1CJWA

Serotonin n-acetyltransferase complexed with a bisubstrate analog
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
166
structure length
166
Chain Sequence
HTLPANEFRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLTLCPELSLGWFVEGRLVAFIIGSLWDEERLTQESLALHRPRGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRAVLMCEDALVPFYQRFGFHPAGPCAIVVGSLTFTEMHCSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SEROTONIN N-ACETYLTRANSFERASE)
publication title The structural basis of ordered substrate binding by serotonin N-acetyltransferase: enzyme complex at 1.8 A resolution with a bisubstrate analog.
pubmed doi rcsb
source organism Ovis aries
molecule tags Transferase
total genus 45
structure length 166
sequence length 166
ec nomenclature ec 2.3.1.87: Aralkylamine N-acetyltransferase.
pdb deposition date 1999-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1cjwA00
4KORA 2ZW6A 2GE3A 2Q04A 4XPLA 3TOAA 2QIRA 4JXRA 2B4BA 5KTCA 4QUSA 4NCZA 4XPDC 3I3GA 4JWPA 1S60A 3GKRA 1NMTA 1ON0A 2JLMA 3FB3A 4QB9A 2ZXVA 5I0CA 4FD4A 1QSMA 3G8WA 2J8RA 4AVAA 1VHSA 4Y49C 5JPHA 1I12A 1XIXA 4KVOE 3SXOA 5EC4A 2BSWA 3TO6A 2REFA 3VWDA 3KKWA 1QSRA 2PR8A 3K9UA 1OZPA 4L89A 1YREA 1VKCA 3JUWA 3WR7A 3F8KA 4OADA 1XF8A 2Q44A 3ZJ0A 4DNCA 1N71A 2C27A 3TOBA 3PP9A 4ZBGA 2PSWA 1S7KA 1Y9WA 4KOYA 1YK3A 4JXQA 3RYOA 1YGHA 4XNHC 4XPDB 1QSTA 2K5TA 4AVCA 2ZW4A 2F5IA 4AG9A 3PGPA 5F48A 3LD2A 1YR0A 5GCNA 4II9A 3DR6A 4YFJA 1FY7A 4Y49B 1L0CA 4CAXA 2HV2A 1IIDA 5KTDA 4MHDA 4CRYB 3D2PA 2B4DA 2FL4A 5H84A 4QVTA 1S7LA 1KZFA 1IYLA 3BJ8A 4UA3A 4I49A 5C88A 2GANA 2Q4VA 2O28A 4AG7A 1MJBA 1PUAA 2D4OA 2BL1A 2B3VA 4HKFA 4U9YA 4E2AA 4FD5A 4XNHB 2BEIA 2H5MA 1R57A 1RXTA 2P6EA 1PU9A 1S7NA 3D8PA 1YVOA 4OLLA 4HNXB 3D2MA 4MI4A 2FIAA 3N7ZA 2OB0A 1Y9KA 2QMLA 2VEZA 1S7FA 3R95A 1CM0A 2J8MA 3DNSA 4XPKA 4BMHA 3FIXA 4PK2A 4KOVA 5IB0A 2RC4A 3R9FA 2FCKA 4LUAA 3S6FA 2QECA 2REEA 4KOXA 4K30A 2PRBA 4KLWA 4YRHA 2ARHA 2D4PA 4X5KA 3R9EA 2FS5A 2JDCA 2OZHA 3GY9A 1Z9UA 1IB1E 2Q7BA 2G3TA 2J8NA 2PDOA 2CNSA 4KUBA 2PR1A 3QAHA 3CXSA 2R1IA 3FYNA 3OWCA 4KVXA 3BJ7A 5CNPA 2ATRA 3R9GA 4M85A 5E96A 5F47A 2ZPAA 4E8OA 2B4DB 2R98A 3GYAA 3DDDA 4AVBA 1Q2YA 4ONUA 2PC1A 1QSOA 4R87A 3I9SA 5IX3A 4IUSA 3C26A 2X7BA 4L8AA 3SHPA 3G3SA 4NF1A 3F5BA 2Q4YA 4IF5A 4R3KA 3TO9A 2R7HA 2VZYA 4H6ZA 2VZZA 2FSRA 1MJ9A 1J4JA 5DWNA 1M4DA 1IYKA 3W6XA 1YVKA 4MY3A 5F46A 2GIVA 4ORFA 1LRZA 5C82A 3LODA 3R96A 1TIQA 1WK4A 1P4NA 1M44A 2G0BA 2Y0MA 2Z0ZA 3TTHA 3V8IA 4QC6A 4HNWB 1GHEA 3TE4A 4PK3A 1M4GA 1BOBA 1U6MA 4H89A 4EVYA 3MGDA 4UWIA 2FXFA 3EY5A 4R9MA 4FD7A 2PQ8A 4MY0A 2ZW7A 4MJ8A 3ZZIA 1BO4A 2HQYA 2EUIA 3R1KA 3BLNA 2HUZA 3SXNA 3T9YA 4CRZB 1Y7RA 1KUXA 2DXQA 5JQ4A 3EC4A 4B5PA 2NMTA 1KUYA 4LX9A 1UFHA 3CXPA 4U5YA 3S6KA 3FNCA 1YX0A 1Z4RA 2JDDA 3DSBA 2B5GA 3FBUA 1S3ZA 3D3SA 1B6BA 2OZGA 1WWZA 1XMTA 2FE7A 2OU2A 1B87A 4E0AA 3P2HA 2JEVA 2Z11A 4CAWA 4FD6A 5DWMA 3VWEA 3TCVA 2AE6A 1IICA 1S5KA 1Z4EA 5H86A 1NSLA 4KOWA 2P6FA 3H4QA 2BUEA 3EXNA 3IGRA 1Q2CA 1CJWA 3F0AA 4F6AA 4GS4A 5EBVA 5F49A 3EFAA 4AB7A 4F0YA 4R3LA 3TT2A 1P0HA 5IV0A 4PSXA 4KVME 3UY5A 5KTAA 3PZJA 4KOSA 5J8FA 2OH1A 4OAEA 3S6GA 1K4JA 1MK4A 2ZW5A 5ISVA 1SQHA 3CXQA 4NEXA 2I00A 4U9ZA 3IWGA 1Q2DA 3P2FA 4UWJA 3T90A 2VXKA 3DR8A 4KZTA 2FIWA 4J3GA 1NE9A 3TO7A 2WPWA 4KLVA 2G3AA 2OZUA 4JJXA 3TFYA 2Z10A 4JLYA 4KUAA 4R57A 4YGOA 1RO5A 2Q0YA 3FXTA 4UBRA 1M4IA 4RS2A 4HNYB 3S6HA 4NSQA 2I79A 4QBJA 1YLEA 2WPXA 1V0CA 2VI7A 4RI1A 1I1DA 1MJAA 4KOUA 4PSWA 5J8CA 4B5PB 1KUVA 3W6SA 3EO4A 2B58A 4NXYA 4CAVA 4JD6A 1XE4A 1XEBA 4PV6A 2B5GB 1M1DA 3FRMA 2A4NA 2IL4A 3NE7A 2CNMA 3QB8A 2P0WA 4H6UA 4MBUA 4M3SA 2CNTA 2B3UA 5HMNA 4KOTA 5FVJA 2VBQA 2R8VA 2FT0A 2P6GA 4B5OA 2EVNA 2VQYA 3B8GA 3E0KA 1QSNA 1I21A 2KCWA 3JVNA 2CY2A 5HH1A 3W91A 2AJ6A 4CS0B
chains in the Genus database with same CATH superfamily
1YMEA 4NJRA 4KORA 3V38A 3CPXA 1FT7A 2ZW6A 2GE3A 4NJQA 2Q04A 2V8VA 4XPLA 5LRGA 3TOAA 1Z2LA 2QIRA 3RAMA 4JXRA 2B4BA 2OOTA 4UFWA 5KTCA 4ZY0A 1XFOA 4PXDA 2AFXA 4QUSA 2GLFA 4CAFA 4NCZA 1F57A 2AFWA 4IAVA 4XPDC 1CBXA 3I3GA 4JWPA 2RFHA 1S60A 3FX6A 2IJZA 1XOVA 1NMTA 3GKRA 3NFZA 4P4IA 3WABA 5JGFA 3CZXA 1ON0A 2JLMA 4O23A 3FB3A 4QB9A 4LQ6A 2ZXVA 3HUVA 4WWVA 5I0CA 4FD4A 4CGMA 3DLJA 2Z3KA 1QSMA 4YU9A 4CGPA 3G8WA 3KHZA 4Q36A 4C7IA 2J8RA 4AVAA 1VHSA 4Y49C 5JPHA 1I12A 1XIXA 2Q51A 4KVOE 5ELYA 3SXOA 2IQ6A 1QQ9A 5EC4A 2BSWA 3TO6A 1XBUA 2PJBA 4C68A 2REFA 3PFEA 3VWDA 4Z65A 3KKWA 5AG4A 3LWUA 1QSRA 4TNUA 2PR8A 3K9UA 3V7ZA 5G22A 4FBEA 1OZPA 4L89A 5LYIA 4C2ZA 1YREA 1LAMA 1VKCA 3JUWA 3WR7A 5BWAB 3SJFA 1Z5RA 3F8KA 3KZWA 4OADA 1XF8A 4R8FA 2DPSA 4CYOA 2C6PA 4GM5A 4B14A 1IOIA 4BBHA 2Q44A 3ZJ0A 4DNCA 1F2PA 1N71A 2C27A 2HC9A 3TOBA 4CYNA 3PP9A 1TKHA 3PB9X 4ZBGA 2PSWA 2FVGA 1S7KA 4H2KA 1TKFA 1Y9WA 2PVWA 4KOYA 4P4JA 5LYFA 1YK3A 1CPSA 4UF4A 4JXQA 3JTKA 1ARMA 3RYOA 1YGHA 1JWQA 2PJAA 4XNHC 4XPDB 1QSTA 5AGEA 2K5TA 5G21A 4RN7A 4AVCA 1BLLE 1HDQA 2ZW4A 2F5IA 3D67A 3PRTA 4AG9A 3B35A 2PIZA 3PGPA 5F48A 3LD2A 1YR0A 2CTBA 3FJUA 1Z8XA 5GCNA 4II9A 3DR6A 1ZG9A 4P45A 4YFJA 1FY7A 4Y49B 3IIBA 1L0CA 4CAXA 4JZ0A 2HV2A 5HVGA 1IIDA 5KTDA 4MHDA 1Y0YA 4CRYB 4ZI6A 3D2PA 3WC5A 1Y0RA 3MN8A 3IC1A 2B4DA 2FL4A 5H84A 4QVTA 4F9UA 4A31A 1S7LA 1KZFA 1IYLA 2EK8A 2ZEOA 3BJ8A 5A27A 4UA3A 3NH8A 3VATA 4I49A 2EBJA 5C88A 2GANA 4P4FA 2Q4VA 2O28A 4AG7A 1MJBA 1PUAA 4R6TA 1X10A 1IOFA 2CF4A 4P44A 4NGNA 4CPAA 2D4OA 2BL1A 2YGWA 2XEIA 2B3VA 3KQZA 3VH9A 1ZG7A 3GIUA 3D7GA 4CAEA 4HKFA 4U9YA 4OC5A 4X8IA 4E2AA 2OR4A 4FD5A 4XNHB 2BEIA 4MHYA 2ANPA 2H5MA 1R57A 4M6HA 1RXTA 2WSAA 3B3WA 3IJ3A 3BI0A 2PJ1A 3L2NA 4OC4A 2P6EA 5AG6A 1PU9A 1S7NA 4A37A 3BHXA 3D8PA 1YVOA 3GB0A 4OLLA 3N5FA 4PQAA 3GLJA 4HNXB 4MFQA 4ZX9A 2ZEDA 4OKOA 5J1QA 2XEGA 3D2MA 4B10A 4P10A 4MCRA 4MI4A 2FIAA 2PJ0A 3N7ZA 3CPAA 2ZEEA 3PBEA 3T8WA 3SI0A 2OB0A 2RB7A 4HPSA 4IK2A 1Y9KA 1TF9A 2ZEMA 4UCPA 2QMLA 2VEZA 1Q7LA 1S7FA 3R95A 2ZEGA 4PXCA 1TF8A 1CM0A 1HDUA 3SI2A 4CGOA 4F9VA 2POKA 2J8MA 3DNSA 4EMEA 4OP4A 1BAVA 3B3TA 3FIXA 4XPKA 4BMHA 3JRUA 2PJ6A 4NGMA 4PK2A 2Z3OA 4A33A 3IWEA 1HEEA 1R3NA 4NGRA 3S9NA 4KOVA 4B11A 1CX8A 3PFOA 3BI1A 5IB0A 3CDXA 2RC4A 2C6GA 3DGVA 4RUHA 3R9FA 2FCKA 4B13A 4OMEA 4M6IA 4LUAA 3IEHA 3S6FA 2QECA 2REEA 4KOXA 4K30A 2O4HA 2PRBA 3KL9A 4KLWA 4Q38A 3D66A 4ZYQA 4YRHA 1ZG8A 2ARHA 3B2YA 4UCNA 3S9MA 2D4PA 4X5KA 3R9EA 2FS5A 2CXAA 3B3SA 3H8FA 3PB6X 1YW6A 2JDCA 3NE8A 2C6CA 2OZHA 2EWBA 1VIXA 3GY9A 1Z9UA 1IB1E 4NGTA 4PPZA 1Z8LA 2Z3LA 3HLPA 2Q7BA 2G3TA 1M4LA 2J8NA 2CNSA 2PDOA 2PR1A 2ZEFA 4KUBA 4C2YA 3GUXA 2AFZA 3QAHA 3CXSA 8CPAA 4JYWA 2R1IA 3FYNA 3OWCA 5D29A 2ZOFA 3KGQA 4KVXA 1Z8TA 3FMCA 3BJ7A 5CNPA 2ATRA 4UFVA 3R9GA 4M85A 5E96A 5F47A 2ZPAA 4E8OA 2B4DB 2R98A 4CYPA 3GYAA 3KQXA 3DDDA 3NH5A 4AVBA 1EE3P 1Q2YA 2PC1A 1GYTA 2WUUA 1LCPA 3K2KA 4ONUA 5HVHA 3MRUA 1QSOA 3NH4A 4CS0B 2ZOGA 4NGQA 4R87A 3I9SA 4MCSA 2YNDA 3LACA 1LAPA 5IX3A 4MFLA 2J9AA 4IUSA 5F09A 1XJOA 2Z3PA 3C26A 1ZLIA 2X7BA 4L8AA 3CT9A 3SHPA 4AXVA 3G3SA 4NF1A 2HB6A 3F5BA 5EMIA 2Q4YA 4K3NA 4IF5A 4A2ZA 2JBKA 3TC8A 5HXDA 4R3KA 3TO9A 2R7HA 2PJ7A 3FF3A 2VZYA 1CG2A 3FEEA 2PIYA 4H6ZA 4OC1A 3SJGA 2VZZA 2FSRA 3KR4A 1MJ9A 1J4JA 5DWNA 1A2ZA 4FWUA 3FEDA 1LANA 1M4DA 5A28A 1IYKA 3W6XA 4MFPA 5AG7A 1YVKA 4MY3A 5F46A 2GIVA 4BD9A 4ORFA 3LMSA 4A32A 3WC7A 1LRZA 3D7FA 5C82A 3LODA 5LYLA 5LRJA 4YWYA 3R96A 1TIQA 1WK4A 1P4NA 1M44A 2G0BA 2Y0MA 2Z0ZA 3TTHA 3V8IA 1JQGA 4QC6A 4PXEA 4HNWB 5K8NA 1GHEA 1DTDA 2CTCA 3B3VA 4PK3A 1M4GA 3TE4A 4MFJA 1BOBA 1U6MA 4G1PA 1KWMA 3I1UA 4H89A 2ZENA 4EVYA 5THWA 4KS9A 4C2XA 3MGDA 3H8EA 3VARA 3KR5A 2Q43A 4UWIA 2FXFA 4CYQA 3EY5A 4R9MA 4A94A 3KASA 4FD7A 1TKJA 1LFWA 4OIDA 4EWTA 1F2OA 2PQ8A 4OC3A 4A95A 4MY0A 2ZW7A 1FNOA 3A9LA 4MJ8A 4MCQA 2JEWA 2DEAA 3ZZIA 3IFEA 2O53A 4MFZA 1BO4A 2CIJA 2HQYA 4NGSA 2EUIA 4CGLA 3R1KA 3BLNA 2HUZA 3SXNA 3T9YA 4CRZB 1R43A 1ZLHA 1Y7RA 5LYDA 1KUXA 6CPAA 2QVPA 2DXQA 1ZO0A 1ELLP 3TX8A 3EC4A 5JQ4A 4NFRA 3RNZA 1ELMP 2NMTA 1PCAA 4B5PA 1QMUA 2PJ9A 4R7MA 1KUYA 5HVFA 4LX9A 4ONWA 1UFHA 2PVVA 2V8GA 3CXPA 4WJBA 1ARLA 4U5YA 2VL1A 3S6KA 3FNCA 1YX0A 1Z4RA 2JDDA 3PB4X 3DSBA 2ABZA 2B5GA 2BO9A 1XMBA 3FBUA 3PBBA 1S3ZA 3D3SA 1B6BA 2OZGA 3RZAA 1YW4A 3SI1A 4X3RA 2GLJA 1WWZA 5DS0A 5D8NA 4LQGA 1XMTA 1VHOA 2FE7A 2OU2A 1B87A 4E0AA 5K8MA 3P2HA 3B7IA 2JEVA 2Z11A 1BPMA 1LOKA 2QYVA 4ZX8A 4CAWA 3SJEA 4MCPA 3PB7X 2AFOA 4FD6A 4TWEA 1VHEA 5DWMA 3VWEA 4IHMA 3TCVA 2AE6A 1IICA 1S5KA 1Z4EA 5H86A 1NSLA 2GFQA 2BOAA 2NSMA 4KOWA 4P4BA 4MFKA 2F8HA 2Q7SA 4UEFA 3KI9A 2P6FA 3H4QA 2BUEA 3EXNA 3IGRA 1Q2CA 2BCOA 1CJWA 1TXRA 3F0AA 3RBUA 4A38A 4GS4A 4A30A 4F6AA 2Q4ZA 2C1CA 2GU2A 2V8HA 3PEIA 3EFAA 5EBVA 5F49A 1Z8WA 4AB7A 4P4EA 2PRQA 4F0YA 4FUUA 4R3LA 1PYTB 2PJ2A 4KSAA 1P0HA 3TT2A 3D4UA 4CGNA 3IU1A 4PSXA 4EFDA 4KVME 3UY5A 3K9TA 3QAYA 4GXHA 5IV0A 5KTAA 3PZJA 2AFUA 4MXUA 4KOSA 4UEZA 2PJ3A 2OH1A 4UEEA 3B3CA 4OAEA 5G20A 5J8FA 4MHPA 4Q7AA 3H5ZA 4MRIA 3S6GA 1K4JA 1MK4A 2ZW5A 5ISVA 4A39A 1SQHA 3CXQA 5JM6A 1RTQA 3NA6A 4NEXA 3QNVA 4P4DA 2YNCC 4UIAA 3FH4A 2I00A 4U9ZA 3IO1A 4MHZA 3IWGA 1Q2DA 3P2FA 4UFXA 4UWJA 4X2TA 3T90A 5JH9A 2VXKA 3DR8A 4OC0A 4KZTA 3S9LA 3D68A 1AUGA 1CP6A 4UIBA 2FIWA 2PCUA 1NE9A 2NYQA 4J3GA 3TO7A 2WPWA 5I4MA 4KLVA 2EO8A 2G3AA 2OZUA 1AMPA 4W9YA 1NSAA 2IMOA 4JJXA 3TFYA 2Z10A 2PJCA 4JLYA 1AYEA 1XRYA 4KUAA 4R57A 4F0XA 3WT4A 4YGOA 1RO5A 2PJ5A 2Q0YA 2Z3NA 3FXTA 4UBRA 7CPAA 4OIWA 2AFSA 1M4IA 2V77A 4RS2A 4HNYB 3S6HA 4NSQA 4F8ZA 2I79A 2PJ8A 2DPTA 4QBJA 1YLEA 2WPXA 5G1ZA 2YNEA 1V0CA 2VI7A 4RI1A 4MHNA 2WYRA 3FECA 1I1DA 1MJAA 3RO0A 4KOUA 2ODFA 4ZY1A 4PSWA 4OC2A 4ZY2A 3H8GA 3BXMA 5J8CA 2AFMA 2G9DA 3SJXA 4BINA 1CP7A 1OBRA 4B5PB 1H8LA 3ISXA 1IGBA 1UWYA 1KUVA 4B6ZA 3D7DA 4DYOA 3W6SA 3EO4A 2GREA 4DJLA 1YSJA 2B58A 3PB8X 4NXYA 4CAVA 1BPNA 1VGYA 2F7VA 4JD6A 1XE4A 1XEBA 5K8OA 2DF5A 4PV6A 4KSFA 1Y7EA 4PXBA 2B5GB 4DUKA 1M1DA 3FRMA 2A4NA 2IL4A 1IU8A 2EK9A 5CBMA 3NE7A 1YLOA 1IY7A 1YQEA 2CNMA 3QB8A 5K8PA 2P0WA 4H6UA 4MBUA 4M3SA 3IWWA 3ISZA 2CNTA 2B3UA 5HMNA 1CPXA 4KOTA 4NGPA 5FVJA 4B12A 1DE4C 3IU2A 4KSIA 2ZELA 2VBQA 2R8VA 2FT0A 2QJ8A 2P6GA 2XEJA 4B5OA 3FVLA 2PE3A 4ZGYB 4M6GA 2EVNA 2YNCA 5IB9A 2V8DA 4MMOA 2VQYA 2Z3MA 4UCMA 5LRKA 4R76A 3B8GA 3D7HA 2I3CA 2WZNA 3KHXA 3E0KA 1QSNA 2XEFA 2ZEPA 4P6YA 2ZEHA 1I21A 2PJ4A 4FAIA 5CPAA 2KCWA 3JVNA 5AG5A 2CY2A 3WC6A 2JBJA 4C7HA 5HH1A 3W91A 2AJ6A 1X12A
chains in the Genus database with same CATH topology
4KORA 2ZW6A 2GE3A 2Q04A 4XPLA 3TOAA 2QIRA 4JXRA 2B4BA 4UFWA 5KTCA 4QUSA 4CAFA 4NCZA 4XPDC 3I3GA 4JWPA 1S60A 3GKRA 1NMTA 1ON0A 2JLMA 3FB3A 4QB9A 2ZXVA 5I0CA 4FD4A 4CGMA 2Z3KA 1QSMA 4CGPA 3G8WA 4Q36A 4C7IA 2J8RA 4AVAA 1VHSA 4Y49C 5JPHA 1I12A 1XIXA 4KVOE 3SXOA 5EC4A 2BSWA 3TO6A 4C68A 2REFA 3VWDA 3KKWA 5AG4A 1QSRA 2PR8A 3K9UA 5G22A 1OZPA 4L89A 4C2ZA 1YREA 1VKCA 3JUWA 3WR7A 5BWAB 3F8KA 4OADA 1XF8A 2DPSA 4CYOA 4B14A 4BBHA 2Q44A 3ZJ0A 4DNCA 1N71A 2C27A 3TOBA 4CYNA 3PP9A 4ZBGA 2PSWA 1S7KA 1Y9WA 4KOYA 1YK3A 4JXQA 3JTKA 3RYOA 1YGHA 4XNHC 4XPDB 1QSTA 5AGEA 2K5TA 5G21A 4AVCA 2ZW4A 2F5IA 4AG9A 3PGPA 5F48A 3LD2A 1YR0A 5GCNA 4II9A 3DR6A 4YFJA 1FY7A 4Y49B 1L0CA 4CAXA 2HV2A 1IIDA 5KTDA 4MHDA 4CRYB 3D2PA 2B4DA 2FL4A 5H84A 4QVTA 4A31A 1S7LA 1KZFA 1IYLA 3BJ8A 5A27A 4UA3A 4I49A 5C88A 2GANA 2Q4VA 2O28A 4AG7A 1MJBA 1PUAA 2D4OA 2BL1A 2YGWA 2B3VA 4CAEA 4HKFA 4U9YA 4E2AA 4FD5A 4XNHB 2BEIA 2H5MA 1R57A 1RXTA 2WSAA 5AG6A 2P6EA 1PU9A 1S7NA 3D8PA 1YVOA 4OLLA 4HNXB 4MFQA 3D2MA 4B10A 4MI4A 2FIAA 3N7ZA 2OB0A 1Y9KA 4UCPA 2QMLA 2VEZA 1S7FA 3R95A 1CM0A 4CGOA 2J8MA 3DNSA 4XPKA 4BMHA 3FIXA 4PK2A 2Z3OA 4A33A 3IWEA 4KOVA 4B11A 5IB0A 2RC4A 3R9FA 2FCKA 4B13A 4LUAA 3S6FA 2QECA 2REEA 4KOXA 4K30A 2PRBA 4KLWA 4Q38A 4YRHA 2ARHA 4UCNA 2D4PA 4X5KA 3R9EA 2FS5A 2CXAA 2JDCA 2OZHA 3GY9A 1Z9UA 1IB1E 2Q7BA 2Z3LA 2G3TA 2J8NA 2PDOA 2CNSA 4KUBA 2PR1A 4C2YA 3QAHA 3CXSA 2R1IA 3FYNA 3OWCA 4KVXA 3BJ7A 5CNPA 2ATRA 4UFVA 3R9GA 4M85A 5E96A 5F47A 2ZPAA 4E8OA 2B4DB 2R98A 4CYPA 3GYAA 3DDDA 4AVBA 1Q2YA 2WUUA 2PC1A 4ONUA 1QSOA 4R87A 3I9SA 2YNDA 5IX3A 4MFLA 4IUSA 2Z3PA 3C26A 2X7BA 4L8AA 3SHPA 3G3SA 4NF1A 3F5BA 2Q4YA 4A2ZA 4IF5A 4R3KA 3TO9A 2R7HA 2VZYA 4H6ZA 2VZZA 2FSRA 1MJ9A 1J4JA 5DWNA 5A28A 1M4DA 1IYKA 3W6XA 4MFPA 5AG7A 1YVKA 4MY3A 5F46A 2GIVA 4ORFA 4A32A 1LRZA 5C82A 3LODA 3R96A 1TIQA 1WK4A 1P4NA 1M44A 2G0BA 2Y0MA 2Z0ZA 3TTHA 3V8IA 4QC6A 4HNWB 1GHEA 3TE4A 4PK3A 1M4GA 4MFJA 1BOBA 1U6MA 4H89A 4EVYA 4C2XA 4KS9A 3MGDA 4UWIA 2FXFA 4CYQA 3EY5A 4R9MA 4FD7A 2PQ8A 4A95A 4MY0A 2ZW7A 3A9LA 4MJ8A 3ZZIA 4MFZA 1BO4A 2HQYA 4CGLA 2EUIA 3R1KA 3BLNA 2HUZA 3SXNA 3T9YA 4CRZB 1Y7RA 1KUXA 2DXQA 1ZO0A 5JQ4A 3EC4A 4B5PA 2NMTA 1KUYA 4LX9A 1UFHA 3CXPA 4U5YA 3S6KA 3FNCA 1YX0A 1Z4RA 2JDDA 3DSBA 2B5GA 3FBUA 1S3ZA 3D3SA 1B6BA 2OZGA 1WWZA 1XMTA 2FE7A 2OU2A 1B87A 4E0AA 3P2HA 2JEVA 2Z11A 4CAWA 4FD6A 5DWMA 3VWEA 3TCVA 2AE6A 1IICA 1S5KA 1Z4EA 5H86A 1NSLA 4KOWA 4MFKA 2P6FA 3H4QA 2BUEA 3IGRA 3EXNA 1Q2CA 4A30A 1CJWA 3F0AA 4F6AA 4GS4A 5EBVA 5F49A 3EFAA 4AB7A 4F0YA 4R3LA 3TT2A 4KSAA 1P0HA 4CGNA 3IU1A 4PSXA 5IV0A 4KVME 3UY5A 5KTAA 3PZJA 4KOSA 5G20A 5J8FA 2OH1A 4OAEA 3H5ZA 3S6GA 1K4JA 1MK4A 2ZW5A 5ISVA 1SQHA 3CXQA 4NEXA 2YNCC 2I00A 4U9ZA 3IWGA 1Q2DA 3P2FA 4UFXA 4UWJA 3T90A 2VXKA 3DR8A 4KZTA 2FIWA 4J3GA 1NE9A 3TO7A 2WPWA 4KLVA 2G3AA 2OZUA 4JJXA 3TFYA 2Z10A 4JLYA 4F0XA 4KUAA 4R57A 4YGOA 1RO5A 2Q0YA 2Z3NA 3FXTA 4UBRA 1M4IA 4RS2A 4HNYB 3S6HA 4NSQA 2I79A 2DPTA 4QBJA 1YLEA 2WPXA 5G1ZA 2YNEA 1V0CA 2VI7A 4RI1A 1I1DA 1MJAA 4KOUA 4PSWA 5J8CA 4B5PB 1KUVA 3W6SA 3EO4A 2B58A 4NXYA 4CAVA 4JD6A 1XE4A 1XEBA 4PV6A 4KSFA 2B5GB 1M1DA 3FRMA 2A4NA 2IL4A 3NE7A 2CNMA 3QB8A 2P0WA 4H6UA 4MBUA 4M3SA 2CNTA 2B3UA 5HMNA 4KOTA 5FVJA 4B12A 3IU2A 2VBQA 2R8VA 2FT0A 2P6GA 4B5OA 4ZGYB 2EVNA 2YNCA 2VQYA 2Z3MA 4UCMA 3B8GA 3E0KA 1QSNA 1I21A 2KCWA 3JVNA 5AG5A 2CY2A 4C7HA 5HH1A 3W91A 2AJ6A 4CS0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KOR A;  2ZW6 A;  2GE3 A;  2Q04 A;  4XPL A;  3TOA A;  2QIR A;  4JXR A;  2B4B A;  5KTC A;  4QUS A;  4NCZ A;  4XPD C;  3I3G A;  4JWP A;  1S60 A;  3GKR A;  1NMT A;  1ON0 A;  2JLM A;  3FB3 A;  4QB9 A;  2ZXV A;  5I0C A;  4FD4 A;  1QSM A;  3G8W A;  2J8R A;  4AVA A;  1VHS A;  4Y49 C;  5JPH A;  1I12 A;  1XIX A;  4KVO E;  3SXO A;  5EC4 A;  2BSW A;  3TO6 A;  2REF A;  3VWD A;  3KKW A;  1QSR A;  2PR8 A;  3K9U A;  1OZP A;  4L89 A;  1YRE A;  1VKC A;  3JUW A;  3WR7 A;  3F8K A;  4OAD A;  1XF8 A;  2Q44 A;  3ZJ0 A;  4DNC A;  1N71 A;  2C27 A;  3TOB A;  3PP9 A;  4ZBG A;  2PSW A;  1S7K A;  1Y9W A;  4KOY A;  1YK3 A;  4JXQ A;  3RYO A;  1YGH A;  4XNH C;  4XPD B;  1QST A;  2K5T A;  4AVC A;  2ZW4 A;  2F5I A;  4AG9 A;  3PGP A;  5F48 A;  3LD2 A;  1YR0 A;  5GCN A;  4II9 A;  3DR6 A;  4YFJ A;  1FY7 A;  4Y49 B;  1L0C A;  4CAX A;  2HV2 A;  1IID A;  5KTD A;  4MHD A;  4CRY B;  3D2P A;  2B4D A;  2FL4 A;  5H84 A;  4QVT A;  1S7L A;  1KZF A;  1IYL A;  3BJ8 A;  4UA3 A;  4I49 A;  5C88 A;  2GAN A;  2Q4V A;  2O28 A;  4AG7 A;  1MJB A;  1PUA A;  2D4O A;  2BL1 A;  2B3V A;  4HKF A;  4U9Y A;  4E2A A;  4FD5 A;  4XNH B;  2BEI A;  2H5M A;  1R57 A;  1RXT A;  2P6E A;  1PU9 A;  1S7N A;  3D8P A;  1YVO A;  4OLL A;  4HNX B;  3D2M A;  4MI4 A;  2FIA A;  3N7Z A;  2OB0 A;  1Y9K A;  2QML A;  2VEZ A;  1S7F A;  3R95 A;  1CM0 A;  2J8M A;  3DNS A;  4XPK A;  4BMH A;  3FIX A;  4PK2 A;  4KOV A;  5IB0 A;  2RC4 A;  3R9F A;  2FCK A;  4LUA A;  3S6F A;  2QEC A;  2REE A;  4KOX A;  4K30 A;  2PRB A;  4KLW A;  4YRH A;  2ARH A;  2D4P A;  4X5K A;  3R9E A;  2FS5 A;  2JDC A;  2OZH A;  3GY9 A;  1Z9U A;  1IB1 E;  2Q7B A;  2G3T A;  2J8N A;  2PDO A;  2CNS A;  4KUB A;  2PR1 A;  3QAH A;  3CXS A;  2R1I A;  3FYN A;  3OWC A;  4KVX A;  3BJ7 A;  5CNP A;  2ATR A;  3R9G A;  4M85 A;  5E96 A;  5F47 A;  2ZPA A;  4E8O A;  2B4D B;  2R98 A;  3GYA A;  3DDD A;  4AVB A;  1Q2Y A;  4ONU A;  2PC1 A;  1QSO A;  4R87 A;  3I9S A;  5IX3 A;  4IUS A;  3C26 A;  2X7B A;  4L8A A;  3SHP A;  3G3S A;  4NF1 A;  3F5B A;  2Q4Y A;  4IF5 A;  4R3K A;  3TO9 A;  2R7H A;  2VZY A;  4H6Z A;  2VZZ A;  2FSR A;  1MJ9 A;  1J4J A;  5DWN A;  1M4D A;  1IYK A;  3W6X A;  1YVK A;  4MY3 A;  5F46 A;  2GIV A;  4ORF A;  1LRZ A;  5C82 A;  3LOD A;  3R96 A;  1TIQ A;  1WK4 A;  1P4N A;  1M44 A;  2G0B A;  2Y0M A;  2Z0Z A;  3TTH A;  3V8I A;  4QC6 A;  4HNW B;  1GHE A;  3TE4 A;  4PK3 A;  1M4G A;  1BOB A;  1U6M A;  4H89 A;  4EVY A;  3MGD A;  4UWI A;  2FXF A;  3EY5 A;  4R9M A;  4FD7 A;  2PQ8 A;  4MY0 A;  2ZW7 A;  4MJ8 A;  3ZZI A;  1BO4 A;  2HQY A;  2EUI A;  3R1K A;  3BLN A;  2HUZ A;  3SXN A;  3T9Y A;  4CRZ B;  1Y7R A;  1KUX A;  2DXQ A;  5JQ4 A;  3EC4 A;  4B5P A;  2NMT A;  1KUY A;  4LX9 A;  1UFH A;  3CXP A;  4U5Y A;  3S6K A;  3FNC A;  1YX0 A;  1Z4R A;  2JDD A;  3DSB A;  2B5G A;  3FBU A;  1S3Z A;  3D3S A;  1B6B A;  2OZG A;  1WWZ A;  1XMT A;  2FE7 A;  2OU2 A;  1B87 A;  4E0A A;  3P2H A;  2JEV A;  2Z11 A;  4CAW A;  4FD6 A;  5DWM A;  3VWE A;  3TCV A;  2AE6 A;  1IIC A;  1S5K A;  1Z4E A;  5H86 A;  1NSL A;  4KOW A;  2P6F A;  3H4Q A;  2BUE A;  3EXN A;  3IGR A;  1Q2C A;  1CJW A;  3F0A A;  4F6A A;  4GS4 A;  5EBV A;  5F49 A;  3EFA A;  4AB7 A;  4F0Y A;  4R3L A;  3TT2 A;  1P0H A;  5IV0 A;  4PSX A;  4KVM E;  3UY5 A;  5KTA A;  3PZJ A;  4KOS A;  5J8F A;  2OH1 A;  4OAE A;  3S6G A;  1K4J A;  1MK4 A;  2ZW5 A;  5ISV A;  1SQH A;  3CXQ A;  4NEX A;  2I00 A;  4U9Z A;  3IWG A;  1Q2D A;  3P2F A;  4UWJ A;  3T90 A;  2VXK A;  3DR8 A;  4KZT A;  2FIW A;  4J3G A;  1NE9 A;  3TO7 A;  2WPW A;  4KLV A;  2G3A A;  2OZU A;  4JJX A;  3TFY A;  2Z10 A;  4JLY A;  4KUA A;  4R57 A;  4YGO A;  1RO5 A;  2Q0Y A;  3FXT A;  4UBR A;  1M4I A;  4RS2 A;  4HNY B;  3S6H A;  4NSQ A;  2I79 A;  4QBJ A;  1YLE A;  2WPX A;  1V0C A;  2VI7 A;  4RI1 A;  1I1D A;  1MJA A;  4KOU A;  4PSW A;  5J8C A;  4B5P B;  1KUV A;  3W6S A;  3EO4 A;  2B58 A;  4NXY A;  4CAV A;  4JD6 A;  1XE4 A;  1XEB A;  4PV6 A;  2B5G B;  1M1D A;  3FRM A;  2A4N A;  2IL4 A;  3NE7 A;  2CNM A;  3QB8 A;  2P0W A;  4H6U A;  4MBU A;  4M3S A;  2CNT A;  2B3U A;  5HMN A;  4KOT A;  5FVJ A;  2VBQ A;  2R8V A;  2FT0 A;  2P6G A;  4B5O A;  2EVN A;  2VQY A;  3B8G A;  3E0K A;  1QSN A;  1I21 A;  2KCW A;  3JVN A;  2CY2 A;  5HH1 A;  3W91 A;  2AJ6 A;  4CS0 B; 
#chains in the Genus database with same CATH topology
 1YME A;  4NJR A;  4KOR A;  3V38 A;  3CPX A;  1FT7 A;  2ZW6 A;  2GE3 A;  4NJQ A;  2Q04 A;  2V8V A;  4XPL A;  5LRG A;  3TOA A;  1Z2L A;  2QIR A;  3RAM A;  4JXR A;  2B4B A;  2OOT A;  4UFW A;  5KTC A;  4ZY0 A;  1XFO A;  4PXD A;  2AFX A;  4QUS A;  2GLF A;  4CAF A;  4NCZ A;  1F57 A;  2AFW A;  4IAV A;  4XPD C;  1CBX A;  3I3G A;  4JWP A;  2RFH A;  1S60 A;  3FX6 A;  2IJZ A;  1XOV A;  1NMT A;  3GKR A;  3NFZ A;  4P4I A;  3WAB A;  5JGF A;  3CZX A;  1ON0 A;  2JLM A;  4O23 A;  3FB3 A;  4QB9 A;  4LQ6 A;  2ZXV A;  3HUV A;  4WWV A;  5I0C A;  4FD4 A;  4CGM A;  3DLJ A;  2Z3K A;  1QSM A;  4YU9 A;  4CGP A;  3G8W A;  3KHZ A;  4Q36 A;  4C7I A;  2J8R A;  4AVA A;  1VHS A;  4Y49 C;  5JPH A;  1I12 A;  1XIX A;  2Q51 A;  4KVO E;  5ELY A;  3SXO A;  2IQ6 A;  1QQ9 A;  5EC4 A;  2BSW A;  3TO6 A;  1XBU A;  2PJB A;  4C68 A;  2REF A;  3PFE A;  3VWD A;  4Z65 A;  3KKW A;  5AG4 A;  3LWU A;  1QSR A;  4TNU A;  2PR8 A;  3K9U A;  3V7Z A;  5G22 A;  4FBE A;  1OZP A;  4L89 A;  5LYI A;  4C2Z A;  1YRE A;  1LAM A;  1VKC A;  3JUW A;  3WR7 A;  5BWA B;  3SJF A;  1Z5R A;  3F8K A;  3KZW A;  4OAD A;  1XF8 A;  4R8F A;  2DPS A;  4CYO A;  2C6P A;  4GM5 A;  4B14 A;  1IOI A;  4BBH A;  2Q44 A;  3ZJ0 A;  4DNC A;  1F2P A;  1N71 A;  2C27 A;  2HC9 A;  3TOB A;  4CYN A;  3PP9 A;  1TKH A;  3PB9 X;  4ZBG A;  2PSW A;  2FVG A;  1S7K A;  4H2K A;  1TKF A;  1Y9W A;  2PVW A;  4KOY A;  4P4J A;  5LYF A;  1YK3 A;  1CPS A;  4UF4 A;  4JXQ A;  3JTK A;  1ARM A;  3RYO A;  1YGH A;  1JWQ A;  2PJA A;  4XNH C;  4XPD B;  1QST A;  5AGE A;  2K5T A;  5G21 A;  4RN7 A;  4AVC A;  1BLL E;  1HDQ A;  2ZW4 A;  2F5I A;  3D67 A;  3PRT A;  4AG9 A;  3B35 A;  2PIZ A;  3PGP A;  5F48 A;  3LD2 A;  1YR0 A;  2CTB A;  3FJU A;  1Z8X A;  5GCN A;  4II9 A;  3DR6 A;  1ZG9 A;  4P45 A;  4YFJ A;  1FY7 A;  4Y49 B;  3IIB A;  1L0C A;  4CAX A;  4JZ0 A;  2HV2 A;  5HVG A;  1IID A;  5KTD A;  4MHD A;  1Y0Y A;  4CRY B;  4ZI6 A;  3D2P A;  3WC5 A;  1Y0R A;  3MN8 A;  3IC1 A;  2B4D A;  2FL4 A;  5H84 A;  4QVT A;  4F9U A;  4A31 A;  1S7L A;  1KZF A;  1IYL A;  2EK8 A;  2ZEO A;  3BJ8 A;  5A27 A;  4UA3 A;  3NH8 A;  3VAT A;  4I49 A;  2EBJ A;  5C88 A;  2GAN A;  4P4F A;  2Q4V A;  2O28 A;  4AG7 A;  1MJB A;  1PUA A;  4R6T A;  1X10 A;  1IOF A;  2CF4 A;  4P44 A;  4NGN A;  4CPA A;  2D4O A;  2BL1 A;  2YGW A;  2XEI A;  2B3V A;  3KQZ A;  3VH9 A;  1ZG7 A;  3GIU A;  3D7G A;  4CAE A;  4HKF A;  4U9Y A;  4OC5 A;  4X8I A;  4E2A A;  2OR4 A;  4FD5 A;  4XNH B;  2BEI A;  4MHY A;  2ANP A;  2H5M A;  1R57 A;  4M6H A;  1RXT A;  2WSA A;  3B3W A;  3IJ3 A;  3BI0 A;  2PJ1 A;  3L2N A;  4OC4 A;  2P6E A;  5AG6 A;  1PU9 A;  1S7N A;  4A37 A;  3BHX A;  3D8P A;  1YVO A;  3GB0 A;  4OLL A;  3N5F A;  4PQA A;  3GLJ A;  4HNX B;  4MFQ A;  4ZX9 A;  2ZED A;  4OKO A;  5J1Q A;  2XEG A;  3D2M A;  4B10 A;  4P10 A;  4MCR A;  4MI4 A;  2FIA A;  2PJ0 A;  3N7Z A;  3CPA A;  2ZEE A;  3PBE A;  3T8W A;  3SI0 A;  2OB0 A;  2RB7 A;  4HPS A;  4IK2 A;  1Y9K A;  1TF9 A;  2ZEM A;  4UCP A;  2QML A;  2VEZ A;  1Q7L A;  1S7F A;  3R95 A;  2ZEG A;  4PXC A;  1TF8 A;  1CM0 A;  1HDU A;  3SI2 A;  4CGO A;  4F9V A;  2POK A;  2J8M A;  3DNS A;  4EME A;  4OP4 A;  1BAV A;  3B3T A;  3FIX A;  4XPK A;  4BMH A;  3JRU A;  2PJ6 A;  4NGM A;  4PK2 A;  2Z3O A;  4A33 A;  3IWE A;  1HEE A;  1R3N A;  4NGR A;  3S9N A;  4KOV A;  4B11 A;  1CX8 A;  3PFO A;  3BI1 A;  5IB0 A;  3CDX A;  2RC4 A;  2C6G A;  3DGV A;  4RUH A;  3R9F A;  2FCK A;  4B13 A;  4OME A;  4M6I A;  4LUA A;  3IEH A;  3S6F A;  2QEC A;  2REE A;  4KOX A;  4K30 A;  2O4H A;  2PRB A;  3KL9 A;  4KLW A;  4Q38 A;  3D66 A;  4ZYQ A;  4YRH A;  1ZG8 A;  2ARH A;  3B2Y A;  4UCN A;  3S9M A;  2D4P A;  4X5K A;  3R9E A;  2FS5 A;  2CXA A;  3B3S A;  3H8F A;  3PB6 X;  1YW6 A;  2JDC A;  3NE8 A;  2C6C A;  2OZH A;  2EWB A;  1VIX A;  3GY9 A;  1Z9U A;  1IB1 E;  4NGT A;  4PPZ A;  1Z8L A;  2Z3L A;  3HLP A;  2Q7B A;  2G3T A;  1M4L A;  2J8N A;  2CNS A;  2PDO A;  2PR1 A;  2ZEF A;  4KUB A;  4C2Y A;  3GUX A;  2AFZ A;  3QAH A;  3CXS A;  8CPA A;  4JYW A;  2R1I A;  3FYN A;  3OWC A;  5D29 A;  2ZOF A;  3KGQ A;  4KVX A;  1Z8T A;  3FMC A;  3BJ7 A;  5CNP A;  2ATR A;  4UFV A;  3R9G A;  4M85 A;  5E96 A;  5F47 A;  2ZPA A;  4E8O A;  2B4D B;  2R98 A;  4CYP A;  3GYA A;  3KQX A;  3DDD A;  3NH5 A;  4AVB A;  1EE3 P;  1Q2Y A;  2PC1 A;  1GYT A;  2WUU A;  1LCP A;  3K2K A;  4ONU A;  5HVH A;  3MRU A;  1QSO A;  3NH4 A;  4CS0 B;  2ZOG A;  4NGQ A;  4R87 A;  3I9S A;  4MCS A;  2YND A;  3LAC A;  1LAP A;  5IX3 A;  4MFL A;  2J9A A;  4IUS A;  5F09 A;  1XJO A;  2Z3P A;  3C26 A;  1ZLI A;  2X7B A;  4L8A A;  3CT9 A;  3SHP A;  4AXV A;  3G3S A;  4NF1 A;  2HB6 A;  3F5B A;  5EMI A;  2Q4Y A;  4K3N A;  4IF5 A;  4A2Z A;  2JBK A;  3TC8 A;  5HXD A;  4R3K A;  3TO9 A;  2R7H A;  2PJ7 A;  3FF3 A;  2VZY A;  1CG2 A;  3FEE A;  2PIY A;  4H6Z A;  4OC1 A;  3SJG A;  2VZZ A;  2FSR A;  3KR4 A;  1MJ9 A;  1J4J A;  5DWN A;  1A2Z A;  4FWU A;  3FED A;  1LAN A;  1M4D A;  5A28 A;  1IYK A;  3W6X A;  4MFP A;  5AG7 A;  1YVK A;  4MY3 A;  5F46 A;  2GIV A;  4BD9 A;  4ORF A;  3LMS A;  4A32 A;  3WC7 A;  1LRZ A;  3D7F A;  5C82 A;  3LOD A;  5LYL A;  5LRJ A;  4YWY A;  3R96 A;  1TIQ A;  1WK4 A;  1P4N A;  1M44 A;  2G0B A;  2Y0M A;  2Z0Z A;  3TTH A;  3V8I A;  1JQG A;  4QC6 A;  4PXE A;  4HNW B;  5K8N A;  1GHE A;  1DTD A;  2CTC A;  3B3V A;  4PK3 A;  1M4G A;  3TE4 A;  4MFJ A;  1BOB A;  1U6M A;  4G1P A;  1KWM A;  3I1U A;  4H89 A;  2ZEN A;  4EVY A;  5THW A;  4KS9 A;  4C2X A;  3MGD A;  3H8E A;  3VAR A;  3KR5 A;  2Q43 A;  4UWI A;  2FXF A;  4CYQ A;  3EY5 A;  4R9M A;  4A94 A;  3KAS A;  4FD7 A;  1TKJ A;  1LFW A;  4OID A;  4EWT A;  1F2O A;  2PQ8 A;  4OC3 A;  4A95 A;  4MY0 A;  2ZW7 A;  1FNO A;  3A9L A;  4MJ8 A;  4MCQ A;  2JEW A;  2DEA A;  3ZZI A;  3IFE A;  2O53 A;  4MFZ A;  1BO4 A;  2CIJ A;  2HQY A;  4NGS A;  2EUI A;  4CGL A;  3R1K A;  3BLN A;  2HUZ A;  3SXN A;  3T9Y A;  4CRZ B;  1R43 A;  1ZLH A;  1Y7R A;  5LYD A;  1KUX A;  6CPA A;  2QVP A;  2DXQ A;  1ZO0 A;  1ELL P;  3TX8 A;  3EC4 A;  5JQ4 A;  4NFR A;  3RNZ A;  1ELM P;  2NMT A;  1PCA A;  4B5P A;  1QMU A;  2PJ9 A;  4R7M A;  1KUY A;  5HVF A;  4LX9 A;  4ONW A;  1UFH A;  2PVV A;  2V8G A;  3CXP A;  4WJB A;  1ARL A;  4U5Y A;  2VL1 A;  3S6K A;  3FNC A;  1YX0 A;  1Z4R A;  2JDD A;  3PB4 X;  3DSB A;  2ABZ A;  2B5G A;  2BO9 A;  1XMB A;  3FBU A;  3PBB A;  1S3Z A;  3D3S A;  1B6B A;  2OZG A;  3RZA A;  1YW4 A;  3SI1 A;  4X3R A;  2GLJ A;  1WWZ A;  5DS0 A;  5D8N A;  4LQG A;  1XMT A;  1VHO A;  2FE7 A;  2OU2 A;  1B87 A;  4E0A A;  5K8M A;  3P2H A;  3B7I A;  2JEV A;  2Z11 A;  1BPM A;  1LOK A;  2QYV A;  4ZX8 A;  4CAW A;  3SJE A;  4MCP A;  3PB7 X;  2AFO A;  4FD6 A;  4TWE A;  1VHE A;  5DWM A;  3VWE A;  4IHM A;  3TCV A;  2AE6 A;  1IIC A;  1S5K A;  1Z4E A;  5H86 A;  1NSL A;  2GFQ A;  2BOA A;  2NSM A;  4KOW A;  4P4B A;  4MFK A;  2F8H A;  2Q7S A;  4UEF A;  3KI9 A;  2P6F A;  3H4Q A;  2BUE A;  3EXN A;  3IGR A;  1Q2C A;  2BCO A;  1CJW A;  1TXR A;  3F0A A;  3RBU A;  4A38 A;  4GS4 A;  4A30 A;  4F6A A;  2Q4Z A;  2C1C A;  2GU2 A;  2V8H A;  3PEI A;  3EFA A;  5EBV A;  5F49 A;  1Z8W A;  4AB7 A;  4P4E A;  2PRQ A;  4F0Y A;  4FUU A;  4R3L A;  1PYT B;  2PJ2 A;  4KSA A;  1P0H A;  3TT2 A;  3D4U A;  4CGN A;  3IU1 A;  4PSX A;  4EFD A;  4KVM E;  3UY5 A;  3K9T A;  3QAY A;  4GXH A;  5IV0 A;  5KTA A;  3PZJ A;  2AFU A;  4MXU A;  4KOS A;  4UEZ A;  2PJ3 A;  2OH1 A;  4UEE A;  3B3C A;  4OAE A;  5G20 A;  5J8F A;  4MHP A;  4Q7A A;  3H5Z A;  4MRI A;  3S6G A;  1K4J A;  1MK4 A;  2ZW5 A;  5ISV A;  4A39 A;  1SQH A;  3CXQ A;  5JM6 A;  1RTQ A;  3NA6 A;  4NEX A;  3QNV A;  4P4D A;  2YNC C;  4UIA A;  3FH4 A;  2I00 A;  4U9Z A;  3IO1 A;  4MHZ A;  3IWG A;  1Q2D A;  3P2F A;  4UFX A;  4UWJ A;  4X2T A;  3T90 A;  5JH9 A;  2VXK A;  3DR8 A;  4OC0 A;  4KZT A;  3S9L A;  3D68 A;  1AUG A;  1CP6 A;  4UIB A;  2FIW A;  2PCU A;  1NE9 A;  2NYQ A;  4J3G A;  3TO7 A;  2WPW A;  5I4M A;  4KLV A;  2EO8 A;  2G3A A;  2OZU A;  1AMP A;  4W9Y A;  1NSA A;  2IMO A;  4JJX A;  3TFY A;  2Z10 A;  2PJC A;  4JLY A;  1AYE A;  1XRY A;  4KUA A;  4R57 A;  4F0X A;  3WT4 A;  4YGO A;  1RO5 A;  2PJ5 A;  2Q0Y A;  2Z3N A;  3FXT A;  4UBR A;  7CPA A;  4OIW A;  2AFS A;  1M4I A;  2V77 A;  4RS2 A;  4HNY B;  3S6H A;  4NSQ A;  4F8Z A;  2I79 A;  2PJ8 A;  2DPT A;  4QBJ A;  1YLE A;  2WPX A;  5G1Z A;  2YNE A;  1V0C A;  2VI7 A;  4RI1 A;  4MHN A;  2WYR A;  3FEC A;  1I1D A;  1MJA A;  3RO0 A;  4KOU A;  2ODF A;  4ZY1 A;  4PSW A;  4OC2 A;  4ZY2 A;  3H8G A;  3BXM A;  5J8C A;  2AFM A;  2G9D A;  3SJX A;  4BIN A;  1CP7 A;  1OBR A;  4B5P B;  1H8L A;  3ISX A;  1IGB A;  1UWY A;  1KUV A;  4B6Z A;  3D7D A;  4DYO A;  3W6S A;  3EO4 A;  2GRE A;  4DJL A;  1YSJ A;  2B58 A;  3PB8 X;  4NXY A;  4CAV A;  1BPN A;  1VGY A;  2F7V A;  4JD6 A;  1XE4 A;  1XEB A;  5K8O A;  2DF5 A;  4PV6 A;  4KSF A;  1Y7E A;  4PXB A;  2B5G B;  4DUK A;  1M1D A;  3FRM A;  2A4N A;  2IL4 A;  1IU8 A;  2EK9 A;  5CBM A;  3NE7 A;  1YLO A;  1IY7 A;  1YQE A;  2CNM A;  3QB8 A;  5K8P A;  2P0W A;  4H6U A;  4MBU A;  4M3S A;  3IWW A;  3ISZ A;  2CNT A;  2B3U A;  5HMN A;  1CPX A;  4KOT A;  4NGP A;  5FVJ A;  4B12 A;  1DE4 C;  3IU2 A;  4KSI A;  2ZEL A;  2VBQ A;  2R8V A;  2FT0 A;  2QJ8 A;  2P6G A;  2XEJ A;  4B5O A;  3FVL A;  2PE3 A;  4ZGY B;  4M6G A;  2EVN A;  2YNC A;  5IB9 A;  2V8D A;  4MMO A;  2VQY A;  2Z3M A;  4UCM A;  5LRK A;  4R76 A;  3B8G A;  3D7H A;  2I3C A;  2WZN A;  3KHX A;  3E0K A;  1QSN A;  2XEF A;  2ZEP A;  4P6Y A;  2ZEH A;  1I21 A;  2PJ4 A;  4FAI A;  5CPA A;  2KCW A;  3JVN A;  5AG5 A;  2CY2 A;  3WC6 A;  2JBJ A;  4C7H A;  5HH1 A;  3W91 A;  2AJ6 A;  1X12 A; 
#chains in the Genus database with same CATH homology
 4KOR A;  2ZW6 A;  2GE3 A;  2Q04 A;  4XPL A;  3TOA A;  2QIR A;  4JXR A;  2B4B A;  4UFW A;  5KTC A;  4QUS A;  4CAF A;  4NCZ A;  4XPD C;  3I3G A;  4JWP A;  1S60 A;  3GKR A;  1NMT A;  1ON0 A;  2JLM A;  3FB3 A;  4QB9 A;  2ZXV A;  5I0C A;  4FD4 A;  4CGM A;  2Z3K A;  1QSM A;  4CGP A;  3G8W A;  4Q36 A;  4C7I A;  2J8R A;  4AVA A;  1VHS A;  4Y49 C;  5JPH A;  1I12 A;  1XIX A;  4KVO E;  3SXO A;  5EC4 A;  2BSW A;  3TO6 A;  4C68 A;  2REF A;  3VWD A;  3KKW A;  5AG4 A;  1QSR A;  2PR8 A;  3K9U A;  5G22 A;  1OZP A;  4L89 A;  4C2Z A;  1YRE A;  1VKC A;  3JUW A;  3WR7 A;  5BWA B;  3F8K A;  4OAD A;  1XF8 A;  2DPS A;  4CYO A;  4B14 A;  4BBH A;  2Q44 A;  3ZJ0 A;  4DNC A;  1N71 A;  2C27 A;  3TOB A;  4CYN A;  3PP9 A;  4ZBG A;  2PSW A;  1S7K A;  1Y9W A;  4KOY A;  1YK3 A;  4JXQ A;  3JTK A;  3RYO A;  1YGH A;  4XNH C;  4XPD B;  1QST A;  5AGE A;  2K5T A;  5G21 A;  4AVC A;  2ZW4 A;  2F5I A;  4AG9 A;  3PGP A;  5F48 A;  3LD2 A;  1YR0 A;  5GCN A;  4II9 A;  3DR6 A;  4YFJ A;  1FY7 A;  4Y49 B;  1L0C A;  4CAX A;  2HV2 A;  1IID A;  5KTD A;  4MHD A;  4CRY B;  3D2P A;  2B4D A;  2FL4 A;  5H84 A;  4QVT A;  4A31 A;  1S7L A;  1KZF A;  1IYL A;  3BJ8 A;  5A27 A;  4UA3 A;  4I49 A;  5C88 A;  2GAN A;  2Q4V A;  2O28 A;  4AG7 A;  1MJB A;  1PUA A;  2D4O A;  2BL1 A;  2YGW A;  2B3V A;  4CAE A;  4HKF A;  4U9Y A;  4E2A A;  4FD5 A;  4XNH B;  2BEI A;  2H5M A;  1R57 A;  1RXT A;  2WSA A;  5AG6 A;  2P6E A;  1PU9 A;  1S7N A;  3D8P A;  1YVO A;  4OLL A;  4HNX B;  4MFQ A;  3D2M A;  4B10 A;  4MI4 A;  2FIA A;  3N7Z A;  2OB0 A;  1Y9K A;  4UCP A;  2QML A;  2VEZ A;  1S7F A;  3R95 A;  1CM0 A;  4CGO A;  2J8M A;  3DNS A;  4XPK A;  4BMH A;  3FIX A;  4PK2 A;  2Z3O A;  4A33 A;  3IWE A;  4KOV A;  4B11 A;  5IB0 A;  2RC4 A;  3R9F A;  2FCK A;  4B13 A;  4LUA A;  3S6F A;  2QEC A;  2REE A;  4KOX A;  4K30 A;  2PRB A;  4KLW A;  4Q38 A;  4YRH A;  2ARH A;  4UCN A;  2D4P A;  4X5K A;  3R9E A;  2FS5 A;  2CXA A;  2JDC A;  2OZH A;  3GY9 A;  1Z9U A;  1IB1 E;  2Q7B A;  2Z3L A;  2G3T A;  2J8N A;  2PDO A;  2CNS A;  4KUB A;  2PR1 A;  4C2Y A;  3QAH A;  3CXS A;  2R1I A;  3FYN A;  3OWC A;  4KVX A;  3BJ7 A;  5CNP A;  2ATR A;  4UFV A;  3R9G A;  4M85 A;  5E96 A;  5F47 A;  2ZPA A;  4E8O A;  2B4D B;  2R98 A;  4CYP A;  3GYA A;  3DDD A;  4AVB A;  1Q2Y A;  2WUU A;  2PC1 A;  4ONU A;  1QSO A;  4R87 A;  3I9S A;  2YND A;  5IX3 A;  4MFL A;  4IUS A;  2Z3P A;  3C26 A;  2X7B A;  4L8A A;  3SHP A;  3G3S A;  4NF1 A;  3F5B A;  2Q4Y A;  4A2Z A;  4IF5 A;  4R3K A;  3TO9 A;  2R7H A;  2VZY A;  4H6Z A;  2VZZ A;  2FSR A;  1MJ9 A;  1J4J A;  5DWN A;  5A28 A;  1M4D A;  1IYK A;  3W6X A;  4MFP A;  5AG7 A;  1YVK A;  4MY3 A;  5F46 A;  2GIV A;  4ORF A;  4A32 A;  1LRZ A;  5C82 A;  3LOD A;  3R96 A;  1TIQ A;  1WK4 A;  1P4N A;  1M44 A;  2G0B A;  2Y0M A;  2Z0Z A;  3TTH A;  3V8I A;  4QC6 A;  4HNW B;  1GHE A;  3TE4 A;  4PK3 A;  1M4G A;  4MFJ A;  1BOB A;  1U6M A;  4H89 A;  4EVY A;  4C2X A;  4KS9 A;  3MGD A;  4UWI A;  2FXF A;  4CYQ A;  3EY5 A;  4R9M A;  4FD7 A;  2PQ8 A;  4A95 A;  4MY0 A;  2ZW7 A;  3A9L A;  4MJ8 A;  3ZZI A;  4MFZ A;  1BO4 A;  2HQY A;  4CGL A;  2EUI A;  3R1K A;  3BLN A;  2HUZ A;  3SXN A;  3T9Y A;  4CRZ B;  1Y7R A;  1KUX A;  2DXQ A;  1ZO0 A;  5JQ4 A;  3EC4 A;  4B5P A;  2NMT A;  1KUY A;  4LX9 A;  1UFH A;  3CXP A;  4U5Y A;  3S6K A;  3FNC A;  1YX0 A;  1Z4R A;  2JDD A;  3DSB A;  2B5G A;  3FBU A;  1S3Z A;  3D3S A;  1B6B A;  2OZG A;  1WWZ A;  1XMT A;  2FE7 A;  2OU2 A;  1B87 A;  4E0A A;  3P2H A;  2JEV A;  2Z11 A;  4CAW A;  4FD6 A;  5DWM A;  3VWE A;  3TCV A;  2AE6 A;  1IIC A;  1S5K A;  1Z4E A;  5H86 A;  1NSL A;  4KOW A;  4MFK A;  2P6F A;  3H4Q A;  2BUE A;  3IGR A;  3EXN A;  1Q2C A;  4A30 A;  1CJW A;  3F0A A;  4F6A A;  4GS4 A;  5EBV A;  5F49 A;  3EFA A;  4AB7 A;  4F0Y A;  4R3L A;  3TT2 A;  4KSA A;  1P0H A;  4CGN A;  3IU1 A;  4PSX A;  5IV0 A;  4KVM E;  3UY5 A;  5KTA A;  3PZJ A;  4KOS A;  5G20 A;  5J8F A;  2OH1 A;  4OAE A;  3H5Z A;  3S6G A;  1K4J A;  1MK4 A;  2ZW5 A;  5ISV A;  1SQH A;  3CXQ A;  4NEX A;  2YNC C;  2I00 A;  4U9Z A;  3IWG A;  1Q2D A;  3P2F A;  4UFX A;  4UWJ A;  3T90 A;  2VXK A;  3DR8 A;  4KZT A;  2FIW A;  4J3G A;  1NE9 A;  3TO7 A;  2WPW A;  4KLV A;  2G3A A;  2OZU A;  4JJX A;  3TFY A;  2Z10 A;  4JLY A;  4F0X A;  4KUA A;  4R57 A;  4YGO A;  1RO5 A;  2Q0Y A;  2Z3N A;  3FXT A;  4UBR A;  1M4I A;  4RS2 A;  4HNY B;  3S6H A;  4NSQ A;  2I79 A;  2DPT A;  4QBJ A;  1YLE A;  2WPX A;  5G1Z A;  2YNE A;  1V0C A;  2VI7 A;  4RI1 A;  1I1D A;  1MJA A;  4KOU A;  4PSW A;  5J8C A;  4B5P B;  1KUV A;  3W6S A;  3EO4 A;  2B58 A;  4NXY A;  4CAV A;  4JD6 A;  1XE4 A;  1XEB A;  4PV6 A;  4KSF A;  2B5G B;  1M1D A;  3FRM A;  2A4N A;  2IL4 A;  3NE7 A;  2CNM A;  3QB8 A;  2P0W A;  4H6U A;  4MBU A;  4M3S A;  2CNT A;  2B3U A;  5HMN A;  4KOT A;  5FVJ A;  4B12 A;  3IU2 A;  2VBQ A;  2R8V A;  2FT0 A;  2P6G A;  4B5O A;  4ZGY B;  2EVN A;  2YNC A;  2VQY A;  2Z3M A;  4UCM A;  3B8G A;  3E0K A;  1QSN A;  1I21 A;  2KCW A;  3JVN A;  5AG5 A;  2CY2 A;  4C7H A;  5HH1 A;  3W91 A;  2AJ6 A;  4CS0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...