5F48A

Crystal structure of an aminoglycoside acetyltransferase meta-aac0020 from an uncultured soil metagenomic sample in complex with coenzyme a
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
150
structure length
150
Chain Sequence
DNFLKIERLAENDLPKFIQLIRLFEAVFEMKNFSIPDSEHLQKLLNQNNFYVFVALLENKIVGGLTSYVLEQYYSEKPLAYIYDLAVDTNWQRQGIGKKLITATNQFYTEKGFEEVFVQADKVDDYALDFYRSTKPTAEEQVVHFYYTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords aminoglycoside acetyltransferase meta-AAC0020
publication title Structural and Functional Survey of Environmental Aminoglycoside Acetyltransferases Reveals Functionality of Resistance Enzymes.
pubmed doi rcsb
source organism Uncultured bacterium
total genus 33
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5f48A00
3NE7A 2C27A 4R9MA 4MBUA 4E2AA 4AG7A 1S7NA 2Q44A 1M1DA 1P4NA 2ARHA 2ZW5A 4JD6A 4E8OA 2R1IA 2B3UA 2Z10A 3FBUA 3T90A 4ORFA 1S7FA 4LX9A 1Q2CA 2G3AA 2JDCA 4QC6A 4H89A 2ZPAA 2QMLA 1Y7RA 4FD4A 3BJ8A 1PUAA 2B4DA 3K9UA 2Q04A 2VZYA 2NMTA 3DR8A 1VHSA 1XEBA 3IGRA 2QIRA 4F0YA 5C82A 1N71A 4HNWB 1KUXA 4U9YA 2K5TA 3SXNA 2VBQA 3BJ7A 5H84A 2I00A 2VXKA 3S6KA 1NMTA 2FSRA 3SXOA 5IX3A 1FY7A 4OLLA 5F48A 5E96A 1S3ZA 3D8PA 2PDOA 3IWGA 5GCNA 3EXNA 4BMHA 5KTDA 1MK4A 1S5KA 4I49A 2Q7BA 4MHDA 2O28A 4CRZB 4YFJA 4KLWA 3TO6A 1KZFA 4XPDC 4NF1A 1Q2YA 1YVKA 2B58A 1U6MA 5J8FA 4B5PB 2X7BA 4HNXB 2VQYA 1QSOA 2JEVA 4X5KA 2REEA 3FYNA 1Z9UA 3W6XA 4GS4A 2QECA 5J8CA 4QBJA 1Y9WA 2CNTA 2FCKA 2J8RA 3F0AA 1MJBA 4CRYB 3TFYA 2IL4A 5JPHA 1YX0A 2HV2A 4XPDB 2B4DB 3OWCA 1Z4EA 1IICA 2J8MA 3F8KA 4YGOA 1BOBA 3CXQA 4UA3A 3EFAA 1YVOA 1NE9A 4MI4A 1NSLA 3LODA 2FE7A 4M3SA 4RS2A 1KUYA 2VZZA 1YR0A 3G8WA 4AVAA 2PRBA 2OZUA 3R9GA 3R96A 4B5OA 2CNMA 2P6EA 2WPWA 1I21A 4XNHC 4R3LA 4NSQA 2ATRA 4YRHA 2H5MA 2J8NA 2BUEA 1M44A 1LRZA 2DXQA 3ZZIA 2GIVA 4HKFA 2EUIA 5DWNA 1SQHA 5DWMA 2B5GA 4XPLA 3I9SA 1YLEA 4XNHB 3EO4A 3SHPA 4KUBA 4KOTA 2F5IA 1IIDA 2ZW6A 2OH1A 4H6ZA 4H6UA 4KUAA 1QSNA 5F47A 1J4JA 4DNCA 1R57A 4UBRA 2I79A 1TIQA 3GYAA 2OB0A 4R3KA 4MJ8A 4U9ZA 3TOAA 4LUAA 1YGHA 2A4NA 4KOXA 3P2HA 1S7LA 2FT0A 2CNSA 3TCVA 3DSBA 3PZJA 3RYOA 1RXTA 5F46A 3VWDA 4M85A 4PSWA 2P0WA 2FS5A 1I12A 1QSRA 3TO9A 2OZHA 3H4QA 4KOWA 2JDDA 4R57A 4KVME 2G3TA 3TE4A 1L0CA 3EC4A 4PSXA 2OU2A 3DDDA 5FVJA 1IB1E 2ZW4A 3FXTA 3UY5A 1IYKA 1M4DA 4L8AA 1V0CA 4QB9A 4AG9A 3MGDA 3F5BA 2FIAA 2KCWA 1WK4A 4AB7A 4AVCA 4ZBGA 3QB8A 2EVNA 1MJ9A 4NCZA 2B4BA 4HNYB 2PR1A 1GHEA 4QUSA 2PQ8A 3R9EA 3S6FA 2Q4VA 3V8IA 4AVBA 3W91A 3JVNA 2WPXA 3KKWA 4IUSA 3PGPA 4UWIA 3R9FA 2HQYA 4NEXA 4JWPA 1WWZA 3TOBA 3G3SA 3BLNA 4IF5A 5H86A 4KOVA 4KVOE 3S6HA 3ZJ0A 2R7HA 2Q0YA 5EC4A 2GANA 2P6FA 3FB3A 4UWJA 4KOSA 4FD7A 3S6GA 2FL4A 2Z11A 4EVYA 3EY5A 2PR8A 4B5PA 4CAXA 3VWEA 1Y9KA 2FXFA 3WR7A 3P2FA 4RI1A 3D3SA 1QSMA 3LD2A 1M4GA 2B3VA 3D2MA 4J3GA 2PSWA 3PP9A 2PC1A 4KOYA 5C88A 3CXPA 4KOUA 2ZW7A 3QAHA 1OZPA 2FIWA 2G0BA 2Y0MA 3CXSA 4KORA 1M4IA 3R95A 1VKCA 2BEIA 2R8VA 3GKRA 4CS0B 3N7ZA 2Q4YA 5IV0A 3TT2A 4KZTA 4MY3A 3D2PA 4PV6A 4U5YA 1XIXA 5F49A 1XF8A 1XE4A 1YK3A 2VI7A 4Y49C 1XMTA 1S60A 5ISVA 4CAWA 1PU9A 1Z4RA 3JUWA 1CM0A 4MY0A 3I3GA 3FRMA 5HH1A 4F6AA 3DR6A 4QVTA 2CY2A 3DNSA 5JQ4A 1UFHA 2P6GA 4OAEA 4KLVA 3C26A 4OADA 1B6BA 4Y49B 1BO4A 3E0KA 3GY9A 3FIXA 2B5GB 4L89A 2D4PA 3FNCA 5KTCA 1KUVA 4JLYA 1ON0A 4R87A 4JXQA 1P0HA 3B8GA 2D4OA 1I1DA 5KTAA 2REFA 4CAVA 1K4JA 1YREA 1RO5A 5HMNA 4K30A 1QSTA 4FD6A 1B87A 1MJAA 2AE6A 3R1KA 2BSWA 5IB0A 4NXYA 4ONUA 4KVXA 4JJXA 2OZGA 4XPKA 4E0AA 3T9YA 4FD5A 4PK3A 5EBVA 1Q2DA 3W6SA 2R98A 1IYLA 1CJWA 2HUZA 4JXRA 3TO7A 4II9A 4PK2A 2VEZA 2AJ6A 2GE3A 1S7KA 2BL1A 3TTHA 2RC4A 5I0CA 2Z0ZA 2ZXVA 2JLMA 5CNPA
chains in the Genus database with same CATH superfamily
4FWUA 4CYQA 1GYTA 3IWEA 2CIJA 3NE7A 2C27A 3GLJA 1XRYA 3IEHA 4R9MA 3B3CA 4MBUA 2AFOA 4AG7A 1S7NA 1YMEA 4E2AA 2YNCA 2DEAA 3SJXA 1HDQA 2Q44A 1M1DA 1P4NA 2ARHA 2ZW5A 4JD6A 4E8OA 5D29A 2R1IA 2B3UA 2Z10A 3FBUA 3T90A 4CYOA 4ORFA 1S7FA 4LX9A 5HVFA 1Q2CA 2G3AA 2JDCA 4QC6A 4H89A 1CG2A 2Q4ZA 4A39A 2ZPAA 2QMLA 4HPSA 2AFWA 5D8NA 1Y7RA 4FD4A 3BJ8A 4P45A 1PUAA 2PIYA 3D4UA 1VHEA 4NGRA 4OIWA 4A94A 2B4DA 4MCRA 4F9UA 3K9UA 4X8IA 2Q04A 4W9YA 2VZYA 2HC9A 2NMTA 3DR8A 3KR5A 4IHMA 1Y0YA 1FT7A 4B14A 1VHSA 2PJ5A 3B7IA 1XEBA 3MN8A 3IGRA 5I4MA 2QIRA 4F0YA 2IJZA 3DGVA 5LYIA 5C82A 1N71A 4HNWB 1KUXA 3BI0A 4OC0A 4P10A 4A33A 4U9YA 2GFQA 4UFXA 2K5TA 4OC1A 3SXNA 4MFPA 2VBQA 2Z3MA 3BJ7A 1Z8LA 3NH4A 5H84A 2I00A 3PRTA 2VXKA 1TKJA 2Z3OA 4R6TA 3S6KA 3NE8A 4C2XA 1NMTA 2FSRA 3NH8A 3IIBA 4MFQA 4P4DA 2BCOA 4NJRA 3SXOA 5IX3A 2PJ8A 2EK9A 4KS9A 4M6HA 3B3VA 1FY7A 4UIAA 4OLLA 2YNCC 1HEEA 5E96A 3IU2A 5F48A 3DLJA 1S3ZA 2ZOGA 3D8PA 4FAIA 1TF9A 3QNVA 4MXUA 2PDOA 3IWGA 5GCNA 3EXNA 4BMHA 5CBMA 2EBJA 5KTDA 2C1CA 1MK4A 1S5KA 4ZX8A 4I49A 2Q7BA 2V8DA 1Z8XA 4MHDA 2NSMA 2O28A 2PJ0A 4CRZB 3PFEA 2PJ9A 2V8HA 4CAFA 4YFJA 4H2KA 4M6IA 4KLWA 3TO6A 4DYOA 8CPAA 1KZFA 4R8FA 4XPDC 4NF1A 1Q2YA 1YVKA 2B58A 1U6MA 5J8FA 2WUUA 4B5PB 2X7BA 3NA6A 4HNXB 3RBUA 3ISZA 3SI1A 2EO8A 2VQYA 4MHPA 2PVWA 4FUUA 1QSOA 2JEVA 4R7MA 5K8PA 4X5KA 2REEA 3FYNA 1X10A 1Z9UA 3W6XA 1YQEA 4GS4A 1IU8A 2QECA 5J8CA 4MHZA 3SI0A 4QBJA 2JBKA 4MFKA 4MMOA 3VARA 1Y9WA 3BHXA 2CNTA 2FCKA 2HB6A 2J8RA 3F0AA 1MJBA 1ZLHA 4CRYB 2CTCA 1Z5RA 2IL4A 2BO9A 1YX0A 3QAYA 2HV2A 5JPHA 4C68A 3TFYA 4XPDB 3CDXA 4A32A 4B13A 2B4DB 4C2YA 2V77A 3OWCA 1Z4EA 1IICA 2J8MA 4KSFA 5LRGA 3PBBA 3F8KA 4PXEA 3WT4A 4YGOA 1BOBA 4UFVA 1PCAA 1CPSA 3CXQA 3EFAA 4UA3A 5G20A 2Q7SA 2ZEMA 5JM6A 1YVOA 1NE9A 4MI4A 3IWWA 4M6GA 1NSLA 2XEGA 1ZO0A 1DE4C 3LODA 1KWMA 2FE7A 4UEZA 5CPAA 1IOIA 4PXDA 1R3NA 4M3SA 2PJ6A 4RS2A 1KUYA 5K8MA 2JBJA 1H8LA 1JQGA 2VZZA 4MHNA 4OMEA 1YR0A 3G8WA 5HXDA 2WYRA 2EK8A 4AVAA 1F57A 2ZENA 3LWUA 2PRBA 4ZGYB 2OZUA 3R9GA 2PRQA 4JYWA 3R96A 5JGFA 3SJFA 4B5OA 2CNMA 2P6EA 4YWYA 2WPWA 2PJBA 4CGNA 1I21A 1LOKA 2ZELA 2ZEPA 2CXAA 3CPXA 3FEEA 4XNHC 1YW6A 3FF3A 2XEFA 1BLLE 2IQ6A 2GLJA 2ZEDA 4NSQA 4R3LA 3SJEA 3FH4A 1ZG9A 1FNOA 3LMSA 2F8HA 2ATRA 4OC4A 4YRHA 4NGQA 2H5MA 1OBRA 3IJ3A 4A37A 3IU1A 3TX8A 5BWAB 2J8NA 2BUEA 2PCUA 1M44A 1LRZA 2DXQA 3WC6A 4ZX9A 3ZZIA 2GIVA 2C6CA 1XJOA 1LCPA 4HKFA 2EUIA 1VIXA 4F0XA 2POKA 7CPAA 2O53A 1CBXA 4G1PA 5DWNA 2WZNA 4EMEA 1PYTB 3S9MA 1SQHA 5DWMA 1HDUA 2B5GA 1R43A 4XPLA 3I9SA 5JH9A 1YLEA 4XNHB 3EO4A 3RO0A 2IMOA 1TXRA 4AXVA 4BINA 3SHPA 4KUBA 1VHOA 3D7HA 2DF5A 2PJ2A 4KOTA 1VGYA 4NGPA 2AFSA 2F5IA 3A9LA 4RN7A 1IIDA 2ZW6A 2OH1A 4H6ZA 4H6UA 2PJ4A 4A31A 4KUAA 4K3NA 1QSNA 5F47A 4CYPA 4KSIA 1J4JA 4DNCA 1R57A 2C6GA 4NGNA 4UBRA 2I79A 3JRUA 1TIQA 3GYAA 2OB0A 3L2NA 3PB7X 4R3KA 4UCNA 4P4IA 4MJ8A 3IFEA 3H8EA 1ZG8A 4U9ZA 3BI1A 4CGMA 3S9NA 3TOAA 1Q7LA 1YGHA 4LUAA 3KR4A 2A4NA 4CAEA 4KOXA 3P2HA 1S7LA 4EWTA 2FT0A 2CNSA 3TCVA 3DSBA 3PZJA 3RYOA 4B12A 1RXTA 5F46A 3VWDA 3H8FA 4M85A 1IGBA 2P0WA 3B3TA 4PSWA 1AUGA 4PQAA 1BAVA 2FS5A 2GU2A 3KGQA 5HVGA 1I12A 5A27A 4X2TA 1QSRA 2PJ7A 3FMCA 3TO9A 4F8ZA 3D7GA 4A95A 2OZHA 1YLOA 3H4QA 4KOWA 3D67A 2JDDA 1CP7A 1RTQA 4NGMA 4R57A 2EWBA 4KVME 4GXHA 2G3TA 3VATA 3JTKA 3GB0A 3TE4A 4OP4A 1L0CA 3EC4A 2RFHA 4PSXA 2OU2A 2PIZA 3DDDA 4MCQA 4PXBA 1IB1E 1LAPA 5FVJA 2CTBA 2ZW4A 2F7VA 3FXTA 1Y7EA 2YNDA 1IYKA 3UY5A 2WSAA 3WC7A 1M4DA 1XBUA 1V0CA 4L8AA 4QB9A 3B35A 4CGLA 4AG9A 4JZ0A 1XFOA 1DTDA 2Z3LA 3MGDA 4BBHA 3F5BA 1QQ9A 2FIAA 3KL9A 4NGTA 2KCWA 5G1ZA 1YSJA 2Z3PA 4A2ZA 1WK4A 4OC5A 4NFRA 1Y0RA 3FVLA 4MHYA 4AB7A 5EMIA 4PXCA 4AVCA 4ZBGA 3QB8A 2EVNA 1MJ9A 1TF8A 4NCZA 2B4BA 4HNYB 2PR1A 4X3RA 4OIDA 2GLFA 3ISXA 1GHEA 3MRUA 4QUSA 2PQ8A 3R9EA 3S6FA 2Q4VA 3V8IA 1IOFA 4C7HA 2ZEHA 1ARLA 4AVBA 3IO1A 3W91A 3K9TA 3JVNA 2V8GA 5AG6A 2WPXA 3KKWA 5LYDA 2PJ3A 4IUSA 3PGPA 2XEIA 4B6ZA 4Z65A 5HVHA 3KHZA 4IK2A 3PB8X 1ELMP 2C6PA 4UWIA 1YW4A 1F2OA 5A28A 3R9FA 1NSAA 4B11A 4CYNA 2HQYA 4DJLA 4KSAA 2FVGA 4OC2A 3CT9A 3NH5A 1CX8A 1IY7A 2ZEOA 3RZAA 4NEXA 1ELLP 3KASA 2PE3A 3FECA 5K8NA 3KI9A 4JWPA 1WWZA 3TOBA 3G3SA 3D7FA 3BLNA 5LYFA 2ZEFA 4IF5A 4NGSA 4P44A 5H86A 4ZY0A 4KOVA 4KVOE 2NYQA 2OR4A 3S6HA 3ZJ0A 3TC8A 2RB7A 5LRKA 2R7HA 4IAVA 3FJUA 3PB6X 3WC5A 1Z2LA 2Q0YA 3NFZA 2AFMA 2YGWA 5AG5A 1Z8WA 4YU9A 4TWEA 4TNUA 5EC4A 2GANA 2P6FA 1AMPA 4UCMA 2QVPA 3FB3A 2Z3NA 4UWJA 5K8OA 4KOSA 4FD7A 3S6GA 2ZEEA 3WABA 1XMBA 2FL4A 4ZYQA 2Z11A 4EVYA 2VL1A 3EY5A 2PR8A 4PPZA 4WJBA 4B5PA 4CAXA 3VWEA 1Y9KA 2FXFA 3B3WA 4R76A 3WR7A 4OC3A 3P2FA 4RI1A 2J9AA 3D3SA 1QSMA 3HLPA 3T8WA 1ZG7A 3LD2A 3N5FA 4WWVA 4CGPA 4LQGA 1M4GA 2B3VA 3D2MA 4CPAA 3SJGA 4A38A 1LFWA 4J3GA 1XOVA 2ABZA 2PJ1A 2PSWA 3PP9A 4MFJA 4Q36A 2I3CA 2PC1A 3H8GA 3KQXA 4KOYA 3B3SA 3SI2A 1ARMA 3CXPA 1M4LA 2ZW7A 4KOUA 5C88A 2OOTA 3K2KA 4OKOA 3QAHA 1JWQA 1Z8TA 2ZOFA 2YNEA 4UIBA 1OZPA 2FIWA 1EE3P 2G0BA 2Y0MA 3CXSA 4KORA 1TKFA 1QMUA 2GREA 2QJ8A 1M4IA 2QYVA 4UEEA 4MFZA 3R95A 1VKCA 2BEIA 2R8VA 4Q7AA 3GKRA 4CS0B 3N7ZA 1LANA 4ZY2A 5LRJA 3KHXA 2Q4YA 5IV0A 2Q43A 4NJQA 1A2ZA 5AGEA 3V38A 3TT2A 1BPNA 2PJCA 4KZTA 4MY3A 4Q38A 2PJAA 3D2PA 2ANPA 3D66A 4BD9A 4PV6A 4P4BA 4U5YA 1BPMA 1XIXA 2JEWA 4UEFA 5F49A 1XF8A 3GUXA 1XE4A 1YK3A 3CZXA 2VI7A 4Y49C 1XMTA 1S60A 3V7ZA 5ISVA 2CF4A 3HUVA 4CAWA 1PU9A 1Z4RA 3S9LA 1UWYA 3JUWA 5AG7A 3PFOA 1CM0A 4LQ6A 2Q51A 3I3GA 4MY0A 3FRMA 3VH9A 4MCPA 2G9DA 5HH1A 4F6AA 3PB9X 2PVVA 1CPXA 3DR6A 4QVTA 2CY2A 3DNSA 4P4JA 5JQ4A 1UFHA 4ZI6A 2P6GA 4OAEA 1TKHA 4FBEA 1F2PA 4KLVA 3C26A 4OADA 6CPAA 4O23A 1B6BA 4F9VA 3KZWA 4Y49B 4EFDA 5IB9A 1BO4A 2DPTA 3H5ZA 3RNZA 4C2ZA 5LYLA 3E0KA 3GY9A 4ZY1A 3FIXA 2B5GB 4ONWA 4P4FA 5DS0A 4L89A 2D4PA 1CP6A 3FNCA 4MFLA 5KTCA 4CGOA 1KUVA 4A30A 4JLYA 1ON0A 4MCSA 4R87A 4C7IA 5J1QA 2O4HA 3I1UA 4GM5A 4JXQA 1P0HA 4P6YA 3B8GA 2D4OA 1I1DA 1X12A 5KTAA 2XEJA 4DUKA 2REFA 4CAVA 2BOAA 3KQZA 1K4JA 1YREA 3CPAA 2Z3KA 1LAMA 3IC1A 5G22A 1ZLIA 3D68A 3FEDA 1RO5A 5THWA 2ODFA 5AG4A 3RAMA 5HMNA 2V8VA 4K30A 3B2YA 1QSTA 3BXMA 3PBEA 4FD6A 1B87A 4RUHA 1MJAA 2AE6A 3PB4X 3R1KA 5F09A 2BSWA 5IB0A 2DPSA 5ELYA 3GIUA 4NXYA 3PEIA 3D7DA 4UCPA 4ONUA 4UFWA 4KVXA 4JJXA 2OZGA 4XPKA 1AYEA 2AFXA 4E0AA 3T9YA 4FD5A 4PK3A 5EBVA 1Q2DA 3W6SA 2R98A 2AFUA 3LACA 3FX6A 1IYLA 1CJWA 2HUZA 4JXRA 2ZEGA 4P4EA 4UF4A 3TO7A 4PK2A 4B10A 4II9A 2AFZA 2VEZA 2AJ6A 2GE3A 1S7KA 2BL1A 3TTHA 2RC4A 4MRIA 5I0CA 2Z0ZA 2ZXVA 2JLMA 5CNPA 5G21A
chains in the Genus database with same CATH topology
4CYQA 3IWEA 3NE7A 2C27A 4R9MA 4MBUA 4E2AA 4AG7A 1S7NA 2YNCA 2Q44A 1M1DA 1P4NA 2ARHA 2ZW5A 4JD6A 4E8OA 2R1IA 2B3UA 2Z10A 3FBUA 3T90A 4CYOA 4ORFA 1S7FA 4LX9A 1Q2CA 2G3AA 2JDCA 4QC6A 4H89A 2ZPAA 2QMLA 1Y7RA 4FD4A 3BJ8A 1PUAA 2B4DA 3K9UA 2Q04A 2VZYA 2NMTA 3DR8A 4B14A 1VHSA 1XEBA 3IGRA 2QIRA 4F0YA 5C82A 1N71A 4HNWB 1KUXA 4A33A 4U9YA 4UFXA 2K5TA 3SXNA 4MFPA 2VBQA 2Z3MA 3BJ7A 5H84A 2I00A 2VXKA 2Z3OA 3S6KA 4C2XA 1NMTA 2FSRA 4MFQA 3SXOA 5IX3A 4KS9A 1FY7A 4OLLA 2YNCC 5F48A 5E96A 3IU2A 1S3ZA 3D8PA 2PDOA 3IWGA 5GCNA 3EXNA 4BMHA 5KTDA 1MK4A 1S5KA 4I49A 2Q7BA 4MHDA 2O28A 4CRZB 4YFJA 4CAFA 4KLWA 3TO6A 1KZFA 4XPDC 4NF1A 1Q2YA 1YVKA 2B58A 1U6MA 5J8FA 2WUUA 4B5PB 2X7BA 4HNXB 2VQYA 1QSOA 2JEVA 4X5KA 2REEA 3FYNA 1Z9UA 3W6XA 4GS4A 2QECA 5J8CA 4QBJA 4MFKA 1Y9WA 2CNTA 2FCKA 2J8RA 3F0AA 1MJBA 4CRYB 3TFYA 2IL4A 5JPHA 1YX0A 2HV2A 4C68A 4XPDB 4A32A 4B13A 2B4DB 4C2YA 3OWCA 1Z4EA 1IICA 2J8MA 4KSFA 3F8KA 4YGOA 1BOBA 4UFVA 3CXQA 4UA3A 3EFAA 5G20A 1YVOA 1NE9A 4MI4A 1NSLA 1ZO0A 3LODA 2FE7A 4M3SA 4RS2A 1KUYA 2VZZA 1YR0A 3G8WA 4AVAA 2PRBA 4ZGYB 2OZUA 3R9GA 3R96A 4B5OA 2CNMA 2P6EA 2WPWA 4CGNA 1I21A 2CXAA 4XNHC 4R3LA 4NSQA 2ATRA 4YRHA 2H5MA 3IU1A 5BWAB 2J8NA 2BUEA 1M44A 1LRZA 2DXQA 3ZZIA 2GIVA 4HKFA 2EUIA 4F0XA 5DWNA 1SQHA 5DWMA 2B5GA 4XPLA 3I9SA 1YLEA 4XNHB 3EO4A 3SHPA 4KUBA 4KOTA 2F5IA 3A9LA 1IIDA 2ZW6A 2OH1A 4H6ZA 4H6UA 4A31A 4KUAA 1QSNA 5F47A 4CYPA 1J4JA 4DNCA 1R57A 4UBRA 2I79A 4UCNA 1TIQA 3GYAA 2OB0A 4R3KA 4MJ8A 4U9ZA 4CGMA 3TOAA 1YGHA 4LUAA 2A4NA 4CAEA 4KOXA 3P2HA 1S7LA 2FT0A 2CNSA 3TCVA 3DSBA 3PZJA 3RYOA 4B12A 1RXTA 5F46A 3VWDA 4M85A 4PSWA 2P0WA 2FS5A 1I12A 5A27A 1QSRA 3TO9A 4A95A 2OZHA 3H4QA 4KOWA 2JDDA 4R57A 4KVME 2G3TA 3JTKA 3TE4A 1L0CA 3EC4A 4PSXA 2OU2A 3DDDA 5FVJA 1IB1E 2ZW4A 3FXTA 2YNDA 1IYKA 3UY5A 2WSAA 1M4DA 4L8AA 1V0CA 4QB9A 4CGLA 4AG9A 2Z3LA 3MGDA 4BBHA 3F5BA 2FIAA 2KCWA 5G1ZA 2Z3PA 4A2ZA 1WK4A 4AB7A 4AVCA 4ZBGA 3QB8A 2EVNA 1MJ9A 4NCZA 2B4BA 4HNYB 2PR1A 1GHEA 4QUSA 2PQ8A 3R9EA 3S6FA 2Q4VA 3V8IA 4C7HA 4AVBA 3W91A 3JVNA 5AG6A 2WPXA 3KKWA 4IUSA 3PGPA 4UWIA 5A28A 3R9FA 4B11A 4CYNA 2HQYA 4KSAA 4NEXA 4JWPA 1WWZA 3TOBA 3G3SA 3BLNA 4IF5A 5H86A 4KOVA 4KVOE 3S6HA 3ZJ0A 2R7HA 2Q0YA 2YGWA 5AG5A 5EC4A 2GANA 2P6FA 4UCMA 3FB3A 2Z3NA 4UWJA 4KOSA 4FD7A 3S6GA 2FL4A 2Z11A 4EVYA 3EY5A 2PR8A 4B5PA 4CAXA 3VWEA 1Y9KA 2FXFA 3WR7A 3P2FA 4RI1A 3D3SA 1QSMA 3LD2A 4CGPA 1M4GA 2B3VA 3D2MA 4J3GA 2PSWA 3PP9A 4MFJA 4Q36A 2PC1A 4KOYA 5C88A 3CXPA 4KOUA 2ZW7A 3QAHA 2YNEA 1OZPA 2FIWA 2G0BA 2Y0MA 3CXSA 4KORA 1M4IA 3R95A 4MFZA 1VKCA 2BEIA 2R8VA 3GKRA 4CS0B 3N7ZA 2Q4YA 5IV0A 5AGEA 3TT2A 4KZTA 4MY3A 4Q38A 3D2PA 4PV6A 4U5YA 1XIXA 5F49A 1XF8A 1XE4A 1YK3A 2VI7A 4Y49C 1XMTA 1S60A 5ISVA 4CAWA 1PU9A 1Z4RA 3JUWA 5AG7A 1CM0A 4MY0A 3I3GA 3FRMA 5HH1A 4F6AA 3DR6A 4QVTA 2CY2A 3DNSA 5JQ4A 1UFHA 2P6GA 4OAEA 4KLVA 3C26A 4OADA 1B6BA 4Y49B 1BO4A 2DPTA 3H5ZA 4C2ZA 3E0KA 3GY9A 3FIXA 2B5GB 4L89A 2D4PA 3FNCA 4MFLA 5KTCA 4CGOA 1KUVA 4A30A 4JLYA 1ON0A 4R87A 4C7IA 4JXQA 1P0HA 3B8GA 2D4OA 1I1DA 5KTAA 2REFA 4CAVA 1K4JA 1YREA 2Z3KA 5G22A 1RO5A 5AG4A 5HMNA 4K30A 1QSTA 4FD6A 1B87A 1MJAA 2AE6A 3R1KA 2BSWA 5IB0A 2DPSA 4NXYA 4UCPA 4ONUA 4UFWA 4KVXA 4JJXA 2OZGA 4XPKA 4E0AA 3T9YA 4FD5A 4PK3A 5EBVA 1Q2DA 3W6SA 2R98A 1IYLA 1CJWA 2HUZA 4JXRA 3TO7A 4II9A 4PK2A 4B10A 2VEZA 2AJ6A 2GE3A 1S7KA 2BL1A 3TTHA 2RC4A 5I0CA 2Z0ZA 2ZXVA 2JLMA 5CNPA 5G21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NE7 A;  2C27 A;  4R9M A;  4MBU A;  4E2A A;  4AG7 A;  1S7N A;  2Q44 A;  1M1D A;  1P4N A;  2ARH A;  2ZW5 A;  4JD6 A;  4E8O A;  2R1I A;  2B3U A;  2Z10 A;  3FBU A;  3T90 A;  4ORF A;  1S7F A;  4LX9 A;  1Q2C A;  2G3A A;  2JDC A;  4QC6 A;  4H89 A;  2ZPA A;  2QML A;  1Y7R A;  4FD4 A;  3BJ8 A;  1PUA A;  2B4D A;  3K9U A;  2Q04 A;  2VZY A;  2NMT A;  3DR8 A;  1VHS A;  1XEB A;  3IGR A;  2QIR A;  4F0Y A;  5C82 A;  1N71 A;  4HNW B;  1KUX A;  4U9Y A;  2K5T A;  3SXN A;  2VBQ A;  3BJ7 A;  5H84 A;  2I00 A;  2VXK A;  3S6K A;  1NMT A;  2FSR A;  3SXO A;  5IX3 A;  1FY7 A;  4OLL A;  5F48 A;  5E96 A;  1S3Z A;  3D8P A;  2PDO A;  3IWG A;  5GCN A;  3EXN A;  4BMH A;  5KTD A;  1MK4 A;  1S5K A;  4I49 A;  2Q7B A;  4MHD A;  2O28 A;  4CRZ B;  4YFJ A;  4KLW A;  3TO6 A;  1KZF A;  4XPD C;  4NF1 A;  1Q2Y A;  1YVK A;  2B58 A;  1U6M A;  5J8F A;  4B5P B;  2X7B A;  4HNX B;  2VQY A;  1QSO A;  2JEV A;  4X5K A;  2REE A;  3FYN A;  1Z9U A;  3W6X A;  4GS4 A;  2QEC A;  5J8C A;  4QBJ A;  1Y9W A;  2CNT A;  2FCK A;  2J8R A;  3F0A A;  1MJB A;  4CRY B;  3TFY A;  2IL4 A;  5JPH A;  1YX0 A;  2HV2 A;  4XPD B;  2B4D B;  3OWC A;  1Z4E A;  1IIC A;  2J8M A;  3F8K A;  4YGO A;  1BOB A;  3CXQ A;  4UA3 A;  3EFA A;  1YVO A;  1NE9 A;  4MI4 A;  1NSL A;  3LOD A;  2FE7 A;  4M3S A;  4RS2 A;  1KUY A;  2VZZ A;  1YR0 A;  3G8W A;  4AVA A;  2PRB A;  2OZU A;  3R9G A;  3R96 A;  4B5O A;  2CNM A;  2P6E A;  2WPW A;  1I21 A;  4XNH C;  4R3L A;  4NSQ A;  2ATR A;  4YRH A;  2H5M A;  2J8N A;  2BUE A;  1M44 A;  1LRZ A;  2DXQ A;  3ZZI A;  2GIV A;  4HKF A;  2EUI A;  5DWN A;  1SQH A;  5DWM A;  2B5G A;  4XPL A;  3I9S A;  1YLE A;  4XNH B;  3EO4 A;  3SHP A;  4KUB A;  4KOT A;  2F5I A;  1IID A;  2ZW6 A;  2OH1 A;  4H6Z A;  4H6U A;  4KUA A;  1QSN A;  5F47 A;  1J4J A;  4DNC A;  1R57 A;  4UBR A;  2I79 A;  1TIQ A;  3GYA A;  2OB0 A;  4R3K A;  4MJ8 A;  4U9Z A;  3TOA A;  4LUA A;  1YGH A;  2A4N A;  4KOX A;  3P2H A;  1S7L A;  2FT0 A;  2CNS A;  3TCV A;  3DSB A;  3PZJ A;  3RYO A;  1RXT A;  5F46 A;  3VWD A;  4M85 A;  4PSW A;  2P0W A;  2FS5 A;  1I12 A;  1QSR A;  3TO9 A;  2OZH A;  3H4Q A;  4KOW A;  2JDD A;  4R57 A;  4KVM E;  2G3T A;  3TE4 A;  1L0C A;  3EC4 A;  4PSX A;  2OU2 A;  3DDD A;  5FVJ A;  1IB1 E;  2ZW4 A;  3FXT A;  3UY5 A;  1IYK A;  1M4D A;  4L8A A;  1V0C A;  4QB9 A;  4AG9 A;  3MGD A;  3F5B A;  2FIA A;  2KCW A;  1WK4 A;  4AB7 A;  4AVC A;  4ZBG A;  3QB8 A;  2EVN A;  1MJ9 A;  4NCZ A;  2B4B A;  4HNY B;  2PR1 A;  1GHE A;  4QUS A;  2PQ8 A;  3R9E A;  3S6F A;  2Q4V A;  3V8I A;  4AVB A;  3W91 A;  3JVN A;  2WPX A;  3KKW A;  4IUS A;  3PGP A;  4UWI A;  3R9F A;  2HQY A;  4NEX A;  4JWP A;  1WWZ A;  3TOB A;  3G3S A;  3BLN A;  4IF5 A;  5H86 A;  4KOV A;  4KVO E;  3S6H A;  3ZJ0 A;  2R7H A;  2Q0Y A;  5EC4 A;  2GAN A;  2P6F A;  3FB3 A;  4UWJ A;  4KOS A;  4FD7 A;  3S6G A;  2FL4 A;  2Z11 A;  4EVY A;  3EY5 A;  2PR8 A;  4B5P A;  4CAX A;  3VWE A;  1Y9K A;  2FXF A;  3WR7 A;  3P2F A;  4RI1 A;  3D3S A;  1QSM A;  3LD2 A;  1M4G A;  2B3V A;  3D2M A;  4J3G A;  2PSW A;  3PP9 A;  2PC1 A;  4KOY A;  5C88 A;  3CXP A;  4KOU A;  2ZW7 A;  3QAH A;  1OZP A;  2FIW A;  2G0B A;  2Y0M A;  3CXS A;  4KOR A;  1M4I A;  3R95 A;  1VKC A;  2BEI A;  2R8V A;  3GKR A;  4CS0 B;  3N7Z A;  2Q4Y A;  5IV0 A;  3TT2 A;  4KZT A;  4MY3 A;  3D2P A;  4PV6 A;  4U5Y A;  1XIX A;  5F49 A;  1XF8 A;  1XE4 A;  1YK3 A;  2VI7 A;  4Y49 C;  1XMT A;  1S60 A;  5ISV A;  4CAW A;  1PU9 A;  1Z4R A;  3JUW A;  1CM0 A;  4MY0 A;  3I3G A;  3FRM A;  5HH1 A;  4F6A A;  3DR6 A;  4QVT A;  2CY2 A;  3DNS A;  5JQ4 A;  1UFH A;  2P6G A;  4OAE A;  4KLV A;  3C26 A;  4OAD A;  1B6B A;  4Y49 B;  1BO4 A;  3E0K A;  3GY9 A;  3FIX A;  2B5G B;  4L89 A;  2D4P A;  3FNC A;  5KTC A;  1KUV A;  4JLY A;  1ON0 A;  4R87 A;  4JXQ A;  1P0H A;  3B8G A;  2D4O A;  1I1D A;  5KTA A;  2REF A;  4CAV A;  1K4J A;  1YRE A;  1RO5 A;  5HMN A;  4K30 A;  1QST A;  4FD6 A;  1B87 A;  1MJA A;  2AE6 A;  3R1K A;  2BSW A;  5IB0 A;  4NXY A;  4ONU A;  4KVX A;  4JJX A;  2OZG A;  4XPK A;  4E0A A;  3T9Y A;  4FD5 A;  4PK3 A;  5EBV A;  1Q2D A;  3W6S A;  2R98 A;  1IYL A;  1CJW A;  2HUZ A;  4JXR A;  3TO7 A;  4II9 A;  4PK2 A;  2VEZ A;  2AJ6 A;  2GE3 A;  1S7K A;  2BL1 A;  3TTH A;  2RC4 A;  5I0C A;  2Z0Z A;  2ZXV A;  2JLM A;  5CNP A; 
#chains in the Genus database with same CATH topology
 4FWU A;  4CYQ A;  1GYT A;  3IWE A;  2CIJ A;  3NE7 A;  2C27 A;  3GLJ A;  1XRY A;  3IEH A;  4R9M A;  3B3C A;  4MBU A;  2AFO A;  4AG7 A;  1S7N A;  1YME A;  4E2A A;  2YNC A;  2DEA A;  3SJX A;  1HDQ A;  2Q44 A;  1M1D A;  1P4N A;  2ARH A;  2ZW5 A;  4JD6 A;  4E8O A;  5D29 A;  2R1I A;  2B3U A;  2Z10 A;  3FBU A;  3T90 A;  4CYO A;  4ORF A;  1S7F A;  4LX9 A;  5HVF A;  1Q2C A;  2G3A A;  2JDC A;  4QC6 A;  4H89 A;  1CG2 A;  2Q4Z A;  4A39 A;  2ZPA A;  2QML A;  4HPS A;  2AFW A;  5D8N A;  1Y7R A;  4FD4 A;  3BJ8 A;  4P45 A;  1PUA A;  2PIY A;  3D4U A;  1VHE A;  4NGR A;  4OIW A;  4A94 A;  2B4D A;  4MCR A;  4F9U A;  3K9U A;  4X8I A;  2Q04 A;  4W9Y A;  2VZY A;  2HC9 A;  2NMT A;  3DR8 A;  3KR5 A;  4IHM A;  1Y0Y A;  1FT7 A;  4B14 A;  1VHS A;  2PJ5 A;  3B7I A;  1XEB A;  3MN8 A;  3IGR A;  5I4M A;  2QIR A;  4F0Y A;  2IJZ A;  3DGV A;  5LYI A;  5C82 A;  1N71 A;  4HNW B;  1KUX A;  3BI0 A;  4OC0 A;  4P10 A;  4A33 A;  4U9Y A;  2GFQ A;  4UFX A;  2K5T A;  4OC1 A;  3SXN A;  4MFP A;  2VBQ A;  2Z3M A;  3BJ7 A;  1Z8L A;  3NH4 A;  5H84 A;  2I00 A;  3PRT A;  2VXK A;  1TKJ A;  2Z3O A;  4R6T A;  3S6K A;  3NE8 A;  4C2X A;  1NMT A;  2FSR A;  3NH8 A;  3IIB A;  4MFQ A;  4P4D A;  2BCO A;  4NJR A;  3SXO A;  5IX3 A;  2PJ8 A;  2EK9 A;  4KS9 A;  4M6H A;  3B3V A;  1FY7 A;  4UIA A;  4OLL A;  2YNC C;  1HEE A;  5E96 A;  3IU2 A;  5F48 A;  3DLJ A;  1S3Z A;  2ZOG A;  3D8P A;  4FAI A;  1TF9 A;  3QNV A;  4MXU A;  2PDO A;  3IWG A;  5GCN A;  3EXN A;  4BMH A;  5CBM A;  2EBJ A;  5KTD A;  2C1C A;  1MK4 A;  1S5K A;  4ZX8 A;  4I49 A;  2Q7B A;  2V8D A;  1Z8X A;  4MHD A;  2NSM A;  2O28 A;  2PJ0 A;  4CRZ B;  3PFE A;  2PJ9 A;  2V8H A;  4CAF A;  4YFJ A;  4H2K A;  4M6I A;  4KLW A;  3TO6 A;  4DYO A;  8CPA A;  1KZF A;  4R8F A;  4XPD C;  4NF1 A;  1Q2Y A;  1YVK A;  2B58 A;  1U6M A;  5J8F A;  2WUU A;  4B5P B;  2X7B A;  3NA6 A;  4HNX B;  3RBU A;  3ISZ A;  3SI1 A;  2EO8 A;  2VQY A;  4MHP A;  2PVW A;  4FUU A;  1QSO A;  2JEV A;  4R7M A;  5K8P A;  4X5K A;  2REE A;  3FYN A;  1X10 A;  1Z9U A;  3W6X A;  1YQE A;  4GS4 A;  1IU8 A;  2QEC A;  5J8C A;  4MHZ A;  3SI0 A;  4QBJ A;  2JBK A;  4MFK A;  4MMO A;  3VAR A;  1Y9W A;  3BHX A;  2CNT A;  2FCK A;  2HB6 A;  2J8R A;  3F0A A;  1MJB A;  1ZLH A;  4CRY B;  2CTC A;  1Z5R A;  2IL4 A;  2BO9 A;  1YX0 A;  3QAY A;  2HV2 A;  5JPH A;  4C68 A;  3TFY A;  4XPD B;  3CDX A;  4A32 A;  4B13 A;  2B4D B;  4C2Y A;  2V77 A;  3OWC A;  1Z4E A;  1IIC A;  2J8M A;  4KSF A;  5LRG A;  3PBB A;  3F8K A;  4PXE A;  3WT4 A;  4YGO A;  1BOB A;  4UFV A;  1PCA A;  1CPS A;  3CXQ A;  3EFA A;  4UA3 A;  5G20 A;  2Q7S A;  2ZEM A;  5JM6 A;  1YVO A;  1NE9 A;  4MI4 A;  3IWW A;  4M6G A;  1NSL A;  2XEG A;  1ZO0 A;  1DE4 C;  3LOD A;  1KWM A;  2FE7 A;  4UEZ A;  5CPA A;  1IOI A;  4PXD A;  1R3N A;  4M3S A;  2PJ6 A;  4RS2 A;  1KUY A;  5K8M A;  2JBJ A;  1H8L A;  1JQG A;  2VZZ A;  4MHN A;  4OME A;  1YR0 A;  3G8W A;  5HXD A;  2WYR A;  2EK8 A;  4AVA A;  1F57 A;  2ZEN A;  3LWU A;  2PRB A;  4ZGY B;  2OZU A;  3R9G A;  2PRQ A;  4JYW A;  3R96 A;  5JGF A;  3SJF A;  4B5O A;  2CNM A;  2P6E A;  4YWY A;  2WPW A;  2PJB A;  4CGN A;  1I21 A;  1LOK A;  2ZEL A;  2ZEP A;  2CXA A;  3CPX A;  3FEE A;  4XNH C;  1YW6 A;  3FF3 A;  2XEF A;  1BLL E;  2IQ6 A;  2GLJ A;  2ZED A;  4NSQ A;  4R3L A;  3SJE A;  3FH4 A;  1ZG9 A;  1FNO A;  3LMS A;  2F8H A;  2ATR A;  4OC4 A;  4YRH A;  4NGQ A;  2H5M A;  1OBR A;  3IJ3 A;  4A37 A;  3IU1 A;  3TX8 A;  5BWA B;  2J8N A;  2BUE A;  2PCU A;  1M44 A;  1LRZ A;  2DXQ A;  3WC6 A;  4ZX9 A;  3ZZI A;  2GIV A;  2C6C A;  1XJO A;  1LCP A;  4HKF A;  2EUI A;  1VIX A;  4F0X A;  2POK A;  7CPA A;  2O53 A;  1CBX A;  4G1P A;  5DWN A;  2WZN A;  4EME A;  1PYT B;  3S9M A;  1SQH A;  5DWM A;  1HDU A;  2B5G A;  1R43 A;  4XPL A;  3I9S A;  5JH9 A;  1YLE A;  4XNH B;  3EO4 A;  3RO0 A;  2IMO A;  1TXR A;  4AXV A;  4BIN A;  3SHP A;  4KUB A;  1VHO A;  3D7H A;  2DF5 A;  2PJ2 A;  4KOT A;  1VGY A;  4NGP A;  2AFS A;  2F5I A;  3A9L A;  4RN7 A;  1IID A;  2ZW6 A;  2OH1 A;  4H6Z A;  4H6U A;  2PJ4 A;  4A31 A;  4KUA A;  4K3N A;  1QSN A;  5F47 A;  4CYP A;  4KSI A;  1J4J A;  4DNC A;  1R57 A;  2C6G A;  4NGN A;  4UBR A;  2I79 A;  3JRU A;  1TIQ A;  3GYA A;  2OB0 A;  3L2N A;  3PB7 X;  4R3K A;  4UCN A;  4P4I A;  4MJ8 A;  3IFE A;  3H8E A;  1ZG8 A;  4U9Z A;  3BI1 A;  4CGM A;  3S9N A;  3TOA A;  1Q7L A;  1YGH A;  4LUA A;  3KR4 A;  2A4N A;  4CAE A;  4KOX A;  3P2H A;  1S7L A;  4EWT A;  2FT0 A;  2CNS A;  3TCV A;  3DSB A;  3PZJ A;  3RYO A;  4B12 A;  1RXT A;  5F46 A;  3VWD A;  3H8F A;  4M85 A;  1IGB A;  2P0W A;  3B3T A;  4PSW A;  1AUG A;  4PQA A;  1BAV A;  2FS5 A;  2GU2 A;  3KGQ A;  5HVG A;  1I12 A;  5A27 A;  4X2T A;  1QSR A;  2PJ7 A;  3FMC A;  3TO9 A;  4F8Z A;  3D7G A;  4A95 A;  2OZH A;  1YLO A;  3H4Q A;  4KOW A;  3D67 A;  2JDD A;  1CP7 A;  1RTQ A;  4NGM A;  4R57 A;  2EWB A;  4KVM E;  4GXH A;  2G3T A;  3VAT A;  3JTK A;  3GB0 A;  3TE4 A;  4OP4 A;  1L0C A;  3EC4 A;  2RFH A;  4PSX A;  2OU2 A;  2PIZ A;  3DDD A;  4MCQ A;  4PXB A;  1IB1 E;  1LAP A;  5FVJ A;  2CTB A;  2ZW4 A;  2F7V A;  3FXT A;  1Y7E A;  2YND A;  1IYK A;  3UY5 A;  2WSA A;  3WC7 A;  1M4D A;  1XBU A;  1V0C A;  4L8A A;  4QB9 A;  3B35 A;  4CGL A;  4AG9 A;  4JZ0 A;  1XFO A;  1DTD A;  2Z3L A;  3MGD A;  4BBH A;  3F5B A;  1QQ9 A;  2FIA A;  3KL9 A;  4NGT A;  2KCW A;  5G1Z A;  1YSJ A;  2Z3P A;  4A2Z A;  1WK4 A;  4OC5 A;  4NFR A;  1Y0R A;  3FVL A;  4MHY A;  4AB7 A;  5EMI A;  4PXC A;  4AVC A;  4ZBG A;  3QB8 A;  2EVN A;  1MJ9 A;  1TF8 A;  4NCZ A;  2B4B A;  4HNY B;  2PR1 A;  4X3R A;  4OID A;  2GLF A;  3ISX A;  1GHE A;  3MRU A;  4QUS A;  2PQ8 A;  3R9E A;  3S6F A;  2Q4V A;  3V8I A;  1IOF A;  4C7H A;  2ZEH A;  1ARL A;  4AVB A;  3IO1 A;  3W91 A;  3K9T A;  3JVN A;  2V8G A;  5AG6 A;  2WPX A;  3KKW A;  5LYD A;  2PJ3 A;  4IUS A;  3PGP A;  2XEI A;  4B6Z A;  4Z65 A;  5HVH A;  3KHZ A;  4IK2 A;  3PB8 X;  1ELM P;  2C6P A;  4UWI A;  1YW4 A;  1F2O A;  5A28 A;  3R9F A;  1NSA A;  4B11 A;  4CYN A;  2HQY A;  4DJL A;  4KSA A;  2FVG A;  4OC2 A;  3CT9 A;  3NH5 A;  1CX8 A;  1IY7 A;  2ZEO A;  3RZA A;  4NEX A;  1ELL P;  3KAS A;  2PE3 A;  3FEC A;  5K8N A;  3KI9 A;  4JWP A;  1WWZ A;  3TOB A;  3G3S A;  3D7F A;  3BLN A;  5LYF A;  2ZEF A;  4IF5 A;  4NGS A;  4P44 A;  5H86 A;  4ZY0 A;  4KOV A;  4KVO E;  2NYQ A;  2OR4 A;  3S6H A;  3ZJ0 A;  3TC8 A;  2RB7 A;  5LRK A;  2R7H A;  4IAV A;  3FJU A;  3PB6 X;  3WC5 A;  1Z2L A;  2Q0Y A;  3NFZ A;  2AFM A;  2YGW A;  5AG5 A;  1Z8W A;  4YU9 A;  4TWE A;  4TNU A;  5EC4 A;  2GAN A;  2P6F A;  1AMP A;  4UCM A;  2QVP A;  3FB3 A;  2Z3N A;  4UWJ A;  5K8O A;  4KOS A;  4FD7 A;  3S6G A;  2ZEE A;  3WAB A;  1XMB A;  2FL4 A;  4ZYQ A;  2Z11 A;  4EVY A;  2VL1 A;  3EY5 A;  2PR8 A;  4PPZ A;  4WJB A;  4B5P A;  4CAX A;  3VWE A;  1Y9K A;  2FXF A;  3B3W A;  4R76 A;  3WR7 A;  4OC3 A;  3P2F A;  4RI1 A;  2J9A A;  3D3S A;  1QSM A;  3HLP A;  3T8W A;  1ZG7 A;  3LD2 A;  3N5F A;  4WWV A;  4CGP A;  4LQG A;  1M4G A;  2B3V A;  3D2M A;  4CPA A;  3SJG A;  4A38 A;  1LFW A;  4J3G A;  1XOV A;  2ABZ A;  2PJ1 A;  2PSW A;  3PP9 A;  4MFJ A;  4Q36 A;  2I3C A;  2PC1 A;  3H8G A;  3KQX A;  4KOY A;  3B3S A;  3SI2 A;  1ARM A;  3CXP A;  1M4L A;  2ZW7 A;  4KOU A;  5C88 A;  2OOT A;  3K2K A;  4OKO A;  3QAH A;  1JWQ A;  1Z8T A;  2ZOF A;  2YNE A;  4UIB A;  1OZP A;  2FIW A;  1EE3 P;  2G0B A;  2Y0M A;  3CXS A;  4KOR A;  1TKF A;  1QMU A;  2GRE A;  2QJ8 A;  1M4I A;  2QYV A;  4UEE A;  4MFZ A;  3R95 A;  1VKC A;  2BEI A;  2R8V A;  4Q7A A;  3GKR A;  4CS0 B;  3N7Z A;  1LAN A;  4ZY2 A;  5LRJ A;  3KHX A;  2Q4Y A;  5IV0 A;  2Q43 A;  4NJQ A;  1A2Z A;  5AGE A;  3V38 A;  3TT2 A;  1BPN A;  2PJC A;  4KZT A;  4MY3 A;  4Q38 A;  2PJA A;  3D2P A;  2ANP A;  3D66 A;  4BD9 A;  4PV6 A;  4P4B A;  4U5Y A;  1BPM A;  1XIX A;  2JEW A;  4UEF A;  5F49 A;  1XF8 A;  3GUX A;  1XE4 A;  1YK3 A;  3CZX A;  2VI7 A;  4Y49 C;  1XMT A;  1S60 A;  3V7Z A;  5ISV A;  2CF4 A;  3HUV A;  4CAW A;  1PU9 A;  1Z4R A;  3S9L A;  1UWY A;  3JUW A;  5AG7 A;  3PFO A;  1CM0 A;  4LQ6 A;  2Q51 A;  3I3G A;  4MY0 A;  3FRM A;  3VH9 A;  4MCP A;  2G9D A;  5HH1 A;  4F6A A;  3PB9 X;  2PVV A;  1CPX A;  3DR6 A;  4QVT A;  2CY2 A;  3DNS A;  4P4J A;  5JQ4 A;  1UFH A;  4ZI6 A;  2P6G A;  4OAE A;  1TKH A;  4FBE A;  1F2P A;  4KLV A;  3C26 A;  4OAD A;  6CPA A;  4O23 A;  1B6B A;  4F9V A;  3KZW A;  4Y49 B;  4EFD A;  5IB9 A;  1BO4 A;  2DPT A;  3H5Z A;  3RNZ A;  4C2Z A;  5LYL A;  3E0K A;  3GY9 A;  4ZY1 A;  3FIX A;  2B5G B;  4ONW A;  4P4F A;  5DS0 A;  4L89 A;  2D4P A;  1CP6 A;  3FNC A;  4MFL A;  5KTC A;  4CGO A;  1KUV A;  4A30 A;  4JLY A;  1ON0 A;  4MCS A;  4R87 A;  4C7I A;  5J1Q A;  2O4H A;  3I1U A;  4GM5 A;  4JXQ A;  1P0H A;  4P6Y A;  3B8G A;  2D4O A;  1I1D A;  1X12 A;  5KTA A;  2XEJ A;  4DUK A;  2REF A;  4CAV A;  2BOA A;  3KQZ A;  1K4J A;  1YRE A;  3CPA A;  2Z3K A;  1LAM A;  3IC1 A;  5G22 A;  1ZLI A;  3D68 A;  3FED A;  1RO5 A;  5THW A;  2ODF A;  5AG4 A;  3RAM A;  5HMN A;  2V8V A;  4K30 A;  3B2Y A;  1QST A;  3BXM A;  3PBE A;  4FD6 A;  1B87 A;  4RUH A;  1MJA A;  2AE6 A;  3PB4 X;  3R1K A;  5F09 A;  2BSW A;  5IB0 A;  2DPS A;  5ELY A;  3GIU A;  4NXY A;  3PEI A;  3D7D A;  4UCP A;  4ONU A;  4UFW A;  4KVX A;  4JJX A;  2OZG A;  4XPK A;  1AYE A;  2AFX A;  4E0A A;  3T9Y A;  4FD5 A;  4PK3 A;  5EBV A;  1Q2D A;  3W6S A;  2R98 A;  2AFU A;  3LAC A;  3FX6 A;  1IYL A;  1CJW A;  2HUZ A;  4JXR A;  2ZEG A;  4P4E A;  4UF4 A;  3TO7 A;  4PK2 A;  4B10 A;  4II9 A;  2AFZ A;  2VEZ A;  2AJ6 A;  2GE3 A;  1S7K A;  2BL1 A;  3TTH A;  2RC4 A;  4MRI A;  5I0C A;  2Z0Z A;  2ZXV A;  2JLM A;  5CNP A;  5G21 A; 
#chains in the Genus database with same CATH homology
 4CYQ A;  3IWE A;  3NE7 A;  2C27 A;  4R9M A;  4MBU A;  4E2A A;  4AG7 A;  1S7N A;  2YNC A;  2Q44 A;  1M1D A;  1P4N A;  2ARH A;  2ZW5 A;  4JD6 A;  4E8O A;  2R1I A;  2B3U A;  2Z10 A;  3FBU A;  3T90 A;  4CYO A;  4ORF A;  1S7F A;  4LX9 A;  1Q2C A;  2G3A A;  2JDC A;  4QC6 A;  4H89 A;  2ZPA A;  2QML A;  1Y7R A;  4FD4 A;  3BJ8 A;  1PUA A;  2B4D A;  3K9U A;  2Q04 A;  2VZY A;  2NMT A;  3DR8 A;  4B14 A;  1VHS A;  1XEB A;  3IGR A;  2QIR A;  4F0Y A;  5C82 A;  1N71 A;  4HNW B;  1KUX A;  4A33 A;  4U9Y A;  4UFX A;  2K5T A;  3SXN A;  4MFP A;  2VBQ A;  2Z3M A;  3BJ7 A;  5H84 A;  2I00 A;  2VXK A;  2Z3O A;  3S6K A;  4C2X A;  1NMT A;  2FSR A;  4MFQ A;  3SXO A;  5IX3 A;  4KS9 A;  1FY7 A;  4OLL A;  2YNC C;  5F48 A;  5E96 A;  3IU2 A;  1S3Z A;  3D8P A;  2PDO A;  3IWG A;  5GCN A;  3EXN A;  4BMH A;  5KTD A;  1MK4 A;  1S5K A;  4I49 A;  2Q7B A;  4MHD A;  2O28 A;  4CRZ B;  4YFJ A;  4CAF A;  4KLW A;  3TO6 A;  1KZF A;  4XPD C;  4NF1 A;  1Q2Y A;  1YVK A;  2B58 A;  1U6M A;  5J8F A;  2WUU A;  4B5P B;  2X7B A;  4HNX B;  2VQY A;  1QSO A;  2JEV A;  4X5K A;  2REE A;  3FYN A;  1Z9U A;  3W6X A;  4GS4 A;  2QEC A;  5J8C A;  4QBJ A;  4MFK A;  1Y9W A;  2CNT A;  2FCK A;  2J8R A;  3F0A A;  1MJB A;  4CRY B;  3TFY A;  2IL4 A;  5JPH A;  1YX0 A;  2HV2 A;  4C68 A;  4XPD B;  4A32 A;  4B13 A;  2B4D B;  4C2Y A;  3OWC A;  1Z4E A;  1IIC A;  2J8M A;  4KSF A;  3F8K A;  4YGO A;  1BOB A;  4UFV A;  3CXQ A;  4UA3 A;  3EFA A;  5G20 A;  1YVO A;  1NE9 A;  4MI4 A;  1NSL A;  1ZO0 A;  3LOD A;  2FE7 A;  4M3S A;  4RS2 A;  1KUY A;  2VZZ A;  1YR0 A;  3G8W A;  4AVA A;  2PRB A;  4ZGY B;  2OZU A;  3R9G A;  3R96 A;  4B5O A;  2CNM A;  2P6E A;  2WPW A;  4CGN A;  1I21 A;  2CXA A;  4XNH C;  4R3L A;  4NSQ A;  2ATR A;  4YRH A;  2H5M A;  3IU1 A;  5BWA B;  2J8N A;  2BUE A;  1M44 A;  1LRZ A;  2DXQ A;  3ZZI A;  2GIV A;  4HKF A;  2EUI A;  4F0X A;  5DWN A;  1SQH A;  5DWM A;  2B5G A;  4XPL A;  3I9S A;  1YLE A;  4XNH B;  3EO4 A;  3SHP A;  4KUB A;  4KOT A;  2F5I A;  3A9L A;  1IID A;  2ZW6 A;  2OH1 A;  4H6Z A;  4H6U A;  4A31 A;  4KUA A;  1QSN A;  5F47 A;  4CYP A;  1J4J A;  4DNC A;  1R57 A;  4UBR A;  2I79 A;  4UCN A;  1TIQ A;  3GYA A;  2OB0 A;  4R3K A;  4MJ8 A;  4U9Z A;  4CGM A;  3TOA A;  1YGH A;  4LUA A;  2A4N A;  4CAE A;  4KOX A;  3P2H A;  1S7L A;  2FT0 A;  2CNS A;  3TCV A;  3DSB A;  3PZJ A;  3RYO A;  4B12 A;  1RXT A;  5F46 A;  3VWD A;  4M85 A;  4PSW A;  2P0W A;  2FS5 A;  1I12 A;  5A27 A;  1QSR A;  3TO9 A;  4A95 A;  2OZH A;  3H4Q A;  4KOW A;  2JDD A;  4R57 A;  4KVM E;  2G3T A;  3JTK A;  3TE4 A;  1L0C A;  3EC4 A;  4PSX A;  2OU2 A;  3DDD A;  5FVJ A;  1IB1 E;  2ZW4 A;  3FXT A;  2YND A;  1IYK A;  3UY5 A;  2WSA A;  1M4D A;  4L8A A;  1V0C A;  4QB9 A;  4CGL A;  4AG9 A;  2Z3L A;  3MGD A;  4BBH A;  3F5B A;  2FIA A;  2KCW A;  5G1Z A;  2Z3P A;  4A2Z A;  1WK4 A;  4AB7 A;  4AVC A;  4ZBG A;  3QB8 A;  2EVN A;  1MJ9 A;  4NCZ A;  2B4B A;  4HNY B;  2PR1 A;  1GHE A;  4QUS A;  2PQ8 A;  3R9E A;  3S6F A;  2Q4V A;  3V8I A;  4C7H A;  4AVB A;  3W91 A;  3JVN A;  5AG6 A;  2WPX A;  3KKW A;  4IUS A;  3PGP A;  4UWI A;  5A28 A;  3R9F A;  4B11 A;  4CYN A;  2HQY A;  4KSA A;  4NEX A;  4JWP A;  1WWZ A;  3TOB A;  3G3S A;  3BLN A;  4IF5 A;  5H86 A;  4KOV A;  4KVO E;  3S6H A;  3ZJ0 A;  2R7H A;  2Q0Y A;  2YGW A;  5AG5 A;  5EC4 A;  2GAN A;  2P6F A;  4UCM A;  3FB3 A;  2Z3N A;  4UWJ A;  4KOS A;  4FD7 A;  3S6G A;  2FL4 A;  2Z11 A;  4EVY A;  3EY5 A;  2PR8 A;  4B5P A;  4CAX A;  3VWE A;  1Y9K A;  2FXF A;  3WR7 A;  3P2F A;  4RI1 A;  3D3S A;  1QSM A;  3LD2 A;  4CGP A;  1M4G A;  2B3V A;  3D2M A;  4J3G A;  2PSW A;  3PP9 A;  4MFJ A;  4Q36 A;  2PC1 A;  4KOY A;  5C88 A;  3CXP A;  4KOU A;  2ZW7 A;  3QAH A;  2YNE A;  1OZP A;  2FIW A;  2G0B A;  2Y0M A;  3CXS A;  4KOR A;  1M4I A;  3R95 A;  4MFZ A;  1VKC A;  2BEI A;  2R8V A;  3GKR A;  4CS0 B;  3N7Z A;  2Q4Y A;  5IV0 A;  5AGE A;  3TT2 A;  4KZT A;  4MY3 A;  4Q38 A;  3D2P A;  4PV6 A;  4U5Y A;  1XIX A;  5F49 A;  1XF8 A;  1XE4 A;  1YK3 A;  2VI7 A;  4Y49 C;  1XMT A;  1S60 A;  5ISV A;  4CAW A;  1PU9 A;  1Z4R A;  3JUW A;  5AG7 A;  1CM0 A;  4MY0 A;  3I3G A;  3FRM A;  5HH1 A;  4F6A A;  3DR6 A;  4QVT A;  2CY2 A;  3DNS A;  5JQ4 A;  1UFH A;  2P6G A;  4OAE A;  4KLV A;  3C26 A;  4OAD A;  1B6B A;  4Y49 B;  1BO4 A;  2DPT A;  3H5Z A;  4C2Z A;  3E0K A;  3GY9 A;  3FIX A;  2B5G B;  4L89 A;  2D4P A;  3FNC A;  4MFL A;  5KTC A;  4CGO A;  1KUV A;  4A30 A;  4JLY A;  1ON0 A;  4R87 A;  4C7I A;  4JXQ A;  1P0H A;  3B8G A;  2D4O A;  1I1D A;  5KTA A;  2REF A;  4CAV A;  1K4J A;  1YRE A;  2Z3K A;  5G22 A;  1RO5 A;  5AG4 A;  5HMN A;  4K30 A;  1QST A;  4FD6 A;  1B87 A;  1MJA A;  2AE6 A;  3R1K A;  2BSW A;  5IB0 A;  2DPS A;  4NXY A;  4UCP A;  4ONU A;  4UFW A;  4KVX A;  4JJX A;  2OZG A;  4XPK A;  4E0A A;  3T9Y A;  4FD5 A;  4PK3 A;  5EBV A;  1Q2D A;  3W6S A;  2R98 A;  1IYL A;  1CJW A;  2HUZ A;  4JXR A;  3TO7 A;  4II9 A;  4PK2 A;  4B10 A;  2VEZ A;  2AJ6 A;  2GE3 A;  1S7K A;  2BL1 A;  3TTH A;  2RC4 A;  5I0C A;  2Z0Z A;  2ZXV A;  2JLM A;  5CNP A;  5G21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...