3DLJA

Crystal structure of human carnosine dipeptidase 1
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
477
structure length
471
Chain Sequence
PPPALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLGQSLPIPPVILAELGSDPTKGTVCFYGHLDVQPADRGDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWISKPAITYGTRGNSYFMVEVKCRDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTKEEILMHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVIGKFSIRLVPHMNVSAVEKQVTRHLEDVFSKRNSSNKMVVSMTLGLHPWIANIDDTQYLAAKRAIRTVFGTEPDMIRDGSTIPIAKMFQEIVHVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFAAFFLEMAQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-Ala-His dipeptidase
publication title Crystal structure of human carnosine dipeptidase 1.
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 136
structure length 471
sequence length 477
chains with identical sequence B
ec nomenclature ec 3.4.13.20: Beta-Ala-His dipeptidase.
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dljA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3dljA01
3FECA 1CX8A 3KGQA 2ZEEA 3FH4A 2CIJA 2JBJA 2WZNA 2PJ0A 4IAVA 2PRQA 2RB7A 2EWBA 2F7VA 4UEZA 2AFZA 1LAMA 4P44A 3WC6A 1ELMP 4IK2A 2V8GA 1UWYA 4EFDA 2OOTA 3IIBA 3MN8A 3H8GA 3QNVA 1ZG9A 1XJOA 4OP4A 2C6GA 4PXCA 2I3CA 2V8VA 4MHPA 4OIWA 3L2NA 2DEAA 2ABZA 2PJ8A 1AMPA 4P4JA 1TXRA 1Y0YA 4OC5A 1LAPA 3GB0A 4B6ZA 4A38A 4MXUA 2PJBA 4FWUA 2EK9A 3B2YA 3TX8A 4R6TA 4ONWA 1BPMA 4OC0A 3FX6A 3KR5A 1EE3P 3GLJA 5D29A 1YSJA 1CP7A 4IHMA 3D67A 3LWUA 4X2TA 1Y7EA 4MCSA 2XEIA 4Z65A 4NGRA 2EK8A 3BXMA 4R8FA 4OC4A 3SI1A 2GLJA 1XBUA 3BI0A 1FNOA 4UIAA 3PFOA 4OC3A 3DLJA 1YLOA 1Y0RA 5LYLA 2J9AA 4UF4A 4NJQA 3N5FA 2PJ7A 4ZYQA 2HC9A 3FEDA 1Q7LA 4P10A 1BAVA 1ZLHA 5K8NA 1PYTB 3NA6A 1LANA 2ZOFA 1H8LA 2O4HA 3LMSA 4MCPA 1ZLIA 3KL9A 3BI1A 2ZEDA 2CF4A 4NJRA 2AFXA 4EMEA 3D7FA 3PEIA 3NFZA 3KQZA 1ARLA 5LRGA 3PRTA 4X8IA 4DYOA 3D7GA 3VATA 4UEEA 1Z8LA 3SJFA 2AFWA 1HEEA 3V38A 2PJ1A 3IO1A 2PCUA 2Q51A 4OC2A 4DJLA 4A37A 1RTQA 3KHZA 1ZG7A 2IQ6A 2BOAA 4FBEA 1ELLP 3B3SA 3DGVA 1OBRA 3S9LA 3KZWA 1LFWA 2XEGA 4FUUA 4LQGA 4PPZA 2ZEPA 3IWWA 2C1CA 2PVWA 2OR4A 3B3TA 1NSAA 4F8ZA 4PXBA 2FVGA 4W9YA 4JZ0A 4NGSA 1R43A 3K9TA 1IY7A 2GREA 1Z2LA 2RFHA 3IFEA 3B7IA 3NH4A 2G9DA 2JEWA 2AFMA 4JYWA 4P4DA 3PB7X 2C6PA 2ZEHA 4NGTA 3MRUA 5HVHA 3PBEA 5HVFA 2IMOA 1IGBA 3KHXA 5DS0A 3I1UA 1VGYA 4YU9A 2PJAA 4OMEA 4PQAA 2CTCA 3RBUA 3B3CA 2QYVA 3FVLA 4MHNA 2PIYA 2XEJA 2PVVA 5CBMA 3SJXA 2POKA 2PIZA 4P45A 1M4LA 3PB8X 2GLFA 3HLPA 4PXDA 4NFRA 5IB9A 1PCAA 4WJBA 3IEHA 4R76A 1TF8A 3H8EA 4MHYA 5LYIA 1BPNA 5D8NA 2Q43A 3HUVA 5LRKA 4Q7AA 3PB9X 1QQ9A 5K8PA 4ZY0A 1HDQA 1YW4A 4MRIA 3T8WA 2ANPA 1AYEA 2F8HA 2AFUA 1XRYA 4P4BA 3PB6X 3SI0A 2QVPA 3TC8A 4NGMA 3VH9A 2ZEMA 3D4UA 3D68A 4BD9A 5ELYA 4CPAA 2XEFA 1TF9A 2PJ6A 3KASA 2V8DA 2BCOA 1VHEA 3FF3A 2ZEFA 4MMOA 4TWEA 2GU2A 4OC1A 1CP6A 1TKJA 5I4MA 1VIXA 3D7HA 3KQXA 1TKHA 2ZOGA 3CT9A 2NSMA 5CPAA 2JBKA 3FEEA 4P4EA 4UEFA 3ISXA 4ZY1A 4ZX8A 1YW6A 3WABA 3FJUA 4MCQA 3PFEA 4ZI6A 2ZEGA 3ISZA 4P4IA 2V77A 3B3VA 4X3RA 4FAIA 1Z5RA 1GYTA 1KWMA 4MCRA 2CTBA 5LYDA 3S9MA 4A39A 3S9NA 1JQGA 4P6YA 3D7DA 5LRJA 1XMBA 4R7MA 1LOKA 3IC1A 5JGFA 3NH8A 3PB4X 2NYQA 3V7ZA 1VHOA 3VARA 4K3NA 3FMCA 4A94A 3SI2A 2PJ5A 1ARMA 4YWYA 1CG2A 4PXEA 3RAMA 3SJGA 1FT7A 2ZEOA 4ZY2A 2PJCA 3CPXA 2PJ2A 4OKOA 1ZG8A 4F9UA 2O53A 5JM6A 5THWA 2BO9A 4O23A 2AFOA 3CDXA 4GM5A 4WWVA 4H2KA 3B35A 1BLLE 1CBXA 3WC7A 5K8OA 3BHXA 4AXVA 3GUXA 2C6CA 5JH9A 3PBBA 3JRUA 1HDUA 4KSIA 2PJ4A 1F57A 6CPAA 5F09A 2ZENA 1DE4C 4OIDA 1LCPA 3KR4A 5J1QA 3WC5A 1CPXA 2Q4ZA 4ZX9A 2ZELA 1QMUA 3NH5A 4P4FA 4TNUA 1R3NA 2V8HA 3B3WA 3K2KA 5HXDA 4F9VA 2QJ8A 1CPSA 4G1PA 1XFOA 3H8FA 2VL1A 4DUKA 3SJEA 2PJ9A 7CPAA 1F2PA 5K8MA 5LYFA 4MHZA 2WYRA 4NGNA 2PJ3A 2AFSA 2IJZA 2PE3A 3WT4A 3KI9A 4EWTA 3RZAA 1F2OA 1DTDA 1TKFA 4RUHA 4NGPA 8CPAA 5HVGA 1YMEA 2HB6A 3CPAA 4NGQA 4UIBA 3D66A 3IJ3A
chains in the Genus database with same CATH superfamily
1Q86T 3LP1A 2GGPB 5J2MA 4QPTA 3UPFA 5AXKA 2YNCC 2DR5A 2AT1B 3H4BA 5KFIA 1DAXA 3S7RA 4C8LA 1U8SA 1IWAA 1QLNA 5AG5A 4C11B 4OP4A 4BHQA 3WHIA 3Q8PB 3SCKE 2BQUA 5ADZA 3M8QB 1WI8A 3IP0A 2FUG9 3TI0A 3RGIA 4JYAF 4H4OA 3CD7A 4AQYJ 4NSQA 1R0BG 3J80Y 2I79A 2QECA 2ZH1A 1EE3P 1U6MA 5H84A 1T8EA 3R9FA 4DCOB 1KQSR 4UWIA 1N34J 1NK5A 4DPTA 1Z4EA 2HK3A 1Q2CA 4UOHA 2EI5A 4D3GA 1QSRA 3RYLA 3AFGA 3S1TA 1FDNA 1Y9KA 1WACA 4LJMA 1EZZB 3BR8A 4M5NA 1N5TA 1YLOA 4WP9A 4CLSA 4L3KA 4NLXA 2ZWPA 5K5MA 3N5FA 1T9YA 2ATCB 1UEUA 3KLFA 3IBCB 3C2PA 3ZTPA 1X4DA 2CDRB 2JC1A 2JOQA 2DO4A 2KHDA 4WYWA 1U6FA 4LMZA 3EWGA 1VQPS 4ZVRB 3C6TA 1NK7A 1RYSA 4ZVQB 3B54A 1NLKL 4L72B 2BUNA 2CJYB 5IT4A 5KFVA 5F8HA 2PO4A 1N8RT 2VG5A 3EX7B 4DQQA 3CDUA 1LV5A 3DGPA 1OPIA 3NGTA 1BLUA 4C8NA 2KT5A 4F0HA 3GYXB 3QO9B 3FBUA 3KZWA 5D0EA 3GSIA 3T6BA 4LF7J 3HZGA 1U4BA 4YEAA 1F9FA 4N56A 3IU1A 4RU9A 3I6PA 2GV1A 4M5LA 4B08A 1RISA 1T03A 3NBPB 1XR6A 3SCIE 3S8SA 1R43A 3IXQA 4IH6A 2FSRA 4A32A 2VF3A 3ETOA 3CDWA 2J76E 2MDAA 3PW0A 4GVLA 1S12A 5I3UA 2DK2A 2AFMA 2HZCA 2C6PA 3DLGA 2AX1A 3IN5A 1IGBA 2WBMA 4LBPA 3T19A 5CABA 1V5VA 3NAHA 2FVQA 1LWEA 2GIQA 4NPOA 2PJAA 3RBUA 4BMHA 3R5BA 4YN3B 2QMWA 5IM0A 1IM6A 3KFWX 4MKAA 3MOZA 2Y8WA 3FEYB 2HNZA 3UD3P 3CJRA 3DRPB 2XYPB 4I6WA 4LSNA 3SFGA 4HH1A 1HPZB 2YKPA 3P45B 4LFCF 3FQKA 1NDPA 3CB4A 4MAKA 2B43A 2C2MB 3LWLA 3MMCA 2R7XA 4DU8A 3DRXA 4WIIA 3FSIA 2M3DA 3FC9A 3MURP 1GAOA 2BVZA 3A3PB 1MROA 5CCLA 2HHSA 4KHPF 3GIRA 3HHLC 1HBOB 4B3TJ 1S6PB 3D3SA 1HHQA 4ZP7A 1GXLA 3I5CA 1K0VA 3KASA 3CJ8A 4K8RA 1VHEA 4EBEA 5A28A 3P49B 1PIEA 2BABA 4DV7F 1NKCA 2ZBRA 2R42A 3A9LA 3M8SA 1RKJA 2DPIA 2XLKA 3HJFA 4DFPA 5E0OA 1TKHA 4ERDA 2G2OA 3MPVA 2K3IA 4ZY1A 3PRVA 3UDVA 4F2RA 5C2GA 3M9MB 5KOXA 1OWXA 1ZAXA 5LM7E 2YNCA 5IV0A 2MLZA 3DC2A 3BQ0A 3LALA 1SCJB 1Z5RA 2FZGB 3ZTOA 5EBVA 4DR2J 4OV6A 4F02A 2MKSA 1VLOA 2GVZB 3DHWC 3RBXA 3QFHA 3ZZUA 4ZHRB 1CG2A 2N7CA 3RAMA 1N54B 3DCAA 1IU8A 1SUQB 2XZDB 1HBUB 2EBEA 1VQ8S 4ID5A 2YNGA 4DQRA 2VU5A 2JSXA 4KYZA 4OLLA 1VBYA 2OUGA 1MU2B 1BWEA 3GUXA 1UP1A 3C15B 3KJNB 1AUSL 1RP5A 1S97A 1HDUA 5KAKA 3DDIA 4NXYA 3UO0A 4FS2A 1TMJA 1S9EA 1CC7A 5CHCB 5F09A 2Q3PA 3TUZC 3AY0A 1RTJB 3OL6A 2PDAA 1RHRB 4C48A 8ATCB 1QSTA 4YY3F 2VFRA 2MZSA 3DRYA 5E33A 6FDRA 4YUDA 2R9LA 3C8YA 4F9VA 2RU9A 2P6EA 2RSQA 3GKRA 3A4TA 5IC4B 1B0PA 4OX6A 2HNDB 2QLWA 3GR0A 2HQFA 2G0JA 3BSCA 4K4XA 4TY9A 2ZNZA 2ASLA 1FT8A 4Q2LA 2BQ3A 4KS9A 1FI4A 1HNWJ 2JBJA 4USTA 3EGWB 5IWAJ 4YB5A 3HMJG 2WVBA 2FPHX 2EKNA 2VJUA 1J4JA 1ELMP 3I82A 5DQGA 4IK2A 3OXFA 1G6BA 3CJKB 3K9UA 5J1NA 1YZ7A 3N28A 1H2VZ 2R7OA 5U47A 4QR1A 2RU3A 3M9NB 2UP1A 3JTOA 5K14B 1HWUA 2J6TA 2Z56B 2Z11A 2GMLA 5G22A 4LF7F 4B9MA 2KL8A 4CLKA 1JLGB 4J9MA 1CP7A 4IHMA 3G6YA 4PWDB 3AXMA 4LRDA 1X5TA 2GLJA 3QT6A 5DS7A 2XSJA 4R5PB 3BI0A 4MFZA 3GIUA 2Z3NA 3HO1A 2CQ3A 3KKWA 2F8MA 5HLFA 2P6FA 2IDLA 5D0GA 3DRSA 1M5PC 3D2PA 1HQEA 4WFNQ 1KQGB 2GZOA 4R0EA 4F4AA 1RWUA 1MW7A 3HHLA 2DT9A 1X4HA 1R8CA 4C7HA 4CNZA 4KGMA 4HDHA 3GY9A 4I67A 3H98A 3ITHA 2NYIA 2KG1A 2Q51A 3UCGA 4DL6A 4NLOA 4P9SA 3ILLA 4V19X 3BS9A 3MM6B 1JLEA 4MK8A 4C8MA 3QT7A 1PC4A 3J7YI 4BLGA 3OVAA 5DDRC 4PPZA 2Z2ZA 3BPSP 1OPZA 1U2RA 1CS4B 2R7HA 2FJBB 2YQ3A 1RT3A 3M8PB 2BJ7A 4C2XA 3M2VA 2VQFF 5B0FA 3S6HA 3VQTA 1P9QC 4JI7J 3TZYA 5AXMA 1TK5A 2FZKB 3GIMA 2CPDA 3X3UA 1XN9A 3LWMA 3IWEA 1DQ9A 2BANA 4OJGA 3FJ2A 3P5BP 4RW4A 1VQ7S 4JI0J 2HHHF 2K1RA 3HT3A 1LEOA 1Y5IB 2A18A 5HANA 3OJUA 3UQSA 3HPOA 2FZCB 4LVOP 1UETA 4PQAA 2CTCA 3FVLA 4BBYA 1XTZA 2PIYA 4U95A 2E1AA 3SJXA 2VBWA 1S60A 5L9NA 2PIZA 1IOFA 4QIFA 4J37A 1NNDA 1M4LA 2GLFA 4KRWA 4C0BA 1LOUA 4QYRA 3M8YA 4L74A 3MXHP 2CPZA 4ZVOB 1WWZA 1RHJB 5CYQA 1TL7A 5D8NA 2D69A 1Q8BA 1BQMB 2HFVA 4CAFA 2GQ2A 5DGBA 4DS4A 1UW9A 5C42A 2F1FA 4RN7A 1YJ9S 1I94F 1CJTB 3QPIA 1IIDA 3D68A 2HG4A 4HHUA 1QY7A 1RBOB 1BOBA 3PM9A 3EDQB 1RXTA 4UFXA 4X5KA 1RK8A 3NE7A 4OC1A 1CP6A 1P4NA 3DLKB 2ODFA 1YDLA 2GJIA 1VIXA 4XPEA 2G9OA 2BM0A 1I1DA 3EGZA 4DUTA 1GNKA 3DOKA 3WQPA 5DO2A 2BE9B 1J5EF 2IRYA 3JQJA 3M2UB 4DMZA 2L08A 4PUOB 3NG8A 3PFEA 4Z2XA 2AYGA 1VRTB 2ZEGA 4FAIA 2VUGA 2MQOA 3TEGA 2AEJA 3L7PA 4BBHA 3R5JB 4A39A 2XI3A 2W2MP 3A1YG 4F4KA 3GIKA 1NSLA 1RCOB 4G3IA 3QIDA 2FL4A 5KFFA 4WBFA 1FEEA 1JJHA 2AE6A 5E96A 2XS2A 2PJ5A 2VC1A 2L9NA 4RWXA 1XF8A 5IT9Y 3ZTSA 2GO8A 1L3TA 3CPXA 2NSBA 4X4SA 4OKOA 1HNWF 5THWA 5IWAF 3TT2A 1RT7B 1QSNA 4GM5A 2CJAA 1H74A 2MQQA 1CBXA 3R27A 1XNQJ 3PR5B 4AXVA 2O66A 2XS7A 3MM5A 2IM1A 2KG0A 2MZJA 1NEEA 1XC9A 1DHMA 2REEA 3FQLA 1F57A 2OPQB 5F8MA 2PMWA 4F4YA 5F48A 3MMJA 2IA6A 4DDFA 5KT5A 2I9SA 5ETTA 1C0TB 3O1LA 1UVIA 1TFWA 2FC8A 3UDLA 3I55S 5HQMA 3TVKA 4P71A 2PR8A 3I0RB 2UVUA 4OJ1A 2WOMA 4TY8B 3RRGA 3HFZB 2OPPA 1O51A 3G82B 4A8SA 4JV2A 1CPSA 2Z3LA 1Q4RA 1HHSA 1SL0A 4JV5F 1IKXB 3A8IA 2D9OA 1F1BB 1TL1A 4PRFA 4I6AA 1PBUA 4MHZA 4B3OB 2BEIA 2OGUA 2NLWA 1VBZA 5SZTA 3WT4A 1UEKA 4NZ0A 2FS5A 1F2HA 3VCDA 5LSLA 4ZCLA 4O3PA 1M5KC 4U5YA 1ZS6A 3FH4A 4IKAA 3W9IA 4OHYA 4YRHA 4LREA 2B51A 4Y65A 2EWBA 1S0VA 1H2TZ 2FHJD 1LK7A 3JSYA 2EUIA 3KJQB 5KFQA 3L9ZA 4CLWA 3T3FA 3ZZZA 4C6AA 4YDDB 2DGTA 1Q95G 3EYZA 4CAEA 5GCNA 4MKVA 3LP0A 1T9WA 1EQ0A 1DTQA 1RTHB 3L7OA 1ZTWA 1W7WA 2LLZA 4IH5A 4Z7CA 1SB6A 3TA0A 1FTRA 3EZUA 4FN5A 4JOUA 3HULA 1DBDA 1XMOF 1Z4UA 4X2TA 4USUA 2XEIA 1RKIA 3R7BB 4CM2A 3TOQA 4DNCA 2HFNA 3FRYA 4PEOA 3EVWA 3IWXA 4JI7F 1FRMA 4CGLA 3ILOA 2LEPA 2C2RA 3IM9A 1RWOB 2VBXA 2FJVA 4I56A 2HVDA 5K8NA 3NA6A 1VQYA 3KK3A 2ROPA 2HMIA 5H9FK 2DHHA 3T5HA 2CF4A 2O28A 3WBZA 4L3NA 2ZDPA 3IGNA 3KLHA 1D9FA 3PTWA 3QJPA 3IMQJ 1SJ4P 4USVA 3OFFA 1D09B 1SVDA 1LW0A 3MOJB 1JLFA 1E6VA 3MMBA 4FF1A 2ZH9A 2B4PA 1F3FA 5MAOA 4DQIA 1GQEA 4TNOA 1S4FA 3BB5A 1BC6A 4I0WA 1CJWA 2UXCF 3IWWA 1WF1A 3AT1B 4F8ZA 2B5GA 4LF6F 2DGXA 4Z37A 3MI7X 5FLXU 1HW8A 4CLYA 3B6BA 1ZM9A 3RB6A 1FRXA 1UFWA 2I5JA 3J7YU 2PMZD 4K4ZA 1G1XA 1FK9B 1KFSA 3FRZA 4ZVUB 4IFYA 4ZBGA 3KLGB 3BDPA 1CJVB 5J8FA 5M2PA 4PQUB 2ZEHA 4WXWA 2Q66A 3G96A 4CO2A 4U7UK 1SKUB 3CCVS 3EICA 1FO1A 1TFYA 4PZVA 2RHQB 3OHBA 3SSSA 2YGWA 4ZVFA 1N6QB 2DNGA 1NBEB 3PYFA 4E8OA 4ZVTB 3HLPA 2ZDOA 4PXDA 3DLBA 2C1EB 2DTJA 2OI2A 2V2KA 1BQNA 3U1MA 3V81B 2VZZA 5LJ3Y 5IQ6A 1LW2A 4F2SA 3VAKA 4ANCA 2AD9A 2JNJA 2DR8A 2NXEA 4OYZA 4Q7AA 1HWJA 4ECXA 2ZH3A 2X3GA 2JFKA 2KFNA 4C98A 1S72S 2QC3A 4IF5A 2ANPA 1MMDA 1TKTA 1EKRA 1MSWD 3W66A 2CDQA 2FC9A 2ZEMA 4BD9A 1YRXA 2XEFA 1TF9A 1WEYA 1HARA 2G0CA 2HAIA 1QSOA 1N0UA 2AJ4A 4X4NA 2YWGA 4DN0A 5HK4A 4TWEA 3IBWA 1FRLA 4U9RA 4I49A 3RAXA 2GU2A 1S7FA 2YQ0A 1MN9A 1CJUB 3IS9A 5DGAA 1VISA 3KLIB 1VRUB 3PIOQ 3C14A 2WVFA 1YW6A 4N47A 3VGUA 5HAOA 2UUBJ 3TW0A 2SXLA 4EU0A 4H4MB 1NMEB 4DR1F 1EETA 4JI3F 2H3EB 1RTDB 2DGQA 2WSEC 2Y8YA 4Q0BB 3KK1B 2YNFB 3CD6S 5LRJA 3TJ9A 4A33A 4AG7A 1P8GA 2W2PP 5JGFA 4UOFA 2UXBJ 2NYQA 1GMWD 2X1FA 2B0GA 4XDDA 1YGYA 2VC0A 1LFPA 3L7UA 1X7VA 2LU2A 3GSDA 2BDPA 2HGNA 2XY5A 2PJ2A 4MKBA 1PUAA 2AJ2A 2EFQA 4KGKA 3R5DA 3WC7A 4J9KA 1NKEA 1S7HA 1VYAA 2AYBA 3AH6A 3PBBA 4HI2A 3JRUA 3NL0A 1QJHA 4FD5A 2PJ4A 5G1ZA 5J2PA 4QU7A 3PACA 1P0HA 1FDAA 1LCPA 2ROEA 2YNEA 1IBCB 4KGXB 2VIHA 4ZP6A 2NUUG 3NH5A 2I00A 2BA9A 3DM2B 3FBBA 3MM9B 1FFWB 4Y6IA 1U1OA 3EC4A 1RAAB 4AT1B 3D8PA 4E98A 5EMIA 5KFAA 2WSCC 7CPAA 2VPYB 4ED1A 1FFSB 3GMGA 5KTDA 2A6MA 4KOTA 2PJ3A 2YBVA 2IAJB 5HVGA 1VQ4S 4LF8J 4KVME 2FIAA 5BR8F 5KT4A 5G0RB 3KUEA 3POTB 2WZNA 1GHEA 2H51B 4WFZA 2GMJA 3GR1A 2RDDA 1YRTA 4UEZA 4MFPA 3OBIA 5G21A 2FLOA 5F46A 2EFNA 3IIBA 3HDSA 2ZZMA 2PEBA 2B58A 4HNXB 4ZOSA 2AF6A 1F9EB 4MYTA 1KLMB 3QSIA 5CD4A 4Q38A 3U1NA 2DEAA 5K20B 1WDDA 4TQSA 3T1HF 2H1YA 2N82B 2OKQA 1S79A 3JB9k 4ONWA 1R0CB 4LF9J 2V63A 3ELHA 2DVIA 3ZZRA 3LWUA 3OUYA 4OYOA 5C88A 3MECB 3GFYA 4NCGA 3KG4A 1UPMB 4FBUA 3KG0A 5IC6B 4OC3A 2XMMA 2OB0A 1BD6A 5C24B 1F5AA 2A10A 4R87A 2MJNA 3OR1B 2XO6A 3BSAA 4NJQA 2PJ7A 5DZ7A 1Y4ZB 3BREA 4NXNJ 2F4FA 2QIFA 4EBCA 5KFBA 5SUHA 3CMES 5KFNA 3HVTB 4KUBA 4NJRA 4ZVSB 4K5RA 3D7FA 3Q8QB 1Y9OA 4R0JA 3W62A 2IM2A 2WSFC 3MAHA 3BGLA 4K4SA 3UVJB 4DYOA 1KNZA 3MPYA 4C8YA 3F73A 1FHTA 2OZHA 4KGVB 4B13A 2PCUA 4NLWA 1QVFR 3OTBA 3MMAB 2H5JB 3TAMA 1ZOTA 2V0NA 3B3SA 2RKIB 2ZH8A 2AZ1A 1SC3B 1LFWA 2QYCA 3E8OA 3QQCD 2IVYA 2PVWA 2R2SA 5KFKA 4D3HA 3R9GA 1AZSB 3V6KA 2DYAA 1ZA1B 5L1JA 1RT5B 3UFCX 1JJ4A 1K47A 1IY7A 3R1LA 5D3GB 3M6VA 2HZVA 3FEZA 1BGXT 2CA9A 1M1KT 4JI2J 1XK8A 2GVDB 1FRHA 1IUJA 2KHCA 1WI6A 5HVHA 3ET6A 1UL3A 2IMOA 4TKTA 3D1OA 1V9OA 4YP3A 2QYVA 2QMXA 4ED5A 3BGFA 2NMTA 1YREA 1IR2A 1WNEA 4YB7A 4KV8B 2B4OA 5DDOC 5IFMA 2W9BA 2CVIA 3EFAA 2B9YA 3TQ1A 5DJBA 4JI8F 4Y2KA 1SC1B 4NASA 4LUAA 2BJEA 2UXBF 3CDAA 3MEEB 2XM3A 4RW9A 1GK8A 3NNCA 3CJ5A 4LFBJ 1KHWA 1VBKA 3JSRA 2HBRB 4WFAQ 3PB6X 5ETSA 3LD2A 4NGMA 2Y1JA 4ZLPA 5JVHQ 3LUYA 2CJXB 1RA6A 4QVTA 3R2CJ 1NH7A 6FD1A 2W7PA 1HR0J 2D41A 1RT4B 3N4WA 4UQTA 1CM0A 1DTTA 4WFXA 3EXYA 1RWKB 3JTKA 3VZIA 2QV6A 1WC3A 1DY3A 4CYNA 4RU2A 2ZOGA 1CSJA 3G8QA 2BJ1A 2JBKA 1R8AA 4KGZB 4R8UA 1XOVA 3AOCA 2IRXA 3TJAA 4LF4F 2FHKA 2B6AB 3SQGA 5T14A 3JAMU 2IJRA 4BWMA 4RNNA 3US5A 3FJUA 2HHWA 3F0AA 4K4YA 4CRZB 1NPPA 4ZI6A 3HF5A 4PG5A 1RT6B 1RWNB 4LR7A 5LYDA 1M4DA 2WONA 4YDXA 5EX0A 4UTGA 3Q89A 3OSNA 4FYYB 5T7LA 1M5VC 5E41A 2XYGB 2HNYB 3GFZA 1D9DA 2P6GA 2MQMA 3S6FA 4F0KA 1GFWB 1S6OA 1RT2A 3LAKA 4CWBA 4OI1A 5A8WB 1O5JA 3W2VA 2YNDA 2PJCA 1NH8A 2HWHA 4MFBB 4MIAA 4NA3A 2J0QD 2MGZB 4ENOA 1C0UB 2PRBA 1N71A 2CQHA 4AVBA 1XE4A 4KOXA 2I0XA 2H9ZA 5DDPC 2MZQA 2OIHA 4CIOA 3EPGA 1S1WA 3SV4A 4DF8A 4X64F 2CQ0A 1SIZA 3R9EA 2BV3A 1CEZA 4CGPA 3PNIA 4HHJA 2ZENA 2M8DB 1MJ9A 1PU9A 1WORA 4B17A 4ZIVA 3VAFA 3M1VA 5B0DA 1Y5NB 2XLIA 4CS0B 2AP6A 4DL2A 5LMUJ 1JLCB 4Q44A 4P4FA 1F3VA 4LX9A 2X7BA 2DRBA 4IRKA 2G2YA 1IKWB 2JDCA 5F8JA 2RNEA 3OHAA 2A2CA 1UPPA 1KTQA 3SDEA 2RQKA 3I3GA 4KJIA 4OMFG 2OEJA 1VQ5S 5B0AA 4I2PB 2DGWA 2ZITA 2WYRA 1FD8A 3AD7C 3M32A 1TZ0A 3HHKA 3TR5A 5KFEA 2VA3A 2HB6A 3M6XA 4HYKA 3MD1A 2QZ8A 2MSSA 2ZWOA 4IAVA 2KXNB 2RB7A 3BBCA 4NMLA 1TL3A 3WC6A 4C11A 2LKZA 2A6OA 3RW7A 3T5JA 5I3QA 5I42B 1U49A 1N4LA 1FKPA 3M8QA 2XG8A 2J7WA 1XEBA 3B4DA 2EVNA 1UFLA 1HQ2A 3G8SA 5GAEI 3AB4B 1UFHA 3BEGB 2PJ8A 3GB0A 1UVJA 2AW0A 4CDIA 2B9WA 4FVMA 4IFVB 4USMA 3G9CA 4LRAA 4MBUA 3IRXB 4OC0A 3FX6A 3T1YF 4IQMA 4CYUA 4GO7X 1UWBB 2HS3A 1U7LA 5GMKa 3BR9A 1RWWB 1NDKA 1YK9A 3R5CA 3WX8A 1QTNB 2ZUGA 3PO4A 2KT3A 1R57A 2DIUA 1FJ7A 3Q8UA 1RWVB 3EGVA 4E0AA 3FEDA 1GTHA 4JI2F 4C0HA 2FVRA 1TV6B 3R6GB 2R7TA 5AJ3J 4P75A 4P72A 3DLHA 3HFKA 4O3RA 5F3ZA 2AFXA 1JLBB 5LXYA 5LRGA 2VFVA 2MPUA 5A8KB 2JEGA 1K1QA 3MPUB 2GFFA 3VZHA 4IRDA 2C3PA 2RIJA 4B11A 3IO1A 3QO9A 1RWPB 3J7AN 1AUGA 5C5JA 1HD0A 2BKNA 1NPRA 1S0NA 1OBRA 3G8TA 4Q2MA 2V5HG 5M2UA 3G6ES 4Q8FA 2GS8A 1XWLA 4QB9A 4L75A 1IOIA 1ZTTA 3P3DA 1MMNA 3VAMA 2DH9A 1NZ8A 4LFBF 2LEAA 3AD8C 4O44B 3T9ZA 5AE3A 4IUFA 2V68A 4DV0J 2E7VA 1OQ3A 2K5TA 3T9YA 4W9YA 3NGDA 2HQYA 1S1VB 5J1PA 4RW8B 2R1IA 2GREA 1Z2LA 2RFHA 3B7IA 2E1PA 2E5GA 5LT5A 2UUCJ 4KR0B 4UQGA 4OIXA 1DARA 2UUAF 3CJSA 2AX0A 1Q8IA 2FE7A 4CLLA 3TP2A 2B4UA 3DRPA 4R3LA 4ZITA 2GJFA 1M1DA 3B3CA 2QN6B 1A7GE 3JYTB 1HPZA 4C8ZA 2FJXA 4P45A 1FESA 4A2ZA 2MY7A 3D2MA 3S6EA 3KLEB 4ID8A 1RAJA 4RL1A 1HQUA 3LPEA 2YX4A 2HIQA 2K06A 1KTVA 2KB2A 4FYVB 1HBOA 4CLZA 5B0CA 2DHSA 2J7UA 1S6PA 2EXUA 3NGSA 3K5PA 3PRBA 2G4BA 4P4BA 3Q0AA 1B6BA 1CULB 5HMNA 1IKVB 2OZGA 3CCZA 4C4WA 2KT2A 4A8QA 3A8EA 5RUBA 3HLUA 1RCXB 4QYZK 4LT6A 2FY8A 4V19J 3BJ7A 3C16B 4GMKA 4HH0A 3H4DA 3SHPA 1EJ7L 4WYLA 1K1SA 2Y0BB 3OFHA 2L3MA 5F0UA 5KFJA 2QLXA 2Z0ZA 4PR6A 4C97A 3GJSB 1UA0A 3FEEA 2MQLA 3CF5Q 4IG3A 1Q16B 3E0KA 5AG4A 4K2JA 3HVWA 4USWA 3EMTA 4R3KA 2VHGA 4P4IA 1KBRA 5LMUF 3ADAC 4QUSA 3A12A 1KWMA 4O4GB 3M6WA 3S9NA 4FD7A 3LACA 3BN4A 2EFOA 1UA1A 4ZHRA 4R7MA 4DLGA 4DUZJ 1LXNA 2WTFA 3H2UB 3D1HA 3V7ZA 2BYCA 2HFUA 1YJWS 1VHOA 1PBAA 3VARA 2AGQA 1SUQA 4A94A 4ZPAA 1S6QB 1XMTA 1XR5A 1REGX 1UFKA 4HVZA 2DY1A 1VHIA 4KH0B 1MU2A 2J8NA 3TFYA 4L73A 1VLYA 4B3MF 4ZJLA 1S5KA 3ENQA 2G13A 2MQNA 1TK8A 3D54A 4A8OA 1E6YB 2XNRA 1YRUA 2JEFA 4DG1A 1LWXA 1SH3A 1YR0A 4JI4F 3GFHA 2Q4ZA 1YVFA 3H2LA 1JWQA 1KVIA 2HNDA 3K2KA 2VG7B 4KSAA 1U0HB 1S7KA 2VBZA 3H8FA 3SI8A 4K5SA 4CQ1A 3SMZA 1BY9A 2K3KA 4EO8A 4HTIA 4G6VB 2ZH6A 1VQ9S 1TKFA 1F2OA 1Y7RA 3FBFA 3NWRA 3PKMA 5AJ3F 3IJ3A 1XEZA 2ZBPA 5BYSA 2JLGA 3VWEA 4DV2J 1SQEA 4NRUA 4FS1A 2QEXS 1KUYA 2QFIA 5CNPA 3V6JA 2DHAA 4KVOE 5IS2A 2I3CA 4DR3F 3O6QA 4OX8A 1AMPA 5DWNA 4MXUA 4CH7A 4Y2MA 2PJBA 2ZH5A 3B2YA 4I4BA 3W5YA 4PWDA 5EHHA 2CZ4A 4R5PA 3PYGA 3NOGA 2XMKA 4FXDA 3CCUS 2PQ8A 3JQMA 3PW4A 2O01C 4Y00A 2XI2A 2ZH2A 3ZXWA 1I51B 4CP5A 4KTQA 1HLWA 2JVOA 1MNEA 3TA1A 4C3MA 2HW3A 4K59A 4Q43A 1N0VC 2UUCF 1RACB 4BWJA 2DXFA 2QYGA 3VAHA 2GJ2A 2ZHBA 2ZEDA 2LU1A 3TVZA 3AODA 3SIPB 3NFZA 3RG6A 4K0KJ 4YFJA 1DQ8A 4K2XA 2KYZA 4OI6A 4DR7F 3FUYA 2M0GB 2FLLA 1CQNA 4FZVA 4OYPA 2DNQA 1G2EA 3TZXA 1KR4A 2WB1D 1TUVA 2LFVA 2WHOA 1X4FA 3NKYA 4M5DB 2BOAA 3UD5A 2KM8B 4FBEA 2MJUA 2OP5A 2H4YB 2J8MA 1CS4A 4NRTA 4DEZA 2QA4G 1TKXB 5HBMB 2XEGA 3M8PA 5GMDA 2C3UA 2X51A 1HNVB 4X4VA 2CXEA 1D8ZA 2EKYA 1VK3A 3HD2A 4WK1A 5HROB 3LP1B 1S76D 2D4PA 5CCMA 1WF0A 4YS2A 1WTBA 3B8GA 4Y2CA 4QU6A 2HEKA 2AEMA 3CCWA 2Q6BA 3T9NA 5DG8A 1ZBTA 3NS7B 3PBEA 5DS0A 1WJ9A 2BJ3A 2V2ZA 3PIPQ 3KWMA 2YQ1A 4DR6J 4LBHA 4LFAJ 4QBUA 2XEJA 1GTEA 2PVVA 3TE4A 2W25A 1QAYA 3KNGA 1F60B 2GX8A 1VIOA 2UV8A 1RAOA 1PJ5A 1H7WA 1BQMA 3QRRA 2BKPA 1TF8A 2DXDA 2ILZA 2J9DA 4USIA 3HK2A 4RW6A 1TELA 3G4SS 2AHOB 3DRRA 4LRBA 3D6FB 2DNRA 5GAHI 1SJRA 2AJFE 1O8BA 3ICLA 3LQVA 3SV3A 2GANA 2Z30B 3I4HX 2GHPA 5KFCA 5IXUA 4EZ6A 3SXLA 3DLKA 4UWJA 3PDNA 3FEXB 3HHEA 4X2BA 3CO0P 2MYFA 1LKZA 4FBTA 4Y0FA 4RUCA 3W5XA 5KT7A 1FVSA 2I6WA 5I4MA 2VG5B 1YVKA 2QJ3A 5IQQA 1XERA 1T11A 3WR7A 1FRIA 4PUOA 3ZZYA 4ZVPB 4DX8H 4NLTA 1YQEA 2Z4PA 4I1TA 2GIRA 3TEHB 4MFLA 3VVTA 4AG9A 5EN1A 2DNLA 2IMWP 1TUGB 4HTJA 4GKJJ 2W4DA 4AUKA 2R2RA 3AA8A 3GE9A 1XIXA 4RLEA 2V77A 4X3RA 5HSPA 1HBMA 8RUCA 1H0HB 1T03B 4NCAA 4ZA1A 1HFEL 2XMVA 2RD5C 1DFDA 2XHWA 4NL5A 1NU4A 5D4PA 1FX4A 2Z2MA 2OD6A 5J1EA 4MKYA 2V94A 2IY5B 3CW2C 4QJVA 2FHJA 1C2PA 2LXUA 1S3ZA 3MR7A 1SH2A 4PAAA 4ZMMA 1Y5LB 1F6TA 1LWCB 2Y1RI 1RT7A 1YJVA 1J5OB 4GVBB 2ADCA 1LWEB 1T95A 4TQRA 1ON0A 5DM7Q 4EMDA 5LMNJ 5D78A 2K7KA 3ILJA 3LTOA 1BLLE 2BQRA 4O0IA 3GPAA 2MKCA 3K17A 3KK2B 1RHQB 4MIWA 4FD6A 3HHDA 4HACB 4JXQA 4N7TA 4OZLA 4WU2A 2DH7A 3N6MA 1VCTA 3I0RA 4TY8A 1VQOS 3CE8A 4CO1A 3G82A 3IGVA 3TARA 1IBLF 4EO6A 1SQFA 1G7CB 2ZHOA 4FP9A 4X4TA 2V8HA 3DI6B 4NE9C 4JI5F 1IKXA 4UA3A 2HHQA 4B3OA 3AJ2A 1Z2ZA 1NB2A 2IIHA 4DV1J 1WHYA 2VDIA 2IHR1 2OEKA 2WB4A 2CUYA 3FGVA 1FF2A 5HJXA 2DPJA 1QDUB 2E66A 4DV3J 2J0XA 4JYAJ 2QG9B 2W4PA 2X7IA 9RUBA 4J5OA 1WG5A 1OYEA 2EW9A 3GYAA 2AFZA 5KG3A 3OLBA 4K0KF 1RTHA 7FDRA 2ZM6F 3MAAA 3R96A 3H8GA 1ZG9A 4B10A 1FJEB 5FDLB 2DNKA 4PXCA 1SBRA 3GV7B 3ZJ0A 4P4JA 2BOPA 2HRUA 3PX0A 3D5MA 4MJ8A 4FWUA 2CWXA 1UJ4A 4QZVB 3W5ZA 3EE3A 1WG4A 1BPMA 1IR0A 1YSJA 3ZZPA 4RX6A 2MHEA 2GCFA 2EWHA 4N41A 1I21A 1T9TA 2G0IA 2H5MA 2YX1A 4ID5B 2YNGB 1CJKA 3M8ZA 3I96A 1QVGR 2JC0A 4LSLB 1B99A 3WIUA 5MLCV 2VPZB 3PG9A 4O0NA 4ED2A 5ETVA 4K7QA 4P10A 2V2QA 2OFHX 2WVDA 1LANA 3VQSA 3PYEA 3BO2A 2R7VA 3THVA 4ILRA 5L1IA 1FFGB 2CAJA 1RADB 3AQOA 1WC5A 2R7RA 4LFAF 3BJYA 4YMEA 1HEEA 1S59A 5E5NA 3V38A 1SH0A 2CG8A 2QE5A 4OC2A 3KHZA 3H40A 1ZG7A 4NOHA 1ELLP 5EGYA 1JK9B 3MF5A 2I8EA 3OXLA 4DL3A 1UVKA 2C2KB 4LQGA 2DPSA 2ZEPA 3M4XA 1UZHA 4A8FA 3DMJB 3I56S 4PXBA 2HVEA 1QTMA 4WCEQ 1B64A 2OZUA 4IO1A 3QJJA 1WTFA 4MI4A 2FYXA 3KLGA 1CJVA 4PQUA 4B9NA 2CPFA 1BXNA 3VF0B 1U45A 2IVFB 5KTCA 3PX6A 4LFCJ 1RABB 3MAQA 2W9CB 4DJBA 2PIIA 2C42A 4XIUA 2KRRA 1RAHB 2I2YA 4XNHB 1A0OB 4KUAA 5A8RA 5A76A 1N6QA 3GCXP 2H65B 2NXNA 4OMEA 4J90A 4KHPJ 3RU0A 4JJXA 4CYPA 1YKWA 5GAGU 5DG9A 2N4DA 1GX5A 4UOCA 1GMWA 5HMXA 4RUBA 4C3KA 3WC0A 5KFDA 1FWKA 4WJBA 5BJRA 4LF5F 4KHRA 4DV7J 1VR6A 1YJ7A 4WZQA 5LYIA 2WPXA 2PA8D 4DPYA 2YKOA 1S99A 2LQ9A 2XMWA 1YW4A 2COLA 3DLLQ 1Q2DA 1L5UA 3EXCX 1A6LA 1MJBA 3CD5A 4RBTA 4DSFA 4A30A 3HHLB 2MY8A 3EUNA 2JEIA 3RR8A 3BSNA 3QWUA 1OMSA 3IR6B 1R8HA 2BX6A 4XPCA 2B56A 1VHFA 2DRDA 5BYRA 4FXVA 1UW4A 4KB7A 4OLPA 2PN6A 1VRUA 2CNNB 1DJ0A 3QRQA 4BC7A 3DOLA 3VHQA 1DQAA 2F40A 5CPAA 2MKJA 1K44A 1IICA 5KG4A 4P4EA 2M88A 3MGJA 2KJVA 4H4MA 3FFIB 1G4CA 4KHMA 3NNAA 4ECTA 2AEFA 4Q5VA 1RTDA 1NUEA 3H5YA 4P7TA 3KK1A 1V3SA 2YNFA 2H48B 1HNIB 4AXJA 2BACA 3OVBA 5KFWA 3G2XA 2OHDA 2LQBA 1HYSA 3HSZA 4Y34A 2NSCA 3D7DA 1UMJA 3NXZA 2YTCA 1N48A 4DV1F 2KCWA 2LVWA 5HJYA 1WDTA 2LXIA 4AXIA 4JP8A 5FVJA 5E3CA 4RW4B 1P9YA 4U7CA 4DV3F 2K1RB 1M1GA 2IC3A 4YY3J 5L38A 1WC1A 3EJMA 3HP6A 3EGNA 3H5SA 2XYHB 2RQMA 4RNOA 5K8OA 1PGZA 1IWGA 2IM0A 3CGIA 2CZVC 4LUBA 2E5LF 2FJEB 1FE4A 4JXRA 5KG1A 2UUWA 2DIVA 4F67A 1WK4A 5KFGA 5JUMA 2J6SA 4HEA9 1C1CB 4M6HA 1X4GA 2DR6A 1S77D 4EVYA 2YH1A 3B3WA 2ZNYA 3NCPA 1ZM2A 1B87A 5DWMA 4ZVEA 1Q7YT 3OR2B 3MUTP 2E5HA 1AXQA 4LQ3A 1F2PA 3MM8B 5LYFA 3IAM9 4JI6F 5G0RA 4CH1A 3D0HE 5KTAA 4NGNA 1FKAF 4UCNA 2YPYA 1DTDA 3MUMP 3ONQA 5DLFA 3CPAA 1B3TA 2G2ZA 4DX6A 3DOKB 3BPDA 2G3AA 4N77A 2BZ2A 5I3PA 2EPIA 4KO0B 3TO8A 3ZFVA 1OO0B 1KLMA 2DHXA 1VFJA 2ZHAA 3TCVA 2CQ1A 1U1LA 4NI2B 2Y9HA 3I4PA 1JJCB 4CH0S 2BW7A 3W6XA 1IBMJ 2D7SA 3ILIA 4H89A 1WUUA 1NK0A 4I2QA 4H4KC 4OC5A 2E1RA 4B6ZA 4CYOA 1Q53A 2VXKA 1SC6A 3DYAA 1PO6A 4XAKA 3QWPA 4HPSA 3H7HB 5CYMB 4KFBA 1X5PA 3QT8A 4K4UA 5C24A 4R8FA 4ZCKA 4EI2A 4UIAA 4DR4F 1D8YA 4WKRA 2DEIA 2EBGA 2AMCB 4ICLB 2PEHA 4C7QA 3H59A 4Y28C 3TO6A 3DHXA 3MM5B 3I0SB 3HVTA 2DF5A 3D4JA 3CJ4A 1PYTB 1EX8A 4CGNA 4PG7A 2ZC4A 4BCAA 4HR2A 3CMAS 1ZLIA 1NK8A 2OLWA 3MEGB 3UVJA 2GQQA 5HH1A 3SZ2A 1VMBA 4QIEA 1WEXA 1IJFB 3M30B 2DCLA 3MMAA 1NK9A 2PC6A 5KFOA 2XMJA 2VQFJ 2BSWA 5J2QA 3PV8A 2PJ1A 1U24A 3UNYA 4CTAB 2J0WA 4DU7A 3THPA 1WF2A 4NLUA 1RTQA 2ZJQQ 1RLCL 1ZA2B 4K30A 3H2VE 3CZXA 1AZSA 3KHRA 3V5RA 2HHHJ 1MWQA 4QCLA 5KG7A 1RT5A 4JBCA 2PE8A 3GIIA 5D3GA 2DH8A 1S1UB 5ETRA 3L4BC 4NEZA 2NR0A 4DL0C 1KUVA 4JZ0A 4NGSA 1YQHA 3N79A 3NS6A 1PKUA 2Z57B 3BGRB 1UAWA 1QD1A 1TP7A 4GRSA 4NF1A 2Z10A 1M4IA 2CIMA 4FDFA 4B9VA 2RC4A 4NLYA 1JKHB 4KY3A 4KV8A 1OSCA 1S0OA 1I94J 1RUSA 2XGPA 2M2BA 2HVHA 4OZ3A 4J9PA 1SL2A 4HNYB 1MLAA 2EG2A 5F47A 3NNHA 4R76A 3PCOB 1MG7A 3E3XA 4NLGA 3H8EA 1WC0A 2ZZTA 3BQ2A 1BPNA 3IRWP 1PILA 4UT4A 1H6KX 1ZETA 2Y3YA 3Q86A 1U6BA 4QWAA 3U02A 1L0CA 1WD6A 1WHVA 2I38A 4B3SJ 1GXUA 1RT4A 1TMMA 1J5EJ 1EB0A 1X4EA 1PYOB 4G1IA 3W1YC 3PEHA 2QX0A 2MSTA 4RWWA 3RBEA 2B7CB 4TLQA 3KLHB 5J8CA 1Z8TA 3K89A 4UUXA 3N6NA 4ONUA 2XLJA 4ED6A 1JLFB 2B6AA 3CUNA 3MMBB 5FIIA 3ZNUA 3KOAA 3KQXA 4P2MA 3PX4A 3KNAA 1Y9WA 2DGUA 3I32A 2DNHA 4IDKB 3TYTA 4DFMA 3H5ZA 4UFWA 1APSA 3GONA 2XULA 4MCQA 4Y2IA 3BH6B 4KSEB 5ETKA 4X65F 4A4JA 4B9UA 2L9DA 4CYQA 1QE1B 1X4CA 3VR1A 3W64A 1UTAA 1FDBA 1MWYA 2OSRA 3DNSA 3Q2TC 5DZ6A 4A8KA 3NH8A 5A8WA 2RE1A 3UCZP 4H4KA 3D0GE 4KQZA 1RU2A 3ZTQA 1T3OA 3HSJA 4UFVA 4MFBA 3SI2A 4YWYA 3N5BA 3N6LA 1C0UA 3OTDA 3WX4A 3PJXA 5CH7B 3IG1B 4TU9A 2O53A 2FJWA 3B35A 1YX2A 4RI1A 3OVSA 2A0FB 1B4SA 2YKMA 4OADA 3J81U 2HQIA 2HBYB 1YZ6A 3H25A 3DN9A 4KKOB 1N33J 3LANA 3QGPA 2P8IA 4ZS6A 3CVKA 2WRMA 1GH8A 4JV5J 1Y00A 5HQ8A 1BHNA 1YG0A 3FIXA 1GXTA 4KC5A 3M2RB 1IBMF 2J9DE 1LWFB 2RILA 1GEHA 3MR6A 1JLCA 3FBCA 4IQXA 4FYWB 4UZCA 4TXSA 1PJ6A 1KP6A 1IKWA 1RZMA 2RF2A 4H54A 2R8VA 1TKTB 1AUDA 1QMUA 1F9HA 4ECRA 1H73A 3FSXA 1BE4A 5EWEA 4MJKA 3IR7B 2N3LA 1N32J 3GYNA 5CZXA 1OYDA 4YB6A 4RPFA 2NXUA 5H9EJ 1KS2A 1YMEA 2CPYA 4CRJA 1H7XA 2X1AA 3MR5A 3KG1A 1RLDA 3MHYA 2RUGA 4DV6F 3VWSA 5IX3A 3CWJA 2NCKL 3Q22A 3M7VA 2QRRA 1XMOJ 3D3BJ 2V8GA 1X9SA 4JV1A 3U7JA 1T05B 5KFUA 1UVLA 5JVGQ 1HKAA 4IFVA 2HFSA 2L9WA 3H5XA 2V8VA 1LRZA 2ZVIA 1KFDA 3JTPA 4NWBA 1I6JA 2Q4VA 4A47A 4X4UA 3IU2A 1UWBA 4J9QA 1GT8A 2EK9A 4C2ZA 5H86A 2Z2LA 4DL4A 4WXOA 4TN2A 1JLAB 1F0XA 5D29A 1CVJA 5H1SV 3D67A 4Z65A 1W25A 1VQ6S 1RAFB 4NXMJ 2W2QP 2PGCA 4QR0A 2B4VA 5GADI 2E7WA 1TV6A 5A0YA 4F25A 4ZCMA 4O3QA 4UF4A 3TQEA 4Y3CA 3DU6A 1RB0A 1JLBA 2JWNA 1ZH5A 2Z3PA 2KVIA 3H20A 2UXCJ 4ZPCA 4JUZA 5L1LA 1H8LA 5D8HB 5LL6d 2OTLS 3MD3A 2ZW4A 4C68A 1IB1E 5F9LA 2YNHA 4USHA 4LF6J 4ELVA 2QL5B 4U9ZA 1RT1B 3PHEA 3OTOF 2KO1A 3LGMA 3RW6A 5ETNA 2Y1LB 3CNQP 1UEVA 4YQWA 2G1DA 2JLMA 4JB8B 4O44A 4CAWA 5L9XA 4P74A 1IKYB 3OXGA 3QZ7A 1Q81T 2OR4A 3B3TA 1S1VA 3HKWA 2YH0A 4B3SF 4RW8A 4TLRA 2FVGA 2N3OA 5HP1A 4TU7A 4DSJA 2VBYA 3VGVA 4I6YA 2JRSA 4HDGA 2QFJA 3MPDA 2UVWA 3FBEA 3CXSA 2Z58B 5A6PA 2B5JB 3QT5A 4P4DA 3KHHA 3PB7X 2KJWA 1XMQF 2U2FA 3ZC4A 3AHPA 2UVVA 3HVRA 1X31C 4CO0A 5KFPA 1X60A 3JYTA 4FD4A 1YBTA 4J7CA 3C26A 3LGNA 3KLEA 3BBFA 4OX9F 2HHUA 8AT1B 2HURA 2WCXA 1GMVA 5A2QU 3SCLE 4NCGB 5E3PA 1OY8A 1FWPA 4OHXA 3BN7A 1FNMA 4A48A 4M5JA 1OS5A 1JX4A 4LQ9A 1HI1A 1CULA 3PB9X 4FYDA 4QW9A 5K8PA 1IKVA 2ZUAA 2G1HA 2Q7BA 3K5LA 2VKRA 4LQ6A 3C6UB 5ELYA 1YK3A 2ZEJA 4B14A 3FCVA 3LO3A 2ZEFA 4DR1J 4JI3J 5G4DA 4DV4F 2IA0A 2OFGX 2XCAA 2VICA 3JTNA 1N33F 3W8GA 3NAIA 3KJVB 2R4FA 3R6LB 2ACYA 3M8WA 3K5MA 2ZC3A 3JSBA 2P2CB 5KG2A 4O4GA 4KH1B 1N5YB 4IO9Q 3QSYB 2ZBCA 4I64A 4ZVGA 4O4RA 3OTCA 3S9MA 2Q44A 1WKJA 3I87A 2XO7A 4N8OA 4KPCA 3CCSS 2QLJB 2XWXA 4L8AA 1U0SA 1N32F 4M6GA 3FCWA 2GNKA 4DV5F 1FJGF 3UN5A 1DURA 4BDPA 1PSDA 2YWHA 1J2VA 2VB6A 1VJWA 4PYAA 2ZW5A 4O23A 1E6YA 3CDXA 1HBNB 4M5HA 4C9DA 2KN4A 3QATA 2NS1B 3SSQA 2YKAA 2QSWA 2YXLA 4B5OA 2MLYA 3SCJE 1O0PA 4ANDA 5LSOA 1UJ6A 3DNCA 1VQKS 4RW9B 5D4OA 3WC5A 5BR8J 1U0HA 3UE2A 3HSGA 1WOOA 2HFZA 4J9UE 4UBRA 2JEJA 4LRFA 1TQLA 2VG6B 4OYIA 3J80U 1VQLS 4FF2A 2VH7A 2NXJA 4NXMF 1PAEX 1TR0A 1SQGA 1F5CA 1K0TA 4NLSA 4L6V3 3F56A 4JLYA 3D6TB 2GMHA 2CG4A 5JJBA 4OL8A 3W8PA 3UI3A 3RYOA 5ETLA 4WE1B 3T1HJ 4OV1A 5JMNA 4H6ZA 2ZEEA 2PRQA 4HL9A 3SQGB 3MGDA 2CQDA 1KDNA 4P44A 1M90T 2JDJA 1JMTA 1U47A 2H4WB 4LF2A 4A8XA 2GW8A 3BH7B 2C28A 4DL7A 3RR7A 2YKNB 3HI9A 1IYLA 1CPZA 4F0YA 2RDIA 1FKOB 4B3RJ 4X84A 4ER8A 2HGMA 5DETA 2C22A 4DPXA 2CY2A 3WDOA 4ECUA 1TAQA 5T7LB 3EZ5A 3ZO7A 1FEHA 4CO5A 1VQNS 3BZQA 4F3OA 4J9LA 4ZP9A 2KI2A 2DCUB 3PZPA 1QSSA 1Q0NA 4NGRA 3G3SA 3SI1A 4MH8A 4K4WA 1X10A 2BJ9A 1HI8A 4UCPA 3W61A 4X4RA 2QMLA 4F26A 1RTIB 2FGOA 4CNYA 4QIVA 4EYHB 2HYIB 2RJZA 2VODA 3MCMA 1RHUB 1EAYC 4GO5X 2PFDA 3UWTA 5ISVA 2NPFA 4ECYA 3LMSA 2BJ8A 4MCPA 2CPHA 1XBWA 2V6AA 4WWSA 1Q7LB 2DXEA 3ZTRA 3P96A 3DOMB 2AYEA 4GKKF 2QGFB 4M6IA 4X66F 3CJTA 5IB0A 3VATA 2EO8A 1NMTA 4ETXA 4ECZA 1NKBA 1QUVA 4M5DA 1VI7A 4NLDA 2DITA 3UD4P 1TKXA 3UR3C 5HBMA 3CCQS 3DU5A 1S9GA 3VAJA 3DGVA 2HUZA 2M8HA 2UV8G 5CA5A 3QAHA 1WHXA 4UCMA 1ZZFA 5HROA 3KHLA 2FLNA 1HWKA 4KLWA 3M32B 1Q8LA 4IYQA 2EEYA 2JFDA 1KZFA 4J9OA 4L89A 5LOQA 2W8KA 3NEKA 3KMQA 3GQCA 2BXJA 3IWGA 1TL3B 2D3OR 2CADA 3K9TA 1L3KA 1X9MA 3DDKA 2JEWA 4C3LA 1FKPB 3HZEA 1Q5VA 1A2ZA 2XGQA 5B0GA 2D3O1 1U2FA 2X1BA 4JI8J 3HHNB 4B9LA 3WZ0A 5F49A 2OPSB 3PGPA 4B9SA 4P2FA 1RDRA 1QAIA 3CXPA 1FTCA 4ED3A 3TZZA 2VZYA 4M85A 1VDHA 1WSVA 4DI6A 1UCNA 3EPIA 5ETPA 1SXLA 5CBMA 5LJ5Y 4CYUB 2XMTA 3PB8X 2VFTA 4N76A 4K50A 1M1HA 4NFRA 4ETZA 4PK2A 3HX9A 3TO7A 1ZAWA 1KEKA 1K73T 3HM9A 3MM7B 2J6UA 1W26A 1K8AT 3W91A 3VGTA 3FKBA 2P9CA 4DQSA 4JI1F 3W60A 4OX7A 2UVRA 1Y7PA 4JV0A 4EFAC 2HLUA 5FLXY 4F7VA 2EC0A 4AYBD 4M5IA 4LF4J 2R2TA 4B5PA 3LAMA 1REVA 1MK4A 1N5QA 2Y1IA 4F4ZA 1BUXA 2V50A 3BF4A 4ED0A 3H5UA 3T5LA 4H6UA 4FKXA 2CRLA 2HK2A 5L8RC 4ZKAA 4CO3A 4KE5A 3W9HA 3CJ2A 2BBEA 2B9XA 1RAGB 3H42A 2PSWA 3UR0A 3CC7S 2B8PA 2OMLA 5AE2A 4QWBA 5G20A 3U27A 4Y49C 5ETMA 3AXKA 1HI0P 2O3DA 4ZJQA 2NYHA 3BYPA 2GE3A 2ZZNA 3K2YA 2YNIB 2HQGA 4P6YA 4MT1A 4C2MA 4XNHC 1LWCA 4OYBA 2XMAA 3O44A 3QLHB 1J5OA 4GVBA 4X64J 3PW7A 2BKOA 1NJXA 3FMCA 1P1LA 4QC6A 5I0CA 1FT7A 2FIWA 3K59A 2GAGC 1EP4B 1NK6A 5EDWA 1AA1B 2XZWA 2M9KA 1FWLA 2X1GA 1BQXA 4OZ5A 4AVAA 1ROFA 3KK2A 3MEDB 4DPWA 3FXTA 4HACA 2CPJA 4KBIA 2V4JB 2BE2A 3DR6A 5ETQA 1N52B 3RB0A 2E5IA 4FVCA 1AFJA 3R95A 4B3RF 4NLPA 2BUEA 4I68A 1HQUB 4DX5A 4F3QA 2ILYA 4O3SA 3DI6A 2CQBA 4DZDA 3KR4A 4DUYF 1U6ZA 1HNXF 1HNZF 1TL4A 4MYUA 4X62J 1YI2S 1T94A 4TNUA 5KOWA 3L3CA 3V4IB 1AT1B 1FD2A 2KZMA 3H4QA 4GXHA 3Q2SC 2PA3A 5K8MA 1ZAVA 2ZVSA 4HKFA 3KI9A 2W8LA 2ARHA 5EUHA 2JZ5A 1D1UA 3M9OB 4OI0A 2K2PA 3N9UC 3OSPA 4IG3B 3T1YJ 2BR0A 4LBIA 2RRNA 2F7VA 2BEFA 1LAMA 3IBFB 5FDLA 3QAEA 2HV2A 4M5GA 1JIHA 4OZNA 3R9LA 3A3OB 5E3AA 2V67A 4IG0B 2YPZA 3DXBA 3FB3A 3F8KA 3PJWA 2C6GA 1SJQA 4MHPA 3MCNA 2HQ3A 3MFHA 3W9JA 3FYNA 3O5TB 3ZZOA 3AD9C 2HRTA 3TX8A 2OJ3A 3DR8A 4DPUA 3R7NB 5GMEA 4NA2A 2ERRA 1S10A 1IBKJ 4MCSA 1VC0A 1ULRA 3RNZA 3K8VA 4LSLA 3KTQA 3G6XA 2HFOA 1CQMA 4YOEA 3FMWA 4KPYA 5DM6Q 4A8YA 5C25B 4LIWA 1U48A 1ZLHA 2YWFA 4DG1B 1U1QA 4AQYF 2ZOFA 2CNMA 4DLEA 2O1PA 3D0IE 1N34F 3KQZA 2W24A 2V4RA 1S7NA 1RBAA 2VPWB 3D7GA 5FJ4A 3OL7A 2PC1A 2LEBA 3K8WA 3LP2B 1WC6A 4M5KA 2CNSA 1FX2A 3PHTA 2QL7B 4U8YA 2O5DA 1MWZA 1NRKA 1SJ3P 1RQ0A 3OFEA 3DMJA 1OIAA 1SKRA 2UUAJ 4ECQA 2H5EA 3SEOA 1M5OC 4AVCA 3DXSX 2ZXVA 1FDDA 2WBRA 3R1KA 3AJ1A 3RRKA 2HQDA 4GC6A 1RGVA 1M5HA 1S1XB 1EQMA 3ISND 2W9CA 2F8EX 1U09A 2IL4A 2RQCA 1Q5YA 4K4VA 3CIMA 2R7SA 2CFXA 4DBQA 4G1QB 4V1Ak 2RS8A 1JNRB 3KHXA 1WOPA 1ELOA 2W1BA 4F3MA 3QIPA 1X0PA 1S9FA 4K4TA 1S0MA 1VHSA 1PJ7A 2ZBQA 4LR9A 1NHKL 1D0EA 2CXAA 2B4DB 4DSLA 2R3VA 2KYXA 3T90A 4OYWA 4OI4A 3AA9A 1V5IB 2ZE2B 4MHYA 4EUVA 2ROGA 3TX0A 3CDEA 2V2VA 5HQLA 2C2ZB 2Q43A 2DJWA 3HD1A 4KIAA 3DSBA 3BSOA 1HDQA 2DNPA 3V6DA 3DLEB 2DB1A 2B3TB 3K5OA 2LQ5A 3FNNA 1XRYA 3TC8A 4U8VA 2ADBA 5EWFA 3N0VA 5AXNA 3OWCA 2BCOA 2OTJS 5IT9U 1R8BA 4ZJOA 1RWMB 1SI9A 1FA0A 2CQ4A 3JSMB 1TTHB 2FQQB 3I5BA 4L76A 3FFIA 4IOBA 4W4MA 1B0VA 4QIWD 3HCXA 2DNOA 3KMSA 1W2IA 3F41A 1JXLA 1HNIA 4HKQA 4ZP8A 4DQPA 2GGPA 3R1HA 1JLQB 2F9JA 4B3TF 4DF4A 2YWWA 1NZAA 4USKA 1S1TB 2G3TA 2K7JA 3W2WB 3OL8A 4X62F 5KT2A 4ES3A 2E1MC 4QPXA 2I1RA 4HT7A 4B3MJ 3EY5A 4MCRA 2XSFA 3UY5A 2OPRB 1XMBA 1LOKA 4AFFA 1A9NB 4OJ3A 4B02A 2CNKB 1KONA 3GIJA 1Y0HA 3OV7A 3QJLA 4RBVA 1TK0A 4PXEA 5K9FA 1X0FA 2VQEJ 4PG4A 3NS5A 1T7PA 4IR1A 4JI4J 2LQ8A 4Q45A 1HIYA 4DR2F 1SC4B 2C3OA 3BKTA 4RNMA 9ATCB 2C6CA 2BJDA 3F44A 3CC2S 2CJBA 4OI2A 2GIVA 1YJRA 1FXRA 3JAMY 4DCJB 2F65A 1VKCA 2AGPA 1RAEB 1C1CA 2APOA 4RW6B 5E7OB 3DRRB 1H38A 5CD4H 1IQZA 4PKDB 4ZX9A 2ZELA 3NCQA 1IBKF 3OR2A 5IZHA 3GU0A 2QIRA 2QJ8A 3MM8A 2NUHA 2IDEA 1NHUA 1NAQA 4A8WA 1RTZA 2P6TA 2AJ0A 4JWPA 4X4OA 2IPOB 4F0MA 4C8KA 3PYDA 4ED7A 1X5SA 3QGGA 4DR3J 2JDDA 4WP3A 1NO8A 3FNCA 1TKDA 5HMWA 4EWTA 4PG6A 4NGPA 5J2NB 8CPAA 4F50A 4P2SA 2PI5A 1L3VA 4KO0A 3NBPA 2VQYA 2CIJA 4J3GA 2W2OP 2XZTB 4NI2A 2RT3A 1R0AB 3S01A 2WW4A 2HVIA 2HQCA 2WPWA 4ZPBA 1YBUA 1HBMB 4OYMA 1FNXH 3IWLA 2AV5A 2HHVA 3GILA 4EFDA 4LF1A 1TKZB 3NRBA 3L2NA 3UDCA 2ABZA 3B82A 4KSFA 3CCES 5J1EB 5CYMA 4MY0A 3F5BA 4R6TA 1RHKB 1H3DA 2OH1A 2LA4A 3LOUA 3MR2A 3A3NB 1YGHA 4ICLA 5JQ4A 1SIWB 1EARA 2J8AA 1WC4A 4CT8A 1M4GA 4DR7J 3SQOP 3I0SA 1I12A 3T5KA 3TRGA 4QW8A 1PYTA 1DRZA 4A95A 4WFYA 3SSRA 3AQPA 2CNLB 3MEGA 4M94A 1JWWA 3QMQA 3RAQA 3BKFA 2IFXA 3M30A 1OJ4A 3CJ0A 4DSIA 2DEJA 3KLVA 4EMEA 4FF3A 3BGOP 3KJFB 4CTAA 3PRDA 2HLTA 1U25A 2GHWA 3HJVA 3PXGa 4UEEA 3SJFA 2HRYA 5KFRA 4CLTA 5KFMA 1C1BB 2KKHA 2OH2A 2E5JA 3UW1A 4NEYA 4UW2A 2AJ6A 1HL6A 2Z3KA 1CC8A 1S1UA 2Z2YB 5BXIA 2AIRB 2F5GA 4DFJA 2F9DA 3PR4A 2GC8A 3PJ9A 2C2EA 1JB0C 1T9UA 1RHMB 4NEXA 3BGRA 2MZ1A 1GMUA 3BO3A 1Y11A 3KDOA 3FRMA 2M52A 3ENVA 3Q8RB 4I7FB 2GVZA 1URRA 4ATNA 1R6VA 1U1MA 3MAAB 4JYWA 1JKHA 2YX7A 3GFXA 1Y10A 4OZ0A 4WIQA 1UWAA 1IXKA 4HT5A 4NX9A 3W7BA 1RI7A 1HBUA 2ACMA 3SXOA 4MHNA 5HATA 1AW0A 1AB8A 1FXDA 4IR9A 2POKA 1IN0A 4F4XA 4ELTA 1KKHA 2XWYA 1Y3JA 4AB7A 1SV5B 2DR9A 2WVEA 1S4EA 3C15A 4M1KA 4XK8C 3G87A 2ZFHA 2W9AA 4OZJA 4WPAA 1T3NA 3MUVP 5BYQA 1CJKB 4J9SA 5F8NA 4Z7YA 4JI0F 1P1TA 4ZDNA 2WK4A 2XCPA 1RTJA 3HSDA 1RSCA 4DZ6A 2PSZA 5IV3A 2YWKA 4M3SA 3T8WA 2F8HA 2D1CA 2N7YA 5KFLA 4CPAA 2VQEF 3P6YC 2CPEA 2NQPA 2GIFA 2K8GA 2HBQB 4N8NA 4TU8A 4DR5J 4CAXA 4IDKA 2J8RA 2FJAB 2R8IA 2P6SA 5L46A 1TVRB 1XQIA 2JX2A 4YGOA 3RRHA 3ISXA 4RW7B 2KXHA 2JJ4D 4ANEA 1QE1A 1V6HA 2JLFA 3ISZA 1DLOB 3B3VA 2KU7A 3LPYA 3CJKA 2CTBA 1T0TV 4OI3A 2ZD1B 3FDSA 5IOLA 3OLAA 2XY7A 4CT9A 5K14A 5F8IA 2PD1A 1YJUA 4OYAA 4DHVA 2RH3A 3BM7A 3IG1A 1JLGA 4KLVA 1SPBP 2DPTA 2J9EA 5A8RB 4U67Q 2VDHA 2Q7SA 3NWGA 4QWDA 1RE1B 1IBLJ 2MB0B 4F9UA 2RUSA 5JM6A 4KKOA 4WWVA 4E2FB 3TANA 4JI5J 5GAEU 1KHVA 2HZAA 3M2RA 5DQHA 1NSPA 1ZYQA 2D74B 2JL9A 1LWFA 3ZZIA 2KRBA 1RO5A 3GG0A 1XJWB 3GYGA 2CPIA 3TTHA 4DWIA 4Q36A 1ZM4A 4MFJA 2FD2A 1W2BR 2R8JA 2AKWB 1Z1ZA 4NCBA 1OZPA 1SL1A 1Q2YA 4NMXA 3CDBA 5FD1A 2KDOA 2XTJP 4B12A 1HMVB 3TWZA 1CPXA 1N5VA 2PI4A 2C2DA 4KZTA 3F0NA 4N5SA 3R5GA 1XNQF 1X12A 2ZM6J 3MM6A 2L41A 1ZM3A 2A1BA 2UU9J 3G8WA 4FXWA 1ZPVA 2EK6A 2J9CA 4KOYA 2B7BB 2IJZA 5A27A 3DOLB 4OFZA 3E01B 5HO4A 1SKSA 3KGQA 4X4PA 1T05A 4R25A 5KFSA 2DO0A 2XS5A 2FHOB 1HWIA 4YB1P 4J9NA 4U7UD 1R7IA 5J2MB 2LYVA 5AXLA 2OD4A 1HYSB 5C7PA 1VK8A 2LDYA 1Q82T 5F0WA 1TXRA 1LAPA 1JLAA 4A38A 2C3MA 4F8RA 2FLPA 2HIYA 3HT0A 5AG7A 2LMIA 3TOAA 5T41A 2PFFB 1N88A 2VJVA 5AG6A 4H4OB 1Y7EA 3P2FA 4J91A 2XBPA 2EK8A 1XBUA 2NREA 2IC3B 4QBJA 1FNOA 4E0DA 3PEJA 1RA7A 3KDNA 4IRCA 1UKUA 4RNHA 4PV6A 3T1AA 2CZ9A 1Q1KA 5LYLA 2J9AA 1H72C 3CCJS 4CRYB 3O2IA 2Z0GA 2HGLA 4NZ6A 3EDRB 2E7XA 3WC2A 3GTYX 2FHMA 2QA2A 4ED8A 1CJTA 2D9PA 2KZZA 2GO9A 1RT1A 3KLFB 2P9GA 4RKUC 2PDOA 4X8IA 1B7YB 1FJCA 3Q8YA 4PWUA 3PVXA 5GVQA 3W63A 3C6TB 3NMRA 1Z8XA 4A37A 3EXNA 2Q4YA 4P73A 2ASYA 2IQ6A 1IKYA 4DX7A 2B3VA 2VD3A 3M2UA 2DNZA 3DGPB 1PAUB 3GCWP 5F3TA 1VRTA 1NSAA 2PMHA 1WHWA 1HW9A 1FY7A 4XPDB 1N36J 1NK4A 4WTYA 3J7A1 3E2EA 2B5JA 2DISA 2W7AA 2J7KA 4KOWA 3C66A 4LF5J 1Q78A 3BDEA 3MEKA 5DQIA 2PR1A 2KVQE 3GZ7A 3NP5A 2QTWA 4DR5F 1U1RA 1FCAA 2CNTA 3OPKA 5E3QA 2M70A 5I3UB 1IM4A 2JHEA 2AQ4A 3I1UA 4I2QB 2W2NP 3NCRA 2DHGA 3AOBA 3DLGB 1YTYA 3DYAB 5CQGA 2GAHC 5F8GA 1C4CA 3RO0A 4CAVA 1YHQS 4OYXA 2F3JA 2HBZB 3C19A 4KFBB 3CXQA 5IM0B 3KYLA 2HNZB 4YFUA 1MJAA 1EHWA 1Y3KA 1AROP 1SJFA 3H8YA 4LSNB 2OPQA 3GJRB 2O67A 3C6UA 3RBDA 1U1NA 1C0TA 4ZY0A 3O8WA 3D7SB 3MMCB 2AFUA 3SI0A 2QVPA 2C3YA 3CPWR 4YR3A 2JLEA 2DR7A 2CVEA 4AL5A 1MROB 3R7SB 2CJ9A 4Y2AA 4M63A 4J9RA 4KOSA 3AB2B 2KTQA 3KJVA 5J2QB 4LVNP 2DKOB 3FK4A 3ZZ0A 1SQHA 1RWXB 3R5AA 1B7FA 3D7HA 3MCOA 2V4QA 1N5YA 1PG5B 2UZAA 4ITSA 2NXCA 4EEYA 5B7WA 3BBBA 3CIZA 4KT0C 1FERA 1QAJA 1ZZNA 3H90A 2KXFA 2W4CA 4RZRA 3NE8A 1QSMA 2VASA 3Q83A 4M95A 1MMLA 2CNOB 3LF0A 4ZIWA 5H9EK 5ETOA 3T41A 3Q24A 2MKHA 1OY6A 2E5LJ 3PB4X 4IOAQ 2DBBA 2UU9F 1WELA 2FJDB 2D3ZA 3ZNJ1 1ARMA 3BLNA 4URGA 3SJGA 1HBNA 2E44A 1YBAA 4ZY2A 4WF9Q 1WKKA 2OU2A 3PP9A 2UUBF 3TUPA 1VOMA 1KQFB 1ACMB 3QGHA 2BO9A 4EZ9A 1KOOA 4H2KA 3AOAA 3R2DJ 4ECVA 2BRKA 2BM1A 1S7IA 3BHXA 2QLFB 3WIVA 1RU1A 3B4MA 3UDEA 4R57A 4JI6J 1VC5A 1UVNA 5B08A 4ZK7M 1CBKA 2MKKA 2XQCA 2VG6A 1J27A 1S9EB 1D9AA 2MQ8A 5D6GA 3BO4A 1L3SA 5C2CA 3TNVA 1L3UA 3OL9A 2DXQA 1NDLA 4G1PA 2WSAA 2HKEA 4WTOB 4FPRA 4WE1A 1FRJA 2CJKA 4NLVA 4PK3A 3IWNC 1RBLA 2AFSA 4HHHA 3MDFA 1HD1A 4ZPTR 4DSKA 3TZWA 1K4JA 4UIBA 1U1KA 1CX8A 4FPIA 1UJ5A 1TIQA 2DGOA 2YKNA 1CLFA 4OQJA 1FKOA 1FK9A 4DR4J 1UWYA 2R7WA 2OOTA 1SJ1A 3QNVA 2Y0MA 4S0MA 2P5VA 4LRCA 4TYAA 4URQU 3R3TA 2LP4A 4DL5A 4FYXB 2DRAA 4LF8F 2ZPAA 3CCLS 3CO9A 2J0SD 5M2RA 2ZKUA 3VGSA 1BMQB 3SBMA 3KR5A 3GLJA 3B8HA 2HWTA 2CPXA 4XTTA 1RTIA 1N36F 3V2UC 4OC4A 4CGOA 3EO4A 3IAS9 2V8PA 2Q79A 2M5YA 4YR0A 3V81A 3PFOA 2DY9A 3J81j 2YKMB 3OQ2A 3PZJA 4OHZA 2FXFA 1VS3A 2RRAA 2XSJB 1Q7LA 1BAVA 5HLFB 3DOMA 1Z9UA 3ULHA 3NGKA 4MHDA 3DRSB 2ALYB 4BS2A 3KL9A 1KUXA 4LF9F 1HQEB 1JXVA 2ALZA 2V34A 2QO3A 3VV2B 4NLQA 2R8GA 2MZRA 2MMYA 3K58A 2RF2B 4RJVA 2YKQA 2EFPA 3P5TL 2E1CA 2UUTA 4NLRA 4C8OA 3D1QA 4LIRA 3CEDA 2ZJRQ 1CJUA 4RS2A 5GAHU 4W90B 2XMUA 3ITHB 4NXNF 1NHVA 4URSA 3KLIA 2Z3OA 1V3RA 1WKLA 1Q79A 2C1CA 1JLEB 1K9MT 3A13A 2U1AA 3TUIC 5ITHA 5KFZA 1QM9A 1YJTA 4PCQA 2V69A 4Q0BA 4MFKA 1P6TA 4EYIB 3X1LB 2OPSA 1QAXA 4YR2A 1RT3B 5HN0A 2G9DA 2D3UA 1H2UX 3M2VB 3SYZA 5B09A 4TYBA 2AGOA 1WSRA 3MR3A 4A8MP 2RRBA 3ISNC 4YU9A 3ETMA 5D4NA 2BANB 4FNHA 4BC9A 3JXOA 1X5OA 5H9FJ 3ZZTA 3MM7A 2CQIA 1ICEB 4ZLLA 1NSQA 4EGLA 1NXIA 4KOUA 3H0PA 1U26A 3P8BB 5IB9A 3HHLD 5AT1B 3UN3A 3CTRA 4NA1A 3W3SA 4B9TA 3PO5A 5A0YB 4YHHJ 1IQTA 5LRKA 2CJQA 2IM3A 2QMUB 4DXLA 4MRIA 4WU3A 1Z4RA 2VKZG 5CYQB 1TL7B 3OJSA 3DM2A 3D4UA 1R31A 3MM9A 3D2WA 2CKWA 3T6JA 1B70B 4QWCA 5C42B 2YNHB 2V8DA 2ZH4A 3A8KA 5KFYA 4X65J 3L95X 4NYZA 3NOCA 3UNGC 4MMOA 3HKZD 3VWDA 2J5AA 3VALA 1X4AA 3UN2A 1TKJA 4QQBA 4G65A 4OAEA 2IAJA 3CT9A 2J8SA 3MCSA 2OELA 2C2OB 3I9V9 4ZCIA 3POTA 5KT6A 3PW5A 2D4OA 3D6MB 3DKDA 2QA4S 3WABA 3QRPA 2YNIA 3OTEA 4P6QA 3N01A 1X4BA 1HR0F 4PABA 1N5SA 1SKWA 1JJ2R 3FCHA 1M0SA 3Q8VA 3QLHA 5HP1B 4DSEA 1URNA 1JQGA 1IR1A 5KT3A 2RVJA 4JD6A 2ASDA 3GJQB 2VFSA 3UCUP 1EP4A 2CQCA 3RB4A 3JQKA 3JUWA 4F4WA 2ABYA 3VAGA 4ORFA 3MEDA 2V4JA 3CSKA 3MECA 2UXDJ 1ZG8A 4ES2A 2QA1A 2AFOA 4ALZA 1R89A 4C2YA 2E29A 5HI7A 5CYJA 3OR1A 4E2AA 1I1GA 2QL9B 4KOVA 3CXCR 1YJNS 2F4VJ 4CM0A 4KSIA 2EVZA 1D3WA 2X3DA 5D4LA 1KSPA 2MKYA 3EVOA 2H5IB 3U1LA 1N56A 3PW2A 2OEMA 2OO4A 4ECWA 3V4IA 3TA2A 1YX0A 2FT0A 4DV6J 2LDIA 5KFXA 1OSDA 2BE7D 2VA2A 4CI0B 1R27B 4NYOA 2LECA 3THTA 7FD1A 3BGUA 3LA0A 2VL1A 3SJEA 2AJQA 2PJ9A 3LODA 3EVMA 2WOMB 1XNRJ 2OPPB 2RKIA 3TUJC 2W7OA 3I5AA 2XEXA 2H54B 3HVAA 2PE3A 1KQKA 2WUUA 2N4CA 2YVSA 1TL1B 1JNZB 4CCHA 4NGQA 4J9VA 2ZKTA 3S6GA 2PJ0A 4FNIA 1KC8T 3K5NA 2ZBIA 3TJ8A 4IG0A 2EFVA 2CWKA 3VAIA 1B0TA 2HHPA 2QT7A 5D77A 3NLCA 2AWZA 3MN8A 4P2XA 2GVDA 2IRUA 4ZPDA 2MHNA 4X4QA 4OIWA 2PT0A 3P4UB 2WW8A 2ATRA 1TL5A 1HHTP 3LP0B 1DTQB 1V3ZA 2VEZA 3FVYA 4DCPB 2M4MA 2W01A 2CQGA 2MZTA 1T9XA 3BXMA 3MTKA 4HNWB 5C25A 2C27A 2Q6CA 3OTOJ 3K7RA 2M7SA 4ZGYB 3DLJA 4A31A 1F5BA 3MEEA 1BWVA 4OLOA 2IJFA 4DOZA 2HC9A 2R8KA 4U6PA 2MQPA 4PG8A 2B3UA 3QGIA 3RBZA 1LXJA 1OY9A 3BI1A 2LCWA 1FE0A 2DNMA 3PY8A 2Q0YA 1NB7A 1NJIT 4NZ7A 3PEIA 3LP2A 5KFTA 1KN6A 3KK3B 2HMIB 1OQ6A 2AYMA 1NJYA 4MK7A 5B0EA 5F8LA 1U2CA 1Z8LA 2AFWA 2B9EA 3MFIA 2AJ1A 2R2UA 4MTPA 1RAIB 3EZOA 3I9SA 3GG1A 2HVZA 2WAQD 1FXLA 3DFEA 3KXDA 3RJMB 3CCRS 1XMQJ 3S9LA 4YHHF 1LW0B 2MXYA 1E6VB 4MFQA 3CMQA 4FF4A 3FMBA 4FUUA 5A6WA 1S1XA 4GC7A 1KRPA 1AFIA 1RT6A 3EM1A 4LR8A 5HMZA 4OX9J 2ZW6A 2L48A 2JH3A 2FB0A 2A2DA 2OSQA 4G1QA 2AZ3A 2B5GB 3TAQA 3FZ2A 3IFEA 3NH4A 3G86A 5CAAA 2HNYA 1VQMS 2Z3MA 2FGCA 4CLPA 2I5JB 5C82A 3OFGA 5HMYA 2RAQA 2AU0A 3I9ZA 1NPKA 1WG1A 5LSRA 4IFYB 3R8YA 4WFBQ 2HSEB 3BYRA 1VBXA 1M44A 4MK9A 4QIGA 2B4DA 4DV0F 2MGZA 3Q8SB 3NMAA 4ZPVR 4USJC 2ZE2A 1NCLA 4FKYA 2FVCA 3CCMS 4XDCA 3IEHA 4DV4J 1WWHA 1H98A 4CLUA 4ILLA 2RHSB 5LXRA 1R8PA 3LW5C 3DLEA 3ENWA 4DN9A 2HWIA 2JEVA 2Q1LA 3V6HA 2OMOA 3HUVA 1WOSA 3JS9A 2XNQA 1BQNB 3V4MA 2VV5A 4CO4A 4C7IA 1LW2B 1C4AA 1KVJA 1AYEA 2LXFA 2OAUA 2ZJPQ 1NJWA 1RXOB 4UOGA 2DGSA 4M8LA 2UXDF 4HLBA 1NJZA 3JSMA 4M5MA 1O6XA 1XR7A 1KD1T 4I2PA 2P0WA 4MY3A 1IVZA 1PC5A 3CJ3A 1YITS 1JLQA 1U1PA 4F04B 2WZ1A 3D28A 2F4VF 2NSMA 2IJNA 2IBKA 1S9GB 4DV5J 4II9A 1FJGJ 1S1TA 3GJTB 2FDNA 4EK2A 3W2WA 2QSFA 1S6UA 4UEFA 3IS9B 2ATLA 5CZVA 5EX3A 4UY85 1S49A 2OPRA 4W98A 5I42A 4UY8T 1VRQC 3QBCA 1GX6A 3C14B 2XY6A 2EG1A 2XB2D 2CYYA 3BJ8A 5GAGI 1Q8KA 2BL1A 5D15A 3MZIA 5E2QA 2A3JA 1EETB 3D6HB 5KG6A 4A46A 2ASJA 1XNRF 3C3LA 4O3NA 3SFUA 4K3NA 5KTQA 3IRXA 3D3CJ 1YVOA 4ZN1A 3FZBA 1KOHA 2REFA 5DDQC 3V8IA 2MKIA 3CULA 4OHWA 2IYIA 3C46A 4DUZF 1YLEA 5AGEA 5JH9A 1VC6A 1NM2A 3RUBL 3M05A 3GP9A 2EFGA 3K57A 2EBJA 2QLBB 3D9BA 2R8HA 4KAIA 5J1QA 2KH9A 5A8KA 3JVNA 2KFZA 4I69A 5J2PB 4PPDA 4B5PB 1REVB 5KG0A 1RYRA 2KFYA 2DNNA 1R3NA 1T9VA 4BINA 2HHTA 1HWLA 1NE9A 1XFOA 4DUKA 2V9KA 5J2NA 4O3OA 4GS4A 3L09A 4W92B 1R6YA 4F6AA 1R0AA 3D66A 3DDNA 3FECA 2JVRA 3J81Y 2E9RX 1TKZA 4XO0A 4RNFA 4NYPA 3O3LA 4ZLNA 3GWCA 4LSZB 3SXNA 4ZPWR 5IT0A 2EC2A 4WK3A 1XJOA 4AE5A 2RS2A 3QAYA 1T02A 3M8RA 1Y0YA 2GHVC 3VVUA 1S5ZA 3TO9A 4IUSA 4OZ1A 4ILMA 3RTVA 3QNWB 3CD0A 4GKKJ 4X66J 2VI7A 4DV2F 2FIUA 4ZN3A 4UZBA 1YLXA 3OUYB 3KUGA 3QAUA 2BE2B 1Y0RA 2MEWA 5KFHA 3PKYA 3W65A 4ZYQA 5AE1A 2R98A 3K0JA 1LK5A 5F41A 2O4HA 3QB8A 2ZW7A 4ECSA 2RMLA 4CLFA 4C0OC 1ARLA 3PRTA 1V0CA 1X9WA 1C1BA 1JXEA 3BV8A 1MN7A 2RDJA 1QSYA 3C16A 2C2NA 4HI1A 3RB3A 1HA1A 2VBQA 5BWAB 4Q8EA 4P52A 2V9WA 4DJLA 2NZ4A 3BKUA 4XPKA 4PSXA 1I5OB 2KM8C 4WKYA 1FVQA 1WEZA 1LQ9A 4AL7A 3NGUA 1PYSB 1P27B 1S57A 1G3OA 4F0XA 3TAMB 3BQ1A 3G71S 3E51A 3QYYA 2DD8S 3DDDA 3OT9A 2DGVA 4I7FA 4AD6A 2P9EA 1EKSA 2MLXA 2E9ZA 2FVSA 2IYGA 2A4NA 2HS4A 5D0RA 2YY3A 2GQCA 5EC4A 3OD2A 3KUHA 4EBDA 3MTJA 2FCKA 4PSWA 2MTLA 3R97A 2XHCA 2VONA 4NGTA 3MRUA 4DPOA 3TAPA 4JI1J 2CQ2A 3HXMA 1S6QA 5HVFA 4OHVA 3A8JA 2ZOMA 1TAUA 1VGYA 2HS0A 1Z8WA 4QR2A 2B4BA 1VJQA 4E8UA 5DLGA 4KORA 3GV8B 1KVKA 4IOCQ 3ET6B 4ZVHA 1SV5A 4NCZA 4WZMA 1I3OB 5EWGA 1NSKL 3QZ8A 4IH7A 3IGRA 1TUWA 1X8DA 1IJEB 1PCAA 4WP8A 4P7VA 5JPHA 3IA0A 3N7ZA 4R9MA 2DNYA 2W9BB 3TOBA 4RO0A 4OJHA 1QQ9A 1UZDA 3VTIA 2HPUA 4UUWA 2F5IA 4DR6F 4RR5A 2BMBA 1BO4A 3W6SA 3VH9A 2VG7A 2PJ6A 1TU0B 1EIYB 2GA7A 2B8QA 1RJJA 7AT1B 3FF3A 4RBUA 4U9YA 1TVRA 5E3RA 2WVCA 3QFWA 2VOOA 1DTTB 4RW7A 3GV5B 5B0BA 4ES1A 1F2GA 2CQPA 3IM8A 1ZO0A 2VOPA 2Z8QA 3CCTA 3LH2S 4XPDC 4OZ2A 2R7UA 1DLOA 2HAFA 4ZLJA 2FY1A 3NY0A 4ZX8A 3KHGA 4Y49B 2R7QA 4R8UB 3CC4S 1S7LA 5A2QY 3CJQA 4ELUA 4AL6A 4KVXA 2ZD1A 3MWBA 4RUAA 4CZCA 2VPXB 1GYTA 3ENAA 3P2HA 2NZCA 4PWWA 2Y0SD 3OW2R 1U8WA 2BRLA 3IC1A 5IV4A 3FSYA 2FTRA 4MIBA 2VZ9A 4F36A 5JXSA 2IBOA 2G0BA 2FVPA 2WONB 3TVYA 4TVAB 2Q04A 2ZEOA 4DUYJ 3QIPB 3Q23A 1HNXJ 1HNZJ 3M6UA 4U96A 4QWEA 4GKJF 3KKFA 1RT2B 3HFVA 5L39A 2VFUA 4QOTA 4CGMA 3W2VB 2XC9A 1U02A 3I31A 4XPLA 5CXTA 2NPIA 1LNQA 5DG7A 3G6VA 4QYZJ 1IYKA 1S48A 2YWEA 1HMVA 2ZH7A 5HL7Q 6CPAA 1YWXA 1M5SA 1ITPA 6AT1B 1S1WB 5L1KA 1DE4C 4OIDA 1YIJS 3AAWB 4PYDA 3S6KA 3B78A 2LA6A 3V6DB 3LGHA 2RQ4A 3IR5B 3MPWA 5GADU 2E9TA 3AJDA 2HHXA 4DFKA 2EK1A 3J7Z5 5LMNF 1UVMA 1FRKA 5D0HA 5HXDA 3M1VB 1ZPWX 3J7ZT 2LQJA 1VQSA 2IVMA 2GFQA 5KG5A