3DLJA

Crystal structure of human carnosine dipeptidase 1
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
477
structure length
471
Chain Sequence
PPPALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLGQSLPIPPVILAELGSDPTKGTVCFYGHLDVQPADRGDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWISKPAITYGTRGNSYFMVEVKCRDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTKEEILMHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVIGKFSIRLVPHMNVSAVEKQVTRHLEDVFSKRNSSNKMVVSMTLGLHPWIANIDDTQYLAAKRAIRTVFGTEPDMIRDGSTIPIAKMFQEIVHVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFAAFFLEMAQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-Ala-His dipeptidase
publication title Crystal structure of human carnosine dipeptidase 1.
rcsb
source organism Homo sapiens
total genus 136
structure length 471
sequence length 477
chains with identical sequence B
ec nomenclature ec 3.4.13.20: Beta-Ala-His dipeptidase.
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dljA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3dljA01
4OC5A 3V38A 2ANPA 4F8ZA 1YW4A 2ZENA 4NGQA 2QYVA 3IJ3A 4ONWA 2AFXA 4MCQA 1YMEA 3IIBA 4OC4A 4FBEA 5ELYA 4EWTA 1CPXA 2ZOGA 3D68A 1LAMA 3RAMA 3PFEA 3KHXA 3NFZA 4P4IA 5HVFA 3GB0A 4JYWA 1ELMP 1IGBA 4OC2A 4FWUA 4A37A 1PYTB 3WC5A 3KGQA 4G1PA 1HDQA 1Z2LA 1CP6A 3L2NA 3D7FA 2POKA 4R8FA 4F9VA 2O53A 3SJFA 1HDUA 3PFOA 5CBMA 1NSAA 3PBBA 2V8DA 3NH5A 1TKHA 2AFWA 2EK9A 2PIZA 5K8NA 1R3NA 2RFHA 1LAPA 4UEFA 5LRJA 1ARLA 3BHXA 2PJ3A 6CPAA 4RUHA 1RTQA 3PB8X 2PIYA 4NGNA 3PB9X 3PEIA 3CDXA 1UWYA 3QNVA 4R6TA 4EFDA 4MMOA 4A38A 4IAVA 1JQGA 4Q7AA 5F09A 2BCOA 3WC7A 1XJOA 3D66A 4ZI6A 4R76A 2ZEGA 3NH4A 1HEEA 1ZG8A 2PRQA 2QJ8A 4DJLA 1XBUA 1F57A 4FUUA 1IY7A 5JGFA 4YWYA 3B3TA 2PJ5A 1Q7LA 4NGSA 1ARMA 3PB6X 1VHEA 3IEHA 1CPSA 4TWEA 1VHOA 4OC0A 2GREA 3PBEA 3VH9A 2CF4A 1BAVA 3D7DA 4PXBA 3S9MA 3CPAA 3FEEA 2ZOFA 4UIBA 3V7ZA 1Y0RA 2JBJA 4F9UA 2IQ6A 3KASA 4TNUA 3FMCA 2BO9A 2NYQA 2PJ6A 1BPMA 4X8IA 4IK2A 4NGTA 5LRGA 4MRIA 4MHNA 3FF3A 2WZNA 3T8WA 1DTDA 1FT7A 2XEGA 4K3NA 4OC1A 1H8LA 3BI0A 4KSIA 2WYRA 1ZG7A 2F7VA 4CPAA 3RZAA 2V8HA 2PJ0A 4WJBA 3S9LA 3I1UA 4NGRA 4NGMA 5IB9A 2V8GA 1ZLIA 1CG2A 3TC8A 2GLFA 1AMPA 3WC6A 3HLPA 1VIXA 4OP4A 2VL1A 5LRKA 4FAIA 2V8VA 2ZEPA 1F2PA 2IMOA 1FNOA 3D7HA 4P6YA 4MHPA 2GLJA 2BOAA 4OIWA 1TF9A 1TXRA 3K2KA 3D67A 2G9DA 1LOKA 5DS0A 4B6ZA 5JH9A 1Y7EA 3ISZA 2ZEMA 3SI2A 4OIDA 2PJ4A 3KL9A 4A94A 3B3SA 4H2KA 4PXEA 3FECA 1CP7A 4NFRA 2AFSA 2ZEDA 3LMSA 4DUKA 4P4EA 2PVWA 1XRYA 2O4HA 2PE3A 2Q51A 4UEEA 4JZ0A 1R43A 3B2YA 7CPAA 3SJGA 2NSMA 1Z8LA 5J1QA 3DLJA 4LQGA 4P45A 2ZELA 3H8EA 1BLLE 1CX8A 5LYLA 1ZG9A 4MCPA 4ZY2A 2DEAA 4P4DA 2PJ2A 4GM5A 3IFEA 2IJZA 2CIJA 3FVLA 1ZLHA 2JEWA 3SI0A 4ZX8A 1QQ9A 2XEJA 3B3VA 4X2TA 1YW6A 3VARA 4NJRA 4UEZA 1AYEA 2CTBA 4X3RA 4W9YA 2HC9A 5HVGA 5I4MA 5THWA 3PB7X 1LFWA 2AFZA 3N5FA 2ZEOA 3MN8A 3B3WA 3FH4A 2C6PA 2XEIA 3MRUA 1M4LA 3HUVA 2GU2A 2OR4A 3FJUA 4PPZA 1TKFA 3DGVA 1Y0YA 2PJ8A 3GLJA 1BPNA 3NA6A 2AFOA 3ISXA 4EMEA 3KR5A 5K8MA 4MHZA 2PJ7A 3CPXA 5K8PA 4MCSA 4R7MA 4ZY1A 5D8NA 4OC3A 4MXUA 1ELLP 1Z5RA 3B7IA 2HB6A 4YU9A 1GYTA 2XEFA 5HXDA 4MHYA 4NJQA 4PXCA 3BXMA 3KHZA 3RBUA 2ABZA 3PRTA 4BD9A 2C6CA 2AFMA 2ZEFA 3KZWA 1LANA 1OBRA 4OKOA 2FVGA 5LYFA 3B3CA 3GUXA 3NH8A 4ZX9A 1XMBA 1YLOA 4UIAA 4P4FA 5HVHA 3PB4X 3SJXA 2C6GA 4ZYQA 1YSJA 1QMUA 4Z65A 4PQAA 4O23A 1XFOA 5D29A 3FX6A 2PJ1A 3JRUA 2I3CA 2EWBA 3WABA 2OOTA 1VGYA 2PJAA 4NGPA 3H8FA 2PJ9A 3CT9A 3IO1A 3H8GA 3LWUA 1CBXA 3SJEA 4MCRA 2Q4ZA 2ZEHA 2EK8A 3D7GA 3K9TA 5LYIA 4ZY0A 3KR4A 5CPAA 3BI1A 5JM6A 5K8OA 4UF4A 3FEDA 4DYOA 2AFUA 5LYDA 4P44A 2C1CA 4PXDA 4WWVA 2F8HA 1EE3P 1F2OA 2JBKA 2PJCA 3D4UA 3SI1A 3VATA 2ZEEA 3KQXA 2J9AA 4A39A 4P10A 3KQZA 1TF8A 2QVPA 3TX8A 4AXVA 4OMEA 3WT4A 4P4BA 4IHMA 2PCUA 3B35A 1KWMA 2V77A 2CTCA 3S9NA 2Q43A 3IWWA 1DE4C 3KI9A 1TKJA 1LCPA 4P4JA 2PJBA 3IC1A 2RB7A 1PCAA 8CPAA 2PVVA
chains in the Genus database with same CATH superfamily
4CAEA 2OMOA 4O3PA 4C0OC 4HPSA 2QYVA 2BRKA 2DF5A 2DY1A 1M5SA 4FBEA 1VQ4S 2CQ0A 4MTPA 3PFEA 3GG0A 3UDLA 2AWZA 3CNQP 2JC0A 1IGBA 4K59A 4I6YA 1ZBTA 5HMNA 2V2QA 4G65A 1P27B 3DRYA 3S6KA 2FJXA 2PFFB 3S6GA 2JLEA 2BJEA 2AYBA 1QAYA 1TAQA 2WVEA 3VAKA 4QBUA 5CZXA 4JYAJ 3DMJB 4LF9J 2GE3A 2QSFA 1HR0F 1YLXA 4USIA 2JZ5A 1U7LA 4K4VA 5IV0A 4N41A 2O66A 1OYEA 2GQ2A 3KK2A 4F02A 4B9SA 4JI1F 4A8FA 5BR8J 4R3KA 2YWEA 3B82A 3W9JA 5KFZA 4ZI6A 1NK4A 2VA3A 3UCZP 1WHWA 5I0CA 1SQHA 4ZCKA 3I5BA 2CJAA 2D3UA 3BPDA 3NE7A 3IEHA 2B3TB 2DXDA 3IR7B 3VH9A 3G71S 1XNRJ 2CF4A 1H72C 3OSPA 1DY3A 3S9MA 4U7UK 3AXMA 3FEEA 4A47A 1UEUA 5L46A 1Q82T 4KJIA 3GR0A 3OR2A 5ITHA 1N5QA 1F0XA 1BPMA 3C19A 2KHCA 1PBUA 4DL5A 2HVIA 4UY8T 2B4DB 4M5IA 3J81j 5ETRA 1HI8A 4FNHA 3QBCA 5DQIA 1MN7A 3N0VA 3H7HB 3VCDA 2GIVA 3IWEA 4B02A 4CWBA 4PSXA 1VJQA 1HD1A 2EVNA 1IKYA 2CKWA 1Y7PA 4PZVA 5J2QB 3NMRA 2BE9B 2FJDB 3R96A 3W1YC 3P49B 2Z30B 5KFGA 5GMEA 4B3MJ 2MLXA 1T9YA 3HX9A 3M2RB 4XDCA 2VG6A 3S6HA 5CYMB 4TU8A 2YNCA 3L7PA 1LWCA 1Y7EA 1R57A 3B4MA 3KHHA 4B9UA 4LF2A 3VWSA 4RU2A 1U49A 2VONA 2FLNA 5DM6Q 4NPOA 2RQMA 5I42A 3UO0A 3CPWR 3GYXB 3NCPA 3TUZC 2C3MA 4XPKA 3CJ0A 3EGWB 4KOSA 2HQFA 3PRDA 3NNCA 1WDDA 2X1GA 4QIWD 2IJZA 2VA2A 3PW7A 2IAJA 1LNQA 2XSJA 4WU3A 1X5SA 4PR6A 4ZX8A 2ACYA 4WZMA 2XEJA 1NXIA 2B5JB 3GQCA 3OTOF 3RYLA 5SUHA 4QJVA 2J6SA 2G0IA 5KTAA 1Z4EA 1N0VC 5KFBA 1RTJB 2XMAA 5IT9U 4NEYA 4OYBA 4GC7A 1KRPA 2CNOB 4L73A 1SQGA 1QSRA 4RW9A 2PO4A 4G1QA 3IRXB 2HVEA 2DNOA 2YX4A 2CJBA 3FJUA 4GKJF 3DGVA 1AUGA 3T1YJ 3EGNA 4HTIA 5K8MA 4MY0A 1ZZFA 2DCLA 1OPIA 5B0CA 4ZITA 3T9NA 1XEBA 3KNGA 4MCSA 2NREA 1JWQA 2FHJA 2NYHA 1CQNA 1S77D 2GIFA 4O44B 2HQGA 4J3GA 2PT0A 1GMWD 1UVLA 1X12A 4NJQA 3R1LA 3D6HB 3SYZA 2K1RB 1OSCA 4BD9A 2DH8A 1T9TA 1X4CA 2G1DA 1ZM9A 4DR1J 4NRTA 5ETLA 2FUG9 4ZX9A 1AW0A 1C4CA 4ZHRB 2WTFA 1KC8T 4EBEA 4ZVPB 4P52A 3M8SA 1WC6A 3ISND 2KFYA 3O2IA 2QRRA 2D4OA 2NR0A 2UZAA 5HO4A 3D2WA 4YUDA 3QWUA 5E0OA 1LKZA 4DV0J 1NJYA 4A95A 3IS9A 1YHQS 5KT4A 4KO0A 3HD2A 4NYPA 3KG4A 5EMIA 4KTQA 3RB4A 3RB3A 4Q45A 3ADAC 1N48A 3IAS9 4UF4A 4NCGB 1E6YA 4F2RA 1FWPA 2C1CA 1RAEB 2F8HA 3IU1A 3UD4P 4OLLA 1GH8A 3NS5A 5B0AA 1U2CA 4ELVA 2XMUA 2GS8A 1WEYA 2A2CA 3FZ2A 2AEFA 1KWMA 3R7NB 3MF5A 1CBKA 2MY8A 4RN7A 2KRRA 1NEEA 1Q8LA 1U47A 2XO7A 1UW9A 2KTQA 4FD7A 2G3TA 2LXFA 4TXSA 2BJ9A 1S9GA 3POTB 2BE2A 2LCWA 3KLIB 4NXYA 4YRHA 5H86A 2QSWA 2ZENA 5M2RA 2CPFA 1YJ9S 3IJ3A 2A4NA 2IYGA 2Y8WA 3GE9A 3EY5A 4DQPA 1C0UB 5A0YB 2C2MB 4OZLA 5F8GA 1HBOB 3IWXA 2J0WA 1M1GA 4B3OB 1S5KA 1PYTB 1HWLA 2CAJA 3KGQA 4XPDC 3OJUA 4RR5A 2O53A 1SJ1A 2Y3YA 1NPKA 3GP9A 2M88A 2YQ3A 3CB4A 2FVQA 1YK3A 1H2VZ 4DV6J 1ARLA 1UFHA 3C14A 1P6TA 4NLGA 2G3AA 4IRDA 2HRTA 2OTLS 3PEIA 5F9LA 4R6TA 2MGZB 2AKWB 4IFYA 5LXRA 3TZZA 4FBTA 1SUQB 3WC7A 2CQBA 1UKUA 2CXAA 5FIIA 4WFXA 1RWWB 4DJLA 3OHBA 3OXLA 4NE9C 4X65F 5IM0B 4RNMA 1VHEA 1VBZA 4YY3J 4Y65A 1W2BR 1IN0A 2NUUG 2BMBA 3RNZA 5F3TA 1DTTA 4GKKF 3QLHA 1BHNA 2DRBA 4TNOA 3VVTA 3PIPQ 4F9UA 4KOTA 1CC8A 2IA6A 1O5JA 3M9NB 4DWIA 5D0EA 2C3YA 3BB5A 2LMIA 4O3SA 4JOUA 4NGTA 2Y1JA 3H4DA 4K3NA 1WKJA 7AT1B 4UCMA 4KOYA 2YY3A 3MFIA 2ADCA 4IUSA 3NG8A 1N33J 1U4BA 2YNFB 2VOPA 3DYAA 4X4OA 3K9UA 4KBIA 2X3DA 1NCLA 4NGMA 2V8GA 5DLGA 1I21A 2VIHA 2ZBQA 5J2MB 1VQSA 2V8VA 4A31A 4JI4J 3MEGA 3PYDA 2UVRA 1WF1A 1IKVA 3OTDA 4OIWA 1T9WA 5A8RB 2HBRB 1JJ4A 1WHVA 4JI3F 4KSEB 1OY8A 4DFPA 2WAQD 4F3MA 3K8VA 1U1PA 1S99A 3UVJB 1RTHA 4ZKAA 1M0SA 3FBFA 3A8IA 5H84A 4O3QA 5C82A 3LANA 2QIFA 2J76E 3ILJA 4IG0A 1RT3A 2J8RA 3SBMA 3ZTQA 5LJ3Y 4K0KF 2Q4YA 1E6VA 2WVDA 2QL7B 3CCZA 3FK4A 3I5CA 1BLLE 4U9YA 1XMOJ 3OTBA 4ZY2A 4GO5X 2RKIA 1QSYA 3ZTRA 2HEKA 3J81U 3SXLA 1QQ9A 2CPEA 4R57A 2RS2A 2Y0MA 1N32F 3HI9A 5KFDA 5JPHA 4EVYA 3GY9A 2EFPA 5KFPA 1S7NA 4AL7A 4U67Q 2HHVA 4FVCA 2PSWA 4NA1A 4NEZA 1KTQA 3HVTA 5E33A 1S1WA 3OHAA 1IKWB 2Z0ZA 3T1AA 2IVYA 2ALZA 4NXMF 1FF2A 2XHCA 4PQUA 4ED4A 3RBXA 4DL0C 4WIQA 4R7MA 5CHCB 3TVKA 4MXUA 2VBQA 1D9FA 2BJDA 3ICLA 1L5UA 3HSDA 2YPZA 1R8PA 2ZEJA 3S7RA 3NWRA 1JKHA 3KHLA 2KKHA 1GEHA 3TANA 2HNZA 3SEOA 2MHNA 3MMAA 1LANA 4PK2A 3AQPA 2JWNA 2IRUA 2E1CA 1CPZA 3IBFB 1EHWA 1WOOA 4OJHA 4FF3A 1Y5LB 5B0EA 4PWDA 4KYZA 1FT8A 5HVHA 1VQLS 2CQ2A 2UUAJ 1H0HB 4J7CA 5CAAA 4UFVA 1FY7A 2QGFB 3JRUA 4HI1A 4JI8F 3M8QA 1IBKF 2C27A 2YNGA 2DT9A 2HVZA 3RW7A 4X62J 2RU3A 3SJEA 2IJNA 4QR2A 4IDKA 5K8OA 4UQGA 1FTCA 1KONA 4ANCA 2V4JA 2HLUA 1ROFA 3PCOB 1S7KA 1O0PA 1Q8KA 5KFKA 4RU9A 1RCOB 4DV3F 2E66A 1Y0HA 4TN2A 2HVDA 3QAEA 3KLGA 2AT1B 2FHOB 8CPAA 4EO8A 2PVVA 3V4IB 4CGOA 4KUBA 1IIDA 4CYUA 1IR2A 1V3SA 2WPWA 3ILLA 3ZNJ1 3BR9A 3A4TA 4NZ7A 3HO1A 2FHJD 2A3JA 1S1UA 1LK7A 3RAMA 3NFZA 5HSPA 3OR1B 4KQZA 3R5DA 3SSQA 2N82B 4P73A 3SQGA 4C48A 5F41A 3PO4A 2JDJA 3WC5A 4LF6J 4D3GA 4KOUA 3JSRA 2GVZB 1YQHA 1TL3A 1BQXA 2DNLA 3EDQB 3SJFA 4JV5J 4XNHB 3QB8A 4ZBGA 4M5DB 1Q78A 2V9WA 2I2YA 3MXHP 1D3WA 4FYWB 5HP1B 4CRZB 4YR0A 2PIIA 1NPPA 1LW2A 1YGYA 3UN2A 2W9BB 2B9YA 1TK5A 3LA0A 4Q7AA 3ILOA 2ZW5A 4DPWA 4PABA 5D0HA 3I0SA 1B6BA 2ZEGA 1ICEB 2QJ8A 4OX6A 3A8KA 3CCJS 1S9FA 2RVJA 3SQOP 3CD7A 3D1QA 2IBKA 4DSIA 3UDCA 1PG5B 3IRWP 3H25A 3LUYA 1PSDA 5IS2A 4J9LA 4TVAB 1KUXA 1X5OA 2VODA 3FJ2A 1FRIA 4C11A 4QOTA 1UW4A 2FL4A 5IOLA 1X9MA 4TNUA 2Y8YA 1SCJB 3CEDA 4MK8A 1QD1A 2HFZA 4YR2A 3H8YA 1PJ7A 3PHEA 2DO4A 2VEZA 4DR6J 1FK9B 2VZZA 3DOMB 1ZG7A 2LVWA 3VHQA 4K2XA 3MEDA 4NGRA 1JJHA 1VQNS 2ILYA 3D3SA 3OW2R 3VQSA 3ITHB 3Q8RB 4OX9F 2GV1A 2U2FA 2Z3KA 6FDRA 2HIQA 1IBLF 4X66J 2L48A 2P9GA 3JSMA 4X4SA 2PJ4A 5CNPA 1K4JA 5KG4A 4F04B 4A94A 5M2PA 1R8CA 4DV7J 3FCVA 2DIUA 4H4MA 1NB2A 4OHWA 1L3TA 4JI6J 1VRQC 3BQ2A 1RE1B 4I49A 5KFMA 1C1CA 4DL4A 5JJBA 3IWGA 2PEHA 4R0EA 2FZCB 1S7LA 4ZMMA 2YH1A 4NL5A 2BQ3A 3MUVP 2OH2A 5J1QA 4I0WA 3GCWP 3CIZA 2AEJA 2BQUA 1ZG9A 2P9CA 1F2HA 2VQEF 2J0SD 2E1PA 1RT7A 1FNMA 3J81Y 1S48A 3PW2A 3CVKA 2WB4A 3MPDA 1HPZA 2ZC4A 2XY5A 3V6JA 1RT2B 3MURP 3CCES 5E3PA 2DY9A 2HC9A 4QZVB 2DGVA 4C3KA 1RWPB 3N4WA 2VDHA 1NK8A 4PAAA 3QO9B 2C2RA 4ED2A 2OZUA 1HA1A 1RA6A 1KVKA 3ILIA 3R9GA 4KS9A 4GC6A 1PAEX 2KHDA 3O1LA 4OHXA 3LP1B 2CPYA 3GFHA 4AD6A 1RSCA 2FY8A 4ID5B 3IG1A 1P0HA 4X64J 1Q5VA 2Q79A 3CC2S 4DZDA 1UVMA 3D7SB 5LJ5Y 4LUBA 4NLWA 4CLFA 1T02A 4MT1A 2HZAA 3DDIA 3PNIA 4CO5A 2PDAA 2RRBA 2ZJPQ 2HQIA 3ELHA 2NSBA 2JSXA 4CH1A 3MAHA 1KFSA 2LDIA 5C42A 4FYXB 4USMA 1SL0A 1CM0A 4JI5J 4F26A 4ZYQA 1HLWA 3CWJA 3N6LA 3HULA 4I6WA 1X9SA 3A1YG 1SKSA 5D29A 1GNKA 2MKKA 2B58A 4NLVA 4ECVA 2DRAA 3H40A 2RDDA 2EWBA 5DO2A 2NQPA 4ED3A 3RB6A 2HMIB 1VBKA 2WOMA 1LWEB 2H9ZA 1RWXB 1N71A 5EBVA 4KGKA 3AA8A 5F46A 1N6QB 2C3PA 3KUGA 4LF7J 1X4AA 4DQRA 5LYDA 3BYRA 4KE5A 2KM8C 2FPHX 1CQMA 1H98A 2AZ3A 1CJTB 2OAUA 3TZYA 4B17A 1A2ZA 2DPIA 2QVPA 4HL9A 4B3RF 3JS9A 1FKPA 5HROA 2UV8A 1TKDA 2V77A 5KFOA 3QT8A 5F8JA 3H2UB 4NLYA 1QM9A 2DNNA 2MKJA 1YJUA 4B10A 2VFVA 2D3O1 1K1QA 3DRSB 1JLAA 3P45B 2LEBA 3WBZA 1HQ2A 5HH1A 4CP5A 3BGOP 1NH7A 4WE1A 1VRTA 4Y49B 5DRKA 5J2PA 2JEIA 1RB0A 1CPXA 2VBWA 4FBUA 5LM7E 4NI2A 4NXNJ 1F5CA 2R7QA 1GTHA 2ZH6A 1FJCA 1ELMP 4KORA 2HS3A 3WC2A 3HFKA 1DLOB 3NXZA 2Q1LA 1JXVA 4LF8F 3DMJA 3SI8A 1HBNA 3JAMU 2HHHJ 4B5PB 5F49A 1Q81T 5HMXA 1KDNA 2ZW6A 4F4WA 3G8QA 3GFYA 2C42A 1IJEB 3BREA 1WC1A 4WFZA 3HD1A 4X4PA 2XMTA 4OI2A 3G4SS 3TOAA 3CMES 5E3CA 2JEGA 2VFTA 2ZKTA 1OQ3A 2OPQA 2CIMA 2ZH9A 2DR8A 3SFUA 2DH7A 3DGPA 5A6PA 5LL6d 2BCOA 4L8AA 2KJVA 1B0VA 1ZH5A 4CNYA 2OELA 4NCAA 4LQ9A 1VQ9S 4V1Ak 1ULRA 3ZTPA 4M6GA 4C7QA 3R9FA 1WHYA 2PJ5A 4B3SF 3CMQA 1QAIA 4BBHA 3TFYA 1P1LA 3EC4A 4CTAB 4FXVA 3NS7B 1HR0J 4O4GA 1M1HA 5C25B 1S4EA 3EVMA 2WSFC 1MMDA 4QUSA 4R25A 2OSQA 2ROEA 2DR5A 3JQMA 2EEYA 4JI1J 4ECYA 1Y10A 4A8OA 1BGXT 3RYOA 4AVCA 2XEGA 2UUBJ 5KTCA 3NAHA 3SCKE 1KQSR 3W7BA 1NK6A 1KNZA 2WYRA 1MMNA 3TAMA 4EMDA 3MR7A 4Q0BA 3RZAA 1MROB 3DLEA 5K14B 4C8OA 1ZAXA 5IB9A 3FFIB 2FHMA 4XK8C 1L3VA 4OI3A 5DG7A 1R27B 1IB1E 4B08A 1FDAA 1ZTWA 4R9MA 3DLGA 4KKOB 2AJ1A 5CYMA 2BQRA 2AIRB 4HT7A 5HMWA 4FPRA 1JLCB 4AYBD 4OX8A 3D9BA 1TXRA 4IG3A 3IN5A 4DSJA 2HGNA 2F8MA 1VISA 2E29A 3R6GB 2HHSA 3O5TB 3AAWB 2XI3A 1C1BA 2B4BA 3KXDA 4NLSA 1KLMB 5HLFB 4CLWA 5L9NA 5AJ3J 2UU9J 2EFOA 3C6TA 5LSOA 3MM9B 3K7RA 1H7WA 3QWPA 5IV4A 7CPAA 4I68A 1PIEA 1PU9A 1AZSA 1WUUA 2Z3MA 4ZCIA 4C7IA 3PP9A 1KLNA 4DNCA 3M8PB 4MIAA 2E7WA 3K5OA 4ZP7A 1H38A 3SDEB 3FDSA 2UXBJ 1JLEA 2BX6A 4HHHA 1RTJA 4WK3A 1CJVA 4QBJA 1DFDA 3VARA 2XCAA 4CNZA 5D0RA 2Z4PA 1I5OB 4HT5A 4UT4A 1SC1B 1ZAVA 1JLFA 2WW4A 1FE0A 4JYAF 4LF9F 2GFQA 1BLUA 2PJ8A 3BBCA 1RTDB 3H20A 1VK3A 1Y7RA 2EFVA 4RBTA 1C4AA 2QC3A 5IFMA 1XR6A 1ON0A 4ZY1A 3O44A 2EG1A 4II9A 2QLJB 3NGSA 2UVUA 1K44A 2E9TA 4L72B 5BR8F 1KP6A 1KD1T 3PYGA 4PG5A 3TO9A 1CJWA 2ABZA 2UUTA 1U02A 5EWEA 4J90A 4AVAA 4H89A 4ZHRA 1UETA 1OBRA 4FKXA 4BHQA 3QJPA 4F0YA 4L6V3 2OEKA 3G6YA 5DDOC 1J5OA 4L74A 4FF1A 4X2BA 4P4FA 2AGQA 1GMVA 2BEFA 5KT2A 1FVSA 1XNRF 3THPA 3L3CA 4CLYA 4LSNA 3BN4A 3J7AN 2R8JA 4ITSA 1BO4A 4NCGA 3A3OB 3PRVA 3GYGA 5D8HB 2W9CA 2GMHA 2Z3NA 2UXDJ 4E8UA 5K20B 4FDFA 3ZZRA 3EWGA 2AFUA 5AE3A 3IU2A 4KSAA 2CQ4A 4J9QA 1YDLA 2EXUA 4DV4J 1S0MA 1F9FA 4OMEA 3WT4A 2E44A 3IWNC 1S1TB 4ZPCA 5AXKA 3B8HA 3KLIA 2R8VA 1DE4C 3DHXA 2EUIA 3JXOA 4RNNA 1TKJA 1BC6A 2PJBA 3L4BC 3B54A 2PR8A 4B3MF 5HJYA 1EARA 2J7UA 2KXFA 3W61A 4IO9Q 4ZVRB 4F8ZA 1YW4A 4DV1J 1YJTA 4B9LA 1B70B 1U2FA 2JFKA 2RJZA 5KFQA 4MI4A 1VQOS 3H42A 3CCVS 4LSLA 4UFWA 4V19J 4A37A 2Y0SD 1LOUA 4LR8A 2OZGA 2HK2A 3RB0A 3QJJA 3TO6A 3IAM9 2ARHA 2C2DA 3JAMY 3CSKA 1UJ5A 3EZ5A 2AJ0A 1HDUA 1YRTA 4S0MA 1JLQA 2PA8D 5GAHI 2CDQA 4E2AA 1IKYB 5RUBA 1M4GA 1R3NA 1S1VA 2HFUA 1LAPA 1NMTA 1RT6A 4RX6A 3MAQA 3MMCA 1YJ7A 2JDCA 3RBEA 5ETMA 3V6KA 2VG6B 5IX3A 4TY8B 5BYQA 1XERA 1LWCB 4ZP9A 3AH6A 2D9OA 5F09A 3D66A 2DNYA 2AYMA 1UA1A 2FGCA 5KFEA 2D41A 1IBCB 4QWEA 2JLGA 1RWKB 5I42B 4I2PA 4F4ZA 1IBMF 4ZVEA 3FSYA 3CMAS 4D3HA 3GILA 1NDKA 2LQ8A 3C8YA 3CZXA 3T1YF 1BAVA 2GZOA 1DJ0A 2MKSA 4OZNA 2YKPA 2JBJA 1VMBA 3ZZYA 3FRMA 2LU2A 2IAJB 1G3OA 2XSJB 5DQGA 3OTCA 3IM9A 3K8WA 1OS5A 4NSQA 3LP2B 4WTOB 4MIWA 4USHA 1WDTA 2KH9A 2DPTA 1X31C 4UUWA 4GVBA 3T6BA 2G0BA 4IFVA 2HIYA 4DR1F 3PY8A 3ET6B 2RU9A 5HJXA 1RTIA 3ZXWA 1JLGB 3NWGA 1QSSA 4LRAA 3ENQA 4G1QB 2B3VA 3TC8A 1FRLA 2EI5A 2QG9B 2ZHOA 5F0UA 4ZLPA 2RT3A 1M5PC 2QLBB 4AB7A 2LP4A 4DV0F 2BW7A 3D7HA 4ZGYB 4KZTA 1IWGA 3UVJA 3N9UC 5IV3A 1MJAA 1D9DA 3R7SB 1U26A 1HBUA 2MZRA 4DX6A 3KL9A 3EDRB 2EBJA 3EGVA 1U48A 4MFBB 3OUYA 4NFRA 4B9VA 4P4EA 4O4RA 2PVWA 2VG7A 2IM2A 1H73A 2DR9A 1S0VA 5DQHA 3BSOA 4KV8A 2P2CB 3CXSA 1Z8LA 2EG2A 2VZ9A 3LTOA 3D2PA 2DIVA 2IA0A 4V19X 4MFPA 5KFXA 3GIJA 1NK5A 2GO9A 3BSAA 3BV8A 3KDOA 5JUMA 3IS9B 1IU8A 4KO0B 3JQKA 3OFGA 2B4UA 2M9KA 4F8RA 3S1TA 2Y9HA 4MIBA 1LXJA 1YW6A 3MOJB 4OHZA 2W4CA 4ER8A 1AYEA 3AOBA 3U1LA 1HYSA 2R42A 2E5JA 1H3DA 2AEMA 1IKWA 5GAGU 4K0KJ 3LWLA 4E0AA 4A8QA 3FH4A 3OVSA 5ETVA 4ES2A 3T19A 4WP3A 2OR4A 4PPZA 3UN5A 3DOKB 4DV6F 1S9GB 2J6TA 2BE2B 1DBDA 3BKFA 2X1BA 2KT5A 9RUBA 4JI2J 1G1XA 4HNXB 4QYRA 2HHTA 4OJ1A 4P2SA 4YU9A 4F3QA 4Q8EA 3H0PA 4K30A 8AT1B 4UZBA 4N77A 4RO0A 5L9XA 2K5TA 3GUXA 2VU5A 3R27A 3NH8A 3HCXA 2OEMA 5KFYA 3B78A 2ZH2A 1N4LA 1KQGB 2OH1A 4YY3F 4TLRA 1U6MA 4LR9A 1RYSA 4U95A 1HWIA 2CXEA 2KZZA 4Z65A 4YB1P 4ECUA 5DS7A 3CJ2A 3C14B 4F50A 4CLSA 4YFUA 1MSWD 4OAEA 2RQ4A 5EHHA 4MBUA 3TRGA 4C8LA 3QIPA 2KZMA 4H4OA 3K9TA 5LYIA 4IFYB 5CPAA 4Y2MA 4Y2IA 5T7LA 4CDIA 1DRZA 1FNXH 1EIYB 1N33F 2K8GA 4YB6A 4X5KA 1QTMA 3SI1A 2YNHA 2YWHA 4QU7A 1RADB 2MKHA 1M44A 5GAHU 1FFSB 2XCPA 4IHMA 4W90B 1L3SA 1B64A 4IH7A 2DHSA 3V4IA 4HVZA 4WTYA 1S49A 4JI4F 2ASJA 2OLWA 2VBXA 4U8YA 1DTTB 3QLHB 2OFGX 4LRCA 2V68A 7FD1A 1ZYQA 3MAAA 2E1MC 3BZQA 2HHUA 4C7HA 4EBCA 2EBGA 2UV8G 3GIKA 2EO8A 4LVNP 1LAMA 2AYEA 5B0FA 2NSCA 1Z8TA 3UE2A 1S6UA 3AD9C 5CZVA 3QFHA 4DF4A 1S0OA 4CYPA 4CT9A 3QYYA 4C97A 3FEZA 3DYAB 2KXHA 1FFWB 2RAQA 3R97A 4M5DA 2POKA 4B13A 4IKAA 3C46A 2WK4A 3UD5A 2MQOA 3X1LB 2V8DA 1NZAA 1XMOF 3E3XA 3EE3A 3I5AA 1TKHA 2RDJA 3Q22A 5K8NA 2VOOA 4C68A 2W9BA 2C2KB 3MEGB 4LBIA 1IKVB 2HS4A 2ZH1A 3QNVA 4PWWA 1JQGA 2M3DA 1G4CA 1RTHB 3M32A 3EJMA 2A0FB 2BA9A 2DPSA 4Z37A 3WR7A 1X10A 3HFZB 2CYYA 4FUUA 2XMWA 1IY7A 4IG0B 1V5VA 3W6XA 3GJTB 1RT3B 2QMXA 1ARMA 3RBDA 1SJ4P 5J1EB 1EKRA 2CFXA 2OPRB 4M1KA 3UCUP 1YZ7A 2OD6A 4HTJA 2RKIB 4UIBA 4R0JA 4A4JA 2F9DA 4DR3F 3G87A 2P5VA 2VBYA 3PW0A 4IK2A 3GV5B 3QAUA 3OT9A 2A6OA 2M7SA 1YWXA 3TR5A 4MHNA 4UFXA 1ZM2A 3PV8A 3EICA 1MLAA 1Q53A 1CJKB 2P6SA 2ZC3A 2ZJQQ 1JNRB 2JVOA 2XHWA 3BO3A 3ITHA 1U8WA 4HHJA 5I3UB 3G82A 3JSBA 3IGNA 2UUAF 2Z2MA 1GXUA 5KG5A 3DKDA 4JV1A 4PQUB 4DPXA 4JD6A 3TUPA 4X62F 5DS0A 3W3SA 1LK5A 1TMMA 2RHSB 3EPGA 5KFVA 2V67A 4DUYJ 2F5GA 4DJBA 2ZEMA 4OIDA 4JWPA 2QTWA 2CA9A 1JKHB 2FZKB 1XR7A 3D6TB 2R2SA 1SC6A 2PE3A 3MPVA 4YR3A 3LW5C 4PWDB 2MQNA 3MPWA 2O67A 4QIVA 4ED5A 1Y11A 1R0AA 5B0DA 2FLOA 1RT1A 3DNCA 1M5VC 1T8EA 2W2OP 2F3JA 1P8GA 2YNGB 4EGLA 4KHPJ 3RRKA 1KEKA 1KVJA 4TKTA 3MCSA 1SV5A 4MH8A 2XNQA 1SJFA 3DC2A 1QLNA 4HYKA 1AFIA 1DQAA 3FBBA 2ATLA 3UD3P 2CNTA 2V4JB 4RW4A 4W9YA 1IR1A 2ODFA 4LF6F 2J8SA 6AT1B 1KOOA 1MWQA 3LP0A 3EXYA 1TIQA 2DNGA 2HZCA 2HAFA 1RHRB 4WBFA 4JV5F 1VCTA 3TVZA 3GFXA 1FDDA 4ZS6A 2ZE2B 3MCMA 2E9RX 1GQEA 1W25A 3DCAA 3K5PA 2F1FA 1UJ4A 4FYVB 3KLGB 2FDNA 1FJEB 3H5SA 4CYUB 1EP4A 2FTRA 4CLUA 5T14A 3HVWA 1D9AA 4XPLA 1Z5RA 4DCOB 1GYTA 1TKZA 5HXDA 3FUYA 3CCRS 1F9HA 3IGRA 4BC9A 3RBUA 2WVBA 1FRMA 2VJVA 3SQGB 2W7OA 1FTRA 3FIXA 2VFUA 9ATCB 3RR7A 1NB7A 2XWXA 3BBFA 5D4OA 3K5NA 1TL3B 3TO8A 3KK1B 3M6XA 1RAFB 4M94A 2XZWA 4P7VA 2RC4A 1TFWA 2MQ8A 3WDOA 1U25A 5IC6B 4O23A 4IF5A 4QVTA 3CCSS 2PJ9A 2I6WA 4KIAA 2A6MA 1LW2B 1ZAWA 2WONA 2Z8QA 3MD1A 3MR5A 1HIYA 1G7CB 4URQU 3TA2A 3HHLC 4DR6F 1XMQF 4WWVA 2NLWA 1KQFB 1EE3P 4DR4J 2FB0A 3I9ZA 2X1FA 1S57A 2HAIA 3EXNA 1RAHB 4Y2CA 1Q8BA 2VC0A 5K5MA 1F60B 3PX4A 1M5KC 2EC0A 1NDPA 3KI9A 2PMZD 1NE9A 3TX0A 4F4YA 2J6UA 5BWAB 1UPMB 2ERRA 1BOBA 1HQUA 4X66F 2VV5A 4KVOE 3R8YA 4WXOA 4FD5A 3TJAA 1C0TA 5D6GA 2W8LA 1U2RA 3FBCA 3LH2S 5DETA 3KLFA 2R7WA 1YJWS 3AQOA 4JI6F 2IVFB 5HVFA 2RSQA 2NXEA 3M6WA 4MK7A 3GJSB 2NCKL 4ZVQB 2HGLA 3KHGA 4ENOA 3MEDB 4N76A 3L2NA 2GQCA 3GJQB 4Q2LA 4ILLA 5DDPC 1NJXA 4Y28C 3MFHA 2CVEA 2XZDB 3K17A 3F0NA 3C26A 5J1NA 3WZ0A 2PIZA 1S3ZA 1URRA 2VG5B 4A33A 3PR4A 1RWVB 3BHXA 2V2KA 2IYIA 1RT5A 3T5HA 4QIEA 2EFNA 2LXIA 1T03B 3JSMB 5IZHA 1J5EJ 2XS5A 4EFDA 3VGUA 2CWXA 4P7TA 3BJ8A 3BJYA 3BDEA 1Y00A 2RQCA 2KG1A 2W2MP 5JQ4A 2LEPA 2PRQA 3BQ1A 2J9DA 1C1CB 5F48A 2JEJA 2KCWA 4CTAA 2W2QP 4Y00A 3I82A 4DCJB 2DXQA 4CLTA 2KXNB 3PB6X 1UZDA 3UN3A 5LXYA 1CPSA 4TWEA 1N52B 1XQIA 4MJ8A 2GREA 4C4WA 2Q7SA 2E5LJ 2IM1A 3WQPA 4PSWA 5DJBA 4M5NA 3FCHA 1RT7B 4DN9A 5IQ6A 3FMCA 4LRFA 5BYRA 1HNZF 4PV6A 4ORFA 1HPZB 4QC6A 3EVWA 1XR5A 4WFAQ 1FT7A 3B6BA 1EB0A 2ZZNA 2B7CB 2CADA 2FVRA 5KFLA 4AQYJ 2MYFA 2ATCB 4Q36A 4M5MA 5E3AA 2VD3A 4LBPA 3W5ZA 1U6ZA 4JI5F 4KKOA 3K5LA 4K2JA 4HI2A 1N56A 4F4KA 4IO1A 1F2PA 1VK8A 2XLJA 4ZVUB 2B4OA 5KT6A 1PKUA 4CAXA 3AOAA 3DLHA 5F8LA 5KFHA 2W25A 3IG1B 5ETOA 5CCMA 3DRXA 5HLFA 3P2HA 3D6MB 3M6VA 3OL9A 4P72A 4H6ZA 2CJKA 3MM9A 4LF7F 4CO4A 3EPIA 2AFSA 1TL1A 3K59A 1FJ7A 3FRYA 3NY0A 1XN9A 1NHUA 2BKPA 2N7YA 3Q89A 3G9CA 4UEEA 3HVAA 3ENVA 4BMHA 5KFSA 5C42B 2YBVA 3QGPA 3OFHA 4NLOA 2H3EB 5F8NA 4DQSA 3SDEA 4M8LA 3LOUA 4NLQA 4FKYA 4P4DA 1U1KA 4GM5A 4FYYB 3IFEA 4RPFA 2WOMB 1U1MA 3B3VA 2KN4A 1KTVA 4DQQA 4QYZJ 1VJWA 1X5TA 2G13A 4NXNF 4EEYA 4I67A 2V63A 1VLOA 2CQHA 1LFWA 1CLFA 1LW0B 1VQMS 1XMTA 1RTDA 2IRYA 1FKPB 3NBPB 5HROB 1LWFB 1RHJB 2HHHF 4PG4A 1Q0NA 1TR0A 2RF2A 1WC4A 2HQ3A 3KOAA 5E3QA 1RZMA 3NA6A 1FKOA 1IOFA 2WPXA 3OD2A 1PYOB 1V6HA 1JLAB 1T95A 2QIRA 3VWDA 3H4BA 4WE1B 2PQ8A 1VRTB 5J2PB 3HFVA 3W2WA 3A8JA 2D3OR 1U09A 3DRRA 4NI2B 3PRTA 1DARA 1U6BA 5FLXY 3OSNA 1WWHA 4U9ZA 4F36A 2N3LA 3EXCX 1MG7A 1XMBA 3CCMS 2A2DA 2RQKA 2GIRA 1HBNB 1H6KX 1XJWB 1OSDA 2XI2A 2K3IA 2VPYB 2GNKA 1NK0A 3W5YA 5J2NA 1K73T 2PI5A 1CULA 2PJAA 2V5HG 2OPQB 1KUYA 4XAKA 2AMCB 2MSSA 2UUBF 3JTKA 3DGPB 3SV4A 2C2OB 1H2TZ 1P1TA 1NAQA 2ADBA 3AODA 1RU2A 3MM6A 5KG0A 4HDGA 2R7VA 3NEKA 1NM2A 5GCNA 1S1TA 4KC5A 3D4UA 3KQXA 2JDDA 1MNEA 4OZJA 5CD4H 4AXVA 2JC1A 2DXEA 3W9HA 2M2BA 4LQ6A 1VQ7S 2LQ5A 1YVOA 4Q5VA 3PTWA 4PG8A 3CF5Q 4HACA 4A48A 4K4YA 3BKUA 4O4GB 3MI7X 3MD3A 4W4MA 2BANB 4MFZA 2QYGA 1HFEL 4Y2AA 3BGLA 1NHVA 2U1AA 5AJ3F 2UU9F 3QMQA 4KVME 2OIHA 3H5UA 3TAMB 1TUVA 4MK9A 3IBWA 4OADA 4Q0BB 5LT5A 2C3UA 1W2IA 4XDDA 3DLEB 1CP6A 4EYIB 4R8FA 4F9VA 1GHEA 3PHTA 1WOSA 2UXCJ 4ZVFA 1R89A 3A9LA 2KL8A 4KPCA 3DLGB 1HNIA 4DV2J 3QSIA 4W98A 2Q4VA 4OYPA 4TY8A 5KT5A 2UXBF 4IG3B 1S12A 4LT6A 3CCUS 4N8NA 3GCXP 2DVIA 3TW0A 5E5NA 3P2FA 2PDOA 2M0GB 3U7JA 1M1KT 1C1BB 4TY9A 4DHVA 2BJ1A 1MWZA 2KT2A 5D3GA 2I9SA 3AB2B 5D4PA 3RG6A 4MJKA 4FYDA 2R8IA 3TQ1A 1F57A 3C6TB 4CGLA 3PGPA 2AJ2A 4AE5A 4JJXA 4Q8FA 1AFJA 1SPBP 3PXGa 2J7WA 1Q7LA 2OO4A 1QY7A 1RBAA 3IA0A 3NGUA 1AZSB 2LKZA 2YTCA 5E2QA 3PBEA 3C66A 1VYAA 2KYZA 1RUSA 3LP2A 1Q7YT 4RW8A 3CD6S 2IQ6A 1JLEB 1HI1A 3MUMP 2FC9A 3W66A 2AJFE 3EYZA 3I4PA 2P6GA 1CJVB 1QSLA 2OB0A 2WZNA 2GGPA 4NF1A 3ET6A 3BI0A 5B08A 2CG8A 4I2QA 1JLGA 4KLWA 1UCNA 4PG7A 1IBMJ 5MAOA 4WK1A 4CPAA 2VZYA 3O3LA 4CO3A 1XIXA 2IRXA 5HN0A 1T0TV 4N7TA 4DI6A 2P6FA 1JLFB 1QAXA 5LRKA 2NPFA 4RUCA 3DRPB 1N5TA 2D1CA 2DGOA 3DLKA 4F67A 4P6YA 4LF5J 1TF9A 3MOZA 1RHQB 2CQ3A 4MFBA 2F63A 2MJNA 4P2FA 5ETSA 2UXDF 4BS2A 5L1KA 3M2UA 1NKBA 1T11A 2ZEDA 3LMSA 5CD4A 2KJWA 4AVBA 4DV4F 3TQEA 3PX6A 1F6TA 2HVHA 1J5OB 2CQCA 3QT5A 4I64A 1BQNB 1UPPA 1I1DA 3K0JA 4B14A 1Z1ZA 4LF4J 2XO6A 1UA0A 3PM9A 3GYNA 4WZQA 4LSNB 2W9AA 4B9NA 2ROGA 4DV1F 4WYLA 2GHWA 4GRSA 1X4DA 2HPUA 1RHUB 1K1SA 2ZD1A 2QL5B 4X2TA 4QQBA 2W9CB 2DO0A 2Y1IA 1EETB 5KFFA 4NJRA 1FDBA 2AJ4A 2Q7BA 2JHEA 2QA4G 2PC1A 1RABB 2CQPA 2OI2A 3CXCR 4LRBA 3J7YI 5KG6A 1NSLA 3DI6A 3F44A 1VFJA 4J9NA 3DOKA 1RXOB 4CGNA 5G20A 2FHKA 1ZOTA 3DR6A 3UY5A 3W2VA 3VAJA 1WF2A 3ETOA 1GK8A 3MMBB 4ZIVA 2BBEA 1QUVA 3MR3A 3H5YA 2R1IA 3CJRA 1WNEA 2WSAA 2AU0A 2YX1A 3QNWB 2YWKA 3FZBA 3KKFA 2OD4A 4ZOSA 4QIFA 4ELUA 2XMJA 2HB6A 1XF8A 2I79A 1JIHA 1V0CA 2QJ3A 5DGBA 1DQ8A 5EC4A 2MZ1A 4K4WA 4CLLA 4LSLB 3M2VA 2IMWP 3KZWA 3B3CA 3W65A 4CH0S 1BWVA 5KT3A 4ES1A 2XYHB 2E1AA 1RLDA 1YLOA 4LFBF 4UIAA 2F5IA 1NK9A 5HAOA 4JUZA 4NLDA 2L3MA 2AX1A 3R5GA 1DTQA 4XPCA 4IOCQ 1JLQB 2CPXA 3AA9A 2ZHBA 4U8VA 3HJFA 4J9KA 4YB7A 1S1VB 3NNAA 1RT6B 1Q4RA 3MMCB 2FLLA 1Y5NB 2RH3A 4QWCA 3H8FA 1MJBA 1LV5A 4DR7J 3IO1A 5DZ7A 2D69A 1HBMA 3SSSA 5HBMA 2YWWA 2Q4ZA 2EK8A 3NKYA 2IL4A 5LSLA 3OFFA 2MQMA 2DR7A 5JXSA 2NS1B 3VAIA 2I0XA 4M3SA 1M5HA 4YDDB 1IYLA 4ED8A 2JBKA 3K58A 2JLFA 2HNDA 2BUEA 4I2PB 3MEEB 5C5JA 1TMJA 4LFAJ 2IY5B 1VQYA 4X4TA 3ULHA 3E01A 3LODA 2DGUA 1XNQJ 2DGSA 1TU0B 1JJ2R 2Z10A 4UCPA 3I56S 2DGTA 1NK7A 4PUOA 4LREA 1EX8A 2HZVA 2W8KA 1SIZA 2BYCA 2RDIA 2LECA 4MYTA 2YNIA 3I87A 3CDEA 3AXKA 1HD0A 1NSPA 4QU6A 4GVBB 2F40A 4RUAA 1VLYA 4IFVB 3P4UB 4CAFA 4XPDB 1IKXB 4DX5A 1RTIB 3QZ8A 5HATA 5ETNA 2DNPA 1ZO0A 1S0NA 3N01A 2NZ4A 2AFWA 3M9MB 4UOCA 2RFHA 5LRJA 4DR5J 1UWBB 2R98A 2Y1LB 3T5JA 1YRUA 3TZXA 1MW7A 1RTQA 3CJ8A 3T5LA 3GPAA 1N34J 2KFZA 3ENAA 3S01A 1ITPA 1HBUB 1WOPA 3TEGA 4K4XA 4Y0FA 3P5BP 2R8KA 3OUYB 4OYWA 4R76A 2MLYA 3SIPB 2VG7B 1X4HA 5J1EA 2OPRA 3ZJ0A 4YWYA 3SV3A 3Q2SC 4KV8B 3HDSA 4OYXA 2FIAA 1EJ7L 3BJ7A 3U27A 4ZN3A 4AG7A 4KH0B 4CAWA 4KVXA 2ZWPA 4JI2F 4B5OA 1UVNA 3R3TA 1U1QA 2WRMA 1CJKA 1HHTP 5IT9Y 1X4BA 3VZHA 2F4FA 5IWAJ 4OI6A 5I3UA 1HYSB 2B8QA 3DM2A 1WTBA 4CYOA 3QPIA 1OY6A 1TQLA 3OL7A 3G6XA 3ZFVA 3I1UA 4KOXA 3R5BA 1OYDA 1KVIA 1NZ8A 4AUKA 2Q3PA 2DCUB 1S4FA 2ZEPA 5ISVA 3QGGA 4DR3J 2IMOA 1IICA 3D6FB 1FNOA 3C2PA 2C2NA 4ZPAA 3NNHA 1BY9A 5EX0A 1IYKA 3K57A 2XYGB 2QZ8A 3J7YU 4PXEA 1XE4A 4USUA 1NUEA 3EZOA 1TUGB 1RWMB 5BJRA 4CGPA 4I6AA 3NCQA 1OY9A 2O4HA 4DFKA 1RP5A 4O0NA 4ED1A 1L3UA 1WHXA 2XSFA 3LPYA 3GV8B 4XO0A 2CPIA 4NA3A 5IB0A 2FJWA 4CI0B 2DEAA 1BUXA 3CXPA 3MEKA 3E51A 3TWZA 3KFWX 1JLBB 2MKIA 3FVLA 2CQGA 1IM4A 4ZLJA 2JEWA 3H5ZA 3P3DA 4A8KA 3QIPB 4Y3CA 4H4OB 2IC3A 4ILRA 5T7LB 2QECA 5DLFA 3VTIA 2H5EA 5HVGA 3T9YA 2YNHB 1RISA 1WG1A 2ZE2A 3F73A 3N6NA 1YVFA 4C2MA 4ED0A 1Y3KA 3M8YA 4CCHA 4LFCJ 2LDYA 3DDNA 2CVIA 2BR0A 4P71A 3ONQA 4EMEA 1FO1A 3FNNA 4ZCLA 4ZVHA 5K8PA 2XGPA 3MAAB 2VDIA 5G1ZA 1BQMB 3AJ2A 1FXDA 4C2XA 1U0HA 1GMWA 1REGX 4C3MA 2EKNA 4X4NA 2RD5C 3GWCA 4RW6A 2NXCA 5KFAA 3RJMB 3MZIA 2D9PA 3KK1A 1J27A 4DV5J 5KFCA 4UWIA 2HHPA 3LWMA 3T5KA 1PYSB 1BMQB 3KNAA 1QSTA 4RUBA 1SJRA 1FXRA 2ZW7A 1XFOA 2HHXA 1HNWJ 2W7AA 4DL3A 3HSGA 1YITS 2PRBA 3B4DA 1UEKA 5ETQA 2O28A 3I0RA 3TA1A 3KMQA 3UQSA 4IQXA 2AW0A 2BW2A 3M32B 5G0RA 2CPDA 3QRPA 2PJCA 1MWYA 2G2OA 2W24A 4PWUA 4J9MA 1S1XB 5JVGQ 2ZVSA 4XPEA 1RA7A 1YX2A 3D5MA 2XS2A 1FXLA 1S6OA 1KZFA 2YKOA 4JI0J 4AG9A 4OZ2A 2I8EA 4GS4A 5B0GA 3IC1A 4CM2A 3NMAA 3KKWA 1UVIA 1TAUA 3OPKA 2GW8A 4DUYF 5A2QU 2W01A 2YPYA 5C2GA 2AFXA 1YMEA 1XMQJ 3IMQJ 2DXFA 3KHXA 2PC6A 2F9JA 1SC3B 3D2MA 2XLIA 2IFXA 4MY3A 1Y9WA 1DHMA 5KAKA 3BDPA 2VG5A 3G82B 3LQVA 5IT4A 2AE6A 1HNXJ 2Y0BB 1XWLA 4BBYA 2FVSA 1T03A 4UEFA 2E9ZA 1QUPA 3W9IA 1VQ6S 3CO0P 3PB8X 1R31A 4K7QA 2OUGA 1RDRA 1JB0C 1HNVA 4KHPF 3PB9X 4DPTA 2P9EA 2VQFJ 2E5GA 2WSEC 4A38A 2P6TA 3HHLA 2LEAA 1TKXA 1XJOA 1SQEA 1WELA 4H4KC 1VC5A 2B9XA 4CYQA 3M30A 4HH0A 1HEEA 3U1MA 2N4CA 4G6VB 3WC0A 3CCLS 5JGFA 1T9VA 2UUCF 4MFLA 5FDLA 1KHVA 4C9DA 1ZM3A 1S60A 4IR1A 5CYJA 2BSWA 3D0IE 1R0AB 2RRAA 2JFDA 4Q43A 1RT1B 2AV5A 3CC4S 4NYZA 2XWYA 1Y0RA 2AX0A 3VF0B 3DOLA 2PJ6A 1GXTA 1X60A 2FVCA 2NXNA 2AF6A 2Q66A 5L1JA 3CE8A 1MMLA 1SV5B 2DNRA 1KQKA 2JVRA 4NASA 1WWZA 3V81A 2Q6BA 4HH1A 4RW4B 2ZNZA 1IOIA 1V3ZA 4C8ZA 3GIIA 4YHHJ 2V8HA 3MMJA 4A8MP 3R5JB 3LP0B 4P9SA 4LSZB 2W4PA 4KGVB 3FEXB 2WUUA 3WX8A 1RAAB 1LEOA 4MKAA 4F4XA 1UZHA 4OMFG 5E96A 3SXOA 3OL8A 2G2ZA 2MEWA 1HNZJ 1RK8A 3TEHB 2GFFA 3D67A 1EP4B 1YLEA 3CDUA 4BWMA 1I12A 1VQKS 2J9DE 1IR0A 1NU4A 2ASLA 1TKZB 3B3SA 4CS0B 1F3VA 3FECA 2YWGA 4DR4F 2X7IA 3RAQA 8ATCB 4DPUA 3THTA 2I38A 4JZ0A 4IUFA 1TKTA 3PYEA 4OZ0A 5HK4A 4OJ3A 3M4XA 1Q86T 2NXUA 5KTDA 3C15A 4CGMA 2B56A 5JVHQ 4HNYB 1CX8A 3OXGA 2RHQB 1VQ8S 3I55S 3VWEA 1JX4A 1FJGJ 3QGHA 2YQ0A 4JXRA 3O6QA 1R6VA 2A18A 4OZ3A 1RHMB 1S6PB 2WONB 1OJ4A 4FF4A 4P6QA 3OFEA 1LW0A 4ZA1A 5KOWA 1HQEA 4WKRA 3NBPA 5I4MA 1LWFA 4QYZK 1HKAA 3QZ7A 2PFDA 4JLYA 3B3WA 2Z3PA 3F56A 3G96A 3MRUA 1DQ9A 3VAMA 3KHRA 4UZCA 1HMVA 1TKFA 2CQ1A 2FJAB 2AFOA 4P2MA 1YJVA 2ASYA 2PJ7A 1IM6A 2DBBA 1HQUB 2F4VJ 3CJQA 1VBYA 5SZTA 2ZDOA 5D8NA 4HKQA 1C0TB 4L3KA 1J5EF 3SMZA 2XULA 1V9OA 5E7OB 3F5BA 4TYAA 1J4JA 4NLUA 4DPYA 3KLFB 1IQTA 3GIUA 4PXCA 2ZUAA 3JYTA 4C0HA 4KFBA 5C2CA 4OYMA 4BC7A 1VI7A 4FZVA 3T41A 2H65B 2R8HA 3V6DB 4OJGA 2R7XA 4U5YA 5CCLA 2BL1A 1AUSL 2OPPA 4M5LA 3LAKA 1SL1A 3HPOA 2HBZB 2C6GA 2E5LF 2F8EX 1A0OB 4USTA 5U47A 2IPOB 1OO0B 4HLBA 2MSTA 1HWUA 5J8CA 2G1HA 3WABA 4L89A 1RI7A 1RT5B 2XYPB 3J80U 3M05A 3CT9A 2BABA 1S10A 2KO1A 4MCRA 3MM7A 1Q1KA 3AY0A 1T05A 3D7GA 2Z0GA 1R7IA 4K8RA 1UJ6A 5CH7B 4M6IA 2KM8B 2Q0YA 4AQYF 3KLEA 1WSVA 4OL8A 2J9AA 1FX4A 1TF8A 4NOHA 2HFVA 2V69A 2CTCA 1D8ZA 2Z56B 1V5IB 4JV0A 2BANA 2FT0A 3W5XA 3OBIA 2M8DB 3IBCB 1YBAA 3VR1A 4A2ZA 3G3SA 4IH5A 1NRKA 3HZGA 5F9NA 5HQMA 5H1SV 4ONWA 5A2QY 2HFOA 2VUGA 1RU1A 4O3RA 5CXTA 2ZOGA 5ETPA 1I6JA 2WSCC 4I56A 2GJ2A 4K5RA 2Z3LA 5AXLA 2R7OA 4CO0A 4ID8A 2XLKA 4ERDA 1B0PA 1VKCA 1Z2LA 2B6AB 1RWUA 3QGIA 1XK8A 1YG0A 3IR6B 4KPYA 3DNSA 3FYNA 3JTPA 3PFOA 2GAGC 3GFZA 5H9EJ 4OYZA 4GO7X 2XMMA 1RKIA 4BWJA 4NA2A 4YOEA 3R2DJ 1AROP 4RUHA 5F3ZA 3DSBA 4DF8A 4ZPDA 2XY6A 3TCVA 4FXDA 1VHIA 4C8YA 4YMEA 4DQIA 2DHXA 4K4ZA 3NE8A 4FN5A 3TP2A 3JTNA 1TL1B 3N7ZA 1XBUA 3BS9A 3CJSA 2J7KA 5DM7Q 4B9MA 2BKNA 2FSRA 2WZ1A 2XQCA 1ZA2B 1TVRA 4QW8A 2XS7A 2I5JA 5EWGA 2UVWA 3D7DA 2DYAA 3THVA 1EZZB 3HP6A 1VR6A 3CJKA 2V34A 4ZPWR 4B11A 2APOA 4C2ZA 2CWKA 3ZZ0A 2NXJA 1XBWA 2P8IA 3OLBA 1M5OC 4ZJQA 1SH0A 4A30A 5E3RA 2RUGA 4OLOA 5DZ6A 4LR7A 3FMBA 3PJXA 5HQ8A 3SCIE 2R7SA 2ZM6J 3TI0A 3E8OA 5EWFA 5ETKA 3DRPA 2HKEA 4IYQA 2PMHA 2ASDA 3TJ8A 2RF2B 1IJFB 1REVA 3MTJA 1OMSA 2BM1A 2EWHA 2MZSA 2B4PA 1PAUB 2VICA 2REFA 3J7Z5 1FKOB 2QLXA 5A27A 3HHNB 1S6QA 3Q86A 1FRJA 3C3LA 4WP9A 4CH7A 4MAKA 4GXHA 3SI2A 1D09B 4QR1A 1O6XA 3I32A 1VRUB 3MGDA 3W2WB 3DRRB 4DUKA 3HHLD 1BQNA 3OJSA 5ETTA 1TP7A 5GAGI 5F47A 2KVIA 1FVQA 3RR8A 3BO2A 2ZFHA 3FVYA 2J9CA 3ZZPA 4LQGA 4P45A 2JX2A 1D0EA 1K0VA 5KFTA 3Q8QB 5C88A 5DDRC 4K50A 2QFIA 2E5HA 5J2NB 1B99A 1CULB 4IRCA 1EETA 2CIJA 2Z2LA 3SSRA 2A10A 4U96A 2PN6A 3RO0A 1WSRA 2CNLB 1EKSA 1YIJS 3KDNA 1B3TA 2O01C 4YQWA 2EC2A 4EBDA 1GMUA 5K9FA 3MM6B 3BSCA 1G2EA 5IQQA 4AFFA 3NLCA 4CLPA 4N8OA 1FDNA 3MPYA 2DISA 5AGEA 1OIAA 2ZEOA 2CNNB 3V6HA 3MMBA 4JBCA 4OX7A 1X9WA 2IM3A 1YRXA 1FHTA 1M4LA 1DZ5A 2UXCF 1SH2A 4DV2F 2OU2A 1NDCA 2L9DA 4HACB 3GLJA 4NLRA 3MWBA 1BPNA 3ISXA 1BWEA 4MHZA 3PG9A 3NGKA 2RUSA 4C0BA 1RACB 2JL9A 1FI4A 1RKJA 4OC3A 3UWTA 5KT7A 4EK2A 2YGWA 3BLNA 2MZQA 3LD2A 4LUAA 1T94A 4ECRA 3M8ZA 1Q5YA 1QSOA 4C8KA 3BXMA 3KHZA 3H2VE 3R5CA 4FP9A 4GMKA 1NLKL 3MECA 3Q8YA 4NMLA 2PMWA 3LPEA 4B3TJ 3PB4X 4U6PA 4DXLA 1UWAA 3CIMA 4A8WA 2J8MA 3F0AA 3MM5A 3UCGA 4MKVA 2LYVA 3UNGC 1NJWA 2AJQA 2MMYA 3KLHA 1HNIB 2GCFA 3D1HA 3MCOA 1VGYA 4L76A 2L41A 3J80Y 4NGPA 1VHSA 3QFWA 2AJ6A 1AUDA 1CBXA 2V8PA 4FXWA 2PEBA 1LWXA 4USKA 4ZY0A 3MGJA 1Z4RA 3BI1A 2L9WA 4TQRA 2HNYA 4OHYA 2EPIA 1CJUA 2IHR1 4DL2A 3D8PA 1N5YA 2XGQA 3MEEA 5D3GB 3I6PA 4F0KA 2VH7A 4F3OA 4LFBJ 3M6UA 2FIWA 4ZVSB 1HW9A 4P10A 1WC5A 3V2UC 1S7IA 3C16A 4IOAQ 2VQYA 4P4BA 3M9OB 1Q7LB 3IWWA 2J8AA 3QAHA 3SFGA 2Z2ZA 2D4PA 2PR1A 3E2EA 3PKMA 4OHVA 4OC5A 4LF5F 5GMKa 3BF4A 4RW8B 3T6JA 4OZ5A 3W60A 1ZS6A 3H98A 3RW6A 5D77A 2VFRA 3SXNA 1VC0A 2DGQA 5KG7A 2F65A 2GGPB 5C24A 1IKXA 4I2QB 4M5HA 4ECWA 3TE4A 3L9ZA 3BGFA 4R3LA 4O3NA 2PA3A 3KYLA 1TL5A 3CW2C 4YS2A 5A8WB 4LF4F 1UWBA 1NSAA 4X84A 3R2CJ 4IQMA 2AGPA 4XTTA 1HHSA 4NLTA 3SCJE 3Q8SB 4XNHC 1KBRA 1YR0A 2O3DA 4UY85 1A9NB 4Q38A 4OI4A 6CPAA 3DLKB 4QIGA 2GJIA 2NZCA 2CG4A 3I3GA 4ETZA 4NGNA 2J9EA 3MM8B 4ED6A 3CDXA 2I00A 1FEHA 1Z8XA 3LO3A 5FD1A 4TYBA 4ICLB 1NH8A 3M2UB 4DU8A 1S97A 2H5JB 1ZG8A 3AB4B 2HGMA 3M7VA 5C7PA 1M4DA 1YX0A 2K3KA 3FSIA 2G9OA 3B3TA 1N0UA 2PGCA 5DGAA 2XB2D 4ECXA 1Y9KA 1JJCB 5AE1A 4EYHB 1S9EB 3G6ES 3JQJA 3JTOA 4J5OA 3R9LA 2HLTA 4J9PA 1ZM4A 3ZNUA 2ZOFA 5AG4A 3V7ZA 4MKYA 2AGOA 4ED7A 3R5AA 4LQ3A 3C6UA 1WD6A 5CA5A 2MDAA 2RE1A 5EDWA 2ZD1B 4FD4A 2OKQA 6FD1A 4OC1A 1OPZA 3CTRA 3D3CJ 5HI7A 5LMNJ 3G2XA 3PDNA 4KSIA 5LMUJ 2F7VA 1YZ6A 4DR2J 3DI6B 1T9UA 1QTNB 2WHOA 4J9VA 1D1UA 5E41A 2H5IB 1ZLIA 1L0CA 2CZ9A 2GVDA 4RKUC 3HLPA 1VIXA 3EUNA 4OP4A 3GMGA 1Y9OA 4FAIA 2EFQA 3W2VB 1PJ6A 2BXJA 4J9OA 3W91A 2XBPA 3DDKA 1HWJA 4CYNA 2FVPA 4RWWA 3KMSA 4TQSA 2M52A 3GV7B 3R6LB 4DR7F 2BOAA 2GLJA 2QFJA 1JXEA 4JXQA 5L1LA 4NCZA 2FGOA 4CO2A 4FS1A 5A8KA 5JH9A 2XNRA 1BD6A 1HL6A 2WBMA 4H2KA 3FEYB 2YKMA 3AD7C 3IP0A 4C8NA 2QEXS 3K89A 1S5ZA 4PPDA 1T3NA 4OYIA 2Q6CA 3M2VB 5AG5A 3EVOA 3TO7A 3O8WA 4RNHA 5KFUA 4R5PB 4LFAF 2D7SA 2MJUA 1Z9UA 3DDDA 3X3UA 1XNQF 1JLBA 1GAOA 3DU6A 1DTQB 1KHWA 3KJQB 2H1YA 1B7YB 4FVMA 2ZZTA 2V2ZA 1S79A 2P6EA 2PJ2A 2G2YA 1VBXA 3OVBA 1HI0P 1ELOA 3PO5A 1U0SA 4RL1A 3UPFA 3CO9A 1HBMB 5HBMB 4YFJA 4FS2A 4UTGA 1PILA 3PACA 1RXTA 4CRJA 2PD1A 4UEZA 2LLZA 2DGWA 4J9RA 3NGTA 5EX3A 3EM1A 3L95X 3BGRA 1VQPS 4L75A 5A76A 3PB7X 3G8TA 3LF0A 5CQGA 3V5RA 2LA4A 2ZUGA 1X8DA 3RU0A 2HNDB 5D0GA 1URNA 3MN8A 3TVYA 1P9QC 2ABYA 1SBRA 2E7XA 1TK0A 3GU0A 4NZ0A 4RI1A 2GU2A 3E01B 1WG4A 1Y0YA 2OPSA 1CS4A 4DR5F 1WF0A 2K06A 1BQMA 2CUYA 3CCTA 3CPXA 2XC9A 1Z8WA 4LX9A 4PUOB 1UVJA 1N34F 2DHAA 4JI7J 2GO8A 1WK4A 1W7WA 4FNIA 4LRDA 4DX8H 1GX6A 3KJVA 2YNIB 3NP5A 2XEFA 2B7BB 4AT1B 4MHYA 3CUNA 3V4MA 1TL7A 4OV1A 2LU1A 2C2ZB 2KDOA 2HQCA 2GC8A 4KUAA 4MFKA 2AP6A 1X0PA 2FS5A 3A8EA 2WVFA 1T3OA 2ZWOA 3N6MA 2EKYA 3SJXA 4KRWA 2AQ4A 4PQAA 5J1PA 2A1BA 2BE7D 4EU0A 3DFEA 1IWAA 3FX6A 4X4RA 5CYQA 3WX4A 1B4SA 1Y3JA 4DCPB 1FEEA 1W26A 1RLCL 4USWA 2DNKA 2CZ4A 3LAMA 2VFSA 3WHIA 3BGUA 1RJJA 2QLWA 2BACA 2B5GA 3WIUA 4KHMA 4NLXA 3IM8A 1TV6A 5IWAF 1H7XA 2NUHA 1S1XA 3PEHA 2C28A 2AZ1A 4P44A 1VC6A 4DG1B 2ACMA 3Q2TC 1HW8A 4W92B 3FB3A 3T1HJ 5KFRA 3B35A 5LOQA 4IR9A 3KJFB 4DEZA 3IR5B 4ZPBA 2OSRA 2IM0A 1U1NA 3FC9A 2QL9B 3FBEA 5ADZA 3OLAA 1WG5A 2RB7A 4UBRA 5CABA 4HNWB 2O5DA 2AHOB 1RQ0A 1EAYC 3V38A 2MY7A 1VDHA 4UOGA 4NGQA 3RUBL 3Q8VA 2FJEB 1U45A 2Y1RI 1QE1A 2C1EB 5H9FJ 3GONA 1YJNS 4Y49C 5KG3A 3UDVA 2B8PA 4A32A 1WC3A 1OZPA 3VQTA 4OC2A 4BDPA 3DM2B 2FIUA 3US5A 2JOQA 3ETMA 1UAWA 4CIOA 2DGXA 2CRLA 4RNFA 4DUZJ 2CPZA 3I96A 2RRNA 3K2YA 3KUHA 4OYAA 1HWKA 4DSEA 2OGUA 3KK3A 3K5MA 3PZPA 2CNKB 2GIQA 4ES3A 3B8GA 3UFCX 2CQDA 1PJ5A 3BSNA 1RT4A 4I69A 1KR4A 4ECTA 1UEVA 4RS2A 3G86A 4X4QA 1U1OA 4HR2A 4RW7A 5HMZA 3NOCA 4N56A 3HT0A 2BEIA 1Q2YA 4N47A 3QRRA 2OMLA 5D78A 1SKRA 2GANA 2BVZA 3T90A 1FCAA 3FQLA 4OLPA 3BN7A 1SJQA 1MU2A 1KS2A 3T3FA 3CD0A 1N36J 3ISNC 4JB8B 4E98A 5F8MA 4LFCF 1YK9A 1Y5IB 3BPSP 4OC0A 2DEJA 1B87A 3GIRA 4DL6A 3FSXA 3BEGB 3PJWA 2BRLA 2CJYB 3M1VB 4ELTA 1PC4A 2HHWA 3AJ1A 2FQQB 2ZH7A 2W1BA 4ZK7M 1TELA 1I94J 3LGHA 5GAEI 4X8IA 4UUXA 1NNDA 5LRGA 1RCXB 4TU9A 4NX9A 2IC3B 4PYDA 2X7BA 3A3NB 2DD8S 1DTDA 4XIUA 1D8YA 1ZTTA 2LA6A 1RHKB 1PBAA 2UUCJ 2MPUA 3GG1A 3KUEA 4YB5A 1TUWA 4DV5F 2VHGA 4WJBA 4YN3B 4WU2A 3FGVA 1ZZNA 3PR5B 2GMJA 1U1RA 2GLFA 3LACA 1AMPA 3WC6A 4CRYB 2PE8A 4YDXA 5AG6A 4ZP8A 4BLGA 2ZW4A 1HNWF 4F7VA 1X0FA 2QMLA 2UUWA 2DNHA 1RBOB 3N79A 1FX2A 1VHFA 2W7PA 2QO3A 4ZIWA 4KSFA 1LOKA 2FC8A 3D3BJ 4H54A 4R8UB 2Z58B 1U0HB 4DOZA 4DSLA 3CCWA 4H4KA 4KB7A 2QMWA 1QVGR 1CP7A 2HBQB 1PGZA 4MFQA 3QRQA 4RW6B 2YNEA 2ZNYA 2IJFA 4AXJA 3EFAA 4O3OA 2NSMA 2YH0A 2EBEA 4O0IA 3HHEA 1F1BB 5D15A 4JI0F 4DFMA 1KUVA 4UW2A 3HSJA 2FCKA 4DX7A 5L1IA 2JEVA 3PVXA 1S6PA 1FRXA 4MHDA 3LGMA 3I4HX 2M5YA 4USJC 1A7GE 1NSQA 2XEXA 4WYWA 4L3NA 1M1DA 4ZVGA 4QPTA 4F2SA 2H5MA 2WVCA 2M8HA 2BOPA 3I0RB 2Z3OA 4LVOP 2B4DA 3BYPA 2J8NA 2N3OA 5IXUA 1AT1B 4OZ1A 5G0RB 4ZPVR 4A8XA 2FY1A 4NRUA 2V50A 1KSPA 1EQMA 3N5FA 4A8SA 3CULA 1UTAA 2MKCA 1XIQA 2NYIA 5L8RC 1HNXF 2QMUB 1SXLA 3AT1B 3HUVA 2ZBPA 4I7FB 2HBYB 4DLGA 5J2QA 4EI2A 1QSNA 1UFLA 3GIMA 1R6YA 3L7OA 3P8BB 1N5VA 3M2RA 5IC4B 1ACMB 1CSJA 1TL4A 1GXLA 4C8MA 5B0BA 2VQFF 1NBEB 3N28A 2ATRA 1NDLA 1ZPWX 2H48B 3B7IA 1R8HA 3VGTA 4M85A 3V6DA 1APSA 4DS4A 5D4LA 5A28A 3R9EA 4Y2KA 1YKWA 5EUHA 3ZTOA 2ZH4A 3Q23A 4OKOA 4JV2A 2VI7A 4QWBA 4WPAA 2DK2A 1RGVA 5IT0A 1T9XA 2OTJS 3LALA 2CNSA 2X3GA 4F25A 2VASA 3NL0A 5F8IA 1R0CB 2GA7A 3FRZA 2DB1A 4BINA 5GADI 2KVQE 2OOTA 3I31A 1IXKA 1HNVB 3GSIA 1BXNA 2B5JA 2ZH8A 4C6AA 2P0WA 3W8GA 3HHLB 3D4JA 3RTVA 1TKXB 3ZZIA 4PXDA 3M30B 2VKZG 1N8RT 4YHHF 2YKNB 3IWLA 2HWTA 3KQZA 1RWOB 1SQFA 3TTHA 1SIWB 5FDLB 3ENWA 3IRXA 2ZBRA 1YREA 2H4YB 1WACA 1UL3A 2ZZMA 2DPJA 5MLCV 3NCRA 3MTKA 5B09A 3OXFA 1CVJA 2XG8A 4DMZA 2XY7A 3DOLB 1Z4UA 1CEZA 4DS5A 2KRBA 3TUIC 2B9WA 4O44A 1JWWA 1H2UX 5ELYA 2REEA 3OTOJ 5KG2A 3FMWA 2IDEA 2LXUA 3BQ0A 2K1RA 3V81B 3MDFA 4N5SA 3EO4A 2HUZA 2B6AA 3D28A 3KLVA 2MHEA 2DJWA 4AL5A 4ZPTR 4C2YA 1VQ5S 1HDQA 3Q24A 4M5GA 3HHDA 4NWBA 5L38A 4U9RA 4KGMA 4DN0A 5CBMA 4NYOA 1LXNA 3GKRA 2KU7A 2VPXB 2Q44A 3D54A 2ZPAA 2EK9A 1FERA 2ROPA 2B43A 4GKJJ 4KHRA 1FJGF 2WCXA 5DWNA 4ZN1A 5GAEU 1FD8A 5H9EK 2KYXA 2RIJA 2RILA 1GTEA 4NMXA 4X4VA 2W4DA 3PRBA 1RAJA 4EO6A 3NRBA 4URGA 2N4DA 2YNCC 4ZDNA 2XMVA 1YJRA 5J8FA 3OTEA 2B3UA 2YWFA 3CGIA 3NH4A 3H59A 3KK2B 4B12A 3NOGA 2UP1A 1RAOA 4CLZA 4KT0C 3PW4A 3FKBA 4ZP6A 1N88A 1TKTB 4OYOA 3MCNA 2RS8A 4ATNA 1QJHA 4NGSA 2GAHC 4M6HA 1NJZA 3C15B 3OWCA 2QT7A 3SCLE 3POTA 1NPRA 4PXBA 1FD2A 1O8BA 3RBZA 1FE4A 2F4VF 4PRFA 5GMDA 3FNCA 4ECZA 3KASA 2ZDPA 2CJ9A 7FDRA 4M5KA 3M8WA 2ZXVA 3F41A 2HHQA 2CPHA 1C0UA 5A0YA 2R7TA 3OL6A 3OR2B 1UFWA 2DH9A 3PJ9A 1HQEB 1FA0A 1HBOA 4B3OA 1PYTA 2GHPA 3QAYA 1X4FA 2IBOA 3S9LA 2EW9A 1MK4A 4TU7A 2EFGA 4OV6A 1NMEB 3VVUA 4QR0A 2BJ8A 2E5IA 1PUAA 2V4QA 2OP5A 2VL1A 3HKWA 1WTFA 2IIHA 3R7BB 1HMVB 4HEA9 4KY3A 4ZCMA 2HS0A 2VF3A 2V94A 1JXLA 4UWJA 1X7VA 2YQ1A 3HM9A 2MXYA 1VRUA 3K2KA 1TK8A 1T7PA 3RGIA 2R2TA 2VJUA 1LRZA 2MGZA 4OQJA 1BE4A 2R7HA 4NZ6A 2ZKUA 1SUQA 1I3OB 3JYTB 1HHQA 5A6WA 2HSEB 4KFBB 3KWMA 2Q51A 4FF2A 1YTYA 2GHVC 3UR3C 5IM0A 3B2YA 2FLPA 4RLEA 4GVLA 5BXIA 2OPPB 2IDLA 1WKKA 2K7JA 4M5JA 3H8EA 3U1NA 1IUJA 2B51A 4MCPA 4CZCA 2R8GA 2MZTA 4PG6A 2OZHA 2B9EA 3Q8UA 1MJ9A 4K5SA 2ZH3A 2UVVA 4E0DA 5KFJA 4EZ9A 5I3PA 3SI0A 1P4NA 1IVZA 3MM7B 2R2RA 3KJNB 1T05B 3BO4A 4RBUA 2CTBA 5T41A 2YNFA 2KI2A 2C2EA 4RWXA 3KLEB 2H51B 4Z7YA 3SZ2A 3FXTA 1TFYA 1YBUA 2CDRB 4WKYA 4KLVA 2MZJA 4X65J 2LFVA 2YKAA 1Q2CA 1NHKL 1X4EA 1XOVA 5GADU 5J2MA 4CQ1A 2JRSA 4RW9B 4USVA 3S8SA 1F5AA 1NSKL 3KR5A 2NPIA 4GKKJ 1SH3A 1M4IA 1YQEA 3A3PB 3VGVA 1S76D 5A8RA 3AHPA 1R0BG 1S59A 3A12A 1ELLP 1FESA 2NMTA 1KN6A 3HHKA 3JVNA 4ANDA 2C22A 5AT1B 3Q8PB 2HK3A 4CT8A 2ZEFA 5LYFA 4YP3A 1VS3A 1JNZB 1IQZA 3MHYA 3TJ9A 2JNJA 4UA3A 4QWDA 1YBTA 2Q04A 2R2UA 3TNVA 4RZRA 4E8OA 4F6AA 1YSJA 1QMUA 4IRKA 5KFWA 4ZLNA 3HMJG 1ZA1B 4KOVA 5AXMA 3TZWA 4DFJA 3D0GE 2CJQA 3BBBA 2JJ4D 4UOHA 3IGVA 4JI3J 2ZEHA 2GQQA 1CC7A 4PCQA 2G4BA 2V4RA 3S6FA 3HF5A 2QA2A 2O1PA 4NEXA 4A46A 4KH1B 1Q95G 2ZM6F 5EN1A 2ZEEA 1WEXA 4A39A 8RUCA 4DUTA 3BKTA 1AB8A 2V0NA 3DHWC 3A13A 4WF9Q 1E6YB 2QN6B 2SXLA 1N54B 3QSYB 1TVRB 3S9NA 2DR6A 2OHDA 4EFAC 4IOBA 2I5JB 2GMLA 5KFIA 2ZITA 1SI9A 3FQKA 3HXMA 3UNYA 1PCAA 4DSKA 2ANPA 2DEIA 4A8YA 4RJVA 2MTLA 3CJKB 5KFNA 4C98A 3CD5A 2HYIB 1QAJA 2K2PA 3BR8A 4MYUA 4I1TA 4KGZB 3IIBA 4OC4A 1QSMA 5AXNA 2Z11A 3D68A 1N32J 4KOWA 1WEZA 1XTZA 4P4IA 3GB0A 3EGZA 1K0TA 3W62A 3M8RA 1H74A 3D1OA 5A8WA 4CAVA 4G1PA 2HG4A 3JB9k 3HK2A 2OJ3A 2ZVIA 1B7FA 4Q2MA 3UW1A 3PBBA 2N7CA 2WW8A 3NH5A 1REVB 3H5XA 3MM8A 4QWAA 1NJIT 4NXMJ 2PI4A 2L9NA 3JUWA 5KG1A 5M2UA 2CNMA 2COLA 1S6QB 4ICLA 4P2XA 5G4DA 4F0HA 4Y6IA 2ZBCA 2DNZA 4I4BA 2HV2A 3QQCD 1KOHA 3I9SA 2HFSA 1WKLA 2I1RA 1N5SA 3CDWA 4KR0B 4P75A 4U7CA 5AE2A 4WWSA 4DSFA 4Z2XA 1S9EA 2HW3A 1RTZA 2B0GA 1Z2ZA 3HJVA 2CY2A 4WP8A 3ZZZA 3IXQA 2R7RA 1MN9A 3TAPA 1XC9A 2QX0A 3NGRA 2YNDA 3HZEA 3QATA 2G0CA 3MPUB 4MFJA 1AXQA 1Q2DA 2HRUA 4JI8J 1IBKJ 5G22A 3QT6A 2BO9A 2NYQA 1I51B 3AOCA 3J7A1 2V2VA 2WBRA 3FF3A 3T8WA 3VZIA 4BCAA 5DWMA 1H8LA 1M90T 4ETXA 5DG9A 5DG8A 4ECQA 1C2PA 4QCLA 3OR1A 3DXBA 4K4TA 2XM3A 2E7VA 2ZBIA 4Y34A 1R8BA 2PJ0A 4FPIA 2GJFA 4B3TF 2GVZA 4FD6A 4DV3J 2J0QD 3TA0A 1Q79A 4RBVA 1RO5A 2CPJA 3VAFA 4J9UE 5HP1A 2XTJP 2BDPA 2W2NP 1K9MT 2ZOMA 1FWKA 5G21A 2QA1A 3ISZA 2HURA 4UQTA 1NKCA 5KTQA 5FJ4A 4DDFA 2M4MA 3NGDA 4R5PA 1S72S 2QLFB 3WIVA 4QW9A 1DURA 1RAIB 1A6LA 2X1AA 1R43A 3MECB 2BZ2A 3DLJA 2DHGA 3GSDA 4ECSA 2EK6A 2GX8A 5HMYA 3CCQS 2ZELA 3MM5B 3OQ2A 1RYRA 5LYLA 3H4QA 3KLHB 3CJTA 1E6VB 1J2VA 3UR0A 4CM0A 5GVQA 1F5BA 1K47A 1SL2A 1VIOA 2CJXB 3FCWA 3R95A 2X51A 4K4UA 2ZHAA 4ZJLA 4LIRA 4WFBQ 3GR1A 2HNYB 2FJVA 1B0TA 1CJUB 4E2FB 3TOBA 1FK9A 1AA1B 4X3RA 1N5YB 3DOMA 5THWA 2HRYA 4X4UA 4YGOA 2AFZA 1QDUB 3W64A 1KKHA 4ILMA 2FE7A 3C16B 5JMNA 3PX0A 3VGSA 2VKRA 5B7WA 4LJMA 2C6PA 2OFHX 2XEIA 2JH3A 2WB1D 2H54B 2XZTB 2BM0A 3RRHA 4ALZA 3HVTB 3G8SA 3E0KA 1S1WB 3ZZUA 1SJ3P 3I9V9 3OVAA 4HDHA 2DITA 3Q83A 3ZZTA 2BJ7A 4TLQA 3LGNA 2FYXA 3GZ7A 3RAXA 2HFNA 1PO6A 2DNMA 2KB2A 1S7HA 2QYCA 5C24B 4C3LA 4EZ6A 2JEFA 5F8HA 3QIDA 4PK3A 2C6CA 4J37A 2RMLA 2FVGA 1WJ9A 4UCNA 4JP8A 4NCBA 2Z2YB 2HQYA 3OV7A 2HNZB 3BH7B 3MMAB 3CDAA 2BUNA 2YKQA 2VXKA 5HQLA 1SB6A 4WXWA 4ZVTB 2QV6A 1GT8A 3Q0AA 3TOQA 4AL6A 4OX9J 2M70A 3DU5A 2I3CA 2LQ9A 2MQPA 2C3OA 4ZLLA 4RNOA 1IBLJ 3HSZA 4WFYA 2FJBB 2ZH5A 2DHHA 5I3QA 3ZO7A 3U02A 3DLLQ 3V8IA 3M8QB 4DZ6A 2ALYB 3R1HA 1RT2A 4DG1A 5LMNF 2MLZA 4URSA 5LMUF 4UOFA 4DLEA 1F2OA 4DR2F 2DKOB 1FKAF 1EQ0A 4IDKB 3QO9A 2MB0B 3P5TL 1QVFR 3DLBA 4LIWA 2PCUA 2XMKA 2Q43A 4J91A 2EK1A 1NO8A 1LCPA 4P4JA 3PYFA 3MR6A 1RAGB 2VB6A 3LP1A 3JSYA 4LMZA 2IJRA 4HKFA 4ID5A 2VQEJ 4KAIA 3C6UB 1YGHA 3TT2A 4MCQA 2VBZA 4IH6A 4EWTA 1K8AT 2OEJA 4DPOA 3PEJA 3UI3A 4JYWA 4QB9A 2J0XA 1TTHB 4M63A 5H9FK 4FWUA 1ZPVA 1S1UB 1LFPA 3PW5A 1Y4ZB 3CJ3A 4U7UD 2FD2A 5FLXU 3D7FA 2QA4S 2L08A 2PSZA 2GVDB 1XEZA 3ZC4A 4DL7A 3L7UA 3NAIA 4F0XA 2LQBA 2PJ3A 4DBQA 1WI6A 1FWLA 3ZZOA 2PIYA 5KOXA 2HMIA 2Z57B 1LWEA 3F8KA 1UWYA 5A8KB 4ZVOB 1R8AA 3CDBA 2EVZA 4MMOA 4IAVA 1DAXA 1N6QA 1UMJA 2YKMB 1S7FA 1FRKA 4PEOA 3GJRB 4MKBA 1CJTA 3CJ5A 1U6FA 4K4SA 4PKDB 3I0SB 2YXLA 2BV3A 3AFGA 3M1VA 4KGXB 2LQJA 1VHOA 4OFZA 4Q44A 1I1GA 3HKZD 3CPAA 2RNEA 4JI7F 3DRSA 1RWNB 1U24A 2J5AA 2FXFA 1ZETA 2BKOA 3T9ZA 4MRIA 2MQLA 4C11B 2IVMA 5FVJA 2JLMA 1GX5A 1U1LA 2G0JA 3TUJC 1P9YA 3BGRB 5BYSA 4DV7F 1DLOA 4AXIA 3TARA 1L3KA 4WCEQ 2MKYA 3BM7A 4R87A 4B3RJ 1RBLA 2D3ZA 3EX7B 1CG2A 4B5PA 3FBUA 3HVRA 1SVDA 3H2LA 4YEAA 4WIIA 2OPSB 2E1RA 1CS4B 1SKWA 1FFGB 3BH6B 4OI0A 4R8UA 1OWXA 4MHPA 3TYTA 1SKUB 2G9DA 4B6ZA 1UP1A 3KJVB 2DRDA 4WFNQ 2K7KA 2BJ3A 3W6SA 3G6VA 2VPZB 1TL7B 1O51A 4F4AA 1XRYA 1YVKA 4G3IA 2W2PP 4H4MB 4M95A 3T1HF 4LF8J 1JK9B 2AYGA 4LF1A 3SJGA 5LSRA 2KFNA 1FRHA 4Z7CA 1G6BA 4PYAA 3NS6A 2V6AA 4F0MA 5C25A 2YX7A 3P96A 2R9LA 5CYQB 3ZTSA 2YVSA 1NKEA 4DU7A 4QPXA 1ZLHA 4LBHA 4CO1A 1TZ0A 4NLPA 2B5GB 1JMTA 3MUTP 3KTQA 3GYAA 1TV6B 1PC5A 3J7ZT 2R4FA 4X64F 3MR2A 3EMTA 1SC4B 2CZVC 4OIXA 4OI1A 3VALA 1WC0A 1V3RA 1GFWB 3EZUA 3D0HE 5EGYA 3PIOQ 1MROA 4I7FA 5K14A 4DUZF 1U8SA 3FFIA 4B3SJ 4HHUA 3TAQA 2HWIA 2AD9A 1F3FA 5HL7Q 2VPWB 4CLKA 3VV2B 2R3VA 1JLCA 1F9EB 1X5PA 3CC7S 5D4NA 3QJLA 1LQ9A 2ILZA 3P6YC 3RRGA 2DTJA 3S6EA 1WI8A 3DN9A 2QE5A 1WORA 1QE1B 4J9SA 2HQDA 3PZJA 5F0WA 1Q8IA 5L39A 1KLMA 3DR8A 2ZJRQ 2B4VA 2AFMA 3VAGA 2VC1A 2HWHA 3L09A 1UVKA 2H4WB 2KG0A 1N36F 1KFDA 3GTYX 5AG7A 1Q16B 2R7UA 5DDQC 3M8PA 3G8WA 3DXSX 3KK3B 1VOMA 3SHPA 3KG0A 4G1IA 4P74A 2KT3A 4H6UA 2V9KA 2PJ1A 3H90A 4ANEA 5HANA 3HLUA 1RT4B 3R1KA 1I94F 3H8GA 4EUVA 1UFKA 2CQIA 3LWUA 2MQQA 2D74B 3HT3A 1YI2S 3N5BA 3KR4A 4ONUA 4RW7B 5JM6A 2YKNA 3FEDA 2DNQA 3UDEA 4DYOA 1X4GA 3W63A