3DLJA

Crystal structure of human carnosine dipeptidase 1
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
477
structure length
471
Chain Sequence
PPPALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLGQSLPIPPVILAELGSDPTKGTVCFYGHLDVQPADRGDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWISKPAITYGTRGNSYFMVEVKCRDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTKEEILMHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVIGKFSIRLVPHMNVSAVEKQVTRHLEDVFSKRNSSNKMVVSMTLGLHPWIANIDDTQYLAAKRAIRTVFGTEPDMIRDGSTIPIAKMFQEIVHVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFAAFFLEMAQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-Ala-His dipeptidase
publication title Crystal structure of human carnosine dipeptidase 1.
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 136
structure length 471
sequence length 477
chains with identical sequence B
ec nomenclature ec 3.4.13.20: Beta-Ala-His dipeptidase.
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dljA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3dljA01
3K9TA 3PFOA 4P4FA 2PVWA 2PJCA 2C6PA 5LYDA 2XEIA 3FMCA 3BI1A 2VL1A 4ONWA 3TC8A 4W9YA 2OOTA 3PB6X 1XRYA 4UEEA 4JZ0A 2ZEEA 4R8FA 1CPXA 5F09A 4WJBA 4P4JA 2RFHA 5K8PA 3BI0A 1FNOA 3TX8A 5JGFA 3FX6A 5K8NA 4P10A 3PBBA 2CF4A 2Q43A 4FWUA 2PJBA 3PB9X 5LYIA 1EE3P 4YWYA 2DEAA 4IAVA 2XEJA 4ZI6A 4P6YA 5LRGA 2BOAA 4UEZA 3ISXA 3FEDA 4OC1A 4NGQA 2V8GA 3JRUA 4NGNA 1F2PA 2EK9A 1OBRA 3KHXA 4OP4A 3KASA 4YU9A 2BCOA 3B2YA 4EMEA 3D4UA 5HXDA 2PJAA 5ELYA 3D7DA 4NGTA 4MHYA 2AFZA 1TF8A 5HVGA 4NJRA 2QYVA 1ELMP 5LYLA 3FEEA 4DYOA 1YSJA 3BXMA 4MCPA 3HUVA 4UIBA 4TNUA 3FJUA 3VARA 3H8GA 1LOKA 4Q7AA 2IQ6A 3CDXA 4ZY0A 3BHXA 2F7VA 1ARMA 3NA6A 1TXRA 1TKHA 1XFOA 2NYQA 4WWVA 8CPAA 3MN8A 3KR5A 4MXUA 2JBJA 1M4LA 4F8ZA 2GREA 3PB4X 3NH5A 3KQXA 2AFMA 3D7FA 2RB7A 5JH9A 2BO9A 3KHZA 5LRJA 5D8NA 2C1CA 5LYFA 3RAMA 4OKOA 1LAMA 3GB0A 4R6TA 3IIBA 3WC7A 3IJ3A 4MHPA 3I1UA 3FH4A 3SJEA 4R7MA 2IJZA 2PE3A 4TWEA 4PXDA 1TF9A 2PJ0A 3DGVA 5HVFA 2AFOA 4X2TA 4EFDA 2G9DA 2IMOA 2PVVA 4FBEA 2O4HA 1LAPA 3SJXA 4H2KA 3KI9A 1RTQA 1Z2LA 1UWYA 4AXVA 3D7HA 2V77A 7CPAA 4GM5A 4NFRA 4FAIA 3CPXA 2ZEFA 4BD9A 3PRTA 1F57A 3KZWA 4OMEA 4G1PA 3B3TA 4OC5A 2PJ1A 1CP6A 2AFXA 4PQAA 1CP7A 1TKJA 2FVGA 2ZEMA 2OR4A 4A39A 3SJGA 3WABA 4UEFA 3V7ZA 1BPMA 4OC4A 4FUUA 1CX8A 1XBUA 3PFEA 1ZG7A 3B3SA 4A38A 4P45A 3SI1A 1PYTB 4DJLA 2Q51A 3V38A 4P4EA 4P44A 1YMEA 1BLLE 1VHEA 4CPAA 4OC0A 2CTCA 1Y0YA 4ZX8A 3QNVA 4A94A 2ZOGA 1ZG8A 2F8HA 2HC9A 2ABZA 2ANPA 5IB9A 4NGPA 1Z5RA 3K2KA 1F2OA 3B7IA 1AMPA 2HB6A 5CBMA 1H8LA 2V8VA 1JQGA 2Q4ZA 4IK2A 4MHNA 1R43A 2PJ6A 3KR4A 1ZLHA 4NGSA 1KWMA 2AFUA 1VIXA 2QVPA 2XEFA 4EWTA 1ELLP 2WZNA 3S9LA 3ISZA 3VH9A 3LWUA 3GLJA 3PBEA 4DUKA 4UF4A 2QJ8A 4B6ZA 4X3RA 1YW6A 1Y0RA 4MMOA 3H8EA 2GLFA 2PIYA 3D66A 2C6CA 1R3NA 1BAVA 1LCPA 2ZOFA 4P4DA 1IGBA 2JEWA 3B3WA 3T8WA 4JYWA 4RUHA 1YLOA 5DS0A 2ZEDA 4OIDA 2WYRA 2GLJA 2PCUA 1QQ9A 1ZLIA 1LANA 3NH4A 4PXBA 2PJ3A 2EK8A 2EWBA 5I4MA 2PRQA 4ZYQA 4P4IA 4NGMA 1HEEA 2PJ8A 2PIZA 1CPSA 1HDQA 5THWA 2NSMA 1XJOA 4OIWA 3VATA 1CG2A 2AFSA 1Y7EA 3PB8X 1PCAA 4PXCA 6CPAA 3IO1A 1IY7A 1VHOA 3NH8A 4OC3A 4ZY2A 3H8FA 3SJFA 1BPNA 1Z8LA 3D68A 5HVHA 5CPAA 3SI0A 3PB7X 4LQGA 5LRKA 2ZEOA 2ZELA 4F9UA 2PJ9A 3RBUA 3WC6A 1YW4A 3KGQA 4O23A 2AFWA 3PEIA 2ZEHA 3KL9A 4NGRA 3CPAA 4UIAA 4A37A 1DTDA 4OC2A 3FECA 5K8OA 1QMUA 4P4BA 2PJ7A 3HLPA 2GU2A 3IC1A 2JBKA 1ZG9A 4MCSA 4F9VA 3B3CA 1CBXA 1XMBA 3RZAA 4IHMA 3WC5A 4ZX9A 1NSAA 2CTBA 4NJQA 2PJ2A 3FVLA 3SI2A 3DLJA 5K8MA 1GYTA 1LFWA 3D67A 2PJ5A 3D7GA 1ARLA 4MHZA 3S9NA 4KSIA 2J9AA 5D29A 3L2NA 3IEHA 3B3VA 4MCRA 1FT7A 1VGYA 2ZEPA 3CT9A 3N5FA 2PJ4A 4MRIA 5J1QA 4K3NA 4MCQA 3B35A 2XEGA 3GUXA 4X8IA 2ZEGA 3LMSA 4Z65A 3S9MA 2I3CA 2V8HA 3IFEA 1TKFA 2ZENA 2C6GA 4ZY1A 3IWWA 2V8DA 1Q7LA 3WT4A 4PPZA 3MRUA 3NFZA 4R76A 3KQZA 4PXEA 1DE4C 3FF3A 5JM6A 1HDUA 2CIJA 1AYEA 2O53A 2POKA
chains in the Genus database with same CATH superfamily
4R8UB 5C42A 1GQEA 5A8RB 2GIFA 1UVJA 3TC8A 5DDRC 5CYJA 2JOQA 4WIIA 2DNYA 1K8AT 1PUAA 5F09A 4E8UA 4I2QB 2BKOA 5EGYA 3EFAA 1I1GA 2JC1A 2FC8A 2BUNA 2BJ8A 1Q81T 2MB0B 4OV1A 4Q38A 2FB0A 1F2PA 2EK9A 2FGOA 3NBPA 1LXNA 3WHIA 1NH8A 3OXGA 3KHXA 2LYVA 2Z3LA 5J2PB 1YGHA 2BCOA 2V2KA 4ZCMA 4EZ6A 3D4UA 2U2FA 3F8KA 1I12A 5B0GA 1RAJA 2GVDB 3LQVA 4MHYA 3TA1A 4JXRA 1R6YA 1U1OA 3R5JB 2CPYA 1FX4A 2UUBJ 3OFEA 5KT4A 3VARA 2BJ7A 3CDXA 2MZRA 4ZVUB 1LNQA 1XFOA 3WX8A 3TX0A 3NGTA 3KR5A 3P8BB 1P9QC 2PMHA 3PJWA 4ZIWA 2DRDA 3SMZA 4ZCKA 2XMMA 2ZD1B 3DMJA 2YKNB 1CLFA 3I1UA 3BEGB 3JQJA 1S9FA 2CG8A 4A48A 2OI2A 1EX8A 3OWCA 1M1GA 2IMOA 1YX0A 2PVVA 2KRRA 3SFUA 3EZ5A 2DPJA 3MTKA 5KFNA 3HVRA 3FVYA 2W7PA 1BWVA 4B3TF 4J3GA 2MZQA 1F5CA 4DG1A 2W8KA 4WU3A 1UFLA 1W25A 5KFVA 2GQ2A 2WB4A 1TAUA 2Q4YA 4LUBA 4M63A 2HQIA 3B82A 5KG5A 3S1TA 1S6PA 3RB0A 5MLCV 2UVUA 2FSRA 3ET6A 2KL8A 5HI7A 1EETA 4A38A 2DEJA 4M95A 4CRJA 4U7UD 2K5TA 4FKYA 2GE3A 2Q7SA 3GY9A 4DV7F 2EFPA 1KQKA 2FLLA 4CPAA 4Y2MA 5BXIA 3ITHA 1RT2A 1RSCA 3MEKA 4QYZK 2YKMB 3K2KA 2EWHA 4UOGA 4B5OA 1S77D 3HSGA 3M8PA 1H8LA 5J1EB 1IKYA 4CDIA 4BWMA 1RHQB 4DCJB 1OWXA 3J7YI 2J8MA 2G2ZA 3IG1A 4YB7A 1PBUA 1TMJA 1UZHA 3GE9A 2WZNA 4PAAA 4GC7A 4PZVA 2V4JB 3GLJA 4QCLA 4Y65A 3KHLA 2X1FA 1ULRA 1SKWA 4DR7F 4IDKB 4MMOA 3E2EA 1Q7YT 1V9OA 3PRDA 4DL5A 4C3MA 2UUCJ 1XEBA 1S9EA 2IVMA 2VQYA 1HL6A 1WG1A 2CFXA 4OIDA 1LWCB 1ICEB 2V0NA 5F0UA 1LANA 2GO8A 4OJ3A 3IS9B 3RTVA 4DU7A 3PRBA 3OTOF 2CVEA 4CLYA 4PV6A 4NGMA 1HEEA 3J7A1 3ZZOA 1WACA 3BQ1A 1V6HA 2BANB 3I55S 2HBYB 2XQCA 3Q8QB 3W5XA 2HGNA 3EPIA 3BSNA 1GK8A 3BGUA 2XMVA 4TN2A 2E5LF 2M52A 2D9OA 3PB8X 4PXCA 3MTJA 3AXMA 3I87A 1NK5A 4JI2J 3EICA 1C0TA 1CULA 3ZXWA 4BC9A 2UUBF 4Y2AA 2G0JA 4ED3A 4KFBA 4RBVA 1UKUA 2BA9A 1OO0B 4KV8A 3DCAA 3R5BA 3QT5A 3DXSX 4NZ7A 1TVRB 3MPYA 5FLXY 2AFWA 3CD7A 1X4GA 4YUDA 3K89A 2M7SA 3PV8A 1SUQB 2WAQD 3UE2A 1NEEA 3A8JA 5GMKa 1NE9A 2A6OA 4M5GA 3HLPA 3W5ZA 4A47A 4TKTA 3OTDA 1GHEA 3LO3A 1NSKL 2NUHA 4I7FB 3F0NA 4K0KJ 2CQ3A 1X60A 2XMJA 4CLSA 3EYZA 3EMTA 3U1MA 2DNNA 3H2UB 4I6AA 4XPEA 5F8NA 2EXUA 4Y2KA 2RIJA 1ZO0A 2YKQA 4NX9A 4DUTA 2MKHA 3R2CJ 4OI6A 3M8RA 4HI1A 3CMQA 4CT9A 2VH7A 4LQ3A 1FRIA 4LR9A 3GUXA 4JYAF 4UBRA 1R57A 2JWNA 2OPRB 3I5CA 3T6BA 3SCLE 3N6LA 4LF1A 2E29A 2ATRA 4A8XA 1AFIA 5A8KA 3UN5A 3E51A 4OHVA 1GXUA 4QJVA 3SCJE 4ALZA 3CCES 1NU4A 2B3VA 3K9TA 2MY7A 1VK3A 4DUYJ 2RH3A 5ETVA 3EE3A 4PG5A 3DDIA 1F60B 5HMNA 2R7QA 2WPXA 4XPDB 3NBPB 4FNIA 2FYXA 2F65A 5HMYA 3G87A 3UCZP 1FNOA 1KRPA 3QGGA 5E3RA 2LU2A 4NLSA 2NUUG 2PJBA 2VA2A 5E3AA 1RTHA 1J4JA 2ZBRA 9ATCB 1EE3P 4IOCQ 2E7WA 5JJBA 2B4OA 2XEJA 4OHWA 2O67A 1KOHA 5GADU 2E1MC 3AT1B 4UEZA 2RC4A 1RYSA 3TOQA 2LXIA 4OI3A 3GIIA 1HYSA 1SKRA 2HNZB 3TJ9A 4CO0A 4HKFA 1R6VA 4YR3A 2NSBA 4U95A 4NZ0A 1HBNA 5KT3A 3KG4A 4URQU 2KRBA 5ETRA 1Y5IB 1LWFA 4KGVB 3NLCA 4KOVA 3HP6A 4OI2A 3TEHB 1S1VB 5AE1A 4UWIA 2A2CA 2ZKTA 2QTWA 5GAHI 4EK2A 3L9ZA 5AXMA 3X1LB 3K59A 2CNNB 2N3OA 3OUYB 5C2CA 4RZRA 2HNDA 4YMEA 4O3RA 3IIBA 3ZZUA 4DG1B 1MWZA 2CQHA 1OPIA 3OT9A 4ED1A 1TF9A 1NM2A 4ZIVA 5DQHA 3J81Y 2NS1B 3G6VA 2R2TA 5HVFA 4PQUA 5KFZA 1S6PB 3J80Y 3FCHA 5A0YA 2Y0SD 3ET6B 2Z4PA 4KVXA 3FCWA 7CPAA 5KFUA 1VC0A 1HA1A 5HJXA 2OELA 4Q36A 2AWZA 1DJ0A 4BD9A 2C42A 3FSXA 4G65A 3B78A 1CP6A 2P5VA 3LGHA 2ZVSA 2GIQA 3H5YA 2JLFA 2ZBQA 5D15A 3RBZA 5KT6A 2VJVA 4X4NA 1Y9OA 2LQJA 3ITHB 1RT2B 1FDAA 2YNHB 5HBMA 2HV2A 1SH3A 2R8VA 3EGZA 1C1CB 1FRHA 2KM8C 2HFVA 2DHHA 3L09A 1EP4B 3H7HB 5CZXA 1MW7A 1WF1A 3OR2A 2W7AA 2HUZA 4JOUA 3AOAA 5KFLA 3SV3A 1S0OA 4K4TA 1Q82T 1HFEL 1Z5RA 1TFWA 5HROA 2V9KA 2R2SA 1R8AA 2RAQA 1N6QB 4A32A 2UUTA 4MHNA 3CCTA 2B56A 4AVAA 2JLGA 4KSFA 4RNNA 2XEFA 5J2MA 1S7KA 4KH1B 2Z3PA 1L3TA 2VG5B 3WX4A 2QJ8A 1NAQA 4RWXA 2F4VF 3GYXB 1IJFB 3TOBA 1Y9KA 3NGKA 1TUWA 2XSJA 4URSA 3OD2A 1BAVA 5G1ZA 2V4RA 4X65J 3NGUA 3KNGA 1NJZA 4MFJA 3CD6S 2BSWA 3VAJA 4ZPVR 3IU1A 3NH4A 3FFIA 1WTBA 2H5IB 2HVIA 4C2ZA 2OKQA 4LBPA 3C8YA 4ZJQA 5D0RA 2JLMA 4F3MA 1F6TA 2EC2A 1C0TB 3TAMB 2J9DA 4P2MA 1PU9A 5F41A 4DV1F 2YY3A 3RU0A 5CA5A 1OYEA 2IYGA 4TYBA 5F8HA 1HQUB 4JI8J 2OP5A 2HBZB 2L9NA 2VHGA 1H3DA 4WCEQ 4F2RA 2NSCA 3QPIA 5GMDA 3CJ3A 3FSIA 2HIQA 4OC3A 2K8GA 3GWCA 3UD4P 1YKWA 4CYPA 2WVFA 2B9YA 1NSQA 3ELHA 3QGPA 2CJQA 5A6WA 2MHNA 3TW0A 4PK2A 3PHTA 1SIWB 1XJWB 2FT0A 4P71A 4C7HA 2FPHX 3J7ZT 3RBUA 1H2VZ 4A31A 3M1VA 5CCMA 1KKHA 1U6MA 2UZAA 1M5KC 3C3LA 4CAFA 3PX4A 4R0EA 5IV3A 4ECUA 5H9FJ 3C14B 3EUNA 3PEJA 4OHZA 1YTYA 1T9YA 2FJVA 4LFCF 2W2MP 1VRTB 1M44A 3RZAA 4ILMA 1RA6A 2KB2A 1WF2A 4O4GB 1ZETA 1PC4A 2LXFA 5IS2A 4Z2XA 4ECSA 3GV7B 3T90A 1DLOA 4K5SA 5ETQA 2XZTB 2CZ9A 3UNYA 1YITS 3CT9A 1LWEB 4RI1A 1NMEB 3TANA 4K3NA 3CF5Q 3GFXA 3PJ9A 2OB0A 3VZIA 4MJ8A 4NEYA 4LF5F 2I3CA 3IFEA 2F9JA 3CEDA 1X10A 1MROA 3MEGA 3OTEA 1YVFA 4DSKA 5B0FA 3MXHP 2VOPA 1K1QA 4U96A 2RKIA 4ZBGA 1U0SA 1X4HA 4M5IA 1T94A 4WP8A 4DN0A 1TFYA 2DNGA 4ZPAA 4B9UA 3LAMA 2VPWB 3R6GB 1REVA 2ZEEA 5L1IA 2CJBA 4WFBQ 4JV5F 3I4PA 1Q0NA 4UT4A 1GTEA 4IQXA 4IH6A 1FTRA 2PGCA 2XLIA 2AX1A 2J5AA 3TUIC 2IRYA 1HYSB 2QA4G 1T9WA 1JLEB 1VJWA 1RBAA 1IR0A 1JLCA 1N54B 2D74B 3T1YJ 3AJ1A 4LR7A 1URRA 2V2ZA 1U2FA 4Q45A 5IQ6A 2BZ2A 5HP1B 4NGNA 1I51B 1E6YA 3DN9A 2F5IA 4OP4A 3QRRA 3UPFA 5IT4A 3K8VA 1LWFB 4HR2A 1VBYA 3KLHB 1RACB 1T9UA 4ZPDA 5F9NA 2GVZB 4F0XA 2ATCB 3LP2A 3CJKA 1Y00A 2YH1A 4USVA 2G3AA 2HNDB 2WSAA 3DLEA 4W4MA 3HKWA 1SB6A 1RBLA 4YR2A 1NXIA 3BO3A 2MJUA 3DLGA 2GMJA 4J9QA 1BE4A 1J2VA 1Q78A 2AYBA 4RW4B 4PQUB 3A3NB 2GREA 3HM9A 2NREA 1KR4A 2CQ0A 5EX0A 4OX8A 4DLGA 5EWGA 3KHZA 2JFKA 3RAMA 1X9MA 2AZ1A 3WC7A 3GILA 2F3JA 3ILJA 1A6LA 3KUEA 2PR1A 2PJ0A 4K7QA 2RU9A 4EFDA 1SBRA 3ENVA 1LAPA 3MAQA 3GU0A 1FWPA 4NLXA 3QIDA 2CPXA 3HD1A 1HBOA 4KLVA 1NH7A 4IF5A 3CPXA 1WC4A 1RT7B 3PRTA 2DHSA 3J81j 3OR2B 4KO0B 3AHPA 1SC3B 2RDIA 3LALA 3OVSA 4PQAA 2B5JA 5HQLA 4UQTA 1NPPA 4QWAA 1KBRA 5HROB 4U7UK 1XMQJ 1CX8A 1B87A 2FC9A 3K5PA 5ETMA 4JD6A 3SI1A 2I79A 2Q51A 1IBLJ 1UA0A 5G4DA 3SDEA 1FO1A 2HQYA 3RNZA 5J2MB 1IQTA 3TP2A 4DQIA 2ZC3A 3OVBA 2CWKA 5KG3A 1IKVA 1T95A 1QLNA 1AMPA 5CBMA 3RBEA 1RUSA 5E0OA 4NGSA 1KEKA 2YQ3A 5G22A 4NXNJ 3RW7A 1F1BB 4F36A 2HAIA 1T7PA 5KFRA 3FFIB 3PR4A 2ZHOA 2WPWA 3H59A 3FYNA 3GG1A 2C6CA 3RW6A 1D09B 2JEWA 2O66A 1FWKA 2ZH9A 4RUHA 1NKBA 1WKKA 3HZEA 2SXLA 4TQRA 2R7UA 5C88A 3UN3A 2OFHX 1L0CA 3LWLA 4KBIA 3S6KA 1Q79A 3CXQA 1TMMA 3KK1B 2YXLA 2G2OA 3VWDA 2FZKB 5KAKA 4DNCA 3M8QA 2ZE2B 2HBRB 1Z4EA 1WDTA 3H90A 2YNDA 4X66F 1PYOB 2QA1A 4CCHA 1LFPA 2XWYA 1YZ7A 5IWAF 2H4WB 5KG7A 4I64A 2CDRB 4X4UA 3ZFVA 2UV8G 3HFKA 5EWFA 7FDRA 2LECA 1OQ6A 2AIRB 4HHJA 5DLFA 2WBMA 1B7YB 3A8IA 3T9NA 1KTQA 1IBKJ 2OHDA 2HRYA 2MLXA 5DS7A 1DAXA 3W66A 2B5GA 2IC3B 3DYAB 3N4WA 4CNZA 4WTOB 1O51A 1V5VA 2BEIA 1SQHA 2AX0A 2JBKA 4M5DB 3W63A 3IRXA 1NMTA 3FMBA 4FD7A 4CAWA 4EYIB 4HT7A 2X1BA 4OX9J 3SSRA 4D3GA 5FIIA 1FRKA 4XIUA 4NYOA 4KSIA 1HW9A 5H9EJ 1PBAA 1MROB 5D29A 1YJ9S 3DOMA 5L39A 2RRBA 3BDEA 1FTCA 4DR3J 5C5JA 1RYRA 1VGYA 2B4BA 1TK8A 1ZTTA 2DIUA 2RKIB 4ED8A 2VQEJ 2QYGA 5DQGA 1Y3KA 4UTGA 4KLWA 1VISA 4K4YA 1XMTA 4Z65A 2ROGA 3KK3A 2Z58B 2E5IA 4KZTA 2JZ5A 1WTFA 5G20A 4DX8H 1RISA 5CYMA 4M5JA 2PD1A 1DE4C 3JSYA 2DVIA 2JC0A 1RB0A 2B6AA 3K5NA 1JLCB 4OX7A 4U9ZA 4IO9Q 3I0RA 1XRYA 2UP1A 4LF6J 1UFHA 2GX8A 3HVWA 2IM0A 1E6YB 3U1NA 2PC1A 1VK8A 1FNXH 2KCWA 1DQ9A 4A8OA 5C2GA 1UTAA 2CQ4A 2KYXA 3RJMB 1HBUB 4W92B 1BHNA 4FS2A 2MY8A 3R27A 1JX4A 3KK2A 2XS5A 3LP2B 3CJKB 1S59A 1J5EJ 1F2HA 3IWNC 1JJHA 5LOQA 3W65A 3DLEB 4FYYB 4MFQA 1U6ZA 4U9RA 4WE1B 1HWIA 3ZTPA 1J5OA 3B4DA 3LP1A 3GONA 3QSYB 4NYPA 2DGUA 3FRYA 1Q1KA 1RT6A 2VF3A 5BYSA 2BACA 1YSJA 2W2NP 3F73A 1Q86T 3TOAA 4JBCA 2HLTA 4KOUA 5LMUJ 1ZYQA 3A13A 1S0VA 1TKHA 2NYQA 3RR8A 4ZLJA 5I42A 4URGA 1QJHA 1M4LA 3HHKA 3PIPQ 4OYPA 3JTNA 3OBIA 1HI8A 4OHXA 3NP5A 5LRJA 2C1CA 3HHNB 2FIUA 3HULA 3KHGA 5LT5A 1RT1A 2BE9B 2GNKA 2XB2D 3BR9A 1TL3B 4RL1A 2JDCA 3KMSA 4C8ZA 5T41A 1FX2A 3TT2A 1TKZB 3H40A 4JXQA 3P4UB 4QU6A 4OADA 1AA1B 3AQPA 3CJRA 2ERRA 2HWHA 3G96A 4ER8A 3LH2S 4FAIA 5E3CA 2HRTA 4LF4J 3SDEB 2HG4A 1S0MA 4LVOP 1TKJA 1RCOB 4QYZJ 2CJAA 3ENAA 2M8DB 1MMNA 3G6XA 2K1RA 3BH7B 1IKVB 1U49A 3PFEA 4WXOA 4CWBA 3G71S 2CUYA 3DRSA 1MSWD 2UVVA 1MN7A 5AJ3F 1NHVA 4C11B 4YHHF 1SQEA 4Y49B 3QSIA 2W25A 5A2QU 1N36J 2F8HA 2HW3A 1XERA 1AZSB 1X5TA 4KPCA 1MU2B 4QPXA 1Y5LB 3O8WA 1QAYA 3J7YU 1TZ0A 2XBPA 3L3CA 1V0CA 4ECRA 4IK2A 2IAJB 4K4ZA 2QLFB 1TV6A 2DITA 3GIJA 3PO4A 1VLOA 1FRJA 3Q8YA 1ELLP 3ISZA 1NKCA 5D0EA 3H5UA 1D9FA 2JEGA 4XTTA 2EFOA 2CDQA 3BN4A 4MTPA 1YWXA 5FJ4A 1QY7A 1WORA 1GXLA 4LT6A 2Q4VA 1C1BA 2V50A 4DLEA 4F4ZA 3UVJB 1FJGJ 3TO7A 3FC9A 1WG5A 1LOUA 2HHTA 1REGX 4DFPA 1FD8A 2A4NA 1FKPB 5H1SV 5DO2A 5KFAA 4ZJOA 4HNYB 3KLEA 4OYIA 4GKKF 1B4SA 4MKAA 3FMWA 5J1NA 4DV5F 1FXRA 4OZLA 4X4QA 2J7KA 2WCXA 4M5NA 2AFSA 1N34F 2YNEA 5E41A 2RDJA 3N6NA 4O4RA 1QE1A 4ZVHA 2ZNYA 4ERDA 5CPAA 1PGZA 4I0WA 3SI0A 3H4DA 2F5GA 3PNIA 3PTWA 3PGPA 3EXYA 3SQGA 1HNIB 2HFSA 1VBZA 1G3OA 1RT4A 2G3TA 2RSQA 4C8NA 1BOBA 1RTIB 4EO6A 2XWXA 2QA4S 3D28A 3PG9A 1L3KA 1ZG9A 4DSEA 3S01A 3I9ZA 4DR5J 4DQRA 1M5OC 2QEXS 2HMIB 2BJ9A 2MXYA 1J27A 3BO4A 3AJDA 1I21A 3F44A 5GAEU 4AVBA 4DL6A 2PJ5A 1OMSA 3IU2A 4LF4F 1ZA2B 2UVWA 2ZUGA 4MCRA 2YX4A 3A9LA 2F8EX 4I1TA 2XEGA 1XMOJ 5DRKA 1RHKB 3S6HA 1M1KT 2B6AB 3MFHA 1TKDA 4OYZA 3V6HA 1VQKS 4K59A 4FF4A 1JWWA 3I0RB 3I4HX 4QIVA 2ROEA 3WQPA 2BM0A 4CYOA 1DY3A 1Y7RA 1QSRA 4P52A 2R2UA 3CNQP 1WSVA 2DH8A 2B4DA 2MGZA 3NRBA 1R0CB 4BS2A 2QFIA 3KDOA 4MYTA 3OTCA 1NK8A 3P6YC 3PFOA 1IBCB 3I82A 5LYDA 3CJQA 4M6HA 3DRPB 3N01A 1TTHB 3OHAA 3PB6X 1DHMA 1FRXA 3IP0A 4MK9A 1NRKA 3VAFA 5KFKA 3NNCA 3D6TB 4WJBA 1V3RA 3VZHA 2QE5A 3DNSA 1J5OB 3LP1B 4OZJA 5I0CA 2Z3NA 4UFWA 3TAQA 3ZZYA 1RT6B 4P6YA 3FBEA 4OC1A 3ETOA 1AUDA 3JRUA 1IM6A 3Q8VA 4G1IA 1BQNA 4DPTA 1FVQA 1AXQA 2L9WA 4E0DA 1JXVA 2VPXB 1OSCA 1S6QB 4JI5J 5ETLA 1B0PA 1NPRA 3MMAA 4V19J 3ISNC 4X64F 3H2LA 4MJKA 1S5KA 3CMAS 4A4JA 2DHXA 4H4OA 4DSLA 4RW7A 2YNCA 1BLUA 3TZWA 2B9WA 4X4VA 5KFXA 3MCOA 2YWHA 1JLGA 2WZ1A 3OSNA 1NJIT 2ZUAA 1RJJA 3BHXA 4ZY0A 2MZSA 2CQ2A 3UQSA 2BJ1A 1I94J 3W7BA 2XY6A 1UJ6A 4ES3A 2M88A 2AFMA 3RYOA 2MPUA 3KG0A 3M2UB 4Q43A 3R7SB 4K2JA 2B8PA 3TVZA 3SJEA 2IL4A 1KONA 2B4VA 4KUBA 4OIXA 3FRZA 5F8GA 4UY8T 3MM6A 4IRCA 4WK1A 3HVTB 3MI7X 1UETA 2V4QA 1X7VA 1WNEA 2YKAA 2K1RB 3S7RA 3E0KA 3KI9A 1ZPVA 1UVKA 2E1PA 2E1CA 2X51A 5KFJA 2ZEFA 5L1KA 3CIZA 3V6DA 1VYAA 4NMLA 3HLUA 2MLYA 3DDKA 4DI6A 2A0FB 5EBVA 2F40A 3CC2S 4A39A 3I32A 2KDOA 3ETMA 4WTYA 1RABB 5KTQA 3B3SA 4I56A 3TA2A 1W2IA 2B58A 4MFLA 3N6MA 1UL3A 3BKTA 4LRDA 1TV6B 2IBKA 4YGOA 2DPTA 2X7IA 4ZPBA 1YMEA 2DNHA 4ZX8A 1T03A 1QDUB 1QSLA 3HSZA 1X9WA 2ZOGA 4JI1J 4OYOA 2AZ3A 3FNNA 4ZVQB 4DSFA 1IB1E 4A2ZA 5F48A 1TUVA 4B9TA 1DARA 2JL9A 2OPPB 4DFJA 3MMBB 1HNZF 2HB6A 1F3FA 1XNRJ 4J9PA 3AXKA 5JQ4A 1QVGR 1R43A 3W2WA 3S9LA 1Q8KA 3LWUA 3WZ0A 4DUKA 1LW2A 1TK5A 2DXDA 4B6ZA 3BDPA 1EHWA 1IU8A 4DPWA 4GVBA 2DNRA 4WFYA 1RXOB 5U47A 4JYWA 4MH8A 2HQFA 1WOPA 2KHCA 4HT5A 3CMES 2D4PA 1XIQA 1SI9A 2WRMA 4UUWA 2PA8D 2EWBA 1SPBP 2MZJA 3WR7A 4P2XA 4DR6J 2WBRA 4FF3A 3JSMA 2AF6A 2R8KA 2OMLA 4R87A 2AJ0A 4HACA 4BINA 2D9PA 2JEJA 3CD5A 1KFSA 4NA1A 4A8MP 4KGZB 4OV6A 1BMQB 2BE7D 2KVQE 2DGXA 1RT4B 2AGPA 2GAHC 3M2RA 2N4DA 1RP5A 3NGSA 4KGKA 2GHVC 4NI2B 3KLFA 3KJFB 2VXKA 1SC4B 4RU2A 3D68A 4GS4A 3AA9A 2VV5A 5KTCA 3CE8A 4DF8A 2HGMA 2PJ9A 4EEYA 1RKIA 1BQXA 2JH3A 3G82A 2DR6A 4DR2F 2GHWA 4YY3J 4PUOA 4L3KA 4ZVTB 2VBQA 3FDSA 4OAEA 3NWGA 2DXQA 1MJAA 4MYUA 5DZ7A 3DGPB 4FVCA 1FE0A 4CO2A 4XPDC 3HD2A 3GIMA 3DRRB 3QZ8A 2QLJB 4QIWD 4HYKA 3B3CA 2XLJA 1KHWA 3WC5A 4L75A 3KJVA 5E7OB 5DG8A 3OLBA 2H5MA 5KTDA 4AG9A 3CC4S 2QG9B 4PPDA 3F41A 1TK0A 4NA2A 1WEXA 4RNFA 3BQ0A 5IT9U 1P1LA 3JTOA 4IG0B 2IHR1 1S1UB 2OGUA 4O3OA 3MECA 1R27B 5LJ3Y 4A46A 4K4XA 3DLKB 2KZMA 3OW2R 5J1QA 4KGMA 4B02A 4NL5A 4UCNA 4QUSA 4DCOB 4P7VA 1TKFA 5DQIA 2Z0ZA 2IM1A 1YBTA 2LP4A 3VAKA 3TQ1A 2UXDJ 3EPGA 5IV0A 1Q7LA 1SC6A 3NFZA 3BS9A 1HWLA 1RI7A 2AU0A 3KQZA 4QIGA 1SQGA 2JLEA 8AT1B 1AFJA 3LWMA 1UVNA 4TLRA 2PVWA 2LQ8A 4ZPWR 5J2QA 1HWJA 1NB7A 2J7UA 3R5GA 2IVFB 1R89A 5KFSA 5KFGA 2MKJA 1NK6A 1OIAA 4P4JA 4RW6A 1BQNB 4OL8A 3IBCB 1SL0A 1RKJA 2Z0GA 3L95X 4EBEA 4ELTA 2CXAA 2D1CA 1AUSL 3BJ7A 3VTIA 1K73T 5LYIA 4F7VA 2A1BA 2DISA 3DM2A 3W64A 2DNQA 2CNSA 3R7BB 4HI2A 1CJTB 2BOAA 4FD5A 3QQCD 2XMAA 2UUAJ 1HBMA 2REFA 2OH2A 5HANA 2VUGA 1KVKA 1M4GA 2D3UA 3B2YA 5HXDA 4NLUA 2G0BA 4E0AA 2BE2A 2XGPA 2AFZA 4P6QA 4DV0J 3MR6A 3BYPA 1MMLA 4J9NA 3R95A 2DGWA 4ED0A 3L4BC 1FFSB 2HLUA 4KSAA 5M2UA 4R3LA 4CNYA 1NPKA 1RTJA 1RT3B 5LL6d 1Z8WA 4DHVA 1HPZA 1KP6A 4FS1A 1LXJA 2CPFA 4DQPA 3I5BA 4U9YA 2DO4A 3BKUA 4JI7F 1HR0F 1DQAA 2CQDA 2O3DA 1HMVB 3EDQB 1EQ0A 3CDWA 5D8NA 2BQRA 3GB0A 1CC8A 1LW0B 2W9BA 5KOWA 4PK3A 4KPYA 3BGFA 2ABYA 2PSWA 3AD8C 2FLPA 2AFOA 1U26A 3ZTRA 4WP9A 4CRYB 3WBZA 1XTZA 1PIEA 5A2QY 2GANA 2KO1A 2Z2MA 4DL7A 2CNTA 5KFMA 1F57A 2GAGC 4KOSA 1SJRA 3ZJ0A 4ED2A 5C24A 4DL3A 1ZPWX 6AT1B 3D0IE 3NAHA 1ZG7A 1VQ8S 2BW2A 1P8GA 4DJLA 5RUBA 4J9RA 3PKMA 5A8WA 5E3PA 4UZBA 4J90A 2QMWA 2YWKA 2CTCA 1PJ7A 1Y9WA 2HQCA 1ZG8A 1ZAVA 1LW2B 2ZZMA 1XK8A 4CP5A 3CCVS 4CTAB 1UEKA 3E01A 1F2OA 2FIAA 3TI0A 4ZP9A 1BWEA 2V8VA 4WFAQ 2UXBJ 2EK1A 2IFXA 3TZZA 4L3NA 4FYWB 4J9VA 4OYXA 4JI3F 1TUGB 1R8PA 1NBEB 3BGRA 3GFHA 5KG1A 2J9EA 3IN5A 4LF9F 2Q0YA 1NZ8A 4DUZJ 3G9CA 4WIQA 3HSJA 2ZXVA 4Y2CA 4B12A 3UDVA 3DU5A 4GKJJ 1FRLA 2ZHAA 2EO8A 3MR3A 1JLFA 1QM9A 3PVXA 3IBFB 4DBQA 1TP7A 1U02A 2ZEDA 1IYKA 2WYRA 3GP9A 2QN6B 2VDHA 1ZLIA 5I3UA 3VQSA 1QD1A 1FERA 2MQ8A 4NLVA 2ZM6F 1IKXA 1RXTA 3T5KA 5EC4A 5CAAA 2RE1A 5LSOA 4IRKA 3M2RB 5KFQA 2OPSA 4P75A 2PJ8A 4WF9Q 3D1QA 1JNZB 1U1KA 2ALYB 3T5HA 4JI0J 2MDAA 3DU6A 2FQQB 1W7WA 1SV5A 1YDLA 2L9DA 3C66A 3BGLA 4DV0F 2W4CA 2XYPB 4PUOB 3M6XA 4ICLB 2CQBA 4NOHA 3LPYA 2MLZA 1FDNA 1VQSA 3F5BA 4DSIA 1U2CA 3CDAA 1QSTA 5FDLB 3WDOA 4R8UA 1K1SA 5LMNF 5B0EA 2XMKA 1NDPA 1NJYA 3CCUS 2PQ8A 2EFQA 4KHPJ 1XWLA 4QYRA 1SJ4P 4DXLA 4LF7F 3OHBA 4BMHA 4EFAC 2KFYA 4I2QA 1I1DA 2OSRA 3M30B 5BJRA 1VRUB 4P2FA 3K9UA 2XHCA 3TJAA 3WC0A 5CD4A 4RUCA 3MECB 2DGSA 2DGVA 5DM6Q 3HJVA 5J8CA 2QLWA 1RT5A 1ITPA 3HI9A 1FWLA 4KAIA 4ELVA 5K14A 1ARLA 1DZ5A 1S9GB 2AYGA 2MQPA 3CJ2A 2CQCA 5ADZA 2GVDA 4YFUA 4CYUB 2QIRA 4MFBB 2DYAA 5D78A 2DR8A 4FF2A 2MKKA 3GG0A 2HK3A 4J37A 2LFVA 2HK2A 3QT6A 3EGVA 2R7TA 1D9DA 3PZPA 2VG7A 3FBFA 3N5BA 1N48A 1OY8A 4PPZA 4RW6B 5DGBA 4DR1J 2OIHA 1IM4A 3GR1A 1AYEA 4NCAA 1CJWA 2EI5A 2POKA 4CT8A 2RS8A 4P4FA 3BPDA 1R0AB 2ZD1A 1RAGB 1FFGB 4J9LA 2YKNA 2BUEA 2DH9A 4E2FB 4MFPA 3HK2A 2IMWP 2ASDA 1JLQB 4OZ0A 3W8PA 4DX5A 5HMZA 3EO4A 2WTFA 2KVIA 2Z30B 2JDJA 2CF4A 4DV2J 1CVJA 3IM9A 4TLQA 3PB9X 3UDEA 1JLBB 5HQMA 1H2TZ 3LD2A 3M32B 1N5YA 1WC5A 3DNCA 4MT1A 3CDEA 4II9A 2AP6A 5J2NB 1CJUB 3KASA 3D1HA 3GYAA 4ZVFA 1VQOS 3V2UC 1SJ1A 2XS2A 4A8QA 3FSYA 3A3OB 1IBMJ 2EBJA 4YS2A 2KH9A 2R7HA 4QPTA 3TVKA 2UXCF 3W8GA 2OTLS 3GTYX 2B7BB 4RNHA 1TXRA 3KLVA 3TUJC 4C97A 2YKMA 3GSDA 4QU7A 4C8MA 4WYLA 2D3OR 3V6JA 2H1YA 2MTLA 5D4PA 3QIPB 1N32F 5ETOA 5LYFA 4ZKAA 1VDHA 2XNRA 1Q2YA 2V4JA 1I6JA 1PSDA 2CAJA 4XPKA 5C24B 2RT3A 4IDKA 3R1HA 4X2TA 2G9DA 3W1YC 4FBEA 4FD6A 2Y8WA 3IGRA 3SFGA 1RWVB 2DEIA 4R0JA 4NLRA 4NFRA 4MHDA 3R1KA 1Y5NB 1SH0A 3CDUA 3M05A 3LGMA 5EWEA 3NXZA 5E2QA 5C82A 3NEKA 1LWCA 3B3TA 4ENOA 1FXLA 1N33F 2FVGA 5DETA 2OR4A 4NRUA 2PC6A 1IWGA 4ECTA 4LSZB 5AG6A 4N47A 3SJGA 3A1YG 2DXEA 1GNKA 3DOLA 3QLHB 1K0VA 2BANA 4E8OA 4LFAJ 1P1TA 5JMNA 1RAOA 4DF4A 3N28A 4X2BA 4AE5A 3BGRB 1WUUA 4I68A 4FXDA 2HRUA 2RU3A 4NGPA 3BREA 1VHFA 1RZMA 2VG6B 2W24A 2KFZA 4KVME 4MIAA 1UCNA 2PDOA 3T1AA 4DV6J 1JLFB 2HURA 2RRNA 1ZLHA 4DPXA 3NOCA 3EVMA 4EWTA 4J7CA 3WC2A 3K58A 4F25A 1T0TV 1IKXB 4UUXA 4U8YA 1SUQA 2NYIA 5J8FA 1SKSA 3VAHA 3CULA 3EY5A 4XDCA 1AT1B 2IVYA 2OPSB 1ON0A 1IGBA 2QYCA 3GFZA 3W9IA 4F0YA 2VB6A 1IJEB 3N79A 4OMFG 3CJTA 1YLOA 1X4AA 2RRAA 4X62J 2C2ZB 4I7FA 3AOBA 3NKYA 2ZZNA 1YBAA 4DV4J 1R7IA 1SV5B 3MPUB 4HH1A 1XNQJ 4ZLLA 2CPHA 2E66A 3RRKA 2BBEA 3MM8B 1YJ7A 5H9EK 3CXPA 4X84A 1KLNA 5HLFB 3RB6A 1RHRB 2E7VA 3QRPA 3W9JA 1S99A 5IX3A 3RG6A 4PR6A 4UOCA 4LF8F 2HHHF 2OPRA 1SJ3P 3TQEA 2O28A 2YNFB 2HVZA 4CGNA 3MAAA 3UN2A 4Q5VA 1UP1A 3P45B 3GJSB 3B8GA 4K30A 3GKRA 4K4VA 3EX7B 2G13A 3KGQA 1P0HA 4QOTA 2W9AA 3IWLA 3VQTA 4F0KA 5IT9Y 1RT5B 3I3GA 3HKZD 4ZPTR 4M5HA 1QMUA 5K14B 4AXIA 1VQLS 4P4BA 4V1Ak 3JUWA 3A3PB 4IH5A 3T19A 2BQUA 1F9HA 2AEMA 1NK7A 1U25A 1WHWA 4N5SA 4NJQA 2C3OA 4ZJLA 3FVLA 4QR0A 3MM5B 4IH7A 4FPIA 1U0HB 5K8MA 4ZK7M 1GYTA 1CC7A 5C7PA 2VG7B 2WVDA 4QZVB 2QL7B 1OQ3A 5L38A 2VI7A 2FHOB 3IR7B 1PYSB 4FYDA 2HNZA 4NCBA 2C2EA 3G2XA 3M4XA 3CCMS 1NHUA 2I00A 2H54B 4IFYB 4OZ1A 2IYIA 1WEYA 2ARHA 1CS4B 4CGLA 3M9MB 1CJKB 5BR8F 3O1LA 2AGOA 3SQOP 5KFOA 1HNVB 1S1VA 2ZH1A 1WHYA 4BBYA 2CWXA 2R42A 4USMA 3FF3A 2LQ9A 4KRWA 3RUBL 5KFFA 2FVRA 3O44A 2PJCA 1YG0A 1FVSA 3LODA 4ECQA 2XEIA 4XPCA 2XMTA 3OUYA 2MHEA 1N5YB 4W9YA 2OUGA 1NDKA 4KOXA 4NZ6A 5IB0A 4DU8A 4USIA 2HZCA 4O3SA 4N77A 3TX8A 4UA3A 3M8WA 2V69A 1GX6A 1FDBA 2DEAA 3H8YA 5CD4H 4CAVA 3DXBA 2A6MA 4TY9A 3QJLA 1G1XA 3PW5A 2PN6A 3BKFA 2RUSA 4PG8A 3QT7A 1ZA1B 3BN7A 2YNHA 1HQ2A 5DZ6A 4DV4F 1YJTA 2H5EA 3C19A 1LRZA 2CJXB 2Y8YA 1C1CA 1HNWJ 3ZO7A 4NJRA 4DR4J 4B3RJ 1FNMA 1ZH5A 2EK6A 3W2VB 1RWUA 3FEEA 1EP4A 2WUUA 4CH1A 4OZ5A 1S1WB 3FJUA 5L1JA 3VF0B 2GQCA 2F1FA 2Z57B 4Y49C 9RUBA 2EUIA 2ILYA 3UCUP 2VZ9A 1ZM9A 4LFBJ 3QWUA 3G8TA 3DHXA 3TTHA 3KLIA 1TKTB 5KT5A 2ADCA 1N6QA 2BOPA 3W62A 2RB7A 1WKJA 2R4FA 3KMQA 3PCOB 2LVWA 1KC8T 3IJ3A 4MHPA 5D3GB 4K8RA 4EMDA 4Y28C 4ZHRB 3H5XA 3CJ5A 2XCPA 2ATLA 2IJZA 2P6GA 4C0HA 2VG5A 3R8YA 4BHQA 3ISND 4HDHA 4K2XA 1VC6A 3PYGA 2JRSA 5E96A 3DOLB 2HS0A 1S7NA 3EDRB 4J9OA 2CZVC 4NLYA 1M5PC 2PJ1A 3M6UA 1F9FA 3CW2C 2GGPA 2D4OA 3ZZTA 2RJZA 4DPUA 4V19X 3TAMA 3V7ZA 3SXNA 1YJWS 1QSYA 2PMZD 5B0AA 1B3TA 3ZZZA 2KT2A 3PACA 1HQUA 2HIYA 4FP9A 4UOFA 2YKPA 4HTIA 3UD5A 2GFFA 2BABA 3M6WA 4XPLA 3QNVA 4ZVRB 4AXJA 4OZNA 1YGYA 3SCKE 2AJ4A 1VKCA 1WJ9A 4YFJA 2XULA 1UEVA 4CGMA 3I0SB 3TJ8A 2PJ6A 3KLGB 2MSSA 4OX6A 5D6GA 2NLWA 2FJWA 1M5HA 1PJ6A 5ETSA 3D2WA 4IRDA 4JI6J 2VPZB 2RILA 1VI7A 1LK5A 1Y0RA 1YLEA 4C0BA 3Q8UA 1X31C 2HHVA 4X4PA 3C14A 5GAEI 3LGNA 4LSNA 1C4AA 5HO4A 2YTCA 1B0VA 5F8JA 1R0BG 2ZC4A 1YJRA 1N5QA 2PI5A 4XO0A 1VRTA 4BLGA 4X4SA 3UFCX 1IICA 2CJ9A 4KOWA 3FZBA 4O4GA 1Y11A 4I69A 3NL0A 4QWDA 2PRQA 4P4IA 2E5GA 5GMEA 4USKA 3C6UA 3MAAB 1JJCB 3DFEA 4WFZA 4ID5A 2NSMA 1DBDA 2DPSA 1CG2A 1LWEA 2J76E 3MUMP 2GA7A 2HWIA 2P0WA 1XBWA 1ACMB 1H7XA 1ROFA 1WDDA 1VHOA 1TL5A 2DNZA 2G0CA 1ZZNA 4RW9B 3H42A 4F3OA 4RUAA 4RPFA 2BEFA 4AVCA 3PW0A 4K50A 5J1PA 4U67Q 1HWKA 2L41A 2ZOMA 1CPZA 3FGVA 3EXCX 2G4BA 5JPHA 2M0GB 2BXJA 3FECA 2IDEA 2UUCF 3OJSA 5HL7Q 1S79A 4U5YA 5A76A 5B0DA 2BMBA 2LCWA 3QWPA 3HF5A 4RJVA 1JLEA 4M5MA 3MWBA 5KFWA 2CTBA 4FBUA 2F4FA 4YDDB 4FPRA 2WVBA 2GIVA 2GFQA 2B43A 5HP1A 4DPOA 1XEZA 5T7LB 1IOFA 3ZC4A 3KLHA 1HNXJ 4E98A 4DZ6A 2Q6BA 2BL1A 2CA9A 3JXOA 2DCLA 2CJYB 2GVZA 4RR5A 2JVOA 1VBXA 4JI2F 3LMSA 1O6XA 2HFOA 2Z2YB 2D41A 2ZENA 3SXOA 4I6YA 3VAIA 1XR6A 3NNAA 3HJFA 2V8DA 2VBZA 2FZGB 2KFNA 4B3MJ 4J9UE 3DI6B 2ZFHA 4RW4A 4HL9A 1N5SA 1TKXB 2E1AA 3DKDA 2BQ3A 4OYAA 4CLFA 3GYNA 3KJQB 3JVNA 4HH0A 2MQMA 2YPYA 2R2RA 2FTRA 4WK3A 1BQMB 2PMWA 1LWXA 5ETNA 1T05A 5K8PA 2JHEA 1EJ7L 3BB5A 3MCMA 3RB3A 1GXTA 4LX9A 5L9NA 2ZH2A 4K0KF 1KLMA 2RQKA 1K47A 4ZITA 4CLWA 2DR5A 3BR8A 3J7AN 2OEMA 3IWEA 1RT7A 2LQBA 5LRGA 2H3EB 4KO0A 2AEFA 1C4CA 2BVZA 3EC4A 5HMXA 5CYQA 1CQMA 4KH0B 3D7DA 4NGTA 1X8DA 5L1LA 4PEOA 3KLIB 3PXGa 5F49A 2FUG9 2O1PA 4IOBA 2C22A 3U02A 2A18A 4MCPA 4P72A 4IO1A 5FLXU 5LJ5Y 1QUVA 5B0BA 2H4YB 3P49B 4RO0A 1XN9A 1RU1A 8CPAA 1FEHA 2C2KB 1D9AA 4CQ1A 3IRWP 4O44B 2ZW4A 1OY6A 4DUYF 2V2QA 4OFZA 2KHDA 3IBWA 4R25A 3S6EA 2DCUB 2FS5A 4Z7CA 2ZBIA 3FH4A 3SSSA 3M9OB 3TWZA 4TWEA 4PXDA 2CNOB 2GGPB 4XAKA 2KTQA 1JB0C 4GO7X 3KKWA 3SJXA 1M4IA 3NS6A 4F04B 3UW1A 2V77A 5HATA 3ZTOA 4OI1A 4CH0S 2YQ0A 2EFGA 1RGVA 4L89A 3NY0A 2XYGB 5CZVA 4MIBA 4KGXB 2COLA 3OR1B 4RW8A 3B6BA 3KK1A 4F4WA 4B5PB 1NSPA 2IIHA 2ZE2A 2OPQA 4C3LA 3HSDA 4G6VB 2EFNA 4NXMJ 1Q5VA 1RE1B 2OEJA 4P44A 2DBBA 1H74A 4TQSA 1HNXF 2YWFA 3CCRS 2CYYA 2J0SD 1PAEX 2HC9A 4JI4J 2XC9A 2GJ2A 3T3FA 2GJFA 1S7IA 3B7IA 5DDPC 2Z56B 1PYTA 4LSNB 1JQGA 5F8LA 4ZGYB 1FK9B 4YQWA 1WSRA 3R1LA 5DDQC 2QVPA 3S6FA 4N8OA 3HFVA 4QC6A 4UF4A 3RRGA 1S76D 3HDSA 2R7VA 2G2YA 2IC3A 3L7OA 1HI0P 4TU7A 3DYAA 4OI0A 4P4DA 3DLHA 1S5ZA 1VCTA 2RDDA 1S10A 1X5OA 3C6UB 4B3OA 4AL5A 2DK2A 4ECWA 5I3PA 1U2RA 3AFGA 4ID5B 4M5DA 5LXYA 2PCUA 2I5JA 5ITHA 2BJEA 3ILIA 1NK9A 2ZH6A 3SZ2A 4IKAA 2IJNA 2V68A 1ZOTA 3BM7A 3OFFA 2ZJPQ 2AYMA 2DY1A 4WZQA 4GMKA 2BDPA 3RAQA 5MAOA 4LSLA 1PCAA 4ZDNA 1SCJB 1K0TA 1QAIA 4DFMA 1E6VB 2AT1B 1EQMA 1P9YA 2UU9J 3SJFA 1H98A 4DS4A 2JDDA 3J80U 3BLNA 2V67A 2E7XA 2M3DA 2FE7A 4A30A 2VZYA 1FDDA 2YX7A 1CM0A 1NO8A 4M8LA 3TZXA 1BC6A 2HPUA 2NXEA 1VQ7S 2IJFA 1FJEB 2FHJD 4X65F 5BYRA 1EB0A 2RF2B 1QSOA 4Y00A 4ILRA 3MMCA 2H65B 4KHRA 1LV5A 2ASLA 3V4IB 1RWKB 4HNWB 4NLTA 4PSWA 1HBUA 2F9DA 4ZX9A 2HHXA 4UCPA 1KHVA 1YLXA 5F0WA 4KB7A 3D7GA 2EG2A 3EVWA 2YNCC 4JI8F 4N8NA 2X1AA 4WE1A 4Q44A 2AJ1A 4CS0B 2HZAA 4UW2A 1BY9A 3V81A 1UVIA 4G1QA 4BDPA 3OXFA 3VGVA 1X4BA 2ZPAA 4PKDB 1T9VA 4P74A 1AW0A 4ZLNA 3CCLS 4CYNA 1S1TB 3EGWB 2V63A 3IWWA 5KFEA 2LQ5A 1TL1B 1T05B 3AD9C 1T11A 2XCAA 1HDUA 2XY7A 3IMQJ 3AH6A 2HHQA 3PR5B 1KLMB 3CCSS 1HLWA 2I8EA 1HQEB 3DLBA 2V34A 2C3PA 4MBUA 1TL3A 4KS9A 1Y3JA 5H84A 2R9LA 2F63A 2NR0A 1P6TA 5CYQB 1TKZA 2GQQA 2ZW7A 5CABA 2OU2A 2HS3A 2BRKA 2MSTA 1KFDA 3RO0A 1UJ4A 1S1XA 4QWCA 3RBDA 4B3TJ 5KTAA 1L3UA 3TA0A 2DT9A 3P5TL 2XM3A 2HHPA 4AB7A 1Y4ZB 2QSFA 4O3PA 4OJHA 2UVRA 4R57A 4H6ZA 1OPZA 2YH0A 3Q8SB 1PO6A 1UWAA 1ZTWA 3VVUA 2LEBA 4AT1B 5I3QA 4B9MA 4C11A 3HUVA 3HFZB 1CEZA 3MEEA 1YVKA 1KTVA 4DV7J 2F7VA 1VIOA 1AZSA 4QW8A 2HWTA 5AE2A 1MU2A 2B7CB 2RQCA 2I1RA 4QIFA 2IAJA 2JSXA 4OKOA 2ZNZA 2N7YA 5DM7Q 3C2PA 4ES2A 3CJ0A 3THTA 3CIMA 4ED4A 3GJRB 3RR7A 3C6TA 3FQLA 4MFKA 4RW8B 3H0PA 1D0EA 3OL7A 4DR7J 3T1YF 4IG3B 4PCQA 1IWAA 5E3QA 2OPQB 2IA0A 3UVJA 3P3DA 2ACYA 4USHA 3O2IA 4G1PA 2IA6A 3D2MA 1G7CB 1XQIA 4C98A 2Q79A 1APSA 2CJKA 1FKPA 2NZ4A 3MM9B 1KVJA 2BKNA 1A0OB 2RQMA 3OTOJ 1H7WA 2Z10A 4OLLA 1NSLA 4E2AA 2XTJP 1PYTB 1BGXT 2BM1A 2W9CB 4Y3CA 4LBHA 5BWAB 2CQGA 2Z3KA 3GJTB 1Y0YA 1RAAB 4DOZA 2E5LJ 5C25A 1JMTA 2VD3A 1UPMB 2Q4ZA 1V3SA 2VIHA 3V8IA 4B3OB 4DWIA 1KWMA 2HHUA 2YNIB 1S12A 2CPIA 2YKOA 2I5JB 1HNIA 3PYDA 2QMXA 4X3RA 1YW6A 3TEGA 4M3SA 1FEEA 2QLBB 1D8YA 1RTIA 3D9BA 2C2MB 5E5NA 3RBXA 4QQBA 3RGIA 2GLJA 2HKEA 2HMIA 2XMWA 4LSLB 5L8RC 4K4WA 3D0HE 4ETZA 1XMQF 2HYIB 3W91A 1VMBA 3GR0A 1GFWB 3Q23A 2DRBA 1G2EA 4PABA 1IBLF 1HWUA 4YB5A 3JQMA 3NMAA 1N71A 4X5KA 3AJ2A 4I2PB 4N56A 4GC6A 1Y7EA 5DDOC 2LA4A 2HVHA 4QR2A 4JUZA 1KN6A 4CAEA 4ECVA 3PRVA 4YDXA 3ILLA 4MKBA 4JYAJ 2E9TA 1F0XA 2VODA 2QFJA 5AT1B 2YPZA 2CQ1A 4NXNF 4AYBD 3MMCB 2IBOA 2N3LA 4ZOSA 1YBUA 2DR9A 4CIOA 2P9GA 3DRPA 4NGRA 3MFIA 3UDLA 3CPWR 1S72S 2DB1A 2OH1A 2FY8A 4CO5A 2FDNA 4A37A 1RAIB 1NZAA 5IZHA 2J0XA 2VA3A 1GTHA 2J0WA 3JAMU 3FCVA 2GHPA 3OFGA 1FD2A 3M7VA 3V81B 3SIPB 2FZCB 4R5PB 4G1QB 5JXSA 1RWXB 4DS5A 5HSPA 1YRXA 3I56S 3JSRA 1UA1A 3SI2A 1N88A 3HMJG 1R8CA 1FESA 1LQ9A 4Q8FA 1LFWA 3KXDA 3I5AA 2DHGA 1X12A 2DF5A 4L72B 2KXFA 1WKLA 1H0HB 2HBQB 1FT7A 1UEUA 4OHYA 4MRIA 4LRBA 2J9CA 5F46A 1S6QA 2R8GA 3D6MB 4JV0A 4YP3A 3EXNA 3S9MA 4JJXA 3LUYA 4F8RA 2HQ3A 3BF4A 4ECZA 1OZPA 2VJUA 1N52B 2O53A 1IBKF 3M2UA 5KFBA 1FA0A 1WI8A 2MYFA 1YVOA 3A4TA 4ONWA 3GV5B 4XK8C 1S1XB 4Q0BA 2AYEA 3THVA 2OOTA 4UEEA 1U4BA 2B4PA 4Q2LA 4GRSA 1ZS6A 3HVAA 4DX6A 3Q0AA 3HVTA 3D6FB 4N41A 1Y0HA 3FX6A 4Y6IA 4FBTA 5EUHA 1WELA 1HW8A 4EI2A 3GQCA 3KHHA 4OX9F 4QB9A 4CO3A 1X4DA 3H4BA 3MEEB 1JXEA 2RD5C 4DR3F 1H72C 1NCLA 1U6FA 1OS5A 1MWYA 2M9KA 3VR1A 4C8YA 3K8WA 2VQEF 1BUXA 4EGLA 4B3SJ 4UFVA 1SL2A 2KG0A 5HVGA 1UWBB 1P4NA 4DYOA 2PIIA 4BC7A 4UIBA 1AROP 1HIYA 5HJYA 2C2RA 2IQ6A 3OTBA 2P6TA 2HSEB 4OYMA 3C6TB 1UPPA 2OPPA 5F3ZA 3MMBA 4F8ZA 4MIWA 5C42B 4C3KA 3C15A 4LF6F 3F0AA 3CTRA 3A8KA 3K17A 4DPYA 1QTMA 2YBVA 4CLUA 3MURP 3FBBA 4U8VA 2ZH7A 3CCZA 3JYTA 1S6OA 2F4VJ 4H2KA 3VALA 2VFSA 2MZ1A 1SH2A 2R3VA 1J5EF 5AG7A 1NJXA 5D0HA 4KY3A 2B8QA 2ADBA 2PDAA 3POTA 3G86A 1ZBTA 3MR2A 4HPSA 1U1PA 2AFXA 4L76A 1UFKA 1NKEA 2ZEMA 1S7LA 4QIEA 1RTDA 4M6GA 4ATNA 5LM7E 1KUYA 3MMJA 2OD6A 3R6LB 5KFIA 3M2VA 4LMZA 5C25B 1V3ZA 1X5PA 4HVZA 4EO8A 2DNPA 4DV1J 2OFGX 1Q8IA 2HHWA 2P9CA 5LMUF 3V38A 3CJSA 2N4CA 3FBUA 4OC0A 1Y7PA 5AG4A 1RWWB 5KFTA 3ZTSA 3GYGA 3J7Z5 4EZ9A 3DLLQ 4NI2A 3S6GA 1X4EA 4CO4A 1RADB 5IC4B 3PIOQ 2PEBA 3DMJB 1Q2CA 1I3OB 2ZZTA 1DTQA 3JSBA 1CSJA 2CQIA 2C3MA 4QWEA 4WU2A 5LSRA 1IIDA 3DC2A 1M4DA 1Z9UA 4TNOA 2WSCC 3DGPA 2J6SA 5EN1A 4M94A 2M2BA 1UW4A 3DRRA 2FJDB 2CVIA 4IR1A 4LUAA 2EBEA 1UW9A 2OO4A 3CO0P 4LFCJ 1QAJA 3P96A 2A2DA 2BJ3A 2W4PA 3PX0A 2IY5B 2EK8A 5AG5A 2KZZA 1Q2DA 1IXKA 3PP9A 1EETB 5KFHA 5AXLA 4K5RA 2BYCA 3Q8RB 4IG0A 4WWSA 1S1UA 2CNLB 1XJOA 5IM0A 1OYDA 3MHYA 3DLKA 2IJRA 1N36F 2BV3A 4O0IA 4Y0FA 1JWQA 2E5HA 3K5MA 4B3SF 6CPAA 5SZTA 4F4KA 1TELA 4LR8A 2QJ3A 3CVKA 2A10A 1NB2A 4LF5J 3MZIA 1BPNA 3M8PB 5K5MA 5DWMA 1IKYB 3ADAC 2YQ1A 4CLLA 4IUSA 2J8RA 4LIRA 3CO9A 4K4UA 3IG1B 4JP8A 4H6UA 4C8OA 2ZEOA 1H2UX 1Q95G 4O23A 2GZOA 2XG8A 2OZGA 3OPKA 1A9NB 2F8MA 1IR1A 1Q4RA 4OC2A 3W6XA 5G21A 2X1GA 1XR7A 2LLZA 4IUFA 1EIYB 4JV5J 1FJGF 3LACA 2AGQA 1S9EB 2P6FA 4O3QA 1CBXA 2VC1A 1VJQA 1WWHA 2B9XA 6FD1A 5HH1A 4QR1A 4LJMA 3GZ7A 1L3VA 4KKOA 1KUXA 1NSAA 3U1LA 4ANCA 3BJYA 1RDRA 1CJTA 3DLJA 1FE4A 2DKOB 3KG1A 4L6V3 1IYLA 4MHZA 1VR6A 3I9SA 1S49A 3JQKA 5EX3A 3B3VA 3D3SA 1YZ6A 4X4TA 3K7RA 3B8HA 1H38A 1QSSA 3G3SA 1IQZA 4Q0BB 1RT3A 4PWUA 2X7BA 1CULB 4A95A 4KFBB 2IRXA 3BQ2A 2XI2A 2J8SA 3MRUA 4KV8B 3CCQS 1TL4A 2PA3A 2BJDA 1O5JA 5JM6A 4EUVA 4KE5A 3R97A 2FHMA 4PG4A 3BSAA 1HMVA 4NEZA 2Q1LA 2XHWA 4NLDA 1TL7A 2CRLA 3K0JA 3FMCA 4AQYJ 2VL1A 4FF1A 3PKYA 2AJQA 3Q24A 2D3ZA 1LW0A 5CXTA 1YRUA 2GMHA 2E1RA 5D8HB 3BI0A 2R1IA 2OTJS 4Q2MA 4BBHA 3FQKA 4DR5F 1UVLA 2WB1D 3DR8A 2ZH5A 1TIQA 3DDNA 4IAVA 3BJ8A 1N8RT 4ZI6A 1S60A 2YWWA 3ISXA 2QA2A 4OLOA 4NGQA 2WVEA 3JTKA 4RN7A 1FKOA 5A27A 1FY7A 1LEOA 2YX1A 3QGIA 1XMOF 1KQGB 4C9DA 2DTJA 4CLTA 1PAUB 3B54A 2QYVA 1ELOA 3C15B 4Z37A 4TNUA 1HHSA 3HHDA 4O0NA 3R2DJ 2MQOA 2JX2A 4AUKA 1GX5A 4DL2A 4WWVA 1MG7A 5A8KB 1Z8XA 2I9SA 5KFDA 3AA8A 4CTAA 3JYTB 3MUVP 4UZCA 4WP3A 4I6WA 5JH9A 1RHUB 2BO9A 5CCLA 3L7PA 1CQNA 3FZ2A 3POTB 3MD3A 2OAUA 4R7MA 3FIXA 3IGNA 2RVJA 4HTJA 3DGVA 2Y1RI 2VICA 3P5BP 2BKPA 1DURA 2VFRA 1RTDB 1D1UA 1JJ4A 4OQJA 4XNHB 3M2VB 1RTHB 1RTQA 3D7HA 3TO9A 4GM5A 3QATA 1QSMA 2J6TA 2J7WA 4NE9C 1KS2A 1YR0A 5IC6B 1KZFA 3H5ZA 4JI5F 2EG1A 4OC4A 4M1KA 1XF8A 2NXNA 3LA0A 3OVAA 4Y2IA 1C2PA 2Y1JA 3VV2B 2E44A 1M5VC 1HBNB 4A8SA 1EKSA 3Q89A 4NWBA 4X66J 1I94F 3NS7B 5CQGA 4C48A 1KVIA 1DTQB 3IAS9 4A94A 4QWBA 2DNOA 3OXLA 5IWAJ 4J91A 2ZH3A 3NE8A 4ICLA 1HI1A 1IKWA 2Y9HA 3KR4A 2KN4A 2BRLA 4ZVPB 4WFXA 2AFUA 5FDLA 3FEYB 1XIXA 1JNRB 1VC5A 2FJAB 3HHLC 3F56A 2EVZA 1FXDA 3Q83A 2FD2A 3T41A 4AQYF 5A0YB 3GIKA 2J8AA 2ZOFA 3UY5A 3KHRA 5HN0A 3M30A 1VRUA 1T9TA 1BD6A 1VQ9S 5IM0B 1S7HA 5HAOA 4C4WA 1QQ9A 1S48A 5L46A 1X0FA 5AXNA 2APOA 4PXBA 2EEYA 4TU9A 3QZ7A 1S97A 3TARA 2C2NA 3Q2SC 5HBMB 1T9XA 2JFDA 4KJIA 1YJUA 1S9GA 3JS9A 4KR0B 1CPSA 4USJC 2NZCA 1FFWB 1R8HA 4MKYA 4CYUA 4MFBA 3W60A 4JI1F 4M5KA 1VOMA 4LRCA 2HNYA 2QV6A 3R7NB 3O3LA 4NXYA 1XNRF 1RAEB 2DGQA 3JAMY 4B08A 3H2VE 4OZ3A 3PJXA 1QVFR 3C16A 2XY5A 3PYEA 2MEWA 4QW9A 4IYQA 5LRKA 2WK4A 4WKRA 1A7GE 3NCRA 1RTZA 4KKOB 4HLBA 1R0AA 2ODFA 3KL9A 1T3NA 4EYHB 3RRHA 2W8LA 2XSJB 3K57A 1DTDA 3BYRA 4F0MA 3PHEA 1JLQA 2B3UA 3DSBA 4I4BA 1RCXB 5KG2A 2XI3A 3D2PA 2NPIA 2KJVA 4MCSA 4NMXA 4F9VA 1YRTA 1JLBA 3D8PA 3FBCA 5GCNA 4A8FA 3M32A 4F0HA 1EZZB 2GS8A 4DR6F 1UAWA 3R5AA 5JUMA 5J2NA 1CJUA 2Z2ZA 5JVHQ 3KOAA 2EPIA 1U1RA 3L2NA 1T3OA 3G4SS 1RWMB 4DJBA 4C2YA 1VS3A 2P2CB 1TL7B 3LANA 3R3TA 3G8QA 4FDFA 2VKRA 4OJ1A 2OZHA 1WG4A 4J5OA 3FUYA 2EFVA 4HKQA 2M4MA 2WOMA 2R8HA 3FXTA 2E9ZA 3QNWB 1IUJA 1TQLA 2CIJA 3KFWX 3QIPA 2DR7A 4CI0B 5F8IA 4YY3F 2OEKA 3M1VB 3PW2A 1X0PA 2ZW6A 4AL6A 4DMZA 4F4YA 2P6EA 4JB8B 3W3SA 2RHQB 2AHOB 4R8FA 4GO5X 2M8HA 2VFUA 3P2FA 1FCAA 2RFHA 1FKOB 4YN3B 3K5LA 4LRFA 3MCSA 4CYQA 4KT0C 2FIWA 2AEJA 3T9ZA 5H86A 1U1QA 2OLWA 4ITSA 1HKAA 2W2QP 2Y1LB 2ZHBA 2VFVA 3O6QA 1FJ7A 2ASJA 1DLOB 4EMEA 2QGFB 2NQPA 1WWZA 5IFMA 2PJAA 5ELYA 5DJBA 3QYYA 2CG4A 2FJXA 2YGWA 1TF8A 3QLHA 2X3GA 1GT8A 5HQ8A 2VC0A 2UXDF 2Y1IA 5AJ3J 2GCFA 4YHHJ 4JV2A 3FNCA 2E9RX 1NJWA 2HAFA 2K3IA 1Z1ZA 3MEGB 5D4NA 2CNMA 1RU2A 3S8SA 2CZ4A 5FD1A 4MXUA 1SXLA 4O3NA 4IQMA 3MGDA 2VG6A 3N0VA 1X4FA 1FF2A 2VBYA 5G0RA 3NNHA 2G1DA 3T1HJ 4JLYA 1U45A 2CPEA 3IM8A 3QGHA 1ZM3A 1REVB 3OJUA 3LTOA 2W7OA 1VHSA 1YIJS 2B3TB 4B9SA 3MAHA 2O4HA 3T5JA 1CJVA 1WF0A 2MKSA 2LMIA 1IOIA 2QC3A 2UUAF 5A6PA 4UOHA 3D5MA 5A28A 4MI4A 4OC5A 1ZAWA 1U24A 4ZPCA 3US5A 5F9LA 2AD9A 3VGTA 2HEKA 3TR5A 1JKHA 5L9XA 4NLPA 3CZXA 4FUUA 3MM8A 2ZW5A 2OZUA 1S3ZA 1IKWB 1N5TA 1KSPA 5HLFA 4GKKJ 3LOUA 2CADA 1HARA 4DV5J 4P73A 1UMJA 4HEA9 2ZVIA 2FY1A 4OJGA 5ISVA 3DLGB 4F67A 1S4FA 1N34J 2EBGA 2NYHA 5IB9A 2XGQA 2DY9A 4KORA 2YNFA 2VBWA 3ENQA 5GAGI 4RU9A 2VPYB 3FB3A 3MPWA 4NLGA 3CDBA 1NDCA 1B6BA 1VQMS 4MY0A 1VIXA 2GO9A 3QJJA 3HT3A 3PBEA 4GXHA 3D7SB 4S0MA 3THPA 4DSJA 2Y0MA 3H8EA 5BYQA 4A8KA 4NLOA 3MEDA 4DDFA 1R3NA 4TY8A 2R8JA 3OLAA 2Q6CA 1HBOB 1BXNA 5LSLA 1WOOA 1PILA 5HK4A 1PKUA 2B5JB 2XLKA 3QFHA 2HNYB 3MM5A 4FVMA 1U0HA 3W6SA 3NE7A 3D3CJ 3ZZPA 3LPEA 1KNZA 3I6PA 3UWTA 2CXEA 3QAEA 1SIZA 2VASA 3C16B 5SUHA 1H73A 2HVEA 4UQGA 1RBOB 3K2YA 1U8WA 4M5LA 3DHWC 2W4DA 4NSQA 3O5TB 2ZWPA 4IFYA 3KWMA 3SXLA 2ACMA 1CS4A 2MQLA 1CJKA 2LDYA 1EKRA 4AG7A 1JK9B 2UXBF 2XZDB 3PO5A 2V9WA 3MOZA 1HNVA 1YHQS 4J9KA 5HVHA 5KT7A 3PB7X 4OYWA 4LQGA 2ZELA 4WZMA 5IV4A 4DUZF 4ECYA 1YW4A 3BSOA 2L08A 1S57A 2ZEHA 1HD1A 3C26A 1MWQA 4WFNQ 3NGRA 3NOGA 3CPAA 5F8MA 1XC9A 4GKJF 3E8OA 2RUGA 4RNOA 1VHIA 3T1HF 2GV1A 2R7WA 4GVLA 3ZNUA 2PJ7A 3IC1A 1OY9A 4NCGA 2CY2A 4F02A 3QRQA 3ENWA 3CWJA 2PJ2A 1FHTA 4NRTA 4OI4A 1KOOA 2ASYA 3PYFA 3R96A 3S9NA 1RWNB 2J9AA 3M8QB 3V4MA 3QAHA 3IAM9 4NPOA 4JI0F 1JJ2R 4DEZA 3PY8A 2WOMB 2IRUA 3PM9A 2ZDPA 4DX7A 3NMRA 2I38A 1NDLA 1WI6A 3D4JA 3B35A 3W2VA 2ZEGA 4LQ6A 3AODA 4RBTA 3KDNA 1S1WA 4X64J 3NCQA 2DHAA 1QUPA 4KHMA 2KYZA 1U6BA 3VAGA 1MNEA 1WC0A 3CJ8A 1TKTA 2QECA 4MY3A 1K44A 4RLEA 3MM7A 4H4KC 1X9SA 4KOYA 4P2SA 1WC3A 4UY85 4KHPF 1I5OB 2B5GB 5D3GA 1M1DA 4Z7YA 4ZHRA 3D0GE 3PW7A 1CPXA 3AD7C 1SVDA 3AOCA 4FWUA 2O5DA 4USWA 3KUHA 3IRXB 3CJ4A 4D3HA 4C2XA 4F2SA 2C3UA 1DRZA 4XDDA 5K20B 2ZITA 4N7TA 2V8GA 3HHEA 4A8WA 3DOMB 4Q8EA 1GEHA 1B0TA 2HFZA 4KSEB 3UD3P 8RUCA 3RYLA 2B9EA 1KQSR 1WC1A 1WHVA 5G0RB 3QAUA 4B14A 3CCJS 2QLXA 4PRFA 3KK3B 1U47A 1TAQA 2RHSB 1RAFB 2W1BA 2HFUA 3GIRA 2C3YA 4DR1F 2IDLA 3GCXP 3TUZC 5ETPA 5CYMB 4PYAA 4ZP6A 1MLAA 3TNVA 2JBJA 1F3VA 3Q86A 1RO5A 2PO4A 3W9HA 1CJVB 3EZUA 3M8ZA 1Z8TA 3I0SA 3KYLA 1SC1B 2LXUA 2V94A 3KLGA 1HNZJ 1LAMA 4R6TA 2CKWA 1VBKA 3A12A 5D4LA 4NCZA 4I67A 2H5JB 4DV2F 1PJ5A 4AFFA 2LKZA 2O01C 1KQFB 1JKHB 3LF0A 3LW5C 3DOKA 2Y0BB 1Z2LA 2WVCA 4H4MA 1RHJB 1MN9A 2J9DE 2FJEB 3UCGA 3KK2B 2VQFJ 2Y3YA 3CXSA 3GSIA 2KXNB 4HNXB 1RAHB 5DLGA 4TVAB 2X3DA 2A3JA 1VQYA 1XOVA 1ZZFA 2J8NA 4FN5A 3WABA 2Z2LA 4UEFA 4CGOA 3I31A 1IBMF 1BPMA 1UFWA 3MUTP 4ZA1A 1YQHA 3IR5B 4ZVOB 2QMLA 2WW4A 3M9NB 1MJ9A 1BLLE 2DH7A 2MQQA 2ZBCA 2ZH8A 4QBJA 4USUA 2ABZA 4BWJA 4FKXA 5I42B 3GPAA 1JIHA 3MEDB 4QVTA 1KD1T 4RW9A 4TY8B 4RUBA 5AE3A 1WHXA 3ZZ0A 2J6UA 1RLCL 4W90B 4A33A 4ES1A 1RT1B 3HHLA 3OL6A 2NMTA 3TO6A 4NEXA 3BBFA 2OMOA 3BSCA 1DFDA 2FXFA 5GAHU 4DZDA 3MDFA 4ANDA 3GV8B 3UR0A 4DR2J 1K4JA 2PIYA 4ZVSB 4K4SA 3D66A 3TRGA 1T02A 2IM3A 1LCPA 2C2OB 3H4QA 3IA0A 2R7SA 2Q04A 1RWPB 5DGAA 1YREA 5B08A 3LAKA 2XSFA 1GMVA 4ZVEA 1G6BA 3ONQA 3LP0A 4KQZA 2AQ4A 2QSWA 5KOXA 2WHOA 3NS5A 2KM8B 5B7WA 3NCPA 2CPZA 3QMQA 2PIZA 2QRRA 5T7LA 2MKIA 1HDQA 4LFAF 3DRSB 3VATA 2CPDA 1U1NA 1F9EB 1N0VC 4UWJA 4DL4A 3R5DA 1WD6A 1SKUB 1PG5B 2RNEA 2HZVA 2AE6A 2Q7BA 2AJ2A 1R8BA 3MR7A 1O0PA 1S0NA 4DV6F 2KJWA 3UNGC 4F4AA 3SBMA 2CIMA 2VOOA 2N7CA 1U8SA 1Z8LA 3PEHA 2VEZA 3R9LA 1XR5A 4OYBA 2KG1A 4B9VA 3DI6A 3ZZIA 4NCGB 1TKXA 2M70A 2V6AA 3WC6A 1UZDA 3PEIA 4DV3J 2E5JA 1IVZA 3BBBA 1IN0A 1NNDA 2FJBB 5EDWA 3V6KA 5DG9A 3UO0A 3DRXA 3QBCA 4CH7A 1BQMA 4P7TA 4C6AA 3BV8A 2L3MA 4X62F 2HQDA 5T14A 1C1BB 2FVQA 1M5SA 2HVDA 3HO1A 1XNQF 4J9SA 1VLYA 3D54A 1RA7A 3D67A 1YK3A 2VQFF 2GW8A 4CLPA 3KLEB 3MCNA 1U48A 3VGUA 3IEHA 2QZ8A 3FEXB 2QT7A 4C7IA 3CGIA 2PJ4A 4C8LA 4B17A 4RBUA 2C2DA 2REEA 1YJVA 4FD4A 4MCQA 3MM7B 4ONUA 1NUEA 2AKWB 3IWXA 5ETKA 3MGJA 1XE4A 4PWDA 2V8HA 1SL1A 1QE1B 1ZM2A 3CD0A 4CO1A 5KFYA 1B70B 5KG0A 4DQQA 2C6GA 3FKBA 3WT4A 5E33A 2NPFA 4MK7A 4R76A 4RWWA 4PXEA 1UJ5A 3EM1A 1V5IB 3D3BJ 2RMLA 4O44A 4ZP8A 4C0OC 5CNPA 4JI7J 4ANEA 4C7QA 2C27A 1HR0J 3SQGB 4ZLPA 1ZAXA 1GAOA 3RB4A 1TU0B 4JZ0A 1G4CA 3CB4A 3X3UA 4WKYA 3U27A 2GMLA 4U7CA 5K8NA 5M2RA 1JLAA 2Q43A 2W2OP 2QO3A 1EARA 1BO4A 2C1EB 1O8BA 2ZH4A 4KC5A 3NWRA 3H20A 2DJWA 1U1MA 4TXSA 3TVYA 2MQNA 1Z4UA 4B11A 3FEDA 5B0CA 3R9EA 2FHKA 5GADI 4IOAQ 3Q8PB 2VKZG 2BR0A 4KTQA 4YU9A 4IR9A 2I6WA 3OR1A 2B51A 3AB2B 3T6JA 4ZCLA 3PDNA 4CLKA 2K7KA 4B5PA 4RNMA 4ED7A 4RS2A 4JWPA 2Z11A 4DQSA 3AB4B 2V5HG 1ELMP 5LYLA 3GMGA 1FJCA 2EW9A 2B0GA 1LOKA 3H8GA 3OV7A 2BW7A 2WSFC 2P9EA 3HXMA 3NA6A 2DIVA 2B4DB 2MGZB 4J9MA 3OL9A 2WONA 2NCKL 4P9SA 4TYAA 3PB4X 3KQXA 3DOKB 4ELUA 4H4MB 5DWNA 1FK9A 1QAXA 2V8PA 1SJQA 2ZDOA 3QO9A 3TZYA 2DNLA 2YNGA 2PSZA 2PE3A 4JI3J 4ZN1A 1FKAF 4LF9J 4NF1A 1VQPS 1A2ZA 4DV3F 1Z4RA 5DG7A 4NLQA 1VQNS 2ILZA 3OSPA 3MR5A 1UWYA 1F2GA 4B10A 2FHJA 4LF2A 3BH6B 2FLNA 4IFVA 4DN9A 1OJ4A 1P27B 4YRHA 1FT8A 2ZEJA 2AJFE 3BBCA 2CNKB 2DD8S 3AY0A 1HNWF 4F3QA 3CC7S 2ZM6J 4B3RF 4DR4F 1M90T 4DCPB 4R3KA 2VBXA 2ZJRQ 2QIFA 3PZJA 2B4UA 4OLPA 3JB9k 1HD0A 4P45A 3MMAB 5ETTA 1RK8A 1HHQA 1DTTA 2HGLA 2KKHA 4H4OB 3VWSA 4LREA 3KNAA 1RHMB 5IT0A 4RW7B 3HHLB 1JLGB 3SSQA 4PG7A 5F47A 4LFBF 4A8YA 3TO8A 2P6SA 1B99A 1VQ6S 2G9OA 1E6VA 2YVSA 2NXCA 2UUWA 3NG8A 1WC6A 2RQ4A 2LA6A 3OFHA 3CCWA 3G8SA 4KUAA 4BCAA 2ROPA 2RS2A 3TAPA 3ZTQA 3MM6B 3G6YA 3KKFA 3LP0B 5LMNJ 1HHTP 4ZCIA 2GLFA 2Q3PA 3HX9A 5IXUA 3I9V9 3KUGA 5KG4A 2XNQA 4CLZA 2R7RA 2RF2A 1MK4A 4M85A 4LF7J 2M5YA 3B3WA 2K2PA 4NYZA 3VVTA 2ZJQQ 3V4IA 2L48A 3HPOA 2IM2A 1RWOB 2W2PP 2PI4A 5DS0A 3V6DB 4FYVB 2G0IA 2MKCA 2NXJA 3BZQA 3QJPA 1DQ8A 2KT5A 1KUVA 2FVSA 4WXWA 2PJ3A 4KVOE 1Q8LA 5I4MA 3BPSP 2DO0A 5EMIA 4ZVGA 4LIWA 4ECXA 1RLDA 5KT2A 2JJ4D 3GCWP 3QFWA 1QSNA 3HHLD 5THWA 4ORFA 4PSXA 3QT8A 1M1HA 2OJ3A 3DRYA 8ATCB 1T03B 5D4OA 2PR8A 2Z3MA 1IY7A 4FYXB 1GMWA 4CZCA 1Q16B 1VFJA 3EZOA 4ZY2A 1S1TA 1LKZA 3H8FA 1WEZA 2N82B 2HHSA 5CHCB 2XO6A 1YK9A 4MAKA 3FJ2A 1S4EA 4RKUC 4F6AA 1TL1A 4EVYA 4I49A 5D0GA 4PYDA 4JI6F 1QTNB 3W2WB 3L7UA 1PC5A 4AD6A 3HT0A 4AL7A 5D77A 3DDDA 4ETXA 2Q44A 1HQEA 2QL9B 1NHKL 2MZTA 3D1OA 2VDIA 1JXLA 4HHHA 5K8OA 5KG6A 4GVBB 2H9ZA 2CQPA 2EVNA 1NK0A 3IGVA 3TYTA 3I96A 4Y34A 4DFKA 1F5BA 5IOLA 2VFTA 3MPVA 4USTA 3IWGA 4NA3A 2LU1A 2XMUA 3HCXA 4IHMA 2EC0A 2KT3A 2MKYA 4L73A 2EKYA 4NASA 4H54A 3ICLA 4CGPA 2ZWOA 3ZZRA 4EU0A 1OSDA 2C28A 2PT0A 4PWDB 5AXKA 2U1AA 3R5CA 5H9FK 2LDIA 3M6VA 4UCMA 3JSMB 3VCDA 4ZN3A 1U7LA 3GFYA 2JEFA 3NGDA 3EVOA 4HACB 4YEAA 3N5FA 1B64A 4ZP7A 3T5LA 2DNKA 2IPOB 2JEVA 2OSQA 5HMWA 1C0UA 2PFDA 1YQEA 4DL0C 2KI2A 4WPAA 1Z2ZA 3KLFB 7AT1B 4RX6A 2UXCJ 4H89A 3SI8A 2ZKUA 1JLAB 3BGOP 6FDRA 4H4KA 1EAYC 4LVNP 1MJBA 3BO2A 1YX2A 3G82B 3VHQA 2C6PA 1URNA 2AJ6A 1WOSA 3BI1A 1N32J 4NLWA 4CM2A 5AGEA 3ILOA 2CPJA 2LEPA 2PE8A 2HQGA 3FEZA 2DPIA 4YOEA 1X4CA 4WBFA 3WIUA 5JGFA 3AAWB 4ID8A 4P10A 3PBBA 3E3XA 2YWEA 4LQ9A 1T8EA 4XNHC 3ULHA 4IG3A 4N76A 4YWYA 5B09A 1FRMA 3KJVB 5A8RA 3VGSA 1IR2A 4L74A 2JEIA 3CXCR 1WK4A 2DNMA 2Q66A 4U6PA 1OBRA 2G1HA 4B9NA 3P2HA 4ED5A 1N33J 3MM9A 2W01A 2WONB 1N56A 5IQQA 3MOJB 4F50A 2YWGA 2P8IA 1FI4A 3N7ZA 2DXFA 2FVCA 3H98A 2UV8A 2XZWA 2W9CA 2VONA 2Z8QA 3W5YA 3BXMA 3VWEA 3FK4A 3TE4A 3QO9B 4YB6A 3KTQA 5J2PA 2YNGB 3IXQA 4Q7AA 1ARMA 4B3MF 1Q7LB 2DGOA 2I0XA 3MN8A 4KOTA 1L3SA 2KU7A 5K9FA 4HHUA 3NH5A 3D7FA 3Q2TC 3W61A 5J2QB 2VU5A 4IFVB 2YNIA 2FVPA 1NLKL 4M6IA 2WSEC 2HS4A 5M2PA 3K5OA 2JVRA 1M0SA 2AW0A 2LEAA 2EKNA 2KXHA 7FD1A 3AQOA 1AUGA 3SV4A 2XYHB 4AXVA 3DM2B 2ZBPA 5FVJA 1SQFA 1DTTB 3KZWA 4OMEA 2K3KA 1HBMB 1YI2S 3WIVA 1Q5YA 3R9GA 4WYWA 3EGNA 1CP7A 2DGTA 2PFFB 4LRAA 4LBIA 2K06A 2BE2B 1S6UA 3D6HB 3JTPA 3J81U 1XBUA 4UFXA 2JNJA 4C2MA 2D69A 2GJIA 3G8WA 2FCKA 4FXVA 3M8YA 1NK4A 3TCVA 4I2PA 1RTJB 4P4EA 1VHEA 1YJNS 5CH7B 5EHHA 3OL8A 1B7FA 1HPZB 2VZZA 3R9FA 4KYZA 2HFNA 4CM0A 5GAGU 2R98A 3SEOA 2ANPA 4LF8J 2HHHJ 4YB1P 2GC8A 3MD1A 2GIRA 2DRAA 3TUPA 5KFPA 4HDGA 2W9BB 4B9LA 2FGCA 4JV1A 3VH9A 4FZVA 1N4LA 4PWWA 4X4RA 2XO7A 4L8AA 1VQ4S 1H6KX 2PEHA 1RQ0A 4B13A 2AV5A 3MF5A 1L5UA 5J1EA 2D7SA 2QMUB 3T8WA 3PW4A 4X4OA 3H5SA 3UR3C 1VRQC 3KJNB 5LXRA 3TFYA 1AB8A 4R5PA 4R9MA 3C46A 4CAXA 3M8SA 1VQ5S 3OQ2A 4ZYQA 1Q53A 2FLOA 4TU8A 2QL5B 1N5VA 2PRBA 2WW8A 1W2BR 1U1LA 4NXMF 1LK7A 4OIWA 2R8IA 3RAXA 5A8WB 4PG6A 3U7JA 3DR6A 3N9UC 3IS9A 3GIUA 4JI4F 3QB8A 1GH8A 4ZMMA 1Q8BA 3IO1A 3EJMA 3NH8A 3PX6A 1N0UA 3G6ES 4G3IA 3E01B 3IR6B 1X5SA 2QX0A 3T9YA 1CBKA 5BR8J 3SYZA 1TR0A 2J0QD 4YR0A 2NXUA 1ZM4A 3SHPA 4F9UA 1F5AA 3ZNJ1 1W26A 4KIAA 4W98A 4MFZA 4F4XA 1GMUA 4EBDA 3V5RA 3UDCA 5GVQA 3HZGA 4UIAA 4OZ2A 4MKVA 1UVMA 4FXWA 4QBUA 5JVGQ 3FRMA 1KDNA 1K9MT 4EBCA 1U09A 3H25A 2GU2A 4CRZB 3NAIA 1TVRA 1XMBA 1GMWD 2MJNA 3GJQB 5I3UB 3QAYA 1D8ZA 3CUNA 2FL4A 1C0UB 2H48B 2R7OA 3A8EA 4MK8A 2I2YA 4FNHA 2BX6A 1D3WA 3UI3A 1SJFA 2H51B 2ZEPA 4C68A 2OD4A 2ALZA 3SCIE 4ED6A 3B4MA 2XS7A 3Q22A 4X8IA 1UWBA 2AMCB 4ILLA 3CSKA 2XEXA 2UU9F 1S7FA