDA 2ZOGA 4M3SA 1NSLA 5IV0A 2ZW5A 1M4LA 4UCMA 1XFOA 3I9SA 3TCVA 2O53A 4M6IA 1GYTA 4CGNA 2QVPA 5F09A 4Q36A 2IQ6A 1LAPA 4UEFA 3IU1A 1DTDA 4WJBA 4ZY1A 3S9LA 1XE4A 3CPAA 3RO0A 4C7HA 3ISXA 2Z3PA 3IJ3A 4MFKA 5JQ4A 2PDOA 4CPAA 2AFMA 1KWMA 1Z8LA 4F9VA 3F5BA 3JRUA 2QMLA 4Q7AA 3DSBA 4PK2A 3R95A 2PJ8A 3T9YA 4A37A 4B11A 4YU9A 4FD5A 1LAMA 1YW4A 3B3CA 4XPDC 1P4NA 2CY2A 3SI2A 4YWYA 1S7NA 2ZW7A 3JVNA 2ZW6A 3G3SA 2YGWA 1Z8XA 4IHMA 5CPAA 4OIWA 7CPAA 4PSWA 4AXVA 4P4BA 5HH1A 5DWNA 1F2OA 1YQEA 2EWBA 3BI0A 4UF4A 4X2TA 1R43A 2PJ7A 2EVNA 3D3SA 4KOTA 4M6GA 3D66A 2OZHA 8CPAA 1XBUA 3N7ZA 1DE4C 2CNSA 4NCZA 4CRYB 1I1DA 1YREA 2ZXVA 2Q4YA 1AYEA 3LACA 4MFJA 2CXAA 1F2PA 2GE3A 3I1UA 5G22A 4AB7A 4MI4A 4MY0A 4HNXB 4QC6A 4B12A 1AMPA 4M6HA 3NE7A 4FD6A 3MGDA 1PYTB 4MCQA 4AG7A 1NE9A 4CRZB 2CTCA 2JBKA 3CXQA 3IWEA 4MFZA 4PV6A 5HVHA 5AG5A 4CGLA 2V8DA 4XPLA 5E96A 4ZX9A 1BAVA 3FRMA 2GLFA 4NGTA 1Z5RA 1I12A 2QJ8A 3IFEA 3NH4A 3QB8A 3KASA 2O28A 4KSAA 3GLJA 2B3UA 1YSJA 2VI7A 3DR6A 4A32A 1ZG9A 4RN7A 3RZAA 3DGVA 3FECA 4C68A 4A31A 4QVTA 3V8IA 3TX8A 3BXMA 3KR5A 1IY7A 3PBBA 4HPSA 1R3NA 4MHPA 3WABA 3IO1A 3BJ8A 2NSMA 1ELMP 3PBEA 4CYQA 3GKRA 4NXYA 2DEAA 3VARA 2FCKA 2EK8A 2VL1A 3EXNA 3KR4A 2ABZA 3K9TA 4ONUA 4C2XA 5HVGA 1HDQA 2OZGA 2PR8A 4AG9A 1N71A 3FX6A 1X12A 1YGHA 5JGFA 1IOFA 4NGNA 4PPZA 3EC4A 4ORFA 2BEIA 2RB7A 5J8CA 1F57A 4MHDA 2ZEPA 4BINA 4GS4A 3BI1A 4OC2A 2R8VA 3TO7A 3TFYA 1MJBA 2ATRA 2B3VA 4NEXA 2C1CA 5C88A 1QSTA 3KZWA 1YR0A 2CIJA 4UBRA 1MJ9A 3SHPA 3B35A 4LX9A 4Q38A 3TTHA 2DF5A 3V38A 1UWYA 3NFZA 2WZNA 1Z8TA 4R3LA 2GREA 4HKFA 5K8NA 5AG7A 4C2ZA 3LODA 4NFRA 4QBJA 1BPNA 2PJBA 2PJCA 5ISVA 3TO6A 1ON0A 2CNMA 1CBXA 2FVGA 1Y9KA 4DNCA 4PSXA 4R9MA 3FEEA 1Q7LA 3DNSA 3P2HA 4DUKA 1MK4A 3WT4A 3EO4A 5A28A 1K4JA 4YRHA 1RXTA 2ZELA 4P45A 4PK3A 1CJWA 1XMBA 4UA3A 5F47A 1Y7RA 4X8IA 5JPHA 4NGSA 2AFWA 3H8FA 2WSAA 1QSRA 4L8AA 5JM6A 3CXPA 2X7BA 4H2KA 3DDDA 4R7MA 5G20A 3ISZA 1LANA 2I79A 3KL9A 4MJ8A 3KHXA 1Q2YA 1Y0YA 3B8GA 2BOAA 4R3KA 4B5PA 3B2YA 2HB6A 3IIBA 3LMSA 3PZJA 2C6PA 2QIRA 5K8OA 3FIXA 2B5GA 2P0WA 3FJUA 3PB8X 4CS0B 2ZW4A 4O23A 1Y7EA 4FUUA 2FXFA 4IAVA 3VWEA 4E8OA 5LYLA 4WWVA 4ONWA 5DS0A 2BO9A 3B3WA 4CGMA 3KQXA 3TE4A 3QNVA 4IF5A 1CX8A 1R57A 4G1PA 4PXEA 4MRIA 2R98A 4OLLA 1BOBA 2REEA 3ZZIA 4QB9A 1ZLHA 2BUEA 3QAYA 2CNTA 5LRJA 4NJRA 4I49A 3RYOA 1PCAA 3BHXA 5ELYA 2F7VA 2IJZA 3IEHA 4NJQA 4H89A 3NE8A 3D7HA 4W9YA 3WC7A 3FF3A 4A95A 4M85A 2HUZA 2FT0A 2JEWA 4DJLA 2AFXA 1BO4A 5D8NA 4K30A 5AG4A 3D67A 5THWA 1P0HA 2PIYA 2EK9A 4CYOA 2D4OA 2PIZA 2GANA 3PRTA 4UWIA 2RFHA 3RAMA 3SXOA 4MFPA 4E0AA 2PRBA 2F8HA 2HC9A 2PJ6A 3MRUA 4MY3A 4FD7A 3RBUA 2PVWA 3HUVA 3S9MA 4EFDA 4MBUA 1M4GA 5K8PA 5LRGA 2R1IA 4P4FA 3G8WA 5BWAB 2CTBA 4PXCA 2XEIA 2OR4A 2P6FA 4A38A 1RTQA 3SI1A 4F0XA 2NMTA 3T90A 2PVVA 3EY5A 4B6ZA 3GYAA 5G21A 2AFSA 4PXBA 1TKHA 4Y49C 3B3VA 4OC0A 4A2ZA 4FBEA 2C6GA 2QECA 3R9GA 2Z3KA 5LYIA 3KKWA 3D7DA 2ARHA 1CP7A 2I00A 2Z3MA 3D7FA 3NA6A 4Z65A 5HMNA 4CAWA 4LUAA 2BCOA 3T8WA 3PEIA 5IX3A 2Q44A 1X10A 2A4NA 4B10A 2ZOFA 4KVOE 2PC1A 5G1ZA 1KUXA 3S6KA 3PFOA 2VQYA 4ZX8A 4F9UA 1TF8A 2PSWA 4UEEA 4NGRA 1ZG8A 4HNWB 2IMOA 5KTDA 5J8FA 1Q2DA 3R1KA 3R96A 2OH1A 2P6GA 3P2FA 5K8MA 1H8LA 2KCWA 2Q0YA 4X3RA 3D8PA 3BLNA 4XPDB 4MHNA 4AVBA 1IGBA 2K5TA 1M4IA 2AJ6A 4CGOA 1QMUA 1S5KA 1V0CA 3TOBA 2GLJA 3B3TA 4ZBGA 3GIUA 3W6XA 1A2ZA 2Q4VA
chains in the Genus database with same CATH topology
4BBHA 3IU2A 4KSFA 1KUVA 1Z4RA 5F46A 5C82A 2FIWA 4X5KA 4KLVA 2PQ8A 4XNHC 3OWCA 4UFXA 4KLWA 1B6BA 4B5PB 4B13A 4CYPA 1GHEA 4F6AA 2B4DB 4NF1A 1KUYA 1OZPA 1S7FA 2FL4A 4JLYA 4UCNA 3F0AA 4OAEA 3TOAA 1IIDA 2BSWA 4KOUA 1Y9WA 3PGPA 4KS9A 1Z4EA 1NMTA 2HQYA 4AVCA 3BJ7A 4H6UA 2RC4A 3TO9A 1S7LA 1IYLA 4UWJA 4C7IA 1WK4A 3QAHA 3K9UA 1J4JA 1S7KA 3FBUA 1YX0A 2J8NA 2WPWA 1M44A 2FE7A 3FB3A 1WWZA 2FSRA 4H6ZA 4ZGYB 3S6GA 4CAVA 1B87A 3FNCA 3F8KA 4KVXA 4U9ZA 2R7HA 1YLEA 3LD2A 2D4PA 5AG6A 3FYNA 4JD6A 2Z3LA 4UFWA 2OZUA 1QSNA 2JDCA 3S6FA 2VZZA 4KOYA 4A30A 1U6MA 1FY7A 3S6HA 4CAEA 1IYKA 4AVAA 3IGRA 2F5IA 1RO5A 3IWGA 1I21A 2DPTA 2JEVA 5DWMA 4MFQA 4KVME 4UFVA 2Z0ZA 2ZPAA 4F0YA 1Q2CA 1M4DA 2OU2A 4HNYB 4KZTA 2DXQA 2VZYA 5CNPA 5A27A 3JTKA 3H4QA 2FS5A 2Q04A 1Z9UA 4CYNA 4KORA 3GY9A 2VXKA 2WUUA 5H86A 5KTCA 4B14A 1S60A 1S3ZA 1LRZA 2P6EA 4NSQA 2FIAA 3D2PA 1MJAA 1VKCA 2VBQA 1YVOA 2G3TA 4IUSA 3JUWA 3R9FA 4J3GA 3H5ZA 4QUSA 2C27A 2PR1A 4KOXA 3W6SA 5AGEA 1ZO0A 4C2YA 1IB1E 2JDDA 2Z11A 2AE6A 1XEBA 3I3GA 2B58A 1QSOA 1M1DA 3ZJ0A 4CAXA 5I0CA 4RS2A 5GCNA 4MFLA 1XMTA 1YVKA 2WPXA 1L0CA 2J8MA 4R87A 2BL1A 4L89A 2G3AA 2YNEA 2Z10A 4U5YA 3W91A 4A33A 3DR8A 2J8RA 2YNCA 4BMHA 3E0KA 4R57A 1SQHA 1XIXA 3EFAA 3FXTA 5FVJA 2VEZA 4KUBA 4CGPA 2EUIA 4KOWA 2B5GB 3PP9A 5H84A 2HV2A 3D2MA 4KOVA 4JJXA 5KTAA 4XPKA 2YNDA 4Y49B 3WR7A 2Z3NA 2IL4A 4UCPA 1KZFA 1QSMA 3SXNA 5IB0A 1IICA 3UY5A 3R9EA 1PUAA 3CXSA 3C26A 4KUAA 2B4BA 1XF8A 1VHSA 4JWPA 3TT2A 2Y0MA 4EVYA 2H5MA 2DPSA 5EC4A 1CM0A 4RI1A 1YK3A 2JLMA 1UFHA 4KOSA 4JXRA 4OADA 4E2AA 1TIQA 4CAFA 2YNCC 2G0BA 3A9LA 5F48A 5F49A 5EBVA 4B5OA 4YFJA 1PU9A 4FD4A 4U9YA 4II9A 2REFA 2Q7BA 2B4DA 2GIVA 4YGOA 4XNHB 2OB0A 4JXQA 3VWDA 1NSLA 4M3SA 5IV0A 2ZW5A 4UCMA 3I9SA 3TCVA 4CGNA 4Q36A 3IU1A 1XE4A 4C7HA 2Z3PA 4MFKA 5JQ4A 2PDOA 3F5BA 3R95A 2QMLA 3T9YA 3DSBA 4PK2A 4B11A 4FD5A 4XPDC 1P4NA 2CY2A 1S7NA 2ZW7A 3JVNA 2ZW6A 3G3SA 2YGWA 4PSWA 5HH1A 5DWNA 4KOTA 2EVNA 3D3SA 2OZHA 3N7ZA 2CNSA 4NCZA 4CRYB 1I1DA 1YREA 2ZXVA 2Q4YA 4MFJA 2CXAA 2GE3A 5G22A 4AB7A 4MI4A 4MY0A 4HNXB 4QC6A 4B12A 3NE7A 4FD6A 3MGDA 4AG7A 1NE9A 4CRZB 3CXQA 3IWEA 4MFZA 4PV6A 5AG5A 4CGLA 4XPLA 5E96A 3FRMA 1I12A 3QB8A 2O28A 4KSAA 2B3UA 2VI7A 3DR6A 4A32A 4C68A 4A31A 4QVTA 3V8IA 3BJ8A 4CYQA 3GKRA 4NXYA 2FCKA 3EXNA 4ONUA 4C2XA 2OZGA 2PR8A 4AG9A 1N71A 1YGHA 3EC4A 4ORFA 2BEIA 5J8CA 4MHDA 4GS4A 3TFYA 2R8VA 3TO7A 1MJBA 2ATRA 2B3VA 4NEXA 5C88A 1QSTA 1YR0A 4UBRA 1MJ9A 3SHPA 4LX9A 4Q38A 3TTHA 4R3LA 4HKFA 5AG7A 4C2ZA 3LODA 4QBJA 5ISVA 3TO6A 1ON0A 2CNMA 1Y9KA 4DNCA 4PSXA 4R9MA 3DNSA 3P2HA 1MK4A 3EO4A 5A28A 1K4JA 4YRHA 1RXTA 4PK3A 1CJWA 5F47A 4UA3A 1Y7RA 5JPHA 2WSAA 1QSRA 4L8AA 3CXPA 2X7BA 3DDDA 2I79A 4MJ8A 1Q2YA 3B8GA 4R3KA 4B5PA 3PZJA 2QIRA 3FIXA 2B5GA 2P0WA 4CS0B 2ZW4A 2FXFA 3VWEA 4E8OA 4CGMA 3TE4A 4IF5A 1R57A 2R98A 4OLLA 1BOBA 2REEA 3ZZIA 4QB9A 2BUEA 2CNTA 4I49A 3RYOA 4H89A 4A95A 4M85A 2HUZA 2FT0A 1BO4A 4K30A 5AG4A 1P0HA 4CYOA 2D4OA 2GANA 4UWIA 3SXOA 4E0AA 4MFPA 2PRBA 4MY3A 4FD7A 4MBUA 1M4GA 2R1IA 3G8WA 5BWAB 2P6FA 4F0XA 2NMTA 3T90A 3EY5A 3GYAA 5G21A 4Y49C 4A2ZA 2QECA 3R9GA 2Z3KA 3KKWA 2ARHA 2I00A 2Z3MA 5HMNA 4CAWA 4LUAA 5IX3A 2Q44A 2A4NA 4B10A 4KVOE 2PC1A 5G1ZA 1KUXA 3S6KA 2VQYA 2PSWA 4HNWB 5KTDA 5J8FA 1Q2DA 3R1KA 3R96A 2OH1A 2P6GA 3P2FA 2KCWA 2Q0YA 3D8PA 3BLNA 4XPDB 4AVBA 2K5TA 1M4IA 2AJ6A 4CGOA 1S5KA 1V0CA 3TOBA 4ZBGA 5G20A 3W6XA 2Z3OA 2Q4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KUV A;  1Z4R A;  5F46 A;  5C82 A;  2FIW A;  4X5K A;  4KLV A;  2PQ8 A;  4XNH C;  3OWC A;  4KLW A;  1B6B A;  4B5P B;  1GHE A;  4F6A A;  2B4D B;  4NF1 A;  1KUY A;  1OZP A;  1S7F A;  2FL4 A;  4JLY A;  3F0A A;  4OAE A;  3TOA A;  1IID A;  2BSW A;  4KOU A;  1Y9W A;  3PGP A;  1Z4E A;  1NMT A;  2HQY A;  4AVC A;  3BJ7 A;  4H6U A;  2RC4 A;  3TO9 A;  1S7L A;  1IYL A;  4UWJ A;  1WK4 A;  3QAH A;  3K9U A;  1J4J A;  1S7K A;  3FBU A;  1YX0 A;  2J8N A;  2WPW A;  1M44 A;  2FE7 A;  3FB3 A;  1WWZ A;  2FSR A;  4H6Z A;  3S6G A;  4CAV A;  1B87 A;  3FNC A;  3F8K A;  4KVX A;  4U9Z A;  2R7H A;  1YLE A;  3LD2 A;  2D4P A;  3FYN A;  4JD6 A;  2OZU A;  1QSN A;  2JDC A;  3S6F A;  2VZZ A;  4KOY A;  1U6M A;  1FY7 A;  3S6H A;  1IYK A;  4AVA A;  3IGR A;  2F5I A;  1RO5 A;  3IWG A;  1I21 A;  2JEV A;  5DWM A;  4KVM E;  2Z0Z A;  2ZPA A;  4F0Y A;  1Q2C A;  1M4D A;  2OU2 A;  4HNY B;  4KZT A;  2DXQ A;  2VZY A;  5CNP A;  3H4Q A;  2FS5 A;  2Q04 A;  1Z9U A;  4KOR A;  3GY9 A;  2VXK A;  5H86 A;  5KTC A;  1S60 A;  1S3Z A;  1LRZ A;  2P6E A;  4NSQ A;  2FIA A;  3D2P A;  1MJA A;  1VKC A;  2VBQ A;  1YVO A;  2G3T A;  4IUS A;  3JUW A;  3R9F A;  4J3G A;  4QUS A;  2C27 A;  2PR1 A;  4KOX A;  3W6S A;  1IB1 E;  2JDD A;  2Z11 A;  2AE6 A;  1XEB A;  3I3G A;  2B58 A;  1QSO A;  1M1D A;  3ZJ0 A;  4CAX A;  5I0C A;  4RS2 A;  5GCN A;  1XMT A;  1YVK A;  2WPX A;  1L0C A;  2J8M A;  4R87 A;  2BL1 A;  4L89 A;  2G3A A;  2Z10 A;  4U5Y A;  3W91 A;  3DR8 A;  2J8R A;  4BMH A;  3E0K A;  4R57 A;  1SQH A;  1XIX A;  3EFA A;  3FXT A;  5FVJ A;  2VEZ A;  4KUB A;  2EUI A;  4KOW A;  2B5G B;  3PP9 A;  5H84 A;  2HV2 A;  3D2M A;  4KOV A;  4JJX A;  5KTA A;  4XPK A;  4Y49 B;  3WR7 A;  2IL4 A;  1KZF A;  1QSM A;  3SXN A;  5IB0 A;  1IIC A;  3UY5 A;  3R9E A;  1PUA A;  3CXS A;  3C26 A;  4KUA A;  2B4B A;  1XF8 A;  1VHS A;  4JWP A;  3TT2 A;  2Y0M A;  4EVY A;  2H5M A;  5EC4 A;  1CM0 A;  4RI1 A;  1YK3 A;  2JLM A;  1UFH A;  4KOS A;  4JXR A;  4OAD A;  4E2A A;  1TIQ A;  2G0B A;  5F48 A;  5F49 A;  5EBV A;  4B5O A;  4YFJ A;  1PU9 A;  4FD4 A;  4U9Y A;  4II9 A;  2REF A;  2Q7B A;  2B4D A;  2GIV A;  4YGO A;  4XNH B;  2OB0 A;  4JXQ A;  3VWD A;  1NSL A;  4M3S A;  5IV0 A;  2ZW5 A;  3I9S A;  3TCV A;  1XE4 A;  5JQ4 A;  2PDO A;  3F5B A;  3R95 A;  2QML A;  3T9Y A;  3DSB A;  4PK2 A;  4FD5 A;  4XPD C;  1P4N A;  2CY2 A;  1S7N A;  2ZW7 A;  3JVN A;  2ZW6 A;  3G3S A;  4PSW A;  5HH1 A;  5DWN A;  4KOT A;  2EVN A;  3D3S A;  2OZH A;  3N7Z A;  2CNS A;  4NCZ A;  4CRY B;  1I1D A;  1YRE A;  2ZXV A;  2Q4Y A;  2GE3 A;  4AB7 A;  4MI4 A;  4MY0 A;  4HNX B;  4QC6 A;  3NE7 A;  4FD6 A;  3MGD A;  4AG7 A;  1NE9 A;  4CRZ B;  3CXQ A;  4PV6 A;  4XPL A;  5E96 A;  3FRM A;  1I12 A;  3QB8 A;  2O28 A;  2B3U A;  2VI7 A;  3DR6 A;  4QVT A;  3V8I A;  3BJ8 A;  3GKR A;  4NXY A;  2FCK A;  3EXN A;  4ONU A;  2OZG A;  2PR8 A;  4AG9 A;  1N71 A;  1YGH A;  3EC4 A;  4ORF A;  2BEI A;  5J8C A;  4MHD A;  4GS4 A;  3TFY A;  2R8V A;  3TO7 A;  1MJB A;  2ATR A;  2B3V A;  4NEX A;  5C88 A;  1QST A;  1YR0 A;  4UBR A;  1MJ9 A;  3SHP A;  4LX9 A;  3TTH A;  4R3L A;  4HKF A;  3LOD A;  4QBJ A;  5ISV A;  3TO6 A;  1ON0 A;  2CNM A;  1Y9K A;  4DNC A;  4PSX A;  4R9M A;  3DNS A;  3P2H A;  1MK4 A;  3EO4 A;  1K4J A;  4YRH A;  1RXT A;  4PK3 A;  1CJW A;  5F47 A;  4UA3 A;  1Y7R A;  5JPH A;  1QSR A;  4L8A A;  3CXP A;  2X7B A;  3DDD A;  2I79 A;  4MJ8 A;  1Q2Y A;  3B8G A;  4R3K A;  4B5P A;  3PZJ A;  2QIR A;  3FIX A;  2B5G A;  2P0W A;  4CS0 B;  2ZW4 A;  2FXF A;  3VWE A;  4E8O A;  3TE4 A;  4IF5 A;  1R57 A;  2R98 A;  4OLL A;  1BOB A;  2REE A;  3ZZI A;  4QB9 A;  2BUE A;  2CNT A;  4I49 A;  3RYO A;  4H89 A;  4M85 A;  2HUZ A;  2FT0 A;  1BO4 A;  4K30 A;  1P0H A;  2D4O A;  2GAN A;  4UWI A;  3SXO A;  4E0A A;  2PRB A;  4MY3 A;  4FD7 A;  4MBU A;  1M4G A;  2R1I A;  3G8W A;  2P6F A;  2NMT A;  3T90 A;  3EY5 A;  3GYA A;  4Y49 C;  2QEC A;  3R9G A;  3KKW A;  2ARH A;  2I00 A;  5HMN A;  4CAW A;  4LUA A;  5IX3 A;  2Q44 A;  2A4N A;  4KVO E;  2PC1 A;  1KUX A;  3S6K A;  2VQY A;  2PSW A;  4HNW B;  5KTD A;  5J8F A;  1Q2D A;  3R1K A;  3R96 A;  2OH1 A;  2P6G A;  3P2F A;  2KCW A;  2Q0Y A;  3D8P A;  3BLN A;  4XPD B;  4AVB A;  2K5T A;  1M4I A;  2AJ6 A;  1S5K A;  1V0C A;  3TOB A;  4ZBG A;  3W6X A;  2Q4V A; 
#chains in the Genus database with same CATH topology
 1YLO A;  4BBH A;  4P4J A;  3IU2 A;  1ARM A;  4KSF A;  1KUV A;  1Z4R A;  3H8E A;  2V77 A;  2FIW A;  2ZEF A;  5C82 A;  5F46 A;  2OOT A;  4A39 A;  4X5K A;  4KLV A;  2AFU A;  3VAT A;  4OKO A;  2PQ8 A;  4XNH C;  3OWC A;  1BLL E;  4KLW A;  1B6B A;  4UFX A;  3FED A;  4B13 A;  4B5P B;  4FWU A;  4BD9 A;  4CYP A;  1GHE A;  1CPX A;  4F6A A;  2B4D B;  2PJ5 A;  3L2N A;  4NF1 A;  3D7G A;  2V8H A;  1KUY A;  1OZP A;  1LFW A;  1S7F A;  2FL4 A;  4JLY A;  4MHY A;  3F0A A;  3KGQ A;  4OAE A;  4UCN A;  1Y0R A;  4OC4 A;  4R8F A;  2PJ2 A;  3TOA A;  6CPA A;  1IID A;  2BSW A;  1EE3 P;  4KOU A;  4EWT A;  2PCU A;  1Y9W A;  2PJ3 A;  2ZEN A;  2JBJ A;  3CPX A;  3PGP A;  4KS9 A;  1Z4E A;  3FH4 A;  1NMT A;  2HQY A;  2NYQ A;  4MMO A;  3BJ7 A;  2PE3 A;  2Q4Z A;  4H6U A;  2RC4 A;  4MCS A;  1S7L A;  4P4E A;  3TO9 A;  4RUH A;  4P44 A;  1IYL A;  4OC5 A;  4UWJ A;  5D29 A;  2C6C A;  4C7I A;  1WK4 A;  2I3C A;  3PB7 X;  4JYW A;  3D4U A;  3IC1 A;  4PQA A;  3QAH A;  1Z8W A;  3K9U A;  2Q43 A;  3RNZ A;  1J4J A;  1S7K A;  3H8G A;  1VHO A;  4NGQ A;  3FBU A;  1YX0 A;  2J8N A;  2WPW A;  4LQ6 A;  1M44 A;  1BPM A;  2FE7 A;  3FB3 A;  1WWZ A;  2FSR A;  4H6Z A;  4ZGY B;  1LOK A;  5HVF A;  1XJO A;  3S6G A;  4CAV A;  3FMC A;  1B87 A;  3FNC A;  3F8K A;  4R6T A;  4KVX A;  3HLP A;  4U9Z A;  2R7H A;  1YLE A;  3PFE A;  1NSA A;  3LD2 A;  2D4P A;  5AG6 A;  2ZEM A;  3FYN A;  4JD6 A;  4ZYQ A;  2Z3L A;  4UFW A;  5J1Q A;  3SJX A;  2PJ9 A;  3N5F A;  2OZU A;  1YW6 A;  1QSN A;  4PXD A;  2JDC A;  5JH9 A;  3S6F A;  2VZZ A;  4KOY A;  4A30 A;  1U6M A;  2ZEG A;  3IWW A;  2ODF A;  4OME A;  5LRK A;  1FY7 A;  3S6H A;  4CAE A;  1IYK A;  4AVA A;  3IGR A;  5LYD A;  4EME A;  2F5I A;  1RO5 A;  3IWG A;  1I21 A;  2DPT A;  1CG2 A;  4TWE A;  1ARL A;  2GFQ A;  2JEV A;  5DWM A;  1CP6 A;  4MFQ A;  4KVM E;  2ANP A;  4UFV A;  2O4H A;  4ZI6 A;  4UIB A;  4UEZ A;  2Z0Z A;  2ZPA A;  5LYF A;  4F0Y A;  4P6Y A;  1Q2C A;  3CZX A;  1M4D A;  1IOI A;  4KSI A;  3SJF A;  4IK2 A;  2OU2 A;  4HNY B;  4KZT A;  2DXQ A;  2VZY A;  5CNP A;  1FT7 A;  3NH5 A;  5A27 A;  3JTK A;  3H4Q A;  2FS5 A;  1XRY A;  2Q04 A;  1Z9U A;  4CYN A;  4KOR A;  2PJA A;  3GY9 A;  2VXK A;  2WUU A;  2WYR A;  5H86 A;  4MXU A;  5KTC A;  4B14 A;  1S60 A;  1S3Z A;  1LRZ A;  4UIA A;  2P6E A;  4NSQ A;  2V8V A;  2FIA A;  4JZ0 A;  3D2P A;  3V7Z A;  3MN8 A;  2EBJ A;  1MJA A;  5I4M A;  4FAI A;  2AFZ A;  1VKC A;  2VBQ A;  3CT9 A;  3TC8 A;  3KHZ A;  1YVO A;  2G3T A;  4IUS A;  3GB0 A;  2GU2 A;  3JUW A;  3R9F A;  4J3G A;  2EO8 A;  3H5Z A;  4DYO A;  2Q51 A;  3PB9 X;  4QUS A;  2C27 A;  2PR1 A;  1FNO A;  4KOX A;  1ZG7 A;  1QQ9 A;  5AGE A;  1ZO0 A;  3W6S A;  4C2Y A;  1IB1 E;  2JDD A;  2Z11 A;  2AE6 A;  3NH8 A;  1XEB A;  2ZED A;  3I3G A;  2B58 A;  1QSO A;  4AVC A;  3S9N A;  1M1D A;  3ZJ0 A;  4CAX A;  5CBM A;  1OBR A;  4LQG A;  4RS2 A;  5I0C A;  5GCN A;  4NGM A;  4OID A;  2XEF A;  4MFL A;  1AUG A;  1XMT A;  1YVK A;  2WPX A;  1L0C A;  2J8M A;  4R87 A;  2BL1 A;  4L89 A;  2V8G A;  1YME A;  2G3A A;  2YNE A;  2Z10 A;  4U5Y A;  4R76 A;  4ZY0 A;  3W91 A;  4A33 A;  4MCR A;  3DR8 A;  2G9D A;  2J8R A;  2CF4 A;  2YNC A;  4BMH A;  3E0K A;  1TF9 A;  3PB4 X;  3GUX A;  4R57 A;  1SQH A;  1HDU A;  1XIX A;  3EFA A;  5IB9 A;  4OC3 A;  3DLJ A;  3FXT A;  5FVJ A;  2VEZ A;  4KUB A;  2XEG A;  4CGP A;  1JWQ A;  4GXH A;  1VIX A;  2AFO A;  2EUI A;  4KOW A;  3D68 A;  4NGP A;  2B5G B;  3PP9 A;  5H84 A;  2HV2 A;  1TXR A;  3KI9 A;  3D2M A;  4KOV A;  4JJX A;  5KTA A;  4K3N A;  1TKJ A;  4XPK A;  2YND A;  4Y49 B;  3WR7 A;  2ZEO A;  2Z3N A;  4TNU A;  2IL4 A;  4UCP A;  1KZF A;  2XEJ A;  1QSM A;  3SXN A;  5IB0 A;  3SJG A;  1IIC A;  1ELL P;  3R9E A;  3FVL A;  3K2K A;  3UY5 A;  1PUA A;  4OP4 A;  3WC5 A;  3B7I A;  3CXS A;  5EMI A;  3C26 A;  4KUA A;  4MHZ A;  2B4B A;  1XF8 A;  2ZEH A;  1VHS A;  2PRQ A;  2ZEE A;  4JWP A;  4ZY2 A;  2Z3O A;  1ZLI A;  3TT2 A;  3LWU A;  4OC1 A;  2Y0M A;  4EVY A;  4F8Z A;  1VHE A;  1IU8 A;  2H5M A;  1TKF A;  5HXD A;  2DPS A;  5EC4 A;  1CM0 A;  4RI1 A;  1YK3 A;  2JLM A;  1UFH A;  2Q7S A;  3PB6 X;  2POK A;  4KOS A;  4MCP A;  4JXR A;  1CPS A;  4OAD A;  4E2A A;  1TIQ A;  4P10 A;  4CAF A;  1JQG A;  2YNC C;  3CDX A;  2G0B A;  3A9L A;  5F48 A;  5F49 A;  3SJE A;  2PJ1 A;  2PJ0 A;  1LCP A;  2QYV A;  1Z2L A;  5EBV A;  1VGY A;  4B5O A;  2PJ4 A;  3SI0 A;  1XOV A;  3WC6 A;  4YFJ A;  1PU9 A;  4FD4 A;  1HEE A;  4P4I A;  3KQZ A;  4U9Y A;  2REF A;  2Q7B A;  3VH9 A;  4II9 A;  2B4D A;  4GM5 A;  4A94 A;  2GIV A;  2J9A A;  3B3S A;  4YGO A;  4P4D A;  4XNH B;  2OB0 A;  4JXQ A;  3VWD A;  2ZOG A;  4M3S A;  1NSL A;  5IV0 A;  2ZW5 A;  1M4L A;  4UCM A;  1XFO A;  3I9S A;  3TCV A;  2O53 A;  4M6I A;  1GYT A;  4CGN A;  2QVP A;  5F09 A;  4Q36 A;  2IQ6 A;  1LAP A;  4UEF A;  3IU1 A;  1DTD A;  4WJB A;  4ZY1 A;  3S9L A;  1XE4 A;  3CPA A;  3RO0 A;  4C7H A;  3ISX A;  2Z3P A;  3IJ3 A;  4MFK A;  5JQ4 A;  2PDO A;  4CPA A;  2AFM A;  1KWM A;  1Z8L A;  4F9V A;  3F5B A;  3JRU A;  2QML A;  4Q7A A;  3DSB A;  4PK2 A;  3R95 A;  2PJ8 A;  3T9Y A;  4A37 A;  4B11 A;  4YU9 A;  4FD5 A;  1LAM A;  1YW4 A;  3B3C A;  4XPD C;  1P4N A;  2CY2 A;  3SI2 A;  4YWY A;  1S7N A;  2ZW7 A;  3JVN A;  2ZW6 A;  3G3S A;  2YGW A;  1Z8X A;  4IHM A;  5CPA A;  4OIW A;  7CPA A;  4PSW A;  4AXV A;  4P4B A;  5HH1 A;  5DWN A;  1F2O A;  1YQE A;  2EWB A;  3BI0 A;  4UF4 A;  4X2T A;  1R43 A;  2PJ7 A;  2EVN A;  3D3S A;  4KOT A;  4M6G A;  3D66 A;  2OZH A;  8CPA A;  1XBU A;  3N7Z A;  1DE4 C;  2CNS A;  4NCZ A;  4CRY B;  1I1D A;  1YRE A;  2ZXV A;  2Q4Y A;  1AYE A;  3LAC A;  4MFJ A;  2CXA A;  1F2P A;  2GE3 A;  3I1U A;  5G22 A;  4AB7 A;  4MI4 A;  4MY0 A;  4HNX B;  4QC6 A;  4B12 A;  1AMP A;  4M6H A;  3NE7 A;  4FD6 A;  3MGD A;  1PYT B;  4MCQ A;  4AG7 A;  1NE9 A;  4CRZ B;  2CTC A;  2JBK A;  3CXQ A;  3IWE A;  4MFZ A;  4PV6 A;  5HVH A;  5AG5 A;  4CGL A;  2V8D A;  4XPL A;  5E96 A;  4ZX9 A;  1BAV A;  3FRM A;  2GLF A;  4NGT A;  1Z5R A;  1I12 A;  2QJ8 A;  3IFE A;  3NH4 A;  3QB8 A;  3KAS A;  2O28 A;  4KSA A;  3GLJ A;  2B3U A;  1YSJ A;  2VI7 A;  3DR6 A;  4A32 A;  1ZG9 A;  4RN7 A;  3RZA A;  3DGV A;  3FEC A;  4C68 A;  4A31 A;  4QVT A;  3V8I A;  3TX8 A;  3BXM A;  3KR5 A;  1IY7 A;  3PBB A;  4HPS A;  1R3N A;  4MHP A;  3WAB A;  3IO1 A;  3BJ8 A;  2NSM A;  1ELM P;  3PBE A;  4CYQ A;  3GKR A;  4NXY A;  2DEA A;  3VAR A;  2FCK A;  2EK8 A;  2VL1 A;  3EXN A;  3KR4 A;  2ABZ A;  3K9T A;  4ONU A;  4C2X A;  5HVG A;  1HDQ A;  2OZG A;  2PR8 A;  4AG9 A;  1N71 A;  3FX6 A;  1X12 A;  1YGH A;  5JGF A;  1IOF A;  4NGN A;  4PPZ A;  3EC4 A;  4ORF A;  2BEI A;  2RB7 A;  5J8C A;  1F57 A;  4MHD A;  2ZEP A;  4BIN A;  4GS4 A;  3BI1 A;  4OC2 A;  2R8V A;  3TO7 A;  3TFY A;  1MJB A;  2ATR A;  2B3V A;  4NEX A;  2C1C A;  5C88 A;  1QST A;  3KZW A;  1YR0 A;  2CIJ A;  4UBR A;  1MJ9 A;  3SHP A;  3B35 A;  4LX9 A;  4Q38 A;  3TTH A;  2DF5 A;  3V38 A;  1UWY A;  3NFZ A;  2WZN A;  1Z8T A;  4R3L A;  2GRE A;  4HKF A;  5K8N A;  5AG7 A;  4C2Z A;  3LOD A;  4NFR A;  4QBJ A;  1BPN A;  2PJB A;  2PJC A;  5ISV A;  3TO6 A;  1ON0 A;  2CNM A;  1CBX A;  2FVG A;  1Y9K A;  4DNC A;  4PSX A;  4R9M A;  3FEE A;  1Q7L A;  3DNS A;  3P2H A;  4DUK A;  1MK4 A;  3WT4 A;  3EO4 A;  5A28 A;  1K4J A;  4YRH A;  1RXT A;  2ZEL A;  4P45 A;  4PK3 A;  1CJW A;  1XMB A;  4UA3 A;  5F47 A;  1Y7R A;  4X8I A;  5JPH A;  4NGS A;  2AFW A;  3H8F A;  2WSA A;  1QSR A;  4L8A A;  5JM6 A;  3CXP A;  2X7B A;  4H2K A;  3DDD A;  4R7M A;  5G20 A;  3ISZ A;  1LAN A;  2I79 A;  3KL9 A;  4MJ8 A;  3KHX A;  1Q2Y A;  1Y0Y A;  3B8G A;  2BOA A;  4R3K A;  4B5P A;  3B2Y A;  2HB6 A;  3IIB A;  3LMS A;  3PZJ A;  2C6P A;  2QIR A;  5K8O A;  3FIX A;  2B5G A;  2P0W A;  3FJU A;  3PB8 X;  4CS0 B;  2ZW4 A;  4O23 A;  1Y7E A;  4FUU A;  2FXF A;  4IAV A;  3VWE A;  4E8O A;  5LYL A;  4WWV A;  4ONW A;  5DS0 A;  2BO9 A;  3B3W A;  4CGM A;  3KQX A;  3TE4 A;  3QNV A;  4IF5 A;  1CX8 A;  1R57 A;  4G1P A;  4PXE A;  4MRI A;  2R98 A;  4OLL A;  1BOB A;  2REE A;  3ZZI A;  4QB9 A;  1ZLH A;  2BUE A;  3QAY A;  2CNT A;  5LRJ A;  4NJR A;  4I49 A;  3RYO A;  1PCA A;  3BHX A;  5ELY A;  2F7V A;  2IJZ A;  3IEH A;  4NJQ A;  4H89 A;  3NE8 A;  3D7H A;  4W9Y A;  3WC7 A;  3FF3 A;  4A95 A;  4M85 A;  2HUZ A;  2FT0 A;  2JEW A;  4DJL A;  2AFX A;  1BO4 A;  5D8N A;  4K30 A;  5AG4 A;  3D67 A;  5THW A;  1P0H A;  2PIY A;  2EK9 A;  4CYO A;  2D4O A;  2PIZ A;  2GAN A;  3PRT A;  4UWI A;  2RFH A;  3RAM A;  3SXO A;  4MFP A;  4E0A A;  2PRB A;  2F8H A;  2HC9 A;  2PJ6 A;  3MRU A;  4MY3 A;  4FD7 A;  3RBU A;  2PVW A;  3HUV A;  3S9M A;  4EFD A;  4MBU A;  1M4G A;  5K8P A;  5LRG A;  2R1I A;  4P4F A;  3G8W A;  5BWA B;  2CTB A;  4PXC A;  2XEI A;  2OR4 A;  2P6F A;  4A38 A;  1RTQ A;  3SI1 A;  4F0X A;  2NMT A;  3T90 A;  2PVV A;  3EY5 A;  4B6Z A;  3GYA A;  5G21 A;  2AFS A;  4PXB A;  1TKH A;  4Y49 C;  3B3V A;  4OC0 A;  4A2Z A;  4FBE A;  2C6G A;  2QEC A;  3R9G A;  2Z3K A;  5LYI A;  3KKW A;  3D7D A;  2ARH A;  1CP7 A;  2I00 A;  2Z3M A;  3D7F A;  3NA6 A;  4Z65 A;  5HMN A;  4CAW A;  4LUA A;  2BCO A;  3T8W A;  3PEI A;  5IX3 A;  2Q44 A;  1X10 A;  2A4N A;  4B10 A;  2ZOF A;  4KVO E;  2PC1 A;  5G1Z A;  1KUX A;  3S6K A;  3PFO A;  2VQY A;  4ZX8 A;  4F9U A;  1TF8 A;  2PSW A;  4UEE A;  4NGR A;  1ZG8 A;  4HNW B;  2IMO A;  5KTD A;  5J8F A;  1Q2D A;  3R1K A;  3R96 A;  2OH1 A;  2P6G A;  3P2F A;  5K8M A;  1H8L A;  2KCW A;  2Q0Y A;  4X3R A;  3D8P A;  3BLN A;  4XPD B;  4MHN A;  4AVB A;  1IGB A;  2K5T A;  1M4I A;  2AJ6 A;  4CGO A;  1QMU A;  1S5K A;  1V0C A;  3TOB A;  2GLJ A;  3B3T A;  4ZBG A;  3GIU A;  3W6X A;  1A2Z A;  2Q4V A; 
#chains in the Genus database with same CATH homology
 4BBH A;  3IU2 A;  4KSF A;  1KUV A;  1Z4R A;  5F46 A;  5C82 A;  2FIW A;  4X5K A;  4KLV A;  2PQ8 A;  4XNH C;  3OWC A;  4UFX A;  4KLW A;  1B6B A;  4B5P B;  4B13 A;  4CYP A;  1GHE A;  4F6A A;  2B4D B;  4NF1 A;  1KUY A;  1OZP A;  1S7F A;  2FL4 A;  4JLY A;  4UCN A;  3F0A A;  4OAE A;  3TOA A;  1IID A;  2BSW A;  4KOU A;  1Y9W A;  3PGP A;  4KS9 A;  1Z4E A;  1NMT A;  2HQY A;  4AVC A;  3BJ7 A;  4H6U A;  2RC4 A;  3TO9 A;  1S7L A;  1IYL A;  4UWJ A;  4C7I A;  1WK4 A;  3QAH A;  3K9U A;  1J4J A;  1S7K A;  3FBU A;  1YX0 A;  2J8N A;  2WPW A;  1M44 A;  2FE7 A;  3FB3 A;  1WWZ A;  2FSR A;  4H6Z A;  4ZGY B;  3S6G A;  4CAV A;  1B87 A;  3FNC A;  3F8K A;  4KVX A;  4U9Z A;  2R7H A;  1YLE A;  3LD2 A;  2D4P A;  5AG6 A;  3FYN A;  4JD6 A;  2Z3L A;  4UFW A;  2OZU A;  1QSN A;  2JDC A;  3S6F A;  2VZZ A;  4KOY A;  4A30 A;  1U6M A;  1FY7 A;  3S6H A;  4CAE A;  1IYK A;  4AVA A;  3IGR A;  2F5I A;  1RO5 A;  3IWG A;  1I21 A;  2DPT A;  2JEV A;  5DWM A;  4MFQ A;  4KVM E;  4UFV A;  2Z0Z A;  2ZPA A;  4F0Y A;  1Q2C A;  1M4D A;  2OU2 A;  4HNY B;  4KZT A;  2DXQ A;  2VZY A;  5CNP A;  5A27 A;  3JTK A;  3H4Q A;  2FS5 A;  2Q04 A;  1Z9U A;  4CYN A;  4KOR A;  3GY9 A;  2VXK A;  2WUU A;  5H86 A;  5KTC A;  4B14 A;  1S60 A;  1S3Z A;  1LRZ A;  2P6E A;  4NSQ A;  2FIA A;  3D2P A;  1MJA A;  1VKC A;  2VBQ A;  1YVO A;  2G3T A;  4IUS A;  3JUW A;  3R9F A;  4J3G A;  3H5Z A;  4QUS A;  2C27 A;  2PR1 A;  4KOX A;  3W6S A;  5AGE A;  1ZO0 A;  4C2Y A;  1IB1 E;  2JDD A;  2Z11 A;  2AE6 A;  1XEB A;  3I3G A;  2B58 A;  1QSO A;  1M1D A;  3ZJ0 A;  4CAX A;  5I0C A;  4RS2 A;  5GCN A;  4MFL A;  1XMT A;  1YVK A;  2WPX A;  1L0C A;  2J8M A;  4R87 A;  2BL1 A;  4L89 A;  2G3A A;  2YNE A;  2Z10 A;  4U5Y A;  3W91 A;  4A33 A;  3DR8 A;  2J8R A;  2YNC A;  4BMH A;  3E0K A;  4R57 A;  1SQH A;  1XIX A;  3EFA A;  3FXT A;  5FVJ A;  2VEZ A;  4KUB A;  4CGP A;  2EUI A;  4KOW A;  2B5G B;  3PP9 A;  5H84 A;  2HV2 A;  3D2M A;  4KOV A;  4JJX A;  5KTA A;  4XPK A;  2YND A;  4Y49 B;  3WR7 A;  2Z3N A;  2IL4 A;  4UCP A;  1KZF A;  1QSM A;  3SXN A;  5IB0 A;  1IIC A;  3UY5 A;  3R9E A;  1PUA A;  3CXS A;  3C26 A;  4KUA A;  2B4B A;  1XF8 A;  1VHS A;  4JWP A;  3TT2 A;  2Y0M A;  4EVY A;  2H5M A;  2DPS A;  5EC4 A;  1CM0 A;  4RI1 A;  1YK3 A;  2JLM A;  1UFH A;  4KOS A;  4JXR A;  4OAD A;  4E2A A;  1TIQ A;  4CAF A;  2YNC C;  2G0B A;  3A9L A;  5F48 A;  5F49 A;  5EBV A;  4B5O A;  4YFJ A;  1PU9 A;  4FD4 A;  4U9Y A;  4II9 A;  2REF A;  2Q7B A;  2B4D A;  2GIV A;  4YGO A;  4XNH B;  2OB0 A;  4JXQ A;  3VWD A;  1NSL A;  4M3S A;  5IV0 A;  2ZW5 A;  4UCM A;  3I9S A;  3TCV A;  4CGN A;  4Q36 A;  3IU1 A;  1XE4 A;  4C7H A;  2Z3P A;  4MFK A;  5JQ4 A;  2PDO A;  3F5B A;  3R95 A;  2QML A;  3T9Y A;  3DSB A;  4PK2 A;  4B11 A;  4FD5 A;  4XPD C;  1P4N A;  2CY2 A;  1S7N A;  2ZW7 A;  3JVN A;  2ZW6 A;  3G3S A;  2YGW A;  4PSW A;  5HH1 A;  5DWN A;  4KOT A;  2EVN A;  3D3S A;  2OZH A;  3N7Z A;  2CNS A;  4NCZ A;  4CRY B;  1I1D A;  1YRE A;  2ZXV A;  2Q4Y A;  4MFJ A;  2CXA A;  2GE3 A;  5G22 A;  4AB7 A;  4MI4 A;  4MY0 A;  4HNX B;  4QC6 A;  4B12 A;  3NE7 A;  4FD6 A;  3MGD A;  4AG7 A;  1NE9 A;  4CRZ B;  3CXQ A;  3IWE A;  4MFZ A;  4PV6 A;  5AG5 A;  4CGL A;  4XPL A;  5E96 A;  3FRM A;  1I12 A;  3QB8 A;  2O28 A;  4KSA A;  2B3U A;  2VI7 A;  3DR6 A;  4A32 A;  4C68 A;  4A31 A;  4QVT A;  3V8I A;  3BJ8 A;  4CYQ A;  3GKR A;  4NXY A;  2FCK A;  3EXN A;  4ONU A;  4C2X A;  2OZG A;  2PR8 A;  4AG9 A;  1N71 A;  1YGH A;  3EC4 A;  4ORF A;  2BEI A;  5J8C A;  4MHD A;  4GS4 A;  3TFY A;  2R8V A;  3TO7 A;  1MJB A;  2ATR A;  2B3V A;  4NEX A;  5C88 A;  1QST A;  1YR0 A;  4UBR A;  1MJ9 A;  3SHP A;  4LX9 A;  4Q38 A;  3TTH A;  4R3L A;  4HKF A;  5AG7 A;  4C2Z A;  3LOD A;  4QBJ A;  5ISV A;  3TO6 A;  1ON0 A;  2CNM A;  1Y9K A;  4DNC A;  4PSX A;  4R9M A;  3DNS A;  3P2H A;  1MK4 A;  3EO4 A;  5A28 A;  1K4J A;  4YRH A;  1RXT A;  4PK3 A;  1CJW A;  5F47 A;  4UA3 A;  1Y7R A;  5JPH A;  2WSA A;  1QSR A;  4L8A A;  3CXP A;  2X7B A;  3DDD A;  2I79 A;  4MJ8 A;  1Q2Y A;  3B8G A;  4R3K A;  4B5P A;  3PZJ A;  2QIR A;  3FIX A;  2B5G A;  2P0W A;  4CS0 B;  2ZW4 A;  2FXF A;  3VWE A;  4E8O A;  4CGM A;  3TE4 A;  4IF5 A;  1R57 A;  2R98 A;  4OLL A;  1BOB A;  2REE A;  3ZZI A;  4QB9 A;  2BUE A;  2CNT A;  4I49 A;  3RYO A;  4H89 A;  4A95 A;  4M85 A;  2HUZ A;  2FT0 A;  1BO4 A;  4K30 A;  5AG4 A;  1P0H A;  4CYO A;  2D4O A;  2GAN A;  4UWI A;  3SXO A;  4E0A A;  4MFP A;  2PRB A;  4MY3 A;  4FD7 A;  4MBU A;  1M4G A;  2R1I A;  3G8W A;  5BWA B;  2P6F A;  4F0X A;  2NMT A;  3T90 A;  3EY5 A;  3GYA A;  5G21 A;  4Y49 C;  4A2Z A;  2QEC A;  3R9G A;  2Z3K A;  3KKW A;  2ARH A;  2I00 A;  2Z3M A;  5HMN A;  4CAW A;  4LUA A;  5IX3 A;  2Q44 A;  2A4N A;  4B10 A;  4KVO E;  2PC1 A;  5G1Z A;  1KUX A;  3S6K A;  2VQY A;  2PSW A;  4HNW B;  5KTD A;  5J8F A;  1Q2D A;  3R1K A;  3R96 A;  2OH1 A;  2P6G A;  3P2F A;  2KCW A;  2Q0Y A;  3D8P A;  3BLN A;  4XPD B;  4AVB A;  2K5T A;  1M4I A;  2AJ6 A;  4CGO A;  1S5K A;  1V0C A;  3TOB A;  4ZBG A;  5G20 A;  3W6X A;  2Z3O A;  2Q4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...