1CJWA

Serotonin n-acetyltransferase complexed with a bisubstrate analog
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
166
structure length
166
Chain Sequence
HTLPANEFRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLTLCPELSLGWFVEGRLVAFIIGSLWDEERLTQESLALHRPRGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRAVLMCEDALVPFYQRFGFHPAGPCAIVVGSLTFTEMHCSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SEROTONIN N-ACETYLTRANSFERASE)
publication title The structural basis of ordered substrate binding by serotonin N-acetyltransferase: enzyme complex at 1.8 A resolution with a bisubstrate analog.
pubmed doi rcsb
source organism Ovis aries
molecule tags Transferase
total genus 45
structure length 166
sequence length 166
ec nomenclature ec 2.3.1.87: Aralkylamine N-acetyltransferase.
pdb deposition date 1999-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1cjwA00
3JUWA 1RO5A 1QSMA 4XPLA 1J4JA 1S7KA 3CXPA 1K4JA 4UWJA 1L0CA 3MGDA 2Q04A 2FSRA 1S60A 3LD2A 5C82A 1Z9UA 4KVOE 3VWEA 1NE9A 3PP9A 2OB0A 3PZJA 4NXYA 3R1KA 1KZFA 3S6FA 3DR8A 4KOUA 4KLWA 4QVTA 3TFYA 1I12A 2FE7A 3F0AA 2ATRA 1XE4A 2REFA 3QAHA 2B3VA 1TIQA 3R95A 3FIXA 4FD5A 2P6EA 4CRZB 3H4QA 5DWNA 3EY5A 2EUIA 2R8VA 4PK2A 5IV0A 4KUBA 4CS0B 3WR7A 1YVOA 3S6GA 3BJ7A 4L89A 1B6BA 1MJ9A 2C27A 2F5IA 2ZW4A 1YGHA 5GCNA 4DNCA 3S6KA 3F5BA 2FIWA 1NSLA 4IUSA 3TE4A 4YGOA 4M85A 1BO4A 2PSWA 2G3AA 1Q2CA 3C26A 1QSRA 3ZZIA 4JLYA 2Y0MA 2G3TA 1U6MA 4KZTA 1IB1E 4UBRA 5I0CA 2BUEA 3N7ZA 1NMTA 2RC4A 2O28A 4MY0A 4AVAA 2OZUA 1BOBA 2BEIA 3R9EA 1XMTA 2B4DB 1IIDA 4U9YA 3I3GA 1UFHA 1KUXA 4HKFA 2FL4A 4CAVA 5JPHA 2ZW5A 4KVME 4NF1A 3GYAA 3TT2A 3CXSA 3TO6A 2HQYA 5KTCA 4KORA 2P0WA 2ZW6A 4R57A 4KLVA 1Q2YA 3ZJ0A 1MJAA 1SQHA 4XNHB 2H5MA 4KOSA 2NMTA 1WK4A 2ZW7A 5EC4A 2OU2A 4Y49C 3W6XA 2J8NA 2ZPAA 4JWPA 1I21A 3FBUA 2AE6A 4ORFA 4FD7A 2AJ6A 2Z0ZA 4UWIA 4MBUA 4OADA 3CXQA 1S5KA 2WPWA 4KOVA 2REEA 2HUZA 4KVXA 4UA3A 3SXOA 5F46A 3FXTA 3EFAA 4RS2A 4QUSA 2A4NA 3EO4A 2CY2A 5KTDA 2PRBA 4R3KA 3S6HA 3JVNA 2HV2A 1M4DA 2I00A 4PSXA 4E0AA 2I79A 4AVCA 3D3SA 2K5TA 2JLMA 1KUVA 4PSWA 4B5PB 2CNMA 1WWZA 1R57A 1XEBA 3LODA 2P6FA 2Q4VA 4B5OA 1KUYA 1PUAA 2GANA 3NE7A 4MI4A 4OLLA 3EXNA 3FRMA 2EVNA 3SHPA 2R7HA 3SXNA 3VWDA 2D4OA 2JDDA 4KUAA 3G3SA 4CAXA 1M4GA 1IYKA 1Z4EA 2FXFA 3D2PA 3TO7A 1YLEA 3PGPA 2CNTA 1Y7RA 2PQ8A 4AVBA 4XPDC 3FB3A 2PR8A 1P0HA 3QB8A 1I1DA 2BSWA 2J8MA 4OAEA 1IICA 4K30A 4MHDA 5IX3A 4KOTA 4LX9A 3DDDA 4QBJA 2ZXVA 1S3ZA 4RI1A 2WPXA 3FNCA 3T9YA 2B5GA 4JJXA 3FYNA 2D4PA 2VZYA 3R9GA 4JD6A 4L8AA 2FT0A 4F6AA 2VZZA 4XPKA 5C88A 1S7FA 2R1IA 4Y49B 4CRYB 1Q2DA 2JEVA 4AG9A 5F47A 5F49A 3KKWA 4J3GA 1V0CA 2BL1A 3EC4A 4HNYB 1M1DA 1QSTA 1M4IA 2B4DA 2Q44A 3TTHA 4AG7A 1S7NA 2PDOA 1N71A 2B58A 4NEXA 4E8OA 3V8IA 4X5KA 4R3LA 2VQYA 4PK3A 3TO9A 3GKRA 1QSNA 1XF8A 2X7BA 1FY7A 1OZPA 1Y9WA 2VI7A 1GHEA 2GE3A 5KTAA 3R96A 5HMNA 4MY3A 3W6SA 4NSQA 5EBVA 4R87A 5H84A 4HNXB 1YVKA 3F8KA 2QIRA 1M44A 5DWMA 2G0BA 4CAWA 5J8FA 5JQ4A 1YR0A 3I9SA 3TOBA 2P6GA 2VBQA 3OWCA 1ON0A 5HH1A 2Q4YA 1XIXA 4F0YA 4II9A 3T90A 3P2FA 4YRHA 2J8RA 2JDCA 1QSOA 3RYOA 3TOAA 4AB7A 2Q7BA 2IL4A 3E0KA 1MJBA 1VHSA 3GY9A 4QC6A 4NCZA 2OZGA 4PV6A 2PC1A 4FD6A 4GS4A 2ARHA 4XPDB 5CNPA 4B5PA 2R98A 3D8PA 4M3SA 4QB9A 4ZBGA 4H89A 2DXQA 2Q0YA 3IWGA 2B5GB 1CM0A 5F48A 3DR6A 4KOWA 1YREA 4H6UA 3B8GA 3TCVA 4U5YA 1LRZA 2FS5A 2QMLA 2VEZA 1PU9A 2FCKA 2FIAA 3UY5A 1Z4RA 1B87A 4I49A 4KOXA 4BMHA 3K9UA 2PR1A 1YX0A 1CJWA 1MK4A 2QECA 5H86A 3D2MA 3R9FA 4E2AA 2VXKA 4YFJA 2Z11A 1RXTA 2OH1A 4R9MA 2Z10A 4JXQA 3DSBA 5J8CA 3DNSA 3P2HA 4HNWB 4EVYA 3IGRA 2OZHA 4ONUA 4IF5A 4KOYA 1YK3A 4XNHC 5E96A 3G8WA 1P4NA 4H6ZA 2B3UA 4JXRA 1IYLA 5IB0A 2GIVA 2B4BA 4MJ8A 3W91A 2KCWA 4LUAA 2CNSA 1VKCA 1S7LA 4U9ZA 5FVJA 5ISVA 1Y9KA 4FD4A 3BJ8A 3BLNA
chains in the Genus database with same CATH superfamily
5LRKA 3JUWA 1RO5A 1QSMA 4XPLA 1CX8A 1J4JA 1S7KA 2Q4ZA 3RAMA 3CXPA 7CPAA 3NFZA 4UEEA 1K4JA 4UWJA 2J9AA 1L0CA 3MGDA 2Q04A 2QJ8A 3NH8A 4KS9A 2FSRA 1VHEA 3D7HA 1S60A 3LD2A 5C82A 3IO1A 4EFDA 4P6YA 1Z9UA 4CYPA 4KVOE 3VWEA 1NE9A 3PP9A 3SI0A 1A2ZA 1DTDA 2OB0A 3PZJA 4NXYA 3N5FA 3R1KA 1KZFA 3S6FA 3BI0A 3CPAA 1ARMA 3DR8A 4NGRA 4MCRA 1KWMA 4R6TA 4Z65A 4OC3A 5A27A 4K3NA 3PFEA 4KOUA 4KLWA 4QVTA 4CAFA 3GLJA 3S9NA 3TFYA 1I12A 2WUUA 2FE7A 4PXEA 3F0AA 2ATRA 1Z2LA 1XE4A 1RTQA 2REFA 3QAHA 2B3VA 1TIQA 3R95A 2ABZA 3FIXA 1TF9A 2I3CA 2AFSA 2P6EA 3FH4A 4FD5A 4CRZB 4ZI6A 3H4QA 5DWNA 2EWBA 2ZEEA 3EY5A 2EUIA 2R8VA 4PK2A 5IV0A 2Z3NA 4KUBA 4CS0B 3WR7A 1YVOA 4MFLA 3S6GA 4OC2A 3BJ7A 2V77A 3D7FA 3GUXA 2ZEFA 2OOTA 4L89A 5CBMA 1B6BA 1LANA 1MJ9A 2C27A 3PBEA 3NA6A 3S9MA 1Z5RA 2PJBA 4OC4A 2F5IA 5HVGA 2Q43A 1VHOA 2YNCC 1GYTA 2ZW4A 1Z8WA 1YGHA 5LYIA 2POKA 4P4BA 4DUKA 4IHMA 5GCNA 4DNCA 1XMBA 3S6KA 2IJZA 3F5BA 4KSFA 4TWEA 2QVPA 5K8MA 2FIWA 1IY7A 2C6PA 3FECA 1NSLA 2DPSA 4IUSA 3TE4A 3RZAA 4YGOA 1YSJA 4M85A 1BO4A 2PSWA 3FX6A 3H5ZA 2G3AA 2V8VA 1Q2CA 5THWA 1YMEA 3C26A 2Z3MA 1QSRA 4G1PA 5AG6A 3ZZIA 4JLYA 2Y0MA 1ZG9A 2G3TA 1U6MA 4KZTA 5K8OA 5G1ZA 3CT9A 1LAPA 1IB1E 1QQ9A 4UBRA 5I0CA 2BUEA 3KQZA 3KL9A 3SJXA 2PJ4A 3N7ZA 1NMTA 2RC4A 3D7GA 3DLJA 4B6ZA 2O28A 2XEIA 4MY0A 4CGLA 3H8EA 5JGFA 4AVAA 2OZUA 3NE8A 4CPAA 1BOBA 4B14A 2ZOFA 2BEIA 3T8WA 2JBJA 3R9EA 1XMTA 2B4DB 1IIDA 1Y7EA 4U9YA 3I3GA 1UFHA 1KUXA 1YLOA 2FL4A 4HKFA 4M6IA 4CAVA 2AFWA 4R8FA 4CYOA 5JPHA 2ZW5A 4ZX8A 2GLJA 3B3TA 4KVME 4NF1A 3GYAA 3TT2A 1ELLP 2WZNA 2DEAA 4KSIA 3CXSA 3TO6A 1TF8A 2HQYA 5KTCA 3KI9A 3VH9A 1YW6A 4JYWA 4KORA 4NGQA 2P0WA 3VARA 2IMOA 2PJ5A 2ZW6A 4H2KA 4R57A 4KLVA 1Q2YA 4X3RA 1MJAA 3ZJ0A 4OC0A 1SQHA 3KQXA 4XNHB 1LOKA 4LQGA 2H5MA 4KOSA 2ANPA 1WK4A 2NMTA 3IEHA 2Z3PA 3LWUA 4R7MA 2ZW7A 5EC4A 2XEGA 2OU2A 3D7DA 4Y49C 3W6XA 4C7IA 4MHZA 2J8NA 2ZPAA 3D66A 3PRTA 1I21A 2GLFA 4JWPA 3WC6A 3FBUA 1H8LA 3I1UA 4NGPA 4ONWA 2AE6A 2ZEOA 3WC7A 8CPAA 4ORFA 1Z8XA 2XEJA 4FD7A 2AJ6A 5LYLA 1X10A 2PJ0A 2Z0ZA 4UWIA 4MBUA 4OADA 3IWEA 3CXQA 1S5KA 2WPWA 4NGNA 4KOVA 2REEA 2HUZA 4KVXA 4MHPA 2V8HA 3FEEA 4UA3A 3SXOA 5F46A 1QMUA 3PB6X 4JZ0A 2F7VA 3FXTA 3EFAA 4NGMA 1PCAA 4RS2A 3FVLA 2PJCA 4QUSA 2A4NA 3EO4A 3V7ZA 4A39A 2CIJA 5F09A 4NGSA 3KZWA 2CY2A 4C7HA 5KTDA 1HDQA 1Z8TA 1CPXA 2PRBA 4NJQA 4R3KA 4C2XA 1PYTB 5G22A 5LRJA 3S6HA 2C6CA 3JVNA 5AG5A 4CGMA 2HV2A 3KR4A 2HC9A 2PJ8A 1M4DA 2I00A 4F0XA 4PSXA 4UFWA 4E0AA 2I79A 4AVCA 3SI1A 3D3SA 2K5TA 2JLMA 5JH9A 4UFVA 2Q51A 1KUVA 4CYNA 4PSWA 4B5PB 5HVHA 2CNMA 2WYRA 1WWZA 1IOFA 1R57A 4FBEA 4B12A 1UWYA 2DPTA 1HDUA 1XEBA 2YNEA 3LODA 2P6FA 4P10A 4MRIA 2Q4VA 4B5OA 1KUYA 1AUGA 2JEWA 1PUAA 2ZEGA 3KR5A 3NH4A 2GANA 3FEDA 3BI1A 3NE7A 4MI4A 3LACA 4WWVA 4OLLA 3ISXA 3KHZA 3EXNA 1X12A 3FRMA 6CPAA 2EVNA 5JM6A 1XFOA 5BWAB 1HEEA 4B11A 4ZX9A 3SHPA 2R7HA 4M6GA 3SXNA 2ZEMA 2RFHA 4P45A 3VWDA 2D4OA 4MFJA 2PJ3A 1Y0RA 2JDDA 2QYVA 1XBUA 4KUAA 3VATA 3G3SA 4CAXA 1M4GA 4HPSA 1IYKA 1Z4EA 2FXFA 3QAYA 3D2PA 4P4IA 4TNUA 3TO7A 1YLEA 2AFOA 1CP6A 2CNTA 3PGPA 1Y7RA 2PQ8A 4AVBA 4DYOA 1BLLE 3LMSA 4MCPA 4XPDC 3FB3A 3IIBA 2PR8A 4UCMA 2NYQA 4NGTA 1P0HA 3ISZA 1F57A 4WJBA 3QB8A 1I1DA 2BSWA 2J8MA 4OAEA 5A28A 1IICA 1NSAA 4K30A 4MCQA 3B7IA 4MCSA 5HXDA 4MHDA 5AG7A 2PJ6A 5IX3A 4Q38A 4KOTA 2PCUA 4LX9A 3DDDA 2GU2A 4QBJA 4MMOA 5HVFA 2ZXVA 4FWUA 1S3ZA 1ZLIA 4PXBA 4RI1A 4FAIA 5K8PA 2WPXA 3FNCA 4B13A 4UIAA 2GREA 3T9YA 2B5GA 3JTKA 1JQGA 4CGOA 4JJXA 3RO0A 3FYNA 3PB7X 2D4PA 4F9VA 2VZYA 3B35A 3R9GA 5EMIA 4JD6A 4L8AA 4MFPA 1XJOA 4A95A 4A94A 1Q7LA 2FT0A 4CGNA 2PJAA 4UCPA 5D8NA 4B10A 4F6AA 2VZZA 4XPKA 5C88A 1S7FA 5G21A 2R1IA 2YGWA 4Y49B 4CRYB 4OMEA 5LYDA 4A33A 3SJFA 1Q2DA 2JEVA 2JBKA 5F47A 4UFXA 5F49A 4AG9A 3KKWA 4J3GA 3HLPA 3QNVA 1V0CA 2BL1A 3GB0A 3EC4A 3PBBA 1ZLHA 4HNYB 1XRYA 1M1DA 1QSTA 4F9UA 1M4IA 2B4DA 2Q44A 3TTHA 2BO9A 1S7NA 4AG7A 2PDOA 2YNDA 1N71A 4P4FA 2B58A 4NEXA 4E8OA 3D68A 4GM5A 4X5KA 3V8IA 3K2KA 1TKHA 4R3LA 1IU8A 2VQYA 4PK3A 5CPAA 3GKRA 1QSNA 1XF8A 1XOVA 3TO9A 2X7BA 4CYQA 5LYFA 1VIXA 1M4LA 2PE3A 1FY7A 1OZPA 1LAMA 1CG2A 1Y9WA 2PJ9A 2VI7A 3A9LA 1GHEA 4OP4A 5G20A 2GE3A 4BD9A 4X8IA 1FNOA 5KTAA 2AFZA 4MXUA 3R96A 2PVVA 4MY3A 5HMNA 2C6GA 4R76A 3HUVA 3W6SA 3B3VA 3PFOA 4OC1A 5IB9A 4NSQA 4RN7A 5EBVA 3B3WA 4P4EA 4R87A 5H84A 4HNXB 3B3CA 1YVKA 4MFZA 1TXRA 3F8KA 3SJEA 5J1QA 2RB7A 1TKJA 1ARLA 2QIRA 5LRGA 1LCPA 4KSAA 3IU2A 2CF4A 4AXVA 1M44A 4M6HA 2BOAA 5DWMA 3KHXA 2G0BA 4A38A 3IC1A 3FMCA 4CAWA 2VL1A 4Q36A 5J8FA 3CPXA 2ODFA 2ZELA 5JQ4A 1EE3P 1IGBA 3WC5A 4A37A 1FT7A 1VGYA 1YR0A 2GFQA 1JWQA 2Z3LA 3I9SA 4UEFA 3TOBA 2P6GA 2VBQA 2G9DA 2PJ7A 3OWCA 1ON0A 5HH1A 3BXMA 4EMEA 1F2OA 2PIZA 1ZG7A 3MRUA 1CPSA 2Q4YA 4MFKA 3MN8A 1XIXA 2AFUA 3TX8A 2AFXA 2ZEHA 4OIWA 4F0YA 2Z3KA 3T90A 4II9A 2PRQA 5I4MA 4MHYA 3P2FA 4YWYA 4UEZA 5ELYA 4GXHA 4DJLA 4YRHA 4BINA 2J8RA 2JDCA 1QSOA 5K8NA 2EO8A 1R43A 4UIBA 3RYOA 3TOAA 3H8GA 1F2PA 4AB7A 1OBRA 4LQ6A 2Q7BA 4A32A 2IL4A 3PEIA 3E0KA 1MJBA 1VHSA 4NJRA 2CXAA 3IJ3A 1Y0YA 3GY9A 4QC6A 4PXCA 1AYEA 2ZENA 1IOIA 4NCZA 5AGEA 2OZGA 4PV6A 3RNZA 2PC1A 4FD6A 4GS4A 4ZY1A 2Z3OA 4Q7AA 2ARHA 2C1CA 4PQAA 2DF5A 2WSAA 4XPDB 5CNPA 3K9TA 4NFRA 4O23A 4B5PA 2R98A 4F8ZA 3D8PA 4UF4A 2NSMA 2O4HA 3PB4X 4M3SA 4QB9A 4ZBGA 4H89A 3TC8A 2DXQA 2Q0YA 3IWGA 4X2TA 2B5GB 4MHNA 3CZXA 4A31A 2YNCA 1R3NA 2PJ1A 1CM0A 5F48A 3CDXA 3DR6A 4ZY2A 4KOWA 1YREA 4EWTA 4P4JA 4H6UA 3B8GA 2XEFA 3TCVA 4U5YA 1AMPA 1CBXA 1LRZA 2FS5A 1PU9A 2QMLA 2FCKA 2FIAA 2V8GA 2VEZA 2CTBA 3IFEA 3UY5A 4C68A 1Z4RA 1TKFA 3B3SA 3JRUA 1B87A 2PIYA 3PB8X 1ZG8A 4I49A 4OKOA 2F8HA 4CGPA 2Q7SA 2ZEPA 4OIDA 2PVWA 2V8DA 4KOXA 3FF3A 4BMHA 4IK2A 3K9UA 4BBHA 3BHXA 2PR1A 1LFWA 1YX0A 1CJWA 1MK4A 2QECA 5H86A 3D2MA 4P44A 2CTCA 3R9FA 2VXKA 4E2AA 2ZEDA 4YFJA 2Z11A 1RXTA 2OH1A 3H8FA 4R9MA 2Z10A 1Z8LA 3KASA 4JXQA 5DS0A 3L2NA 3DSBA 5J8CA 3DNSA 4A30A 3P2HA 4C2ZA 3KGQA 3D4UA 4HNWB 4EVYA 3IGRA 3IU1A 4C2YA 3PB9X 1BPMA 3GIUA 4PXDA 3V38A 3FJUA 4W9YA 2FVGA 1DE4C 4IAVA 3WT4A 4PPZA 2OZHA 2BCOA 3S9LA 3B2YA 4ONUA 1ELMP 4ZGYB 2EBJA 1BAVA 1YW4A 4IF5A 4YU9A 4ZY0A 2IQ6A 4KOYA 4RUHA 4FUUA 2EK8A 3RBUA 4CAEA 2ZOGA 4ZYQA 1YK3A 4XNHC 5E96A 3SJGA 3G8WA 1P4NA 1ZO0A 2B3UA 3NH5A 4H6ZA 3DGVA 4JXRA 1IYLA 5IB0A 2GIVA 2B4BA 4MFQA 4OC5A 2HB6A 1YQEA 3D67A 4A2ZA 4MJ8A 3IWWA 3WABA 3W91A 2KCWA 5D29A 4LUAA 2CNSA 2O53A 2PJ2A 1CP7A 4P4DA 1VKCA 1S7LA 2AFMA 4U9ZA 5FVJA 3SI2A 4UCNA 2OR4A 1BPNA 2EK9A 5AG4A 5ISVA 1Y9KA 4FD4A 3BJ8A 3BLNA
chains in the Genus database with same CATH topology
3JUWA 1RO5A 1QSMA 4XPLA 1J4JA 1S7KA 3CXPA 1K4JA 4UWJA 1L0CA 3MGDA 2Q04A 4KS9A 2FSRA 1S60A 3LD2A 5C82A 1Z9UA 4CYPA 4KVOE 3VWEA 1NE9A 3PP9A 2OB0A 3PZJA 4NXYA 3R1KA 1KZFA 3S6FA 3DR8A 5A27A 4KOUA 4KLWA 4QVTA 4CAFA 3TFYA 1I12A 2WUUA 2FE7A 3F0AA 2ATRA 1XE4A 2REFA 3QAHA 2B3VA 1TIQA 3R95A 3FIXA 4FD5A 2P6EA 4CRZB 3H4QA 5DWNA 3EY5A 2EUIA 2R8VA 4PK2A 5IV0A 2Z3NA 4KUBA 4CS0B 3WR7A 1YVOA 4MFLA 3S6GA 3BJ7A 4L89A 1B6BA 1MJ9A 2C27A 2F5IA 2YNCC 2ZW4A 1YGHA 5GCNA 4DNCA 3S6KA 3F5BA 4KSFA 2FIWA 1NSLA 2DPSA 4IUSA 3TE4A 4YGOA 4M85A 1BO4A 2PSWA 3H5ZA 2G3AA 1Q2CA 3C26A 2Z3MA 1QSRA 5AG6A 3ZZIA 4JLYA 2Y0MA 2G3TA 1U6MA 4KZTA 5G1ZA 1IB1E 4UBRA 5I0CA 2BUEA 3N7ZA 1NMTA 2RC4A 2O28A 4MY0A 4CGLA 4AVAA 2OZUA 1BOBA 4B14A 2BEIA 3R9EA 1XMTA 2B4DB 1IIDA 4U9YA 3I3GA 1UFHA 1KUXA 4HKFA 2FL4A 4CAVA 4CYOA 5JPHA 2ZW5A 4KVME 4NF1A 3GYAA 3TT2A 3CXSA 3TO6A 2HQYA 5KTCA 4KORA 2P0WA 2ZW6A 4R57A 4KLVA 1Q2YA 3ZJ0A 1MJAA 1SQHA 4XNHB 2H5MA 4KOSA 2NMTA 1WK4A 2Z3PA 2ZW7A 5EC4A 2OU2A 4Y49C 3W6XA 4C7IA 2J8NA 2ZPAA 4JWPA 1I21A 3FBUA 2AE6A 4ORFA 4FD7A 2AJ6A 2Z0ZA 4UWIA 4MBUA 4OADA 3IWEA 3CXQA 1S5KA 2WPWA 4KOVA 2REEA 2HUZA 4KVXA 4UA3A 3SXOA 5F46A 3FXTA 3EFAA 4RS2A 4QUSA 2A4NA 3EO4A 2CY2A 4C7HA 5KTDA 2PRBA 4C2XA 4R3KA 5G22A 3S6HA 3JVNA 5AG5A 4CGMA 2HV2A 1M4DA 2I00A 4F0XA 4PSXA 4UFWA 4E0AA 2I79A 4AVCA 3D3SA 2K5TA 2JLMA 4UFVA 1KUVA 4CYNA 4PSWA 4B5PB 2CNMA 1WWZA 1R57A 4B12A 2DPTA 1XEBA 2YNEA 3LODA 2P6FA 2Q4VA 4B5OA 1KUYA 1PUAA 2GANA 3NE7A 4MI4A 4OLLA 3EXNA 3FRMA 2EVNA 5BWAB 4B11A 3SHPA 2R7HA 3SXNA 3VWDA 2D4OA 4MFJA 2JDDA 4KUAA 3G3SA 4CAXA 1M4GA 1IYKA 1Z4EA 2FXFA 3D2PA 3TO7A 1YLEA 3PGPA 2CNTA 1Y7RA 2PQ8A 4AVBA 4XPDC 3FB3A 2PR8A 4UCMA 1P0HA 3QB8A 1I1DA 2BSWA 2J8MA 4OAEA 5A28A 1IICA 4K30A 4MHDA 5AG7A 5IX3A 4Q38A 4KOTA 4LX9A 3DDDA 4QBJA 2ZXVA 1S3ZA 4RI1A 2WPXA 3FNCA 4B13A 3T9YA 4CGOA 2B5GA 3JTKA 4JJXA 3FYNA 2D4PA 2VZYA 3R9GA 4JD6A 4L8AA 4MFPA 4A95A 2FT0A 4CGNA 4UCPA 4B10A 4F6AA 2VZZA 4XPKA 5C88A 1S7FA 5G21A 2R1IA 2YGWA 4Y49B 4CRYB 4A33A 1Q2DA 2JEVA 4AG9A 5F47A 4UFXA 5F49A 3KKWA 4J3GA 1V0CA 2BL1A 3EC4A 4HNYB 1M1DA 1QSTA 1M4IA 2B4DA 2Q44A 3TTHA 4AG7A 1S7NA 2PDOA 2YNDA 1N71A 2B58A 4NEXA 4E8OA 3V8IA 4X5KA 4R3LA 2VQYA 4PK3A 3TO9A 3GKRA 1QSNA 1XF8A 4CYQA 2X7BA 1FY7A 1OZPA 1Y9WA 2VI7A 3A9LA 5G20A 1GHEA 2GE3A 5KTAA 3R96A 5HMNA 4MY3A 3W6SA 4NSQA 5EBVA 4R87A 5H84A 4HNXB 1YVKA 4MFZA 3F8KA 2QIRA 4KSAA 3IU2A 1M44A 5DWMA 2G0BA 4CAWA 4Q36A 5J8FA 5JQ4A 1YR0A 2Z3LA 3I9SA 3TOBA 2P6GA 2VBQA 3OWCA 1ON0A 5HH1A 2Q4YA 4MFKA 1XIXA 4F0YA 4II9A 2Z3KA 3T90A 3P2FA 4YRHA 2J8RA 2JDCA 1QSOA 3RYOA 3TOAA 4AB7A 2Q7BA 4A32A 2IL4A 3E0KA 1MJBA 1VHSA 2CXAA 3GY9A 4QC6A 4NCZA 5AGEA 2OZGA 4PV6A 2PC1A 4FD6A 4GS4A 2Z3OA 2ARHA 4XPDB 2WSAA 5CNPA 4B5PA 2R98A 3D8PA 4M3SA 4QB9A 4ZBGA 4H89A 2DXQA 2Q0YA 3IWGA 2B5GB 4A31A 2YNCA 1CM0A 5F48A 3DR6A 4KOWA 1YREA 4H6UA 3B8GA 3TCVA 4U5YA 1LRZA 2FS5A 2QMLA 2VEZA 1PU9A 2FCKA 2FIAA 3UY5A 4C68A 1Z4RA 1B87A 4I49A 4CGPA 4KOXA 4BMHA 3K9UA 4BBHA 2PR1A 1YX0A 1CJWA 1MK4A 2QECA 5H86A 3D2MA 3R9FA 4E2AA 2VXKA 4YFJA 2Z11A 1RXTA 2OH1A 4R9MA 2Z10A 4JXQA 3DSBA 5J8CA 3DNSA 4A30A 3P2HA 4C2ZA 4HNWB 4EVYA 3IGRA 3IU1A 4C2YA 2OZHA 4ONUA 4ZGYB 4IF5A 4KOYA 4CAEA 1YK3A 4XNHC 5E96A 3G8WA 1P4NA 1ZO0A 2B3UA 4H6ZA 4JXRA 1IYLA 5IB0A 2GIVA 2B4BA 4MFQA 4A2ZA 4MJ8A 3W91A 2KCWA 4LUAA 2CNSA 1VKCA 1S7LA 4U9ZA 5FVJA 4UCNA 5AG4A 5ISVA 1Y9KA 4FD4A 3BJ8A 3BLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JUW A;  1RO5 A;  1QSM A;  4XPL A;  1J4J A;  1S7K A;  3CXP A;  1K4J A;  4UWJ A;  1L0C A;  3MGD A;  2Q04 A;  2FSR A;  1S60 A;  3LD2 A;  5C82 A;  1Z9U A;  4KVO E;  3VWE A;  1NE9 A;  3PP9 A;  2OB0 A;  3PZJ A;  4NXY A;  3R1K A;  1KZF A;  3S6F A;  3DR8 A;  4KOU A;  4KLW A;  4QVT A;  3TFY A;  1I12 A;  2FE7 A;  3F0A A;  2ATR A;  1XE4 A;  2REF A;  3QAH A;  2B3V A;  1TIQ A;  3R95 A;  3FIX A;  4FD5 A;  2P6E A;  4CRZ B;  3H4Q A;  5DWN A;  3EY5 A;  2EUI A;  2R8V A;  4PK2 A;  5IV0 A;  4KUB A;  4CS0 B;  3WR7 A;  1YVO A;  3S6G A;  3BJ7 A;  4L89 A;  1B6B A;  1MJ9 A;  2C27 A;  2F5I A;  2ZW4 A;  1YGH A;  5GCN A;  4DNC A;  3S6K A;  3F5B A;  2FIW A;  1NSL A;  4IUS A;  3TE4 A;  4YGO A;  4M85 A;  1BO4 A;  2PSW A;  2G3A A;  1Q2C A;  3C26 A;  1QSR A;  3ZZI A;  4JLY A;  2Y0M A;  2G3T A;  1U6M A;  4KZT A;  1IB1 E;  4UBR A;  5I0C A;  2BUE A;  3N7Z A;  1NMT A;  2RC4 A;  2O28 A;  4MY0 A;  4AVA A;  2OZU A;  1BOB A;  2BEI A;  3R9E A;  1XMT A;  2B4D B;  1IID A;  4U9Y A;  3I3G A;  1UFH A;  1KUX A;  4HKF A;  2FL4 A;  4CAV A;  5JPH A;  2ZW5 A;  4KVM E;  4NF1 A;  3GYA A;  3TT2 A;  3CXS A;  3TO6 A;  2HQY A;  5KTC A;  4KOR A;  2P0W A;  2ZW6 A;  4R57 A;  4KLV A;  1Q2Y A;  3ZJ0 A;  1MJA A;  1SQH A;  4XNH B;  2H5M A;  4KOS A;  2NMT A;  1WK4 A;  2ZW7 A;  5EC4 A;  2OU2 A;  4Y49 C;  3W6X A;  2J8N A;  2ZPA A;  4JWP A;  1I21 A;  3FBU A;  2AE6 A;  4ORF A;  4FD7 A;  2AJ6 A;  2Z0Z A;  4UWI A;  4MBU A;  4OAD A;  3CXQ A;  1S5K A;  2WPW A;  4KOV A;  2REE A;  2HUZ A;  4KVX A;  4UA3 A;  3SXO A;  5F46 A;  3FXT A;  3EFA A;  4RS2 A;  4QUS A;  2A4N A;  3EO4 A;  2CY2 A;  5KTD A;  2PRB A;  4R3K A;  3S6H A;  3JVN A;  2HV2 A;  1M4D A;  2I00 A;  4PSX A;  4E0A A;  2I79 A;  4AVC A;  3D3S A;  2K5T A;  2JLM A;  1KUV A;  4PSW A;  4B5P B;  2CNM A;  1WWZ A;  1R57 A;  1XEB A;  3LOD A;  2P6F A;  2Q4V A;  4B5O A;  1KUY A;  1PUA A;  2GAN A;  3NE7 A;  4MI4 A;  4OLL A;  3EXN A;  3FRM A;  2EVN A;  3SHP A;  2R7H A;  3SXN A;  3VWD A;  2D4O A;  2JDD A;  4KUA A;  3G3S A;  4CAX A;  1M4G A;  1IYK A;  1Z4E A;  2FXF A;  3D2P A;  3TO7 A;  1YLE A;  3PGP A;  2CNT A;  1Y7R A;  2PQ8 A;  4AVB A;  4XPD C;  3FB3 A;  2PR8 A;  1P0H A;  3QB8 A;  1I1D A;  2BSW A;  2J8M A;  4OAE A;  1IIC A;  4K30 A;  4MHD A;  5IX3 A;  4KOT A;  4LX9 A;  3DDD A;  4QBJ A;  2ZXV A;  1S3Z A;  4RI1 A;  2WPX A;  3FNC A;  3T9Y A;  2B5G A;  4JJX A;  3FYN A;  2D4P A;  2VZY A;  3R9G A;  4JD6 A;  4L8A A;  2FT0 A;  4F6A A;  2VZZ A;  4XPK A;  5C88 A;  1S7F A;  2R1I A;  4Y49 B;  4CRY B;  1Q2D A;  2JEV A;  4AG9 A;  5F47 A;  5F49 A;  3KKW A;  4J3G A;  1V0C A;  2BL1 A;  3EC4 A;  4HNY B;  1M1D A;  1QST A;  1M4I A;  2B4D A;  2Q44 A;  3TTH A;  4AG7 A;  1S7N A;  2PDO A;  1N71 A;  2B58 A;  4NEX A;  4E8O A;  3V8I A;  4X5K A;  4R3L A;  2VQY A;  4PK3 A;  3TO9 A;  3GKR A;  1QSN A;  1XF8 A;  2X7B A;  1FY7 A;  1OZP A;  1Y9W A;  2VI7 A;  1GHE A;  2GE3 A;  5KTA A;  3R96 A;  5HMN A;  4MY3 A;  3W6S A;  4NSQ A;  5EBV A;  4R87 A;  5H84 A;  4HNX B;  1YVK A;  3F8K A;  2QIR A;  1M44 A;  5DWM A;  2G0B A;  4CAW A;  5J8F A;  5JQ4 A;  1YR0 A;  3I9S A;  3TOB A;  2P6G A;  2VBQ A;  3OWC A;  1ON0 A;  5HH1 A;  2Q4Y A;  1XIX A;  4F0Y A;  4II9 A;  3T90 A;  3P2F A;  4YRH A;  2J8R A;  2JDC A;  1QSO A;  3RYO A;  3TOA A;  4AB7 A;  2Q7B A;  2IL4 A;  3E0K A;  1MJB A;  1VHS A;  3GY9 A;  4QC6 A;  4NCZ A;  2OZG A;  4PV6 A;  2PC1 A;  4FD6 A;  4GS4 A;  2ARH A;  4XPD B;  5CNP A;  4B5P A;  2R98 A;  3D8P A;  4M3S A;  4QB9 A;  4ZBG A;  4H89 A;  2DXQ A;  2Q0Y A;  3IWG A;  2B5G B;  1CM0 A;  5F48 A;  3DR6 A;  4KOW A;  1YRE A;  4H6U A;  3B8G A;  3TCV A;  4U5Y A;  1LRZ A;  2FS5 A;  2QML A;  2VEZ A;  1PU9 A;  2FCK A;  2FIA A;  3UY5 A;  1Z4R A;  1B87 A;  4I49 A;  4KOX A;  4BMH A;  3K9U A;  2PR1 A;  1YX0 A;  1CJW A;  1MK4 A;  2QEC A;  5H86 A;  3D2M A;  3R9F A;  4E2A A;  2VXK A;  4YFJ A;  2Z11 A;  1RXT A;  2OH1 A;  4R9M A;  2Z10 A;  4JXQ A;  3DSB A;  5J8C A;  3DNS A;  3P2H A;  4HNW B;  4EVY A;  3IGR A;  2OZH A;  4ONU A;  4IF5 A;  4KOY A;  1YK3 A;  4XNH C;  5E96 A;  3G8W A;  1P4N A;  4H6Z A;  2B3U A;  4JXR A;  1IYL A;  5IB0 A;  2GIV A;  2B4B A;  4MJ8 A;  3W91 A;  2KCW A;  4LUA A;  2CNS A;  1VKC A;  1S7L A;  4U9Z A;  5FVJ A;  5ISV A;  1Y9K A;  4FD4 A;  3BJ8 A;  3BLN A; 
#chains in the Genus database with same CATH topology
 5LRK A;  3JUW A;  1RO5 A;  1QSM A;  4XPL A;  1CX8 A;  1J4J A;  1S7K A;  2Q4Z A;  3RAM A;  3CXP A;  7CPA A;  3NFZ A;  4UEE A;  1K4J A;  4UWJ A;  2J9A A;  1L0C A;  3MGD A;  2Q04 A;  2QJ8 A;  3NH8 A;  4KS9 A;  2FSR A;  1VHE A;  3D7H A;  1S60 A;  3LD2 A;  5C82 A;  3IO1 A;  4EFD A;  4P6Y A;  1Z9U A;  4CYP A;  4KVO E;  3VWE A;  1NE9 A;  3PP9 A;  3SI0 A;  1A2Z A;  1DTD A;  2OB0 A;  3PZJ A;  4NXY A;  3N5F A;  3R1K A;  1KZF A;  3S6F A;  3BI0 A;  3CPA A;  1ARM A;  3DR8 A;  4NGR A;  4MCR A;  1KWM A;  4R6T A;  4Z65 A;  4OC3 A;  5A27 A;  4K3N A;  3PFE A;  4KOU A;  4KLW A;  4QVT A;  4CAF A;  3GLJ A;  3S9N A;  3TFY A;  1I12 A;  2WUU A;  2FE7 A;  4PXE A;  3F0A A;  2ATR A;  1Z2L A;  1XE4 A;  1RTQ A;  2REF A;  3QAH A;  2B3V A;  1TIQ A;  3R95 A;  2ABZ A;  3FIX A;  1TF9 A;  2I3C A;  2AFS A;  2P6E A;  3FH4 A;  4FD5 A;  4CRZ B;  4ZI6 A;  3H4Q A;  5DWN A;  2EWB A;  2ZEE A;  3EY5 A;  2EUI A;  2R8V A;  4PK2 A;  5IV0 A;  2Z3N A;  4KUB A;  4CS0 B;  3WR7 A;  1YVO A;  4MFL A;  3S6G A;  4OC2 A;  3BJ7 A;  2V77 A;  3D7F A;  3GUX A;  2ZEF A;  2OOT A;  4L89 A;  5CBM A;  1B6B A;  1LAN A;  1MJ9 A;  2C27 A;  3PBE A;  3NA6 A;  3S9M A;  1Z5R A;  2PJB A;  4OC4 A;  2F5I A;  5HVG A;  2Q43 A;  1VHO A;  2YNC C;  1GYT A;  2ZW4 A;  1Z8W A;  1YGH A;  5LYI A;  2POK A;  4P4B A;  4DUK A;  4IHM A;  5GCN A;  4DNC A;  1XMB A;  3S6K A;  2IJZ A;  3F5B A;  4KSF A;  4TWE A;  2QVP A;  5K8M A;  2FIW A;  1IY7 A;  2C6P A;  3FEC A;  1NSL A;  2DPS A;  4IUS A;  3TE4 A;  3RZA A;  4YGO A;  1YSJ A;  4M85 A;  1BO4 A;  2PSW A;  3FX6 A;  3H5Z A;  2G3A A;  2V8V A;  1Q2C A;  5THW A;  1YME A;  3C26 A;  2Z3M A;  1QSR A;  4G1P A;  5AG6 A;  3ZZI A;  4JLY A;  2Y0M A;  1ZG9 A;  2G3T A;  1U6M A;  4KZT A;  5K8O A;  5G1Z A;  3CT9 A;  1LAP A;  1IB1 E;  1QQ9 A;  4UBR A;  5I0C A;  2BUE A;  3KQZ A;  3KL9 A;  3SJX A;  2PJ4 A;  3N7Z A;  1NMT A;  2RC4 A;  3D7G A;  3DLJ A;  4B6Z A;  2O28 A;  2XEI A;  4MY0 A;  4CGL A;  3H8E A;  5JGF A;  4AVA A;  2OZU A;  3NE8 A;  4CPA A;  1BOB A;  4B14 A;  2ZOF A;  2BEI A;  3T8W A;  2JBJ A;  3R9E A;  1XMT A;  2B4D B;  1IID A;  1Y7E A;  4U9Y A;  3I3G A;  1UFH A;  1KUX A;  1YLO A;  2FL4 A;  4HKF A;  4M6I A;  4CAV A;  2AFW A;  4R8F A;  4CYO A;  5JPH A;  2ZW5 A;  4ZX8 A;  2GLJ A;  3B3T A;  4KVM E;  4NF1 A;  3GYA A;  3TT2 A;  1ELL P;  2WZN A;  2DEA A;  4KSI A;  3CXS A;  3TO6 A;  1TF8 A;  2HQY A;  5KTC A;  3KI9 A;  3VH9 A;  1YW6 A;  4JYW A;  4KOR A;  4NGQ A;  2P0W A;  3VAR A;  2IMO A;  2PJ5 A;  2ZW6 A;  4H2K A;  4R57 A;  4KLV A;  1Q2Y A;  4X3R A;  1MJA A;  3ZJ0 A;  4OC0 A;  1SQH A;  3KQX A;  4XNH B;  1LOK A;  4LQG A;  2H5M A;  4KOS A;  2ANP A;  1WK4 A;  2NMT A;  3IEH A;  2Z3P A;  3LWU A;  4R7M A;  2ZW7 A;  5EC4 A;  2XEG A;  2OU2 A;  3D7D A;  4Y49 C;  3W6X A;  4C7I A;  4MHZ A;  2J8N A;  2ZPA A;  3D66 A;  3PRT A;  1I21 A;  2GLF A;  4JWP A;  3WC6 A;  3FBU A;  1H8L A;  3I1U A;  4NGP A;  4ONW A;  2AE6 A;  2ZEO A;  3WC7 A;  8CPA A;  4ORF A;  1Z8X A;  2XEJ A;  4FD7 A;  2AJ6 A;  5LYL A;  1X10 A;  2PJ0 A;  2Z0Z A;  4UWI A;  4MBU A;  4OAD A;  3IWE A;  3CXQ A;  1S5K A;  2WPW A;  4NGN A;  4KOV A;  2REE A;  2HUZ A;  4KVX A;  4MHP A;  2V8H A;  3FEE A;  4UA3 A;  3SXO A;  5F46 A;  1QMU A;  3PB6 X;  4JZ0 A;  2F7V A;  3FXT A;  3EFA A;  4NGM A;  1PCA A;  4RS2 A;  3FVL A;  2PJC A;  4QUS A;  2A4N A;  3EO4 A;  3V7Z A;  4A39 A;  2CIJ A;  5F09 A;  4NGS A;  3KZW A;  2CY2 A;  4C7H A;  5KTD A;  1HDQ A;  1Z8T A;  1CPX A;  2PRB A;  4NJQ A;  4R3K A;  4C2X A;  1PYT B;  5G22 A;  5LRJ A;  3S6H A;  2C6C A;  3JVN A;  5AG5 A;  4CGM A;  2HV2 A;  3KR4 A;  2HC9 A;  2PJ8 A;  1M4D A;  2I00 A;  4F0X A;  4PSX A;  4UFW A;  4E0A A;  2I79 A;  4AVC A;  3SI1 A;  3D3S A;  2K5T A;  2JLM A;  5JH9 A;  4UFV A;  2Q51 A;  1KUV A;  4CYN A;  4PSW A;  4B5P B;  5HVH A;  2CNM A;  2WYR A;  1WWZ A;  1IOF A;  1R57 A;  4FBE A;  4B12 A;  1UWY A;  2DPT A;  1HDU A;  1XEB A;  2YNE A;  3LOD A;  2P6F A;  4P10 A;  4MRI A;  2Q4V A;  4B5O A;  1KUY A;  1AUG A;  2JEW A;  1PUA A;  2ZEG A;  3KR5 A;  3NH4 A;  2GAN A;  3FED A;  3BI1 A;  3NE7 A;  4MI4 A;  3LAC A;  4WWV A;  4OLL A;  3ISX A;  3KHZ A;  3EXN A;  1X12 A;  3FRM A;  6CPA A;  2EVN A;  5JM6 A;  1XFO A;  5BWA B;  1HEE A;  4B11 A;  4ZX9 A;  3SHP A;  2R7H A;  4M6G A;  3SXN A;  2ZEM A;  2RFH A;  4P45 A;  3VWD A;  2D4O A;  4MFJ A;  2PJ3 A;  1Y0R A;  2JDD A;  2QYV A;  1XBU A;  4KUA A;  3VAT A;  3G3S A;  4CAX A;  1M4G A;  4HPS A;  1IYK A;  1Z4E A;  2FXF A;  3QAY A;  3D2P A;  4P4I A;  4TNU A;  3TO7 A;  1YLE A;  2AFO A;  1CP6 A;  2CNT A;  3PGP A;  1Y7R A;  2PQ8 A;  4AVB A;  4DYO A;  1BLL E;  3LMS A;  4MCP A;  4XPD C;  3FB3 A;  3IIB A;  2PR8 A;  4UCM A;  2NYQ A;  4NGT A;  1P0H A;  3ISZ A;  1F57 A;  4WJB A;  3QB8 A;  1I1D A;  2BSW A;  2J8M A;  4OAE A;  5A28 A;  1IIC A;  1NSA A;  4K30 A;  4MCQ A;  3B7I A;  4MCS A;  5HXD A;  4MHD A;  5AG7 A;  2PJ6 A;  5IX3 A;  4Q38 A;  4KOT A;  2PCU A;  4LX9 A;  3DDD A;  2GU2 A;  4QBJ A;  4MMO A;  5HVF A;  2ZXV A;  4FWU A;  1S3Z A;  1ZLI A;  4PXB A;  4RI1 A;  4FAI A;  5K8P A;  2WPX A;  3FNC A;  4B13 A;  4UIA A;  2GRE A;  3T9Y A;  2B5G A;  3JTK A;  1JQG A;  4CGO A;  4JJX A;  3RO0 A;  3FYN A;  3PB7 X;  2D4P A;  4F9V A;  2VZY A;  3B35 A;  3R9G A;  5EMI A;  4JD6 A;  4L8A A;  4MFP A;  1XJO A;  4A95 A;  4A94 A;  1Q7L A;  2FT0 A;  4CGN A;  2PJA A;  4UCP A;  5D8N A;  4B10 A;  4F6A A;  2VZZ A;  4XPK A;  5C88 A;  1S7F A;  5G21 A;  2R1I A;  2YGW A;  4Y49 B;  4CRY B;  4OME A;  5LYD A;  4A33 A;  3SJF A;  1Q2D A;  2JEV A;  2JBK A;  5F47 A;  4UFX A;  5F49 A;  4AG9 A;  3KKW A;  4J3G A;  3HLP A;  3QNV A;  1V0C A;  2BL1 A;  3GB0 A;  3EC4 A;  3PBB A;  1ZLH A;  4HNY B;  1XRY A;  1M1D A;  1QST A;  4F9U A;  1M4I A;  2B4D A;  2Q44 A;  3TTH A;  2BO9 A;  1S7N A;  4AG7 A;  2PDO A;  2YND A;  1N71 A;  4P4F A;  2B58 A;  4NEX A;  4E8O A;  3D68 A;  4GM5 A;  4X5K A;  3V8I A;  3K2K A;  1TKH A;  4R3L A;  1IU8 A;  2VQY A;  4PK3 A;  5CPA A;  3GKR A;  1QSN A;  1XF8 A;  1XOV A;  3TO9 A;  2X7B A;  4CYQ A;  5LYF A;  1VIX A;  1M4L A;  2PE3 A;  1FY7 A;  1OZP A;  1LAM A;  1CG2 A;  1Y9W A;  2PJ9 A;  2VI7 A;  3A9L A;  1GHE A;  4OP4 A;  5G20 A;  2GE3 A;  4BD9 A;  4X8I A;  1FNO A;  5KTA A;  2AFZ A;  4MXU A;  3R96 A;  2PVV A;  4MY3 A;  5HMN A;  2C6G A;  4R76 A;  3HUV A;  3W6S A;  3B3V A;  3PFO A;  4OC1 A;  5IB9 A;  4NSQ A;  4RN7 A;  5EBV A;  3B3W A;  4P4E A;  4R87 A;  5H84 A;  4HNX B;  3B3C A;  1YVK A;  4MFZ A;  1TXR A;  3F8K A;  3SJE A;  5J1Q A;  2RB7 A;  1TKJ A;  1ARL A;  2QIR A;  5LRG A;  1LCP A;  4KSA A;  3IU2 A;  2CF4 A;  4AXV A;  1M44 A;  4M6H A;  2BOA A;  5DWM A;  3KHX A;  2G0B A;  4A38 A;  3IC1 A;  3FMC A;  4CAW A;  2VL1 A;  4Q36 A;  5J8F A;  3CPX A;  2ODF A;  2ZEL A;  5JQ4 A;  1EE3 P;  1IGB A;  3WC5 A;  4A37 A;  1FT7 A;  1VGY A;  1YR0 A;  2GFQ A;  1JWQ A;  2Z3L A;  3I9S A;  4UEF A;  3TOB A;  2P6G A;  2VBQ A;  2G9D A;  2PJ7 A;  3OWC A;  1ON0 A;  5HH1 A;  3BXM A;  4EME A;  1F2O A;  2PIZ A;  1ZG7 A;  3MRU A;  1CPS A;  2Q4Y A;  4MFK A;  3MN8 A;  1XIX A;  2AFU A;  3TX8 A;  2AFX A;  2ZEH A;  4OIW A;  4F0Y A;  2Z3K A;  3T90 A;  4II9 A;  2PRQ A;  5I4M A;  4MHY A;  3P2F A;  4YWY A;  4UEZ A;  5ELY A;  4GXH A;  4DJL A;  4YRH A;  4BIN A;  2J8R A;  2JDC A;  1QSO A;  5K8N A;  2EO8 A;  1R43 A;  4UIB A;  3RYO A;  3TOA A;  3H8G A;  1F2P A;  4AB7 A;  1OBR A;  4LQ6 A;  2Q7B A;  4A32 A;  2IL4 A;  3PEI A;  3E0K A;  1MJB A;  1VHS A;  4NJR A;  2CXA A;  3IJ3 A;  1Y0Y A;  3GY9 A;  4QC6 A;  4PXC A;  1AYE A;  2ZEN A;  1IOI A;  4NCZ A;  5AGE A;  2OZG A;  4PV6 A;  3RNZ A;  2PC1 A;  4FD6 A;  4GS4 A;  4ZY1 A;  2Z3O A;  4Q7A A;  2ARH A;  2C1C A;  4PQA A;  2DF5 A;  2WSA A;  4XPD B;  5CNP A;  3K9T A;  4NFR A;  4O23 A;  4B5P A;  2R98 A;  4F8Z A;  3D8P A;  4UF4 A;  2NSM A;  2O4H A;  3PB4 X;  4M3S A;  4QB9 A;  4ZBG A;  4H89 A;  3TC8 A;  2DXQ A;  2Q0Y A;  3IWG A;  4X2T A;  2B5G B;  4MHN A;  3CZX A;  4A31 A;  2YNC A;  1R3N A;  2PJ1 A;  1CM0 A;  5F48 A;  3CDX A;  3DR6 A;  4ZY2 A;  4KOW A;  1YRE A;  4EWT A;  4P4J A;  4H6U A;  3B8G A;  2XEF A;  3TCV A;  4U5Y A;  1AMP A;  1CBX A;  1LRZ A;  2FS5 A;  1PU9 A;  2QML A;  2FCK A;  2FIA A;  2V8G A;  2VEZ A;  2CTB A;  3IFE A;  3UY5 A;  4C68 A;  1Z4R A;  1TKF A;  3B3S A;  3JRU A;  1B87 A;  2PIY A;  3PB8 X;  1ZG8 A;  4I49 A;  4OKO A;  2F8H A;  4CGP A;  2Q7S A;  2ZEP A;  4OID A;  2PVW A;  2V8D A;  4KOX A;  3FF3 A;  4BMH A;  4IK2 A;  3K9U A;  4BBH A;  3BHX A;  2PR1 A;  1LFW A;  1YX0 A;  1CJW A;  1MK4 A;  2QEC A;  5H86 A;  3D2M A;  4P44 A;  2CTC A;  3R9F A;  2VXK A;  4E2A A;  2ZED A;  4YFJ A;  2Z11 A;  1RXT A;  2OH1 A;  3H8F A;  4R9M A;  2Z10 A;  1Z8L A;  3KAS A;  4JXQ A;  5DS0 A;  3L2N A;  3DSB A;  5J8C A;  3DNS A;  4A30 A;  3P2H A;  4C2Z A;  3KGQ A;  3D4U A;  4HNW B;  4EVY A;  3IGR A;  3IU1 A;  4C2Y A;  3PB9 X;  1BPM A;  3GIU A;  4PXD A;  3V38 A;  3FJU A;  4W9Y A;  2FVG A;  1DE4 C;  4IAV A;  3WT4 A;  4PPZ A;  2OZH A;  2BCO A;  3S9L A;  3B2Y A;  4ONU A;  1ELM P;  4ZGY B;  2EBJ A;  1BAV A;  1YW4 A;  4IF5 A;  4YU9 A;  4ZY0 A;  2IQ6 A;  4KOY A;  4RUH A;  4FUU A;  2EK8 A;  3RBU A;  4CAE A;  2ZOG A;  4ZYQ A;  1YK3 A;  4XNH C;  5E96 A;  3SJG A;  3G8W A;  1P4N A;  1ZO0 A;  2B3U A;  3NH5 A;  4H6Z A;  3DGV A;  4JXR A;  1IYL A;  5IB0 A;  2GIV A;  2B4B A;  4MFQ A;  4OC5 A;  2HB6 A;  1YQE A;  3D67 A;  4A2Z A;  4MJ8 A;  3IWW A;  3WAB A;  3W91 A;  2KCW A;  5D29 A;  4LUA A;  2CNS A;  2O53 A;  2PJ2 A;  1CP7 A;  4P4D A;  1VKC A;  1S7L A;  2AFM A;  4U9Z A;  5FVJ A;  3SI2 A;  4UCN A;  2OR4 A;  1BPN A;  2EK9 A;  5AG4 A;  5ISV A;  1Y9K A;  4FD4 A;  3BJ8 A;  3BLN A; 
#chains in the Genus database with same CATH homology
 3JUW A;  1RO5 A;  1QSM A;  4XPL A;  1J4J A;  1S7K A;  3CXP A;  1K4J A;  4UWJ A;  1L0C A;  3MGD A;  2Q04 A;  4KS9 A;  2FSR A;  1S60 A;  3LD2 A;  5C82 A;  1Z9U A;  4CYP A;  4KVO E;  3VWE A;  1NE9 A;  3PP9 A;  2OB0 A;  3PZJ A;  4NXY A;  3R1K A;  1KZF A;  3S6F A;  3DR8 A;  5A27 A;  4KOU A;  4KLW A;  4QVT A;  4CAF A;  3TFY A;  1I12 A;  2WUU A;  2FE7 A;  3F0A A;  2ATR A;  1XE4 A;  2REF A;  3QAH A;  2B3V A;  1TIQ A;  3R95 A;  3FIX A;  4FD5 A;  2P6E A;  4CRZ B;  3H4Q A;  5DWN A;  3EY5 A;  2EUI A;  2R8V A;  4PK2 A;  5IV0 A;  2Z3N A;  4KUB A;  4CS0 B;  3WR7 A;  1YVO A;  4MFL A;  3S6G A;  3BJ7 A;  4L89 A;  1B6B A;  1MJ9 A;  2C27 A;  2F5I A;  2YNC C;  2ZW4 A;  1YGH A;  5GCN A;  4DNC A;  3S6K A;  3F5B A;  4KSF A;  2FIW A;  1NSL A;  2DPS A;  4IUS A;  3TE4 A;  4YGO A;  4M85 A;  1BO4 A;  2PSW A;  3H5Z A;  2G3A A;  1Q2C A;  3C26 A;  2Z3M A;  1QSR A;  5AG6 A;  3ZZI A;  4JLY A;  2Y0M A;  2G3T A;  1U6M A;  4KZT A;  5G1Z A;  1IB1 E;  4UBR A;  5I0C A;  2BUE A;  3N7Z A;  1NMT A;  2RC4 A;  2O28 A;  4MY0 A;  4CGL A;  4AVA A;  2OZU A;  1BOB A;  4B14 A;  2BEI A;  3R9E A;  1XMT A;  2B4D B;  1IID A;  4U9Y A;  3I3G A;  1UFH A;  1KUX A;  4HKF A;  2FL4 A;  4CAV A;  4CYO A;  5JPH A;  2ZW5 A;  4KVM E;  4NF1 A;  3GYA A;  3TT2 A;  3CXS A;  3TO6 A;  2HQY A;  5KTC A;  4KOR A;  2P0W A;  2ZW6 A;  4R57 A;  4KLV A;  1Q2Y A;  3ZJ0 A;  1MJA A;  1SQH A;  4XNH B;  2H5M A;  4KOS A;  2NMT A;  1WK4 A;  2Z3P A;  2ZW7 A;  5EC4 A;  2OU2 A;  4Y49 C;  3W6X A;  4C7I A;  2J8N A;  2ZPA A;  4JWP A;  1I21 A;  3FBU A;  2AE6 A;  4ORF A;  4FD7 A;  2AJ6 A;  2Z0Z A;  4UWI A;  4MBU A;  4OAD A;  3IWE A;  3CXQ A;  1S5K A;  2WPW A;  4KOV A;  2REE A;  2HUZ A;  4KVX A;  4UA3 A;  3SXO A;  5F46 A;  3FXT A;  3EFA A;  4RS2 A;  4QUS A;  2A4N A;  3EO4 A;  2CY2 A;  4C7H A;  5KTD A;  2PRB A;  4C2X A;  4R3K A;  5G22 A;  3S6H A;  3JVN A;  5AG5 A;  4CGM A;  2HV2 A;  1M4D A;  2I00 A;  4F0X A;  4PSX A;  4UFW A;  4E0A A;  2I79 A;  4AVC A;  3D3S A;  2K5T A;  2JLM A;  4UFV A;  1KUV A;  4CYN A;  4PSW A;  4B5P B;  2CNM A;  1WWZ A;  1R57 A;  4B12 A;  2DPT A;  1XEB A;  2YNE A;  3LOD A;  2P6F A;  2Q4V A;  4B5O A;  1KUY A;  1PUA A;  2GAN A;  3NE7 A;  4MI4 A;  4OLL A;  3EXN A;  3FRM A;  2EVN A;  5BWA B;  4B11 A;  3SHP A;  2R7H A;  3SXN A;  3VWD A;  2D4O A;  4MFJ A;  2JDD A;  4KUA A;  3G3S A;  4CAX A;  1M4G A;  1IYK A;  1Z4E A;  2FXF A;  3D2P A;  3TO7 A;  1YLE A;  3PGP A;  2CNT A;  1Y7R A;  2PQ8 A;  4AVB A;  4XPD C;  3FB3 A;  2PR8 A;  4UCM A;  1P0H A;  3QB8 A;  1I1D A;  2BSW A;  2J8M A;  4OAE A;  5A28 A;  1IIC A;  4K30 A;  4MHD A;  5AG7 A;  5IX3 A;  4Q38 A;  4KOT A;  4LX9 A;  3DDD A;  4QBJ A;  2ZXV A;  1S3Z A;  4RI1 A;  2WPX A;  3FNC A;  4B13 A;  3T9Y A;  4CGO A;  2B5G A;  3JTK A;  4JJX A;  3FYN A;  2D4P A;  2VZY A;  3R9G A;  4JD6 A;  4L8A A;  4MFP A;  4A95 A;  2FT0 A;  4CGN A;  4UCP A;  4B10 A;  4F6A A;  2VZZ A;  4XPK A;  5C88 A;  1S7F A;  5G21 A;  2R1I A;  2YGW A;  4Y49 B;  4CRY B;  4A33 A;  1Q2D A;  2JEV A;  4AG9 A;  5F47 A;  4UFX A;  5F49 A;  3KKW A;  4J3G A;  1V0C A;  2BL1 A;  3EC4 A;  4HNY B;  1M1D A;  1QST A;  1M4I A;  2B4D A;  2Q44 A;  3TTH A;  4AG7 A;  1S7N A;  2PDO A;  2YND A;  1N71 A;  2B58 A;  4NEX A;  4E8O A;  3V8I A;  4X5K A;  4R3L A;  2VQY A;  4PK3 A;  3TO9 A;  3GKR A;  1QSN A;  1XF8 A;  4CYQ A;  2X7B A;  1FY7 A;  1OZP A;  1Y9W A;  2VI7 A;  3A9L A;  5G20 A;  1GHE A;  2GE3 A;  5KTA A;  3R96 A;  5HMN A;  4MY3 A;  3W6S A;  4NSQ A;  5EBV A;  4R87 A;  5H84 A;  4HNX B;  1YVK A;  4MFZ A;  3F8K A;  2QIR A;  4KSA A;  3IU2 A;  1M44 A;  5DWM A;  2G0B A;  4CAW A;  4Q36 A;  5J8F A;  5JQ4 A;  1YR0 A;  2Z3L A;  3I9S A;  3TOB A;  2P6G A;  2VBQ A;  3OWC A;  1ON0 A;  5HH1 A;  2Q4Y A;  4MFK A;  1XIX A;  4F0Y A;  4II9 A;  2Z3K A;  3T90 A;  3P2F A;  4YRH A;  2J8R A;  2JDC A;  1QSO A;  3RYO A;  3TOA A;  4AB7 A;  2Q7B A;  4A32 A;  2IL4 A;  3E0K A;  1MJB A;  1VHS A;  2CXA A;  3GY9 A;  4QC6 A;  4NCZ A;  5AGE A;  2OZG A;  4PV6 A;  2PC1 A;  4FD6 A;  4GS4 A;  2Z3O A;  2ARH A;  4XPD B;  2WSA A;  5CNP A;  4B5P A;  2R98 A;  3D8P A;  4M3S A;  4QB9 A;  4ZBG A;  4H89 A;  2DXQ A;  2Q0Y A;  3IWG A;  2B5G B;  4A31 A;  2YNC A;  1CM0 A;  5F48 A;  3DR6 A;  4KOW A;  1YRE A;  4H6U A;  3B8G A;  3TCV A;  4U5Y A;  1LRZ A;  2FS5 A;  2QML A;  2VEZ A;  1PU9 A;  2FCK A;  2FIA A;  3UY5 A;  4C68 A;  1Z4R A;  1B87 A;  4I49 A;  4CGP A;  4KOX A;  4BMH A;  3K9U A;  4BBH A;  2PR1 A;  1YX0 A;  1CJW A;  1MK4 A;  2QEC A;  5H86 A;  3D2M A;  3R9F A;  4E2A A;  2VXK A;  4YFJ A;  2Z11 A;  1RXT A;  2OH1 A;  4R9M A;  2Z10 A;  4JXQ A;  3DSB A;  5J8C A;  3DNS A;  4A30 A;  3P2H A;  4C2Z A;  4HNW B;  4EVY A;  3IGR A;  3IU1 A;  4C2Y A;  2OZH A;  4ONU A;  4ZGY B;  4IF5 A;  4KOY A;  4CAE A;  1YK3 A;  4XNH C;  5E96 A;  3G8W A;  1P4N A;  1ZO0 A;  2B3U A;  4H6Z A;  4JXR A;  1IYL A;  5IB0 A;  2GIV A;  2B4B A;  4MFQ A;  4A2Z A;  4MJ8 A;  3W91 A;  2KCW A;  4LUA A;  2CNS A;  1VKC A;  1S7L A;  4U9Z A;  5FVJ A;  4UCN A;  5AG4 A;  5ISV A;  1Y9K A;  4FD4 A;  3BJ8 A;  3BLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...