2Q4VA

Ensemble refinement of the protein crystal structure of thialysine n-acetyltransferase (ssat2) from homo sapiens
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
167
structure length
156
Chain Sequence
SVRIREAKEGDCGDILRLIRELAEFEKLKISEEALRADGFGDNPFYHCLVAEILGPCVVGYGIYYFIYSTWKGRTIYLEDIYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDLYKALGAQDLTEAEGWHFFCFQGEATRKLAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ensemble refinement of protein crystal structures: validation and application.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Diamine acetyltransferase 2
total genus 33
structure length 156
sequence length 167
chains with identical sequence B
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2q4vA00
3NE7A 2QMLA 5IV0A 2X7BA 3D8PA 1Z9UA 4MY3A 3BJ7A 1RXTA 3FXTA 4RI1A 1LRZA 3K9UA 2Z11A 3TFYA 1RO5A 3T9YA 2ARHA 2HV2A 2C27A 5JQ4A 1YX0A 2ZXVA 2PQ8A 5DWMA 3P2HA 4F0YA 3S6HA 5CNPA 1B6BA 2G3AA 1UFHA 4B5OA 1WWZA 3GYAA 2K5TA 4R87A 3D2PA 1SQHA 4U9YA 4M3SA 5GCNA 1S7KA 4GS4A 4NCZA 4ONUA 4E0AA 4B5PA 1QSRA 1I21A 3W6XA 2OB0A 3OWCA 2PR8A 2OZGA 3UY5A 1CM0A 3EY5A 3TCVA 2G3TA 1WK4A 4KLWA 4KVOE 2B4BA 4MI4A 4NEXA 2GE3A 1I12A 1P4NA 2ZW4A 1NSLA 1YREA 2KCWA 2NMTA 4MHDA 4QB9A 3QAHA 5KTDA 4BMHA 4X5KA 4J3GA 2BEIA 3I3GA 3TTHA 4H6ZA 2I00A 1VHSA 1YK3A 2OU2A 1YVOA 2HUZA 4PK3A 4JXRA 2FIWA 2FSRA 4MY0A 4OAEA 1KUYA 3D3SA 3E0KA 3IWGA 4KOYA 3SXNA 4KUAA 1Y9WA 5HH1A 4KOXA 3TOAA 2Q4YA 2WPWA 4RS2A 5KTCA 4PSWA 1PU9A 1QSTA 3FIXA 4ZBGA 2R7HA 3R95A 2FL4A 1XIXA 1ON0A 2VZZA 4CRZB 1YLEA 4L8AA 3FNCA 4QUSA 4QVTA 5IB0A 4AB7A 2QIRA 4PK2A 2VQYA 1U6MA 2ZW6A 1YVKA 3IGRA 1N71A 2FIAA 1KUXA 4YFJA 2Z0ZA 3BJ8A 2P6GA 4U5YA 4MBUA 3B8GA 4UBRA 3VWDA 4Y49C 4NXYA 2ATRA 5F47A 3DNSA 4FD6A 1OZPA 1M44A 1MJBA 3TOBA 5KTAA 2RC4A 4JJXA 1IYLA 4JLYA 4MJ8A 3W6SA 3H4QA 5H86A 2AJ6A 2DXQA 2OZUA 3QB8A 1QSNA 5F49A 3DDDA 1MJAA 1GHEA 4I49A 1Z4RA 4AVAA 2FT0A 4E8OA 2VEZA 4R3LA 4KVME 4R9MA 2ZW5A 3EXNA 2B5GB 4KOWA 4H6UA 5J8CA 2JDDA 3F8KA 3PGPA 2JDCA 4II9A 4Y49B 3GY9A 3R1KA 1Y9KA 2B4DA 5EC4A 2Q0YA 2FCKA 2VZYA 2FS5A 1K4JA 3R9EA 1XF8A 5E96A 2R1IA 2Q7BA 1J4JA 2R8VA 4KUBA 3DR6A 4NSQA 3EC4A 4OADA 1CJWA 4AVCA 1QSOA 3VWEA 1MK4A 2AE6A 3GKRA 3BLNA 3F5BA 2GIVA 4XPLA 1P0HA 2PC1A 1NE9A 3EO4A 3D2MA 3G8WA 3CXSA 3JUWA 1S7FA 4HKFA 3I9SA 3MGDA 4IUSA 4KOTA 4UWJA 3FB3A 3S6GA 1S7LA 4HNYB 3C26A 2B5GA 5FVJA 2Y0MA 5DWNA 4KZTA 1Q2YA 1I1DA 5H84A 4R3KA 3DR8A 1IICA 2B3VA 3V8IA 4PSXA 1VKCA 2FXFA 2VXKA 3LD2A 4KOVA 2P6EA 4F6AA 1IB1E 1M1DA 2D4PA 4XPDB 2EVNA 1S60A 4XNHC 3R96A 2H5MA 2J8NA 5F48A 1IYKA 3TO7A 5C88A 1NMTA 2Q04A 2CNTA 4B5PB 2PSWA 5J8FA 5HMNA 4UA3A 3JVNA 2CNMA 1Q2DA 5C82A 1S7NA 3S6FA 2P0WA 4QBJA 4M85A 2O28A 3CXQA 1XMTA 3DSBA 4YRHA 4JWPA 4FD7A 2B58A 1IIDA 4CRYB 4XPDC 1PUAA 2PR1A 3W91A 4XNHB 4CAWA 1Z4EA 5I0CA 4HNWB 2CNSA 2WPXA 2OH1A 4U9ZA 2REEA 3CXPA 4HNXB 4YGOA 2P6FA 1Y7RA 4LX9A 4ORFA 2J8RA 2JEVA 3N7ZA 1XEBA 2BUEA 2VI7A 1R57A 2I79A 2B3UA 4L89A 4PV6A 2QECA 4KOSA 2D4OA 3FRMA 2Z10A 5JPHA 3PP9A 4KORA 2REFA 1YR0A 3FBUA 2IL4A 4FD5A 5F46A 2VBQA 4CAXA 2FE7A 5ISVA 4R57A 4JD6A 4E2AA 3F0AA 3S6KA 4KOUA 4XPKA 4JXQA 3T90A 1YGHA 3TO9A 2BSWA 1FY7A 1TIQA 2CY2A 2ZW7A 2JLMA 3TE4A 2BL1A 2PDOA 2HQYA 2PRBA 4IF5A 1S3ZA 4CAVA 2A4NA 3TT2A 2GANA 3TO6A 2F5IA 5EBVA 4OLLA 2Q4VA 3FYNA 3R9FA 4H89A 3RYOA 3PZJA 3R9GA 4AG7A 2EUIA 4K30A 2R98A 4DNCA 1Q2CA 3ZJ0A 2G0BA 1L0CA 2ZPAA 3P2FA 1B87A 4EVYA 3ZZIA 4NF1A 1BO4A 2J8MA 1XE4A 4FD4A 5IX3A 1M4GA 1MJ9A 4QC6A 3EFAA 1M4IA 4KVXA 1KZFA 1M4DA 3LODA 1QSMA 1V0CA 4CS0B 1KUVA 2B4DB 3G3SA 4LUAA 2OZHA 1S5KA 4AG9A 3WR7A 3SHPA 3SXOA 2Q44A 4KLVA 4UWIA 1BOBA 4AVBA 3KKWA
chains in the Genus database with same CATH superfamily
1GYTA 3NE7A 2QMLA 5IV0A 2X7BA 3D8PA 1Z9UA 2J9AA 1Z2LA 4MY3A 1RTQA 2PJ1A 3SI1A 2V8DA 3BJ7A 2WSAA 1RXTA 3FXTA 4RI1A 1LRZA 3K9UA 4MMOA 2Z11A 4C2XA 1VHEA 3TFYA 1RO5A 3IEHA 4P6YA 3TC8A 3T9YA 3FEDA 3RAMA 2ARHA 4M6HA 2HV2A 2C27A 4R6TA 1PCAA 5JQ4A 2V8GA 2C6PA 2PJAA 5JGFA 5CPAA 1FNOA 3SJGA 4LQGA 1YX0A 5AG7A 2ZXVA 2PQ8A 2PJ0A 1ZG9A 4HPSA 4NGMA 4MCPA 2FVGA 4LQ6A 5DWMA 1Y0RA 3P2HA 3V38A 4F0YA 3PFOA 5CNPA 3S6HA 1B6BA 1YQEA 2G3AA 1UFHA 3GUXA 4K3NA 2PJ8A 1WWZA 2PJ6A 4B5OA 3GYAA 3KASA 4BD9A 3NE8A 4MHNA 2K5TA 2ZELA 2PCUA 2V77A 4MHZA 4P4EA 4C2YA 1ZG7A 5JH9A 4R87A 4RUHA 1TF9A 2Q4ZA 3D2PA 4MFZA 4YWYA 1CP6A 1YSJA 1SQHA 3VH9A 4W9YA 3B3SA 4U9YA 4A30A 4M3SA 3H5ZA 5GCNA 4MFPA 4FAIA 1S7KA 4GS4A 4NCZA 4ONUA 3V7ZA 4CPAA 4E0AA 4B5PA 4NGTA 3IU1A 4NJRA 4PQAA 2C1CA 1QSRA 5A27A 1YLOA 1I21A 4IHMA 3W6XA 4GM5A 1DE4C 2OB0A 2QYVA 2YNCA 2PR8A 3CT9A 2OZGA 3OWCA 5THWA 4P4DA 1CM0A 3UY5A 3EY5A 3PFEA 5G21A 4Q7AA 2G3TA 1WK4A 3FH4A 4KLWA 4KVOE 3TCVA 2AFSA 2B4BA 3KZWA 5I4MA 1IOFA 2CIJA 4A39A 4MI4A 2Q51A 4DUKA 4B11A 1X10A 1IU8A 4NEXA 4ZY2A 2GE3A 1I12A 1P4NA 2ZW4A 1NSLA 1YW4A 1F2PA 2JBKA 1YREA 2KCWA 3RNZA 4CAEA 2NMTA 4MHDA 1KWMA 3IO1A 4QB9A 3FECA 3QAHA 4PXBA 4B6ZA 5KTDA 3LMSA 3S9MA 4C2ZA 4BMHA 4X5KA 4J3GA 4A31A 2BEIA 2GFQA 3I3GA 1XBUA 4MFJA 4M6GA 4MXUA 3D66A 1QMUA 3TTHA 4H6ZA 1ZLHA 2I00A 2GREA 1VHSA 1YK3A 4ZI6A 2OU2A 3WC5A 2AFOA 4NJQA 1ZG8A 1UWYA 4YU9A 1YVOA 4NGRA 5K8OA 3B3TA 2HUZA 3IIBA 4F8ZA 2HC9A 4PK3A 4C7HA 4JXRA 5EMIA 4P4BA 2XEGA 2FIWA 2FSRA 4A37A 2JBJA 2ZEMA 4MY0A 4OAEA 1KUYA 3D3SA 3E0KA 3IWGA 4KOYA 4KSAA 3SJFA 3FJUA 4KUAA 1Y9WA 2ZOGA 3KKWA 5HH1A 3SXNA 4KOXA 1HDUA 3TOAA 4FBEA 3WC6A 1M4LA 2DEAA 2Q4YA 2WPWA 4RS2A 4UCMA 2CF4A 2ZEDA 5KTCA 3IWWA 4PSWA 5D8NA 5ELYA 1PU9A 1QSTA 3FIXA 4ZBGA 2R7HA 2ZENA 3R95A 2Z3NA 2FL4A 1LAMA 2OR4A 1ZLIA 1XIXA 2QVPA 1ON0A 2VZZA 4X8IA 4CRZB 1JWQA 2YGWA 1YLEA 4X3RA 5A28A 4L8AA 5LYIA 3KR4A 3FNCA 4CGPA 4DJLA 1H8LA 3PB4X 4NFRA 4QUSA 4QVTA 5J1QA 5IB0A 3B3WA 4AB7A 2QIRA 4PK2A 1CX8A 2VQYA 2V8VA 1U6MA 1F2OA 2ZW6A 1YVKA 4UCNA 3IGRA 1N71A 3NH8A 4A38A 4TNUA 2PE3A 2FIAA 1KUXA 4YFJA 2Z0ZA 3BJ8A 2P6GA 2C6GA 2C6CA 3PEIA 4U5YA 4MBUA 7CPAA 3B8GA 4PXDA 5LYDA 4UBRA 4UEFA 3VWDA 4Y49C 5LYLA 1AUGA 1TKFA 4NXYA 2ATRA 5F47A 1CPSA 3DNSA 4FD6A 1OZPA 1M44A 1MJBA 4EMEA 3CZXA 3TOBA 5KTAA 2RC4A 3BI0A 4JJXA 1IYLA 4JLYA 4M6IA 4MJ8A 3H4QA 5H86A 3W6SA 3IWEA 2AJ6A 2ZEGA 4CGOA 2DXQA 2OZUA 3QB8A 1QSNA 5F49A 1HDQA 3DDDA 1MJAA 1VIXA 1ZO0A 4OIWA 1GHEA 2RB7A 4MCRA 4UFXA 5HVGA 4I49A 2IMOA 1Z4RA 2GLFA 4AVAA 2FT0A 4E8OA 2VEZA 4R3LA 4ZX8A 3SJEA 4KVME 4R9MA 2ZW5A 3EXNA 4NGNA 1IGBA 3B35A 4OC3A 2B5GB 8CPAA 1VHOA 4KOWA 2DPTA 4H6UA 4C7IA 5J8CA 3QNVA 3PB9X 2JDDA 3F8KA 4OKOA 4A32A 3PGPA 2JDCA 4II9A 4Y49B 3GY9A 1PYTB 2NSMA 3MRUA 3PB7X 2YNEA 3SI2A 3R1KA 1Y9KA 5BWAB 2B4DA 4KS9A 3RZAA 4B14A 4P44A 5EC4A 2Q0YA 4NGSA 2FCKA 2VZYA 4OIDA 1TKJA 2FS5A 2PRQA 2ZOFA 4UEEA 1K4JA 3R9EA 1XF8A 5E96A 2PJCA 2EK9A 4CYPA 2R1IA 2OOTA 4MFQA 3H8FA 3JRUA 4UEZA 2Q7BA 4OMEA 4CYOA 1J4JA 3D67A 4GXHA 2ANPA 2R8VA 2G9DA 3DR6A 3H8EA 2F8HA 4IK2A 3EC4A 4KUBA 4NSQA 4X2TA 4OADA 3QAYA 3GB0A 1CJWA 4AVCA 1QSOA 3WT4A 2Z3KA 3VARA 3VWEA 1MK4A 2AE6A 3GKRA 5LRGA 3BLNA 3F5BA 2GIVA 1DTDA 2Q7SA 4XPLA 1P0HA 4OP4A 2PC1A 3RBUA 4UFVA 1NE9A 3EO4A 3D2MA 1R3NA 3G8WA 5G1ZA 1IOIA 2AFMA 3CXSA 3JUWA 3PBBA 1S7FA 4R8FA 4P4IA 5D29A 4OC0A 2AFZA 4HKFA 3I9SA 1AMPA 2BOAA 1Y7EA 3K9TA 3MGDA 5G22A 4IUSA 4KOTA 4UWJA 3FB3A 1A2ZA 1S7LA 3S6GA 1Y0YA 3FMCA 2XEJA 4HNYB 5HXDA 1Z8TA 3C26A 4CYNA 1YMEA 2B5GA 2PVWA 5FVJA 3IU2A 2Y0MA 5DWNA 4KZTA 3T8WA 5AG4A 1Q2YA 1I1DA 3ISZA 3KHXA 2XEFA 2ZEOA 2Z3OA 1BAVA 3B7IA 2QJ8A 5H84A 4R3KA 3HLPA 3DR8A 3KL9A 1IICA 2B3VA 1QQ9A 2EO8A 3SI0A 4PSXA 3V8IA 1VKCA 2IQ6A 3KI9A 4JYWA 2FXFA 2VXKA 1F57A 4OC1A 4PPZA 3NH4A 1VGYA 2PIYA 3KGQA 1TF8A 3LD2A 3PB6X 1XOVA 4KOVA 1Z8WA 3D7GA 3BI1A 2F7VA 2P6EA 2Z3PA 1IB1E 1M1DA 1TKHA 4F6AA 2O53A 3B3CA 4BINA 4CYQA 2D4PA 4XPDB 2EVNA 5AGEA 1S60A 3PB8X 3KHZA 4XNHC 4ONWA 4EFDA 3R96A 2H5MA 1R43A 4MFLA 4UFWA 3BXMA 3WABA 2J8NA 5F48A 1IYKA 2ZEFA 3TO7A 2POKA 5C88A 3SJXA 1NMTA 2YNDA 3A9LA 2Q04A 4OC2A 4ZGYB 4ZY1A 2CNTA 1NSAA 3CPAA 4B5PB 3N5FA 2PSWA 5J8FA 5K8PA 3GIUA 5HMNA 5IB9A 3I1UA 3NH5A 2YNCC 4UA3A 3JVNA 1Z8XA 2CNMA 1Q2DA 1X12A 5LRJA 5C82A 2HB6A 1Q7LA 4Z65A 1S7NA 3S6FA 3FEEA 3IC1A 4Q36A 2CXAA 2P0WA 4QBJA 2O28A 3CXQA 3DSBA 1XMTA 2CTCA 2PJ4A 4M85A 4YRHA 4UCPA 3LWUA 4JWPA 4FD7A 4DYOA 1XMBA 2B58A 1IIDA 4CRYB 5LYFA 4XPDC 4OC5A 1PUAA 2PR1A 4IAVA 3W91A 3KR5A 4XNHB 4CAWA 4A2ZA 1Z4EA 2V8HA 5I0CA 4P45A 4HNWB 2CNSA 4ZX9A 2WPXA 2OH1A 4U9ZA 2REEA 3JTKA 3CXPA 4HNXB 4YGOA 2P6FA 4A95A 1Y7RA 4LX9A 4P4FA 2AFXA 4ORFA 3HUVA 4CAFA 2J8RA 2JEVA 4CGNA 3N7ZA 4UIAA 1ELMP 1XEBA 2BUEA 4AXVA 2VI7A 5G20A 2AFWA 3WC7A 1ARLA 3FVLA 1R57A 4MRIA 4MFKA 2I79A 5F09A 2B3UA 4L89A 4PV6A 4ZY0A 3FX6A 5DS0A 4NGQA 2PJ3A 1LCPA 2QECA 4KOSA 2D4OA 4PXCA 1CP7A 4R7MA 3FRMA 2Z10A 5JPHA 3D7FA 1FT7A 4A94A 3PP9A 2PJ7A 3KQXA 1CBXA 4KORA 2ZEEA 4FWUA 2REFA 1YR0A 4MCQA 3PRTA 4P4JA 4F9VA 1IY7A 3FBUA 4FUUA 2IL4A 4FD5A 4EWTA 5F46A 2VBQA 4CAXA 3FF3A 2FE7A 1BPNA 4UF4A 5ISVA 2PJ9A 4R57A 4JD6A 2O4HA 4MHPA 4E2AA 2BO9A 2Z3LA 3F0AA 5AG5A 3S6KA 5K8MA 4KOUA 4XPKA 4MCSA 3ISXA 4JXQA 1BPMA 3T90A 1YGHA 4RN7A 2CTBA 5K8NA 3H8GA 3TO9A 4BBHA 2BSWA 1FY7A 4H2KA 4UIBA 3CDXA 1TIQA 2CY2A 2ZW7A 2JLMA 3TE4A 2BL1A 2NYQA 6CPAA 2PDOA 2HQYA 1XJOA 2PRBA 4B12A 1LANA 4IF5A 1S3ZA 4B13A 2VL1A 4TWEA 4G1PA 2WZNA 1XFOA 4O23A 4OC4A 2A4NA 3DLJA 4CAVA 3D7DA 3TT2A 2GANA 3TO6A 2PIZA 2F5IA 3CPXA 5EBVA 5JM6A 4OLLA 4F0XA 1LFWA 3MN8A 3B3VA 3IFEA 2PJ2A 2DF5A 3S9LA 2EK8A 3RO0A 3PBEA 2Q4VA 2PJBA 3FYNA 2Z3MA 2ABZA 3R9FA 2AFUA 3GLJA 1Z5RA 4JZ0A 4H89A 3RYOA 3NFZA 3PZJA 3VATA 4ZYQA 1YW6A 3R9GA 4AG7A 2EUIA 4K30A 2BCOA 4Q38A 4PXEA 2R98A 4DNCA 2IJZA 1Z8LA 3LACA 3TX8A 1Q2CA 1LAPA 3IJ3A 3ZJ0A 1ARMA 2WUUA 4KSIA 2PJ5A 2G0BA 1L0CA 3BHXA 3D68A 2JEWA 2ZPAA 3B2YA 5HVFA 3P2FA 1B87A 4EVYA 2GU2A 4CGMA 1AYEA 3ZZIA 2XEIA 3DGVA 3L2NA 4NF1A 1BO4A 2J8MA 3D4UA 1ELLP 1XE4A 2ODFA 3KQZA 1HEEA 4A33A 4F9UA 5CBMA 4CGLA 4NGPA 4FD4A 4P10A 1TXRA 4C68A 5IX3A 1M4GA 3NA6A 1MJ9A 4QC6A 4WWVA 3EFAA 1M4IA 4KVXA 1BLLE 2EBJA 2Q43A 1KZFA 2RFHA 1M4DA 2WYRA 2ZEHA 3LODA 1OBRA 4R76A 3S9NA 1EE3P 1QSMA 1V0CA 4KSFA 1KUVA 4CS0B 2B4DB 3G3SA 4LUAA 5AG6A 2I3CA 2GLJA 2OZHA 1XRYA 5LRKA 1S5KA 4AG9A 4MHYA 5HVHA 3WR7A 3K2KA 2ZEPA 3SHPA 3SXOA 2DPSA 2Q44A 1CG2A 4B10A 3D7HA 1LOKA 1JQGA 4KLVA 4UWIA 1BOBA 4AVBA 1CPXA 4WJBA 2PVVA 2EWBA
chains in the Genus database with same CATH topology
3NE7A 2QMLA 5IV0A 2X7BA 3D8PA 1Z9UA 4MY3A 3BJ7A 2WSAA 1RXTA 3FXTA 4RI1A 1LRZA 3K9UA 2Z11A 4C2XA 3TFYA 1RO5A 3T9YA 2ARHA 2HV2A 2C27A 5JQ4A 5AG7A 1YX0A 2ZXVA 2PQ8A 5DWMA 3P2HA 4F0YA 3S6HA 5CNPA 1B6BA 2G3AA 1UFHA 4B5OA 1WWZA 3GYAA 4C2YA 2K5TA 4R87A 3D2PA 4MFZA 1SQHA 4U9YA 4A30A 4M3SA 3H5ZA 5GCNA 4MFPA 1S7KA 4GS4A 4NCZA 4ONUA 4E0AA 4B5PA 3IU1A 1QSRA 5A27A 1I21A 3W6XA 2OB0A 2YNCA 3OWCA 2PR8A 2OZGA 3UY5A 1CM0A 3EY5A 5G21A 3TCVA 2G3TA 1WK4A 4KLWA 4KVOE 2B4BA 4MI4A 4B11A 4NEXA 2GE3A 1I12A 1P4NA 2ZW4A 1NSLA 1YREA 2KCWA 4CAEA 2NMTA 4MHDA 4QB9A 3QAHA 5KTDA 4C2ZA 4BMHA 4X5KA 4J3GA 4A31A 2BEIA 3I3GA 4MFJA 3TTHA 4H6ZA 2I00A 1VHSA 1YK3A 2OU2A 1YVOA 2HUZA 4PK3A 4C7HA 4JXRA 2FIWA 2FSRA 4MY0A 4OAEA 1KUYA 3D3SA 3E0KA 3IWGA 4KOYA 4KSAA 3SXNA 4KUAA 1Y9WA 5HH1A 4KOXA 3TOAA 2Q4YA 2WPWA 4RS2A 4UCMA 5KTCA 4PSWA 1PU9A 1QSTA 3FIXA 4ZBGA 2R7HA 3R95A 2Z3NA 2FL4A 1XIXA 1ON0A 2VZZA 4CRZB 5A28A 2YGWA 1YLEA 4L8AA 3FNCA 4CGPA 4QUSA 4QVTA 5IB0A 4AB7A 2QIRA 4PK2A 2VQYA 1U6MA 4UCNA 2ZW6A 1YVKA 3IGRA 1N71A 2FIAA 1KUXA 4YFJA 2Z0ZA 3BJ8A 2P6GA 4U5YA 4MBUA 3B8GA 4UBRA 3VWDA 4Y49C 4NXYA 2ATRA 5F47A 3DNSA 4FD6A 1OZPA 1M44A 1MJBA 3TOBA 5KTAA 2RC4A 4JJXA 1IYLA 4JLYA 4MJ8A 3W6SA 3H4QA 5H86A 4CGOA 3IWEA 2AJ6A 2DXQA 2OZUA 3QB8A 1QSNA 5F49A 3DDDA 1MJAA 1ZO0A 1GHEA 4UFXA 4I49A 1Z4RA 4AVAA 2FT0A 4E8OA 2VEZA 4R3LA 4KVME 4R9MA 2ZW5A 3EXNA 2B5GB 4KOWA 4C7IA 2DPTA 4H6UA 5J8CA 2JDDA 3F8KA 4A32A 3PGPA 2JDCA 4II9A 4Y49B 3GY9A 2YNEA 5BWAB 3R1KA 1Y9KA 2B4DA 4KS9A 4B14A 5EC4A 2Q0YA 2FCKA 2VZYA 2FS5A 1K4JA 3R9EA 1XF8A 5E96A 4CYPA 2R1IA 4MFQA 2Q7BA 4CYOA 1J4JA 2R8VA 4KUBA 3DR6A 4NSQA 3EC4A 4OADA 1CJWA 4AVCA 1QSOA 2Z3KA 3VWEA 1MK4A 2AE6A 3GKRA 3BLNA 3F5BA 2GIVA 4XPLA 1P0HA 2PC1A 4UFVA 1NE9A 3EO4A 3D2MA 3G8WA 5G1ZA 3CXSA 3JUWA 1S7FA 4HKFA 3I9SA 3MGDA 5G22A 4IUSA 4KOTA 4UWJA 3FB3A 3S6GA 1S7LA 4HNYB 3C26A 4CYNA 2B5GA 5FVJA 3IU2A 2Y0MA 5DWNA 4KZTA 5AG4A 1Q2YA 1I1DA 2Z3OA 5H84A 4R3KA 3DR8A 1IICA 2B3VA 3V8IA 4PSXA 1VKCA 2FXFA 2VXKA 3LD2A 4KOVA 2P6EA 2Z3PA 1IB1E 1M1DA 4F6AA 4CYQA 2D4PA 4XPDB 2EVNA 5AGEA 1S60A 4XNHC 3R96A 2H5MA 4MFLA 4UFWA 2J8NA 5F48A 1IYKA 3TO7A 5C88A 1NMTA 2YNDA 3A9LA 2Q04A 4ZGYB 2CNTA 4B5PB 2PSWA 5J8FA 5HMNA 2YNCC 4UA3A 3JVNA 2CNMA 1Q2DA 5C82A 1S7NA 3S6FA 4Q36A 2CXAA 2P0WA 4QBJA 4M85A 2O28A 3CXQA 1XMTA 3DSBA 4YRHA 4UCPA 4JWPA 4FD7A 2B58A 1IIDA 4CRYB 4XPDC 1PUAA 2PR1A 3W91A 4XNHB 4CAWA 4A2ZA 1Z4EA 5I0CA 4HNWB 2CNSA 2WPXA 2OH1A 4U9ZA 2REEA 3JTKA 3CXPA 4HNXB 4YGOA 2P6FA 4A95A 1Y7RA 4LX9A 4ORFA 4CAFA 2J8RA 2JEVA 4CGNA 3N7ZA 1XEBA 2BUEA 2VI7A 5G20A 1R57A 4MFKA 2I79A 2B3UA 4L89A 4PV6A 2QECA 4KOSA 2D4OA 3FRMA 2Z10A 5JPHA 3PP9A 4KORA 2REFA 1YR0A 3FBUA 2IL4A 4FD5A 5F46A 2VBQA 4CAXA 2FE7A 5ISVA 4R57A 4JD6A 4E2AA 2Z3LA 3F0AA 5AG5A 3S6KA 4KOUA 4XPKA 4JXQA 3T90A 1YGHA 3TO9A 4BBHA 2BSWA 1FY7A 1TIQA 2CY2A 2ZW7A 2JLMA 3TE4A 2BL1A 2PDOA 2HQYA 2PRBA 4B12A 4B13A 4IF5A 1S3ZA 4CAVA 2A4NA 3TT2A 2GANA 3TO6A 2F5IA 5EBVA 4OLLA 4F0XA 2Q4VA 3FYNA 2Z3MA 3R9FA 4H89A 3RYOA 3PZJA 3R9GA 4AG7A 2EUIA 4K30A 4Q38A 2R98A 4DNCA 1Q2CA 3ZJ0A 2WUUA 2G0BA 1L0CA 2ZPAA 3P2FA 1B87A 4EVYA 4CGMA 3ZZIA 4NF1A 1BO4A 2J8MA 1XE4A 4A33A 4CGLA 4FD4A 4C68A 5IX3A 1M4GA 1MJ9A 4QC6A 3EFAA 1M4IA 4KVXA 1KZFA 1M4DA 3LODA 1QSMA 1V0CA 4KSFA 4CS0B 1KUVA 2B4DB 3G3SA 4LUAA 5AG6A 2OZHA 1S5KA 4AG9A 3WR7A 3SHPA 3SXOA 2DPSA 2Q44A 4B10A 4KLVA 4UWIA 1BOBA 4AVBA 3KKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NE7 A;  2QML A;  5IV0 A;  2X7B A;  3D8P A;  1Z9U A;  4MY3 A;  3BJ7 A;  1RXT A;  3FXT A;  4RI1 A;  1LRZ A;  3K9U A;  2Z11 A;  3TFY A;  1RO5 A;  3T9Y A;  2ARH A;  2HV2 A;  2C27 A;  5JQ4 A;  1YX0 A;  2ZXV A;  2PQ8 A;  5DWM A;  3P2H A;  4F0Y A;  3S6H A;  5CNP A;  1B6B A;  2G3A A;  1UFH A;  4B5O A;  1WWZ A;  3GYA A;  2K5T A;  4R87 A;  3D2P A;  1SQH A;  4U9Y A;  4M3S A;  5GCN A;  1S7K A;  4GS4 A;  4NCZ A;  4ONU A;  4E0A A;  4B5P A;  1QSR A;  1I21 A;  3W6X A;  2OB0 A;  3OWC A;  2PR8 A;  2OZG A;  3UY5 A;  1CM0 A;  3EY5 A;  3TCV A;  2G3T A;  1WK4 A;  4KLW A;  4KVO E;  2B4B A;  4MI4 A;  4NEX A;  2GE3 A;  1I12 A;  1P4N A;  2ZW4 A;  1NSL A;  1YRE A;  2KCW A;  2NMT A;  4MHD A;  4QB9 A;  3QAH A;  5KTD A;  4BMH A;  4X5K A;  4J3G A;  2BEI A;  3I3G A;  3TTH A;  4H6Z A;  2I00 A;  1VHS A;  1YK3 A;  2OU2 A;  1YVO A;  2HUZ A;  4PK3 A;  4JXR A;  2FIW A;  2FSR A;  4MY0 A;  4OAE A;  1KUY A;  3D3S A;  3E0K A;  3IWG A;  4KOY A;  3SXN A;  4KUA A;  1Y9W A;  5HH1 A;  4KOX A;  3TOA A;  2Q4Y A;  2WPW A;  4RS2 A;  5KTC A;  4PSW A;  1PU9 A;  1QST A;  3FIX A;  4ZBG A;  2R7H A;  3R95 A;  2FL4 A;  1XIX A;  1ON0 A;  2VZZ A;  4CRZ B;  1YLE A;  4L8A A;  3FNC A;  4QUS A;  4QVT A;  5IB0 A;  4AB7 A;  2QIR A;  4PK2 A;  2VQY A;  1U6M A;  2ZW6 A;  1YVK A;  3IGR A;  1N71 A;  2FIA A;  1KUX A;  4YFJ A;  2Z0Z A;  3BJ8 A;  2P6G A;  4U5Y A;  4MBU A;  3B8G A;  4UBR A;  3VWD A;  4Y49 C;  4NXY A;  2ATR A;  5F47 A;  3DNS A;  4FD6 A;  1OZP A;  1M44 A;  1MJB A;  3TOB A;  5KTA A;  2RC4 A;  4JJX A;  1IYL A;  4JLY A;  4MJ8 A;  3W6S A;  3H4Q A;  5H86 A;  2AJ6 A;  2DXQ A;  2OZU A;  3QB8 A;  1QSN A;  5F49 A;  3DDD A;  1MJA A;  1GHE A;  4I49 A;  1Z4R A;  4AVA A;  2FT0 A;  4E8O A;  2VEZ A;  4R3L A;  4KVM E;  4R9M A;  2ZW5 A;  3EXN A;  2B5G B;  4KOW A;  4H6U A;  5J8C A;  2JDD A;  3F8K A;  3PGP A;  2JDC A;  4II9 A;  4Y49 B;  3GY9 A;  3R1K A;  1Y9K A;  2B4D A;  5EC4 A;  2Q0Y A;  2FCK A;  2VZY A;  2FS5 A;  1K4J A;  3R9E A;  1XF8 A;  5E96 A;  2R1I A;  2Q7B A;  1J4J A;  2R8V A;  4KUB A;  3DR6 A;  4NSQ A;  3EC4 A;  4OAD A;  1CJW A;  4AVC A;  1QSO A;  3VWE A;  1MK4 A;  2AE6 A;  3GKR A;  3BLN A;  3F5B A;  2GIV A;  4XPL A;  1P0H A;  2PC1 A;  1NE9 A;  3EO4 A;  3D2M A;  3G8W A;  3CXS A;  3JUW A;  1S7F A;  4HKF A;  3I9S A;  3MGD A;  4IUS A;  4KOT A;  4UWJ A;  3FB3 A;  3S6G A;  1S7L A;  4HNY B;  3C26 A;  2B5G A;  5FVJ A;  2Y0M A;  5DWN A;  4KZT A;  1Q2Y A;  1I1D A;  5H84 A;  4R3K A;  3DR8 A;  1IIC A;  2B3V A;  3V8I A;  4PSX A;  1VKC A;  2FXF A;  2VXK A;  3LD2 A;  4KOV A;  2P6E A;  4F6A A;  1IB1 E;  1M1D A;  2D4P A;  4XPD B;  2EVN A;  1S60 A;  4XNH C;  3R96 A;  2H5M A;  2J8N A;  5F48 A;  1IYK A;  3TO7 A;  5C88 A;  1NMT A;  2Q04 A;  2CNT A;  4B5P B;  2PSW A;  5J8F A;  5HMN A;  4UA3 A;  3JVN A;  2CNM A;  1Q2D A;  5C82 A;  1S7N A;  3S6F A;  2P0W A;  4QBJ A;  4M85 A;  2O28 A;  3CXQ A;  1XMT A;  3DSB A;  4YRH A;  4JWP A;  4FD7 A;  2B58 A;  1IID A;  4CRY B;  4XPD C;  1PUA A;  2PR1 A;  3W91 A;  4XNH B;  4CAW A;  1Z4E A;  5I0C A;  4HNW B;  2CNS A;  2WPX A;  2OH1 A;  4U9Z A;  2REE A;  3CXP A;  4HNX B;  4YGO A;  2P6F A;  1Y7R A;  4LX9 A;  4ORF A;  2J8R A;  2JEV A;  3N7Z A;  1XEB A;  2BUE A;  2VI7 A;  1R57 A;  2I79 A;  2B3U A;  4L89 A;  4PV6 A;  2QEC A;  4KOS A;  2D4O A;  3FRM A;  2Z10 A;  5JPH A;  3PP9 A;  4KOR A;  2REF A;  1YR0 A;  3FBU A;  2IL4 A;  4FD5 A;  5F46 A;  2VBQ A;  4CAX A;  2FE7 A;  5ISV A;  4R57 A;  4JD6 A;  4E2A A;  3F0A A;  3S6K A;  4KOU A;  4XPK A;  4JXQ A;  3T90 A;  1YGH A;  3TO9 A;  2BSW A;  1FY7 A;  1TIQ A;  2CY2 A;  2ZW7 A;  2JLM A;  3TE4 A;  2BL1 A;  2PDO A;  2HQY A;  2PRB A;  4IF5 A;  1S3Z A;  4CAV A;  2A4N A;  3TT2 A;  2GAN A;  3TO6 A;  2F5I A;  5EBV A;  4OLL A;  2Q4V A;  3FYN A;  3R9F A;  4H89 A;  3RYO A;  3PZJ A;  3R9G A;  4AG7 A;  2EUI A;  4K30 A;  2R98 A;  4DNC A;  1Q2C A;  3ZJ0 A;  2G0B A;  1L0C A;  2ZPA A;  3P2F A;  1B87 A;  4EVY A;  3ZZI A;  4NF1 A;  1BO4 A;  2J8M A;  1XE4 A;  4FD4 A;  5IX3 A;  1M4G A;  1MJ9 A;  4QC6 A;  3EFA A;  1M4I A;  4KVX A;  1KZF A;  1M4D A;  3LOD A;  1QSM A;  1V0C A;  4CS0 B;  1KUV A;  2B4D B;  3G3S A;  4LUA A;  2OZH A;  1S5K A;  4AG9 A;  3WR7 A;  3SHP A;  3SXO A;  2Q44 A;  4KLV A;  4UWI A;  1BOB A;  4AVB A;  3KKW A; 
#chains in the Genus database with same CATH topology
 1GYT A;  3NE7 A;  2QML A;  5IV0 A;  2X7B A;  3D8P A;  1Z9U A;  2J9A A;  1Z2L A;  4MY3 A;  1RTQ A;  2PJ1 A;  3SI1 A;  2V8D A;  3BJ7 A;  2WSA A;  1RXT A;  3FXT A;  4RI1 A;  1LRZ A;  3K9U A;  4MMO A;  2Z11 A;  4C2X A;  1VHE A;  3TFY A;  1RO5 A;  3IEH A;  4P6Y A;  3TC8 A;  3T9Y A;  3FED A;  3RAM A;  2ARH A;  4M6H A;  2HV2 A;  2C27 A;  4R6T A;  1PCA A;  5JQ4 A;  2V8G A;  2C6P A;  2PJA A;  5JGF A;  5CPA A;  1FNO A;  3SJG A;  4LQG A;  1YX0 A;  5AG7 A;  2ZXV A;  2PQ8 A;  2PJ0 A;  1ZG9 A;  4HPS A;  4NGM A;  4MCP A;  2FVG A;  4LQ6 A;  5DWM A;  1Y0R A;  3P2H A;  3V38 A;  4F0Y A;  3PFO A;  5CNP A;  3S6H A;  1B6B A;  1YQE A;  2G3A A;  1UFH A;  3GUX A;  4K3N A;  2PJ8 A;  1WWZ A;  2PJ6 A;  4B5O A;  3GYA A;  3KAS A;  4BD9 A;  3NE8 A;  4MHN A;  2K5T A;  2ZEL A;  2PCU A;  2V77 A;  4MHZ A;  4P4E A;  4C2Y A;  1ZG7 A;  5JH9 A;  4R87 A;  4RUH A;  1TF9 A;  2Q4Z A;  3D2P A;  4MFZ A;  4YWY A;  1CP6 A;  1YSJ A;  1SQH A;  3VH9 A;  4W9Y A;  3B3S A;  4U9Y A;  4A30 A;  4M3S A;  3H5Z A;  5GCN A;  4MFP A;  4FAI A;  1S7K A;  4GS4 A;  4NCZ A;  4ONU A;  3V7Z A;  4CPA A;  4E0A A;  4B5P A;  4NGT A;  3IU1 A;  4NJR A;  4PQA A;  2C1C A;  1QSR A;  5A27 A;  1YLO A;  1I21 A;  4IHM A;  3W6X A;  4GM5 A;  1DE4 C;  2OB0 A;  2QYV A;  2YNC A;  2PR8 A;  3CT9 A;  2OZG A;  3OWC A;  5THW A;  4P4D A;  1CM0 A;  3UY5 A;  3EY5 A;  3PFE A;  5G21 A;  4Q7A A;  2G3T A;  1WK4 A;  3FH4 A;  4KLW A;  4KVO E;  3TCV A;  2AFS A;  2B4B A;  3KZW A;  5I4M A;  1IOF A;  2CIJ A;  4A39 A;  4MI4 A;  2Q51 A;  4DUK A;  4B11 A;  1X10 A;  1IU8 A;  4NEX A;  4ZY2 A;  2GE3 A;  1I12 A;  1P4N A;  2ZW4 A;  1NSL A;  1YW4 A;  1F2P A;  2JBK A;  1YRE A;  2KCW A;  3RNZ A;  4CAE A;  2NMT A;  4MHD A;  1KWM A;  3IO1 A;  4QB9 A;  3FEC A;  3QAH A;  4PXB A;  4B6Z A;  5KTD A;  3LMS A;  3S9M A;  4C2Z A;  4BMH A;  4X5K A;  4J3G A;  4A31 A;  2BEI A;  2GFQ A;  3I3G A;  1XBU A;  4MFJ A;  4M6G A;  4MXU A;  3D66 A;  1QMU A;  3TTH A;  4H6Z A;  1ZLH A;  2I00 A;  2GRE A;  1VHS A;  1YK3 A;  4ZI6 A;  2OU2 A;  3WC5 A;  2AFO A;  4NJQ A;  1ZG8 A;  1UWY A;  4YU9 A;  1YVO A;  4NGR A;  5K8O A;  3B3T A;  2HUZ A;  3IIB A;  4F8Z A;  2HC9 A;  4PK3 A;  4C7H A;  4JXR A;  5EMI A;  4P4B A;  2XEG A;  2FIW A;  2FSR A;  4A37 A;  2JBJ A;  2ZEM A;  4MY0 A;  4OAE A;  1KUY A;  3D3S A;  3E0K A;  3IWG A;  4KOY A;  4KSA A;  3SJF A;  3FJU A;  4KUA A;  1Y9W A;  2ZOG A;  3KKW A;  5HH1 A;  3SXN A;  4KOX A;  1HDU A;  3TOA A;  4FBE A;  3WC6 A;  1M4L A;  2DEA A;  2Q4Y A;  2WPW A;  4RS2 A;  4UCM A;  2CF4 A;  2ZED A;  5KTC A;  3IWW A;  4PSW A;  5D8N A;  5ELY A;  1PU9 A;  1QST A;  3FIX A;  4ZBG A;  2R7H A;  2ZEN A;  3R95 A;  2Z3N A;  2FL4 A;  1LAM A;  2OR4 A;  1ZLI A;  1XIX A;  2QVP A;  1ON0 A;  2VZZ A;  4X8I A;  4CRZ B;  1JWQ A;  2YGW A;  1YLE A;  4X3R A;  5A28 A;  4L8A A;  5LYI A;  3KR4 A;  3FNC A;  4CGP A;  4DJL A;  1H8L A;  3PB4 X;  4NFR A;  4QUS A;  4QVT A;  5J1Q A;  5IB0 A;  3B3W A;  4AB7 A;  2QIR A;  4PK2 A;  1CX8 A;  2VQY A;  2V8V A;  1U6M A;  1F2O A;  2ZW6 A;  1YVK A;  4UCN A;  3IGR A;  1N71 A;  3NH8 A;  4A38 A;  4TNU A;  2PE3 A;  2FIA A;  1KUX A;  4YFJ A;  2Z0Z A;  3BJ8 A;  2P6G A;  2C6G A;  2C6C A;  3PEI A;  4U5Y A;  4MBU A;  7CPA A;  3B8G A;  4PXD A;  5LYD A;  4UBR A;  4UEF A;  3VWD A;  4Y49 C;  5LYL A;  1AUG A;  1TKF A;  4NXY A;  2ATR A;  5F47 A;  1CPS A;  3DNS A;  4FD6 A;  1OZP A;  1M44 A;  1MJB A;  4EME A;  3CZX A;  3TOB A;  5KTA A;  2RC4 A;  3BI0 A;  4JJX A;  1IYL A;  4JLY A;  4M6I A;  4MJ8 A;  3H4Q A;  5H86 A;  3W6S A;  3IWE A;  2AJ6 A;  2ZEG A;  4CGO A;  2DXQ A;  2OZU A;  3QB8 A;  1QSN A;  5F49 A;  1HDQ A;  3DDD A;  1MJA A;  1VIX A;  1ZO0 A;  4OIW A;  1GHE A;  2RB7 A;  4MCR A;  4UFX A;  5HVG A;  4I49 A;  2IMO A;  1Z4R A;  2GLF A;  4AVA A;  2FT0 A;  4E8O A;  2VEZ A;  4R3L A;  4ZX8 A;  3SJE A;  4KVM E;  4R9M A;  2ZW5 A;  3EXN A;  4NGN A;  1IGB A;  3B35 A;  4OC3 A;  2B5G B;  8CPA A;  1VHO A;  4KOW A;  2DPT A;  4H6U A;  4C7I A;  5J8C A;  3QNV A;  3PB9 X;  2JDD A;  3F8K A;  4OKO A;  4A32 A;  3PGP A;  2JDC A;  4II9 A;  4Y49 B;  3GY9 A;  1PYT B;  2NSM A;  3MRU A;  3PB7 X;  2YNE A;  3SI2 A;  3R1K A;  1Y9K A;  5BWA B;  2B4D A;  4KS9 A;  3RZA A;  4B14 A;  4P44 A;  5EC4 A;  2Q0Y A;  4NGS A;  2FCK A;  2VZY A;  4OID A;  1TKJ A;  2FS5 A;  2PRQ A;  2ZOF A;  4UEE A;  1K4J A;  3R9E A;  1XF8 A;  5E96 A;  2PJC A;  2EK9 A;  4CYP A;  2R1I A;  2OOT A;  4MFQ A;  3H8F A;  3JRU A;  4UEZ A;  2Q7B A;  4OME A;  4CYO A;  1J4J A;  3D67 A;  4GXH A;  2ANP A;  2R8V A;  2G9D A;  3DR6 A;  3H8E A;  2F8H A;  4IK2 A;  3EC4 A;  4KUB A;  4NSQ A;  4X2T A;  4OAD A;  3QAY A;  3GB0 A;  1CJW A;  4AVC A;  1QSO A;  3WT4 A;  2Z3K A;  3VAR A;  3VWE A;  1MK4 A;  2AE6 A;  3GKR A;  5LRG A;  3BLN A;  3F5B A;  2GIV A;  1DTD A;  2Q7S A;  4XPL A;  1P0H A;  4OP4 A;  2PC1 A;  3RBU A;  4UFV A;  1NE9 A;  3EO4 A;  3D2M A;  1R3N A;  3G8W A;  5G1Z A;  1IOI A;  2AFM A;  3CXS A;  3JUW A;  3PBB A;  1S7F A;  4R8F A;  4P4I A;  5D29 A;  4OC0 A;  2AFZ A;  4HKF A;  3I9S A;  1AMP A;  2BOA A;  1Y7E A;  3K9T A;  3MGD A;  5G22 A;  4IUS A;  4KOT A;  4UWJ A;  3FB3 A;  1A2Z A;  1S7L A;  3S6G A;  1Y0Y A;  3FMC A;  2XEJ A;  4HNY B;  5HXD A;  1Z8T A;  3C26 A;  4CYN A;  1YME A;  2B5G A;  2PVW A;  5FVJ A;  3IU2 A;  2Y0M A;  5DWN A;  4KZT A;  3T8W A;  5AG4 A;  1Q2Y A;  1I1D A;  3ISZ A;  3KHX A;  2XEF A;  2ZEO A;  2Z3O A;  1BAV A;  3B7I A;  2QJ8 A;  5H84 A;  4R3K A;  3HLP A;  3DR8 A;  3KL9 A;  1IIC A;  2B3V A;  1QQ9 A;  2EO8 A;  3SI0 A;  4PSX A;  3V8I A;  1VKC A;  2IQ6 A;  3KI9 A;  4JYW A;  2FXF A;  2VXK A;  1F57 A;  4OC1 A;  4PPZ A;  3NH4 A;  1VGY A;  2PIY A;  3KGQ A;  1TF8 A;  3LD2 A;  3PB6 X;  1XOV A;  4KOV A;  1Z8W A;  3D7G A;  3BI1 A;  2F7V A;  2P6E A;  2Z3P A;  1IB1 E;  1M1D A;  1TKH A;  4F6A A;  2O53 A;  3B3C A;  4BIN A;  4CYQ A;  2D4P A;  4XPD B;  2EVN A;  5AGE A;  1S60 A;  3PB8 X;  3KHZ A;  4XNH C;  4ONW A;  4EFD A;  3R96 A;  2H5M A;  1R43 A;  4MFL A;  4UFW A;  3BXM A;  3WAB A;  2J8N A;  5F48 A;  1IYK A;  2ZEF A;  3TO7 A;  2POK A;  5C88 A;  3SJX A;  1NMT A;  2YND A;  3A9L A;  2Q04 A;  4OC2 A;  4ZGY B;  4ZY1 A;  2CNT A;  1NSA A;  3CPA A;  4B5P B;  3N5F A;  2PSW A;  5J8F A;  5K8P A;  3GIU A;  5HMN A;  5IB9 A;  3I1U A;  3NH5 A;  2YNC C;  4UA3 A;  3JVN A;  1Z8X A;  2CNM A;  1Q2D A;  1X12 A;  5LRJ A;  5C82 A;  2HB6 A;  1Q7L A;  4Z65 A;  1S7N A;  3S6F A;  3FEE A;  3IC1 A;  4Q36 A;  2CXA A;  2P0W A;  4QBJ A;  2O28 A;  3CXQ A;  3DSB A;  1XMT A;  2CTC A;  2PJ4 A;  4M85 A;  4YRH A;  4UCP A;  3LWU A;  4JWP A;  4FD7 A;  4DYO A;  1XMB A;  2B58 A;  1IID A;  4CRY B;  5LYF A;  4XPD C;  4OC5 A;  1PUA A;  2PR1 A;  4IAV A;  3W91 A;  3KR5 A;  4XNH B;  4CAW A;  4A2Z A;  1Z4E A;  2V8H A;  5I0C A;  4P45 A;  4HNW B;  2CNS A;  4ZX9 A;  2WPX A;  2OH1 A;  4U9Z A;  2REE A;  3JTK A;  3CXP A;  4HNX B;  4YGO A;  2P6F A;  4A95 A;  1Y7R A;  4LX9 A;  4P4F A;  2AFX A;  4ORF A;  3HUV A;  4CAF A;  2J8R A;  2JEV A;  4CGN A;  3N7Z A;  4UIA A;  1ELM P;  1XEB A;  2BUE A;  4AXV A;  2VI7 A;  5G20 A;  2AFW A;  3WC7 A;  1ARL A;  3FVL A;  1R57 A;  4MRI A;  4MFK A;  2I79 A;  5F09 A;  2B3U A;  4L89 A;  4PV6 A;  4ZY0 A;  3FX6 A;  5DS0 A;  4NGQ A;  2PJ3 A;  1LCP A;  2QEC A;  4KOS A;  2D4O A;  4PXC A;  1CP7 A;  4R7M A;  3FRM A;  2Z10 A;  5JPH A;  3D7F A;  1FT7 A;  4A94 A;  3PP9 A;  2PJ7 A;  3KQX A;  1CBX A;  4KOR A;  2ZEE A;  4FWU A;  2REF A;  1YR0 A;  4MCQ A;  3PRT A;  4P4J A;  4F9V A;  1IY7 A;  3FBU A;  4FUU A;  2IL4 A;  4FD5 A;  4EWT A;  5F46 A;  2VBQ A;  4CAX A;  3FF3 A;  2FE7 A;  1BPN A;  4UF4 A;  5ISV A;  2PJ9 A;  4R57 A;  4JD6 A;  2O4H A;  4MHP A;  4E2A A;  2BO9 A;  2Z3L A;  3F0A A;  5AG5 A;  3S6K A;  5K8M A;  4KOU A;  4XPK A;  4MCS A;  3ISX A;  4JXQ A;  1BPM A;  3T90 A;  1YGH A;  4RN7 A;  2CTB A;  5K8N A;  3H8G A;  3TO9 A;  4BBH A;  2BSW A;  1FY7 A;  4H2K A;  4UIB A;  3CDX A;  1TIQ A;  2CY2 A;  2ZW7 A;  2JLM A;  3TE4 A;  2BL1 A;  2NYQ A;  6CPA A;  2PDO A;  2HQY A;  1XJO A;  2PRB A;  4B12 A;  1LAN A;  4IF5 A;  1S3Z A;  4B13 A;  2VL1 A;  4TWE A;  4G1P A;  2WZN A;  1XFO A;  4O23 A;  4OC4 A;  2A4N A;  3DLJ A;  4CAV A;  3D7D A;  3TT2 A;  2GAN A;  3TO6 A;  2PIZ A;  2F5I A;  3CPX A;  5EBV A;  5JM6 A;  4OLL A;  4F0X A;  1LFW A;  3MN8 A;  3B3V A;  3IFE A;  2PJ2 A;  2DF5 A;  3S9L A;  2EK8 A;  3RO0 A;  3PBE A;  2Q4V A;  2PJB A;  3FYN A;  2Z3M A;  2ABZ A;  3R9F A;  2AFU A;  3GLJ A;  1Z5R A;  4JZ0 A;  4H89 A;  3RYO A;  3NFZ A;  3PZJ A;  3VAT A;  4ZYQ A;  1YW6 A;  3R9G A;  4AG7 A;  2EUI A;  4K30 A;  2BCO A;  4Q38 A;  4PXE A;  2R98 A;  4DNC A;  2IJZ A;  1Z8L A;  3LAC A;  3TX8 A;  1Q2C A;  1LAP A;  3IJ3 A;  3ZJ0 A;  1ARM A;  2WUU A;  4KSI A;  2PJ5 A;  2G0B A;  1L0C A;  3BHX A;  3D68 A;  2JEW A;  2ZPA A;  3B2Y A;  5HVF A;  3P2F A;  1B87 A;  4EVY A;  2GU2 A;  4CGM A;  1AYE A;  3ZZI A;  2XEI A;  3DGV A;  3L2N A;  4NF1 A;  1BO4 A;  2J8M A;  3D4U A;  1ELL P;  1XE4 A;  2ODF A;  3KQZ A;  1HEE A;  4A33 A;  4F9U A;  5CBM A;  4CGL A;  4NGP A;  4FD4 A;  4P10 A;  1TXR A;  4C68 A;  5IX3 A;  1M4G A;  3NA6 A;  1MJ9 A;  4QC6 A;  4WWV A;  3EFA A;  1M4I A;  4KVX A;  1BLL E;  2EBJ A;  2Q43 A;  1KZF A;  2RFH A;  1M4D A;  2WYR A;  2ZEH A;  3LOD A;  1OBR A;  4R76 A;  3S9N A;  1EE3 P;  1QSM A;  1V0C A;  4KSF A;  1KUV A;  4CS0 B;  2B4D B;  3G3S A;  4LUA A;  5AG6 A;  2I3C A;  2GLJ A;  2OZH A;  1XRY A;  5LRK A;  1S5K A;  4AG9 A;  4MHY A;  5HVH A;  3WR7 A;  3K2K A;  2ZEP A;  3SHP A;  3SXO A;  2DPS A;  2Q44 A;  1CG2 A;  4B10 A;  3D7H A;  1LOK A;  1JQG A;  4KLV A;  4UWI A;  1BOB A;  4AVB A;  1CPX A;  4WJB A;  2PVV A;  2EWB A; 
#chains in the Genus database with same CATH homology
 3NE7 A;  2QML A;  5IV0 A;  2X7B A;  3D8P A;  1Z9U A;  4MY3 A;  3BJ7 A;  2WSA A;  1RXT A;  3FXT A;  4RI1 A;  1LRZ A;  3K9U A;  2Z11 A;  4C2X A;  3TFY A;  1RO5 A;  3T9Y A;  2ARH A;  2HV2 A;  2C27 A;  5JQ4 A;  5AG7 A;  1YX0 A;  2ZXV A;  2PQ8 A;  5DWM A;  3P2H A;  4F0Y A;  3S6H A;  5CNP A;  1B6B A;  2G3A A;  1UFH A;  4B5O A;  1WWZ A;  3GYA A;  4C2Y A;  2K5T A;  4R87 A;  3D2P A;  4MFZ A;  1SQH A;  4U9Y A;  4A30 A;  4M3S A;  3H5Z A;  5GCN A;  4MFP A;  1S7K A;  4GS4 A;  4NCZ A;  4ONU A;  4E0A A;  4B5P A;  3IU1 A;  1QSR A;  5A27 A;  1I21 A;  3W6X A;  2OB0 A;  2YNC A;  3OWC A;  2PR8 A;  2OZG A;  3UY5 A;  1CM0 A;  3EY5 A;  5G21 A;  3TCV A;  2G3T A;  1WK4 A;  4KLW A;  4KVO E;  2B4B A;  4MI4 A;  4B11 A;  4NEX A;  2GE3 A;  1I12 A;  1P4N A;  2ZW4 A;  1NSL A;  1YRE A;  2KCW A;  4CAE A;  2NMT A;  4MHD A;  4QB9 A;  3QAH A;  5KTD A;  4C2Z A;  4BMH A;  4X5K A;  4J3G A;  4A31 A;  2BEI A;  3I3G A;  4MFJ A;  3TTH A;  4H6Z A;  2I00 A;  1VHS A;  1YK3 A;  2OU2 A;  1YVO A;  2HUZ A;  4PK3 A;  4C7H A;  4JXR A;  2FIW A;  2FSR A;  4MY0 A;  4OAE A;  1KUY A;  3D3S A;  3E0K A;  3IWG A;  4KOY A;  4KSA A;  3SXN A;  4KUA A;  1Y9W A;  5HH1 A;  4KOX A;  3TOA A;  2Q4Y A;  2WPW A;  4RS2 A;  4UCM A;  5KTC A;  4PSW A;  1PU9 A;  1QST A;  3FIX A;  4ZBG A;  2R7H A;  3R95 A;  2Z3N A;  2FL4 A;  1XIX A;  1ON0 A;  2VZZ A;  4CRZ B;  5A28 A;  2YGW A;  1YLE A;  4L8A A;  3FNC A;  4CGP A;  4QUS A;  4QVT A;  5IB0 A;  4AB7 A;  2QIR A;  4PK2 A;  2VQY A;  1U6M A;  4UCN A;  2ZW6 A;  1YVK A;  3IGR A;  1N71 A;  2FIA A;  1KUX A;  4YFJ A;  2Z0Z A;  3BJ8 A;  2P6G A;  4U5Y A;  4MBU A;  3B8G A;  4UBR A;  3VWD A;  4Y49 C;  4NXY A;  2ATR A;  5F47 A;  3DNS A;  4FD6 A;  1OZP A;  1M44 A;  1MJB A;  3TOB A;  5KTA A;  2RC4 A;  4JJX A;  1IYL A;  4JLY A;  4MJ8 A;  3W6S A;  3H4Q A;  5H86 A;  4CGO A;  3IWE A;  2AJ6 A;  2DXQ A;  2OZU A;  3QB8 A;  1QSN A;  5F49 A;  3DDD A;  1MJA A;  1ZO0 A;  1GHE A;  4UFX A;  4I49 A;  1Z4R A;  4AVA A;  2FT0 A;  4E8O A;  2VEZ A;  4R3L A;  4KVM E;  4R9M A;  2ZW5 A;  3EXN A;  2B5G B;  4KOW A;  4C7I A;  2DPT A;  4H6U A;  5J8C A;  2JDD A;  3F8K A;  4A32 A;  3PGP A;  2JDC A;  4II9 A;  4Y49 B;  3GY9 A;  2YNE A;  5BWA B;  3R1K A;  1Y9K A;  2B4D A;  4KS9 A;  4B14 A;  5EC4 A;  2Q0Y A;  2FCK A;  2VZY A;  2FS5 A;  1K4J A;  3R9E A;  1XF8 A;  5E96 A;  4CYP A;  2R1I A;  4MFQ A;  2Q7B A;  4CYO A;  1J4J A;  2R8V A;  4KUB A;  3DR6 A;  4NSQ A;  3EC4 A;  4OAD A;  1CJW A;  4AVC A;  1QSO A;  2Z3K A;  3VWE A;  1MK4 A;  2AE6 A;  3GKR A;  3BLN A;  3F5B A;  2GIV A;  4XPL A;  1P0H A;  2PC1 A;  4UFV A;  1NE9 A;  3EO4 A;  3D2M A;  3G8W A;  5G1Z A;  3CXS A;  3JUW A;  1S7F A;  4HKF A;  3I9S A;  3MGD A;  5G22 A;  4IUS A;  4KOT A;  4UWJ A;  3FB3 A;  3S6G A;  1S7L A;  4HNY B;  3C26 A;  4CYN A;  2B5G A;  5FVJ A;  3IU2 A;  2Y0M A;  5DWN A;  4KZT A;  5AG4 A;  1Q2Y A;  1I1D A;  2Z3O A;  5H84 A;  4R3K A;  3DR8 A;  1IIC A;  2B3V A;  3V8I A;  4PSX A;  1VKC A;  2FXF A;  2VXK A;  3LD2 A;  4KOV A;  2P6E A;  2Z3P A;  1IB1 E;  1M1D A;  4F6A A;  4CYQ A;  2D4P A;  4XPD B;  2EVN A;  5AGE A;  1S60 A;  4XNH C;  3R96 A;  2H5M A;  4MFL A;  4UFW A;  2J8N A;  5F48 A;  1IYK A;  3TO7 A;  5C88 A;  1NMT A;  2YND A;  3A9L A;  2Q04 A;  4ZGY B;  2CNT A;  4B5P B;  2PSW A;  5J8F A;  5HMN A;  2YNC C;  4UA3 A;  3JVN A;  2CNM A;  1Q2D A;  5C82 A;  1S7N A;  3S6F A;  4Q36 A;  2CXA A;  2P0W A;  4QBJ A;  4M85 A;  2O28 A;  3CXQ A;  1XMT A;  3DSB A;  4YRH A;  4UCP A;  4JWP A;  4FD7 A;  2B58 A;  1IID A;  4CRY B;  4XPD C;  1PUA A;  2PR1 A;  3W91 A;  4XNH B;  4CAW A;  4A2Z A;  1Z4E A;  5I0C A;  4HNW B;  2CNS A;  2WPX A;  2OH1 A;  4U9Z A;  2REE A;  3JTK A;  3CXP A;  4HNX B;  4YGO A;  2P6F A;  4A95 A;  1Y7R A;  4LX9 A;  4ORF A;  4CAF A;  2J8R A;  2JEV A;  4CGN A;  3N7Z A;  1XEB A;  2BUE A;  2VI7 A;  5G20 A;  1R57 A;  4MFK A;  2I79 A;  2B3U A;  4L89 A;  4PV6 A;  2QEC A;  4KOS A;  2D4O A;  3FRM A;  2Z10 A;  5JPH A;  3PP9 A;  4KOR A;  2REF A;  1YR0 A;  3FBU A;  2IL4 A;  4FD5 A;  5F46 A;  2VBQ A;  4CAX A;  2FE7 A;  5ISV A;  4R57 A;  4JD6 A;  4E2A A;  2Z3L A;  3F0A A;  5AG5 A;  3S6K A;  4KOU A;  4XPK A;  4JXQ A;  3T90 A;  1YGH A;  3TO9 A;  4BBH A;  2BSW A;  1FY7 A;  1TIQ A;  2CY2 A;  2ZW7 A;  2JLM A;  3TE4 A;  2BL1 A;  2PDO A;  2HQY A;  2PRB A;  4B12 A;  4B13 A;  4IF5 A;  1S3Z A;  4CAV A;  2A4N A;  3TT2 A;  2GAN A;  3TO6 A;  2F5I A;  5EBV A;  4OLL A;  4F0X A;  2Q4V A;  3FYN A;  2Z3M A;  3R9F A;  4H89 A;  3RYO A;  3PZJ A;  3R9G A;  4AG7 A;  2EUI A;  4K30 A;  4Q38 A;  2R98 A;  4DNC A;  1Q2C A;  3ZJ0 A;  2WUU A;  2G0B A;  1L0C A;  2ZPA A;  3P2F A;  1B87 A;  4EVY A;  4CGM A;  3ZZI A;  4NF1 A;  1BO4 A;  2J8M A;  1XE4 A;  4A33 A;  4CGL A;  4FD4 A;  4C68 A;  5IX3 A;  1M4G A;  1MJ9 A;  4QC6 A;  3EFA A;  1M4I A;  4KVX A;  1KZF A;  1M4D A;  3LOD A;  1QSM A;  1V0C A;  4KSF A;  4CS0 B;  1KUV A;  2B4D B;  3G3S A;  4LUA A;  5AG6 A;  2OZH A;  1S5K A;  4AG9 A;  3WR7 A;  3SHP A;  3SXO A;  2DPS A;  2Q44 A;  4B10 A;  4KLV A;  4UWI A;  1BOB A;  4AVB A;  3KKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...