1CJWA

Serotonin n-acetyltransferase complexed with a bisubstrate analog
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
166
structure length
166
Chain Sequence
HTLPANEFRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLTLCPELSLGWFVEGRLVAFIIGSLWDEERLTQESLALHRPRGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRAVLMCEDALVPFYQRFGFHPAGPCAIVVGSLTFTEMHCSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis of ordered substrate binding by serotonin N-acetyltransferase: enzyme complex at 1.8 A resolution with a bisubstrate analog.
pubmed doi rcsb
source organism Ovis aries
molecule tags Transferase
molecule keywords PROTEIN (SEROTONIN N-ACETYLTRANSFERASE)
total genus 45
structure length 166
sequence length 166
ec nomenclature ec 2.3.1.87: Aralkylamine N-acetyltransferase.
pdb deposition date 1999-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1cjwA00
2FCKA 2B5GB 2G0BA 3R9EA 1S5KA 1QSRA 3F5BA 1YK3A 1Q2CA 2K5TA 2CNTA 2B4DA 2NMTA 2I00A 3P2HA 1Z4RA 1XIXA 1P4NA 4U5YA 4AVCA 1NE9A 3G8WA 1M4IA 3D8PA 4NSQA 4U9YA 1FY7A 4AVAA 2VXKA 3SXNA 1NMTA 4RI1A 4YFJA 5HMNA 4MY3A 3LD2A 2WPXA 1I21A 2QIRA 1S3ZA 3G3SA 3FRMA 3IWGA 3I3GA 5DWMA 1Q2DA 3JVNA 3F0AA 4YGOA 2JDDA 3NE7A 3S6FA 1V0CA 4AB7A 1I1DA 4KOVA 1M1DA 1MJ9A 1Z4EA 5H86A 4F0YA 1K4JA 1XE4A 1I12A 3T90A 2P0WA 4CAWA 2JLMA 4ZBGA 2VZYA 3TO9A 4M3SA 3GY9A 1QSNA 2CNMA 4UBRA 2ATRA 4KOYA 3LODA 4KOSA 4E2AA 4RS2A 4KORA 4ONUA 2JDCA 4MJ8A 3TCVA 4E8OA 2FL4A 2ZW5A 4Y49C 4H6ZA 1CM0A 5F46A 1Y7RA 1RXTA 1YR0A 2BEIA 5EC4A 3R95A 4I49A 5C82A 4CRYB 1R57A 1YVKA 3R1KA 3TOBA 3N7ZA 4DNCA 4L89A 3FNCA 4L8AA 1S7LA 4U9ZA 2R98A 4Y49B 3DNSA 5E96A 5IV0A 1Y9KA 5ISVA 3OWCA 1PU9A 1S7NA 4IF5A 4HNYB 3W91A 4B5PB 1IYKA 4FD4A 2B5GA 4H6UA 1J4JA 1S7FA 5JQ4A 3FB3A 4HKFA 2B4DB 2OB0A 1XMTA 2WPWA 3RYOA 3R9GA 1YREA 4MBUA 4KUAA 2J8RA 3DR6A 3QB8A 2Y0MA 4KLWA 4QVTA 1XEBA 4E0AA 3VWEA 4KOUA 4QC6A 2X7BA 2B4BA 2R7HA 3F8KA 2P6FA 4KVXA 2OZGA 4CAXA 4KVOE 5CNPA 2GANA 2RC4A 4JXRA 5KTAA 4BMHA 1S60A 3R9FA 4OADA 3SHPA 3S6KA 4X5KA 2A4NA 2AJ6A 2ZPAA 3GYAA 1BO4A 2PR8A 4LX9A 4NEXA 1NSLA 1YX0A 2Q0YA 1Y9WA 2Q4YA 4MI4A 4HNWB 3TTHA 3EFAA 4J3GA 3BJ7A 2FIWA 3IGRA 3BJ8A 1GHEA 3W6XA 4PK3A 4FD6A 2VQYA 3CXQA 2G3AA 5DWNA 1VKCA 2FXFA 2FIAA 2QECA 3EY5A 4KOXA 2OZHA 2QMLA 5KTCA 4R9MA 3W6SA 2ZW6A 2EUIA 1M4DA 2Z10A 5FVJA 4KUBA 4LUAA 2PDOA 4B5PA 2HV2A 4F6AA 4KZTA 4XNHB 2O28A 3S6GA 3BLNA 4OLLA 1QSTA 1OZPA 4AG7A 2IL4A 2R1IA 1B6BA 2GE3A 4PK2A 2B3VA 5HH1A 2D4PA 4B5OA 2CY2A 4QB9A 5F49A 1WWZA 3FXTA 3CXSA 1LRZA 3S6HA 3PP9A 3CXPA 1L0CA 3DR8A 4JD6A 1BOBA 4QBJA 4NXYA 2HUZA 4AG9A 2OH1A 3MGDA 4R3KA 2OZUA 4PV6A 1ON0A 1M4GA 2JEVA 2PQ8A 2VEZA 1B87A 2ZW7A 2FS5A 3D2MA 5J8FA 5I0CA 1WK4A 2REEA 1P0HA 1S7KA 2Z11A 4JXQA 2F5IA 5EBVA 5GCNA 1IIDA 2VI7A 3PZJA 4NF1A 4R57A 3TOAA 3JUWA 3C26A 3DDDA 1Z9UA 4JJXA 1RO5A 3D3SA 4JLYA 4ORFA 2ARHA 2BSWA 3R96A 3UY5A 4CRZB 2BL1A 2VBQA 3FBUA 2H5MA 4KOWA 2CNSA 2G3TA 4QUSA 1MK4A 2ZXVA 5IX3A 1KUVA 1KZFA 2EVNA 2FSRA 1VHSA 2I79A 4K30A 2AE6A 1IICA 2GIVA 5F47A 4R87A 3TO7A 3EO4A 4UWIA 1CJWA 1U6MA 3SXOA 1QSMA 1KUYA 2B58A 1M44A 2P6EA 1IB1E 3FIXA 3PGPA 3DSBA 3VWDA 2FT0A 3T9YA 4YRHA 4XPDC 5JPHA 2Z0ZA 4FD5A 1MJBA 5F48A 4R3LA 2Q44A 2R8VA 2DXQA 3ZZIA 3P2FA 3H4QA 3TE4A 1QSOA 2Q04A 4KLVA 1YVOA 4MHDA 4CAVA 1SQHA 4MY0A 1PUAA 1XF8A 5H84A 3TO6A 5J8CA 3K9UA 3EC4A 1UFHA 1TIQA 2Q7BA 2FE7A 4XPKA 3WR7A 2VZZA 1MJAA 2B3UA 4PSWA 3B8GA 3GKRA 3TT2A 3V8IA 4UA3A 4KOTA 3I9SA 1YGHA 3KKWA 2OU2A 2J8MA 4KVME 1IYLA 4HNXB 2KCWA 1YLEA 4OAEA 4GS4A 1N71A 4PSXA 3E0KA 5IB0A 4NCZA 3D2PA 4M85A 4II9A 2PC1A 5C88A 3TFYA 1Q2YA 2C27A 3EXNA 2P6GA 2PRBA 3FYNA 4XNHC 1KUXA 2REFA 4IUSA 2BUEA 3QAHA 4AVBA 4XPLA 4EVYA 2PR1A 4JWPA 4FD7A 4H89A 2PSWA 4UWJA 2HQYA 2Q4VA 5KTDA 4CS0B 2ZW4A 2J8NA 2D4OA 3ZJ0A 4XPDB
chains in the Genus database with same CATH superfamily
2FCKA 2B5GB 4CYPA 2YGWA 4CYNA 4R76A 4WWVA 1CG2A 2C6PA 2G0BA 5EMIA 5ELYA 5HVGA 3R9EA 1S5KA 1QSRA 3F5BA 1YK3A 1Q2CA 2K5TA 2CNTA 2PJ3A 1NSAA 2B4DA 2NMTA 4ZX9A 2I00A 3GB0A 2ANPA 4X3RA 3P2HA 4RUHA 4W9YA 1Z4RA 1XIXA 4MFZA 1P4NA 4U5YA 1Z5RA 1ZG7A 3FF3A 3RO0A 3CT9A 3PB6X 1IOIA 2F8HA 4AVCA 1NE9A 2DPSA 4KS9A 4MFJA 3G8WA 1M4IA 4UCPA 3D8PA 1R3NA 4NSQA 4UEZA 4U9YA 1HDQA 1FY7A 4AVAA 2DEAA 2EBJA 5LYDA 2VXKA 3SXNA 1NMTA 3DLJA 4RI1A 4YFJA 2ZEGA 5HMNA 3FEEA 4MY3A 3LD2A 2WPXA 4A94A 1I21A 3SJGA 2PJ6A 2QIRA 3V7ZA 1S3ZA 3G3SA 3FRMA 4FAIA 3IWGA 3IJ3A 3PB8X 6CPAA 3I3GA 1TF9A 5DWMA 4UCNA 1Q2DA 2ZEHA 3JVNA 3F0AA 4YGOA 1BPNA 3D67A 2G9DA 4MCRA 1XOVA 1LAPA 4JYWA 3WT4A 4OIWA 4NGQA 2JDDA 3NE7A 3TX8A 4P6YA 4MCPA 2Z3OA 1YLOA 1CX8A 1F2PA 1V0CA 2BO9A 3S6FA 4AB7A 1I1DA 4KOVA 4GM5A 1M1DA 4TNUA 1MJ9A 1TXRA 1Z4EA 5H86A 4MHZA 2PJ2A 4F0YA 1K4JA 1XE4A 4MFQA 1I12A 3T90A 1Q7LA 2PE3A 2P0WA 2VL1A 4CAWA 4B11A 2JLMA 4ZBGA 2VZYA 3TO9A 5HXDA 5LRKA 2C1CA 4NGNA 1BPMA 4M3SA 3GY9A 1JWQA 1GYTA 1QSNA 1YSJA 2RFHA 3IU2A 2CNMA 5LRGA 4WJBA 5G1ZA 4OC0A 4UBRA 3B3CA 4UFVA 1EE3P 1XBUA 3SJEA 2PJ7A 2ATRA 4KOYA 5D8NA 3LODA 2DF5A 1X12A 2V77A 2WZNA 1KWMA 4KOSA 5THWA 1CBXA 4E2AA 4PXBA 4RS2A 1Y7EA 3S9MA 3NH8A 1ARMA 4KORA 4ONUA 2JDCA 2GU2A 4MJ8A 3TCVA 5K8NA 4E8OA 2I3CA 4UEFA 4MFKA 4Q36A 4B13A 2FL4A 2O4HA 2ZOFA 1TKFA 2ZW5A 4K3NA 4Y49C 2PJCA 4H6ZA 4PPZA 1CM0A 5AG4A 5F46A 2NYQA 1Y7RA 3KZWA 1CP6A 3A9LA 1RXTA 2CF4A 4R8FA 2ZENA 3CZXA 1YR0A 2BEIA 3RAMA 5EC4A 3T8WA 4Q38A 3R95A 3ISZA 4MCQA 4OC5A 1AYEA 4C7HA 3LACA 1ARLA 3D7HA 4MMOA 2PIYA 4I49A 3CDXA 5C82A 4CRYB 3KHZA 4DJLA 1R57A 1YVKA 2XEJA 2PJ1A 3R1KA 4MHPA 3TOBA 3N7ZA 4C2XA 2PJ0A 3B3WA 4MCSA 4DNCA 3TC8A 1F2OA 2AFWA 4L89A 4A39A 3SJFA 3FNCA 4C2ZA 2POKA 1TKJA 4L8AA 2V8HA 3PB4X 3WABA 3BI0A 1S7LA 4U9ZA 3BI1A 2R98A 4OC1A 5JGFA 1YMEA 3S9LA 4Y49B 3DNSA 5E96A 4BBHA 5A28A 4OMEA 2WYRA 5IV0A 1Y9KA 3L2NA 5ISVA 4NGPA 3OWCA 1PU9A 1S7NA 3BXMA 4GXHA 4C68A 3V38A 5JH9A 4A31A 3CPXA 4YU9A 4IF5A 4HNYB 1VHEA 4P44A 3W91A 3PFOA 2PIZA 4B5PB 2GLFA 1IYKA 4UEEA 4FD4A 2B5GA 3JRUA 4NJRA 4G1PA 4OKOA 5K8OA 3K9TA 4H6UA 4TWEA 1J4JA 3D7GA 1S7FA 3ISXA 5JQ4A 3FB3A 1ZG9A 4HKFA 2B4DB 2OB0A 1XMTA 2WPWA 3RYOA 2C6CA 3R9GA 2JEWA 4BD9A 1ZO0A 2PVWA 1YREA 4MBUA 3KHXA 4FBEA 4KUAA 2J8RA 3DR6A 3QB8A 3IWEA 1A2ZA 2Y0MA 3LWUA 4UCMA 1CPXA 4EFDA 1LCPA 4KSAA 4KLWA 4CGNA 4QVTA 1XEBA 4F0XA 3FMCA 4IHMA 1CP7A 4E0AA 3IIBA 3WC7A 3VWEA 3KI9A 4MHNA 4KOUA 4QC6A 2X7BA 2YNDA 2B4BA 2R7HA 5IB9A 3F8KA 3H8GA 2FVGA 4DYOA 4B14A 3I1UA 2P6FA 4KVXA 4ZY0A 2OZGA 3RNZA 4CAXA 4KVOE 5CNPA 2PJBA 2GANA 2RC4A 1IGBA 2EK8A 4M6HA 4MFLA 4JXRA 5KTAA 1X10A 4OC3A 3GLJA 1S60A 4BMHA 4CPAA 2ZEPA 2AFXA 3R9FA 1Y0RA 4OADA 3SHPA 3S6KA 4X5KA 2A4NA 2AJ6A 3IO1A 1VGYA 3MN8A 1UWYA 2ZPAA 3GYAA 5AG5A 1BO4A 1ZLHA 1PYTB 2PR8A 2Q43A 5AG6A 4LX9A 1HEEA 1IY7A 4NEXA 1NSLA 1YX0A 2Q0YA 2F7VA 2PVVA 3FH4A 4R6TA 1CPSA 4A32A 3LMSA 1Y9WA 2Q4YA 2JBKA 3SI0A 4MI4A 4HNWB 2AFOA 4ZY1A 2PRQA 4CAEA 3TTHA 2AFUA 3EFAA 4C7IA 4J3GA 4P4FA 1ELLP 3BJ7A 2FIWA 3IGRA 3PBEA 3BJ8A 5I4MA 2QJ8A 1GHEA 3W6XA 4PK3A 2ABZA 4MRIA 4FD6A 2VQYA 3CXQA 2G3AA 1ELMP 1IOFA 5DWNA 4UF4A 3GUXA 1TKHA 5BWAB 5CPAA 4PQAA 1VKCA 1LAMA 1VHOA 2ODFA 3JTKA 4R7MA 1LFWA 2FIAA 2FXFA 2QECA 3EY5A 5G20A 4CYOA 4KOXA 4F9UA 5J1QA 2OZHA 4MHYA 2QVPA 1TF8A 4NGTA 2QMLA 3CPAA 2Z3MA 5G21A 5KTCA 3FECA 3KQXA 3SI1A 4R9MA 1F57A 3VARA 4A30A 3W6SA 2ZW6A 2EUIA 5AGEA 1M4DA 2Z10A 3PRTA 4EWTA 1R43A 2C6GA 2ZEMA 5FVJA 5K8MA 4KUBA 4LUAA 1M4LA 2PJ5A 2XEIA 5G22A 2PDOA 4A38A 2HV2A 4B5PA 4F6AA 2CIJA 4KZTA 4XNHB 2O28A 3QAYA 2JBJA 3N5FA 3S6GA 3BLNA 4UIAA 1Z8TA 2Z3KA 3H5ZA 4OLLA 1XJOA 5LYIA 4P4IA 1QSTA 4P4EA 1OZPA 2WSAA 1OBRA 3DGVA 2NSMA 4AG7A 2IL4A 1QQ9A 2XEGA 2BOAA 2R1IA 3KASA 2Z3NA 3HLPA 1B6BA 2IMOA 2GE3A 4PK2A 1YQEA 2B3VA 3B3SA 3FVLA 5HH1A 7CPAA 3B2YA 2D4PA 4MXUA 4B5OA 1DE4C 4X2TA 2V8DA 2CY2A 4UFWA 4QB9A 1QMUA 5F49A 3WC5A 1WWZA 4CGPA 2Q4ZA 3FXTA 3PB7X 4ZY2A 2GLJA 3VATA 3CXSA 1LRZA 1Z8XA 1JQGA 3S6HA 4ZYQA 4B10A 2Q51A 3PP9A 3CXPA 4YWYA 1L0CA 2V8VA 2YNCA 1ZG8A 3DR8A 3FX6A 1BOBA 4JD6A 4UFXA 3RZAA 2ZEEA 4QBJA 4X8IA 4NXYA 3SJXA 2Z3LA 1BLLE 2HUZA 3FEDA 1XRYA 2O53A 3B7IA 4AG9A 4F8ZA 2OH1A 3KR5A 3MGDA 1AUGA 4A37A 4JZ0A 2CTBA 3HUVA 2ZEOA 2OZUA 4R3KA 2V8GA 3KL9A 4IK2A 4PV6A 3BHXA 1M4GA 1ON0A 2JEVA 2PQ8A 4A95A 2VEZA 1B87A 2ZW7A 2FS5A 3D2MA 1HDUA 5I0CA 5J8FA 1WK4A 1LANA 2REEA 1P0HA 1S7KA 2Z11A 4OP4A 4A2ZA 1H8LA 4JXQA 2F5IA 5EBVA 1XMBA 5GCNA 3IC1A 1IIDA 1Y0YA 2VI7A 2YNEA 3PZJA 3H8EA 4NF1A 4R57A 4MFPA 1DTDA 3C26A 3JUWA 3TOAA 4ZI6A 3DDDA 1Z9UA 4JJXA 4NJQA 2OOTA 1RO5A 5LYFA 3D3SA 4JLYA 4ORFA 2ARHA 2BSWA 4ZGYB 1YW4A 3R96A 4A33A 3UY5A 4CRZB 2BL1A 2VBQA 3FBUA 4OIDA 2PCUA 2H5MA 2HC9A 3PB9X 4LQ6A 2CNSA 2G3TA 4KOWA 4EMEA 2EWBA 3IEHA 4QUSA 4B12A 2QYVA 3MRUA 1MK4A 1XFOA 2ZXVA 5IX3A 1KUVA 1KZFA 2EVNA 3D7DA 2BCOA 2FSRA 1VHSA 4RN7A 2I79A 5LRJA 4K30A 2AE6A 2PJ8A 1IICA 3B3VA 2GIVA 5AG7A 5F47A 4FUUA 4KSFA 4R87A 3EO4A 5DS0A 3TO7A 3B3TA 2CXAA 3SI2A 2PJ4A 5HVHA 3D66A 4UIBA 4UWIA 1YW6A 4P4DA 3IU1A 1CJWA 1U6MA 1BAVA 1QSMA 1Z2LA 3SXOA 2PJ9A 2J9AA 1FT7A 5CBMA 1KUYA 2B58A 1M44A 2IQ6A 1LOKA 2P6EA 2EK9A 4Q7AA 1IB1E 4BINA 1FNOA 3FIXA 3PGPA 3DSBA 4P10A 3VWDA 3PFEA 2ZEDA 2FT0A 4O23A 3KQZA 4YRHA 3T9YA 4XPDC 5JPHA 2WUUA 2RB7A 3QNVA 2Z0ZA 4PXCA 4M6GA 4IAVA 4FD5A 5F09A 5JM6A 1MJBA 4H2KA 1IU8A 5F48A 4R3LA 2Q44A 2R8VA 2DXQA 3ZZIA 4P45A 3P2FA 3H4QA 3IFEA 1QSOA 5K8PA 3TE4A 2Q04A 4KLVA 1YVOA 4MHDA 2GFQA 4CAVA 1SQHA 3NH5A 1PUAA 1XF8A 4MY0A 5H84A 3TO6A 5J8CA 4HPSA 3S9NA 4M6IA 3K9UA 4PXDA 2Q7SA 3NE8A 4ZX8A 8CPAA 3EC4A 1UFHA 2EO8A 4NGSA 3VH9A 1TIQA 2Q7BA 2FE7A 2HB6A 3FJUA 2ZELA 4FWUA 4XPKA 3WR7A 2VZZA 4CGMA 1MJAA 2B3UA 4PSWA 4CGOA 4ONWA 4OC2A 2OR4A 2PJAA 4NGRA 3NFZA 3NH4A 3B8GA 3GKRA 3PBBA 4OC4A 3TT2A 3V8IA 4UA3A 1VIXA 1Z8WA 3K2KA 4NFRA 4KOTA 4C2YA 2AFZA 1RTQA 3I9SA 1YGHA 3RBUA 3KKWA 2OU2A 4B6ZA 2J8MA 1Z8LA 5D29A 3H8FA 1AMPA 3KGQA 3B35A 4KVME 5A27A 4KSIA 1IYLA 4HNXB 2KCWA 2Z3PA 3GIUA 5HVFA 4Z65A 1YLEA 3D7FA 4LQGA 4OAEA 4GS4A 3D4UA 1N71A 4PSXA 3E0KA 5IB0A 2GREA 4NCZA 3D2PA 4M85A 4II9A 2PC1A 1ZLIA 2YNCC 2ZEFA 2ZOGA 5C88A 3TFYA 2IJZA 1Q2YA 2C27A 3EXNA 4F9VA 3IWWA 2P6GA 2PRBA 3FYNA 2DPTA 4XNHC 1KUXA 4P4JA 2REFA 4CYQA 4IUSA 4CGLA 4CAFA 3PEIA 2AFSA 4AXVA 2BUEA 3QAHA 3WC6A 4PXEA 1PCAA 4AVBA 4XPLA 4EVYA 2PR1A 2CTCA 4P4BA 4JWPA 3KR4A 4FD7A 4H89A 2PSWA 4UWJA 2HQYA 2AFMA 2Q4VA 2XEFA 3NA6A 4DUKA 4CS0B 2ZW4A 5KTDA 5LYLA 2J8NA 2D4OA 4NGMA 3ZJ0A 3D68A 4XPDB
chains in the Genus database with same CATH topology
2FCKA 2B5GB 4CYPA 2YGWA 4CYNA 2G0BA 3R9EA 1S5KA 1QSRA 3F5BA 1YK3A 1Q2CA 2K5TA 2CNTA 2B4DA 2NMTA 2I00A 3P2HA 1Z4RA 1XIXA 4MFZA 1P4NA 4U5YA 4AVCA 1NE9A 2DPSA 4KS9A 4MFJA 3G8WA 1M4IA 4UCPA 3D8PA 4NSQA 4U9YA 1FY7A 4AVAA 2VXKA 3SXNA 1NMTA 4RI1A 4YFJA 5HMNA 4MY3A 3LD2A 2WPXA 1I21A 2QIRA 1S3ZA 3G3SA 3FRMA 3IWGA 3I3GA 5DWMA 4UCNA 1Q2DA 3JVNA 3F0AA 4YGOA 2JDDA 3NE7A 2Z3OA 3S6FA 1V0CA 4AB7A 1I1DA 4KOVA 1M1DA 1MJ9A 1Z4EA 5H86A 4F0YA 1K4JA 1XE4A 4MFQA 1I12A 3T90A 2P0WA 4CAWA 4B11A 2JLMA 4ZBGA 2VZYA 3TO9A 4M3SA 3GY9A 1QSNA 3IU2A 2CNMA 5G1ZA 4UBRA 4UFVA 2ATRA 4KOYA 3LODA 4KOSA 4E2AA 4RS2A 4KORA 4ONUA 2JDCA 4MJ8A 3TCVA 4E8OA 4MFKA 4Q36A 4B13A 2FL4A 2ZW5A 4Y49C 4H6ZA 1CM0A 5AG4A 5F46A 1Y7RA 3A9LA 1RXTA 1YR0A 2BEIA 5EC4A 4Q38A 3R95A 4C7HA 4I49A 5C82A 4CRYB 1R57A 1YVKA 3R1KA 3TOBA 3N7ZA 4C2XA 4DNCA 4L89A 3FNCA 4C2ZA 4L8AA 1S7LA 4U9ZA 2R98A 4Y49B 3DNSA 5E96A 4BBHA 5A28A 5IV0A 1Y9KA 5ISVA 3OWCA 1PU9A 1S7NA 4C68A 4A31A 4IF5A 4HNYB 3W91A 4B5PB 1IYKA 4FD4A 2B5GA 4H6UA 1J4JA 1S7FA 5JQ4A 3FB3A 4HKFA 2B4DB 2OB0A 1XMTA 2WPWA 3RYOA 3R9GA 1ZO0A 1YREA 4MBUA 4KUAA 2J8RA 3DR6A 3QB8A 3IWEA 2Y0MA 4UCMA 4KSAA 4KLWA 4CGNA 4QVTA 1XEBA 4F0XA 4E0AA 3VWEA 4KOUA 4QC6A 2X7BA 2YNDA 2B4BA 2R7HA 3F8KA 4B14A 2P6FA 4KVXA 2OZGA 4CAXA 4KVOE 5CNPA 2GANA 2RC4A 4MFLA 4JXRA 5KTAA 4BMHA 1S60A 3R9FA 4OADA 3SHPA 3S6KA 4X5KA 2A4NA 2AJ6A 2ZPAA 3GYAA 5AG5A 1BO4A 2PR8A 5AG6A 4LX9A 4NEXA 1NSLA 1YX0A 2Q0YA 4A32A 1Y9WA 2Q4YA 4MI4A 4HNWB 4CAEA 3TTHA 3EFAA 4C7IA 4J3GA 3BJ7A 2FIWA 3IGRA 3BJ8A 1GHEA 3W6XA 4PK3A 4FD6A 2VQYA 3CXQA 2G3AA 5DWNA 5BWAB 1VKCA 3JTKA 2FXFA 2FIAA 2QECA 3EY5A 5G20A 4CYOA 4KOXA 2OZHA 2QMLA 2Z3MA 5G21A 5KTCA 4R9MA 4A30A 3W6SA 2ZW6A 2EUIA 5AGEA 1M4DA 2Z10A 5FVJA 4KUBA 4LUAA 5G22A 2PDOA 4B5PA 2HV2A 4F6AA 4KZTA 4XNHB 2O28A 3S6GA 3BLNA 3H5ZA 2Z3KA 4OLLA 1QSTA 1OZPA 2WSAA 4AG7A 2IL4A 2R1IA 2Z3NA 1B6BA 2GE3A 4PK2A 2B3VA 5HH1A 2D4PA 4B5OA 2CY2A 4UFWA 4QB9A 5F49A 4CGPA 1WWZA 3FXTA 3CXSA 1LRZA 3S6HA 4B10A 3PP9A 3CXPA 1L0CA 2YNCA 3DR8A 4UFXA 4JD6A 1BOBA 4QBJA 4NXYA 2Z3LA 2HUZA 4AG9A 2OH1A 3MGDA 4R3KA 2OZUA 4PV6A 1ON0A 1M4GA 2JEVA 2PQ8A 4A95A 2VEZA 1B87A 2ZW7A 2FS5A 3D2MA 5J8FA 5I0CA 1WK4A 2REEA 1P0HA 1S7KA 2Z11A 4A2ZA 4JXQA 2F5IA 5EBVA 5GCNA 1IIDA 2VI7A 2YNEA 3PZJA 4NF1A 4R57A 4MFPA 3JUWA 3C26A 3TOAA 3DDDA 1Z9UA 4JJXA 1RO5A 3D3SA 4JLYA 4ORFA 2ARHA 2BSWA 4ZGYB 3R96A 4A33A 3UY5A 4CRZB 2BL1A 2VBQA 3FBUA 2H5MA 4KOWA 2CNSA 2G3TA 4QUSA 4B12A 1MK4A 2ZXVA 5IX3A 1KUVA 1KZFA 2EVNA 2FSRA 1VHSA 2I79A 4K30A 2AE6A 1IICA 2GIVA 5AG7A 5F47A 4KSFA 4R87A 3TO7A 3EO4A 2CXAA 4UWIA 3IU1A 1CJWA 1U6MA 3SXOA 1QSMA 1KUYA 2B58A 1M44A 2P6EA 1IB1E 3FIXA 3PGPA 3DSBA 3VWDA 2FT0A 3T9YA 4YRHA 4XPDC 5JPHA 2WUUA 2Z0ZA 4FD5A 1MJBA 5F48A 4R3LA 2Q44A 2R8VA 2DXQA 3ZZIA 3P2FA 3H4QA 3TE4A 1QSOA 2Q04A 4KLVA 1YVOA 4MHDA 4CAVA 1SQHA 4MY0A 1PUAA 1XF8A 5H84A 3TO6A 5J8CA 3K9UA 3EC4A 1UFHA 1TIQA 2Q7BA 2FE7A 4XPKA 3WR7A 2VZZA 4CGMA 1MJAA 2B3UA 4PSWA 4CGOA 3B8GA 3GKRA 3TT2A 3V8IA 4UA3A 4KOTA 4C2YA 3I9SA 1YGHA 3KKWA 2OU2A 2J8MA 4KVME 5A27A 1IYLA 4HNXB 2KCWA 2Z3PA 1YLEA 4OAEA 4GS4A 1N71A 4PSXA 3E0KA 5IB0A 4NCZA 3D2PA 4M85A 4II9A 2PC1A 2YNCC 5C88A 3TFYA 1Q2YA 2C27A 3EXNA 2P6GA 2PRBA 3FYNA 2DPTA 4XNHC 1KUXA 2REFA 4CYQA 4IUSA 4CGLA 4CAFA 2BUEA 3QAHA 4AVBA 4XPLA 4EVYA 2PR1A 4JWPA 4FD7A 4H89A 2PSWA 4UWJA 2HQYA 2Q4VA 5KTDA 4CS0B 2ZW4A 2J8NA 2D4OA 3ZJ0A 4XPDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FCK A;  2B5G B;  2G0B A;  3R9E A;  1S5K A;  1QSR A;  3F5B A;  1YK3 A;  1Q2C A;  2K5T A;  2CNT A;  2B4D A;  2NMT A;  2I00 A;  3P2H A;  1Z4R A;  1XIX A;  1P4N A;  4U5Y A;  4AVC A;  1NE9 A;  3G8W A;  1M4I A;  3D8P A;  4NSQ A;  4U9Y A;  1FY7 A;  4AVA A;  2VXK A;  3SXN A;  1NMT A;  4RI1 A;  4YFJ A;  5HMN A;  4MY3 A;  3LD2 A;  2WPX A;  1I21 A;  2QIR A;  1S3Z A;  3G3S A;  3FRM A;  3IWG A;  3I3G A;  5DWM A;  1Q2D A;  3JVN A;  3F0A A;  4YGO A;  2JDD A;  3NE7 A;  3S6F A;  1V0C A;  4AB7 A;  1I1D A;  4KOV A;  1M1D A;  1MJ9 A;  1Z4E A;  5H86 A;  4F0Y A;  1K4J A;  1XE4 A;  1I12 A;  3T90 A;  2P0W A;  4CAW A;  2JLM A;  4ZBG A;  2VZY A;  3TO9 A;  4M3S A;  3GY9 A;  1QSN A;  2CNM A;  4UBR A;  2ATR A;  4KOY A;  3LOD A;  4KOS A;  4E2A A;  4RS2 A;  4KOR A;  4ONU A;  2JDC A;  4MJ8 A;  3TCV A;  4E8O A;  2FL4 A;  2ZW5 A;  4Y49 C;  4H6Z A;  1CM0 A;  5F46 A;  1Y7R A;  1RXT A;  1YR0 A;  2BEI A;  5EC4 A;  3R95 A;  4I49 A;  5C82 A;  4CRY B;  1R57 A;  1YVK A;  3R1K A;  3TOB A;  3N7Z A;  4DNC A;  4L89 A;  3FNC A;  4L8A A;  1S7L A;  4U9Z A;  2R98 A;  4Y49 B;  3DNS A;  5E96 A;  5IV0 A;  1Y9K A;  5ISV A;  3OWC A;  1PU9 A;  1S7N A;  4IF5 A;  4HNY B;  3W91 A;  4B5P B;  1IYK A;  4FD4 A;  2B5G A;  4H6U A;  1J4J A;  1S7F A;  5JQ4 A;  3FB3 A;  4HKF A;  2B4D B;  2OB0 A;  1XMT A;  2WPW A;  3RYO A;  3R9G A;  1YRE A;  4MBU A;  4KUA A;  2J8R A;  3DR6 A;  3QB8 A;  2Y0M A;  4KLW A;  4QVT A;  1XEB A;  4E0A A;  3VWE A;  4KOU A;  4QC6 A;  2X7B A;  2B4B A;  2R7H A;  3F8K A;  2P6F A;  4KVX A;  2OZG A;  4CAX A;  4KVO E;  5CNP A;  2GAN A;  2RC4 A;  4JXR A;  5KTA A;  4BMH A;  1S60 A;  3R9F A;  4OAD A;  3SHP A;  3S6K A;  4X5K A;  2A4N A;  2AJ6 A;  2ZPA A;  3GYA A;  1BO4 A;  2PR8 A;  4LX9 A;  4NEX A;  1NSL A;  1YX0 A;  2Q0Y A;  1Y9W A;  2Q4Y A;  4MI4 A;  4HNW B;  3TTH A;  3EFA A;  4J3G A;  3BJ7 A;  2FIW A;  3IGR A;  3BJ8 A;  1GHE A;  3W6X A;  4PK3 A;  4FD6 A;  2VQY A;  3CXQ A;  2G3A A;  5DWN A;  1VKC A;  2FXF A;  2FIA A;  2QEC A;  3EY5 A;  4KOX A;  2OZH A;  2QML A;  5KTC A;  4R9M A;  3W6S A;  2ZW6 A;  2EUI A;  1M4D A;  2Z10 A;  5FVJ A;  4KUB A;  4LUA A;  2PDO A;  4B5P A;  2HV2 A;  4F6A A;  4KZT A;  4XNH B;  2O28 A;  3S6G A;  3BLN A;  4OLL A;  1QST A;  1OZP A;  4AG7 A;  2IL4 A;  2R1I A;  1B6B A;  2GE3 A;  4PK2 A;  2B3V A;  5HH1 A;  2D4P A;  4B5O A;  2CY2 A;  4QB9 A;  5F49 A;  1WWZ A;  3FXT A;  3CXS A;  1LRZ A;  3S6H A;  3PP9 A;  3CXP A;  1L0C A;  3DR8 A;  4JD6 A;  1BOB A;  4QBJ A;  4NXY A;  2HUZ A;  4AG9 A;  2OH1 A;  3MGD A;  4R3K A;  2OZU A;  4PV6 A;  1ON0 A;  1M4G A;  2JEV A;  2PQ8 A;  2VEZ A;  1B87 A;  2ZW7 A;  2FS5 A;  3D2M A;  5J8F A;  5I0C A;  1WK4 A;  2REE A;  1P0H A;  1S7K A;  2Z11 A;  4JXQ A;  2F5I A;  5EBV A;  5GCN A;  1IID A;  2VI7 A;  3PZJ A;  4NF1 A;  4R57 A;  3TOA A;  3JUW A;  3C26 A;  3DDD A;  1Z9U A;  4JJX A;  1RO5 A;  3D3S A;  4JLY A;  4ORF A;  2ARH A;  2BSW A;  3R96 A;  3UY5 A;  4CRZ B;  2BL1 A;  2VBQ A;  3FBU A;  2H5M A;  4KOW A;  2CNS A;  2G3T A;  4QUS A;  1MK4 A;  2ZXV A;  5IX3 A;  1KUV A;  1KZF A;  2EVN A;  2FSR A;  1VHS A;  2I79 A;  4K30 A;  2AE6 A;  1IIC A;  2GIV A;  5F47 A;  4R87 A;  3TO7 A;  3EO4 A;  4UWI A;  1CJW A;  1U6M A;  3SXO A;  1QSM A;  1KUY A;  2B58 A;  1M44 A;  2P6E A;  1IB1 E;  3FIX A;  3PGP A;  3DSB A;  3VWD A;  2FT0 A;  3T9Y A;  4YRH A;  4XPD C;  5JPH A;  2Z0Z A;  4FD5 A;  1MJB A;  5F48 A;  4R3L A;  2Q44 A;  2R8V A;  2DXQ A;  3ZZI A;  3P2F A;  3H4Q A;  3TE4 A;  1QSO A;  2Q04 A;  4KLV A;  1YVO A;  4MHD A;  4CAV A;  1SQH A;  4MY0 A;  1PUA A;  1XF8 A;  5H84 A;  3TO6 A;  5J8C A;  3K9U A;  3EC4 A;  1UFH A;  1TIQ A;  2Q7B A;  2FE7 A;  4XPK A;  3WR7 A;  2VZZ A;  1MJA A;  2B3U A;  4PSW A;  3B8G A;  3GKR A;  3TT2 A;  3V8I A;  4UA3 A;  4KOT A;  3I9S A;  1YGH A;  3KKW A;  2OU2 A;  2J8M A;  4KVM E;  1IYL A;  4HNX B;  2KCW A;  1YLE A;  4OAE A;  4GS4 A;  1N71 A;  4PSX A;  3E0K A;  5IB0 A;  4NCZ A;  3D2P A;  4M85 A;  4II9 A;  2PC1 A;  5C88 A;  3TFY A;  1Q2Y A;  2C27 A;  3EXN A;  2P6G A;  2PRB A;  3FYN A;  4XNH C;  1KUX A;  2REF A;  4IUS A;  2BUE A;  3QAH A;  4AVB A;  4XPL A;  4EVY A;  2PR1 A;  4JWP A;  4FD7 A;  4H89 A;  2PSW A;  4UWJ A;  2HQY A;  2Q4V A;  5KTD A;  4CS0 B;  2ZW4 A;  2J8N A;  2D4O A;  3ZJ0 A;  4XPD B; 
#chains in the Genus database with same CATH topology
 2FCK A;  2B5G B;  4CYP A;  2YGW A;  4CYN A;  4R76 A;  4WWV A;  1CG2 A;  2C6P A;  2G0B A;  5EMI A;  5ELY A;  5HVG A;  3R9E A;  1S5K A;  1QSR A;  3F5B A;  1YK3 A;  1Q2C A;  2K5T A;  2CNT A;  2PJ3 A;  1NSA A;  2B4D A;  2NMT A;  4ZX9 A;  2I00 A;  3GB0 A;  2ANP A;  4X3R A;  3P2H A;  4RUH A;  4W9Y A;  1Z4R A;  1XIX A;  4MFZ A;  1P4N A;  4U5Y A;  1Z5R A;  1ZG7 A;  3FF3 A;  3RO0 A;  3CT9 A;  3PB6 X;  1IOI A;  2F8H A;  4AVC A;  1NE9 A;  2DPS A;  4KS9 A;  4MFJ A;  3G8W A;  1M4I A;  4UCP A;  3D8P A;  1R3N A;  4NSQ A;  4UEZ A;  4U9Y A;  1HDQ A;  1FY7 A;  4AVA A;  2DEA A;  2EBJ A;  5LYD A;  2VXK A;  3SXN A;  1NMT A;  3DLJ A;  4RI1 A;  4YFJ A;  2ZEG A;  5HMN A;  3FEE A;  4MY3 A;  3LD2 A;  2WPX A;  4A94 A;  1I21 A;  3SJG A;  2PJ6 A;  2QIR A;  3V7Z A;  1S3Z A;  3G3S A;  3FRM A;  4FAI A;  3IWG A;  3IJ3 A;  3PB8 X;  6CPA A;  3I3G A;  1TF9 A;  5DWM A;  4UCN A;  1Q2D A;  2ZEH A;  3JVN A;  3F0A A;  4YGO A;  1BPN A;  3D67 A;  2G9D A;  4MCR A;  1XOV A;  1LAP A;  4JYW A;  3WT4 A;  4OIW A;  4NGQ A;  2JDD A;  3NE7 A;  3TX8 A;  4P6Y A;  4MCP A;  2Z3O A;  1YLO A;  1CX8 A;  1F2P A;  1V0C A;  2BO9 A;  3S6F A;  4AB7 A;  1I1D A;  4KOV A;  4GM5 A;  1M1D A;  4TNU A;  1MJ9 A;  1TXR A;  1Z4E A;  5H86 A;  4MHZ A;  2PJ2 A;  4F0Y A;  1K4J A;  1XE4 A;  4MFQ A;  1I12 A;  3T90 A;  1Q7L A;  2PE3 A;  2P0W A;  2VL1 A;  4CAW A;  4B11 A;  2JLM A;  4ZBG A;  2VZY A;  3TO9 A;  5HXD A;  5LRK A;  2C1C A;  4NGN A;  1BPM A;  4M3S A;  3GY9 A;  1JWQ A;  1GYT A;  1QSN A;  1YSJ A;  2RFH A;  3IU2 A;  2CNM A;  5LRG A;  4WJB A;  5G1Z A;  4OC0 A;  4UBR A;  3B3C A;  4UFV A;  1EE3 P;  1XBU A;  3SJE A;  2PJ7 A;  2ATR A;  4KOY A;  5D8N A;  3LOD A;  2DF5 A;  1X12 A;  2V77 A;  2WZN A;  1KWM A;  4KOS A;  5THW A;  1CBX A;  4E2A A;  4PXB A;  4RS2 A;  1Y7E A;  3S9M A;  3NH8 A;  1ARM A;  4KOR A;  4ONU A;  2JDC A;  2GU2 A;  4MJ8 A;  3TCV A;  5K8N A;  4E8O A;  2I3C A;  4UEF A;  4MFK A;  4Q36 A;  4B13 A;  2FL4 A;  2O4H A;  2ZOF A;  1TKF A;  2ZW5 A;  4K3N A;  4Y49 C;  2PJC A;  4H6Z A;  4PPZ A;  1CM0 A;  5AG4 A;  5F46 A;  2NYQ A;  1Y7R A;  3KZW A;  1CP6 A;  3A9L A;  1RXT A;  2CF4 A;  4R8F A;  2ZEN A;  3CZX A;  1YR0 A;  2BEI A;  3RAM A;  5EC4 A;  3T8W A;  4Q38 A;  3R95 A;  3ISZ A;  4MCQ A;  4OC5 A;  1AYE A;  4C7H A;  3LAC A;  1ARL A;  3D7H A;  4MMO A;  2PIY A;  4I49 A;  3CDX A;  5C82 A;  4CRY B;  3KHZ A;  4DJL A;  1R57 A;  1YVK A;  2XEJ A;  2PJ1 A;  3R1K A;  4MHP A;  3TOB A;  3N7Z A;  4C2X A;  2PJ0 A;  3B3W A;  4MCS A;  4DNC A;  3TC8 A;  1F2O A;  2AFW A;  4L89 A;  4A39 A;  3SJF A;  3FNC A;  4C2Z A;  2POK A;  1TKJ A;  4L8A A;  2V8H A;  3PB4 X;  3WAB A;  3BI0 A;  1S7L A;  4U9Z A;  3BI1 A;  2R98 A;  4OC1 A;  5JGF A;  1YME A;  3S9L A;  4Y49 B;  3DNS A;  5E96 A;  4BBH A;  5A28 A;  4OME A;  2WYR A;  5IV0 A;  1Y9K A;  3L2N A;  5ISV A;  4NGP A;  3OWC A;  1PU9 A;  1S7N A;  3BXM A;  4GXH A;  4C68 A;  3V38 A;  5JH9 A;  4A31 A;  3CPX A;  4YU9 A;  4IF5 A;  4HNY B;  1VHE A;  4P44 A;  3W91 A;  3PFO A;  2PIZ A;  4B5P B;  2GLF A;  1IYK A;  4UEE A;  4FD4 A;  2B5G A;  3JRU A;  4NJR A;  4G1P A;  4OKO A;  5K8O A;  3K9T A;  4H6U A;  4TWE A;  1J4J A;  3D7G A;  1S7F A;  3ISX A;  5JQ4 A;  3FB3 A;  1ZG9 A;  4HKF A;  2B4D B;  2OB0 A;  1XMT A;  2WPW A;  3RYO A;  2C6C A;  3R9G A;  2JEW A;  4BD9 A;  1ZO0 A;  2PVW A;  1YRE A;  4MBU A;  3KHX A;  4FBE A;  4KUA A;  2J8R A;  3DR6 A;  3QB8 A;  3IWE A;  1A2Z A;  2Y0M A;  3LWU A;  4UCM A;  1CPX A;  4EFD A;  1LCP A;  4KSA A;  4KLW A;  4CGN A;  4QVT A;  1XEB A;  4F0X A;  3FMC A;  4IHM A;  1CP7 A;  4E0A A;  3IIB A;  3WC7 A;  3VWE A;  3KI9 A;  4MHN A;  4KOU A;  4QC6 A;  2X7B A;  2YND A;  2B4B A;  2R7H A;  5IB9 A;  3F8K A;  3H8G A;  2FVG A;  4DYO A;  4B14 A;  3I1U A;  2P6F A;  4KVX A;  4ZY0 A;  2OZG A;  3RNZ A;  4CAX A;  4KVO E;  5CNP A;  2PJB A;  2GAN A;  2RC4 A;  1IGB A;  2EK8 A;  4M6H A;  4MFL A;  4JXR A;  5KTA A;  1X10 A;  4OC3 A;  3GLJ A;  1S60 A;  4BMH A;  4CPA A;  2ZEP A;  2AFX A;  3R9F A;  1Y0R A;  4OAD A;  3SHP A;  3S6K A;  4X5K A;  2A4N A;  2AJ6 A;  3IO1 A;  1VGY A;  3MN8 A;  1UWY A;  2ZPA A;  3GYA A;  5AG5 A;  1BO4 A;  1ZLH A;  1PYT B;  2PR8 A;  2Q43 A;  5AG6 A;  4LX9 A;  1HEE A;  1IY7 A;  4NEX A;  1NSL A;  1YX0 A;  2Q0Y A;  2F7V A;  2PVV A;  3FH4 A;  4R6T A;  1CPS A;  4A32 A;  3LMS A;  1Y9W A;  2Q4Y A;  2JBK A;  3SI0 A;  4MI4 A;  4HNW B;  2AFO A;  4ZY1 A;  2PRQ A;  4CAE A;  3TTH A;  2AFU A;  3EFA A;  4C7I A;  4J3G A;  4P4F A;  1ELL P;  3BJ7 A;  2FIW A;  3IGR A;  3PBE A;  3BJ8 A;  5I4M A;  2QJ8 A;  1GHE A;  3W6X A;  4PK3 A;  2ABZ A;  4MRI A;  4FD6 A;  2VQY A;  3CXQ A;  2G3A A;  1ELM P;  1IOF A;  5DWN A;  4UF4 A;  3GUX A;  1TKH A;  5BWA B;  5CPA A;  4PQA A;  1VKC A;  1LAM A;  1VHO A;  2ODF A;  3JTK A;  4R7M A;  1LFW A;  2FIA A;  2FXF A;  2QEC A;  3EY5 A;  5G20 A;  4CYO A;  4KOX A;  4F9U A;  5J1Q A;  2OZH A;  4MHY A;  2QVP A;  1TF8 A;  4NGT A;  2QML A;  3CPA A;  2Z3M A;  5G21 A;  5KTC A;  3FEC A;  3KQX A;  3SI1 A;  4R9M A;  1F57 A;  3VAR A;  4A30 A;  3W6S A;  2ZW6 A;  2EUI A;  5AGE A;  1M4D A;  2Z10 A;  3PRT A;  4EWT A;  1R43 A;  2C6G A;  2ZEM A;  5FVJ A;  5K8M A;  4KUB A;  4LUA A;  1M4L A;  2PJ5 A;  2XEI A;  5G22 A;  2PDO A;  4A38 A;  2HV2 A;  4B5P A;  4F6A A;  2CIJ A;  4KZT A;  4XNH B;  2O28 A;  3QAY A;  2JBJ A;  3N5F A;  3S6G A;  3BLN A;  4UIA A;  1Z8T A;  2Z3K A;  3H5Z A;  4OLL A;  1XJO A;  5LYI A;  4P4I A;  1QST A;  4P4E A;  1OZP A;  2WSA A;  1OBR A;  3DGV A;  2NSM A;  4AG7 A;  2IL4 A;  1QQ9 A;  2XEG A;  2BOA A;  2R1I A;  3KAS A;  2Z3N A;  3HLP A;  1B6B A;  2IMO A;  2GE3 A;  4PK2 A;  1YQE A;  2B3V A;  3B3S A;  3FVL A;  5HH1 A;  7CPA A;  3B2Y A;  2D4P A;  4MXU A;  4B5O A;  1DE4 C;  4X2T A;  2V8D A;  2CY2 A;  4UFW A;  4QB9 A;  1QMU A;  5F49 A;  3WC5 A;  1WWZ A;  4CGP A;  2Q4Z A;  3FXT A;  3PB7 X;  4ZY2 A;  2GLJ A;  3VAT A;  3CXS A;  1LRZ A;  1Z8X A;  1JQG A;  3S6H A;  4ZYQ A;  4B10 A;  2Q51 A;  3PP9 A;  3CXP A;  4YWY A;  1L0C A;  2V8V A;  2YNC A;  1ZG8 A;  3DR8 A;  3FX6 A;  1BOB A;  4JD6 A;  4UFX A;  3RZA A;  2ZEE A;  4QBJ A;  4X8I A;  4NXY A;  3SJX A;  2Z3L A;  1BLL E;  2HUZ A;  3FED A;  1XRY A;  2O53 A;  3B7I A;  4AG9 A;  4F8Z A;  2OH1 A;  3KR5 A;  3MGD A;  1AUG A;  4A37 A;  4JZ0 A;  2CTB A;  3HUV A;  2ZEO A;  2OZU A;  4R3K A;  2V8G A;  3KL9 A;  4IK2 A;  4PV6 A;  3BHX A;  1M4G A;  1ON0 A;  2JEV A;  2PQ8 A;  4A95 A;  2VEZ A;  1B87 A;  2ZW7 A;  2FS5 A;  3D2M A;  1HDU A;  5I0C A;  5J8F A;  1WK4 A;  1LAN A;  2REE A;  1P0H A;  1S7K A;  2Z11 A;  4OP4 A;  4A2Z A;  1H8L A;  4JXQ A;  2F5I A;  5EBV A;  1XMB A;  5GCN A;  3IC1 A;  1IID A;  1Y0Y A;  2VI7 A;  2YNE A;  3PZJ A;  3H8E A;  4NF1 A;  4R57 A;  4MFP A;  1DTD A;  3C26 A;  3JUW A;  3TOA A;  4ZI6 A;  3DDD A;  1Z9U A;  4JJX A;  4NJQ A;  2OOT A;  1RO5 A;  5LYF A;  3D3S A;  4JLY A;  4ORF A;  2ARH A;  2BSW A;  4ZGY B;  1YW4 A;  3R96 A;  4A33 A;  3UY5 A;  4CRZ B;  2BL1 A;  2VBQ A;  3FBU A;  4OID A;  2PCU A;  2H5M A;  2HC9 A;  3PB9 X;  4LQ6 A;  2CNS A;  2G3T A;  4KOW A;  4EME A;  2EWB A;  3IEH A;  4QUS A;  4B12 A;  2QYV A;  3MRU A;  1MK4 A;  1XFO A;  2ZXV A;  5IX3 A;  1KUV A;  1KZF A;  2EVN A;  3D7D A;  2BCO A;  2FSR A;  1VHS A;  4RN7 A;  2I79 A;  5LRJ A;  4K30 A;  2AE6 A;  2PJ8 A;  1IIC A;  3B3V A;  2GIV A;  5AG7 A;  5F47 A;  4FUU A;  4KSF A;  4R87 A;  3EO4 A;  5DS0 A;  3TO7 A;  3B3T A;  2CXA A;  3SI2 A;  2PJ4 A;  5HVH A;  3D66 A;  4UIB A;  4UWI A;  1YW6 A;  4P4D A;  3IU1 A;  1CJW A;  1U6M A;  1BAV A;  1QSM A;  1Z2L A;  3SXO A;  2PJ9 A;  2J9A A;  1FT7 A;  5CBM A;  1KUY A;  2B58 A;  1M44 A;  2IQ6 A;  1LOK A;  2P6E A;  2EK9 A;  4Q7A A;  1IB1 E;  4BIN A;  1FNO A;  3FIX A;  3PGP A;  3DSB A;  4P10 A;  3VWD A;  3PFE A;  2ZED A;  2FT0 A;  4O23 A;  3KQZ A;  4YRH A;  3T9Y A;  4XPD C;  5JPH A;  2WUU A;  2RB7 A;  3QNV A;  2Z0Z A;  4PXC A;  4M6G A;  4IAV A;  4FD5 A;  5F09 A;  5JM6 A;  1MJB A;  4H2K A;  1IU8 A;  5F48 A;  4R3L A;  2Q44 A;  2R8V A;  2DXQ A;  3ZZI A;  4P45 A;  3P2F A;  3H4Q A;  3IFE A;  1QSO A;  5K8P A;  3TE4 A;  2Q04 A;  4KLV A;  1YVO A;  4MHD A;  2GFQ A;  4CAV A;  1SQH A;  3NH5 A;  1PUA A;  1XF8 A;  4MY0 A;  5H84 A;  3TO6 A;  5J8C A;  4HPS A;  3S9N A;  4M6I A;  3K9U A;  4PXD A;  2Q7S A;  3NE8 A;  4ZX8 A;  8CPA A;  3EC4 A;  1UFH A;  2EO8 A;  4NGS A;  3VH9 A;  1TIQ A;  2Q7B A;  2FE7 A;  2HB6 A;  3FJU A;  2ZEL A;  4FWU A;  4XPK A;  3WR7 A;  2VZZ A;  4CGM A;  1MJA A;  2B3U A;  4PSW A;  4CGO A;  4ONW A;  4OC2 A;  2OR4 A;  2PJA A;  4NGR A;  3NFZ A;  3NH4 A;  3B8G A;  3GKR A;  3PBB A;  4OC4 A;  3TT2 A;  3V8I A;  4UA3 A;  1VIX A;  1Z8W A;  3K2K A;  4NFR A;  4KOT A;  4C2Y A;  2AFZ A;  1RTQ A;  3I9S A;  1YGH A;  3RBU A;  3KKW A;  2OU2 A;  4B6Z A;  2J8M A;  1Z8L A;  5D29 A;  3H8F A;  1AMP A;  3KGQ A;  3B35 A;  4KVM E;  5A27 A;  4KSI A;  1IYL A;  4HNX B;  2KCW A;  2Z3P A;  3GIU A;  5HVF A;  4Z65 A;  1YLE A;  3D7F A;  4LQG A;  4OAE A;  4GS4 A;  3D4U A;  1N71 A;  4PSX A;  3E0K A;  5IB0 A;  2GRE A;  4NCZ A;  3D2P A;  4M85 A;  4II9 A;  2PC1 A;  1ZLI A;  2YNC C;  2ZEF A;  2ZOG A;  5C88 A;  3TFY A;  2IJZ A;  1Q2Y A;  2C27 A;  3EXN A;  4F9V A;  3IWW A;  2P6G A;  2PRB A;  3FYN A;  2DPT A;  4XNH C;  1KUX A;  4P4J A;  2REF A;  4CYQ A;  4IUS A;  4CGL A;  4CAF A;  3PEI A;  2AFS A;  4AXV A;  2BUE A;  3QAH A;  3WC6 A;  4PXE A;  1PCA A;  4AVB A;  4XPL A;  4EVY A;  2PR1 A;  2CTC A;  4P4B A;  4JWP A;  3KR4 A;  4FD7 A;  4H89 A;  2PSW A;  4UWJ A;  2HQY A;  2AFM A;  2Q4V A;  2XEF A;  3NA6 A;  4DUK A;  4CS0 B;  2ZW4 A;  5KTD A;  5LYL A;  2J8N A;  2D4O A;  4NGM A;  3ZJ0 A;  3D68 A;  4XPD B; 
#chains in the Genus database with same CATH homology
 2FCK A;  2B5G B;  4CYP A;  2YGW A;  4CYN A;  2G0B A;  3R9E A;  1S5K A;  1QSR A;  3F5B A;  1YK3 A;  1Q2C A;  2K5T A;  2CNT A;  2B4D A;  2NMT A;  2I00 A;  3P2H A;  1Z4R A;  1XIX A;  4MFZ A;  1P4N A;  4U5Y A;  4AVC A;  1NE9 A;  2DPS A;  4KS9 A;  4MFJ A;  3G8W A;  1M4I A;  4UCP A;  3D8P A;  4NSQ A;  4U9Y A;  1FY7 A;  4AVA A;  2VXK A;  3SXN A;  1NMT A;  4RI1 A;  4YFJ A;  5HMN A;  4MY3 A;  3LD2 A;  2WPX A;  1I21 A;  2QIR A;  1S3Z A;  3G3S A;  3FRM A;  3IWG A;  3I3G A;  5DWM A;  4UCN A;  1Q2D A;  3JVN A;  3F0A A;  4YGO A;  2JDD A;  3NE7 A;  2Z3O A;  3S6F A;  1V0C A;  4AB7 A;  1I1D A;  4KOV A;  1M1D A;  1MJ9 A;  1Z4E A;  5H86 A;  4F0Y A;  1K4J A;  1XE4 A;  4MFQ A;  1I12 A;  3T90 A;  2P0W A;  4CAW A;  4B11 A;  2JLM A;  4ZBG A;  2VZY A;  3TO9 A;  4M3S A;  3GY9 A;  1QSN A;  3IU2 A;  2CNM A;  5G1Z A;  4UBR A;  4UFV A;  2ATR A;  4KOY A;  3LOD A;  4KOS A;  4E2A A;  4RS2 A;  4KOR A;  4ONU A;  2JDC A;  4MJ8 A;  3TCV A;  4E8O A;  4MFK A;  4Q36 A;  4B13 A;  2FL4 A;  2ZW5 A;  4Y49 C;  4H6Z A;  1CM0 A;  5AG4 A;  5F46 A;  1Y7R A;  3A9L A;  1RXT A;  1YR0 A;  2BEI A;  5EC4 A;  4Q38 A;  3R95 A;  4C7H A;  4I49 A;  5C82 A;  4CRY B;  1R57 A;  1YVK A;  3R1K A;  3TOB A;  3N7Z A;  4C2X A;  4DNC A;  4L89 A;  3FNC A;  4C2Z A;  4L8A A;  1S7L A;  4U9Z A;  2R98 A;  4Y49 B;  3DNS A;  5E96 A;  4BBH A;  5A28 A;  5IV0 A;  1Y9K A;  5ISV A;  3OWC A;  1PU9 A;  1S7N A;  4C68 A;  4A31 A;  4IF5 A;  4HNY B;  3W91 A;  4B5P B;  1IYK A;  4FD4 A;  2B5G A;  4H6U A;  1J4J A;  1S7F A;  5JQ4 A;  3FB3 A;  4HKF A;  2B4D B;  2OB0 A;  1XMT A;  2WPW A;  3RYO A;  3R9G A;  1ZO0 A;  1YRE A;  4MBU A;  4KUA A;  2J8R A;  3DR6 A;  3QB8 A;  3IWE A;  2Y0M A;  4UCM A;  4KSA A;  4KLW A;  4CGN A;  4QVT A;  1XEB A;  4F0X A;  4E0A A;  3VWE A;  4KOU A;  4QC6 A;  2X7B A;  2YND A;  2B4B A;  2R7H A;  3F8K A;  4B14 A;  2P6F A;  4KVX A;  2OZG A;  4CAX A;  4KVO E;  5CNP A;  2GAN A;  2RC4 A;  4MFL A;  4JXR A;  5KTA A;  4BMH A;  1S60 A;  3R9F A;  4OAD A;  3SHP A;  3S6K A;  4X5K A;  2A4N A;  2AJ6 A;  2ZPA A;  3GYA A;  5AG5 A;  1BO4 A;  2PR8 A;  5AG6 A;  4LX9 A;  4NEX A;  1NSL A;  1YX0 A;  2Q0Y A;  4A32 A;  1Y9W A;  2Q4Y A;  4MI4 A;  4HNW B;  4CAE A;  3TTH A;  3EFA A;  4C7I A;  4J3G A;  3BJ7 A;  2FIW A;  3IGR A;  3BJ8 A;  1GHE A;  3W6X A;  4PK3 A;  4FD6 A;  2VQY A;  3CXQ A;  2G3A A;  5DWN A;  5BWA B;  1VKC A;  3JTK A;  2FXF A;  2FIA A;  2QEC A;  3EY5 A;  5G20 A;  4CYO A;  4KOX A;  2OZH A;  2QML A;  2Z3M A;  5G21 A;  5KTC A;  4R9M A;  4A30 A;  3W6S A;  2ZW6 A;  2EUI A;  5AGE A;  1M4D A;  2Z10 A;  5FVJ A;  4KUB A;  4LUA A;  5G22 A;  2PDO A;  4B5P A;  2HV2 A;  4F6A A;  4KZT A;  4XNH B;  2O28 A;  3S6G A;  3BLN A;  3H5Z A;  2Z3K A;  4OLL A;  1QST A;  1OZP A;  2WSA A;  4AG7 A;  2IL4 A;  2R1I A;  2Z3N A;  1B6B A;  2GE3 A;  4PK2 A;  2B3V A;  5HH1 A;  2D4P A;  4B5O A;  2CY2 A;  4UFW A;  4QB9 A;  5F49 A;  4CGP A;  1WWZ A;  3FXT A;  3CXS A;  1LRZ A;  3S6H A;  4B10 A;  3PP9 A;  3CXP A;  1L0C A;  2YNC A;  3DR8 A;  4UFX A;  4JD6 A;  1BOB A;  4QBJ A;  4NXY A;  2Z3L A;  2HUZ A;  4AG9 A;  2OH1 A;  3MGD A;  4R3K A;  2OZU A;  4PV6 A;  1ON0 A;  1M4G A;  2JEV A;  2PQ8 A;  4A95 A;  2VEZ A;  1B87 A;  2ZW7 A;  2FS5 A;  3D2M A;  5J8F A;  5I0C A;  1WK4 A;  2REE A;  1P0H A;  1S7K A;  2Z11 A;  4A2Z A;  4JXQ A;  2F5I A;  5EBV A;  5GCN A;  1IID A;  2VI7 A;  2YNE A;  3PZJ A;  4NF1 A;  4R57 A;  4MFP A;  3JUW A;  3C26 A;  3TOA A;  3DDD A;  1Z9U A;  4JJX A;  1RO5 A;  3D3S A;  4JLY A;  4ORF A;  2ARH A;  2BSW A;  4ZGY B;  3R96 A;  4A33 A;  3UY5 A;  4CRZ B;  2BL1 A;  2VBQ A;  3FBU A;  2H5M A;  4KOW A;  2CNS A;  2G3T A;  4QUS A;  4B12 A;  1MK4 A;  2ZXV A;  5IX3 A;  1KUV A;  1KZF A;  2EVN A;  2FSR A;  1VHS A;  2I79 A;  4K30 A;  2AE6 A;  1IIC A;  2GIV A;  5AG7 A;  5F47 A;  4KSF A;  4R87 A;  3TO7 A;  3EO4 A;  2CXA A;  4UWI A;  3IU1 A;  1CJW A;  1U6M A;  3SXO A;  1QSM A;  1KUY A;  2B58 A;  1M44 A;  2P6E A;  1IB1 E;  3FIX A;  3PGP A;  3DSB A;  3VWD A;  2FT0 A;  3T9Y A;  4YRH A;  4XPD C;  5JPH A;  2WUU A;  2Z0Z A;  4FD5 A;  1MJB A;  5F48 A;  4R3L A;  2Q44 A;  2R8V A;  2DXQ A;  3ZZI A;  3P2F A;  3H4Q A;  3TE4 A;  1QSO A;  2Q04 A;  4KLV A;  1YVO A;  4MHD A;  4CAV A;  1SQH A;  4MY0 A;  1PUA A;  1XF8 A;  5H84 A;  3TO6 A;  5J8C A;  3K9U A;  3EC4 A;  1UFH A;  1TIQ A;  2Q7B A;  2FE7 A;  4XPK A;  3WR7 A;  2VZZ A;  4CGM A;  1MJA A;  2B3U A;  4PSW A;  4CGO A;  3B8G A;  3GKR A;  3TT2 A;  3V8I A;  4UA3 A;  4KOT A;  4C2Y A;  3I9S A;  1YGH A;  3KKW A;  2OU2 A;  2J8M A;  4KVM E;  5A27 A;  1IYL A;  4HNX B;  2KCW A;  2Z3P A;  1YLE A;  4OAE A;  4GS4 A;  1N71 A;  4PSX A;  3E0K A;  5IB0 A;  4NCZ A;  3D2P A;  4M85 A;  4II9 A;  2PC1 A;  2YNC C;  5C88 A;  3TFY A;  1Q2Y A;  2C27 A;  3EXN A;  2P6G A;  2PRB A;  3FYN A;  2DPT A;  4XNH C;  1KUX A;  2REF A;  4CYQ A;  4IUS A;  4CGL A;  4CAF A;  2BUE A;  3QAH A;  4AVB A;  4XPL A;  4EVY A;  2PR1 A;  4JWP A;  4FD7 A;  4H89 A;  2PSW A;  4UWJ A;  2HQY A;  2Q4V A;  5KTD A;  4CS0 B;  2ZW4 A;  2J8N A;  2D4O A;  3ZJ0 A;  4XPD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...