2Q4VA

Ensemble refinement of the protein crystal structure of thialysine n-acetyltransferase (ssat2) from homo sapiens
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
167
structure length
156
Chain Sequence
SVRIREAKEGDCGDILRLIRELAEFEKLKISEEALRADGFGDNPFYHCLVAEILGPCVVGYGIYYFIYSTWKGRTIYLEDIYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDLYKALGAQDLTEAEGWHFFCFQGEATRKLAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Diamine acetyltransferase 2
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 156
sequence length 167
chains with identical sequence B
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2q4vA00
1YGHA 4QUSA 4IF5A 3DR6A 2FSRA 4YGOA 5H86A 1L0CA 3DNSA 3D2MA 3CXPA 4KZTA 1GHEA 3P2HA 1B6BA 2Q4YA 3JVNA 5HH1A 5C82A 3FXTA 4F6AA 4PK3A 2J8RA 4U5YA 3S6HA 4KOUA 2FXFA 4XPKA 3VWDA 3IGRA 4H6UA 2Q0YA 1BO4A 4MI4A 4XPDC 1YR0A 3H4QA 2R98A 4MHDA 1QSNA 2OZGA 4H6ZA 2FIAA 3BJ8A 2FT0A 1M4DA 4GS4A 4AVCA 1IB1E 4UA3A 2PC1A 2HUZA 2JEVA 2PSWA 3DR8A 4HNYB 3EXNA 1MJBA 3R9GA 2R1IA 3TFYA 4FD6A 4L89A 2X7BA 4KOTA 4H89A 3R9FA 3F8KA 4HKFA 3SXNA 3P2FA 5F48A 4KLWA 1Y9WA 2F5IA 2ZXVA 2G0BA 4AVAA 4OLLA 1N71A 4HNWB 1Z9UA 1YREA 1M4GA 2D4OA 1QSTA 2PR1A 4RI1A 1S3ZA 1KUXA 1XMTA 1S5KA 2EVNA 4KORA 4UWJA 3R1KA 4JD6A 3TT2A 3RYOA 3ZZIA 2Z11A 4XNHB 3G8WA 1I21A 3TO9A 3GY9A 1QSOA 1UFHA 4NF1A 2OZUA 1BOBA 4KOSA 5IB0A 1P4NA 2J8NA 5GCNA 3EO4A 3TCVA 3MGDA 4NXYA 4R87A 2QMLA 4KOXA 2R8VA 4U9YA 3EFAA 3LD2A 3UY5A 3C26A 2JDDA 2G3TA 2O28A 2VZZA 1Q2YA 4R3KA 4ONUA 1XIXA 2FS5A 5KTDA 3CXQA 2P0WA 4IUSA 3NE7A 2I79A 5F46A 4FD7A 2VQYA 2AE6A 2PDOA 3E0KA 4OAEA 1YLEA 3FYNA 1NMTA 4PSWA 4II9A 3JUWA 2GIVA 5JQ4A 4Y49C 1VHSA 1RO5A 1I1DA 3F0AA 2OH1A 1QSMA 2QECA 3V8IA 1RXTA 1WWZA 2BSWA 3T9YA 2B5GB 4CRYB 2KCWA 5H84A 4PK2A 2PR8A 1LRZA 3D2PA 2VI7A 2C27A 2Z10A 3TO7A 3S6GA 3DDDA 2OU2A 4R57A 1M1DA 3S6FA 2ZW6A 2I00A 3LODA 2VEZA 1R57A 3CXSA 4YFJA 2B4DB 1CM0A 4KLVA 5DWNA 5CNPA 5J8FA 2D4PA 4KOYA 2J8MA 4BMHA 2ZPAA 2Z0ZA 4KUBA 1CJWA 5IX3A 1NSLA 4XPDB 3N7ZA 4MBUA 3TOBA 5I0CA 2ARHA 2A4NA 1KUYA 1OZPA 1VKCA 2B3UA 3PZJA 4FD4A 2FIWA 1V0CA 3K9UA 4KOWA 4M3SA 1P0HA 1YX0A 4AG9A 2FL4A 3TE4A 3BJ7A 4RS2A 2P6EA 1PUAA 4KVME 5KTCA 2P6FA 1QSRA 4JJXA 2WPWA 1Q2DA 1Y7RA 3PGPA 4MY0A 4B5PB 5C88A 1IYLA 1SQHA 5F49A 1Y9KA 2FCKA 1I12A 2ZW4A 4E0AA 3F5BA 3I3GA 3PP9A 1WK4A 4LX9A 4CS0B 2AJ6A 2VZYA 4B5OA 4E8OA 3W6XA 3QB8A 5ISVA 2B4BA 2JLMA 1KZFA 1IICA 3FB3A 1IIDA 4JWPA 3I9SA 5DWMA 5J8CA 4U9ZA 1S7KA 4EVYA 3VWEA 4CRZB 1MJ9A 2REEA 4NCZA 1KUVA 2CNSA 1Z4EA 2GANA 4MY3A 2WPXA 4FD5A 3R95A 4PSXA 4CAXA 4QB9A 3FRMA 1YVOA 2VBQA 3EC4A 4K30A 1S7FA 3KKWA 1S60A 2Q4VA 4AB7A 4E2AA 4UWIA 4AG7A 4NEXA 1K4JA 2RC4A 1PU9A 2VXKA 4KVOE 2P6GA 4YRHA 4CAWA 4J3GA 3FIXA 2CNMA 4JLYA 3T90A 1B87A 3R96A 2ZW7A 4F0YA 4ORFA 1NE9A 3SXOA 3DSBA 2K5TA 4QC6A 2Q44A 4Y49B 1TIQA 4OADA 5JPHA 4QVTA 4NSQA 3QAHA 4I49A 3BLNA 2HV2A 1S7LA 1Q2CA 4LUAA 1ON0A 2PRBA 2CNTA 2Q7BA 3GKRA 4KOVA 1U6MA 2Q04A 2OB0A 4KUAA 3D3SA 4KVXA 3G3SA 2B3VA 2QIRA 4AVBA 2GE3A 1M44A 2H5MA 2EUIA 4CAVA 4MJ8A 4JXQA 2B58A 5KTAA 4M85A 2NMTA 2B5GA 1J4JA 2PQ8A 3TOAA 3TTHA 3SHPA 5EBVA 5IV0A 2REFA 1XF8A 3WR7A 3B8GA 3S6KA 4XNHC 2BUEA 1M4IA 4QBJA 3IWGA 4X5KA 2G3AA 2B4DA 1IYKA 3FNCA 1S7NA 3ZJ0A 2JDCA 2IL4A 2OZHA 3R9EA 1XEBA 2DXQA 4ZBGA 2R7HA 4XPLA 4DNCA 2Y0MA 5E96A 1MK4A 5EC4A 4L8AA 4R3LA 1XE4A 3OWCA 3FBUA 2HQYA 1Z4RA 1MJAA 3EY5A 3W6SA 3W91A 1YVKA 2BEIA 1YK3A 3TO6A 2CY2A 2ATRA 3GYAA 5FVJA 4HNXB 2FE7A 5HMNA 4UBRA 2ZW5A 2BL1A 4JXRA 4PV6A 4B5PA 1FY7A 3D8PA 4R9MA 5F47A
chains in the Genus database with same CATH superfamily
1YGHA 4QUSA 2I3CA 4ZY2A 1F57A 4IF5A 3CDXA 3DR6A 2FSRA 4YGOA 5H86A 2IMOA 2EBJA 2ZEEA 1L0CA 3B3TA 3DNSA 4ZGYB 2PRQA 3D2MA 3CXPA 4UFVA 4KZTA 4EWTA 1GHEA 2PJCA 3IWEA 4UCNA 2EK9A 3P2HA 1CPSA 3S9MA 3FVLA 4MMOA 4ZX8A 2IJZA 1B6BA 2Q4YA 1X12A 3JVNA 4G1PA 5HH1A 3PEIA 4NJRA 5C82A 3FXTA 4F6AA 4B13A 4PK3A 1DE4C 2PJ3A 2J8RA 4U5YA 3S6HA 4A31A 4K3NA 2PVWA 4KOUA 2FXFA 4OC5A 4XPKA 4JYWA 3VWDA 5JM6A 3IGRA 2RFHA 3GUXA 4H6UA 2Q0YA 1BO4A 1XRYA 4MI4A 4XPDC 4EFDA 3TC8A 2VL1A 3KZWA 1YR0A 3H4QA 2R98A 5A28A 4MHDA 5G20A 1QSNA 2OZGA 3K2KA 4H6ZA 2FIAA 3H5ZA 3BJ8A 2FT0A 3PFOA 4P44A 1AYEA 2XEGA 1M4DA 4GS4A 4AVCA 1IB1E 2PJ2A 1XMBA 3NH5A 4UA3A 5HVFA 4OKOA 2PC1A 4OIDA 2ZEHA 2EO8A 1XOVA 2HUZA 2JEVA 2V8VA 3B3SA 1ZG9A 4C2XA 2PSWA 3DR8A 4HNYB 4C2ZA 3EXNA 1MJBA 4MFLA 3R9GA 1HEEA 2PIZA 2R1IA 2POKA 1Z8WA 2ZELA 3KGQA 4FD6A 4L89A 4OP4A 5BWAB 2X7BA 1Z8TA 2PJ0A 3HLPA 4KOTA 4H89A 2ZEPA 3LMSA 1XFOA 3R9FA 1F2OA 2OOTA 3F8KA 2WYRA 4HKFA 3SXNA 1XBUA 3N5FA 3P2FA 1VHEA 1Q7LA 1CX8A 4X2TA 5F48A 2QVPA 4KLWA 4R76A 4HPSA 4UIAA 3TFYA 1Y9WA 2F5IA 2ZXVA 2V8DA 1CBXA 1ELLP 4P10A 2AFSA 3V38A 3CPXA 3NA6A 2G0BA 5HVHA 2AFOA 5AG4A 3KQZA 2YNDA 4AVAA 4OLLA 1N71A 2ZEOA 4MFJA 4OC1A 4HNWB 1Z9UA 1YREA 2PE3A 3IC1A 1M4GA 1Z8XA 1XJOA 1IU8A 5K8NA 2D4OA 1TF8A 1QSTA 2ZEMA 5AGEA 2PR1A 4RI1A 5G1ZA 4FBEA 1EE3P 1KUXA 1S3ZA 1S5KA 1XMTA 3GB0A 2EVNA 4ZX9A 4KORA 4UWJA 3R1KA 4JD6A 2GFQA 3SJGA 3TT2A 3H8FA 1IY7A 4PXEA 3RYOA 3ZZIA 4FAIA 2Z11A 3V8IA 4MCRA 4RUHA 3GLJA 4XNHB 3G8WA 4MFPA 1I21A 2JBJA 4FUUA 3ISZA 1ZO0A 3TO9A 4ZI6A 4KS9A 3WT4A 3GY9A 1JWQA 1QSOA 1UFHA 1PCAA 4NF1A 2OZUA 3WC7A 4F9VA 5K8PA 1BOBA 4KOSA 5IB0A 1TXRA 5LRJA 1P4NA 2J8NA 5GCNA 3T8WA 2ODFA 5EMIA 2YGWA 4C7IA 3EO4A 4P4BA 3B2YA 2RB7A 3B3WA 3PB9X 3TCVA 3MGDA 4NXYA 4R87A 2QMLA 4KOXA 3D7GA 1BAVA 4KSFA 1X10A 2R8VA 4U9YA 3EFAA 4CPAA 5K8OA 1QQ9A 5AG7A 2DPTA 4P4JA 3D67A 3LD2A 4UCPA 2ZOGA 2V8HA 4UFWA 3UY5A 2C6PA 4A94A 3C26A 2Q43A 2JDDA 3SI0A 2G3TA 2O28A 2VZZA 2XEJA 3FMCA 1Q2YA 1Z5RA 3PB6X 4O23A 4R3KA 2ANPA 3QAYA 4X8IA 4ONUA 1XIXA 2FS5A 5KTDA 3CXQA 3IEHA 3PBBA 2P0WA 4IUSA 3NE7A 2I79A 4UEEA 5F46A 3PB8X 4FD7A 4MHZA 4NGMA 4OC2A 2VQYA 3S9NA 2QYVA 4CYNA 1LFWA 2V8GA 1PYTB 1YMEA 2AE6A 4P4IA 4R8FA 3TX8A 2PDOA 3E0KA 4OAEA 1YLEA 3FEEA 1NMTA 3FYNA 3LACA 4PSWA 2ZEFA 3SJFA 3JUWA 4A95A 4II9A 4NGTA 2GIVA 5JQ4A 2IQ6A 2GREA 4Y49C 1CP7A 2ZEGA 5G22A 1VHSA 1RO5A 1I1DA 3F0AA 4NGNA 5JH9A 2OH1A 2XEIA 1QSMA 2CTCA 2ZEDA 4UIBA 1YW4A 2O4HA 2PJ7A 2QECA 1IGBA 1RXTA 2Q4ZA 1CG2A 1WWZA 2BSWA 4Q7AA 2F8HA 4PXDA 4MFZA 3T9YA 1Y0RA 2B5GB 4A39A 4P45A 4CRYB 2KCWA 3ISXA 4P6YA 3D7FA 4PPZA 4PK2A 5H84A 4P4DA 2PR8A 1LRZA 2FVGA 2PJ5A 1DTDA 4A32A 2NSMA 5D29A 3D2PA 2VI7A 2C27A 2Z10A 3TO7A 3S6GA 5AG6A 3DDDA 2OU2A 3RO0A 4R57A 4M6IA 1M1DA 4FWUA 3S6FA 2ZW6A 1M4LA 4Z65A 4MRIA 2I00A 3LODA 1FNOA 2VEZA 4ZY1A 1R57A 2NYQA 4KSIA 3CXSA 4YFJA 3VH9A 4DYOA 2B4DB 1CM0A 2Z3NA 4KSAA 3MRUA 2AFMA 3HUVA 4KLVA 5DWNA 1Y7EA 4P4EA 5CNPA 5I4MA 3I1UA 2DPSA 3RNZA 5J8FA 2D4PA 4KOYA 2J8MA 4NGQA 4H2KA 4BMHA 2ZPAA 5DS0A 2CXAA 2Z0ZA 4KUBA 1CJWA 1YSJA 3RZAA 1NSLA 5IX3A 4F0XA 3PB7X 4OC3A 2Z3MA 4XPDB 3SJEA 3N7ZA 4MBUA 2BCOA 2ZENA 3TOBA 3B7IA 5I0CA 4C68A 4CYQA 4OIWA 4DJLA 2ARHA 2EWBA 4MFQA 2A4NA 4NGPA 4UF4A 3RBUA 4GXHA 1KUYA 4OC4A 1OZPA 1TKJA 1VKCA 4MHYA 2B3UA 4F9UA 4PXCA 1YW6A 2V77A 4MCQA 1ZG8A 3PZJA 4FD4A 2FIWA 1V0CA 1OBRA 5HXDA 2PJ1A 2PJ4A 4IK2A 3K9UA 4KOWA 4TWEA 1F2PA 3PRTA 2GLJA 3DGVA 4A30A 4M3SA 1P0HA 5LYFA 1YX0A 8CPAA 4AG9A 2FL4A 3TE4A 3BJ7A 4RS2A 2P6EA 4M6HA 4CAFA 1LANA 4ZYQA 1PUAA 3PFEA 4KVME 5KTCA 2P6FA 2Q7SA 1QSRA 4JJXA 2WPWA 1Q2DA 3L2NA 5CPAA 4MCSA 1Y7RA 2C6GA 3PGPA 4MY0A 4B5PB 1JQGA 1IYLA 1SQHA 5C88A 5LRKA 5F49A 1LAMA 1Z2LA 1Y9KA 2FCKA 1I12A 2ZW4A 5LYDA 4E0AA 2HC9A 3PBEA 1VIXA 3F5BA 3I3GA 3IIBA 1WK4A 3PP9A 4MXUA 4LX9A 4WWVA 4CS0B 2AJ6A 4CAEA 4CYOA 2PJ6A 1HDQA 2VZYA 4B5OA 4E8OA 3W6XA 3FH4A 3QB8A 4BBHA 2Q51A 5ISVA 2B4BA 2PVVA 4NGRA 2JLMA 1KZFA 1IICA 3FB3A 3H8GA 4CGNA 2F7VA 1IIDA 3CT9A 4A2ZA 4JWPA 3DLJA 3WC5A 3I9SA 5DWMA 5J8CA 1AMPA 1HDUA 1ZLIA 4CGLA 3CPAA 3B3VA 1RTQA 3D68A 1S7KA 4U9ZA 4EVYA 3IWWA 3JRUA 4X3RA 2C1CA 3VWEA 4MCPA 1YQEA 3IJ3A 1MJ9A 4Q38A 4CRZB 2DEAA 2PJBA 2REEA 4NCZA 4DUKA 3S9LA 1KUVA 1R43A 1BLLE 2CNSA 1Z4EA 3VARA 4TNUA 2GANA 3A9LA 4MY3A 4C2YA 5G21A 2WPXA 4FD5A 2PJAA 3R95A 7CPAA 5IB9A 4PSXA 2PIYA 4CAXA 4QB9A 3BXMA 3FRMA 1YVOA 2VBQA 3EC4A 4K30A 1S7FA 3BI0A 3D7DA 3LWUA 5JGFA 4W9YA 2OR4A 4NGSA 2WSAA 2CF4A 3KKWA 1S60A 1QMUA 2Q4VA 4AB7A 4E2AA 4UWIA 3D4UA 5D8NA 4AG7A 4NEXA 1K4JA 2RC4A 4EMEA 1PU9A 2VXKA 4KVOE 1TKHA 5K8MA 3KI9A 2P6GA 4YRHA 4CAWA 4M6GA 2QJ8A 3KL9A 4J3GA 3FIXA 2CNMA 4JLYA 3T90A 2WUUA 4ZY0A 5THWA 4GM5A 1B87A 3R96A 2ZW7A 4F0YA 4ORFA 1NE9A 1ELMP 3SXOA 1NSAA 2ZOFA 3DSBA 4B14A 1ARLA 2XEFA 2K5TA 2Z3LA 1VGYA 3WC6A 4QC6A 1IOFA 2Q44A 4Y49B 1TIQA 4JZ0A 1VHOA 4OADA 5JPHA 2G9DA 3NH8A 2AFXA 4QVTA 4NSQA 2ABZA 3QAHA 5A27A 4I49A 5J1QA 3BLNA 2HV2A 3IO1A 1FT7A 1S7LA 3D66A 4A37A 4CGMA 1Q2CA 4LUAA 4Q36A 4CGPA 1A2ZA 1CPXA 1ON0A 2YNEA 2Z3OA 3BI1A 3NFZA 5ELYA 2PRBA 4BD9A 2CNTA 2Q7BA 3GKRA 1U6MA 1LCPA 2Q04A 4KOVA 1Y0YA 4OMEA 3BHXA 3KASA 1TF9A 2JBKA 4BINA 2OB0A 4KUAA 3D3SA 3K9TA 4B6ZA 4UEZA 4KVXA 3FF3A 3G3SA 4MHPA 3SI1A 5LYIA 2B3VA 4LQ6A 3KHXA 5HVGA 2QIRA 4AVBA 2GE3A 2BO9A 3D7HA 1GYTA 1M44A 3FJUA 4WJBA 4B12A 2GU2A 2H5MA 4PXBA 4PQAA 2EUIA 4CAVA 4MJ8A 1ARMA 4JXQA 2B58A 5KTAA 1LOKA 4NFRA 4A38A 4M85A 2YNCA 2NMTA 3SJXA 4ONWA 2B5GA 1J4JA 3IU2A 4NJQA 4IAVA 4P4FA 2PQ8A 2O53A 4UEFA 3TOAA 3TTHA 4F8ZA 3B35A 3SHPA 2EK8A 5EBVA 5IV0A 4LQGA 4YWYA 3SI2A 2REFA 1XF8A 3CZXA 3KHZA 3B8GA 3S6KA 4XNHC 3WR7A 2BUEA 1M4IA 4RN7A 4UCMA 5F09A 4QBJA 3FECA 3IWGA 1BPMA 3QNVA 1ZLHA 4X5KA 3FEDA 2G3AA 2B4DA 2BOAA 1CP6A 3B3CA 1IYKA 3FNCA 2JEWA 1S7NA 3ZJ0A 2JDCA 2J9AA 5LYLA 4UFXA 4YU9A 2IL4A 2OZHA 3KR5A 5AG5A 4MFKA 3R9EA 1XEBA 4CGOA 1BPNA 2DXQA 1IOIA 4R6TA 4ZBGA 2R7HA 4A33A 4CYPA 3V7ZA 4XPLA 2GLFA 3GIUA 4DNCA 5LRGA 2Y0MA 5E96A 1R3NA 2DF5A 4AXVA 1MK4A 1TKFA 1AUGA 2CTBA 5EC4A 4IHMA 1Z8LA 4L8AA 4R3LA 1XE4A 3FX6A 3MN8A 1ZG7A 3OWCA 4R7MA 1LAPA 3WABA 4B10A 5CBMA 3FBUA 2Z3KA 2HQYA 4B11A 1Z4RA 2PJ8A 4OC0A 1MJAA 3EY5A 3W6SA 3W91A 1H8LA 1YVKA 3IU1A 2BEIA 3NE8A 3RAMA 1YK3A 3TO6A 3IFEA 3H8EA 2CY2A 2ATRA 2HB6A 1YLOA 3KQXA 3GYAA 3NH4A 5FVJA 4HNXB 4MHNA 2FE7A 2Z3PA 5HMNA 2AFWA 2AFUA 2PJ9A 4UBRA 2WZNA 6CPAA 2ZW5A 3VATA 2CIJA 2AFZA 3JTKA 2BL1A 1UWYA 2YNCC 4JXRA 4PV6A 4B5PA 2PCUA 3KR4A 1FY7A 4C7HA 3D8PA 4R9MA 2C6CA 1KWMA 5F47A 3PB4X
chains in the Genus database with same CATH topology
1YGHA 4QUSA 4IF5A 3DR6A 2FSRA 4YGOA 5H86A 1L0CA 3DNSA 4ZGYB 3D2MA 3CXPA 4UFVA 4KZTA 1GHEA 3IWEA 4UCNA 3P2HA 1B6BA 2Q4YA 3JVNA 5HH1A 5C82A 3FXTA 4F6AA 4B13A 4PK3A 2J8RA 4U5YA 3S6HA 4A31A 4KOUA 2FXFA 4XPKA 3VWDA 3IGRA 4H6UA 2Q0YA 1BO4A 4MI4A 4XPDC 1YR0A 3H4QA 2R98A 5A28A 4MHDA 5G20A 1QSNA 2OZGA 4H6ZA 2FIAA 3H5ZA 3BJ8A 2FT0A 1M4DA 4GS4A 4AVCA 1IB1E 4UA3A 2PC1A 2HUZA 2JEVA 4C2XA 2PSWA 3DR8A 4HNYB 4C2ZA 3EXNA 1MJBA 4MFLA 3R9GA 2R1IA 5BWAB 4FD6A 4L89A 3TFYA 2X7BA 4KOTA 4H89A 3R9FA 3F8KA 4HKFA 3SXNA 3P2FA 5F48A 4KLWA 1Y9WA 2F5IA 2ZXVA 2G0BA 5AG4A 2YNDA 4AVAA 4OLLA 1N71A 4MFJA 4HNWB 1Z9UA 1YREA 1M4GA 2D4OA 1QSTA 5AGEA 2PR1A 4RI1A 5G1ZA 1S3ZA 1KUXA 1XMTA 1S5KA 2EVNA 4KORA 4UWJA 3R1KA 4JD6A 3TT2A 3RYOA 3ZZIA 2Z11A 4XNHB 3G8WA 4MFPA 1I21A 3TO9A 1ZO0A 4KS9A 3GY9A 1QSOA 1UFHA 4NF1A 2OZUA 1BOBA 4KOSA 5IB0A 1P4NA 2J8NA 5GCNA 2YGWA 4C7IA 3EO4A 3TCVA 3MGDA 4NXYA 4R87A 2QMLA 4KOXA 4KSFA 2R8VA 4U9YA 3EFAA 5AG7A 2DPTA 3LD2A 4UCPA 4UFWA 3UY5A 3C26A 2JDDA 2G3TA 2O28A 2VZZA 1Q2YA 4R3KA 4ONUA 1XIXA 2FS5A 5KTDA 3CXQA 2P0WA 4IUSA 3NE7A 2I79A 5F46A 4FD7A 2VQYA 4CYNA 2AE6A 2PDOA 3E0KA 4OAEA 1YLEA 3FYNA 1NMTA 4PSWA 4A95A 4II9A 3JUWA 2GIVA 5JQ4A 4Y49C 5G22A 1VHSA 1RO5A 1I1DA 3F0AA 2OH1A 1QSMA 2QECA 3V8IA 1RXTA 1WWZA 2BSWA 4MFZA 3T9YA 2B5GB 4CRYB 2KCWA 5H84A 4PK2A 2PR8A 1LRZA 4A32A 3D2PA 2VI7A 2C27A 2Z10A 3TO7A 3S6GA 5AG6A 3DDDA 2OU2A 4R57A 1M1DA 3S6FA 2ZW6A 2I00A 3LODA 2VEZA 1R57A 3CXSA 4YFJA 2B4DB 1CM0A 2Z3NA 4KSAA 4KLVA 5DWNA 5CNPA 2DPSA 5J8FA 2D4PA 4KOYA 2J8MA 4BMHA 2ZPAA 2CXAA 2Z0ZA 4KUBA 1CJWA 5IX3A 1NSLA 4F0XA 4XPDB 2Z3MA 3N7ZA 4MBUA 3TOBA 5I0CA 4C68A 4CYQA 2ARHA 4MFQA 2A4NA 1KUYA 1OZPA 1VKCA 2B3UA 3PZJA 4FD4A 2FIWA 1V0CA 3K9UA 4KOWA 4A30A 4M3SA 1P0HA 1YX0A 4AG9A 2FL4A 3TE4A 3BJ7A 4RS2A 2P6EA 4CAFA 1PUAA 4KVME 5KTCA 2P6FA 1QSRA 4JJXA 2WPWA 1Q2DA 1Y7RA 3PGPA 4MY0A 4B5PB 5C88A 1IYLA 1SQHA 5F49A 1Y9KA 2FCKA 1I12A 2ZW4A 4E0AA 3F5BA 3I3GA 3PP9A 1WK4A 4LX9A 4CS0B 2AJ6A 4CAEA 4CYOA 2VZYA 4B5OA 4E8OA 3W6XA 3QB8A 4BBHA 5ISVA 2B4BA 2JLMA 1KZFA 1IICA 3FB3A 4CGNA 1IIDA 4A2ZA 4JWPA 3I9SA 5DWMA 5J8CA 4CGLA 4U9ZA 1S7KA 4EVYA 3VWEA 4CRZB 1MJ9A 4Q38A 2REEA 4NCZA 1KUVA 2CNSA 1Z4EA 2GANA 3A9LA 4MY3A 4C2YA 5G21A 2WPXA 4FD5A 3R95A 4PSXA 4CAXA 4QB9A 3FRMA 1YVOA 2VBQA 3EC4A 4K30A 1S7FA 2WSAA 3KKWA 1S60A 2Q4VA 4AB7A 4E2AA 4UWIA 4AG7A 4NEXA 1K4JA 2RC4A 1PU9A 2VXKA 4KVOE 2P6GA 4YRHA 4CAWA 4J3GA 3FIXA 2CNMA 4JLYA 3T90A 2WUUA 1B87A 3R96A 2ZW7A 4F0YA 4ORFA 1NE9A 3SXOA 3DSBA 4B14A 2K5TA 2Z3LA 4QC6A 2Q44A 4Y49B 1TIQA 4OADA 5JPHA 4QVTA 4NSQA 3QAHA 5A27A 4I49A 3BLNA 2HV2A 1S7LA 4CGMA 1Q2CA 4LUAA 4Q36A 4CGPA 1ON0A 2YNEA 2Z3OA 2PRBA 2CNTA 2Q7BA 3GKRA 1U6MA 4KOVA 2Q04A 2OB0A 4KUAA 3D3SA 4KVXA 3G3SA 2B3VA 2QIRA 4AVBA 2GE3A 4B12A 1M44A 2H5MA 2EUIA 4CAVA 4MJ8A 4JXQA 2B58A 5KTAA 4M85A 2YNCA 2NMTA 2B5GA 1J4JA 3IU2A 2PQ8A 3TOAA 3TTHA 3SHPA 5EBVA 5IV0A 2REFA 1XF8A 3WR7A 3B8GA 3S6KA 4XNHC 2BUEA 1M4IA 4UCMA 4QBJA 3IWGA 4X5KA 2G3AA 2B4DA 1IYKA 3FNCA 1S7NA 3ZJ0A 2JDCA 4UFXA 2IL4A 2OZHA 5AG5A 4MFKA 3R9EA 1XEBA 4CGOA 2DXQA 4ZBGA 2R7HA 4A33A 4CYPA 4XPLA 4DNCA 2Y0MA 5E96A 1MK4A 5EC4A 4L8AA 4R3LA 1XE4A 3OWCA 4B10A 3FBUA 2Z3KA 2HQYA 4B11A 1Z4RA 1MJAA 3EY5A 3W6SA 3W91A 1YVKA 3IU1A 2BEIA 1YK3A 3TO6A 2CY2A 2ATRA 3GYAA 5FVJA 4HNXB 2FE7A 2Z3PA 5HMNA 4UBRA 2ZW5A 3JTKA 2BL1A 2YNCC 4JXRA 4PV6A 4B5PA 1FY7A 4C7HA 3D8PA 4R9MA 5F47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YGH A;  4QUS A;  4IF5 A;  3DR6 A;  2FSR A;  4YGO A;  5H86 A;  1L0C A;  3DNS A;  3D2M A;  3CXP A;  4KZT A;  1GHE A;  3P2H A;  1B6B A;  2Q4Y A;  3JVN A;  5HH1 A;  5C82 A;  3FXT A;  4F6A A;  4PK3 A;  2J8R A;  4U5Y A;  3S6H A;  4KOU A;  2FXF A;  4XPK A;  3VWD A;  3IGR A;  4H6U A;  2Q0Y A;  1BO4 A;  4MI4 A;  4XPD C;  1YR0 A;  3H4Q A;  2R98 A;  4MHD A;  1QSN A;  2OZG A;  4H6Z A;  2FIA A;  3BJ8 A;  2FT0 A;  1M4D A;  4GS4 A;  4AVC A;  1IB1 E;  4UA3 A;  2PC1 A;  2HUZ A;  2JEV A;  2PSW A;  3DR8 A;  4HNY B;  3EXN A;  1MJB A;  3R9G A;  2R1I A;  3TFY A;  4FD6 A;  4L89 A;  2X7B A;  4KOT A;  4H89 A;  3R9F A;  3F8K A;  4HKF A;  3SXN A;  3P2F A;  5F48 A;  4KLW A;  1Y9W A;  2F5I A;  2ZXV A;  2G0B A;  4AVA A;  4OLL A;  1N71 A;  4HNW B;  1Z9U A;  1YRE A;  1M4G A;  2D4O A;  1QST A;  2PR1 A;  4RI1 A;  1S3Z A;  1KUX A;  1XMT A;  1S5K A;  2EVN A;  4KOR A;  4UWJ A;  3R1K A;  4JD6 A;  3TT2 A;  3RYO A;  3ZZI A;  2Z11 A;  4XNH B;  3G8W A;  1I21 A;  3TO9 A;  3GY9 A;  1QSO A;  1UFH A;  4NF1 A;  2OZU A;  1BOB A;  4KOS A;  5IB0 A;  1P4N A;  2J8N A;  5GCN A;  3EO4 A;  3TCV A;  3MGD A;  4NXY A;  4R87 A;  2QML A;  4KOX A;  2R8V A;  4U9Y A;  3EFA A;  3LD2 A;  3UY5 A;  3C26 A;  2JDD A;  2G3T A;  2O28 A;  2VZZ A;  1Q2Y A;  4R3K A;  4ONU A;  1XIX A;  2FS5 A;  5KTD A;  3CXQ A;  2P0W A;  4IUS A;  3NE7 A;  2I79 A;  5F46 A;  4FD7 A;  2VQY A;  2AE6 A;  2PDO A;  3E0K A;  4OAE A;  1YLE A;  3FYN A;  1NMT A;  4PSW A;  4II9 A;  3JUW A;  2GIV A;  5JQ4 A;  4Y49 C;  1VHS A;  1RO5 A;  1I1D A;  3F0A A;  2OH1 A;  1QSM A;  2QEC A;  3V8I A;  1RXT A;  1WWZ A;  2BSW A;  3T9Y A;  2B5G B;  4CRY B;  2KCW A;  5H84 A;  4PK2 A;  2PR8 A;  1LRZ A;  3D2P A;  2VI7 A;  2C27 A;  2Z10 A;  3TO7 A;  3S6G A;  3DDD A;  2OU2 A;  4R57 A;  1M1D A;  3S6F A;  2ZW6 A;  2I00 A;  3LOD A;  2VEZ A;  1R57 A;  3CXS A;  4YFJ A;  2B4D B;  1CM0 A;  4KLV A;  5DWN A;  5CNP A;  5J8F A;  2D4P A;  4KOY A;  2J8M A;  4BMH A;  2ZPA A;  2Z0Z A;  4KUB A;  1CJW A;  5IX3 A;  1NSL A;  4XPD B;  3N7Z A;  4MBU A;  3TOB A;  5I0C A;  2ARH A;  2A4N A;  1KUY A;  1OZP A;  1VKC A;  2B3U A;  3PZJ A;  4FD4 A;  2FIW A;  1V0C A;  3K9U A;  4KOW A;  4M3S A;  1P0H A;  1YX0 A;  4AG9 A;  2FL4 A;  3TE4 A;  3BJ7 A;  4RS2 A;  2P6E A;  1PUA A;  4KVM E;  5KTC A;  2P6F A;  1QSR A;  4JJX A;  2WPW A;  1Q2D A;  1Y7R A;  3PGP A;  4MY0 A;  4B5P B;  5C88 A;  1IYL A;  1SQH A;  5F49 A;  1Y9K A;  2FCK A;  1I12 A;  2ZW4 A;  4E0A A;  3F5B A;  3I3G A;  3PP9 A;  1WK4 A;  4LX9 A;  4CS0 B;  2AJ6 A;  2VZY A;  4B5O A;  4E8O A;  3W6X A;  3QB8 A;  5ISV A;  2B4B A;  2JLM A;  1KZF A;  1IIC A;  3FB3 A;  1IID A;  4JWP A;  3I9S A;  5DWM A;  5J8C A;  4U9Z A;  1S7K A;  4EVY A;  3VWE A;  4CRZ B;  1MJ9 A;  2REE A;  4NCZ A;  1KUV A;  2CNS A;  1Z4E A;  2GAN A;  4MY3 A;  2WPX A;  4FD5 A;  3R95 A;  4PSX A;  4CAX A;  4QB9 A;  3FRM A;  1YVO A;  2VBQ A;  3EC4 A;  4K30 A;  1S7F A;  3KKW A;  1S60 A;  2Q4V A;  4AB7 A;  4E2A A;  4UWI A;  4AG7 A;  4NEX A;  1K4J A;  2RC4 A;  1PU9 A;  2VXK A;  4KVO E;  2P6G A;  4YRH A;  4CAW A;  4J3G A;  3FIX A;  2CNM A;  4JLY A;  3T90 A;  1B87 A;  3R96 A;  2ZW7 A;  4F0Y A;  4ORF A;  1NE9 A;  3SXO A;  3DSB A;  2K5T A;  4QC6 A;  2Q44 A;  4Y49 B;  1TIQ A;  4OAD A;  5JPH A;  4QVT A;  4NSQ A;  3QAH A;  4I49 A;  3BLN A;  2HV2 A;  1S7L A;  1Q2C A;  4LUA A;  1ON0 A;  2PRB A;  2CNT A;  2Q7B A;  3GKR A;  4KOV A;  1U6M A;  2Q04 A;  2OB0 A;  4KUA A;  3D3S A;  4KVX A;  3G3S A;  2B3V A;  2QIR A;  4AVB A;  2GE3 A;  1M44 A;  2H5M A;  2EUI A;  4CAV A;  4MJ8 A;  4JXQ A;  2B58 A;  5KTA A;  4M85 A;  2NMT A;  2B5G A;  1J4J A;  2PQ8 A;  3TOA A;  3TTH A;  3SHP A;  5EBV A;  5IV0 A;  2REF A;  1XF8 A;  3WR7 A;  3B8G A;  3S6K A;  4XNH C;  2BUE A;  1M4I A;  4QBJ A;  3IWG A;  4X5K A;  2G3A A;  2B4D A;  1IYK A;  3FNC A;  1S7N A;  3ZJ0 A;  2JDC A;  2IL4 A;  2OZH A;  3R9E A;  1XEB A;  2DXQ A;  4ZBG A;  2R7H A;  4XPL A;  4DNC A;  2Y0M A;  5E96 A;  1MK4 A;  5EC4 A;  4L8A A;  4R3L A;  1XE4 A;  3OWC A;  3FBU A;  2HQY A;  1Z4R A;  1MJA A;  3EY5 A;  3W6S A;  3W91 A;  1YVK A;  2BEI A;  1YK3 A;  3TO6 A;  2CY2 A;  2ATR A;  3GYA A;  5FVJ A;  4HNX B;  2FE7 A;  5HMN A;  4UBR A;  2ZW5 A;  2BL1 A;  4JXR A;  4PV6 A;  4B5P A;  1FY7 A;  3D8P A;  4R9M A;  5F47 A; 
#chains in the Genus database with same CATH topology
 1YGH A;  4QUS A;  2I3C A;  4ZY2 A;  1F57 A;  4IF5 A;  3CDX A;  3DR6 A;  2FSR A;  4YGO A;  5H86 A;  2IMO A;  2EBJ A;  2ZEE A;  1L0C A;  3B3T A;  3DNS A;  4ZGY B;  2PRQ A;  3D2M A;  3CXP A;  4UFV A;  4KZT A;  4EWT A;  1GHE A;  2PJC A;  3IWE A;  4UCN A;  2EK9 A;  3P2H A;  1CPS A;  3S9M A;  3FVL A;  4MMO A;  4ZX8 A;  2IJZ A;  1B6B A;  2Q4Y A;  1X12 A;  3JVN A;  4G1P A;  5HH1 A;  3PEI A;  4NJR A;  5C82 A;  3FXT A;  4F6A A;  4B13 A;  4PK3 A;  1DE4 C;  2PJ3 A;  2J8R A;  4U5Y A;  3S6H A;  4A31 A;  4K3N A;  2PVW A;  4KOU A;  2FXF A;  4OC5 A;  4XPK A;  4JYW A;  3VWD A;  5JM6 A;  3IGR A;  2RFH A;  3GUX A;  4H6U A;  2Q0Y A;  1BO4 A;  1XRY A;  4MI4 A;  4XPD C;  4EFD A;  3TC8 A;  2VL1 A;  3KZW A;  1YR0 A;  3H4Q A;  2R98 A;  5A28 A;  4MHD A;  5G20 A;  1QSN A;  2OZG A;  3K2K A;  4H6Z A;  2FIA A;  3H5Z A;  3BJ8 A;  2FT0 A;  3PFO A;  4P44 A;  1AYE A;  2XEG A;  1M4D A;  4GS4 A;  4AVC A;  1IB1 E;  2PJ2 A;  1XMB A;  3NH5 A;  4UA3 A;  5HVF A;  4OKO A;  2PC1 A;  4OID A;  2ZEH A;  2EO8 A;  1XOV A;  2HUZ A;  2JEV A;  2V8V A;  3B3S A;  1ZG9 A;  4C2X A;  2PSW A;  3DR8 A;  4HNY B;  4C2Z A;  3EXN A;  1MJB A;  4MFL A;  3R9G A;  1HEE A;  2PIZ A;  2R1I A;  2POK A;  1Z8W A;  2ZEL A;  3KGQ A;  4FD6 A;  4L89 A;  4OP4 A;  5BWA B;  2X7B A;  1Z8T A;  2PJ0 A;  3HLP A;  4KOT A;  4H89 A;  2ZEP A;  3LMS A;  1XFO A;  3R9F A;  1F2O A;  2OOT A;  3F8K A;  2WYR A;  4HKF A;  3SXN A;  1XBU A;  3N5F A;  3P2F A;  1VHE A;  1Q7L A;  1CX8 A;  4X2T A;  5F48 A;  2QVP A;  4KLW A;  4R76 A;  4HPS A;  4UIA A;  3TFY A;  1Y9W A;  2F5I A;  2ZXV A;  2V8D A;  1CBX A;  1ELL P;  4P10 A;  2AFS A;  3V38 A;  3CPX A;  3NA6 A;  2G0B A;  5HVH A;  2AFO A;  5AG4 A;  3KQZ A;  2YND A;  4AVA A;  4OLL A;  1N71 A;  2ZEO A;  4MFJ A;  4OC1 A;  4HNW B;  1Z9U A;  1YRE A;  2PE3 A;  3IC1 A;  1M4G A;  1Z8X A;  1XJO A;  1IU8 A;  5K8N A;  2D4O A;  1TF8 A;  1QST A;  2ZEM A;  5AGE A;  2PR1 A;  4RI1 A;  5G1Z A;  4FBE A;  1EE3 P;  1KUX A;  1S3Z A;  1S5K A;  1XMT A;  3GB0 A;  2EVN A;  4ZX9 A;  4KOR A;  4UWJ A;  3R1K A;  4JD6 A;  2GFQ A;  3SJG A;  3TT2 A;  3H8F A;  1IY7 A;  4PXE A;  3RYO A;  3ZZI A;  4FAI A;  2Z11 A;  3V8I A;  4MCR A;  4RUH A;  3GLJ A;  4XNH B;  3G8W A;  4MFP A;  1I21 A;  2JBJ A;  4FUU A;  3ISZ A;  1ZO0 A;  3TO9 A;  4ZI6 A;  4KS9 A;  3WT4 A;  3GY9 A;  1JWQ A;  1QSO A;  1UFH A;  1PCA A;  4NF1 A;  2OZU A;  3WC7 A;  4F9V A;  5K8P A;  1BOB A;  4KOS A;  5IB0 A;  1TXR A;  5LRJ A;  1P4N A;  2J8N A;  5GCN A;  3T8W A;  2ODF A;  5EMI A;  2YGW A;  4C7I A;  3EO4 A;  4P4B A;  3B2Y A;  2RB7 A;  3B3W A;  3PB9 X;  3TCV A;  3MGD A;  4NXY A;  4R87 A;  2QML A;  4KOX A;  3D7G A;  1BAV A;  4KSF A;  1X10 A;  2R8V A;  4U9Y A;  3EFA A;  4CPA A;  5K8O A;  1QQ9 A;  5AG7 A;  2DPT A;  4P4J A;  3D67 A;  3LD2 A;  4UCP A;  2ZOG A;  2V8H A;  4UFW A;  3UY5 A;  2C6P A;  4A94 A;  3C26 A;  2Q43 A;  2JDD A;  3SI0 A;  2G3T A;  2O28 A;  2VZZ A;  2XEJ A;  3FMC A;  1Q2Y A;  1Z5R A;  3PB6 X;  4O23 A;  4R3K A;  2ANP A;  3QAY A;  4X8I A;  4ONU A;  1XIX A;  2FS5 A;  5KTD A;  3CXQ A;  3IEH A;  3PBB A;  2P0W A;  4IUS A;  3NE7 A;  2I79 A;  4UEE A;  5F46 A;  3PB8 X;  4FD7 A;  4MHZ A;  4NGM A;  4OC2 A;  2VQY A;  3S9N A;  2QYV A;  4CYN A;  1LFW A;  2V8G A;  1PYT B;  1YME A;  2AE6 A;  4P4I A;  4R8F A;  3TX8 A;  2PDO A;  3E0K A;  4OAE A;  1YLE A;  3FEE A;  1NMT A;  3FYN A;  3LAC A;  4PSW A;  2ZEF A;  3SJF A;  3JUW A;  4A95 A;  4II9 A;  4NGT A;  2GIV A;  5JQ4 A;  2IQ6 A;  2GRE A;  4Y49 C;  1CP7 A;  2ZEG A;  5G22 A;  1VHS A;  1RO5 A;  1I1D A;  3F0A A;  4NGN A;  5JH9 A;  2OH1 A;  2XEI A;  1QSM A;  2CTC A;  2ZED A;  4UIB A;  1YW4 A;  2O4H A;  2PJ7 A;  2QEC A;  1IGB A;  1RXT A;  2Q4Z A;  1CG2 A;  1WWZ A;  2BSW A;  4Q7A A;  2F8H A;  4PXD A;  4MFZ A;  3T9Y A;  1Y0R A;  2B5G B;  4A39 A;  4P45 A;  4CRY B;  2KCW A;  3ISX A;  4P6Y A;  3D7F A;  4PPZ A;  4PK2 A;  5H84 A;  4P4D A;  2PR8 A;  1LRZ A;  2FVG A;  2PJ5 A;  1DTD A;  4A32 A;  2NSM A;  5D29 A;  3D2P A;  2VI7 A;  2C27 A;  2Z10 A;  3TO7 A;  3S6G A;  5AG6 A;  3DDD A;  2OU2 A;  3RO0 A;  4R57 A;  4M6I A;  1M1D A;  4FWU A;  3S6F A;  2ZW6 A;  1M4L A;  4Z65 A;  4MRI A;  2I00 A;  3LOD A;  1FNO A;  2VEZ A;  4ZY1 A;  1R57 A;  2NYQ A;  4KSI A;  3CXS A;  4YFJ A;  3VH9 A;  4DYO A;  2B4D B;  1CM0 A;  2Z3N A;  4KSA A;  3MRU A;  2AFM A;  3HUV A;  4KLV A;  5DWN A;  1Y7E A;  4P4E A;  5CNP A;  5I4M A;  3I1U A;  2DPS A;  3RNZ A;  5J8F A;  2D4P A;  4KOY A;  2J8M A;  4NGQ A;  4H2K A;  4BMH A;  2ZPA A;  5DS0 A;  2CXA A;  2Z0Z A;  4KUB A;  1CJW A;  1YSJ A;  3RZA A;  1NSL A;  5IX3 A;  4F0X A;  3PB7 X;  4OC3 A;  2Z3M A;  4XPD B;  3SJE A;  3N7Z A;  4MBU A;  2BCO A;  2ZEN A;  3TOB A;  3B7I A;  5I0C A;  4C68 A;  4CYQ A;  4OIW A;  4DJL A;  2ARH A;  2EWB A;  4MFQ A;  2A4N A;  4NGP A;  4UF4 A;  3RBU A;  4GXH A;  1KUY A;  4OC4 A;  1OZP A;  1TKJ A;  1VKC A;  4MHY A;  2B3U A;  4F9U A;  4PXC A;  1YW6 A;  2V77 A;  4MCQ A;  1ZG8 A;  3PZJ A;  4FD4 A;  2FIW A;  1V0C A;  1OBR A;  5HXD A;  2PJ1 A;  2PJ4 A;  4IK2 A;  3K9U A;  4KOW A;  4TWE A;  1F2P A;  3PRT A;  2GLJ A;  3DGV A;  4A30 A;  4M3S A;  1P0H A;  5LYF A;  1YX0 A;  8CPA A;  4AG9 A;  2FL4 A;  3TE4 A;  3BJ7 A;  4RS2 A;  2P6E A;  4M6H A;  4CAF A;  1LAN A;  4ZYQ A;  1PUA A;  3PFE A;  4KVM E;  5KTC A;  2P6F A;  2Q7S A;  1QSR A;  4JJX A;  2WPW A;  1Q2D A;  3L2N A;  5CPA A;  4MCS A;  1Y7R A;  2C6G A;  3PGP A;  4MY0 A;  4B5P B;  1JQG A;  1IYL A;  1SQH A;  5C88 A;  5LRK A;  5F49 A;  1LAM A;  1Z2L A;  1Y9K A;  2FCK A;  1I12 A;  2ZW4 A;  5LYD A;  4E0A A;  2HC9 A;  3PBE A;  1VIX A;  3F5B A;  3I3G A;  3IIB A;  1WK4 A;  3PP9 A;  4MXU A;  4LX9 A;  4WWV A;  4CS0 B;  2AJ6 A;  4CAE A;  4CYO A;  2PJ6 A;  1HDQ A;  2VZY A;  4B5O A;  4E8O A;  3W6X A;  3FH4 A;  3QB8 A;  4BBH A;  2Q51 A;  5ISV A;  2B4B A;  2PVV A;  4NGR A;  2JLM A;  1KZF A;  1IIC A;  3FB3 A;  3H8G A;  4CGN A;  2F7V A;  1IID A;  3CT9 A;  4A2Z A;  4JWP A;  3DLJ A;  3WC5 A;  3I9S A;  5DWM A;  5J8C A;  1AMP A;  1HDU A;  1ZLI A;  4CGL A;  3CPA A;  3B3V A;  1RTQ A;  3D68 A;  1S7K A;  4U9Z A;  4EVY A;  3IWW A;  3JRU A;  4X3R A;  2C1C A;  3VWE A;  4MCP A;  1YQE A;  3IJ3 A;  1MJ9 A;  4Q38 A;  4CRZ B;  2DEA A;  2PJB A;  2REE A;  4NCZ A;  4DUK A;  3S9L A;  1KUV A;  1R43 A;  1BLL E;  2CNS A;  1Z4E A;  3VAR A;  4TNU A;  2GAN A;  3A9L A;  4MY3 A;  4C2Y A;  5G21 A;  2WPX A;  4FD5 A;  2PJA A;  3R95 A;  7CPA A;  5IB9 A;  4PSX A;  2PIY A;  4CAX A;  4QB9 A;  3BXM A;  3FRM A;  1YVO A;  2VBQ A;  3EC4 A;  4K30 A;  1S7F A;  3BI0 A;  3D7D A;  3LWU A;  5JGF A;  4W9Y A;  2OR4 A;  4NGS A;  2WSA A;  2CF4 A;  3KKW A;  1S60 A;  1QMU A;  2Q4V A;  4AB7 A;  4E2A A;  4UWI A;  3D4U A;  5D8N A;  4AG7 A;  4NEX A;  1K4J A;  2RC4 A;  4EME A;  1PU9 A;  2VXK A;  4KVO E;  1TKH A;  5K8M A;  3KI9 A;  2P6G A;  4YRH A;  4CAW A;  4M6G A;  2QJ8 A;  3KL9 A;  4J3G A;  3FIX A;  2CNM A;  4JLY A;  3T90 A;  2WUU A;  4ZY0 A;  5THW A;  4GM5 A;  1B87 A;  3R96 A;  2ZW7 A;  4F0Y A;  4ORF A;  1NE9 A;  1ELM P;  3SXO A;  1NSA A;  2ZOF A;  3DSB A;  4B14 A;  1ARL A;  2XEF A;  2K5T A;  2Z3L A;  1VGY A;  3WC6 A;  4QC6 A;  1IOF A;  2Q44 A;  4Y49 B;  1TIQ A;  4JZ0 A;  1VHO A;  4OAD A;  5JPH A;  2G9D A;  3NH8 A;  2AFX A;  4QVT A;  4NSQ A;  2ABZ A;  3QAH A;  5A27 A;  4I49 A;  5J1Q A;  3BLN A;  2HV2 A;  3IO1 A;  1FT7 A;  1S7L A;  3D66 A;  4A37 A;  4CGM A;  1Q2C A;  4LUA A;  4Q36 A;  4CGP A;  1A2Z A;  1CPX A;  1ON0 A;  2YNE A;  2Z3O A;  3BI1 A;  3NFZ A;  5ELY A;  2PRB A;  4BD9 A;  2CNT A;  2Q7B A;  3GKR A;  1U6M A;  1LCP A;  2Q04 A;  4KOV A;  1Y0Y A;  4OME A;  3BHX A;  3KAS A;  1TF9 A;  2JBK A;  4BIN A;  2OB0 A;  4KUA A;  3D3S A;  3K9T A;  4B6Z A;  4UEZ A;  4KVX A;  3FF3 A;  3G3S A;  4MHP A;  3SI1 A;  5LYI A;  2B3V A;  4LQ6 A;  3KHX A;  5HVG A;  2QIR A;  4AVB A;  2GE3 A;  2BO9 A;  3D7H A;  1GYT A;  1M44 A;  3FJU A;  4WJB A;  4B12 A;  2GU2 A;  2H5M A;  4PXB A;  4PQA A;  2EUI A;  4CAV A;  4MJ8 A;  1ARM A;  4JXQ A;  2B58 A;  5KTA A;  1LOK A;  4NFR A;  4A38 A;  4M85 A;  2YNC A;  2NMT A;  3SJX A;  4ONW A;  2B5G A;  1J4J A;  3IU2 A;  4NJQ A;  4IAV A;  4P4F A;  2PQ8 A;  2O53 A;  4UEF A;  3TOA A;  3TTH A;  4F8Z A;  3B35 A;  3SHP A;  2EK8 A;  5EBV A;  5IV0 A;  4LQG A;  4YWY A;  3SI2 A;  2REF A;  1XF8 A;  3CZX A;  3KHZ A;  3B8G A;  3S6K A;  4XNH C;  3WR7 A;  2BUE A;  1M4I A;  4RN7 A;  4UCM A;  5F09 A;  4QBJ A;  3FEC A;  3IWG A;  1BPM A;  3QNV A;  1ZLH A;  4X5K A;  3FED A;  2G3A A;  2B4D A;  2BOA A;  1CP6 A;  3B3C A;  1IYK A;  3FNC A;  2JEW A;  1S7N A;  3ZJ0 A;  2JDC A;  2J9A A;  5LYL A;  4UFX A;  4YU9 A;  2IL4 A;  2OZH A;  3KR5 A;  5AG5 A;  4MFK A;  3R9E A;  1XEB A;  4CGO A;  1BPN A;  2DXQ A;  1IOI A;  4R6T A;  4ZBG A;  2R7H A;  4A33 A;  4CYP A;  3V7Z A;  4XPL A;  2GLF A;  3GIU A;  4DNC A;  5LRG A;  2Y0M A;  5E96 A;  1R3N A;  2DF5 A;  4AXV A;  1MK4 A;  1TKF A;  1AUG A;  2CTB A;  5EC4 A;  4IHM A;  1Z8L A;  4L8A A;  4R3L A;  1XE4 A;  3FX6 A;  3MN8 A;  1ZG7 A;  3OWC A;  4R7M A;  1LAP A;  3WAB A;  4B10 A;  5CBM A;  3FBU A;  2Z3K A;  2HQY A;  4B11 A;  1Z4R A;  2PJ8 A;  4OC0 A;  1MJA A;  3EY5 A;  3W6S A;  3W91 A;  1H8L A;  1YVK A;  3IU1 A;  2BEI A;  3NE8 A;  3RAM A;  1YK3 A;  3TO6 A;  3IFE A;  3H8E A;  2CY2 A;  2ATR A;  2HB6 A;  1YLO A;  3KQX A;  3GYA A;  3NH4 A;  5FVJ A;  4HNX B;  4MHN A;  2FE7 A;  2Z3P A;  5HMN A;  2AFW A;  2AFU A;  2PJ9 A;  4UBR A;  2WZN A;  6CPA A;  2ZW5 A;  3VAT A;  2CIJ A;  2AFZ A;  3JTK A;  2BL1 A;  1UWY A;  2YNC C;  4JXR A;  4PV6 A;  4B5P A;  2PCU A;  3KR4 A;  1FY7 A;  4C7H A;  3D8P A;  4R9M A;  2C6C A;  1KWM A;  5F47 A;  3PB4 X; 
#chains in the Genus database with same CATH homology
 1YGH A;  4QUS A;  4IF5 A;  3DR6 A;  2FSR A;  4YGO A;  5H86 A;  1L0C A;  3DNS A;  4ZGY B;  3D2M A;  3CXP A;  4UFV A;  4KZT A;  1GHE A;  3IWE A;  4UCN A;  3P2H A;  1B6B A;  2Q4Y A;  3JVN A;  5HH1 A;  5C82 A;  3FXT A;  4F6A A;  4B13 A;  4PK3 A;  2J8R A;  4U5Y A;  3S6H A;  4A31 A;  4KOU A;  2FXF A;  4XPK A;  3VWD A;  3IGR A;  4H6U A;  2Q0Y A;  1BO4 A;  4MI4 A;  4XPD C;  1YR0 A;  3H4Q A;  2R98 A;  5A28 A;  4MHD A;  5G20 A;  1QSN A;  2OZG A;  4H6Z A;  2FIA A;  3H5Z A;  3BJ8 A;  2FT0 A;  1M4D A;  4GS4 A;  4AVC A;  1IB1 E;  4UA3 A;  2PC1 A;  2HUZ A;  2JEV A;  4C2X A;  2PSW A;  3DR8 A;  4HNY B;  4C2Z A;  3EXN A;  1MJB A;  4MFL A;  3R9G A;  2R1I A;  5BWA B;  4FD6 A;  4L89 A;  3TFY A;  2X7B A;  4KOT A;  4H89 A;  3R9F A;  3F8K A;  4HKF A;  3SXN A;  3P2F A;  5F48 A;  4KLW A;  1Y9W A;  2F5I A;  2ZXV A;  2G0B A;  5AG4 A;  2YND A;  4AVA A;  4OLL A;  1N71 A;  4MFJ A;  4HNW B;  1Z9U A;  1YRE A;  1M4G A;  2D4O A;  1QST A;  5AGE A;  2PR1 A;  4RI1 A;  5G1Z A;  1S3Z A;  1KUX A;  1XMT A;  1S5K A;  2EVN A;  4KOR A;  4UWJ A;  3R1K A;  4JD6 A;  3TT2 A;  3RYO A;  3ZZI A;  2Z11 A;  4XNH B;  3G8W A;  4MFP A;  1I21 A;  3TO9 A;  1ZO0 A;  4KS9 A;  3GY9 A;  1QSO A;  1UFH A;  4NF1 A;  2OZU A;  1BOB A;  4KOS A;  5IB0 A;  1P4N A;  2J8N A;  5GCN A;  2YGW A;  4C7I A;  3EO4 A;  3TCV A;  3MGD A;  4NXY A;  4R87 A;  2QML A;  4KOX A;  4KSF A;  2R8V A;  4U9Y A;  3EFA A;  5AG7 A;  2DPT A;  3LD2 A;  4UCP A;  4UFW A;  3UY5 A;  3C26 A;  2JDD A;  2G3T A;  2O28 A;  2VZZ A;  1Q2Y A;  4R3K A;  4ONU A;  1XIX A;  2FS5 A;  5KTD A;  3CXQ A;  2P0W A;  4IUS A;  3NE7 A;  2I79 A;  5F46 A;  4FD7 A;  2VQY A;  4CYN A;  2AE6 A;  2PDO A;  3E0K A;  4OAE A;  1YLE A;  3FYN A;  1NMT A;  4PSW A;  4A95 A;  4II9 A;  3JUW A;  2GIV A;  5JQ4 A;  4Y49 C;  5G22 A;  1VHS A;  1RO5 A;  1I1D A;  3F0A A;  2OH1 A;  1QSM A;  2QEC A;  3V8I A;  1RXT A;  1WWZ A;  2BSW A;  4MFZ A;  3T9Y A;  2B5G B;  4CRY B;  2KCW A;  5H84 A;  4PK2 A;  2PR8 A;  1LRZ A;  4A32 A;  3D2P A;  2VI7 A;  2C27 A;  2Z10 A;  3TO7 A;  3S6G A;  5AG6 A;  3DDD A;  2OU2 A;  4R57 A;  1M1D A;  3S6F A;  2ZW6 A;  2I00 A;  3LOD A;  2VEZ A;  1R57 A;  3CXS A;  4YFJ A;  2B4D B;  1CM0 A;  2Z3N A;  4KSA A;  4KLV A;  5DWN A;  5CNP A;  2DPS A;  5J8F A;  2D4P A;  4KOY A;  2J8M A;  4BMH A;  2ZPA A;  2CXA A;  2Z0Z A;  4KUB A;  1CJW A;  5IX3 A;  1NSL A;  4F0X A;  4XPD B;  2Z3M A;  3N7Z A;  4MBU A;  3TOB A;  5I0C A;  4C68 A;  4CYQ A;  2ARH A;  4MFQ A;  2A4N A;  1KUY A;  1OZP A;  1VKC A;  2B3U A;  3PZJ A;  4FD4 A;  2FIW A;  1V0C A;  3K9U A;  4KOW A;  4A30 A;  4M3S A;  1P0H A;  1YX0 A;  4AG9 A;  2FL4 A;  3TE4 A;  3BJ7 A;  4RS2 A;  2P6E A;  4CAF A;  1PUA A;  4KVM E;  5KTC A;  2P6F A;  1QSR A;  4JJX A;  2WPW A;  1Q2D A;  1Y7R A;  3PGP A;  4MY0 A;  4B5P B;  5C88 A;  1IYL A;  1SQH A;  5F49 A;  1Y9K A;  2FCK A;  1I12 A;  2ZW4 A;  4E0A A;  3F5B A;  3I3G A;  3PP9 A;  1WK4 A;  4LX9 A;  4CS0 B;  2AJ6 A;  4CAE A;  4CYO A;  2VZY A;  4B5O A;  4E8O A;  3W6X A;  3QB8 A;  4BBH A;  5ISV A;  2B4B A;  2JLM A;  1KZF A;  1IIC A;  3FB3 A;  4CGN A;  1IID A;  4A2Z A;  4JWP A;  3I9S A;  5DWM A;  5J8C A;  4CGL A;  4U9Z A;  1S7K A;  4EVY A;  3VWE A;  4CRZ B;  1MJ9 A;  4Q38 A;  2REE A;  4NCZ A;  1KUV A;  2CNS A;  1Z4E A;  2GAN A;  3A9L A;  4MY3 A;  4C2Y A;  5G21 A;  2WPX A;  4FD5 A;  3R95 A;  4PSX A;  4CAX A;  4QB9 A;  3FRM A;  1YVO A;  2VBQ A;  3EC4 A;  4K30 A;  1S7F A;  2WSA A;  3KKW A;  1S60 A;  2Q4V A;  4AB7 A;  4E2A A;  4UWI A;  4AG7 A;  4NEX A;  1K4J A;  2RC4 A;  1PU9 A;  2VXK A;  4KVO E;  2P6G A;  4YRH A;  4CAW A;  4J3G A;  3FIX A;  2CNM A;  4JLY A;  3T90 A;  2WUU A;  1B87 A;  3R96 A;  2ZW7 A;  4F0Y A;  4ORF A;  1NE9 A;  3SXO A;  3DSB A;  4B14 A;  2K5T A;  2Z3L A;  4QC6 A;  2Q44 A;  4Y49 B;  1TIQ A;  4OAD A;  5JPH A;  4QVT A;  4NSQ A;  3QAH A;  5A27 A;  4I49 A;  3BLN A;  2HV2 A;  1S7L A;  4CGM A;  1Q2C A;  4LUA A;  4Q36 A;  4CGP A;  1ON0 A;  2YNE A;  2Z3O A;  2PRB A;  2CNT A;  2Q7B A;  3GKR A;  1U6M A;  4KOV A;  2Q04 A;  2OB0 A;  4KUA A;  3D3S A;  4KVX A;  3G3S A;  2B3V A;  2QIR A;  4AVB A;  2GE3 A;  4B12 A;  1M44 A;  2H5M A;  2EUI A;  4CAV A;  4MJ8 A;  4JXQ A;  2B58 A;  5KTA A;  4M85 A;  2YNC A;  2NMT A;  2B5G A;  1J4J A;  3IU2 A;  2PQ8 A;  3TOA A;  3TTH A;  3SHP A;  5EBV A;  5IV0 A;  2REF A;  1XF8 A;  3WR7 A;  3B8G A;  3S6K A;  4XNH C;  2BUE A;  1M4I A;  4UCM A;  4QBJ A;  3IWG A;  4X5K A;  2G3A A;  2B4D A;  1IYK A;  3FNC A;  1S7N A;  3ZJ0 A;  2JDC A;  4UFX A;  2IL4 A;  2OZH A;  5AG5 A;  4MFK A;  3R9E A;  1XEB A;  4CGO A;  2DXQ A;  4ZBG A;  2R7H A;  4A33 A;  4CYP A;  4XPL A;  4DNC A;  2Y0M A;  5E96 A;  1MK4 A;  5EC4 A;  4L8A A;  4R3L A;  1XE4 A;  3OWC A;  4B10 A;  3FBU A;  2Z3K A;  2HQY A;  4B11 A;  1Z4R A;  1MJA A;  3EY5 A;  3W6S A;  3W91 A;  1YVK A;  3IU1 A;  2BEI A;  1YK3 A;  3TO6 A;  2CY2 A;  2ATR A;  3GYA A;  5FVJ A;  4HNX B;  2FE7 A;  2Z3P A;  5HMN A;  4UBR A;  2ZW5 A;  3JTK A;  2BL1 A;  2YNC C;  4JXR A;  4PV6 A;  4B5P A;  1FY7 A;  4C7H A;  3D8P A;  4R9M A;  5F47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...