3DLJA

Crystal structure of human carnosine dipeptidase 1
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
477
structure length
471
Chain Sequence
b'PPPALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLGQSLPIPPVILAELGSDPTKGTVCFYGHLDVQPADRGDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWISKPAITYGTRGNSYFMVEVKCRDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTKEEILMHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVIGKFSIRLVPHMNVSAVEKQVTRHLEDVFSKRNSSNKMVVSMTLGLHPWIANIDDTQYLAAKRAIRTVFGTEPDMIRDGSTIPIAKMFQEIVHVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFAAFFLEMAQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-Ala-His dipeptidase
publication title Crystal structure of human carnosine dipeptidase 1.
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 136
structure length 471
sequence length 477
chains with identical sequence B
ec nomenclature ec 3.4.13.20: Beta-Ala-His dipeptidase.
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dljA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3dljA01
3RAMA 1F57A 3BXMA 1ZG9A 3FEEA 1LOKA 4OIDA 1CBXA 3IC1A 2PJ2A 1IGBA 3B3WA 5K8NA 4PXCA 1BPMA 2XEIA 1F2PA 3FEDA 2ZELA 4P44A 2EK8A 1TKHA 2ZEHA 2ANPA 2AFSA 3B3SA 2ZEMA 4A37A 2ZEDA 2F7VA 4A39A 2PCUA 1FNOA 5LYIA 2C1CA 4Q7AA 4FUUA 2OOTA 5F09A 1VIXA 3SJEA 3L2NA 1GYTA 1ZLIA 2I3CA 2AFOA 2O4HA 1HEEA 3SI1A 1LANA 5ELYA 1JQGA 4B6ZA 2V8VA 2PJ6A 4R76A 2NYQA 3CPAA 1CPXA 5HVHA 4P4FA 3GB0A 3CPXA 4NGRA 3LWUA 2ZEPA 4MXUA 3PFOA 3ISXA 4ZYQA 4P4DA 3I1UA 3S9MA 3H8GA 1QMUA 5THWA 1Q7LA 5DS0A 5CPAA 1TF8A 3IJ3A 4KSIA 2PJBA 2VL1A 2RB7A 1CPSA 2WYRA 2Q4ZA 3KZWA 3KGQA 3SI0A 2PVWA 1Z5RA 3SJFA 4IK2A 2XEGA 1LAMA 4NGPA 1BLLE 4NJRA 4TNUA 1OBRA 2PE3A 1YLOA 3KASA 2PJ3A 6CPAA 2QYVA 2EWBA 4IAVA 4OC2A 1ARLA 4IHMA 2PJAA 4PXEA 2CF4A 2IJZA 4W9YA 3PRTA 4UEFA 1AMPA 4ZX8A 3KHZA 2IMOA 4ONWA 1ZLHA 4MHYA 3B3VA 4OP4A 4OC4A 2DEAA 2PJ1A 2Q43A 2JBKA 5HXDA 1F2OA 3SJXA 4MCPA 4NGQA 4UIBA 3CDXA 4WWVA 2POKA 5JGFA 4F9VA 1VHEA 4X2TA 3KL9A 4UF4A 3NH8A 1R43A 1ZG8A 1CX8A 4P4IA 4G1PA 4A94A 3JRUA 2OR4A 1Y0YA 2JEWA 1ELLP 5J1QA 3PFEA 4JYWA 2BCOA 4X8IA 4MMOA 3D66A 3RBUA 4F8ZA 3WT4A 1XRYA 4PXDA 3RZAA 4RUHA 2BO9A 1VGYA 2AFZA 2PJ5A 5LYLA 1YW4A 1Z8LA 1M4LA 4EMEA 5I4MA 3TX8A 2ZEOA 2V8DA 2PIZA 4NGMA 4MCQA 4NJQA 4OC5A 1YSJA 4F9UA 1ZG7A 3HUVA 2PJ0A 3DLJA 3ISZA 2PRQA 5K8MA 2V77A 4OC1A 4JZ0A 4R8FA 3B7IA 4FWUA 4MHNA 4PQAA 4NGTA 2PJ9A 1VHOA 2QVPA 3FMCA 3IWWA 2CTCA 5JH9A 4PXBA 4OC0A 5LYDA 5HVFA 4P6YA 2ZOFA 2HC9A 3B2YA 2C6GA 3CT9A 1CG2A 4FAIA 4MHPA 4WJBA 5LRKA 3B35A 3IFEA 3GUXA 3H8EA 5D8NA 4BD9A 5K8OA 3KR5A 4OKOA 4MCRA 2V8HA 4H2KA 1DTDA 3D7FA 3D7DA 4ZY2A 4P4EA 5JM6A 4YU9A 4FBEA 3VARA 1YW6A 4Z65A 1AYEA 4MCSA 4UEEA 2WZNA 3PB9X 2O53A 5D29A 3KHXA 2ZEEA 3MRUA 4UEZA 3D68A 4UIAA 5IB9A 3S9LA 3QNVA 3PB4X 4NFRA 4OMEA 3IIBA 2ZEFA 2ZOGA 4NGNA 2GLJA 7CPAA 1R3NA 3WABA 3KQZA 3D7GA 4P10A 3N5FA 3PBBA 5K8PA 4GM5A 1DE4C 3WC5A 3WC7A 1QQ9A 3K2KA 3V7ZA 2GREA 1CP7A 3IEHA 3NH5A 4DYOA 2C6CA 3D67A 3NA6A 4OIWA 2AFMA 3PB7X 4TWEA 1PYTB 2ZEGA 3FJUA 1XJOA 3S9NA 1IY7A 3FF3A 3KQXA 3SJGA 5LYFA 2EK9A 1XMBA 1KWMA 2AFWA 4R7MA 1TF9A 8CPAA 3DGVA 1FT7A 4DJLA 2RFHA 3SI2A 1XBUA 2GLFA 4ZY0A 2F8HA 1TKJA 2PJCA 3D4UA 3HLPA 1UWYA 2CIJA 3K9TA 2AFUA 3FECA 2AFXA 4EWTA 2PIYA 4ZI6A 3PEIA 3KR4A 1LCPA 5LRGA 4NGSA 1CP6A 2ABZA 2ZENA 2PVVA 1PCAA 3BHXA 2G9DA 5CBMA 3PBEA 4DUKA 3KI9A 4YWYA 3VH9A 3WC6A 1LFWA 2Q51A 2BOAA 4R6TA 2QJ8A 4MRIA 1ARMA 3GLJA 1HDUA 3BI1A 1RTQA 2XEFA 4PPZA 1HDQA 4P4BA 3LMSA 4LQGA 1EE3P 3VATA 2FVGA 4AXVA 2GU2A 2IQ6A 3PB8X 2V8GA 1BAVA 3FH4A 4ZX9A 1TKFA 4MHZA 1BPNA 5LRJA 3V38A 4OC3A 4P45A 2JBJA 2J9AA 3H8FA 1NSAA 1ELMP 1Y7EA 1H8LA 1LAPA 2XEJA 2CTBA 2PJ8A 5HVGA 3FVLA 3NFZA 2PJ4A 4O23A 3BI0A 3T8WA 3B3TA 2HB6A 3PB6X 4P4JA 1Z2LA 4K3NA 1XFOA 3D7HA 4CPAA 3TC8A 1Y0RA 4A38A 4ZY1A 2C6PA 3MN8A 3FX6A 1YMEA 1TXRA 3B3CA 3IO1A 4EFDA 3NH4A 2PJ7A 4X3RA 2NSMA
chains in the Genus database with same CATH superfamily
4Y49C 3BXMA 1HHQA 3VGTA 4DX7A 3SEOA 4Y6IA 5C25A 3MMBA 4DHVA 1KUYA 2HNZA 1XOVA 2ZEHA 2ANPA 2C27A 3ILOA 4LBHA 3ULHA 3VALA 2F7VA 4P75A 3QZ8A 3EDQB 3DGPB 1GNKA 3EX7B 4MFQA 4JI3J 5A6WA 4GO7X 3OR1B 4O3QA 2CUYA 1RLDA 4IH5A 4ZVHA 4J9KA 3MOJB 2W4PA 1TL3B 1NK5A 4CGOA 1UL3A 4P4FA 1A2ZA 2CYYA 1WC6A 4MXUA 3PFOA 3M8SA 3IR5B 2VOOA 3D1QA 3MAAB 1J5OA 2BEIA 1S0MA 1FKPB 2C2OB 3SI0A 1GMUA 4PRFA 4LFBJ 2EI5A 3R7BB 3SXLA 1CULB 1FRLA 2WB1D 2YGWA 3AAWB 2GMHA 2PJAA 5DDPC 2CF4A 1OJ4A 2WSCC 4ETZA 4DR2F 2YNIB 1XWLA 1TMJA 3PRTA 2DT9A 4P6QA 1FESA 3AHPA 3VTIA 1DTQA 1CBKA 4DMZA 4DV2J 2WBRA 3HFZB 1GAOA 4ORFA 2YKMA 4EI2A 1ZM9A 2RRNA 3BGOP 3GJRB 1YGYA 3J80Y 2DGXA 5KFLA 4V19J 3OTBA 2F5GA 3D66A 1L3UA 4V19X 2Q66A 3IWNC 1IBMF 1ZS6A 3JYTA 4USUA 2HAFA 2UU9F 4CGPA 1R6VA 3E0KA 2H4WB 2J7KA 1Y7RA 3HSDA 2GZOA 3MR2A 2Z30B 3TAMB 2A2DA 4MIWA 3K7RA 2VBQA 1XR6A 3S6EA 2Y9HA 2AYMA 3RU0A 3OLBA 3N79A 4ZCIA 2AJ2A 4TQSA 1YLXA 4DV0F 1FWLA 1NRKA 4CYNA 2PRQA 1YDLA 1TKXA 3NWRA 3UD3P 5A76A 3W7BA 3IWWA 1VHSA 1Q5VA 4NI2A 1W26A 4XK8C 4QR0A 3IG1B 2Q3PA 4B9SA 4AVAA 4C2XA 1SJRA 2B5JA 4J9LA 4LRCA 3DOLA 3KJFB 4DV2F 3IFEA 4Q8FA 1FJ7A 2ZW7A 2FS5A 5C24A 4QQBA 1B99A 4TY8A 3CCZA 3SXOA 3N01A 4H2KA 3R1HA 3M2UA 4OI6A 3AB4B 5B0FA 4CI0B 4QWDA 4UEEA 4F67A 3CDBA 3KJNB 1IBKJ 4CYOA 4YN3B 4L76A 4DN9A 3IA0A 2WTFA 2H4YB 3KJVB 2BANB 1KKHA 2VPWB 1R8CA 3C46A 4UCMA 4U9ZA 4UEZA 3BGLA 2VBYA 4LRAA 4G1IA 2M3DA 2KG0A 5DDRC 1ZPWX 3CGIA 4X4VA 3C6TA 2RS2A 3K5OA 3WABA 3TZYA 1MNEA 3AJ1A 1RTJB 3PIOQ 3K2KA 4KGKA 3D9BA 5KFXA 3VF0B 1CP7A 1RT5A 2BQRA 2GJ2A 3NA6A 5IV0A 2FC8A 4URSA 3PO4A 1SVDA 1DJ0A 2GV1A 5A27A 5KFZA 1VQ7S 1VJWA 1VRUB 4ONUA 3EGWB 2VICA 2YNHA 2ZJPQ 1U1NA 1M5PC 1N8RT 4Y28C 4CAFA 1X8DA 2BMBA 2HVIA 2RFHA 3W2WA 2OEJA 2QA4G 2ZKUA 2HIYA 5A8RA 3Q8RB 3D4UA 3WC2A 1FDBA 4EWTA 3AB2B 2VBXA 3QIDA 2MHNA 4RNNA 3CO9A 3KOAA 1XEBA 3WC6A 2ZITA 2LKZA 2NPIA 1S7NA 4X2BA 1OPZA 4M1KA 4WCEQ 2AX0A 2D7SA 1B0TA 3V81A 3MFHA 2Q04A 4TQRA 2PSZA 4ZPWR 4ED5A 2NXCA 4F04B 2LQJA 3Q0AA 2I0XA 3SZ2A 3S01A 1U1OA 1I6JA 5DETA 1FRMA 1TKFA 1R0BG 2IM3A 5G21A 2NUUG 5JUMA 2R1IA 5U47A 1H8LA 3LP2A 3BF4A 1FDDA 3Q24A 2WUUA 2OLWA 2NZCA 3ZZRA 1M90T 3D7HA 4RW7A 3L9ZA 2R8IA 4OFZA 1AB8A 3SCLE 4HYKA 2Q6CA 1RBOB 2AGOA 2QRRA 2HZAA 4HLBA 3CC7S 2JL9A 1KHWA 4HACA 3ZJ0A 3DNCA 3RBZA 1F0XA 3BM7A 3TT2A 4CH0S 4OX8A 4YY3J 4FD7A 1MN7A 2EFVA 3W5ZA 2DR6A 1BUXA 2FIAA 1E6YB 2KU7A 2FDNA 3TI0A 3B3SA 2D69A 5T14A 2CQ3A 2J9CA 2Q6BA 4PQUA 1PJ6A 2FJEB 2ERRA 1S99A 1F6TA 3TUJC 4ZA1A 3SI1A 3D0IE 2I1RA 4K5SA 4LRFA 1I94J 4F3MA 2MQ8A 1Q8IA 2GVDA 2V8VA 2YNFB 1JKHB 3QT7A 4DFKA 3NP5A 1PKUA 2DJWA 1Q7LA 2CVEA 2YWKA 3KNGA 5LL6d 3RRHA 4KFBB 2VHGA 4EK2A 2FUG9 2HNYB 2QA1A 3PHEA 1MMDA 2FVSA 1RHQB 2YKAA 1R89A 2EBJA 1T03B 4DSFA 2IC3A 3IM8A 2DGWA 4FYXB 2QSWA 3SCKE 4FKYA 4FD6A 4BS2A 5B0DA 4IAVA 3PX4A 5IQ6A 3TR5A 2RUSA 3NWGA 5HMNA 3PYFA 3NOCA 2UXCF 3TA1A 1MLAA 4CO2A 1OZPA 1T9YA 3GR0A 1ZA1B 3DI6A 1JNRB 3K89A 4MKYA 1Z9UA 1ZAVA 5KT4A 4RW4B 2PJ1A 4QPXA 3WC0A 1IYKA 2R2SA 1LNQA 4Q44A 1TKTB 3LGHA 1XMOJ 1EP4B 2Q4VA 3GTYX 2EFPA 5K14A 3M6VA 3CXPA 1AFJA 4M5JA 1YLEA 1GT8A 2MSSA 2VPZB 5IV3A 2V63A 3SSSA 2DGTA 4F8ZA 1XIXA 4KHRA 4LBPA 3UDVA 3FZ2A 4RBTA 2NQPA 1B7FA 1B64A 1S1VB 1XMQF 1Z8LA 4C7HA 1T05A 4NCBA 2E7VA 3PX6A 2OAUA 3KLIA 4DF4A 1SBRA 2IBOA 3TANA 1HHTP 2H54B 2C2EA 5L1LA 1TVRB 1UVIA 3TUIC 2JC1A 3GIMA 3TX0A 3G6YA 5LJ3Y 4RW8B 5I42A 1MJAA 1VHFA 1J5EJ 2DRDA 5KTAA 3V2UC 3CJRA 3DLKA 3HCXA 2ZH9A 5CD4H 1VQKS 1S9EB 1YG0A 5GVQA 2VC0A 1UVJA 3ENQA 4JI5F 1CJUA 3M9MB 5KFGA 4J5OA 4DV1J 1BXNA 4AXJA 1O8BA 2RS8A 2LVWA 5A8KA 4DV6J 3A1YG 2RVJA 5J1EA 1X4CA 5GAGU 1YW6A 4LF4J 1HL6A 1S5ZA 2PRBA 3ITHB 3DFEA 2DEIA 3HHLD 2E29A 3T1HJ 2H51B 1KZFA 3S9LA 1RT4A 2HWIA 2K7KA 2D3O1 2W25A 3IIBA 2P6TA 3GWCA 1YJ9S 2YPYA 4PPDA 1IKVA 4LFAJ 2FT0A 4JI7F 3WC7A 1SC1B 3SQGA 3I6PA 1GXTA 3BR8A 1VRTA 4ECRA 2R7HA 4C11B 3W8PA 3FJUA 2UVUA 4KPYA 4DSKA 3IWXA 1SJ4P 4OJ1A 3TE4A 2Z3MA 3C16B 3KLHA 3NE7A 1HBNB 1VMBA 3J7AN 3DXBA 2G1DA 2FHOB 3MM8A 2XCPA 4F4WA 1AUGA 4OV6A 1NKBA 1YWXA 1RA7A 3QBCA 1YBUA 2M8HA 1DFDA 2Q7BA 1RAGB 4LR7A 1NDCA 3DLBA 3ZZPA 5HJYA 2BJ9A 3CCWA 3C66A 2B3TB 4ZHRB 3GV8B 4NYZA 4QUSA 5FLXU 1P0HA 5B0AA 2Z57B 1BGXT 3S6FA 1U1LA 3CJ8A 4CLLA 4CH1A 4P4BA 3LMSA 1EE3P 4LFAF 4MYUA 1M5HA 5HJXA 2YY3A 3KG1A 4EGLA 3RW7A 1BE4A 4OMFG 4KKOB 1MROB 1N5SA 2R7VA 2F8MA 4ED2A 1URNA 3M8ZA 2KO1A 2LLZA 1KLMA 2P8IA 1VQMS 2I6WA 4PYAA 2PJ4A 1BC6A 1WWZA 4P4JA 2FXFA 1EB0A 5H9EK 2VUGA 1Y0RA 5IB0A 2CNNB 3MN8A 4ZVEA 4F25A 4OZ1A 2VIHA 4X3RA 1WC1A 1AT1B 4X65J 1BOBA 1ZG9A 1C1CA 1KDNA 2B56A 1HQEB 4B3MJ 4JI8F 2DXDA 2KXNB 2HHHF 4FF2A 1PYSB 3R3TA 7FDRA 3QATA 4M63A 4YP3A 1KTQA 1RYSA 1VIXA 4ECYA 2DNRA 4DUTA 1HWKA 3G9CA 1Q2YA 2FLLA 3CIMA 2HMIB 2AFOA 2YNGB 2O4HA 4R87A 5ELYA 4WBFA 4JI2J 3DHWC 3OTEA 2ZC4A 2NYQA 5KG7A 2GIRA 4DCOB 3CPXA 1JLEA 2BE2A 1IM4A 1RAEB 4OHVA 1T8EA 2UXDF 4DCPB 4ZYQA 3WZ0A 3AD7C 1IYLA 1PO6A 1F9HA 1YZ7A 3KLVA 2I5JB 4JI0J 1JK9B 3W6XA 2QG9B 3EZUA 1RK8A 4R9MA 3KZWA 3KGQA 4DPOA 1NE9A 2XEGA 5MLCV 2WW8A 2DVIA 4CH7A 1Y5IB 2IIHA 3TEGA 3NEKA 3ET6A 2B4OA 4UBRA 2Z3NA 3TQEA 5KFPA 3R6GB 2CG4A 5AJ3J 5AGEA 1U45A 2OI2A 4FPIA 3K0JA 2CQ2A 4ICLB 3TW0A 3UCUP 4MHYA 3KDNA 4QBJA 2R2RA 3GY9A 4BWJA 4OYZA 3W9HA 2ZH3A 4QBUA 5EBVA 1WKKA 1AFIA 4F4AA 2GHWA 2C3YA 4GO5X 2CQ0A 1TV6A 2DB1A 4ANEA 3HHEA 4X2TA 4Y2AA 3AH6A 1CX8A 1UW9A 3FSYA 2AGPA 2CJXB 5HH1A 1OYDA 5J1QA 3PG9A 2QJ3A 4GKKJ 4UTGA 1RAIB 3EY5A 4X66J 4PK2A 3DGPA 3D0HE 1YW4A 5J2NB 1Y0HA 2EG2A 3OR1A 1WOOA 3OXLA 2WAQD 2XS5A 3LF0A 1TL3A 4ILLA 4K4ZA 1T11A 4AL5A 2HYIB 1RTIB 4ETXA 2WVDA 1LV5A 4Y34A 2RNEA 3M4XA 3BH7B 2D9PA 4ZIVA 1NPKA 1Y3JA 4F2SA 4PQAA 3MAAA 2RU9A 5ETOA 2CNKB 1FKPA 3T6JA 4DLEA 2OZUA 1Z4UA 2JLGA 3DN9A 3MGDA 2JDJA 3H5YA 1S6OA 1RQ0A 4GVBB 2FD2A 2KZZA 5KG3A 5KFEA 1N52B 1CULA 5SUHA 3HVRA 3SDEB 4ZBGA 4BD9A 5D8NA 5K8OA 2YNIA 2V8HA 4X4QA 4U96A 1DTDA 3C15B 3EXYA 2C2RA 2V5HG 5G1ZA 5BYSA 4A48A 4AQYJ 3NNCA 2RD5C 2QTWA 4CLFA 1F5AA 4NLVA 3UO0A 1BLUA 2O67A 1IUJA 4J9VA 4TYAA 1YHQS 1HNVB 5LSRA 3V6DB 4WF9Q 3JSMB 1WACA 4HKQA 3OD2A 2CVIA 4DQIA 2E5LJ 3C3LA 2PEBA 3J7ZT 2VB6A 1FHTA 5CA5A 2C3UA 2CPEA 3GFXA 3BZQA 5K8PA 3IXQA 1A9NB 2DH8A 2F40A 3US5A 2YKQA 5D0HA 1WWHA 5ETMA 3BSOA 1NJXA 1O51A 1QAXA 4QU6A 6FD1A 3I56S 2CQCA 2C22A 1LRZA 4ZOSA 2EO8A 3E3XA 3WIVA 4XPCA 2DBBA 2JC0A 4MK8A 3F8KA 1UPMB 1JJ4A 5M2RA 4GKJF 2CJQA 4R7MA 5DZ6A 1PSDA 5E3AA 3SI2A 3MM7B 4DU8A 1KUVA 4USIA 4QWCA 4GXHA 3IG1A 1P8GA 4MFJA 3R9EA 1S1XB 4ECUA 3W62A 4DPWA 4B11A 4AQYF 1RT7B 5LRGA 5EX0A 1JNZB 3G4SS 2Q7SA 1P6TA 2XMKA 2B8QA 3R27A 3R1LA 4I1TA 3EVOA 1S1WB 5KFBA 4C3MA 4MKBA 4CLUA 1Z2ZA 1ZH5A 3E51A 1IJFB 3KJVA 2BANA 2K8GA 2VPYB 2RRAA 4C8MA 2MXYA 2OHDA 2MQOA 2XWYA 3HHNB 2IQ6A 1RHRB 3RAQA 3LUYA 4U9RA 3V38A 1EAYC 2H65B 2M70A 1ELMP 1K0TA 1IR0A 2I00A 4EBEA 5FLXY 3JSRA 4F7VA 3ZTSA 4FP9A 3J81j 1MMNA 4OX9F 1RTJA 5GAHI 3G2XA 2ZZTA 4DV3F 1JLCA 1D9AA 2KB2A 3TC8A 1WHYA 3GIRA 2C6PA 1S6UA 5CCMA 1JLFB 4Y2KA 5D0GA 3CMAS 1YK3A 2DR9A 1VRUA 5KFJA 5JVGQ 1QTNB 3DRPB 3J7A1 4CNZA 2PFFB 3KNAA 2M4MA 4RW9B 4P52A 3HJFA 4B02A 1WD6A 4ED8A 3B8HA 3RGIA 2MJNA 3CD5A 1U8SA 4DUZJ 1FA0A 4X4PA 2RAQA 5H9FJ 2HRUA 2NUHA 4DLGA 3EPGA 4P4DA 3N7ZA 1QAIA 5IT4A 1QMUA 4MFZA 2RE1A 4YEAA 6FDRA 4O44B 5CPAA 2ODFA 4L8AA 4WFXA 2EK1A 2ACYA 2I2YA 1L3VA 3KLEB 1HR0J 1FX4A 3RR7A 2BUEA 2XLIA 6CPAA 5K20B 1VQ5S 4PXEA 4LIWA 2LQBA 3OTOJ 2RF2A 1ON0A 4BC7A 4GC7A 3TRGA 2BJ3A 5KFMA 4IRKA 4FN5A 3NLCA 4FYWB 4OP4A 3MUVP 4JI6F 2X3GA 4C2ZA 2M9KA 4KGXB 4MCPA 1TK5A 4TU7A 2MKIA 4B3TJ 2KCWA 4UIBA 3G96A 1S60A 3ZZOA 4DR1J 2JNJA 3QFHA 4AUKA 1OY8A 4CTAB 2OGUA 1DLOB 1QJHA 2R7SA 5DS7A 4EBCA 2RH3A 5DG8A 3JRUA 4EMDA 4WIIA 4JYWA 2YWHA 1IVZA 4DUZF 4F02A 1T9UA 3OLAA 1E6YA 3H25A 2MSTA 3MDFA 4YUDA 1YQEA 4FNIA 3I5CA 3QT6A 3EUNA 5K9FA 4PK3A 4F3QA 4K4VA 4X4SA 4JV5F 3THTA 2ZH5A 3KTQA 4MK7A 1V3RA 1HNZJ 3BJ8A 2ZEOA 3LP1B 4M5MA 5B0BA 9RUBA 2HRYA 4ZPAA 4OYOA 1TK0A 4K59A 4F36A 4TKTA 2YNFA 5KTCA 4MY0A 2E1AA 1JKHA 4FYVB 3KK3B 3B7IA 4YRHA 3U1MA 4NGTA 5C88A 3DHXA 2KI2A 2LEPA 4KFBA 4ZPTR 3H20A 2HNYA 3I0RB 2V2KA 3HVAA 1T03A 3A8EA 4C8LA 4Y49B 4Y65A 1T7PA 4UWJA 3CDWA 4FAIA 4LR9A 2BJDA 1HWIA 2LXFA 2CKWA 4LF7J 2AJ6A 4DI6A 2FL4A 3UDEA 3EC4A 4MYTA 5HROB 2KDOA 5JM6A 3P5BP 3QRRA 4DL5A 2DHSA 3E8OA 1EARA 1RYRA 2BXJA 3FBBA 4RW4A 2VZ9A 1U6ZA 4TLRA 2YKNB 4KC5A 4WKYA 1TKTA 2ZBRA 1EP4A 3R9GA 2Z2ZA 1TL5A 2M8DB 3OQ2A 3LWMA 2MHEA 3R5AA 3RG6A 4LF9J 2EC2A 3T5KA 1Z8WA 3NGKA 5JPHA 2O5DA 3N5BA 4CWBA 2NXEA 1QSSA 3I4HX 1KRPA 2GE3A 1VBKA 2VG7B 2YNCA 5EWEA 4QU7A 3AA8A 1S1VA 1M1KT 1IOIA 1R8HA 1ZZFA 2LQ8A 4DYOA 3NGUA 3W2VB 5LSLA 3VQTA 2DPTA 5ETNA 3MWBA 1Z4RA 3CWJA 3RNZA 4LF8J 2DIUA 8ATCB 1K44A 2R8VA 3C8YA 1TVRA 1KOOA 3PYEA 5DLGA 1CS4B 2BV3A 1X4GA 2ZDOA 1EIYB 1WELA 2OTLS 4RW8A 4JI4J 2GO8A 3I31A 1FT7A 4ZGYB 3UDCA 4XPEA 3BPDA 1UPPA 3D0GE 4ZVQB 2VFUA 5E0OA 3CDAA 4NLOA 2DY1A 3BLNA 1S9EA 3M6UA 3PEIA 1TUGB 3KR4A 1SB6A 3CC2S 3UN2A 2ZWOA 1SL0A 3FQKA 2CY2A 2B4DB 4KJIA 2DCLA 2ZH7A 4YB1P 2BOAA 2CA9A 3Q8UA 4DS5A 1LK5A 5KFKA 3ITHA 2HW3A 3VR1A 1RSCA 4H4OA 3X3UA 5ISVA 2VQFJ 5IT9U 3HD1A 3KLFB 3AD8C 1FRIA 1CPZA 4EYHB 2CQDA 1WKLA 2RHSB 2IJFA 3CCQS 3RW6A 5I3QA 4B08A 2V9WA 2ZH8A 4UT4A 3BBCA 1HNXJ 4O3OA 4CYQA 2W9CB 4C11A 5L9NA 2MEWA 3I4PA 2ZFHA 3L3CA 1XJWB 3G6XA 2FVCA 1F57A 1DBDA 1ROFA 4OIDA 3C16A 4NZ0A 4GS4A 5K8NA 2G9OA 2L08A 1HBNA 4K4SA 1CC8A 3OJUA 1YJUA 3VWEA 4C3LA 3Q23A 3JTOA 4FUUA 3FCWA 2L41A 1VQ4S 3NNHA 2C3MA 4FF3A 4LVOP 4IG3B 2DXQA 4MT1A 2OJ3A 4X4TA 2UVRA 3RRGA 2LECA 3GONA 4ZHRA 2ZEPA 2HHUA 1B0VA 1SH2A 1NK6A 5DM6Q 5DWNA 4DL6A 3M30B 1G1XA 2RB7A 1IXKA 1EX8A 1HI0P 1S7IA 1NUEA 2AYGA 3GCXP 4LIRA 3SJFA 4YR3A 3OSNA 1EETB 4X4UA 3CXQA 1MROA 5FJ4A 2YWFA 5M2PA 4YHHF 4DR6J 4DV4J 3SQOP 2VKRA 2Q44A 2WVBA 1UEUA 5L9XA 4ZP8A 2QX0A 4KH0B 1HKAA 2LA6A 3A8IA 3LAKA 2KHCA 3EGZA 2CADA 2MKHA 3NMAA 2G2ZA 3Q22A 2XO6A 4OX6A 3CDXA 3ZO7A 3JTPA 3FJ2A 2VD3A 1ZG8A 2B4PA 3BB5A 2HFUA 1TKDA 1MU2B 5C7PA 1HQEA 3JTKA 2BCOA 1YJ7A 1U2RA 3MD3A 2VG6B 1UAWA 2M7SA 2BO9A 5B7WA 4LF5J 2EWHA 1VYAA 4LQ9A 4EMEA 2D3UA 2HMIA 2YNGA 3OL8A 4NGMA 3GILA 1HHSA 3PZPA 3MPUB 3HUVA 2QEXS 2E44A 3K9UA 4ITSA 1NDLA 5KFDA 1EQ0A 1QSMA 2EVNA 4DV4F 5E96A 2I5JA 2Q1LA 3OL6A 2WBMA 2FLPA 2BM0A 1B3TA 1R8AA 3KUEA 1IJEB 1XBWA 4OLLA 2J8AA 1FK9B 1PC5A 3QB8A 2BKPA 3EGNA 5ETTA 4HVZA 4JB8B 3LO3A 3GYXB 2CNLB 5LRKA 3G86A 2JEFA 3B6BA 3KG4A 4YR0A 4MK9A 1K47A 5KFYA 4ID5B 4B3SF 1YREA 1T94A 4ICLA 3BDPA 2B5GB 2W1BA 3VARA 3QNWB 4L73A 5KG1A 2MMYA 3DRYA 4J91A 1QAYA 4FS2A 4FVCA 1KVKA 2HHTA 1CVJA 2L9DA 3PX0A 1WC5A 2D1CA 1X12A 1FNXH 2H5MA 2GCFA 2IDEA 2BKOA 4LF5F 3TUPA 4QIGA 3FB3A 4ELUA 2IYIA 2DHAA 3HHLC 2A6OA 2JLMA 2R2UA 1UFWA 1I12A 1N33F 1Y00A 3HP6A 4LFCF 2QA2A 2P6FA 2IBKA 1FFWB 2YQ3A 1GX5A 1GMVA 4K8RA 1DURA 4FNHA 1N48A 1NH7A 1NPPA 1LWCB 3O3LA 4I68A 2XCAA 5GMDA 5J2NA 3TTHA 4DQSA 1XERA 2AFMA 3MEKA 3PCOB 2ZM6F 3UN3A 3DOMB 1WHWA 4BWMA 2ASLA 4IFYB 2P6GA 1RTIA 2GW8A 5F8LA 1X10A 1KSPA 3FK4A 2RMLA 3U1LA 1H2UX 2G0BA 3MM9B 1XMBA 1YJVA 5FVJA 2VQEF 2ZUGA 2ALZA 5AG4A 4OZ5A 3TCVA 2RC4A 2V6AA 3IWEA 4IRDA 1VQYA 4KV8B 3DR8A 3KMSA 3EWGA 4GVBA 5DM7Q 2NREA 3TWZA 2OEKA 3SDEA 1U24A 3M8RA 3R5BA 1S9GB 3N9UC 1N54B 1LFWA 4J7CA 5HBMB 3C15A 3FRYA 3MI7X 1F9EB 1ARMA 1JJCB 1HDUA 2LFVA 3W66A 3OL7A 3PXGa 4K4TA 3PVXA 4OHZA 2YH1A 2HHVA 3NGTA 1V3SA 1PILA 2GU2A 1HNVA 1LW0B 3V6DA 3JSMA 1UEVA 4AT1B 5D3GB 2XC9A 1NBEB 2OD4A 2JBJA 4DQPA 4UUXA 3QGIA 2I38A 1WTFA 1V9OA 1Q82T 3B3TA 1ITPA 3QZ7A 3O6QA 3FBEA 1CJVB 5HL7Q 4A8OA 4CGLA 3MM5B 1PC4A 1RKIA 1GH8A 5CAAA 5IT9Y 4DL7A 4ZY1A 1UETA 4J9OA 3B3CA 1BHNA 2FIUA 2ASJA 1NSLA 2NSMA 2Z56B 1M44A 3C26A 4NZ7A 4W90B 4OZ2A 1C4CA 1OPIA 4RBUA 4HNYB 1CBXA 4WFZA 1BPMA 2F4VF 1N5YB 4P44A 4XDDA 2DR5A 4O3SA 3W8GA 3MM7A 2I8EA 4K4XA 4YB7A 3R9FA 4J90A 2DITA 1KEKA 1S1XA 3SJEA 4F50A 3IWGA 2NPFA 3MMJA 1RT7A 4USMA 1FO1A 4K4YA 1NEEA 3AQPA 3PACA 4ED7A 4E2FB 5E7OB 4I64A 3J81U 3OVSA 3HZGA 1CPXA 2FVRA 4PG7A 2RT3A 1S1WA 4KS9A 3CSKA 2V94A 1VFJA 2JVRA 4QIWD 2DPSA 5HQ8A 4DR4J 3QWUA 2F3JA 3WIUA 1H3DA 2NXUA 4Q8EA 5EMIA 1YK9A 3BS9A 5BXIA 2OZGA 5HMZA 1RWVB 4H4KC 1KN6A 3FBCA 4L6V3 5IQQA 2HFNA 2ZZNA 2H48B 3CC4S 1JLQB 3NG8A 4IHMA 2GQ2A 1IBLJ 4DXLA 3R8YA 5CABA 5IC4B 3MPVA 2MLXA 4D3HA 1SCJB 1WNEA 1R6YA 4UEFA 4F0KA 4ZX8A 1ZLHA 2ZW6A 2ATRA 4OC4A 5D77A 3F0NA 5HXDA 4K2JA 1K9MT 1U25A 1JLFA 5ETSA 4DV5J 2CNTA 3HJVA 2FLNA 4CYUB 4DR5J 3Q8QB 4X64J 3UR3C 2XSJB 3AQOA 3OFGA 3DRPA 4X8IA 1QVGR 2H3EB 1RADB 4RW9A 4KOXA 2GVZB 4QCLA 5IWAJ 3RZAA 3DDIA 5JMNA 5LYLA 5F0WA 4QIEA 1WJ9A 2E7WA 3ELHA 1MJ9A 3OSPA 2OIHA 3FUYA 5ETLA 3H5XA 3LTOA 2MQLA 5GAEU 3DNSA 2QN6B 1CJTB 1XTZA 4DR4F 1GXUA 1TL7B 3JB9k 4UY8T 4KT0C 5D8HB 2B9XA 3HKWA 3JAMU 3M7VA 5ETRA 4BHQA 4O44A 1A7GE 3BGUA 4DZDA 4UQTA 3FBUA 2AEMA 2DGQA 1ZTWA 2YPZA 3SMZA 3GZ7A 5IS2A 3PV8A 4ED0A 3KLEA 3EO4A 5L38A 1SXLA 3SFGA 2LEBA 4OJGA 4F6AA 4WK3A 1BQXA 4LF2A 4K30A 2OP5A 4P71A 4ZY2A 2WB4A 4J9NA 4DR5F 2AYBA 1IM6A 2IL4A 2BRLA 3TZWA 1WOPA 4Z37A 4C3KA 1RTHB 2KN4A 1L3TA 1FX2A 3OXGA 1YRTA 4UUWA 4F26A 2CWKA 5HSPA 2B43A 4CTAA 1SJ3P 3UNYA 4I6AA 3QT8A 1DLOA 5D0EA 5IB9A 3PHTA 3QNVA 4KLVA 3SBMA 4LR8A 2ZOGA 4ILRA 3M8WA 4DJBA 4HNXB 5HLFA 1Y4ZB 4LUAA 1JLGB 2RDDA 3PBBA 2MKKA 3FKBA 1Y5NB 4YQWA 4XNHB 4C98A 3E01B 1EQMA 4KHPF 2OFGX 3D67A 4P72A 3BJ7A 3UDLA 2JX2A 3THPA 3LP1A 2FSRA 4X62F 3PR4A 1QVFR 4IUFA 3S9NA 4DPXA 5DZ7A 3H98A 2ADCA 3BGRB 4HEA9 4KOTA 1HBOB 4FXWA 3TVKA 5AG7A 4DF8A 1SUQA 2RHQB 3KK3A 5A28A 1QUVA 1N34J 3OHBA 1T02A 2ILZA 4HH0A 4HTJA 4BBHA 3DRSB 4DUYJ 5HATA 2UUCJ 4I69A 4DL4A 5I3UB 3NGSA 3I0RA 2HUZA 2MQQA 4CO4A 1UWYA 2CIJA 4X4NA 4YGOA 2DHHA 3ENVA 3GV5B 1SC6A 3TOQA 5AXNA 3K8WA 2HQ3A 4B3RF 4ZJQA 3HXMA 4YDDB 4I49A 3HVTB 1S77D 2O66A 5HROA 4MRIA 2O1PA 3BI1A 2XEFA 1CQMA 4DFMA 1VQ6S 2YKNA 1NJZA 2KT2A 1HDQA 4HHHA 4LQGA 2Z11A 4DR7F 2VODA 2FHJA 2AP6A 1KTVA 3I0SB 1S6QB 1PJ7A 3FH4A 4FBUA 1S97A 1RT2B 1GHEA 4XDCA 3I96A 4NCAA 4DG1B 2ZH6A 2B58A 2PJ8A 2R7OA 1B87A 2VG7A 1K1SA 3T8WA 2WCXA 2W9AA 4KRWA 4NLQA 3W2VA 5HQLA 2HNDB 3MCOA 2CQIA 4TLQA 4KUAA 5IV4A 1S79A 3CJ4A 2CJBA 1N32J 4O3RA 3FEYB 1CS4A 5KTDA 3OFEA 3FXTA 1XN9A 1LEOA 1U26A 1DQ9A 5IOLA 1AW0A 1TZ0A 4Y3CA 1WKJA 3PEJA 1PU9A 1GYTA 2UZAA 5AT1B 1HEEA 2C28A 2V67A 2AJFE 3VVTA 2B4DA 2PJ6A 2R3VA 3CPAA 1YQHA 3GB0A 2HEKA 3LWUA 4PUOB 2XM3A 4NMXA 3ISXA 1WSVA 5DRKA 3EM1A 4PKDB 1VC0A 4B10A 3CCJS 5THWA 2V2ZA 4PWWA 3NS6A 3ILJA 1U6BA 4CLSA 3M9OB 2UUBJ 1OS5A 3BQ0A 4BCAA 2E5GA 2G3TA 1BY9A 1RU1A 3IWLA 2PR8A 2ASDA 2DISA 2PE3A 3KLFA 3W91A 2HHWA 5IX3A 3KXDA 2CJYB 2VJUA 1S3ZA 3ZNUA 3IU1A 3MMCB 3J81Y 1BWEA 2GQQA 4C2MA 2PN6A 4P73A 5L1IA 2EBGA 4W9YA 5ETPA 4NLRA 2JEIA 2W8LA 3T1YJ 4ZPBA 4CAEA 1U1RA 2DNMA 2JSXA 4DV7F 1VHIA 1YVFA 2Q43A 1WG1A 1T9TA 2W9CA 4A47A 3EJMA 4ZVFA 2XMVA 2C2ZB 1Q53A 2MDAA 2M5YA 3MECB 4N56A 2H1YA 2J5AA 4RL1A 1JJHA 3WT4A 2EFQA 2KL8A 1NSQA 3TZZA 4NEYA 1NK7A 5HAOA 1UTAA 4NZ6A 2COLA 1S49A 2IM0A 2DF5A 5B0CA 2HSEB 1UP1A 2EG1A 1WEZA 1GFWB 4ELTA 1OQ6A 1HYSB 2ZDPA 3S7RA 3TYTA 4IG3A 4NLWA 4ENOA 3A8JA 3ZZZA 2MQNA 3D1HA 2LEAA 4XPLA 4HDHA 4KOYA 4F9UA 1ZG7A 1LKZA 3GQCA 3MEGB 4WTOB 1YBTA 3MPYA 1BD6A 2X51A 4HDGA 1LWFB 3LWLA 4A8WA 2APOA 3M30A 3SSQA 4CLYA 2KTQA 2E1CA 1X60A 1P1LA 5J2MB 1DTTB 3KK2B 1H74A 1FEEA 1EETA 3LGMA 4E98A 5DDOC 3T19A 3IN5A 3JAMY 5A2QU 1O0PA 2BE2B 4MFKA 3NGDA 3GJQB 3TNVA 5H84A 2F4FA 2CIMA 3KHGA 4ZCMA 4QC6A 1TAUA 2Z3PA 1XIQA 3CVKA 4TYBA 4DU7A 1RHJB 1S6PB 3P96A 2ZH2A 1X4AA 1R27B 4OHYA 3RBDA 4M8LA 4OYAA 3MRUA 2HK3A 1VI7A 1MU2A 2WPXA 2YWEA 3NNAA 1RXOB 2XSFA 4A8SA 4NPOA 4AL7A 3JXOA 2ZEFA 2GHPA 4ZVPB 1U48A 2VG6A 5M2UA 2OMLA 2X3DA 3PZJA 2B8PA 5F8HA 4XPDC 2IRUA 1FRXA 2GFQA 2KVIA 3W6SA 1SL2A 2DY9A 4DR2J 1FRKA 4PABA 4DDFA 2BQ3A 2B51A 1KONA 4M94A 1YVKA 1SKSA 4JJXA 2SXLA 1IOFA 3VWSA 2AFWA 8CPAA 5DG9A 2QMXA 4DJLA 1TFWA 1U47A 2XI3A 3VCDA 2PJCA 3TVYA 1FK9A 5B08A 1IBMJ 2UU9J 2CXEA 1AUSL 1VCTA 2Z2MA 4OI0A 4ID5A 3HD2A 2W7OA 3GE9A 3FC9A 2Q51A 3HX9A 2B5GA 2IAJB 1K0VA 2V2QA 4EU0A 3HKZD 3UVJB 2AW0A 4ZVSB 1SI9A 2JVOA 1RTQA 1FKOB 2CRLA 4DV0J 4HT7A 1N5QA 1I51B 3HDSA 3RB0A 1M4IA 2PDAA 1HIYA 4DSIA 1FRJA 4F3OA 1S7KA 1Q79A 3MGJA 4OYBA 4RUCA 2DNOA 1T9XA 1VDHA 4MHZA 2HS3A 4QIVA 5LJ5Y 2XMUA 5H86A 7AT1B 3S8SA 1PAEX 1WEYA 4QYZJ 3KHHA 3ZZUA 4OL8A 4PWDB 2AT1B 3SSRA 1LWCA 3N0VA 1HARA 2A10A 5HMWA 2NYIA 1TIQA 3ENWA 1H72C 1RBAA 3ZNJ1 1UA0A 2JLEA 3DOMA 1WC4A 3MCMA 4Q0BB 4IFYA 1LW2B 5FD1A 4RWWA 1W2BR 2JFDA 2L3MA 1SH3A 3MM9A 2HFSA 1QSTA 3B3WA 1K4JA 3CCES 1T9VA 2XEIA 1FXRA 4JV1A 1X4FA 3ISND 2HQDA 2PC6A 4NOHA 4KV8A 1RWKB 4LSLB 1U1MA 4WYLA 2C1CA 1EZZB 3BJYA 1M1DA 2PFDA 1D8YA 2XHCA 4RI1A 2UUWA 1LANA 4URQU 4KBIA 2AEFA 4TY9A 4DX8H 1S9GA 4J9QA 4H6UA 3PYGA 3D7SB 1P27B 5HBMA 4K0KF 1NAQA 2R7QA 5LMNJ 4EFAC 4DX6A 2LA4A 2N7YA 2VL1A 2ZOMA 4ZPDA 4MH8A 3PJWA 2P6SA 3A4TA 1RA6A 8AT1B 1Q8BA 4UCPA 3G82B 3I82A 5CYQB 1LW0A 4ECZA 1YLOA 1UZDA 5D3GA 5ADZA 1PUAA 1VC6A 2DR8A 2E66A 1V5VA 5E33A 3CULA 3M6WA 2RSQA 1Q7YT 4LF6F 4IYQA 4LQ3A 4LSNB 5KFNA 3D3CJ 1GMWD 3R5GA 2P9EA 1CJVA 4IUSA 3MM5A 4OYIA 4W4MA 1XEZA 3KL9A 4QWAA 1U0HB 4G3IA 4G1PA 4B3OB 3NY0A 2JEWA 3FMBA 4DL2A 1KHVA 1N5YA 1N36F 1KQGB 3KHRA 4M6IA 2Y0MA 2DTJA 2DH9A 1JLCB 4C4WA 3CJKB 2J9EA 4I7FB 2RQMA 5LMNF 2YVSA 4NYOA 2L9NA 4J9PA 1G4CA 5BYRA 5KT2A 2HHPA 2C2MB 2Y1RI 2IHR1 2VZYA 3H40A 1RE1B 3PGPA 3LAMA 3W63A 1Z1ZA 2V34A 2V77A 4OC1A 4XIUA 1NZ8A 3DU6A 1RB0A 4MHNA 2MZRA 1PG5B 3CXCR 2N3OA 2GC8A 3ZZ0A 2C42A 2BUNA 1U4BA 1L3SA 4S0MA 4P6YA 4ZLPA 4EO6A 2IM2A 1XNQF 3B35A 5GMKa 1JLQA 4E0DA 4K50A 3A3OB 2WVEA 1NM2A 1IKYB 3D7FA 2XO7A 5CYMB 2OPRA 3LANA 5DQGA 1WSRA 4MCSA 5KOWA 2WZNA 3MOZA 1ZM2A 1GX6A 1Q4RA 1FE4A 3ZZYA 3D5MA 3D8PA 4CYUA 2ZEEA 4RW6B 2XSJA 5A2QY 3D68A 2M88A 5B0EA 2BYCA 3RAXA 2RF2B 1KFSA 4NGNA 4QJVA 3B54A 4AVCA 2GVZA 3MMAB 3CPWR 3CCLS 2N82B 1IICA 2C6CA 4U7CA 4UFVA 1ZOTA 3MUMP 2UXCJ 3MEDB 2L48A 1UFKA 4TXSA 2ZH1A 1CJTA 2NZ4A 2LU2A 4PG6A 1TL7A 4O4RA 2R7XA 5DDQC 3KQXA 2CDQA 2GO9A 2ZBIA 2VASA 1VQ9S 3Q83A 3NCQA 4IQMA 1RAJA 3PYDA 1YI2S 2FCKA 2ZH4A 2PDOA 4FYYB 2YNEA 4XO0A 1URRA 4EEYA 2Z2YB 5AXMA 2XY7A 2OEMA 3CNQP 5F3TA 4X4RA 2AFUA 3KUHA 4GVLA 1C1BB 5EUHA 1CSJA 5BR8J 3BO2A 5GCNA 4PZVA 4KOSA 1FI4A 5J1NA 2ZENA 1XMQJ 3IRXB 3GFZA 3PW4A 2LXIA 2YKOA 5KG6A 3PBEA 3M8PB 3DR6A 3FRMA 2KJVA 4C68A 3B4MA 5G20A 2M0GB 4ZP6A 4YB6A 4R6TA 1RTHA 2IJNA 2W7PA 4UQGA 3VATA 2QZ8A 2F9DA 4DR3F 5HMYA 5LRJA 1KC8T 2WZ1A 4E2AA 1Y7EA 2AE6A 1LAPA 1JLGA 2FVQA 4ZPVR 2EFOA 2AJ1A 1Y3KA 1JX4A 3GG0A 2XNQA 4JI5J 5LXRA 2RQ4A 3E01A 3MXHP 4JBCA 4UOHA 4IG0B 1TL4A 2KXHA 4O0IA 3EDRB 3BN4A 4N41A 3BGRA 2ZWPA 2FYXA 1M5OC 3AXKA 1HBOA 4XAKA 2WOMB 2Z0GA 2UXBF 1PJ5A 4WIQA 4FD4A 5BR8F 3PKYA 3GU0A 1LWXA 3DM2B 3EXCX 4LF1A 3HT3A 1C4AA 4QOTA 4K4WA 1DQ8A 3DRSA 4LT6A 4OQJA 5I3UA 5LYIA 3HVWA 1HNWF 2N7CA 2VA3A 4W92B 3HHLB 4C8KA 4DS4A 2KFZA 1UEKA 5KAKA 4JI7J 4DEZA 1S1UB 1UWBB 4WZQA 2Y8WA 4R76A 1G7CB 1ZYQA 3HVTA 1HI8A 2EFGA 2Y1JA 4PSXA 4JI1F 3QGGA 3QJLA 3MPDA 4QPTA 2C2NA 3HSZA 3OV7A 3FYNA 4IH6A 1WUUA 2ZUAA 5CNPA 1B70B 2GGPB 4NGPA 1LAMA 4NJRA 3FSIA 3I0SA 1S6QA 4TNUA 3A13A 1VC5A 1OBRA 3G6ES 4M5DB 5GADU 1RT2A 1I5OB 2RILA 4DG1A 1NDKA 2UUTA 5GAGI 2XB2D 4CRZB 2GMJA 2K7JA 4M3SA 1NHUA 3KKWA 1HWJA 2GNKA 4CLKA 1W2IA 4BMHA 3D6TB 4H4OB 3Q8PB 3OFFA 2IY5B 4Q2LA 4URGA 2W9BB 2HNDA 2Y8YA 1V5IB 4FYDA 1CQNA 1D1UA 4ECQA 3AA9A 1APSA 4IQXA 1OQ3A 4UF4A 1P4NA 4ECSA 3R5JB 1HPZB 1FT8A 3FFIB 3PY8A 3RBUA 4IR9A 3HFKA 5AG6A 1HQUB 5ITHA 2MTLA 2PQ8A 1SJFA 2BQUA 2C3OA 2ZHBA 3FNCA 1TMMA 3D2WA 2DD8S 1SJ1A 4CO1A 2QMWA 2V8DA 2VG5B 1S7LA 1HW8A 3THVA 2PIZA 4BBYA 3ZXWA 3D2MA 1SV5B 5CD4A 3NKYA 4KQZA 2W2QP 3TJAA 2CQGA 4PUOA 4U67Q 1G3OA 2HQCA 1NK8A 4FWUA 3F41A 2FJXA 4BLGA 2ZPAA 1WC3A 3FMCA 4WZMA 3E2EA 3SHPA 4XTTA 2P9CA 1REGX 2FVPA 4JI8J 4B9TA 2A4NA 3QJPA 2KM8C 3M9NB 1WOSA 2HHHJ 3B2YA 2JJ4D 5J2PB 4J9RA 3MMCA 2XTJP 1HD0A 3U7JA 2EK6A 5EHHA 2FQQB 2GA7A 4MCRA 3DDNA 3J80U 1VQ8S 1WC0A 2VZZA 4ZVRB 1FXDA 1QSYA 5C82A 3IBCB 1YJWS 3BPSP 4TVAB 1RWMB 4CP5A 2BABA 1QY7A 2P6EA 2R98A 3TO6A 3OW2R 2XBPA 2V69A 4K2XA 3TJ9A 2UXDJ 2RJZA 1YJRA 2BKNA 3BQ2A 3X1LB 1KQFB 3MECA 4WFNQ 1X31C 4DFPA 2NYHA 4UIAA 2FTRA 4NCGB 2DGOA 2MKSA 3LP0B 2EKNA 2QECA 4QIFA 3J7YU 1R3NA 3D7GA 4KLWA 3GYGA 5D78A 3PW7A 1HYSA 2LQ9A 4OIWA 2HQIA 7FD1A 4C0HA 1NLKL 4PYDA 2FGOA 1WG4A 2VJVA 1U6FA 1XJOA 1RWNB 2QL5B 3QSIA 1PGZA 3QPIA 3FF3A 4P2SA 3SJGA 2UUAF 3MEGA 4NCZA 2WSEC 3L09A 2ZVSA 4AFFA 1JLAB 1LWFA 1ZM3A 3FCHA 3PIPQ 1KD1T 3VZIA 4Q38A 5J2MA 1DTTA 3KK2A 2GAGC 4JP8A 4QW9A 2CQPA 1RACB 2YNDA 3GSIA 3K9TA 2FIWA 3LALA 3SV4A 5EDWA 4KGVB 2MYFA 3WX4A 3DCAA 1CP6A 4IDKB 2GMLA 4I0WA 3G8SA 4PV6A 3TP2A 2E7XA 3D54A 2G4BA 3LA0A 1OY6A 1X7VA 4USHA 5EWGA 3TEHB 2DNGA 4WTYA 5ETKA 4WXWA 4R25A 4ZMMA 4XNHC 1HW9A 2CJAA 1S6PA 3ZZTA 1TFYA 3P3DA 2H5JB 2NCKL 2IJRA 4ZIWA 1NKCA 5KFFA 2HBYB 2N4CA 4WP8A 2MZQA 3TZXA 1YX0A 2FLOA 3CCTA 3CJQA 2J9AA 3UWTA 3VGVA 4N8OA 2ROGA 2HS0A 1QM9A 2MB0B 1ZM4A 1S1TB 4E8UA 4B9VA 3CB4A 1RT6B 2B3UA 2AZ3A 2MJUA 1KVIA 3H0PA 2K1RB 2J7UA 3OL9A 1UVNA 3FZBA 3CXSA 1YKWA 3OVAA 1LOKA 3GP9A 2PJ2A 2IRYA 2AU0A 1KUXA 3UNGC 4Q5VA 3RB4A 1WI6A 2DGVA 5CZVA 2PCUA 2R7RA 2PA3A 4N7TA 2OOTA 2XMMA 4L3NA 1A0OB 2ZNYA 1ZLIA 5AXLA 2OPSB 5J1PA 2HLTA 3ADAC 5C42B 1IIDA 4H4MB 1GTHA 2ZVIA 2R42A 1U7LA 3AT1B 4NEXA 3O2IA 2IAJA 2GS8A 4LRBA 3UVJA 2BJEA 3QJJA 2IM1A 3QWPA 2CNOB 2U2FA 1FKOA 2Q0YA 4IH7A 1KP6A 2VXKA 1CPSA 4GKJJ 1MWZA 3R9LA 4NA3A 1FVSA 3KASA 4RUAA 4A8FA 1VLYA 1X5TA 2EWBA 4O3PA 2A1BA 2B4VA 2EW9A 5FDLB 2PO4A 4PWDA 5F47A 1NDPA 4M5NA 4F2RA 3JSYA 4AD6A 4UFXA 5J8FA 4MHDA 3AJ2A 4USVA 3V6HA 3NCRA 4R5PB 4Q0BA 1LW2A 5KG4A 2OUGA 2CQ1A 1UFHA 2CPXA 2BA9A 3T90A 1REVB 3GYAA 4KGMA 2ZEJA 1VQPS 3O44A 2VF3A 1U8WA 1PBAA 2LQ5A 3EVWA 5CYJA 4MI4A 2KHDA 3UY5A 1WDDA 3HMJG 2DKOB 3UE2A 3T5LA 1JXVA 3HSGA 4DBQA 2ASYA 3UPFA 4LSLA 4TU8A 3P2HA 3RTVA 1GMWA 2XYPB 1ICEB 1JLBB 4WXOA 2PMHA 4OX9J 4NJQA 4DV3J 4OC5A 1YSJA 2DNPA 3RYLA 1YX2A 4ZITA 3MEEB 1BQNB 2JFKA 2WSAA 1DY3A 2OPPB 4R8FA 3NXZA 4MY3A 4FF4A 1F3VA 1RAFB 2ZE2B 2CNMA 1ZETA 2DNKA 1BQMB 4DN0A 2OELA 3PRDA 3G3SA 2HPUA 4PXBA 4DNCA 3H5ZA 4L3KA 1UJ5A 3N4WA 3K2YA 4A8KA 3G82A 3ICLA 1OY9A 2LP4A 4I2QB 2HC9A 2F5IA 5CYQA 4QR1A 3BR9A 5KFCA 1R7IA 3Q8VA 2XGPA 1V3ZA 3KR5A 3WQPA 4V1Ak 2R2TA 3BDEA 3SIPB 5CQGA 5F48A 4P4EA 2LYVA 4CM2A 1XMTA 4LSNA 4JYAF 4Z65A 2E1RA 3KMQA 1ZAWA 1AYEA 5KTQA 2PD1A 3PO5A 1YBAA 4NRTA 5H1SV 5IC6B 2IVMA 2AJQA 5BJRA 3QIPB 1U0HA 2OO4A 1HWUA 4B3OA 3VHQA 4KSAA 2XYGB 1NU4A 4DOZA 2HVDA 1UVKA 2PI5A 1RI7A 4JI3F 1SQGA 4KVME 2JDDA 1NK4A 1SKUB 1XK8A 1HA1A 3CJKA 4LBIA 3MM6B 4I7FA 1QQ9A 3AJDA 1S4EA 4FDFA 4NYPA 1PYTB 2D3OR 5H9FK 3VGUA 3QRQA 5C5JA 4B5PB 2E5HA 3BBBA 3GIIA 1WHVA 5LYFA 4JI6J 4NEZA 5EGYA 5BYQA 4JOUA 1TK8A 3VGSA 2CAJA 1IKWB 2YWWA 2XMAA 4LFBF 1TF9A 3JQKA 2XG8A 4FF1A 1OO0B 5EN1A 3DGVA 2KRRA 3UFCX 2QLWA 4RPFA 4KOWA 2F8HA 3PJ9A 4NLDA 4I6YA 4C0OC 1NB7A 5L46A 3IS9A 1T95A 2W2NP 1TR0A 4U6PA 3T1AA 1Q0NA 3SXNA 4JWPA 3UCZP 5LXYA 4JV5J 3PP9A 2G9DA 4U8YA 1ZO0A 2BSWA 3KI9A 1IKYA 1LWEB 3CJ2A 3C2PA 5CYMA 4JUZA 1CJKB 1VBXA 1SL1A 1RWWB 1RDRA 2GJIA 4RU2A 3OJSA 4NA2A 2HVZA 1PAUB 1K73T 4OHWA 4QYRA 5E5NA 4RW6A 4A2ZA 2GIFA 2MLZA 3LGNA 2GIVA 3EYZA 1BPNA 1QSOA 5KG5A 1VJQA 4O4GB 5HK4A 1RCOB 2DGSA 3AXMA 4ZCKA 3P5TL 1P9QC 3MMAA 4UOFA 2KH9A 3M6XA 3B78A 4O23A 2VOPA 1FNMA 3PB6X 4AVBA 4RKUC 4A95A 2WPWA 3IGVA 3HSJA 4J9SA 2W01A 3MEDA 2ZD1B 3IBWA 4CNYA 1HBUB 3D4JA 3NH4A 2BVZA 2LCWA 2HKEA 3EICA 1AZSB 5HLFB 3V6JA 3QMQA 3CZXA 1MG7A 2W2MP 3Q89A 4PG8A 3DLGA 1Q8KA 2G3AA 4RN7A 3FQLA 2ZEMA 1VS3A 3S1TA 3BKTA 1FNOA 3CIZA 4KORA 3ISNC 5HQMA 1BWVA 3DXSX 1IR1A 3H8YA 2AF6A 3PDNA 3DC2A 1C1BA 1RCXB 2YKPA 2ZBQA 5D6GA 2QFJA 2DNZA 4ES1A 3IRXA 3M8PA 1UVMA 5SZTA 1SUQB 3UCGA 4O0NA 4UOGA 2HLUA 1IBKF 1T3NA 4WE1B 4XPDB 2KVQE 2NSBA 4OZJA 1HMVB 3OT9A 4QWEA 3V6KA 2IA0A 1FJCA 1TU0B 1R8PA 5KFWA 2IMWP 5JJBA 1F5BA 3N6LA 3IJ3A 4KSIA 5A0YB 2KT5A 5GMEA 1RT1B 2HAIA 1M1GA 3CD0A 5LOQA 3L7PA 1C0UB 3BBFA 5KFSA 2GIQA 2HS4A 4OI1A 1YJNS 1NNDA 2A6MA 1RAOA 5DO2A 3MZIA 2HVEA 2IDLA 4OZLA 4ONWA 5KFAA 3VAMA 4NLGA 3TA2A 2E1PA 4IG0A 1S0OA 3IR6B 3FBFA 2ZJRQ 1Q81T 1VHEA 2HWTA 1N0VC 5KFTA 4B12A 1Q1KA 1R43A 2WOMA 5E3CA 2VA2A 2J6SA 3GFHA 4A94A 4M5IA 2F9JA 4DX5A 4WP9A 3JQJA 1U1KA 3DM2A 4MAKA 3CDUA 1QSNA 2HGNA 4EUVA 1I21A 4K7QA 2AFZA 2VKZG 3FEXB 2PMZD 1F60B 2G0CA 1JIHA 4Y2IA 3HHLA 2B4BA 2AX1A 1F1BB 2YWGA 3VQSA 1TL1B 4MKVA 1S1UA 1UWBA 4RWXA 3NBPB 2A0FB 5E3PA 3R95A 3A3NB 4KO0B 3M8YA 2BZ2A 2ADBA 3R96A 4ANDA 4J9MA 5K8MA 3N6MA 2DEJA 3QAYA 3NOGA 1NXIA 3F56A 3EGVA 2E1MC 3A8KA 3V4IB 4OAEA 1LQ9A 1N0UA 2DRBA 2MKCA 4E8OA 1S76D 5CH7B 4OC0A 5LYDA 2GGPA 3NMRA 5ETQA 3QT5A 3ZZIA 4ID8A 1K1QA 4M5DA 1NSKL 5I0CA 2DO0A 2BBEA 4OKOA 4ECVA 3D28A 4RR5A 1PIEA 2BACA 2IYGA 2VC1A 1RBLA 3CE8A 2W9BA 2QIRA 1WI8A 4YY3F 2QL7B 4CLPA 1M1HA 4C8NA 2QT7A 5D29A 3OXFA 4PR6A 3IU2A 1HPZA 2AWZA 1L5UA 2C2KB 1WHXA 3FFIA 2NLWA 1CEZA 4Y0FA 3D3SA 2GLJA 3EE3A 3K5NA 4KVOE 3GJSB 1HQUA 4L72B 2R7UA 4UWIA 4YHHJ 2B4UA 1I94F 1LOUA 5CXTA 2Z8QA 4Y2MA 4UFWA 2VG5A 2ZEGA 2CNSA 3NL0A 1S0NA 2HIQA 2HFZA 1SV5A 2A18A 1NK9A 2KXFA 1YR0A 2QIFA 3MHYA 2EK9A 3B8GA 2B0GA 3QYYA 3O5TB 1U2FA 4ED6A 1RKJA 2ZHAA 2DNYA 3QGPA 2DGUA 3AOAA 2J8MA 2GLFA 2Y1LB 1TKJA 4KVXA 2ZXVA 2AFXA 4CLWA 5J2PA 4N77A 1Y11A 4NGSA 4CYPA 4ECTA 3L7UA 3UN5A 3W9IA 3LW5C 1OYEA 1IQZA 2CPZA 4BDPA 4ES3A 2J9DA 2JEVA 2CQ4A 2G2YA 2BJ7A 5RUBA 1XMOF 1VKCA 3KKFA 4ZS6A 3GLJA 1XC9A 4L74A 2LMIA 2CPIA 1X9MA 2R7TA 2VEZA 4R8UB 4P2FA 3KHLA 1U0SA 3T5JA 1TUVA 3I5AA 1GXLA 2J0SD 3JVNA 1NHKL 4NCGA 1Q86T 4ZX9A 4OC3A 3LP0A 1M5KC 4CO3A 1Z8XA 3TOBA 2KZMA 2E5JA 4NASA 3T9ZA 2XEJA 2CTBA 2MLYA 1RHMB 4Q45A 2YX1A 4HHJA 2HFOA 3TO8A 4H4KA 4B3SJ 1HI1A 1QAJA 3CW2C 4M95A 2BRKA 1TXRA 1RHKB 3IO1A 3BKFA 2MGZB 2CDRB 5J2QB 3RAMA 4QZVB 1J5EF 2P2CB 4ES2A 1LFPA 3W65A 1IGBA 1DAXA 2YBVA 5KFHA 1JLAA 2AKWB 2HQGA 4HT5A 3M2RB 2R9LA 1WK4A 2OSQA 3LACA 4JXQA 5HP1B 2XY5A 4A37A 3OFHA 2ZEDA 1N33J 3PR5B 4LFCJ 2BL1A 4KGZB 1FJEB 4DV1F 2HVHA 4DV6F 4KZTA 2I3CA 3RRKA 4IDKA 1UZHA 4LF4F 4RO0A 4B6ZA 4PSWA 2UV8A 3W3SA 2J76E 4NGRA 4Y00A 4G1QB 2ZM6J 1D9FA 3T1HF 3FMWA 5DS0A 1FKAF 2UVVA 2G1HA 5DGBA 3QFWA 2ZZMA 2WYRA 4ED1A 2PSWA 2VQEJ 4KH1B 4Q36A 3TAQA 2FZKB 2ARHA 1CLFA 3D3BJ 2J0QD 2Y1IA 4HKFA 4MBUA 2QYCA 3UI3A 1GEHA 1IWGA 4OI3A 1KNZA 4EBDA 4PG5A 3WBZA 3D6FB 4H89A 1Q95G 1S1TA 3HK2A 1JMTA 3IMQJ 3B3VA 3QO9B 4U8VA 1DQAA 1RT6A 3NCPA 3G71S 4KHMA 1X4DA 4NL5A 2K1RA 1S12A 1WORA 1ZZNA 4DPUA 5JQ4A 4P4IA 1Q2CA 1X5PA 1HNIB 4FD5A 5DJBA 1HQ2A 3ENAA 5F41A 2FGCA 3QGHA 3FVYA 4PXDA 1FRHA 4UCNA 3M32B 1HD1A 2JRSA 3BYRA 4WK1A 2PJ5A 1NSPA 4JV2A 4DWIA 3MR7A 2QA4S 1Y9KA 1YTYA 5I4MA 3JS9A 2OPSA 3DLEB 1EJ7L 1ZA2B 5H9EJ 3UR0A 2RDIA 5T7LB 2V9KA 5C42A 4WFAQ 4H4MA 1QD1A 1G2EA 4MCQA 2OD6A 2KFYA 3RJMB 2PJ0A 1RISA 4DSJA 3TFYA 2J0XA 4I4BA 1VBZA 2PJ9A 4OLPA 1FFSB 1IQTA 2OPQB 1ELOA 3V8IA 2CPYA 3MF5A 5JH9A 3ETMA 5D15A 1RUSA 4JD6A 2F4VJ 2XZTB 2ZOFA 1N6QB 3I32A 2C6GA 3CT9A 4CLZA 2MZSA 4MHPA 5B09A 2WK4A 1X5SA 2CJ9A 2EUIA 5FDLA 3H8EA 2C1EB 2FY8A 1NMTA 2AHOB 5IFMA 3H5SA 3IBFB 3FCVA 4KPCA 1N4LA 2B9EA 2VU5A 2PGCA 4M5GA 4X65F 1UA1A 2YX7A 3AFGA 2C3PA 4R5PA 4B3MF 5IM0B 4ATNA 1F2HA 4KAIA 1REVA 2X1GA 3TVZA 3PB4X 1JXLA 1X4BA 3H4BA 5F8IA 3HULA 2DNNA 1NJYA 4DSLA 1XR5A 1YVOA 1CM0A 3KQZA 1FXLA 1UFLA 2FHMA 4IRCA 4CAXA 3WC5A 3CF5Q 4KUBA 4JI2F 4HNWB 3NH5A 1JLBA 4QB9A 2BJ8A 1VQSA 3KUGA 2UV8G 2D41A 1WF0A 3P45B 5DQHA 1L0CA 1SIWB 2O28A 3G8WA 4JI0F 1RGVA 4RUBA 3MEEA 1BQNA 2OPPA 4G65A 1MSWD 3J7Z5 5KFIA 2AIRB 4ED4A 2Y0BB 4AYBD 2ZE2A 3U1NA 1BQMA 4HI1A 4HHUA 4ZLNA 3IAS9 4OZ0A 1SC4B 3FDSA 1H6KX 1XR7A 2X7IA 1RTDB 2O01C 3DDKA 4FXDA 3CDEA 2OH1A 1KS2A 5AJ3F 4I2QA 4GRSA 1X0FA 1NZAA 2C2DA 3AY0A 1LCPA 2OH2A 5ETVA 1HFEL 2M2BA 4L75A 2MZ1A 2HFVA 3QSYB 4CAWA 2Z0ZA 4JLYA 3CMES 2YH0A 4PG4A 1CJWA 3VV2B 1IWAA 4FVMA 4UOCA 1YGHA 3KWMA 3BO3A 2V8PA 2BEFA 4U7UK 4OHXA 2OTJS 3ZFVA 2QGFB 2XZWA 1S4FA 3DRXA 1LK7A 5E41A 3GR1A 3QIPA 1TP7A 4GKKF 4E0AA 1IN0A 2V8GA 2IVFB 3ILLA 5KOXA 4X66F 4CGMA 1FWPA 2OFHX 1TKZB 3I9ZA 5FIIA 4U95A 2ZC3A 3JSBA 5AXKA 2CZ4A 2DIVA 2OPRB 3OUYB 2R7WA 2VI7A 3MM6A 3P4UB 2KM8B 1S7HA 1AROP 4K3NA 1FWKA 3G8TA 3MD1A 4LMZA 1PYTA 2WONB 3QLHB 3TAMA 3FX6A 4B5PA 4OYMA 5KT5A 5F0UA 2VFSA 4OYPA 3MPWA 2W4DA 1H2VZ 1IKWA 4LSZB 4NSQA 4PXCA 4I2PB 5E3QA 1U6MA 4HTIA 1VBYA 1UWAA 2QYGA 2M52A 5F9LA 1QSRA 3I55S 3M2VB 1R57A 4A30A 3Q2SC 3AOCA 3FNNA 5GAEI 3WHIA 2HGMA 4NLXA 2F1FA 2QLJB 4F0MA 4OADA 3F5BA 2Z10A 2HG4A 5F9NA 1V0CA 4KHPJ 1F3FA 1H2TZ 4GMKA 4AG7A 1LWEA 5HVHA 2UP1A 4X62J 2DR7A 5KFRA 1CJKA 2P5VA 2N3LA 3JQMA 3I1UA 5I3PA 4ZJOA 2KT3A 4ZCLA 3KLGB 2OU2A 3V4MA 2G0IA 2FPHX 2PJBA 3DDDA 2MZTA 4HI2A 1KQSR 2EXUA 1RT3B 2E5LF 2KFNA 5E2QA 2PVWA 2YXLA 2LU1A 1NK0A 2EPIA 1YIJS 3H42A 2HHQA 2KKHA 2YQ1A 4O4GA 5A8WB 4DQRA 2AJ0A 4A32A 1NO8A 4K4UA 2HK2A 2PR1A 4P7VA 2WVCA 5KT6A 4J3GA 3KHZA 1HWLA 3ZTOA 1OMSA 4B3RJ 4P2MA 4CIOA 2NS1B 2JBKA 2V4JB 5AE3A 2ZD1A 4NXNJ 3SJXA 5GAHU 1M5VC 4NGQA 5JGFA 3LH2S 4ZVOB 1HBUA 1M4DA 1TUWA 2XHWA 4ECXA 3Q2TC 4C2YA 4OYXA 2W2PP 1AZSA 1FD2A 1TTHB 4DR7J 5KFVA 2J6UA 4ALZA 1VGYA 5CZXA 4FXVA 5DLFA 2PE8A 2DCUB 4DFJA 1M4LA 3I9V9 2K3IA 2CXAA 3CJ5A 1I3OB 1MW7A 2WHOA 3HZEA 3D1OA 4WU2A 4AL6A 3HO1A 4F4XA 1U2CA 2BE7D 2CFXA 4FBTA 4WE1A 4JZ0A 1I1DA 2J0WA 1HMVA 5G22A 1FVQA 4R57A 4ZP9A 3OR2B 1NJWA 2ROPA 1FTRA 2RIJA 5A0YA 3R1KA 3JUWA 1RT1A 1VIOA 3PRVA 2ZJQQ 4C0BA 3W9JA 5L1JA 3FRZA 2PC1A 1D8ZA 1FERA 3A9LA 1C0UA 3I9SA 4A8QA 1QDUB 2FY1A 4CGNA 4USKA 4NXNF 4ZVGA 2H9ZA 2XS2A 4B9UA 4ZN1A 4NLPA 2XZDB 1NH8A 1SC3B 2KJWA 4IOBA 4A8XA 2R8GA 4OV1A 1YRXA 4LVNP 3H4QA 3UQSA 4DQQA 3PW0A 2O53A 3R2DJ 3TOAA 3H59A 3B82A 2QSFA 1VK8A 1U1QA 3GJTB 3MCSA 4CCHA 2OB0A 4YDXA 2YX4A 1OSDA 5LSOA 1Q16B 2MPUA 1R31A 2LDIA 2D4OA 2G13A 4A33A 1KFDA 1H0HB 2Z3LA 1K8AT 3R2CJ 4DL0C 2J9DE 3V7ZA 2ACMA 2AD9A 4IFVB 1RU2A 4IF5A 2Z3OA 1TL1A 1Q2DA 4WFBQ 4P74A 2H5EA 3NBPA 4DV7J 3H5UA 4KO0A 1N5TA 1E6VB 3PEHA 1LXJA 4C9DA 2V0NA 4AXIA 4WU3A 1NCLA 1HR0F 2V50A 4ZVTB 3V4IA 2VONA 2VFTA 2Z4PA 1XBUA 3O1LA 4FPRA 3K5LA 1ZPVA 1UW4A 2MQPA 2QMLA 1U49A 2ROEA 3BN7A 4WFYA 2PIYA 3OTOF 1IKXB 4NF1A 3K57A 1HBMB 4MJKA 2ABZA 5F8JA 2CJKA 4OX7A 6AT1B 2QLXA 3L7OA 4YWYA 2DRAA 3W60A 2BX6A 1KR4A 3DYAB 2DO4A 4B3TF 3MFIA 2CQHA 4Y2CA 2X1BA 4DR1F 2CZVC 2XULA 3I5BA 4DSEA 3S6GA 4KOUA 1Z4EA 1FDAA 3M8QB 4AXVA 3BEGB 2DK2A 1GQEA 3C14B 2EKYA 3PM9A 1L3KA 2GQCA 1DRZA 3L95X 3CMQA 4CO5A 1I1GA 2FJAB 4OYWA 1HNZF 4M5LA 2BDPA 1WDTA 2ATLA 1F5CA 2H5IB 2E5IA 2B9WA 2A3JA 3M1VB 1R0AB 1S72S 1MMLA 1ZBTA 3AD9C 4YOEA 1SQEA 2B6AB 3EFAA 3PRBA 4R3KA 3BH6B 3D6MB 2NR0A 1FEHA 1DARA 3KK1B 3CTRA 2EK8A 1TKHA 1X4HA 3BGFA 4LF7F 1FDNA 3T9YA 1KLNA 1X5OA 4C8OA 3M05A 4ZPCA 3EZOA 4NA1A 4M5HA 2RKIB 2VPXB 2FHJD 3BSCA 3FIXA 2JZ5A 3DMJB 4CAVA 3RB3A 4OJHA 4WWSA 2Z3KA 2ILYA 4B9MA 1VQNS 3W5XA 4OI4A 2YQ0A 4N76A 4EVYA 2REFA 4LF9F 2QLFB 1C0TB 4R8UA 2XLJA 2UVWA 3C6UB 2Q4ZA 5G0RB 1D09B 1Z5RA 4IK2A 2QE5A 1EKRA 1RWOB 2E9TA 1BLLE 3CCMS 3RYOA 3VAHA 3T3FA 4AB7A 2QYVA 3W64A 4OC2A 1RTZA 4X84A 4U5YA 2B9YA 4PAAA 2HZVA 4OI2A 5IXUA 2GAHC 3H2VE 2AJ4A 3UD5A 3IP0A 3U27A 2KG1A 2QMUB 1QLNA 2GHVC 1SJQA 3SI8A 4LF8F 1B4SA 3NRBA 2JEGA 1WG5A 4RNMA 2DH7A 4QVTA 3MTKA 1RXTA 3SCIE 3IGRA 2GJFA 4F9VA 2MGZA 4ZDNA 4C8ZA 5J2QA 3GIKA 4JI4F 4A8YA 1EHWA 5DWMA 2OR4A 1Y0YA 1ELLP 1W25A 1ULRA 3M2RA 5D4NA 4AG9A 5HP1A 4WP3A 1RAAB 2FC9A 1MWQA 4C97A 2EFNA 3KYLA 2HHSA 3S6HA 1S10A 2Z2LA 1X9WA 3GPAA 2XQCA 1N71A 3TO7A 3POTB 2HBQB 3QQCD 2L9WA 2NSCA 2CZ9A 4GC6A 1SKRA 3TO9A 3CD6S 4G1QA 2K5TA 2Z58B 2KYXA 4H6ZA 3HHDA 2VQFF 1RABB 4R3LA 1VHOA 4XPKA 2VH7A 1H38A 2QVPA 2IA6A 2IRXA 4X5KA 3R6LB 1RLCL 2JOQA 5KFOA 4C48A 2DNHA 4A8MP 4A4JA 3K59A 5D4OA 1M5SA 3DRRB 1NB2A 3N28A 2XGQA 5F8GA 4M5KA 3OTDA 4QYZK 4KKOA 4MFPA 1HNXF 3GIUA 3MR3A 2LDYA 2X7BA 3BREA 4B13A 4ER8A 3NE8A 2OMOA 3EMTA 2VFVA 3QO9A 5F8NA 2QL9B 4I56A 2W4CA 2HV2A 4G6VB 3DOKB 3T9NA 1JJ2R 4K0KJ 4JV0A 2ALYB 4K5RA 4RNOA 1H7XA 5L39A 9ATCB 1VQLS 3HHKA 2Y3YA 3K5MA 4NWBA 4DCJB 1VQOS 2U1AA 1HNIA 4DPYA 1ZAXA 4KB7A 2MY7A 1Y5LB 3OTCA 3IR7B 4UA3A 1D3WA 1KBRA 3L4BC 5MAOA 3M32A 4QWBA 4KOVA 1SQFA 4RNHA 1BO4A 3LPYA 2DHXA 1DE4C 1QE1B 5HO4A 2ZW5A 2R8HA 2GREA 3IEHA 1XNRJ 3DLEA 3R5DA 3A12A 3PB7X 1UJ6A 4TWEA 2VFRA 2B7BB 4LF6J 5T7LA 4RNFA 4MFBB 2XI2A 4II9A 3Q86A 4ZLJA 3H4DA 3R5CA 2BM1A 5JVHQ 3GFYA 3PW5A 3CJ3A 5D0RA 4EZ9A 4MIBA 1AXQA 5C25B 3GMGA 3MMBB 1YZ6A 3P49B 2HNZB 1OWXA 3MUTP 2OPQA 1RZMA 1X9SA 4DR6F 3TQ1A 4Q43A 4M6GA 1N6QA 2DNLA 1N36J 5LMUJ 3SV3A 3G6VA 3VAKA 1IR2A 1PCAA 1VK3A 2W2OP 3BHXA 4WPAA 5LM7E 3TARA 3EZ5A 3CJ0A 1R8BA 2ATCB 3PNIA 5EWFA 4M85A 4IOAQ 3D2PA 2QJ8A 4B9LA 4B14A 3W1YC 3OHAA 3RR8A 5C2GA 1J5OB 3G8QA 2FZGB 1KOHA 4RBVA 3ZTRA 2YNCC 1F9FA 2CPHA 5IM0A 3TA0A 4B5OA 4DL3A 1KVJA 3ILIA 4MFLA 3FEZA 4PEOA 1BAVA 3OBIA 1SPBP 1XNRF 3W5YA 5G4DA 3AOBA 2FB0A 3P6YC 3P2FA 5AG5A 1QSLA 2HGLA 1VR6A 1XNQJ 2MZJA 3NFZA 3OVBA 5KT7A 3P8BB 2HB6A 2J8NA 3I87A 4LX9A 1Z2LA 1VISA 1NJIT 2OZHA 1DTQB 4IKAA 4CM0A 2FJVA 2I9SA 2YKMB 4RZRA 3ONQA 3MCNA 3SYZA 2PT0A 1RWXB 4RS2A 2AMCB 1WTBA 1FJGJ 5KFUA 3FEEA 2IVYA 2X1FA 3IC1A 2IFXA 2DHGA 1O6XA 4ZN3A 1FF2A 5LMUF 5IT0A 1F2PA 1U02A 4OZ3A 1FFGB 4FS1A 3CCUS 2AFSA 5CCLA 4ZP7A 2LXUA 3JYTB 4M6HA 4A39A 4Q2MA 1RTDA 4ZLLA 2FJDB 5F09A 1FCAA 5DQIA 5D4LA 2ZNZA 5IZHA 1VOMA 2HWHA 4NMLA 2WRMA 4W98A 3MR5A 1JQGA 4YFJA 5CHCB 1V6HA 3K17A 4A31A 4RU9A 4F0XA 4IO1A 2F8EX 4P7TA 4KTQA 2A2CA 3N6NA 2CPJA 2MKJA 2W8KA 2DPIA 1TKXB 3K8VA 4YS2A 3IS9B 4NI2B 5HI7A 1AA1B 2B5JB 3DOLB 2PJ3A 3R7NB 1TKZA 1ARLA 2VQYA 4CQ1A 1VLOA 4TU9A 2VDHA 2BW2A 5C24B 4TY8B 3OUYA 1N5VA 3CCVS 3UD4P 2XMTA 3AODA 1FJGF 3M2UB 3MR6A 3VAGA 4KIAA 3HLUA 2EVZA 2WONA 5HMXA 3QLHA 3IRWP 1W7WA 1NMEB 1Y9OA 2POKA 2JH3A 5DGAA 3NH8A 1YJTA 4CT8A 3K5PA 1WF2A 5DG7A 4I2PA 1QUPA 2PIIA 4MMOA 4ERDA 3C6TB 4DR3J 2CPDA 3S6KA 4HPSA 1H98A 2F63A 4RUHA 3HFVA 3M2VA 2VBZA 4O3NA 1FE0A 2HQFA 4PWUA 2CG8A 1UKUA 4BINA 1RT5B 1TQLA 2RQCA 2AZ1A 2HURA 1M4GA 1A6LA 1QTMA 3HI9A 2J8SA 4H54A 2AEJA 2MQMA 4N47A 4RX6A 4ZKAA 3I3GA 4LUBA 3RBXA 5K5MA 3ISZA 3WR7A 3DLGB 3EXNA 2VV5A 4I67A 4OLOA 3HT0A 2QFIA 2YNHB 3KLGA 2D4PA 4FZVA 4D3GA 3GIJA 2CTCA 3W2WB 2UXBJ 3TJ8A 1RT3A 2XNRA 5A8RB 3HPOA 5HVFA 2EC0A 2DXFA 4C6AA 1CG2A 1FTCA 1KQKA 5A8WA 3BSAA 2P0WA 4UY85 1RAHB 2NMTA 4LRDA 1HNWJ 4R0EA 5AE1A 3U02A 1WEXA 5JXSA 4FBEA 5C2CA 3FSXA 3GCWP 1NHVA 3V81B 4JXRA 2V4JA 3KG0A 2XLKA 4JI1J 4MJ8A 2JHEA 3KHXA 4IOCQ 4CS0B 2N4DA 5KT3A 3H7HB 2PA8D 1O5JA 1CC7A 2QO3A 1FD8A 1X0PA 2V2VA 2XMJA 4P10A 3LP2B 1T0TV 5J8CA 3CD7A 4NXYA 4C7QA 3QAHA 1JWWA 4N5SA 3IAM9 1DHMA 4RW7B 1S9FA 3BV8A 3GV7B 5F46A 4RLEA 1N56A 2I79A 3IM9A 3JTNA 1SQHA 1IBCB 3MAQA 1Q5YA 2HZCA 4HACB 2OSRA 2EEYA 3CEDA 1YITS 1KWMA 3QAEA 2D3ZA 3MAHA 1Z8TA 3GKRA 4U7UD 3OR2A 1PYOB 4Z7YA 1NKEA 3F44A 2RDJA 3F0AA 4KR0B 2V4RA 4PQUB 4ZY0A 2B3VA 4IO9Q 1IBLF 2Q4YA 1P1TA 2BJ1A 3FECA 4ZI6A 4U9YA 4ECWA 5KG2A 4C8YA 2PVVA 4YR2A 2GVDB 2MKYA 4ZVUB 1MK4A 1M0SA 2XS7A 1UVLA 2FJWA 4DV5F 4AE5A 1U09A 5KFQA 4NLTA 1Q7LB 5F49A 4PPZA 4X64F 3EPIA 4F4YA 1UCNA 4YMEA 2JWNA 4KE5A 1RHUB 3V5RA 5GADI 2PEHA 2P9GA 4OZNA 4MTPA 2G0JA 2IC3B 5IWAF 2DYAA 3IGNA 5KG0A 2WSFC 1B7YB 3RUBL 1NPRA 1T9WA 2RRBA 5F8MA 3PTWA 4NLSA 3HM9A 2J7WA 2HHXA 5HVGA 3TUZC 3FVLA 2DXEA 1MJBA 4OIXA 3DI6B 3SCJE 3EVMA 3GG1A 2R8JA 3Q8SB 4HH1A 1XFOA 4CPAA 4IFVA 4USWA 4J9UE 4NRUA 4NXMJ 1RO5A 2AQ4A 4WYWA 4EFDA 2J6TA 1S0VA 2PJ7A 5K14B 3T6BA 4EZ6A 1E6VA 3QRPA 1DZ5A 1H7WA 3H2LA 4ZK7M 3RB6A 3DLLQ 3FEDA 2ZBCA 2ZELA 3CJTA 1J4JA 1GTEA 3WX8A 2ZW4A 2X1AA 3K58A 2FHKA 3CUNA 3H90A 2PMWA 1BMQB 4QW8A 4Q7AA 1T05B 4DPTA 3L2NA 3LQVA 1IKXA 1N88A 1TELA 3BSNA 1HBMA 5F3ZA 5L1KA 3KLIB 1RWPB 2KRBA 1G6BA 3H2UB 1RWUA 2JLFA 5EC4A 3BQ1A 3DYAA 2KYZA 4F0YA 1H73A 4KYZA 1OSCA 5A6PA 1SIZA 3S9MA 3H8GA 1AUDA 2E9ZA 5I42B 4CZCA 2BOPA 1TF8A 4FKXA 2UUAJ 2MY8A 2EBEA 2D9OA 3R97A 3KFWX 4RJVA 3MURP 2QV6A 3M8QA 2QC3A 1S57A 3DLKB 3LD2A 3C14A 2E9RX 2AV5A 1IU8A 1UMJA 2WW4A 2XMWA 3PW2A 1CJUB 3LODA 3DU5A 4NXMF 2B7CB 2IJZA 5A8KB 3VAJA 5T41A 1AMPA 2IMOA 3T5HA 5J1EB 4OJ3A 4Z2XA 3O8WA 4ZJLA 2DEAA 3M1VA 1R0AA 4A46A 1F2OA 3ZC4A 1VRQC 4WWVA 3D6HB 4CT9A 5L8RC 2REEA 4UZBA 4KSFA 1N34F 3BO4A 5LT5A 2B6AA 3VVUA 3G87A 4P2XA 4CLTA 3J7YI 2PI4A 1RT4B 2XYHB 4DUYF 2UUCF 3TAPA 3PFEA 4CO0A 2Q79A 4MKAA 3KK1A 1XRYA 1IB1E 1IKVB 5E3RA 4CDIA 2CPFA 1HLWA 4KSEB 4R0JA 2W24A 4CRYB 1P9YA 1S7FA 4ELVA 3F73A 2ABYA 3SQGB 1VRTB 3CCRS 3TX8A 3CO0P 2AYEA 4YB5A 2RKIA 4EYIB 4UW2A 2V68A 3W61A 1SH0A 2K2PA 2DNQA 3HF5A 4F4KA 3BKUA 1T3OA 3DMJA 4NX9A 2CWXA 3DLJA 4HR2A 1S5KA 3KLHB 3GYNA 2FJBB 3PKMA 4USJC 8RUCA 1RJJA 2NXJA 1TAQA 1C0TA 1OIAA 3VAFA 1XQIA 3C6UA 2J8RA 2NXNA 5G0RA 4USTA 2R8KA 3MM8B 2RU3A 2RQKA 2HRTA 2GFFA 1D0EA 4WJBA 3NGRA 3GUXA 4F4ZA 2AGQA 1XE4A 4F0HA 2VBWA 1S48A 2ZHOA 4TNOA 1Y10A 2XWXA 2V4QA 3D7DA 2O3DA 3NAHA 1LXNA 4KY3A 4YU9A 3UW1A 1R0CB 1Q78A 1MWYA 1PBUA 1X4EA 1GK8A 3NS7B 2JEJA 2JDCA 1N32F 4IR1A 3KDOA 4J37A 4P9SA 5HN0A 3KJQB 4TN2A 3DKDA 2F65A 3PB9X 2BR0A 3CJSA 4NLUA 4HL9A 5D4PA 1S59A 3RBEA 4ED3A 2CQBA 4UZCA 4NFRA 2HBRB 4OMEA 1F2GA 3R7SB 5EX3A 3SFUA 2YTCA 7CPAA 1J2VA 1KLMB 2ZBPA 3N5FA 2VDIA 4GM5A 2QLBB 2OKQA 1RP5A 1MN9A 4EO8A 5B0GA 4YFUA 4L89A 4ANCA 1FY7A 4MIAA 2ZKTA 1C2PA 1U1PA 1ZTTA 2HBZB 3ZTPA 3POTA 2BW7A 4DZ6A 4NE9C 1IY7A 3ZTQA 2W7AA 2K3KA 3DSBA 4LJMA 3CCSS 4LQ6A 1C1CB 4Z7CA 2XY6A 4WKRA 3GSDA 1Y7PA 2G2OA 1SKWA 2UUBF 4LREA 2GANA 2Y0SD 2BE9B 3RO0A 4N8NA 4PCQA 1B0PA 4F8RA 1JXEA 1J27A 3LPEA 3Q8YA 3HLPA 3A3PB 1B6BA 2HQYA 4NLYA 2D74B 2IPOB 3DRRA 3VZHA 3BYPA 3VAIA 5BWAB 3T1YF 5CBMA 4B17A 3NS5A 3VWDA 3NAIA 4DUKA 1JB0C 3DLHA 3VH9A 1JLEB 3DOKA 4ILMA 3LOUA 3C19A 4BC9A 1Q8LA 4X4OA 2WVFA 1WF1A 2FVGA 3MTJA 2K06A 4I6WA 3PB8X 3OWCA 4P45A 3ET6B 5HANA 3WDOA 1EKSA 3H8FA 4B9NA 1NSAA 2FE7A 2GX8A 3OPKA 2DPJA 3FGVA 4QR2A 3BI0A 2XEXA 3PJXA 1Y9WA 4CRJA 2RUGA 3T41A 1QE1A