3DLJA

Crystal structure of human carnosine dipeptidase 1
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
477
structure length
471
Chain Sequence
PPPALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLGQSLPIPPVILAELGSDPTKGTVCFYGHLDVQPADRGDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWISKPAITYGTRGNSYFMVEVKCRDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTKEEILMHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVIGKFSIRLVPHMNVSAVEKQVTRHLEDVFSKRNSSNKMVVSMTLGLHPWIANIDDTQYLAAKRAIRTVFGTEPDMIRDGSTIPIAKMFQEIVHVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFAAFFLEMAQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human carnosine dipeptidase 1.
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Beta-Ala-His dipeptidase
total genus 136
structure length 471
sequence length 477
chains with identical sequence B
ec nomenclature ec 3.4.13.20: Beta-Ala-His dipeptidase.
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dljA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3dljA01
3KL9A 2AFZA 4NGTA 1PYTB 2ZEOA 2XEJA 1CBXA 3WC5A 4DJLA 3NA6A 4MMOA 2PJ4A 1LOKA 5K8OA 2ZEFA 2RB7A 1Z5RA 3BXMA 4UF4A 4K3NA 1Q7LA 2GLFA 4OMEA 4PXDA 2PJAA 2XEGA 4PXBA 3IJ3A 4O23A 3KQZA 1YW6A 3D68A 3LWUA 2Q43A 1ARLA 2AFSA 4PQAA 1IY7A 2QVPA 2ZEDA 2AFUA 2PJCA 2RFHA 5HXDA 2PCUA 4R8FA 4ZX9A 1TKJA 1LANA 6CPAA 4P4EA 3IEHA 4YWYA 3SJGA 3SI1A 3B35A 5ELYA 4MHPA 3SJXA 1XMBA 2CF4A 3IWWA 3B3SA 4P4BA 1F2OA 4OKOA 3ISXA 5LYIA 4G1PA 4KSIA 1VIXA 2QJ8A 4MRIA 3PRTA 4TNUA 1GYTA 3K2KA 2PVVA 1QMUA 4B6ZA 1BPNA 1YLOA 3KASA 1TF8A 2PJ5A 4FUUA 1DE4C 8CPAA 4OIDA 4EWTA 4MXUA 5LYLA 3GLJA 1HDQA 1F57A 2NYQA 1YSJA 3IIBA 2ZOGA 3NH4A 4IAVA 2C6GA 2CTBA 3RBUA 2ZEMA 4AXVA 1ZG8A 1ELLP 4Q7AA 5K8PA 3FEDA 1XJOA 2PJ6A 3TX8A 2F7VA 4ONWA 1H8LA 3NH8A 2O4HA 1XBUA 3TC8A 2PJ0A 4F9UA 3SI0A 3I1UA 4P10A 1BPMA 2F8HA 2IQ6A 1ZG9A 4RUHA 1TKHA 2BOAA 3H8GA 2PJBA 4IK2A 3L2NA 4A39A 3CT9A 4UEEA 4ZX8A 1FT7A 4EFDA 3FMCA 2PIYA 4UEFA 1NSAA 2PJ8A 2JBJA 3FVLA 1IGBA 3WABA 1LAPA 2QYVA 3FX6A 1BLLE 4F9VA 3WC6A 2EK9A 4P4FA 3WT4A 3B3TA 2ZOFA 5THWA 5LRKA 3DGVA 3PFEA 4GM5A 3KI9A 3D7HA 3FECA 3PB6X 4ZYQA 4X2TA 2ZEEA 4MCQA 3KZWA 3T8WA 4NGNA 5LYFA 4NGQA 4OC2A 3D7GA 1BAVA 4UEZA 3VH9A 1LCPA 2EWBA 3KHZA 3NFZA 3CDXA 1ZLHA 3H8EA 4P4JA 5K8NA 1AMPA 1OBRA 5LRJA 2J9AA 1CPSA 3FH4A 2V8HA 4P4DA 2PRQA 5HVGA 3JRUA 1YMEA 3CPXA 3K9TA 3S9NA 1CG2A 1CP7A 4MCRA 2AFOA 5IB9A 4DUKA 3NH5A 5HVHA 1XFOA 3PB7X 3D4UA 3D7DA 3PB9X 2ZEGA 2BCOA 3LMSA 4WWVA 2PJ9A 5HVFA 3B3WA 3PB8X 4WJBA 5D29A 3PFOA 3N5FA 2NSMA 1CX8A 4F8ZA 3KQXA 1KWMA 3KR5A 4FAIA 1HDUA 1F2PA 1VHEA 3D66A 3KHXA 4JZ0A 3V7ZA 1AYEA 3BI0A 4ZY1A 4MHYA 4DYOA 2CIJA 3MRUA 3IFEA 2I3CA 2C1CA 4R76A 2GLJA 1Z8LA 4R7MA 2WYRA 2IJZA 4NJQA 4OC0A 4OP4A 2XEIA 1VHOA 2JEWA 4PPZA 2POKA 3V38A 4OC5A 4A37A 4NGMA 7CPAA 3BHXA 1LAMA 3VATA 2PJ1A 2HB6A 3HLPA 3KGQA 1FNOA 4MHZA 1TXRA 2V8DA 1ZG7A 3BI1A 4NGRA 1ARMA 3FF3A 4X3RA 4MCPA 4MCSA 2PVWA 4ZI6A 5JH9A 3IC1A 4P45A 2CTCA 2AFMA 1UWYA 4W9YA 4Z65A 2VL1A 2ZEPA 2G9DA 2XEFA 3GUXA 4ZY2A 1ZLIA 3RAMA 4IHMA 2C6PA 3PB4X 4A94A 3ISZA 1DTDA 1XRYA 1Z2LA 4TWEA 2O53A 3B3CA 3B2YA 3VARA 3S9MA 1CP6A 1Y0RA 5CBMA 3PEIA 4A38A 2WZNA 3B3VA 3QNVA 2ANPA 4JYWA 1R3NA 2GU2A 2IMOA 3GB0A 1RTQA 4H2KA 3B7IA 4OC1A 3FEEA 4P6YA 3D7FA 4UIBA 2PE3A 4NFRA 2ZELA 4PXEA 5LYDA 2PJ7A 4PXCA 4EMEA 3RZAA 1QQ9A 3FJUA 3WC7A 2V77A 3SI2A 5LRGA 4OC4A 3PBBA 3D67A 4ZY0A 3PBEA 1Y7EA 2PIZA 1HEEA 2V8VA 2AFXA 5DS0A 3MN8A 3KR4A 4OIWA 5J1QA 4MHNA 2AFWA 5K8MA 4FBEA 1R43A 2EK8A 2OR4A 1EE3P 3H8FA 4R6TA 3SJEA 4NGSA 4UIAA 4OC3A 1TKFA 5JGFA 5CPAA 3CPAA 2GREA 1ELMP 1YW4A 5D8NA 5F09A 2ZENA 5JM6A 5I4MA 4X8IA 2OOTA 4LQGA 1Y0YA 4P4IA 2PJ2A 4YU9A 2JBKA 3SJFA 2V8GA 1CPXA 2PJ3A 4BD9A 4P44A 1VGYA 4NGPA 2Q51A 2ABZA 1TF9A 2Q4ZA 1JQGA 4FWUA 2FVGA 2HC9A 1PCAA 4CPAA 2BO9A 3HUVA 3S9LA 2DEAA 1LFWA 2C6CA 1M4LA 3DLJA 3IO1A 2ZEHA 4NJRA
chains in the Genus database with same CATH superfamily
3NOCA 4F4ZA 4E0AA 2Y0MA 2CIMA 3MEEB 3NMAA 2GNKA 4MIBA 2CVEA 1P6TA 3C46A 4M6GA 2KVQE 5BR8F 4II9A 2KRRA 2CJXB 3HSGA 3DKDA 4JLYA 1Q7LA 3GYNA 2C2ZB 2HHUA 1WKJA 4CM0A 4DV7F 3TQEA 3TZYA 3M2UB 2OEJA 2DXQA 3LODA 4A8KA 5HO4A 2RF2A 3NRBA 1VDHA 4NRUA 1BC6A 1ZAWA 5HROB 1N5VA 1TL3B 2BJEA 1TZ0A 4OI0A 1N34J 3OPKA 2VUGA 4FD5A 2VKRA 1TL7B 3ISXA 2PN6A 4NZ6A 3KLHB 4XTTA 3PIPQ 2BM1A 1FRXA 5GADI 4C3MA 4ED6A 3US5A 2R3VA 2HHSA 4RNOA 3KASA 1Q86T 5KFMA 2MSTA 3DLEA 1HDQA 3A8EA 4UFVA 4BCAA 1EAYC 3RBUA 4NE9C 2C28A 1D09B 1E6VB 3SMZA 4ZGYB 5A27A 1KVKA 2B5JB 2COLA 4DN9A 5HLFB 1A2ZA 2AGQA 2DPSA 5E41A 3SIPB 3D5MA 3G82B 5KG3A 4ONWA 2UUBJ 4HT5A 3W9IA 5GAEI 4NEXA 1XEBA 2KT2A 3VGSA 1GAOA 3C6UA 1NMEB 3J7Z5 1XIQA 2P9GA 4QWAA 3UD5A 4TNOA 3BQ1A 4KSFA 2EKNA 4HVZA 2PA3A 4Q8EA 1QSRA 2B51A 4ZIVA 4H89A 1K0VA 5AJ3F 1BWVA 4KOUA 1VRTA 3HFVA 4OYAA 5L39A 2CNOB 4DV3F 4LBPA 2ATLA 1NJYA 1U6MA 2WVEA 1HFEL 3SSSA 2W9AA 1KFDA 2ROPA 1BAVA 2UUAF 2Z0ZA 1NE9A 4NLYA 1UJ5A 3CJKB 4KBIA 2UVVA 4LUAA 4NLQA 3ZNJ1 2EWBA 3MM6A 4ICLB 1IR2A 3MEGA 3TT2A 5LSOA 4CNYA 1HL6A 1OBRA 2YWEA 1I3OB 1XN9A 4CH0S 3EYZA 1CPSA 2VZZA 1Y3KA 3DU6A 2ABYA 3FSYA 1CG2A 4AXJA 1YITS 2MTLA 1WC0A 2UXDF 3PB9X 1K1SA 3C8YA 2PJ9A 5HVFA 4K4WA 3PB8X 3KJVA 4JI0J 1UW4A 1RAAB 4KRWA 2J6SA 3KHGA 3DNSA 5A8RA 1L3TA 1KRPA 4BMHA 3CCQS 2ZC4A 4X64F 3OR1A 1LWCA 4R3LA 2NPFA 1URRA 5KOWA 5FDLB 2IY5B 2CIJA 4FXWA 3UWTA 2W01A 1RA7A 3WX8A 4R76A 1R57A 2NYHA 2WYRA 1TU0B 5J2QB 3MMCA 1FKPB 2DRDA 3IBWA 2ASDA 1Z1ZA 3DGPA 2CQBA 4GKKF 3DRPA 3QGHA 1S1WA 3CMQA 2XNRA 1JMTA 2G3AA 3DN9A 3VATA 1TVRB 2PJ1A 1ZETA 2RJZA 1TXRA 4AT1B 4X4QA 3PW5A 3FC9A 3PG9A 4C3LA 3JYTA 2UXCF 2FLOA 4LFCF 2B4BA 4PABA 3EXNA 3CXSA 4L89A 2HQ3A 5KT2A 2KHCA 2WONB 3D28A 1T3OA 5IT9U 3HULA 1U02A 1RQ0A 1HNWJ 4FKXA 2DR9A 2G4BA 1QY7A 2AEJA 4NMXA 4U7UD 4WP3A 2ASLA 1NK4A 1XRYA 1MWYA 4IFYB 2XYGB 1FJ7A 2GMLA 3TR5A 2IPOB 2P6TA 1ZH5A 5IT9Y 3RYLA 2V63A 5E33A 2P2CB 3QFHA 5A8WB 2C3MA 2DRBA 5DG9A 3GB0A 1CULB 2UVUA 3Q8RB 2OTJS 4OI3A 2OEMA 4X2BA 1NKBA 2P6EA 4PXEA 2IBOA 3DMJB 2FDNA 3F5BA 3HHLC 1RDRA 2V77A 4P74A 2IVYA 3WDOA 2FZCB 3TP2A 2XSJB 4DWIA 2EPIA 2XYPB 5L1LA 4XPDC 5ETKA 2OR4A 2GS8A 2CQIA 5KFUA 2AF6A 3N6LA 4IF5A 5EWGA 1FRKA 2PQ8A 2IYIA 1G6BA 3TE4A 3TW0A 2HMIB 4KOVA 1ZAXA 3QT8A 4ATNA 3RB3A 1Y7PA 2FLLA 2QE5A 5JM6A 3I9SA 3FYNA 4DV1F 4UWJA 3O8WA 3CXQA 4P4IA 5I3UA 3BKUA 3O3LA 3MM8B 1Q8KA 3OD2A 3DDDA 1WACA 2ZBCA 2J0SD 4FDFA 1U2CA 4KE5A 4JUZA 2XZTB 4H4MB 3KLFA 2DYAA 2W9BB 2DEAA 3IG1B 5HBMA 3SFUA 1H7XA 1C1BB 4ZVFA 3QQCD 1DTTB 4WTYA 2J6TA 2ROGA 4IKAA 4DJLA 2R9LA 4WYLA 2Y0SD 2FY1A 3A3NB 3HFZB 3O6QA 1KHWA 3S6HA 5B0EA 3GQCA 4NLSA 2J9CA 2YKNA 2PJAA 3M8PB 2RQKA 2CDQA 1KVJA 2KYXA 2REEA 2Q43A 2B9YA 2VU5A 2MHEA 4ZVTB 2AFUA 3I4PA 1JXEA 2D74B 1OY8A 1B0TA 1F5AA 2DPIA 2OTLS 3QJPA 2H1YA 2OKQA 2GC8A 2FSRA 1Z4UA 1R31A 2XMJA 3MM5B 5GADU 5LYIA 5DQHA 1BQNA 4NA2A 1Y9OA 1GEHA 5A8WA 4CRJA 1TQLA 1OS5A 3ADAC 3PO4A 2HBZB 3U7JA 3NCQA 2E9ZA 1V6HA 3PW4A 1M1DA 1N32F 5D0EA 3RNZA 1F9EB 2YPYA 3CW2C 2H5MA 3AJDA 1VQKS 1RAFB 3N4WA 1ZPWX 4OZ5A 2JEVA 5K8PA 3MD1A 1RISA 2F1FA 1KS2A 5GMDA 3V81A 3CJQA 4EO6A 3MEDA 3SI8A 3PACA 4Y2IA 4NXYA 4RNFA 4E8OA 1GMVA 3PKMA 3CJ8A 2VDHA 1TKHA 2B3TB 1S6QA 2WVBA 1JKHA 3OL7A 2J8NA 4NA1A 3IU1A 2PE8A 4EFDA 4ONUA 1IBLJ 4Q8FA 2C3UA 1YBUA 2HVZA 5C24A 1M5VC 4MKBA 4PK3A 3EVWA 2JLEA 5L9XA 5DLGA 4C2XA 1NBEB 4O3QA 2O01C 1BLLE 2IA0A 1HBUA 1YJNS 3BSCA 1BMQB 3KI9A 1H98A 1YTYA 4ZYQA 4MFBB 1UVKA 9ATCB 3RBDA 1FERA 2ZWOA 3DLGB 1UETA 1T02A 4G1IA 2QA2A 2E5HA 3DLKB 4LRDA 1FRJA 2ZDPA 4ETZA 4LF8F 1U1OA 1YMEA 3K9TA 4M6IA 3ZZRA 5B0CA 3H5YA 1HLWA 1DFDA 1C0UB 3M2UA 5E5NA 2OAUA 3CWJA 4KJIA 4DX6A 1T95A 3SSQA 2DGSA 3C2PA 4CLKA 4CZCA 4WJBA 3V81B 3PJ9A 3R7SB 1RWMB 1WELA 2EO8A 3LGMA 2D69A 3ILOA 3OFFA 4HT7A 4FS1A 4B14A 1EB0A 3NGDA 2VIHA 1CJVB 4ZJOA 1HHTP 2OPPB 1FKOA 3VV2B 2VQEJ 2DGVA 3MCMA 2W25A 4DSFA 2C27A 4B9VA 4CDIA 4GO5X 2I3CA 3DOKB 3J7A1 2Z58B 4R7MA 4ETXA 5CD4H 1RU2A 2AGPA 4OX7A 3MMJA 2DR6A 5IT4A 2JEWA 5FDLA 1WEYA 4XNHC 4J9PA 4CIOA 1UWBA 1XWLA 1LAMA 5DG8A 2V69A 1H3DA 3NGUA 2F3JA 2Y8YA 1KHVA 2AP6A 1MMDA 2MSSA 4OIXA 3BGUA 2PVWA 4J9SA 3BJ8A 4DSJA 1FEHA 2B8PA 4IG3B 4LRAA 3UY5A 4Z65A 2MDAA 2VG7B 2ZEPA 1ROFA 1UFWA 4EEYA 4LVNP 1IKVB 2DR8A 1JLEA 3RAMA 3E3XA 4J3GA 4KT0C 3QPIA 4FVMA 3RU0A 1RT7A 4JOUA 4ED1A 1UAWA 2N4CA 5EBVA 5DG7A 5D78A 1RGVA 2QFIA 5DM6Q 3Q89A 4ECSA 3GFYA 4QR0A 4CYOA 3KUHA 2DIUA 2LA6A 4X66F 1S4FA 2IDEA 4OC1A 1N8RT 1E6YB 1TP7A 5DDOC 1GQEA 5LYDA 4ZP7A 4UW2A 5F8GA 1WNEA 2V4JA 1RTZA 2MZTA 4ECYA 3HHKA 2E66A 4MH8A 5I3UB 4AB7A 4Y0FA 3MM8A 4OHWA 2PIZA 2HLTA 4AG9A 1N0VC 3DMJA 3FQLA 3SQOP 4KGXB 4UOCA 1FO1A 3SV4A 1N4LA 3HZEA 3R1KA 1RT4B 1I94J 2W2MP 2HFVA 3MAQA 2MQNA 4I67A 4NGSA 4UIAA 3TRGA 5KG2A 3CCRS 2CQ4A 2XS2A 2GVZB 3OJSA 1XQIA 3KHHA 2YNGA 2RNEA 4LQGA 4DFJA 2DNQA 1WSRA 3ZTPA 1KTVA 4DFPA 4LF7F 4NGPA 4P2SA 1V5VA 3LA0A 1DLOA 3ZTSA 4A95A 1GMWA 1KUYA 4KGVB 1QTMA 1SL0A 5CQGA 5AE1A 1VC5A 4MFLA 4USWA 2AFZA 4KGKA 4Y49B 4YDDB 3W1YC 3T5HA 3ILIA 1KZFA 1M5HA 1SCJB 4TY8B 2XG8A 5K8OA 2HZCA 4XPLA 4ZN3A 1RT5B 1DTTA 1KQGB 4V1Ak 2ZZMA 3LP2A 4IG0B 4F2SA 1H0HB 4UOFA 3UNYA 4KFBB 4RW6A 3ENVA 3HO1A 2QVPA 5H1SV 4EVYA 1RB0A 4F26A 1HMVA 3B35A 4ZVRB 5FJ4A 1FTRA 4L6V3 3HVTB 2IM1A 2M8DB 1ELOA 2XLJA 3NAHA 1VBKA 1VIOA 2NUUG 3MM9B 1LW0A 3T9ZA 2AYGA 2AX0A 1TF8A 4FUUA 3EZ5A 2MGZA 1NDLA 1YJ7A 3HX9A 4JD6A 3NH4A 3NE7A 4UY85 2HVIA 1TAQA 3K8VA 2IBKA 4FF4A 1YIJS 3D2PA 4DCPB 2VBYA 3IWGA 3Q2TC 3FEDA 4DV3J 3K59A 1VCTA 3FBUA 1YKWA 2VXKA 3PJWA 4FBUA 3GY9A 3C16A 1IBCB 3S6KA 3IBCB 1CEZA 3OVAA 4YFJA 5FLXY 2Y1JA 3CJ5A 4P75A 4ZIWA 4MFBA 5D0RA 1F9FA 1S6OA 2UV8G 3I0RB 3C3LA 1FWPA 2KI2A 2HNYB 2ZZTA 4USTA 4LRFA 2CNKB 3MXHP 1HHQA 3I96A 4OL8A 1IYLA 3DRYA 4NLGA 5JMNA 4ZVHA 1IM4A 4J9RA 1U1NA 4LR7A 5EUHA 2CPFA 3JQJA 3R1HA 1VQ7S 5G20A 1MG7A 4M5DA 4FPIA 2V2KA 3HHLB 1YHQS 1ZZFA 3KWMA 1QSLA 4CRZB 4QYRA 2YNIA 2DPTA 2BKNA 3T8WA 4F0KA 2FL4A 3AD9C 4FKYA 3T9YA 1VQOS 4M5HA 3VH9A 4UWIA 2AJFE 1AXQA 1DQ9A 5B0GA 4RW4A 4U8VA 5K8NA 4KPCA 3FH4A 4K4SA 4WWSA 2I8EA 4PWWA 5KFXA 1S5KA 2XMAA 3JRUA 2YKNB 4M94A 1U8WA 4JV2A 4BBYA 3HKWA 2ODFA 1AUDA 1BLUA 3D4UA 3PGPA 2KT3A 1NK7A 4RW8B 1S1UA 3ZZIA 4XAKA 3UI3A 2EG2A 5E3AA 4M5MA 1NJXA 3ETMA 4Y34A 3CC2S 4B3TF 3KHXA 2Z30B 4ZY1A 1QE1B 2HS0A 1U09A 3A12A 2E1CA 4C6AA 1XTZA 2VICA 2J8MA 3FDSA 2OSQA 1HD1A 1JLEB 5FD1A 4LF4J 2WB1D 4PKDB 1U0SA 2CPEA 3FFIB 3B4MA 3OFEA 1RTDB 2CQPA 4ICLA 4MY0A 2EXUA 3KG0A 2BRLA 2OGUA 3PW0A 3FF3A 3CO0P 3OVBA 5JH9A 4HTIA 3EZOA 2YWHA 1TVRA 4MAKA 1WC1A 3HKZD 4UCMA 3M30B 3FZ2A 3T1YJ 1VJWA 2CADA 1H2TZ 5LT5A 5HMNA 2NXNA 2GMJA 3QWUA 1X31C 4IRKA 3TOBA 4B9NA 3FUYA 2AJ2A 1ZTTA 2Y0BB 2IVFB 3NKYA 3L7UA 5KG6A 3M2VA 2R1IA 4USIA 4H2KA 1HNIB 3VTIA 3UCZP 5L9NA 1A9NB 2K7JA 3G8QA 2E9RX 4WE1A 3FJUA 4P9SA 3WC7A 1DY3A 4DV0J 1K47A 1N5SA 4ED5A 5EN1A 4GKJF 4O4GA 2UUCF 3MN8A 4I56A 5J1QA 3C15B 3UDEA 2G1HA 4PG5A 3K9UA 1RT3A 3PEHA 2RQCA 4DU8A 1Y3JA 2XLKA 2KVIA 2E1MC 3QZ8A 5IV3A 3IWNC 1AFJA 5F48A 3M9NB 2YNHB 4JI7F 2ZITA 2JEGA 1N71A 1ICEB 3OT9A 5GAHU 3BN7A 2B4DB 3HZGA 3AJ2A 3HK2A 3SJFA 3EX7B 1ZA1B 2B6AB 2GAGC 1TF9A 2N4DA 1Y5NB 1PYOB 3ET6B 3SCLE 1KUXA 4X4OA 1SQFA 1UA0A 4TLQA 4YY3F 3DOKA 2BJ7A 3CMES 4QU7A 1ZM2A 1KQSR 3FMBA 3UDVA 1J5EJ 4NGTA 1UPMB 1UEVA 1SI9A 1T11A 5GAEU 4KORA 4A8MP 3Q8QB 5AT1B 2XMMA 1FY7A 4LQ6A 3MEKA 4AFFA 4WFXA 2DR7A 1KUVA 2D1CA 1HBUB 2LU1A 1RHQB 1WI6A 3R9GA 1FJCA 1E6VA 2XEGA 3W8PA 5E3CA 4C8NA 1M90T 2H5EA 3DDKA 4B9LA 2MKSA 5AGEA 1HA1A 3R95A 1X0PA 2PJCA 4R8FA 3ONQA 5DQIA 3J7YU 1H6KX 4CGMA 2LFVA 4KTQA 5AG4A 3CJKA 2N82B 3IAM9 5T41A 1NK5A 1O6XA 5EWFA 1A7GE 3HF5A 4KSIA 4DV2F 4DZDA 4J9KA 4EK2A 2PVVA 1HMVB 1MMLA 4Q38A 4NLDA 1YLEA 1WF1A 2UU9J 2YWFA 4P6QA 3CCSS 4DX8H 3R9EA 1RAGB 2NXUA 2CG4A 2CTBA 1JLBB 3K5OA 2FLNA 5E3RA 2OPPA 5IWAJ 1RT1A 3KFWX 2HG4A 4NZ0A 2PJ6A 2L9NA 3OW2R 1IKXA 3R27A 4EU0A 4ZA1A 4BBHA 4P10A 4A8WA 4ZJLA 2ZD1B 1CS4B 3J80U 4IK2A 4B3RF 2CPHA 4W90B 4IR9A 2IRXA 2N7CA 5J2NB 1MROB 1NSLA 1S49A 4C8OA 3QATA 2FVQA 1ZA2B 5HATA 4ZOSA 1S72S 2PT0A 2V34A 2HRTA 5DWMA 5CYMB 1E6YA 2OU2A 3BJYA 3FX6A 3CJ0A 2EK9A 4P4FA 1W2IA 2QL9B 2B3UA 5J1PA 3GCWP 3AAWB 3NGTA 3A13A 5HAOA 4WZMA 3CC7S 5FIIA 4ALZA 4CGPA 2GA7A 3BO2A 4Y28C 3SQGA 2J5AA 1AMPA 2HHTA 4I0WA 1RAEB 3QT7A 3POTB 4RJVA 1S1XB 5CA5A 2FHOB 2NZCA 2YNGB 4OAEA 2XCAA 1CULA 4ZHRB 4G6VB 4C97A 1Q8BA 2BE9B 2WRMA 4HI1A 4ED7A 2FHJA 3BH6B 1RWXB 4USMA 2C2KB 2L9WA 5AE3A 3OUYB 1CJUB 3K5MA 5LJ3Y 2UXBJ 2OZHA 1X12A 1AYEA 3HP6A 1RT4A 4DR6J 3CCES 1HWIA 4IFYA 3GILA 3V4MA 4B3SF 4C8KA 2RF2B 2LDYA 4L73A 2H54B 2FT0A 2HYIB 2D41A 3O5TB 3CCLS 5AXKA 4Q2MA 3A1YG 1D3WA 1I12A 4CO5A 4X4PA 2YKMA 4RW9B 1Q95G 3C14A 2J9EA 1OQ3A 5E96A 4X84A 3TOQA 1BGXT 2Q04A 3IWLA 1EKSA 2JLGA 3SXLA 5KT3A 3FCWA 4AVBA 2FVRA 4ZS6A 3AA8A 1QSSA 5KTCA 1S79A 1C1CA 1T9WA 4ED0A 4RWWA 2B0GA 2VG7A 3GE9A 5J1EA 1OMSA 2B4OA 1CP6A 3BBFA 4I2PB 5CBMA 1NZ8A 1Q16B 5EHHA 1Q4RA 4ANDA 1HI1A 2I5JB 4HHHA 1JLAB 2CYYA 4BINA 2M8HA 2OMLA 3DOLB 1KOOA 2QC3A 1KDNA 3I3GA 1YJVA 5HBMB 3MTKA 2XMWA 2V8VA 2AFXA 4DQPA 1LW0B 7AT1B 3B82A 3UNGC 1NB7A 5M2UA 1WOPA 3RUBL 4CO1A 9RUBA 1FRMA 2FPHX 4DSKA 3K7RA 2QN6B 1UMJA 4H6ZA 4ZJQA 4ZPAA 3KK2A 2ZFHA 4EBEA 4DR1F 2LYVA 4A8OA 2VBWA 5IM0B 1NK8A 2BQUA 3GYGA 1GMWD 3BGRB 3NCPA 1SQEA 2M7SA 1YX0A 1CQNA 2WVDA 3TAMB 1ZYQA 5KFFA 4ZCMA 1N5TA 1PCAA 3W64A 4P7VA 2FCKA 2YKQA 1BE4A 4M85A 3ELHA 4X4SA 2ASJA 2MY8A 3KL9A 3TEHB 3I55S 4L75A 1S48A 1VHSA 2VQFJ 5KT4A 4R87A 3WC5A 3MZIA 5IT0A 3HD2A 2VQEF 4YB6A 1ZBTA 4QCLA 4MKAA 3CJRA 2WSEC 1S1TA 1JWQA 2HBYB 3MMAA 4W4MA 4UFXA 4FYWB 2VOPA 2IVMA 5IS2A 3UE2A 1M1GA 3VGTA 2HFZA 1F5CA 1NJWA 5DDPC 3KQZA 1MWZA 2V4QA 3IP0A 1IR0A 2Q66A 3NY0A 2RFHA 5HXDA 4ZX9A 4DPYA 1TKJA 5AXLA 1LANA 5KFLA 1U47A 4AVAA 4WBFA 2C3OA 2KL8A 5KG1A 1XMBA 4DF4A 2NSBA 3TAPA 4QR1A 2R8JA 1U6FA 3KLHA 4G1PA 5AG6A 3Q83A 4MRIA 3KLIA 4C7QA 2VODA 1YGYA 3K5NA 4ED3A 3IWXA 4U67Q 3IGVA 1GX6A 1RWVB 2R8GA 4AL7A 1S9FA 2QGFB 2V9KA 2YNEA 1CJWA 2ZEMA 4LF9F 1UVLA 4O3SA 3QAEA 3R5AA 2N3OA 1ELLP 1CQMA 2BX6A 4HL9A 1YVKA 1HQUB 2HFSA 4RI1A 1T7PA 1NPPA 1PYTA 4PG8A 3J7ZT 1S7LA 2C22A 4F0YA 1TL7A 2DNGA 1CJTB 3QRRA 1XNRJ 1HQEA 3CNQP 4O44B 3ZZYA 5LOQA 4NPOA 2H51B 1FT7A 4FXVA 1GTHA 2BA9A 3VAFA 1Q1KA 3QGIA 3LPEA 2UP1A 5CAAA 1XNQF 1HNXJ 1S0VA 4AD6A 1HQ2A 2R7RA 2ERRA 1TK5A 4LF6F 7FDRA 3WT4A 3DGVA 2VG5B 2JVRA 3PYFA 4GM5A 3NWGA 4IG3A 2HMIA 3DDNA 4I2QB 3C6UB 4OLPA 4OYXA 4HDGA 1Y11A 2G2ZA 4DS5A 2HFOA 5CYQA 3P8BB 4GVBB 1ZLHA 1TFWA 4ZLJA 1WJ9A 1XMQF 4LBIA 2LP4A 2J9AA 1HD0A 4M5IA 4Y6IA 2P9CA 3N5BA 4NOHA 3CPXA 3AOAA 5D3GA 4JV1A 1XNRF 3R96A 1NEEA 2B4DA 2W4PA 2EKYA 5HVHA 3GMGA 2O66A 2Y8WA 5KOXA 1AUGA 4QPXA 2D3UA 1N5YA 4OX9J 2W24A 3HHEA 3MEEA 3RB6A 2R7HA 2VZYA 3PFOA 4EYHB 1IU8A 2A4NA 1L3SA 1OQ6A 2OIHA 3B8GA 3PJXA 3PYEA 1HBOB 3UD4P 2OPRA 1R8HA 1TIQA 4KGZB 3ZZUA 4FD7A 4JZ0A 2QIFA 2GANA 2HGNA 2HV2A 2AQ4A 3X1LB 4KKOA 2GLJA 3ETOA 2IJZA 3CJSA 1F60B 4PPZA 1YGHA 4YFUA 2DNHA 3EXCX 4DV6J 3JVNA 1RTHB 4X62F 1GH8A 4UOHA 3PP9A 2KO1A 3M4XA 4CGOA 2DXEA 3IN5A 2QT7A 3GJRB 4NLRA 1LXJA 4YUDA 4IDKB 2XI2A 1U25A 1N33J 3GFXA 2ZZNA 2HVDA 2QG9B 3ISZA 5FLXU 3QT6A 4JI5J 2K3KA 4YHHJ 2VKZG 1FI4A 3RR7A 5H9EK 3SCJE 1IVZA 3TCVA 3FBEA 4Z7YA 4DCOB 4TN2A 4CO0A 1MWQA 2RE1A 1RYRA 4HH1A 1R3NA 2BMBA 1C4AA 2VFRA 5JVHQ 3D7FA 4LR9A 4J9MA 2WAQD 1RHUB 2CG8A 2UUWA 1XF8A 4NFRA 3KK3B 1RCXB 2AX1A 1NDKA 1GXLA 2HVHA 4EZ9A 1Q2DA 3BDEA 4WFAQ 4DR5J 4IOCQ 2Y1LB 3PRBA 3UN2A 2MMYA 1U4BA 1XE4A 4WXWA 1HYSB 2OO4A 3FNCA 3CCJS 3MHYA 2F9DA 3MM9A 1T8EA 3LO3A 2GIRA 4YR0A 2CPYA 4NASA 3KK1A 3M9OB 1W26A 5B0DA 2BE7D 1N33F 2BACA 1SKWA 2ZWPA 1VQPS 3NS7B 1LQ9A 2RMLA 4NYZA 1VRQC 2JWNA 2W7OA 2RVJA 2RHQB 5J2PA 3LQVA 2Q79A 2RHSB 2OPSB 4PQUA 1WUUA 1RK8A 3I5BA 2UVRA 3Q86A 2VONA 4B5OA 2GVDB 2BO9A 5LSLA 1JXVA 1K73T 2JOQA 3EWGA 3UD3P 1D8YA 1XR7A 1T03B 1NSPA 2HAFA 3NA6A 1VRUA 5CZVA 1IBMF 1Y5IB 2LCWA 1URNA 2ILZA 1UA1A 4UUXA 3A8IA 2ZBIA 2JVOA 4J9OA 2GMHA 2PC1A 4NLVA 4K2JA 1VR6A 4V19X 2V0NA 1R0AB 2YH0A 3G71S 1YVFA 4PAAA 2DK2A 4B5PB 4JI2J 1HWLA 2HNZB 4DEZA 5L46A 3QLHA 4RZRA 3KG4A 2NSCA 3SQGB 4ED4A 3TA1A 1SC1B 3H7HB 4HACA 1ITPA 2KU7A 2ZH3A 3EY5A 2E1PA 3JAMY 3D3SA 4BWJA 1YG0A 5G4DA 4C7IA 1CC8A 3G2XA 1RT6B 5I3PA 1MN7A 3T1HF 8CPAA 1MW7A 3MECB 3MR5A 1SC3B 1BWEA 4QIWD 2DNLA 4C8YA 3P96A 3H2UB 1N54B 4OV1A 6FDRA 1NUEA 1EQMA 2ZBQA 1Q78A 1LWFB 5K14B 3JSRA 2XULA 3CDWA 2QFJA 2J6UA 5J8CA 3GG1A 1BQNB 1RZMA 3V6HA 1RT1B 2E5GA 4PSXA 1QUVA 4YS2A 1N36J 2F9JA 5CHCB 4QBJA 4F6AA 2VASA 2VFSA 4WU3A 3P2HA 4YP3A 3MDFA 5KFZA 3A8KA 4YB7A 2NPIA 2VFTA 2ZNZA 3W5YA 5KFOA 5IQ6A 1ZZNA 3R9LA 4R8UB 1RA6A 5L1JA 5F8HA 1FDDA 4HI2A 2NQPA 1U6BA 4WIIA 1YI2S 3D7HA 5ETOA 3LP1A 4KIAA 4NGQA 4CGLA 3D7GA 1Z4EA 1YJ9S 2XC9A 4C2ZA 3OL6A 2OH1A 4ZPTR 2BQ3A 5KFDA 3KHZA 3S6FA 3W2VB 3H8EA 3AT1B 4KFBA 5KFYA 4NLOA 2K2PA 5D4NA 2DNOA 2MY7A 2GQ2A 1RAJA 2ZXVA 2PIIA 5AJ3J 1OSDA 4GVBA 3KTQA 2QSWA 1IQZA 4CM2A 2BKOA 1YZ7A 2GHVC 5BR8J 3R5BA 2BCOA 5DZ6A 2W2OP 2WSAA 3SXNA 3MCOA 4OZ1A 1KR4A 2H5JB 1EJ7L 4ZITA 1KVIA 4ORFA 2CWXA 4B3OA 1M1KT 4ZHRA 2KZZA 2PA8D 2IC3A 5HQ8A 1NNDA 3D0IE 5EX0A 2VH7A 3M8PA 4F3QA 5T7LB 3ULHA 1B64A 2Z2YB 3J81U 4IFVA 4ZPDA 1R27B 2X1FA 2XB2D 2CZ4A 2DO0A 1S1TB 3TVZA 2VG6B 2GHPA 3PW7A 5EDWA 2BR0A 3F8KA 3MCSA 4Q36A 3EPIA 5E7OB 4K4YA 1HKAA 2HB6A 5CCMA 3S1TA 3TEGA 2C2OB 3OTOF 3KLVA 4HR2A 4C4WA 4NGRA 4HNWB 1HQUA 3G6ES 2CTCA 2J7WA 5F41A 4F25A 2PSWA 3H40A 1U48A 2P0WA 4NXNJ 3R6GB 1I94F 4JI8J 4IHMA 1JLFA 4GKJJ 4ECZA 4CLWA 3NXZA 2MKYA 4B08A 4B3MF 4DL2A 2F4VJ 2MQMA 3RB4A 1XMOF 2W7PA 1SH3A 4RU2A 3IRWP 2IRUA 4YN3B 2EW9A 2HBRB 3K5PA 2BVZA 1QDUB 3BSAA 1RTQA 2A6OA 3MPUB 2R8KA 3BKFA 1QUPA 4I7FB 4NSQA 3GFHA 1SH2A 4JI5F 1S1VB 1ULRA 1M4IA 4RPFA 4C2MA 2B9XA 2V8PA 3GTYX 1HNZJ 4QC6A 5J2MB 5F49A 2ZW6A 1VBZA 1PSDA 4I64A 6AT1B 2CWKA 4Y00A 2ZH9A 4KHPF 2VV5A 4LF2A 2VZ9A 2QLFB 4YB1P 3G8WA 3D2MA 4TQRA 3CD5A 3KLGB 4KO0A 3TZWA 1TK0A 3PRDA 5KFJA 1P9YA 3C6TB 2CPXA 4R3KA 4LFBF 4JI1F 1YW4A 2AYEA 3KNGA 4OADA 1VC0A 2GGPB 4BC7A 3CD6S 2WOMB 4YU9A 3EXYA 1H38A 4I6WA 3O1LA 1XMQJ 3FRZA 3L7PA 2CZVC 4ZLNA 1YZ6A 4F0XA 2EFOA 1VFJA 1SPBP 3FJ2A 1IBMJ 2HC9A 2ACYA 4K4ZA 2C6CA 2LQ5A 2QRRA 1GX5A 5ETRA 4QW9A 4P2XA 2ZEOA 2XEJA 4F2RA 3R2CJ 1CBXA 1NDCA 1WC6A 4OX9F 2RSQA 3D6MB 2GQQA 2KXHA 3G3SA 4WCEQ 1NHKL 4WFNQ 1IQTA 3IS9B 1Y00A 4OMEA 1S6PB 3MF5A 2MLYA 1AFIA 4F0HA 1G3OA 2AFSA 3HHDA 1FDBA 3NBPB 3IRXB 4P73A 3G6VA 1EETA 5LMUF 4DV0F 5IM0A 3DYAB 4YWYA 2LXUA 4ZBGA 3S6GA 3SDEA 5JPHA 4M6HA 3PRVA 3DHWC 2PD1A 3H25A 3GSDA 1L0CA 1D8ZA 2V50A 3IU2A 1T9UA 3V4IB 1UZHA 3NGRA 1FT8A 3ITHA 2F63A 3IXQA 1DE4C 1QSOA 2VD3A 3GP9A 3NLCA 1OPZA 1FJGF 4USVA 1WI8A 3DLHA 2W8KA 1HNVB 2M3DA 1MSWD 2E7WA 1F1BB 2C6GA 2QA4G 1YJTA 1RWUA 3W60A 2XY5A 3RB0A 2XYHB 1R8BA 1UVNA 3BQ0A 1FD2A 5D6GA 3TX8A 4CLSA 2OMOA 2HZVA 2KFYA 2D4OA 5ETLA 5L1KA 3E2EA 2KHDA 4J90A 3D2WA 2ZW7A 2PEBA 1UPPA 2PJBA 3BN4A 3RYOA 4WU2A 1O51A 1J5OB 1QAJA 4UEFA 1F3FA 3THVA 3MAAB 1MJBA 2KT5A 1JIHA 2HK2A 1K4JA 2HFUA 3PIOQ 1RBLA 2AYMA 5F8MA 4QU6A 1IGBA 2Z3PA 4H4KA 4RUAA 3OR1B 4DUYF 5CYJA 2HIQA 5LRKA 5C88A 4DSEA 1IWAA 1S99A 3CJ3A 1BHNA 4DR2F 4IQMA 2G2YA 4NGNA 1KTQA 1R0BG 1I1DA 4UEZA 3MEDB 2WSFC 4QYZJ 2UXBF 4JV5F 1LCPA 2R98A 4BC9A 2G13A 5M2PA 1VC6A 5LMUJ 2RDIA 2PRQA 1B7FA 3AHPA 3H5SA 2GAHC 1CP7A 1TUGB 3OTDA 2AFOA 2VHGA 1B0VA 4LFAF 3PB7X 2G0JA 4K5RA 1PAUB 2FJAB 4G3IA 3DR6A 1B3TA 1NO8A 4Z2XA 4X4RA 4RKUC 1CX8A 4KHRA 1TV6A 3VAHA 1SXLA 1W25A 2LXFA 4N47A 8RUCA 1HWUA 2QV6A 3LGNA 4MHYA 2NLWA 4X66J 2RDJA 2AKWB 1YLXA 4U9YA 3G96A 3KUGA 3M8SA 1HBNB 3OR2B 1HNZF 4OC0A 1S9EB 4R57A 2N3LA 1Z8TA 5F46A 3LW5C 1FX2A 3MOZA 4L76A 3MECA 4RBTA 4FD6A 1UFHA 1S7HA 4GRSA 1T94A 2JEJA 4YHHF 4UBRA 1AA1B 4OC5A 5CYQB 3BHXA 1FDNA 1KD1T 2HQFA 2X51A 1FNOA 4IOBA 2XY7A 2OJ3A 4IR1A 4NLPA 1ARMA 4X3RA 1S7KA 3EE3A 1NJIT 4P45A 5F3ZA 4JI0F 2VJVA 1XMOJ 4XDCA 4PSWA 4XPEA 5A8KB 1YRTA 3GIRA 3N79A 3RBEA 2IA6A 2V9WA 2JL9A 1VQ8S 5KT6A 4ECUA 6FD1A 1Y4ZB 4W98A 2WPWA 3KK2B 1SQGA 1QAYA 3KLGA 3R3TA 4FN5A 1X4AA 2DGOA 3W9HA 3LWMA 3M2RA 1UZDA 2BYCA 3EICA 1U26A 4U96A 5HMYA 5AG5A 3H4DA 1FWLA 3RZAA 5ETQA 3I5AA 1PO6A 2OSRA 4DL5A 3ET6A 4A32A 3C26A 2OP5A 1F5BA 5LMNF 1CLFA 3CZXA 2OD4A 4KC5A 1T9YA 2DY1A 2LKZA 4CCHA 3L7OA 1N6QB 1AB8A 2B4VA 3DR8A 3FCHA 4AYBD 1PGZA 4FBEA 2BSWA 2O1PA 2W2QP 1O5JA 2WB4A 3UFCX 2FGOA 4MIWA 5F8LA 3UDCA 4OYIA 2RKIB 3G9CA 1Q7YT 2PR8A 3OQ2A 4N77A 2R8IA 1JNZB 2P6SA 4X8IA 3DRPB 3I0SA 2YPZA 1IJFB 2V8GA 3MMBA 4BD9A 4A31A 2DNMA 1PJ7A 2BUEA 1JQGA 1REGX 1S6PA 1R8PA 4NCZA 2ZOMA 1V0CA 5IV4A 5A8RB 4JI4J 2VB6A 3KLIB 1PJ6A 2M2BA 2QLJB 4O0NA 2A6MA 4RW8A 1Q0NA 4C98A 2R7SA 1G2EA 3NNHA 3NS5A 1N0UA 1GFWB 5D0HA 4R8UA 3BXMA 3CJ4A 2YWKA 2K06A 5DS7A 2IM3A 4USHA 4C11B 2UVWA 3OLBA 4ES3A 1WC5A 1RTIB 2EFQA 4O0IA 2OZGA 2Q1LA 1J2VA 4PQAA 1PC4A 3ISNC 2IC3B 2CJBA 1YWXA 1L3UA 3MWBA 1FFWB 4KHMA 2Z2ZA 2FJXA 1HIYA 3KLEB 4NYPA 4RUCA 3IWWA 1KNZA 3QWPA 2ZH2A 5C2GA 1EKRA 4Z37A 2RKIA 2Q6BA 4LSNB 1FDAA 1NSQA 2OFGX 3PRTA 3BGOP 2UUBF 1UP1A 3CXPA 4DV6F 2W9CB 2Z10A 4LSLA 2C2DA 3W5ZA 3LACA 3FIXA 1M1HA 5E3QA 5KAKA 2MLXA 2FIUA 4I4BA 2CJKA 3A8JA 3D7SB 2H3EB 3HSJA 5A0YB 2JFDA 4K8RA 4MK8A 4TU9A 5GMEA 3QSYB 4PWDB 5JQ4A 4MTPA 1MN9A 3BZQA 3S01A 3BO3A 2I5JA 4ID8A 4ILMA 2WBMA 2GCFA 3PX6A 1FWKA 5KFKA 3R6LB 4PR6A 4PG6A 2YQ0A 3ZZ0A 1RXOB 3CO9A 4IO9Q 4H54A 1SUQB 2B4PA 3QIDA 3VWDA 4KOSA 4NZ7A 2RH3A 4F4KA 1Q81T 3NOGA 4FPRA 1WC4A 5F8IA 1RT6A 3KUEA 5THWA 3MR6A 3GV5B 2JSXA 3PFEA 2JEIA 1EZZB 4X65J 5H9FK 1L3VA 2YNHA 2QLXA 4DL3A 1PAEX 4F3OA 4KQZA 2ZJPQ 2I38A 2YNFA 3DFEA 2B9WA 2ZKUA 2DHSA 1F3VA 1RLCL 2APOA 3DOMA 4DV5J 5E0OA 2U2FA 2VDIA 1RJJA 3FQKA 3LGHA 4CAVA 2CFXA 3VZIA 3QSIA 2DHXA 4PWUA 2KG0A 5FVJA 3TA2A 4RW9A 1NKCA 4DLEA 3L9ZA 1P1TA 3QIPA 3P45B 3PY8A 3EO4A 4K4XA 3IM8A 1YQHA 3UQSA 3KG1A 4TU7A 1JK9B 3AB2B 1O0PA 2VPWB 1EQ0A 1QD1A 1TMMA 2GE3A 4OX8A 4KPYA 3DRRB 3IFEA 1YX2A 4TVAB 4NXMJ 1BQMB 2JHEA 1M5SA 2PC6A 1Y9KA 2CXEA 4B02A 1V5IB 3OSPA 3BBCA 4OYBA 1RTJA 2HWTA 1IUJA 3GR1A 5KFPA 2FYXA 2BE2A 2KN4A 2WBRA 2HHWA 5HJYA 1S5ZA 1HQEB 2QYCA 4JWPA 3QNWB 5K9FA 4N5SA 2NS1B 2VPYB 1FXLA 3EDRB 1TMJA 1EETB 1ZM9A 1SB6A 1R6VA 4AXIA 4DR3J 4KLWA 3PHEA 1RKJA 3MCNA 2KFZA 4ID5B 1B0PA 2RAQA 2C6PA 1JWWA 4DPUA 1J5OA 4OI1A 1S6QB 4ED2A 1DAXA 4U7CA 2ZE2B 3RRGA 3W5XA 3B2YA 3S9MA 2DHGA 2W7AA 2F4FA 3OVSA 2F5GA 3QNVA 2YX1A 4JYWA 2GU2A 1JLAA 5C7PA 4QW8A 3FNNA 4KSAA 3R7BB 1QSYA 3FEEA 3IRXA 2EBGA 4E2FB 2HFNA 2PJ7A 3P5TL 1OIAA 3RW7A 1TL5A 2K7KA 1VQ9S 1P8GA 3TJAA 2XMUA 1U24A 4FXDA 3TUIC 2E5IA 3Q8YA 4NEZA 3PBEA 4I7FA 2R7QA 4NCGB 3JAMU 3ITHB 3GIIA 4Q0BB 4B3TJ 5KFSA 4EMDA 1SJRA 1F2GA 3DU5A 1QVGR 2NZ4A 4PG4A 1IN0A 4AG7A 1RTDA 2BANB 4LSZB 2CA9A 3IMQJ 1QJHA 3D9BA 2E1AA 3QAHA 2ZEJA 2HNZA 3KOAA 1VGYA 1GNKA 4LBHA 5DGBA 3CEDA 5G22A 4DLGA 3DRRA 2VQFF 1KEKA 3CD0A 1NKEA 3R9FA 4LRBA 2BDPA 3KHRA 3TX0A 3LP2B 5KFQA 4ILLA 4F50A 2C2EA 4IRDA 2A3JA 2FC8A 5JXSA 2Y9HA 2MQLA 5L8RC 1LOKA 4IH6A 1WHYA 4KVOE 2AJ0A 4K3NA 2G2OA 3D6FB 2V67A 4DMZA 4KH0B 2VPXB 3IJ3A 1UVMA 3IM9A 4ZPWR 3ZTRA 3R8YA 3LWUA 3BYRA 4AQYF 2O67A 1P9QC 3LF0A 3IS9A 4JV5J 2DHAA 3EM1A 2EK1A 3DI6B 1QSMA 4DSLA 5JVGQ 3AD7C 2OFHX 1F2OA 2QL7B 1FXDA 1T9TA 2CVIA 4WK3A 3HVWA 1M4DA 4TNUA 2YNDA 1RT3B 3AFGA 1QAXA 4K0KF 1RT7B 2DGXA 1YLOA 2IAJB 2ZM6F 3SDEB 2PJ5A 1XK8A 2CDRB 1KKHA 3V6DB 3S7RA 4NXMF 2PEHA 2MKKA 4NCAA 3T1HJ 4GKKJ 5HQLA 4F8RA 1IB1E 2IIHA 2KJWA 2NYQA 1YSJA 1HBMA 2DBBA 2ZJQQ 2MKCA 4RN7A 2R42A 3HXMA 5J1NA 1GXUA 2DNRA 3B54A 4DR3F 1IKYB 5EC4A 2FXFA 1H8LA 3I0RA 5D15A 2CNTA 2O4HA 2GJIA 3HI9A 4B3MJ 2LQBA 2UXDJ 3I5CA 2WW8A 1UL3A 5DDRC 1RP5A 5KG5A 4QWCA 1FK9B 1KLNA 2LDIA 1SIZA 1FJEB 4ZX8A 1SBRA 3OXLA 5B09A 4KH1B 1Z8WA 4WFYA 3WHIA 7FD1A 3M2RB 4XPDB 4OI2A 4AL6A 4CYPA 4H6UA 4M5KA 3LP0A 4BHQA 2MZRA 2ZH5A 3D8PA 3W2WA 1X4CA 2AJ1A 4I2QA 2VC1A 4B3OB 3KZWA 4YR2A 4MK9A 3BF4A 2KDOA 3UN3A 3DRSA 3DHXA 1VI7A 4CLPA 1RWNB 2CZ9A 4P4JA 1DHMA 3FEZA 3MURP 1YR0A 1T05B 3MD3A 3U02A 4Y49C 4IFVB 5A76A 2GQCA 4LQ9A 1N34F 5J2NA 3M8ZA 1SVDA 4ANCA 4JB8B 3NEKA 2DGQA 1EX8A 1GK8A 2B5GA 1LV5A 3TAQA 3H98A 4ZLPA 2ZEGA 2GVZA 5ETNA 4EUVA 5F9NA 3W62A 2ZVIA 5CXTA 2KXNB 5IZHA 2HK3A 2U1AA 3N5FA 4BWMA 4USUA 3M8RA 3OHAA 3CIMA 3KR5A 1JB0C 3BREA 1HDUA 1IKXB 1KFSA 1DURA 4KOXA 3D66A 4KLVA 4PG7A 5H9FJ 4MK7A 5HH1A 2IYGA 4H4MA 4UZCA 1N48A 3OHBA 2P9EA 2XQCA 4OZ3A 1LEOA 3D3CJ 1QSNA 3ENQA 3GYXB 2MQ8A 4KVXA 3R5CA 3PYDA 4NLUA 1TELA 4KV8A 1P1LA 2IRYA 2GGPA 4C68A 4O3RA 2AWZA 2A2CA 5CH7B 2GFQA 4KOYA 4OYZA 3DRXA 2H65B 4MHDA 1NH7A 5ETVA 4K4UA 1UWYA 4W9YA 2D7SA 3JB9k 2X1BA 4ZY2A 3TI0A 3SV3A 1N36F 4DL7A 4QB9A 1ZLIA 4M5GA 3M1VB 4OZNA 3P2FA 4I69A 3KYLA 2AGOA 5HANA 4BLGA 3ZZPA 3O2IA 2L08A 3E51A 1SL1A 2FIAA 2BEFA 2LECA 2R7XA 1HW9A 2YWWA 4RW4B 2GJ2A 3T9NA 4L74A 3W6XA 2Z3MA 4PV6A 3ZTOA 1DTQB 3F41A 4XO0A 3BR8A 2Z4PA 4DXLA 2FJWA 2I0XA 3BPDA 3X3UA 1X4GA 2XHWA 5DZ7A 1NXIA 1S12A 1NRKA 3VAJA 2SXLA 5BYQA 1MU2B 1H74A 3AQOA 4ZVUB 4K2XA 2OLWA 2WHOA 4ZVSB 1B70B 3N7ZA 2GREA 1H72C 2G0BA 3KJVB 2LQJA 2ASYA 5I4MA 1VYAA 4RNMA 2VA2A 1U2RA 3JXOA 2OH2A 1W7WA 1ZM4A 3DM2B 3LALA 2PJ3A 2Q51A 1RE1B 3M1VA 3VR1A 1X8DA 3RBZA 2J0WA 2FIWA 1PYSB 3D3BJ 4EZ6A 3I0SB 5KFBA 2YNCC 1LFPA 1D1UA 1TFYA 2ALZA 2FY8A 3QGPA 5DQGA 2K3IA 2HEKA 4ZP6A 2GX8A 4R5PA 4MBUA 4KV8B 5EX3A 1YJUA 2RB7A 2YQ3A 1Y9WA 1Z5RA 1YK3A 2Z57B 3BEGB 1N6QA 5GAGU 3OXFA 2R7OA 4PXDA 4RW7A 1XNQJ 4AVCA 2KM8C 3QMQA 2HGLA 3E0KA 2XS5A 2A10A 2RC4A 5T7LA 4NXNF 4PXBA 3VF0B 2BZ2A 1S57A 3K58A 3BYPA 2EG1A 2JDDA 3CMAS 2ZEDA 2PCUA 1MROA 3BKTA 1REVA 4MHPA 5ELYA 2LA4A 3B3SA 1Q82T 1PUAA 3N01A 5SZTA 4ER8A 1WOOA 4RO0A 4LF9J 2A18A 4J9QA 5GMKa 2YXLA 3K2KA 3QAYA 3FEYB 4O4GB 2BE2B 2HIYA 3KLEA 1X9SA 2LEBA 1RKIA 1WC3A 4QJVA 2BEIA 5HN0A 3Q8SB 4E2AA 2LU2A 3FKBA 3TO6A 1VJQA 2DIVA 1SJ3P 1RADB 3MPYA 4CH1A 5HL7Q 1R0AA 3BGRA 2VBQA 1KOHA 3K2YA 3L95X 2XHCA 4AL5A 1Y7RA 2F7VA 4C11A 1TV6B 4B17A 1VQMS 1MU2A 1RAHB 4G1QB 1N88A 2IQ6A 4DG1A 4ZPCA 2RRNA 1XEZA 4A39A 4LR8A 4UEEA 5D8HB 3M7VA 2R7UA 1DARA 4ZLLA 2E1RA 3FVYA 5ETSA 2PJ8A 2JC1A 3DM2A 3A3OB 1Y10A 3ZNUA 4YRHA 3LAKA 4F3MA 2MYFA 4I6AA 2JNJA 2FJDB 4DPXA 1J4JA 1PBUA 1R7IA 1UFLA 3RG6A 4A8FA 3EJMA 3LP0B 3ZZTA 1L5UA 4O3NA 1IYKA 1HHSA 2C42A 2C2MB 2RS2A 3OLAA 1G7CB 3I82A 2BABA 3TZZA 1XMTA 3HM9A 4RU9A 3MM6B 3MTJA 4F4YA 1T05A 4X4UA 3OUYA 4ECXA 1Q53A 2AT1B 2FHKA 3LMSA 1WHXA 1R0CB 3IA0A 2ZW4A 4U5YA 2XY6A 2JFKA 4Y2AA 3K5LA 3EVMA 1KWMA 1X10A 1IM6A 1RO5A 3T19A 1RUSA 1WKLA 2ATRA 2Q3PA 2Z2LA 3ILLA 3JS9A 3GIKA 1WKKA 2FE7A 4OJHA 3OTBA 4Y2KA 2GJFA 1LWCB 1AZSB 4F4AA 4I6YA 4DZ6A 1VS3A 4DF8A 2G1DA 2GHWA 4NGMA 4QIVA 1EIYB 1AW0A 1TKDA 1WDTA 1VK8A 1VQ5S 2Q4VA 2DNNA 3KMSA 4URQU 4D3GA 3V6JA 3HSDA 2EK6A 2FS5A 1HNWF 4NLWA 1SV5A 2XI3A 5J1EB 2PR1A 4IUFA 1CPZA 1LOUA 2RD5C 1LWEA 4A94A 4DQIA 4NX9A 3T1YF 1JLFB 1VQLS 3KXDA 3CDAA 2OPQB 2DEIA 4OZLA 2D3O1 4HDHA 3FZBA 4KZTA 2E5LJ 2EEYA 4WXOA 1V3RA 2ANPA 1OJ4A 1APSA 1S4EA 3NG8A 2A0FB 1NAQA 5HLFA 2LXIA 3W2WB 1NK9A 2D3ZA 1IKYA 4DV2J 1Q8IA 2GFFA 2Y1RI 4OJ3A 4PXCA 4DR1J 2AJQA 1HWJA 2M52A 3TO7A 2DO4A 1H2VZ 4A33A 4HHJA 1UW9A 3H4BA 4IDKA 3SI2A 3CGIA 1WHVA 2W4CA 1WEXA 3IBFB 5KG4A 1YREA 2CJAA 2IAJA 2DTJA 4OJ1A 4B12A 4WP9A 5DETA 4WK1A 5B0AA 3M8YA 4KHPJ 1DRZA 1X5SA 3LP1B 1HW8A 4FBTA 1RT2A 4RWXA 2XM3A 5D8NA 3NCRA 4LJMA 3D0GE 4LFAJ 4JJXA 1M5PC 5HSPA 2H9ZA 4ELUA 3GJSB 3J81Y 1RBAA 1CPXA 2BQRA 5KFAA 3MFIA 3M6WA 4NLXA 4FWUA 3KK3A 1LWEB 4IRCA 2E5LF 3UVJA 2HS4A 4CS0B 2J9DA 3DC2A 2ZEHA 3SBMA 1VQYA 2B8QA 4ECWA 1TKZA 4XNHB 4P2FA 1BOBA 4MMOA 1WSVA 4XDDA 4CQ1A 3MM5A 4UF4A 5C25A 4KAIA 3GPAA 4JI1J 1JJ2R 1Q5VA 3QRQA 1S10A 4NF1A 5F8NA 4DR4F 1Q5YA 4LF8J 2YBVA 3RRKA 4D3HA 1UVIA 4DV4F 2Q7SA 3ZJ0A 3I32A 4KOWA 1Q8LA 3TJ8A 1FA0A 4NCBA 3R5JB 4PEOA 4JP8A 3FSXA 3NS6A 4M1KA 2CQ3A 3UPFA 4X62J 3KKFA 1V3ZA 4Q2LA 4NLTA 4IQXA 1QSTA 4A46A 4BDPA 4IOAQ 2LQ9A 4EI2A 1MNEA 3N9UC 4ILRA 5SUHA 5KFTA 2E29A 4FS2A 3W63A 2L3MA 1M5KC 4OIDA 3OJUA 2OI2A 4IYQA 3R97A 3THTA 4DR6F 1JLGB 2NYIA 1LK5A 2PRBA 4DR2J 1BQXA 4OX6A 1V9OA 2B4UA 5HQMA 4XIUA 4ED8A 3MPWA 4O44A 2OPSA 2IHR1 2ZD1A 4NRTA 1HR0F 1Z4RA 3U1MA 1MJAA 4X4TA 1DJ0A 4FYYB 2AZ1A 2BJ8A 4RUHA 2BOAA 5KG0A 4CAXA 3LWLA 1T03A 3EGWB 1ON0A 4YR3A 3CT9A 1SJQA 3I31A 4L8AA 1TL3A 4I68A 3DI6A 3M32B 2AD9A 3FBBA 1U8SA 5EGYA 1RXTA 2I9SA 1NSAA 5J2MA 1WORA 3IGRA 5IOLA 1OY6A 3GIUA 2I1RA 1IBKF 4F9VA 1NMTA 1F2HA 2QEXS 4C0BA 2CKWA 3KJNB 3B8HA 3FECA 2C2NA 5HMWA 1KQFB 1CS4A 1IOIA 4MCQA 5LYFA 1LK7A 4ENOA 2JRSA 3T6BA 1LWFA 1NLKL 1NPKA 2NREA 5T14A 3NGKA 4HACB 3ZFVA 2AEFA 2YTCA 3J7AN 1KBRA 1TL1B 4QWDA 5LRJA 3PVXA 5IQQA 2F8MA 4C8LA 4BS2A 2QMLA 4CWBA 2CXAA 2DITA 3OTCA 2PFFB 2VBXA 4ZVGA 3S9NA 3H2LA 2FHMA 3HD1A 1QVFR 4MCRA 2AW0A 1FNXH 1KONA 5IB9A 4C48A 1FK9A 3PXGa 1C0TA 5IB0A 1TKXA 4WWVA 3AH6A 2HQYA 2W2NP 4UQTA 5IC4B 2EC2A 2NSMA 1V3SA 2BUNA 2OB0A 5F3TA 3KQXA 1VQSA 5K14A 1OYDA 3OBIA 3RRHA 3MUTP 1QAIA 3EGZA 2RU9A 4U8YA 3Q0AA 4B9UA 2C1CA 1PJ5A 1GMUA 4E98A 4EBCA 5HMZA 3R5GA 2XEIA 4HYKA 2QMWA 2R4FA 3SCIE 4RW7B 4XK8C 7CPAA 2O5DA 3L4BC 1FXRA 3D54A 4ECTA 4CLTA 3FMWA 3G8SA 4MYUA 4F04B 4MCPA 4UCPA 1I51B 3LH2S 4RUBA 2JH3A 2ZH7A 3SHPA 3TQ1A 1U1PA 3BS9A 5LMNJ 3BBBA 4DQSA 2EFGA 3U1NA 1HBNA 4FF3A 5A6WA 1BO4A 2XZWA 4KOTA 3AXKA 4DR5F 3EZUA 4ZN1A 4M5JA 2QL5B 3PEIA 2V2QA 3CC4S 4CLYA 4A8SA 2NUHA 2PI4A 2UV8A 1NCLA 2MQOA 2BL1A 2GZOA 3QBCA 4MFQA 4A2ZA 2FGCA 4CYUA 2XWXA 1UEKA 1U1RA 4DHVA 5C42A 1XR6A 3QJLA 4DL4A 4UT4A 2MB0B 4GS4A 1Z2ZA 1UEUA 4RLEA 5IV0A 1OPIA 3PHTA 1LXNA 3W66A 1YDLA 1TL1A 1HEEA 2R8HA 2OPRB 4OIWA 2V4JB 2F4VF 1VLYA 2OUGA 3SXOA 1EE3P 4Z7CA 1PU9A 3CPAA 3FCVA 4HNYB 2ZC3A 2XWYA 5MAOA 3W91A 3QYYA 1N56A 1Y0YA 4MI4A 5LXYA 3CCTA 3RTVA 4MFKA 3PTWA 2CY2A 3CCUS 3AOBA 1S1VA 2M0GB 3MAAA 1LFWA 1JKHB 3A4TA 1CC7A 1WHWA 3CDUA 3DLJA 1S77D 4WFZA 3HHLD 1K9MT 3FRYA 3N6NA 2REFA 5AXMA 4DDFA 1ZM3A 2DNZA 1GHEA 2EC0A 4KO0B 4U95A 1OY9A 2ZEFA 4GO7X 1JX4A 5HJXA 2HHXA 3T3FA 3FEXB 5F0UA 2XMTA 1IOFA 1MJ9A 2BJ9A 1D9AA 5GAGI 1B6BA 1I5OB 3MUVP 4LF1A 3D68A 3H2VE 1FKOB 1IKVA 2MXYA 3D6TB 1GTEA 1SJ4P 6CPAA 3T41A 3MM7A 4DUTA 3JQKA 2FQQB 2QX0A 4P4BA 1S6UA 3F0AA 1UFKA 3CVKA 4OKOA 3IWEA 2RUGA 2IL4A 5ETPA 1OZPA 2D9PA 1U1QA 4QIGA 3ENAA 3LANA 4CAFA 4DPTA 5CD4A 2EI5A 2IJRA 4KYZA 1QMUA 4B6ZA 3KLFB 4B3SJ 3OSNA 4OMFG 1KLMB 3GIJA 4EWTA 3PYGA 2J8SA 1IJEB 4JBCA 3WR7A 1F57A 5F47A 1U0HB 2C3PA 2B6AA 4YY3J 5BWAB 2DNPA 1S0OA 4GC7A 2HVEA 5A2QU 2B7CB 4USJC 3W2VA 3KKWA 4U9RA 3UDLA 3G6XA 3E8OA 3TWZA 1FNMA 1OWXA 2HHHF 1RHMB 2PMWA 1JLQB 1XBUA 4JI2F 2VA3A 3TC8A 4WKRA 4K4TA 3HHLA 2ZJRQ 2DVIA 4K4VA 3W6SA 5GVQA 3TARA 4F9UA 3SI0A 1KQKA 1RAIB 3DYAA 1ZG9A 3UO0A 3FMCA 2P6GA 4NA3A 3NNCA 2EFPA 4DSIA 2I00A 5D4OA 2MKJA 4HHUA 4O3OA 3GZ7A 3WQPA 2CRLA 3U1LA 2VFUA 5H84A 4PUOB 1I21A 4J9VA 2ZOFA 2B3VA 4U6PA 3TANA 4GMKA 4WTOB 2GIFA 3NL0A 2MZSA 4J9LA 1RI7A 3CDXA 1FKPA 3GJTB 2EFVA 1WK4A 3KNAA 3MMBB 1XBWA 1S7FA 5HK4A 2YQ1A 1SC4B 4HTJA 4EO8A 4ZPVR 1J27A 3EVOA 1P27B 1VHFA 4OYPA 2YX7A 3GFZA 3CUNA 2DGTA 5ISVA 2MPUA 2HS3A 2RILA 4ECRA 2M9KA 1ZOTA 4QBUA 4YDXA 2QJ3A 1NPRA 3PKYA 1PBAA 1DQ8A 1PKUA 4F8ZA 4FAIA 4LIWA 1R6YA 3QLHB 2JDJA 3I4HX 4OI6A 2WW4A 3MRUA 3UCUP 3I9ZA 4JI3J 1DQAA 2FLPA 5D3GB 4R9MA 1SC6A 3R7NB 1SKSA 1X5OA 1U2FA 2WZ1A 4P2MA 4WP8A 1K44A 3DLGA 4F4WA 4DPWA 4C9DA 4X4NA 5HMXA 3SSRA 3DLKA 2J0QD 5KT5A 3ICLA 2W4DA 1HBOA 4MFZA 3V5RA 1B7YB 2V8DA 2W8LA 3BI1A 4A8QA 2RQMA 4M63A 2NMTA 2JC0A 1C0UA 2VL1A 3CSKA 1RYSA 2OZUA 4H4OB 1S76D 4M95A 5C42B 4YMEA 3G4SS 2B56A 1CJVA 1WG1A 4FP9A 5C82A 4N41A 4K30A 3B3CA 3VARA 4UZBA 2VQYA 3B3VA 3D6HB 2YH1A 5A28A 2ZBRA 2JX2A 4MYTA 1X5TA 3EPGA 2IMOA 4M5DB 3I87A 4A48A 1MK4A 3CULA 1F0XA 3NWRA 2JEFA 3D1QA 5ETMA 3VWEA 1UWAA 4EMEA 2FVPA 5DO2A 2XGQA 2ZH1A 1QQ9A 4NYOA 4FYDA 3MGDA 4Q44A 1HPZB 3PBBA 4ZY0A 3UW1A 2OEKA 4Q45A 3BH7B 3HDSA 5K8MA 2J8AA 2EK8A 3Q24A 2KCWA 4R6TA 4E0DA 3SJEA 4P71A 5B7WA 2O3DA 1K8AT 3VGVA 5DM7Q 4KUBA 3PCOB 5JGFA 3L09A 4W92B 3C15A 1JJCB 2WCXA 2MQQA 2ZENA 4DV7J 5DLFA 3GCXP 2DCLA 4C0OC 2PJ2A 2FJVA 3BR9A 4ZVPB 3EC4A 3MMCB 3VQTA 4WKYA 2CNLB 1VBYA 2GIQA 3Q23A 4HNXB 3S9LA 4IH5A 2QA1A 4U9ZA 4M8LA 2UUTA 2XSFA 4DV1J 3PM9A 3A3PB 1JLCA 3P3DA 4NJRA 2CNSA 4MY3A 3DSBA 1PYTB 1PIEA 3BB5A 4J7CA 5G0RB 3KJQB 2PGCA 2CAJA 1R8AA 1W2BR 4CLUA 2I79A 1PG5B 3WZ0A 2PJ4A 2LQ8A 2DGWA 1WTFA 1N5QA 2XCPA 2VG6A 3DXSX 4KGMA 2V2VA 4FZVA 3ILJA 1RWOB 4M3SA 4DL0C 3TVKA 4LX9A 1CJKB 3U27A 3PEJA 3WC0A 4O23A 1FKAF 2R2RA 4DNCA 4RS2A 1RACB 3CXCR 1HPZA 3M8QB 2EFNA 1RT5A 5KFHA 3QB8A 1WF2A 4FNHA 1S9GA 2LEPA 1IKWA 3M6XA 1H7WA 2DKOB 2ILYA 3OTOJ 2LLZA 3MUMP 4IH7A 3SJXA 1DTQA 5MLCV 2B43A 3HJFA 2J76E 1H73A 2CNMA 4DG1B 1RCOB 5E3PA 5HP1A 1KSPA 1BXNA 3DLLQ 2WVCA 1ZS6A 1FVSA 1VOMA 1GYTA 2HQGA 5LM7E 4EGLA 3VAGA 2YWGA 1T0TV 1HBMB 3Q8UA 4IAVA 4CO3A 4N8NA 4HKQA 2EVNA 3CDBA 4AXVA 1KLMA 1LNQA 4MJ8A 3PDNA 2PSZA 5D4LA 4AQYJ 4DUYJ 4KB7A 2K1RA 4IG0A 2HWHA 3G87A 3F44A 4R0EA 4DR7J 2H4WB 3K57A 1B99A 3MGJA 3K17A 1AT1B 4ZCIA 1UJ4A 4QZVB 3FFIA 3TVYA 1U45A 1S59A 4ZPBA 1AZSA 3WX4A 4NL5A 4WF9Q 3VQSA 2KYZA 2W9BA 5F9LA 4QVTA 1TKTB 3FVLA 4DX5A 2GW8A 4OQJA 5D77A 3EDQB 5B08A 3FB3A 4DN0A 2D4PA 3M32A 4X64J 2L9DA 3PO5A 3B3TA 2HQCA 4DBQA 4OI4A 4CAEA 3T5LA 2FUG9 1VQNS 2ZEEA 3JTPA 4OHXA 4OC2A 3VALA 5HP1B 3L3CA 2MZJA 2CPDA 2ADBA 4H4KC 1C2PA 2CPJA 3QO9A 1VK3A 2OPQA 2HQDA 2DXFA 1FRHA 4LF5F 2ZHOA 3CCMS 4P4DA 1LRZA 2BKPA 4DI6A 1CBKA 3TUJC 3CJTA 3RJMB 3ZTQA 2ZUGA 3SEOA 3GSIA 1TUVA 4IUSA 3C66A 1T9VA 4UA3A 4R5PB 3G6YA 1ACMB 2KRBA 1SJFA 4R25A 4DS4A 3HVRA 1C0TB 2E5JA 2UUAJ 1VHEA 2DHHA 1TKXB 4E8UA 1FCAA 3TYTA 2WUUA 5BYSA 1U6ZA 3D1OA 3CCVS 4JI6J 2HHVA 1CVJA 2L48A 2H48B 3H42A 1C1CB 3V38A 4XPKA 3M05A 2D9OA 2R2SA 3H4QA 2CJQA 2G0CA 2HURA 2KM8B 2EUIA 4MHZA 4EYIB 1VKCA 3TTHA 3BSOA 2CJYB 4MCSA 4ZI6A 2KH9A 2J7KA 1SH0A 2NXJA 4KVME 4A8YA 4J5OA 4ERDA 4CT9A 3PV8A 3QJJA 2G9DA 4NI2B 3HT3A 2ZPAA 2RRAA 2J8RA 1BQMA 1Z2LA 2VOOA 4F7VA 1P4NA 2BOPA 4URGA 4TY8A 2X7IA 5H9EJ 2ALYB 3V6KA 4A38A 1SKUB 1T9XA 2Z3OA 1EHWA 2BJDA 1N5YB 4KUAA 3TOAA 5K20B 1FHTA 4OJGA 2AZ3A 2RT3A 4K5SA 4OYOA 2UZAA 2ACMA 5DRKA 1RHJB 4MKYA 4CTAB 1MLAA 4LF7J 1DLOB 2YVSA 3W9JA 3D1HA 1HI8A 4KKOB 1Y5LB 3ZC4A 1NM2A 1Y7EA 4WYWA 4C0HA 2CQ2A 1I6JA 1X60A 4ID5A 2M5YA 4RBUA 1R43A 1XR5A 4C8ZA 1ZPVA 3OFHA 2QLBB 1D9FA 4GVLA 4YQWA 3GU0A 3HJVA 3W65A 2Q6CA 5CPAA 4ZCKA 1IICA 2IMWP 5G0RA 4RL1A 1R8CA 3AJ1A 3GR0A 5F09A 2NXEA 2YNCA 2ZH4A 5KFWA 3CF5Q 3VGUA 2OOTA 5CNPA 4DUZF 2ZUAA 4LIRA 4P44A 4A47A 3KJFB 3RR8A 4A30A 1X0FA 1IWGA 3LPYA 4KY3A 1S3ZA 2NR0A 2MJUA 3E01A 3T5KA 3BGFA 3EGVA 4CO2A 1M4LA 3DXBA 4JI6F 1WG5A 1X4DA 4CAWA 4A8XA 4NEYA 4EBDA 3M6UA 2LEAA 1VBXA 3CDEA 1NK6A 2GIVA 2X7BA 4QQBA 1JLCB 2BJ3A 4PWDA 2ZNYA 2Y1IA 2C3YA 1RLDA 5LXRA 4TU8A 5DDQC 2V2ZA 4UOGA 4ELVA 2FTRA 3FXTA 2B58A 2ZH6A 3BJ7A 3BM7A 5J2QA 1ARLA 1RWKB 1YRXA 4CLLA 1IY7A 3WIVA 2DCUB 4S0MA 2Z2MA 3NP5A 3M9MB 5I0CA 1SUQA 3AXMA 5F8JA 4P4EA 1GT8A 4LSLB 3P5BP 3THPA 1YQEA 3Q2SC 3BLNA 4G1QA 3KK1B 2DY9A 2K1RB 2IFXA 2XMVA 1N32J 2MEWA 2R7TA 3EFAA 4RX6A 3MM7B 2X1AA 2M70A 2Z3KA 2CPIA 1QM9A 2HHQA 1TAUA 2ROEA 3NBPA 1U1MA 3IIBA 3V2UC 4CNZA 4PPDA 2VF3A 2N7YA 4ELTA 1FJGJ 2R7WA 3VCDA 4ZVOB 2DH9A 2ADCA 1XJWB 1RT2B 1FRIA 2PMHA 2AE6A 5KTDA 3V4IA 2PJ0A 1LWXA 2Z56B 3I1UA 2F8HA 2V68A 4LFBJ 1RSCA 3MPVA 2XO6A 1UCNA 3T6JA 3L2NA 1M5OC 1X4HA 1K0TA 3OXGA 1TL4A 4AE5A 2KKHA 3F73A 2AHOB 1HI0P 2PO4A 2AYBA 4YGOA 5C24B 1KP6A 3CD7A 3WABA 4HH0A 4PQUB 2HUZA 4FF1A 3GV8B 4O4RA 4K59A 2F5IA 2MJNA 1KC8T 5ETTA 5G1ZA 2HBQB 3Q22A 4X2TA 3ISND 5EWEA 1IIDA 3TNVA 4X4VA 1B4SA 3WIUA 3BGLA 3NE8A 5KFVA 4I2PA 4O3PA 1B87A 4QOTA 2DISA 2QIRA 1HARA 1AROP 4DR4J 4OZ2A 3MMAB 2G0IA 5D4PA 3DLEB 3D4JA 4DV4J 3P6YC 4J91A 1XFOA 3FRMA 3HMJG 2P8IA 2F8EX 3HT0A 3T90A 1FX4A 2HRUA 1TKZB 1WDDA 2CQCA 1SQHA 1YBTA 5DJBA 2B7BB 2MZQA 3G82A 3MR2A 1RTHA 5KTAA 1NHUA 4B13A 3UN5A 2WTFA 1Q2YA 3SYZA 1RTJB 1VQ6S 4J9NA 3QZ7A 4ECQA 3TUZC 4DYOA 4P72A 4OHYA 1VHIA 4ZP8A 1YVOA 4DU7A 5BXIA 2VBZA 1Z8LA 4CGNA 5J8FA 3KDNA 3CIZA 1NK0A 4GXHA 4NJQA 3H0PA 3ENWA 2HGMA 1VHOA 4N56A 2W9CA 2RQ4A 3MPDA 1YRUA 3JTOA 4ZVQB 2Z3NA 4K0KJ 2K8GA 4WPAA 4K50A 5H86A 2OHDA 2FC9A 1ZG7A 4MFPA 4OZ0A 2X3GA 4ZVEA 3TA0A 3UR0A 3EMTA 4ZK7M 3P4UB 2OELA 2QECA 3B78A 5C5JA 3BSNA 3JTNA 3G8TA 4F67A 2GV1A 3PB4X 2CPZA 8ATCB 3RAXA 1CJUA 4N7TA 2XNQA 4LSNA 5I42B 2HNDA 4LRCA 4TQSA 3C16B 4QUSA 4USKA 4F02A 2FVSA 1SIWB 2NXCA 1PILA 4DOZA 4P6YA 2XTJP 2PE3A 2ZELA 4CLFA 1NSKL 5L1IA 2G3TA 1RABB 5IFMA 2VJUA 3VVTA 4QWBA 2HKEA 5D0GA 3R2DJ 3CPWR 4CYQA 4M5LA 4JI3F 4OC4A 4JV0A 2WONA 3QRPA 1HWKA 1BY9A 4B11A 5DS0A 1K1QA 3KR4A 4MHNA 2AFWA 1Q79A 4CO4A 4TY9A 4L72B 5IC6B 2D3OR 3TJ9A 4LVOP 2DB1A 4UQGA 4OC3A 2MLZA 1BD6A 1TKFA 2WPXA 1RHKB 1IXKA 1ELMP 1RBOB 1FVQA 2DT9A 3MR3A 2ATCB 1P0HA 2JBKA 2IM0A 1LW2A 4MIAA 1FE0A 4RR5A 1NH8A 1VLOA 5KFGA 4LF5J 2FVGA 2ZKTA 3BV8A 3QO9B 3RW6A 3DOLA 2Z11A 3EUNA 2AMCB 2BW7A 1RAOA 1KN6A 3DCAA 1YJRA 4HKFA 3FSIA 2W1BA 3BQ2A 4B9TA 2GLFA 5CYMA 2JLMA 4PUOA 4CYNA 1JLBA 3JTKA 2DJWA 1YW6A 2YKOA 5KFNA 3MR7A 3Q8VA 4NI2A 1X4FA 5JJBA 1S0MA 4DR7F 2J7UA 1TR0A 4CP5A 2V94A 3H20A 2YKPA 1FEEA 4TYBA 4URSA 3SJGA 5BYRA 4A4JA 5F0WA 4LFCJ 4C7HA 1HNIA 1YK9A 4P7TA 3C6TA 2KXFA 3ZZZA 2OD6A 1WWHA 2PFDA 2W2PP 2VFVA 2WK4A 3PNIA 4NCGA 4G65A 1ZTWA 2ZE2A 2A1BA 5LYLA 1LW2B 1WOSA 2K5TA 1JLGA 2ZOGA 4MKVA 4FYXB 3V8IA 4OZJA 4CTAA 4Y3CA 2Q0YA 4CLZA 3MEGB 4Q7AA 4Q43A 4F36A 3K8WA 3FK4A 1GXTA 3TZXA 4Y2MA 3W3SA 2WSCC 3NH8A 3R1LA 2P6FA 3M2VB 1REVB 2JJ4D 3W7BA 2DF5A 1HR0J 2CJ9A 3T1AA 1EARA 1BPMA 1IR1A 3RGIA 3I6PA 1XIXA 3ZXWA 3HFKA 2I2YA 3WC2A 1S9GB 2FVCA 2Q44A 3LAMA 4Q0BA 2BV3A 3AA9A 4C2YA 1S1XA 2FJEB 3N28A 2PIYA 1EP4B 1FF2A 4RBVA 1FFGB 5A0YA 3VAIA 1S9EA 3JQMA 2WOMA 2HAIA 1LKZA 3D0HE 4QPTA 3GWCA 1LAPA 4FF2A 3OTEA 2QYVA 4N76A 4ANEA 2HLUA 3WC6A 4U7UK 3H90A 4C3KA 1X7VA 2H5IB 2KTQA 1S1UB 2YNFB 2YGWA 3PB6X 2AIRB 2Z8QA 4OFZA 1UTAA 4FNIA 1IBKJ 4ECVA 4X65F 1HYSA 3W61A 2BBEA 1RHRB 5HROA 3VAKA 5U47A 5JUMA 3NFZA 2VG5A 4M5NA 2NCKL 1XC9A 4L3KA 2R8VA 4WIQA 2IJFA 4B10A 1HNVA 2DPJA 1M0SA 4OHZA 2O28A 4AUKA 4RNHA 3H5ZA 4DUKA 4TYAA 2B9EA 3D7DA 3CJ2A 3V6DA 1Q7LB 2BANA 3CB4A 2ZVSA 4PRFA 1PC5A 3RAQA 1UKUA 2I6WA 3IR7B 2DNYA 3JSYA 2AJ4A 2BM0A 4ZDNA 1DBDA 3GJQB 2RIJA 4UFWA 5KTQA 2HHPA 1UVJA 3EGNA 1F2PA 3V7ZA 1QLNA 1XERA 2QMUB 3NNAA 3TO8A 3TO9A 4CH7A 4RW6B 2R2UA 2CQ1A 1X4EA 2BRKA 3DDIA 2GO8A 4PCQA 2FZGB 2UU9F 4A37A 1QTNB 3KGQA 1IBLF 1CM0A 2ZDOA 3C19A 4JI8F 2CQDA 2G9OA 4KR0B 1S97A 1WEZA 2DGUA 3HVTA 3IR6B 5B0BA 1RU1A 5KG7A 3IC1A 3IGNA 2AFMA 1FRLA 2UUCJ 2CUYA 3H5UA 3O44A 4DJBA 1NU4A 5E2QA 4OLLA 4DV5F 4B3RJ 4Y2CA 1F9HA 2MGZB 1FESA 4I1TA 2VEZA 4UTGA 2XZDB 2BJ1A 4FYVB 4TXSA 3DLBA 5CZXA 3Q8PB 4QWEA 4DPOA 1Z8XA 3TFYA 2O53A 1VISA 2XS7A 3RBXA 5CABA 3P49B 4KS9A 1X5PA 2WZNA 3JSMA 4J37A 2MQPA 4ES2A 2Z3LA 3QFWA 4MFJA 2X3DA 3AOCA 1WD6A 5K5MA 3SCKE 3JSBA 3GKRA 2QTWA 3FBFA 2HNDB 2XSJA 1C1BA 1NDPA 1TUWA 3NGSA 5LSRA 4NMLA 1NJZA 3K0JA 2KG1A 2Z0GA 1IKWB 2J9DE 4WFBQ 1JJ4A 2AV5A 3M30A 3D67A 1BUXA 2R7VA 5KFIA 2A2DA 2HW3A 2C1EB 2AU0A 3DRSB 1NZAA 2XBPA 4DL6A 3BDPA 4LMZA 4HEA9 2EBJA 3H8FA 2L41A 5DGAA 2KJVA 3IR5B 2PMZD 4DCJB 3F0NA 5GAHI 2KB2A 2MKHA 1DZ5A 3HPOA 1JXLA 3K89A 3HCXA 1Z9UA 4F0MA 2QLWA 2FB0A 1S1WB 2DH7A 4JXRA 2UXCJ 3SFGA 2ZH8A 3M8QA 2ABZA 5C2CA 5L38A 1JJHA 3MOJB 1VMBA 5B0FA 2C2RA 4YEAA 1SV5B 1S7IA 3HUVA 5J2PB 1M44A 2Q4YA 4LQ3A 2HWIA 1D0EA 1CJTA 3JUWA 4JXQA 2YY3A 2M4MA 3R5DA 3W8GA 2KZMA 2EVZA 2V4RA 1U1LA 2DH8A 2XMKA 2ZW5A 3RO0A 4LT6A 3GV7B 2AEMA 2FJBB 1U0HA 3LUYA 2HPUA 3MI7X 1FFSB 2B5GB 2RU3A 2MKIA 4JYAF 4ZCLA 3N0VA 4QIEA 3LTOA 2F65A 5BJRA 4PYAA 5A8KA 2QO3A 1D9DA 2IM2A 1SKRA 4DFMA 2HHHJ 3OL9A 3J81j 3M8WA 4V19J 3IEHA 2ZHAA 2H4YB 1U7LA 3ZZOA 3SI1A 2CF4A 4KSEB 3IAS9 2VC0A 1R89A 2ARHA 1ZAVA 3HHNB 1VIXA 2QJ8A 2Q7BA 1U49A 2YX4A 3E01B 1BPNA 5A2QY 1A6LA 2PDAA 4ITSA 3AD8C 4Q5VA 4MXUA 1SL2A 1S60A 2E7VA 3GLJA 2IDLA 5KFRA 2RDDA 4YOEA 1TTHB 4OYMA 2AJ6A 2QSFA 1QE1A 5A6PA 8AT1B 2HSEB 3AB4B 4Y65A 3HSZA 4EFAC 3SZ2A 1ZG8A 3VHQA 3QAUA 3CCZA 4LF6J 2ZM6J 2XLIA 1U1KA 2FD2A 4LUBA 4TKTA 1XJOA 2XEXA 2DRAA 3VVUA 2FZKB 5ADZA 3QT5A 4RNNA 3OL8A 1WWZA 3KMQA 2JZ5A 4MJKA 5AG7A 3GIMA 2LVWA 3PW2A 2JDCA 2CNNB 1S0NA 4B9MA 4HLBA 3CE8A 3H8GA 4N8OA 1OYEA 3H8YA 2IJNA 3IG1A 5I42A 5ITHA 1H2UX 2HRYA 2EWHA 1UJ6A 2JBJA 2E7XA 3AY0A 4UUWA 1RTIA 3A9LA 2P5VA 5DWNA 3B6BA 1WG4A 4OYWA 2F40A 5LL6d 4GC6A 3BO4A 1EP4A 5IWAF 2WVFA 4ZMMA 2JLFA 5IX3A 2QZ8A 3I9V9 4FD4A 1X9MA 2CQ0A 4UCNA 2BW2A 5RUBA 3VAMA 3AODA 3OFGA 3J80Y 3CCWA 3FGVA 1YBAA 2HZAA 5LJ5Y 2EBEA 4K7QA 1VRTB 4DFKA 4DQQA 1OSCA 4PK2A 2V8HA 3H5XA 2ZBPA 4J9UE 3KDOA 2HNYA 2QMXA 4MT1A 2MZ1A 3POTA 4WE1B 3I56S 4IO1A 5HVGA 4DUZJ 3OR2A 3NH5A 1C4CA 4JYAJ 2MHNA 3B3WA 4OHVA 5G21A 5D29A 3LOUA 1TK8A 3PR4A 5AXNA 3FBCA 4P52A 3MFHA 1NB2A 2RUSA 2YNIB 5KFCA 3UR3C 3BI0A 2DR5A 3DGPB 3NMRA 1HNXF 2KFNA 1L3KA 1J5EF 1S7NA 2LMIA 5M2RA 1XOVA 1CJKA 3VZHA 4QYZK 4F4XA 4X5KA 1CSJA 2YKAA 2E44A 4R0JA 4OP4A 1FTCA 4LREA 4JI4F 1OO0B 2POKA 4OV6A 3JYTB 3H59A 1VQ4S 4OLOA 2E9TA 2R2TA 2YKMB 3HLPA 4C8MA 4DQRA 3BPSP 2J0XA 4PYDA 2CQHA 2RS8A 4TLRA 3JSMB 3F56A 1YJWS 3C14B 3PX4A 5KT7A 2V6AA 1JNRB 1G4CA 2X1GA 2BXJA 3S6EA 3LD2A 3M6VA 5KFEA 3GG0A 3PZJA 2XEFA 1I1GA 1TKTA 5CCLA 3T5JA 3GUXA 3VWSA 4QR2A 2QA4S 3DOMB 4H4OA 3TUPA 1DTDA 1FE4A 1ZO0A 5I3QA 4TWEA 2RRBA 3PX0A 3KHLA 4LF4F 3MAHA 3S8SA 1Y0RA 3AQPA 3B4DA 1RWWB 4CT8A 3WBZA 3OWCA 4HPSA 3GONA 4YB5A 4WZQA 3QIPB 1G1XA 3B7IA 1WTBA 4FVCA 4UIBA 3HVAA 1M4GA 1MMNA 5GCNA 4CRYB 4B5PA 2M88A 1NHVA 2GO9A 2B5JA 3DNCA 4ES1A 2VI7A 3CTRA 2GVDA 3PR5B 3UCGA 3ZO7A 5LRGA 1F6TA 2Y3YA 1N52B 4ZP9A 4XPCA 4QIFA 2XGPA 4DX7A 1Y0HA 2CQGA 2QYGA 1WF0A 2PDOA 3NAIA 3J7YI 1X9WA 4ZKAA 1SJ1A 5HI7A 1VRUB 1AUSL 2V5HG 3OV7A 4I49A 2XO7A 4JI7J 1X4BA 2HQIA 2DD8S 4L3NA 2FHJD 1Q2CA 1JLQA 2DXDA 5EMIA 1T3NA 3UVJB 2DEJA 1FD8A 1UWBB 5IXUA 3PZPA 3TAMA 1A0OB 5AE2A 2VPZB 2Q4ZA 2DNKA