1Y9WA

Structural genomics, 1.9a crystal structure of an acetyltransferase from bacillus cereus atcc 14579
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
140
structure length
140
Chain Sequence
MYMKHIENGTRIEGEYIKNKVIQYNMSILTDEVKQPMEEVSLVVKNEEGKIFGGVTGTMYFYHLHIDFLWVDESVRHDGYGSQLLHEIEGIAKEKGCRLILLDSFSFQAPEFYKKHGYREYGVVEDHPKGHSQHFFEKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.9A crystal structure of an acetyltransferase from Bacillus cereus ATCC 14579
rcsb
source organism Bacillus cereus
molecule tags Transferase
molecule keywords Acetyltransferase
total genus 36
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1y9wA01
2PQ8A 3D3SA 1YX0A 1VHSA 1XEBA 1MJAA 4NCZA 2Y0MA 4R87A 4ORFA 2NMTA 5F49A 4XNHB 4QUSA 3NE7A 4U9ZA 2B3UA 3G8WA 4XPDC 2ATRA 4KOTA 1IB1E 5JPHA 2D4OA 2P6EA 3UY5A 1GHEA 2QMLA 5F46A 5DWMA 2HUZA 3TOAA 1K4JA 3P2FA 3FXTA 4R3LA 2Q7BA 1RXTA 2OH1A 2Q0YA 4HNXB 5C88A 4CAVA 3KKWA 1YREA 3R9FA 4J3GA 1KUYA 4B5OA 2AJ6A 3TT2A 3W6XA 3FNCA 1FY7A 1MJ9A 1PU9A 1VKCA 2OZUA 1LRZA 1S7NA 4H6ZA 4MHDA 5IB0A 2IL4A 3PZJA 3FYNA 2GIVA 1MK4A 4CRZB 2PR8A 3TO9A 4KOVA 3T90A 4DNCA 4XPDB 2PDOA 4FD7A 2J8NA 3CXQA 2FS5A 4NF1A 3R96A 3QAHA 1WK4A 2CNMA 4L89A 4IUSA 4KUAA 5KTAA 5HH1A 4U5YA 4Y49C 4E0AA 3R95A 2REFA 1Z4RA 3GKRA 2BL1A 1IICA 3ZZIA 2P6GA 1NSLA 4OAEA 1R57A 2PC1A 4KLVA 3E0KA 2REEA 4FD5A 5KTCA 2JLMA 4B5PA 2OZGA 2A4NA 3S6GA 3FB3A 5H84A 4HNYB 2Q4YA 5CNPA 3S6KA 1U6MA 2Z11A 1B87A 1M4IA 1I21A 3N7ZA 2B5GA 4JLYA 4RS2A 3S6FA 4II9A 2B58A 5I0CA 5HMNA 2J8RA 2X7BA 3F5BA 3GY9A 1Q2YA 4BMHA 2EVNA 3K9UA 1QSOA 1N71A 2FIAA 4LX9A 1PUAA 2R1IA 2RC4A 4UA3A 4NXYA 4JD6A 1P4NA 1QSRA 1OZPA 3G3SA 4PSWA 4QC6A 1M1DA 4F6AA 3T9YA 3WR7A 2B5GB 3D2PA 3I9SA 4YGOA 2I79A 4OADA 3VWEA 5EBVA 3EFAA 4U9YA 2VEZA 3BJ7A 3SHPA 4MY3A 3LODA 2H5MA 2B3VA 2FIWA 4F0YA 1WWZA 3D2MA 4UWIA 1KZFA 4R57A 1S3ZA 2ZW4A 2I00A 2Q44A 1B6BA 2P6FA 1RO5A 4XPLA 4PV6A 1S7KA 4AVAA 3DNSA 4XNHC 5F47A 1YK3A 2JEVA 1XE4A 2WPWA 1YLEA 2F5IA 3V8IA 4CS0B 1XIXA 3C26A 3MGDA 5FVJA 1QSMA 2AE6A 5EC4A 4YFJA 1S7FA 3GYAA 2Z0ZA 4XPKA 3PP9A 3IGRA 4KZTA 4QBJA 5F48A 3VWDA 1QSTA 3PGPA 4R3KA 2HQYA 3R9GA 1TIQA 2QIRA 2BUEA 3D8PA 3DR8A 2CNSA 4MI4A 3SXOA 2VZZA 2J8MA 4KOUA 4ZBGA 4E2AA 4KOSA 2ZXVA 4X5KA 4MY0A 4KOXA 3QB8A 4QVTA 4HNWB 5C82A 4GS4A 4M85A 2PR1A 1Q2DA 3LD2A 4CRYB 3IWGA 4OLLA 3JVNA 2ARHA 3FIXA 3R1KA 1YVKA 4KVOE 4AG9A 1YR0A 2OZHA 1XF8A 1L0CA 2FE7A 3TE4A 2B4DA 2CNTA 1I1DA 2ZW6A 3F0AA 2G3AA 1MJBA 2BSWA 4IF5A 5H86A 1XMTA 2FL4A 3W91A 4M3SA 3I3GA 3TO6A 2Z10A 3ZJ0A 2VI7A 5JQ4A 2K5TA 3BLNA 4LUAA 4UBRA 5IX3A 2G0BA 2ZW7A 2PSWA 2B4DB 2OU2A 1IIDA 4KORA 3FRMA 2R98A 1QSNA 1S60A 3BJ8A 4H6UA 3FBUA 2G3TA 1S7LA 3DR6A 3R9EA 1Y9KA 2FSRA 3EXNA 3B8GA 5J8CA 3EC4A 4Y49B 3OWCA 4HKFA 4PK3A 4EVYA 3DDDA 4KOYA 5DWNA 3H4QA 2PRBA 1V0CA 1KUVA 4AVBA 4QB9A 4PK2A 4YRHA 3P2HA 2QECA 1CJWA 2OB0A 1I12A 2CY2A 2R7HA 3RYOA 4CAWA 4R9MA 1NMTA 2D4PA 4KOWA 1M4GA 3F8KA 2WPXA 5IV0A 2VBQA 1NE9A 4AG7A 1P0HA 3TTHA 1YGHA 3TFYA 4PSXA 2B4BA 5E96A 1Y7RA 3W6SA 2HV2A 1CM0A 4AVCA 1KUXA 4UWJA 4KUBA 1UFHA 4K30A 1M4DA 2GANA 4FD4A 4JJXA 4E8OA 4ONUA 4I49A 1Y9WA 1YVOA 3CXSA 4NSQA 5GCNA 1J4JA 2ZPAA 3DSBA 2O28A 2C27A 2DXQA 5J8FA 4JXQA 2P0WA 2ZW5A 2JDDA 1Q2CA 3EY5A 4KLWA 1ON0A 4JWPA 3SXNA 1SQHA 2FXFA 4FD6A 3TOBA 3JUWA 5ISVA 1IYLA 2FCKA 2VQYA 4KVXA 3S6HA 3CXPA 4H89A 4MJ8A 3TO7A 3TCVA 4AB7A 2GE3A 4JXRA 2FT0A 4RI1A 1M44A 2JDCA 2Q04A 1S5KA 1BO4A 2VZYA 4B5PB 4KVME 1Z4EA 2EUIA 1BOBA 4MBUA 1IYKA 2R8VA 2VXKA 4NEXA 2BEIA 1Z9UA 2KCWA 4CAXA 2Q4VA 4L8AA 3EO4A 5KTDA
chains in the Genus database with same CATH superfamily
4FBEA 2PQ8A 3D3SA 3PBEA 3TC8A 1AYEA 3KGQA 4M6IA 2V77A 5JGFA 1YX0A 1VHSA 1BPNA 1XEBA 4JZ0A 3CPAA 1MJAA 2J9AA 3NA6A 4NCZA 3RBUA 2Y0MA 2GU2A 4R87A 4ORFA 4R8FA 1R3NA 2NMTA 4OIWA 1TF8A 5F49A 4XNHB 4QUSA 3NE7A 4U9ZA 2IMOA 4OC1A 5AG6A 2B3UA 3G8WA 1DTDA 4XPDC 2BCOA 4IHMA 4EMEA 3KQXA 2ATRA 3RAMA 4KOTA 3FJUA 1IB1E 5JPHA 2D4OA 2P6EA 3PB9X 3UY5A 1GHEA 2QMLA 5F46A 1LANA 5DWMA 5K8OA 2HUZA 3IEHA 3TOAA 5G21A 2PRQA 1K4JA 3P2FA 3FXTA 4R3LA 2Q7BA 1RXTA 2OH1A 2Q0YA 4HNXB 5C88A 3BI1A 5IB9A 4CAVA 2AFXA 4MHPA 3KKWA 3DLJA 2ZOFA 1YREA 4P10A 3R9FA 1HDQA 4J3GA 1KUYA 4B5OA 1Y7EA 2AJ6A 3K9TA 3TT2A 3W6XA 5K8PA 2Z3NA 2PVVA 3FNCA 1FY7A 1MJ9A 1PU9A 3IJ3A 1XOVA 1VKCA 1XJOA 2C6PA 3PRTA 3B3SA 5DS0A 2OZUA 4YU9A 1LRZA 3B35A 1S7NA 3SJGA 1CP6A 2DPTA 5ELYA 4H6ZA 2OR4A 2PVWA 1Y0YA 3D7DA 1M4LA 4MHDA 5IB0A 2IL4A 3PZJA 3D4UA 2ODFA 2AFMA 3FYNA 3PEIA 4KSFA 2PJ8A 2GIVA 3KR5A 1XFOA 1MK4A 1BAVA 2Z3OA 4CRZB 1Z2LA 2PR8A 3TO9A 3A9LA 4KOVA 3VH9A 3T90A 4DNCA 4XPDB 1A2ZA 2V8GA 2C6GA 2PDOA 4FD7A 1AMPA 4HPSA 2J8NA 2FS5A 3CXQA 1GYTA 4NF1A 4F9VA 3R96A 3FH4A 2ZEDA 3QAHA 1QMUA 5K8NA 2V8VA 1WK4A 2CNMA 3FF3A 4L89A 1XRYA 4MMOA 4IUSA 1CPXA 4KUAA 2WZNA 4C2ZA 4P4EA 5CPAA 5KTAA 3PB6X 5HH1A 4U5YA 4NGSA 4Y49C 4M6GA 4A2ZA 3R95A 4E0AA 2REFA 1Z4RA 3GKRA 2BL1A 3PFEA 3HUVA 2Q7SA 1IICA 3MRUA 3ZZIA 2P6GA 4AXVA 1NSLA 4OC2A 4OAEA 1R57A 2PC1A 4UCPA 5EMIA 4ZYQA 3H5ZA 3TX8A 4P4DA 4KLVA 4ZGYB 2DF5A 3E0KA 2REEA 4FD5A 4F0XA 2ZOGA 3SI2A 5KTCA 2JLMA 3B3CA 2OZGA 4B5PA 2A4NA 4UEEA 3FB3A 3S6GA 4KSAA 3IIBA 1OBRA 5H84A 4HNYB 3D7HA 1LAPA 2Q4YA 1ZG8A 4PXBA 5CNPA 4ZX9A 1YW4A 5D8NA 4FWUA 3S6KA 1U6MA 1LAMA 2ZEMA 4ZY2A 2BO9A 2Z11A 4P4IA 3NH5A 5LRKA 4BINA 2O53A 5HVHA 1B87A 1XBUA 4B12A 1M4IA 1TF9A 3IWEA 4CGOA 1I21A 2XEFA 3N7ZA 4MFQA 4C7HA 3IO1A 2B5GA 4JLYA 3B3WA 5CBMA 1CG2A 4C2YA 5A27A 4RS2A 3NE8A 2EO8A 4R6TA 4C2XA 3S6FA 4II9A 2B58A 5I0CA 6CPAA 1AUGA 4AVBA 2J8RA 5HMNA 2GLFA 2X7BA 2Q43A 2ZEGA 3F5BA 4PXDA 2GLJA 3GY9A 1LOKA 1Q2YA 1Z8LA 4LQGA 3SI1A 4BMHA 4NFRA 2EVNA 3K9UA 3LMSA 5THWA 1QSOA 4A37A 2ABZA 1N71A 2FIAA 4RN7A 4CYOA 2YGWA 2NSMA 3I1UA 4LX9A 2FVGA 2PJ5A 2IQ6A 2AFUA 1PUAA 2R1IA 3CT9A 2RC4A 4UA3A 4A94A 2ZEHA 3B7IA 4B10A 3CDXA 4NXYA 3QNVA 4JD6A 2WYRA 4TWEA 1TKJA 1P4NA 1QSRA 1VGYA 4DJLA 4G1PA 1OZPA 4CYQA 2PJ2A 2YNDA 2PJ3A 3G3SA 2Z3MA 1HDUA 4PSWA 1M1DA 4QC6A 1Q7LA 5HVFA 3T9YA 4OC3A 3WR7A 4F6AA 2B5GB 3D2PA 1X12A 3I9SA 4YGOA 1IU8A 2I79A 4OADA 4PPZA 3VWEA 5EBVA 3EFAA 4U9YA 2PJ9A 2DPSA 2VEZA 3BJ7A 4A33A 3SHPA 7CPAA 4MY3A 1LCPA 4ZI6A 4P4BA 4ZY0A 5LYLA 5F09A 4CYNA 2IJZA 1YMEA 2H5MA 3JTKA 3LODA 2B3VA 2FIWA 2CF4A 4H2KA 4F0YA 3CZXA 1WWZA 3D2MA 4UWIA 4PXCA 1KZFA 3IWWA 4CYPA 2Z3KA 4NGMA 3S9LA 4R57A 1S3ZA 1TKHA 2ZW4A 3VARA 4A39A 2I00A 3RNZA 2ZEFA 2Q44A 1BPMA 1Z8TA 2QJ8A 1B6BA 4CGNA 2P6FA 3WC5A 1RO5A 4XPLA 4PV6A 3D7GA 1S7KA 3D66A 4UFVA 2XEJA 2HC9A 4AVAA 2XEIA 3DNSA 1CPSA 4XNHC 2C6CA 4P4FA 4MFPA 2ZENA 5F47A 5J1QA 1YK3A 3FECA 1FNOA 5HVGA 2XEGA 3CPXA 4UCMA 1IGBA 2ZEEA 8CPAA 1XMBA 2JEVA 1XE4A 2QVPA 1Z8WA 4WWVA 2WPWA 2G9DA 1YLEA 2F5IA 3KHZA 2DEAA 4O23A 4OP4A 3V8IA 4NGPA 4CS0B 3K2KA 1XIXA 3C26A 1F2PA 3MGDA 1QSMA 2AE6A 5FVJA 5EC4A 3SI0A 2BOAA 2EK9A 4YFJA 1S7FA 4PQAA 4Q38A 4F8ZA 3GYAA 4OKOA 4OC5A 2O4HA 2Z0ZA 4P4JA 4XPKA 4R7MA 4C68A 3PP9A 3IGRA 1ELMP 1TKFA 4KZTA 3BI0A 5F48A 4QBJA 2Z3PA 3VWDA 1QSTA 2PIYA 3PGPA 1ZG9A 3NH8A 1IOIA 4ZX8A 4R3KA 2HQYA 3R9GA 1DE4C 1TIQA 2QIRA 2BUEA 3D8PA 2GREA 2CNSA 3DR8A 4MI4A 3LACA 3SXOA 4OIDA 3WC7A 2VZZA 1X10A 2J8MA 4KOUA 4ZBGA 3RZAA 4E2AA 3L2NA 4KOSA 5I4MA 5AG7A 5G22A 3ISXA 2ZXVA 4X5KA 1TXRA 4MY0A 4KOXA 4UEZA 3QB8A 4QVTA 1YSJA 4HNWB 2PJ0A 3KL9A 5C82A 4WJBA 1JQGA 2AFSA 3WABA 4GS4A 4NGNA 4M85A 4RUHA 1NSAA 1VHEA 2ZEPA 4UIBA 1ARMA 2PR1A 1Q2DA 3LD2A 2JBJA 3IWGA 4OLLA 4CRYB 1ZLIA 3BXMA 3JVNA 2ARHA 3FIXA 3KASA 3R1KA 3V38A 1YVKA 3T8WA 3BHXA 4KVOE 3KQZA 4AG9A 3D7FA 4A95A 1YR0A 2OZHA 4X8IA 1XF8A 2ZEOA 1L0CA 2FE7A 3TE4A 2B4DA 1CBXA 2CNTA 1I1DA 2ZW6A 3IC1A 1ZLHA 4OC4A 3F0AA 3ISZA 4NGTA 4A31A 2G3AA 1H8LA 3N5FA 4BD9A 3PFOA 4R76A 5LYIA 3D68A 1MJBA 2BSWA 3KI9A 4MFZA 2HB6A 4B11A 4IF5A 3B2YA 5H86A 1XMTA 2FL4A 3FMCA 4A32A 3W91A 1F2OA 4M3SA 4C7IA 1VHOA 1JWQA 2Q4ZA 3IU2A 3I3GA 2PJBA 3H8EA 3TO6A 2AFOA 2Z10A 5LYDA 3ZJ0A 2VI7A 3VATA 5JQ4A 2K5TA 4MRIA 3BLNA 4MFJA 1CP7A 2PCUA 4LUAA 4UBRA 1F57A 2G0BA 2ZW7A 5IX3A 4Q7AA 4MFLA 1RTQA 2PSWA 3B3TA 3MN8A 2V8DA 2EBJA 3FVLA 2B4DB 2OU2A 1IIDA 4EWTA 2CXAA 4KORA 3WT4A 3FRMA 4FAIA 3H8FA 4NGQA 4UFXA 2R98A 1QSNA 4B6ZA 1YQEA 3GIUA 4K3NA 5A28A 1S60A 3BJ8A 3KHXA 4H6UA 5G1ZA 3RO0A 3FBUA 2G3TA 1S7LA 4FUUA 3DR6A 2WUUA 3R9EA 1Y0RA 1Y9KA 2FSRA 2RB7A 3EXNA 3B8GA 5J8CA 4EFDA 3EC4A 4Y49B 3S9MA 3OWCA 4HKFA 4PK3A 4EVYA 3DDDA 5AGEA 4KOYA 5DWNA 2PIZA 2POKA 1UWYA 1KWMA 3H4QA 1Z5RA 1V0CA 2CTBA 2PRBA 1KUVA 1IOFA 4X3RA 5G20A 4QB9A 4PK2A 4W9YA 3IU1A 3P2HA 2YNCC 4YRHA 1CX8A 2QECA 4CAFA 1CJWA 4CAEA 3FEDA 2OB0A 4BBHA 3NFZA 1I12A 2CY2A 2R7HA 4MCQA 3RYOA 4R9MA 2AFZA 1NMTA 4CAWA 3IFEA 5LRJA 2V8HA 3FX6A 2D4PA 4P44A 4KOWA 3SJFA 4CGPA 3PB7X 2RFHA 4P6YA 1M4GA 3F8KA 2WPXA 4UEFA 4X2TA 5AG5A 2PE3A 4UFWA 4CGMA 5IV0A 2VBQA 1NE9A 4AG7A 1P0HA 3NH4A 3TTHA 1YGHA 3TFYA 4UCNA 4PSXA 2B4BA 5E96A 4NJRA 4MFKA 3PB4X 4MXUA 2Q51A 4CGLA 4DYOA 4NJQA 4IK2A 1Y7RA 1BLLE 3W6SA 2HV2A 4A30A 4A38A 1CM0A 2PJAA 4OMEA 3SJXA 4AVCA 2PJ6A 1KUXA 2EWBA 4PXEA 1YLOA 1ELLP 4UWJA 4UIAA 2YNEA 4KUBA 1UFHA 3D67A 4K30A 1M4DA 2GANA 3KR4A 4FD4A 2OOTA 4TNUA 1FT7A 3LWUA 4JJXA 2JEWA 4E8OA 4ONUA 4Q36A 4NGRA 4MCRA 3S9NA 1PCAA 4I49A 4YWYA 5AG4A 1LFWA 3FEEA 2PJ7A 2Z3LA 1Y9WA 3B3VA 5JH9A 1QQ9A 1YVOA 1YW6A 3CXSA 4MHNA 2C1CA 2I3CA 4NSQA 2JBKA 3PBBA 3KZWA 5GCNA 1J4JA 2CIJA 2ZPAA 3DSBA 3QAYA 2O28A 2PJCA 4MCPA 2C27A 2DXQA 2QYVA 4GM5A 4ONWA 5J8FA 4ZY1A 1ZO0A 4JYWA 4JXQA 2P0WA 2ZW5A 2JDDA 1Q2CA 2F7VA 3EY5A 4KLWA 2VL1A 1ON0A 5K8MA 2PJ4A 2F8HA 1R43A 4JWPA 3SXNA 1SQHA 2ANPA 2FXFA 4FD6A 4MCSA 4GXHA 3TOBA 3WC6A 3JUWA 5ISVA 1IYLA 3DGVA 2FCKA 2VQYA 4KVXA 4UF4A 3GUXA 3S6HA 4B13A 3CXPA 4H89A 3H8GA 4MJ8A 1ZG7A 3TO7A 4KSIA 2AFWA 2WSAA 2GE3A 3TCVA 3PB8X 4AB7A 4JXRA 1EE3P 2FT0A 5D29A 4RI1A 1M44A 4B14A 2JDCA 5LYFA 2CTCA 2Q04A 1S5KA 2GFQA 1BO4A 5LRGA 4P45A 2VZYA 4DUKA 1HEEA 2ZELA 5BWAB 4B5PB 2EK8A 5JM6A 5HXDA 4KVME 1Z4EA 2EUIA 4OC0A 1Z8XA 4LQ6A 1BOBA 4IAVA 1IY7A 3SJEA 2NYQA 4MBUA 3GB0A 4KS9A 1IYKA 3HLPA 4M6HA 2R8VA 2VXKA 3V7ZA 1ARLA 2YNCA 4NEXA 2BEIA 1Z9UA 4MHYA 1VIXA 2PJ1A 2KCWA 4CAXA 1PYTB 4Z65A 2Q4VA 4L8AA 3EO4A 4MHZA 4F9UA 5KTDA 4CPAA 3GLJA 3JRUA
chains in the Genus database with same CATH topology
2PQ8A 3D3SA 1YX0A 1VHSA 1XEBA 1MJAA 4NCZA 2Y0MA 4R87A 4ORFA 2NMTA 5F49A 4XNHB 4QUSA 3NE7A 4U9ZA 5AG6A 2B3UA 3G8WA 4XPDC 2ATRA 4KOTA 1IB1E 5JPHA 2D4OA 2P6EA 3UY5A 1GHEA 2QMLA 5F46A 5DWMA 2HUZA 3TOAA 5G21A 1K4JA 3P2FA 3FXTA 4R3LA 2Q7BA 1RXTA 2OH1A 2Q0YA 4HNXB 5C88A 4CAVA 3KKWA 1YREA 3R9FA 4J3GA 1KUYA 4B5OA 2AJ6A 3TT2A 3W6XA 2Z3NA 3FNCA 1FY7A 1MJ9A 1PU9A 1VKCA 2OZUA 1LRZA 1S7NA 2DPTA 4H6ZA 4MHDA 5IB0A 2IL4A 3PZJA 4KSFA 3FYNA 2GIVA 1MK4A 4CRZB 2Z3OA 2PR8A 3TO9A 3A9LA 4KOVA 3T90A 4DNCA 4XPDB 2PDOA 4FD7A 2J8NA 3CXQA 2FS5A 4NF1A 3R96A 3QAHA 1WK4A 2CNMA 4L89A 4IUSA 4KUAA 4C2ZA 5KTAA 5HH1A 4U5YA 4A2ZA 4Y49C 4E0AA 3R95A 2REFA 1Z4RA 3GKRA 2BL1A 1IICA 3ZZIA 2P6GA 1NSLA 4OAEA 1R57A 2PC1A 4UCPA 3H5ZA 4ZGYB 4KLVA 3E0KA 2REEA 4FD5A 4F0XA 5KTCA 2JLMA 4B5PA 2OZGA 2A4NA 3S6GA 3FB3A 4KSAA 5H84A 4HNYB 2Q4YA 5CNPA 3S6KA 1U6MA 2Z11A 1B87A 4B12A 1M4IA 3IWEA 4CGOA 1I21A 3N7ZA 4MFQA 4C7HA 2B5GA 4JLYA 4C2YA 5A27A 4RS2A 4C2XA 3S6FA 4II9A 2B58A 5I0CA 5HMNA 2J8RA 2X7BA 3F5BA 3GY9A 1Q2YA 4BMHA 2EVNA 3K9UA 1QSOA 1N71A 2FIAA 4CYOA 2YGWA 4LX9A 1PUAA 2R1IA 2RC4A 4UA3A 4B10A 4NXYA 4JD6A 1P4NA 1QSRA 1OZPA 4CYQA 2YNDA 3G3SA 2Z3MA 4PSWA 4QC6A 1M1DA 4F6AA 3T9YA 3WR7A 2B5GB 3D2PA 3I9SA 4YGOA 2I79A 4OADA 3VWEA 5EBVA 3EFAA 4U9YA 2DPSA 2VEZA 3BJ7A 4A33A 3SHPA 4MY3A 4CYNA 3JTKA 2H5MA 3LODA 2B3VA 2FIWA 4F0YA 1WWZA 3D2MA 4UWIA 1KZFA 2Z3KA 4R57A 1S3ZA 2ZW4A 2I00A 2Q44A 4CGNA 1B6BA 2P6FA 1RO5A 4XPLA 4PV6A 1S7KA 4UFVA 4AVAA 3DNSA 4XNHC 5F47A 4MFPA 1YK3A 4UCMA 2JEVA 1XE4A 2WPWA 1YLEA 2F5IA 3V8IA 4CS0B 1XIXA 3C26A 3MGDA 5FVJA 1QSMA 2AE6A 5EC4A 4YFJA 1S7FA 4Q38A 3GYAA 2Z0ZA 4XPKA 4C68A 3PP9A 3IGRA 4KZTA 4QBJA 5F48A 2Z3PA 3VWDA 1QSTA 3PGPA 4R3KA 2HQYA 3R9GA 1TIQA 2QIRA 2BUEA 3D8PA 3DR8A 2CNSA 4MI4A 3SXOA 2VZZA 2J8MA 4KOUA 4ZBGA 4E2AA 4KOSA 5AG7A 5G22A 2ZXVA 4X5KA 4MY0A 4KOXA 3QB8A 4QVTA 4HNWB 5C82A 4GS4A 4M85A 2PR1A 1Q2DA 3LD2A 4CRYB 3IWGA 4OLLA 3JVNA 2ARHA 3FIXA 3R1KA 1YVKA 4KVOE 4AG9A 4A95A 1YR0A 2OZHA 1XF8A 1L0CA 2FE7A 3TE4A 2B4DA 2CNTA 1I1DA 2ZW6A 3F0AA 4A31A 2G3AA 1MJBA 2BSWA 4B11A 4MFZA 4IF5A 5H86A 1XMTA 2FL4A 4A32A 3W91A 4M3SA 4C7IA 3IU2A 3I3GA 3TO6A 2Z10A 3ZJ0A 2VI7A 5JQ4A 2K5TA 3BLNA 4MFJA 4LUAA 4UBRA 5IX3A 2G0BA 2ZW7A 4MFLA 2PSWA 2B4DB 2OU2A 1IIDA 2CXAA 4KORA 3FRMA 4UFXA 2R98A 1QSNA 5A28A 1S60A 3BJ8A 4H6UA 5G1ZA 3FBUA 2G3TA 1S7LA 3DR6A 2WUUA 3R9EA 1Y9KA 2FSRA 3EXNA 3B8GA 5J8CA 3EC4A 4Y49B 3OWCA 4HKFA 4PK3A 4EVYA 3DDDA 5AGEA 4KOYA 5DWNA 3H4QA 2PRBA 1V0CA 1KUVA 4AVBA 5G20A 4QB9A 4PK2A 4YRHA 3IU1A 3P2HA 2YNCC 4CAFA 4CAEA 2QECA 1CJWA 2OB0A 4BBHA 1I12A 2CY2A 2R7HA 3RYOA 4CAWA 4R9MA 1NMTA 2D4PA 4KOWA 4CGPA 5AG5A 1M4GA 3F8KA 2WPXA 4UFWA 4CGMA 5IV0A 2VBQA 1NE9A 4AG7A 1P0HA 3TTHA 1YGHA 3TFYA 4UCNA 4PSXA 2B4BA 5E96A 4MFKA 4CGLA 1Y7RA 3W6SA 2HV2A 4A30A 1CM0A 4AVCA 1KUXA 4UWJA 2YNEA 4KUBA 1UFHA 4K30A 1M4DA 2GANA 4FD4A 4JJXA 4E8OA 4ONUA 4Q36A 4I49A 5AG4A 2Z3LA 1Y9WA 1YVOA 3CXSA 4NSQA 5GCNA 1J4JA 2ZPAA 3DSBA 2O28A 2C27A 2DXQA 5J8FA 1ZO0A 4JXQA 2P0WA 2ZW5A 2JDDA 1Q2CA 3EY5A 4KLWA 1ON0A 4JWPA 3SXNA 4CYPA 1SQHA 2FXFA 4FD6A 3TOBA 3JUWA 5ISVA 1IYLA 2FCKA 2VQYA 4KVXA 3S6HA 4B13A 3CXPA 4H89A 4MJ8A 3TO7A 3TCVA 2WSAA 2GE3A 4AB7A 4JXRA 2FT0A 4RI1A 1M44A 4B14A 2JDCA 2Q04A 1S5KA 1BO4A 2VZYA 5BWAB 4B5PB 4KVME 1Z4EA 2EUIA 1BOBA 4MBUA 4KS9A 1IYKA 2R8VA 2VXKA 2YNCA 4NEXA 2BEIA 1Z9UA 2KCWA 4CAXA 2Q4VA 4L8AA 3EO4A 5KTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PQ8 A;  3D3S A;  1YX0 A;  1VHS A;  1XEB A;  1MJA A;  4NCZ A;  2Y0M A;  4R87 A;  4ORF A;  2NMT A;  5F49 A;  4XNH B;  4QUS A;  3NE7 A;  4U9Z A;  2B3U A;  3G8W A;  4XPD C;  2ATR A;  4KOT A;  1IB1 E;  5JPH A;  2D4O A;  2P6E A;  3UY5 A;  1GHE A;  2QML A;  5F46 A;  5DWM A;  2HUZ A;  3TOA A;  1K4J A;  3P2F A;  3FXT A;  4R3L A;  2Q7B A;  1RXT A;  2OH1 A;  2Q0Y A;  4HNX B;  5C88 A;  4CAV A;  3KKW A;  1YRE A;  3R9F A;  4J3G A;  1KUY A;  4B5O A;  2AJ6 A;  3TT2 A;  3W6X A;  3FNC A;  1FY7 A;  1MJ9 A;  1PU9 A;  1VKC A;  2OZU A;  1LRZ A;  1S7N A;  4H6Z A;  4MHD A;  5IB0 A;  2IL4 A;  3PZJ A;  3FYN A;  2GIV A;  1MK4 A;  4CRZ B;  2PR8 A;  3TO9 A;  4KOV A;  3T90 A;  4DNC A;  4XPD B;  2PDO A;  4FD7 A;  2J8N A;  3CXQ A;  2FS5 A;  4NF1 A;  3R96 A;  3QAH A;  1WK4 A;  2CNM A;  4L89 A;  4IUS A;  4KUA A;  5KTA A;  5HH1 A;  4U5Y A;  4Y49 C;  4E0A A;  3R95 A;  2REF A;  1Z4R A;  3GKR A;  2BL1 A;  1IIC A;  3ZZI A;  2P6G A;  1NSL A;  4OAE A;  1R57 A;  2PC1 A;  4KLV A;  3E0K A;  2REE A;  4FD5 A;  5KTC A;  2JLM A;  4B5P A;  2OZG A;  2A4N A;  3S6G A;  3FB3 A;  5H84 A;  4HNY B;  2Q4Y A;  5CNP A;  3S6K A;  1U6M A;  2Z11 A;  1B87 A;  1M4I A;  1I21 A;  3N7Z A;  2B5G A;  4JLY A;  4RS2 A;  3S6F A;  4II9 A;  2B58 A;  5I0C A;  5HMN A;  2J8R A;  2X7B A;  3F5B A;  3GY9 A;  1Q2Y A;  4BMH A;  2EVN A;  3K9U A;  1QSO A;  1N71 A;  2FIA A;  4LX9 A;  1PUA A;  2R1I A;  2RC4 A;  4UA3 A;  4NXY A;  4JD6 A;  1P4N A;  1QSR A;  1OZP A;  3G3S A;  4PSW A;  4QC6 A;  1M1D A;  4F6A A;  3T9Y A;  3WR7 A;  2B5G B;  3D2P A;  3I9S A;  4YGO A;  2I79 A;  4OAD A;  3VWE A;  5EBV A;  3EFA A;  4U9Y A;  2VEZ A;  3BJ7 A;  3SHP A;  4MY3 A;  3LOD A;  2H5M A;  2B3V A;  2FIW A;  4F0Y A;  1WWZ A;  3D2M A;  4UWI A;  1KZF A;  4R57 A;  1S3Z A;  2ZW4 A;  2I00 A;  2Q44 A;  1B6B A;  2P6F A;  1RO5 A;  4XPL A;  4PV6 A;  1S7K A;  4AVA A;  3DNS A;  4XNH C;  5F47 A;  1YK3 A;  2JEV A;  1XE4 A;  2WPW A;  1YLE A;  2F5I A;  3V8I A;  4CS0 B;  1XIX A;  3C26 A;  3MGD A;  5FVJ A;  1QSM A;  2AE6 A;  5EC4 A;  4YFJ A;  1S7F A;  3GYA A;  2Z0Z A;  4XPK A;  3PP9 A;  3IGR A;  4KZT A;  4QBJ A;  5F48 A;  3VWD A;  1QST A;  3PGP A;  4R3K A;  2HQY A;  3R9G A;  1TIQ A;  2QIR A;  2BUE A;  3D8P A;  3DR8 A;  2CNS A;  4MI4 A;  3SXO A;  2VZZ A;  2J8M A;  4KOU A;  4ZBG A;  4E2A A;  4KOS A;  2ZXV A;  4X5K A;  4MY0 A;  4KOX A;  3QB8 A;  4QVT A;  4HNW B;  5C82 A;  4GS4 A;  4M85 A;  2PR1 A;  1Q2D A;  3LD2 A;  4CRY B;  3IWG A;  4OLL A;  3JVN A;  2ARH A;  3FIX A;  3R1K A;  1YVK A;  4KVO E;  4AG9 A;  1YR0 A;  2OZH A;  1XF8 A;  1L0C A;  2FE7 A;  3TE4 A;  2B4D A;  2CNT A;  1I1D A;  2ZW6 A;  3F0A A;  2G3A A;  1MJB A;  2BSW A;  4IF5 A;  5H86 A;  1XMT A;  2FL4 A;  3W91 A;  4M3S A;  3I3G A;  3TO6 A;  2Z10 A;  3ZJ0 A;  2VI7 A;  5JQ4 A;  2K5T A;  3BLN A;  4LUA A;  4UBR A;  5IX3 A;  2G0B A;  2ZW7 A;  2PSW A;  2B4D B;  2OU2 A;  1IID A;  4KOR A;  3FRM A;  2R98 A;  1QSN A;  1S60 A;  3BJ8 A;  4H6U A;  3FBU A;  2G3T A;  1S7L A;  3DR6 A;  3R9E A;  1Y9K A;  2FSR A;  3EXN A;  3B8G A;  5J8C A;  3EC4 A;  4Y49 B;  3OWC A;  4HKF A;  4PK3 A;  4EVY A;  3DDD A;  4KOY A;  5DWN A;  3H4Q A;  2PRB A;  1V0C A;  1KUV A;  4AVB A;  4QB9 A;  4PK2 A;  4YRH A;  3P2H A;  2QEC A;  1CJW A;  2OB0 A;  1I12 A;  2CY2 A;  2R7H A;  3RYO A;  4CAW A;  4R9M A;  1NMT A;  2D4P A;  4KOW A;  1M4G A;  3F8K A;  2WPX A;  5IV0 A;  2VBQ A;  1NE9 A;  4AG7 A;  1P0H A;  3TTH A;  1YGH A;  3TFY A;  4PSX A;  2B4B A;  5E96 A;  1Y7R A;  3W6S A;  2HV2 A;  1CM0 A;  4AVC A;  1KUX A;  4UWJ A;  4KUB A;  1UFH A;  4K30 A;  1M4D A;  2GAN A;  4FD4 A;  4JJX A;  4E8O A;  4ONU A;  4I49 A;  1Y9W A;  1YVO A;  3CXS A;  4NSQ A;  5GCN A;  1J4J A;  2ZPA A;  3DSB A;  2O28 A;  2C27 A;  2DXQ A;  5J8F A;  4JXQ A;  2P0W A;  2ZW5 A;  2JDD A;  1Q2C A;  3EY5 A;  4KLW A;  1ON0 A;  4JWP A;  3SXN A;  1SQH A;  2FXF A;  4FD6 A;  3TOB A;  3JUW A;  5ISV A;  1IYL A;  2FCK A;  2VQY A;  4KVX A;  3S6H A;  3CXP A;  4H89 A;  4MJ8 A;  3TO7 A;  3TCV A;  4AB7 A;  2GE3 A;  4JXR A;  2FT0 A;  4RI1 A;  1M44 A;  2JDC A;  2Q04 A;  1S5K A;  1BO4 A;  2VZY A;  4B5P B;  4KVM E;  1Z4E A;  2EUI A;  1BOB A;  4MBU A;  1IYK A;  2R8V A;  2VXK A;  4NEX A;  2BEI A;  1Z9U A;  2KCW A;  4CAX A;  2Q4V A;  4L8A A;  3EO4 A;  5KTD A; 
#chains in the Genus database with same CATH topology
 4FBE A;  2PQ8 A;  3D3S A;  3PBE A;  3TC8 A;  1AYE A;  3KGQ A;  4M6I A;  2V77 A;  5JGF A;  1YX0 A;  1VHS A;  1BPN A;  1XEB A;  4JZ0 A;  3CPA A;  1MJA A;  2J9A A;  3NA6 A;  4NCZ A;  3RBU A;  2Y0M A;  2GU2 A;  4R87 A;  4ORF A;  4R8F A;  1R3N A;  2NMT A;  4OIW A;  1TF8 A;  5F49 A;  4XNH B;  4QUS A;  3NE7 A;  4U9Z A;  2IMO A;  4OC1 A;  5AG6 A;  2B3U A;  3G8W A;  1DTD A;  4XPD C;  2BCO A;  4IHM A;  4EME A;  3KQX A;  2ATR A;  3RAM A;  4KOT A;  3FJU A;  1IB1 E;  5JPH A;  2D4O A;  2P6E A;  3PB9 X;  3UY5 A;  1GHE A;  2QML A;  5F46 A;  1LAN A;  5DWM A;  5K8O A;  2HUZ A;  3IEH A;  3TOA A;  5G21 A;  2PRQ A;  1K4J A;  3P2F A;  3FXT A;  4R3L A;  2Q7B A;  1RXT A;  2OH1 A;  2Q0Y A;  4HNX B;  5C88 A;  3BI1 A;  5IB9 A;  4CAV A;  2AFX A;  4MHP A;  3KKW A;  3DLJ A;  2ZOF A;  1YRE A;  4P10 A;  3R9F A;  1HDQ A;  4J3G A;  1KUY A;  4B5O A;  1Y7E A;  2AJ6 A;  3K9T A;  3TT2 A;  3W6X A;  5K8P A;  2Z3N A;  2PVV A;  3FNC A;  1FY7 A;  1MJ9 A;  1PU9 A;  3IJ3 A;  1XOV A;  1VKC A;  1XJO A;  2C6P A;  3PRT A;  3B3S A;  5DS0 A;  2OZU A;  4YU9 A;  1LRZ A;  3B35 A;  1S7N A;  3SJG A;  1CP6 A;  2DPT A;  5ELY A;  4H6Z A;  2OR4 A;  2PVW A;  1Y0Y A;  3D7D A;  1M4L A;  4MHD A;  5IB0 A;  2IL4 A;  3PZJ A;  3D4U A;  2ODF A;  2AFM A;  3FYN A;  3PEI A;  4KSF A;  2PJ8 A;  2GIV A;  3KR5 A;  1XFO A;  1MK4 A;  1BAV A;  2Z3O A;  4CRZ B;  1Z2L A;  2PR8 A;  3TO9 A;  3A9L A;  4KOV A;  3VH9 A;  3T90 A;  4DNC A;  4XPD B;  1A2Z A;  2V8G A;  2C6G A;  2PDO A;  4FD7 A;  1AMP A;  4HPS A;  2J8N A;  2FS5 A;  3CXQ A;  1GYT A;  4NF1 A;  4F9V A;  3R96 A;  3FH4 A;  2ZED A;  3QAH A;  1QMU A;  5K8N A;  2V8V A;  1WK4 A;  2CNM A;  3FF3 A;  4L89 A;  1XRY A;  4MMO A;  4IUS A;  1CPX A;  4KUA A;  2WZN A;  4C2Z A;  4P4E A;  5CPA A;  5KTA A;  3PB6 X;  5HH1 A;  4U5Y A;  4NGS A;  4Y49 C;  4M6G A;  4A2Z A;  3R95 A;  4E0A A;  2REF A;  1Z4R A;  3GKR A;  2BL1 A;  3PFE A;  3HUV A;  2Q7S A;  1IIC A;  3MRU A;  3ZZI A;  2P6G A;  4AXV A;  1NSL A;  4OC2 A;  4OAE A;  1R57 A;  2PC1 A;  4UCP A;  5EMI A;  4ZYQ A;  3H5Z A;  3TX8 A;  4P4D A;  4KLV A;  4ZGY B;  2DF5 A;  3E0K A;  2REE A;  4FD5 A;  4F0X A;  2ZOG A;  3SI2 A;  5KTC A;  2JLM A;  3B3C A;  2OZG A;  4B5P A;  2A4N A;  4UEE A;  3FB3 A;  3S6G A;  4KSA A;  3IIB A;  1OBR A;  5H84 A;  4HNY B;  3D7H A;  1LAP A;  2Q4Y A;  1ZG8 A;  4PXB A;  5CNP A;  4ZX9 A;  1YW4 A;  5D8N A;  4FWU A;  3S6K A;  1U6M A;  1LAM A;  2ZEM A;  4ZY2 A;  2BO9 A;  2Z11 A;  4P4I A;  3NH5 A;  5LRK A;  4BIN A;  2O53 A;  5HVH A;  1B87 A;  1XBU A;  4B12 A;  1M4I A;  1TF9 A;  3IWE A;  4CGO A;  1I21 A;  2XEF A;  3N7Z A;  4MFQ A;  4C7H A;  3IO1 A;  2B5G A;  4JLY A;  3B3W A;  5CBM A;  1CG2 A;  4C2Y A;  5A27 A;  4RS2 A;  3NE8 A;  2EO8 A;  4R6T A;  4C2X A;  3S6F A;  4II9 A;  2B58 A;  5I0C A;  6CPA A;  1AUG A;  4AVB A;  2J8R A;  5HMN A;  2GLF A;  2X7B A;  2Q43 A;  2ZEG A;  3F5B A;  4PXD A;  2GLJ A;  3GY9 A;  1LOK A;  1Q2Y A;  1Z8L A;  4LQG A;  3SI1 A;  4BMH A;  4NFR A;  2EVN A;  3K9U A;  3LMS A;  5THW A;  1QSO A;  4A37 A;  2ABZ A;  1N71 A;  2FIA A;  4RN7 A;  4CYO A;  2YGW A;  2NSM A;  3I1U A;  4LX9 A;  2FVG A;  2PJ5 A;  2IQ6 A;  2AFU A;  1PUA A;  2R1I A;  3CT9 A;  2RC4 A;  4UA3 A;  4A94 A;  2ZEH A;  3B7I A;  4B10 A;  3CDX A;  4NXY A;  3QNV A;  4JD6 A;  2WYR A;  4TWE A;  1TKJ A;  1P4N A;  1QSR A;  1VGY A;  4DJL A;  4G1P A;  1OZP A;  4CYQ A;  2PJ2 A;  2YND A;  2PJ3 A;  3G3S A;  2Z3M A;  1HDU A;  4PSW A;  1M1D A;  4QC6 A;  1Q7L A;  5HVF A;  3T9Y A;  4OC3 A;  3WR7 A;  4F6A A;  2B5G B;  3D2P A;  1X12 A;  3I9S A;  4YGO A;  1IU8 A;  2I79 A;  4OAD A;  4PPZ A;  3VWE A;  5EBV A;  3EFA A;  4U9Y A;  2PJ9 A;  2DPS A;  2VEZ A;  3BJ7 A;  4A33 A;  3SHP A;  7CPA A;  4MY3 A;  1LCP A;  4ZI6 A;  4P4B A;  4ZY0 A;  5LYL A;  5F09 A;  4CYN A;  2IJZ A;  1YME A;  2H5M A;  3JTK A;  3LOD A;  2B3V A;  2FIW A;  2CF4 A;  4H2K A;  4F0Y A;  3CZX A;  1WWZ A;  3D2M A;  4UWI A;  4PXC A;  1KZF A;  3IWW A;  4CYP A;  2Z3K A;  4NGM A;  3S9L A;  4R57 A;  1S3Z A;  1TKH A;  2ZW4 A;  3VAR A;  4A39 A;  2I00 A;  3RNZ A;  2ZEF A;  2Q44 A;  1BPM A;  1Z8T A;  2QJ8 A;  1B6B A;  4CGN A;  2P6F A;  3WC5 A;  1RO5 A;  4XPL A;  4PV6 A;  3D7G A;  1S7K A;  3D66 A;  4UFV A;  2XEJ A;  2HC9 A;  4AVA A;  2XEI A;  3DNS A;  1CPS A;  4XNH C;  2C6C A;  4P4F A;  4MFP A;  2ZEN A;  5F47 A;  5J1Q A;  1YK3 A;  3FEC A;  1FNO A;  5HVG A;  2XEG A;  3CPX A;  4UCM A;  1IGB A;  2ZEE A;  8CPA A;  1XMB A;  2JEV A;  1XE4 A;  2QVP A;  1Z8W A;  4WWV A;  2WPW A;  2G9D A;  1YLE A;  2F5I A;  3KHZ A;  2DEA A;  4O23 A;  4OP4 A;  3V8I A;  4NGP A;  4CS0 B;  3K2K A;  1XIX A;  3C26 A;  1F2P A;  3MGD A;  1QSM A;  2AE6 A;  5FVJ A;  5EC4 A;  3SI0 A;  2BOA A;  2EK9 A;  4YFJ A;  1S7F A;  4PQA A;  4Q38 A;  4F8Z A;  3GYA A;  4OKO A;  4OC5 A;  2O4H A;  2Z0Z A;  4P4J A;  4XPK A;  4R7M A;  4C68 A;  3PP9 A;  3IGR A;  1ELM P;  1TKF A;  4KZT A;  3BI0 A;  5F48 A;  4QBJ A;  2Z3P A;  3VWD A;  1QST A;  2PIY A;  3PGP A;  1ZG9 A;  3NH8 A;  1IOI A;  4ZX8 A;  4R3K A;  2HQY A;  3R9G A;  1DE4 C;  1TIQ A;  2QIR A;  2BUE A;  3D8P A;  2GRE A;  2CNS A;  3DR8 A;  4MI4 A;  3LAC A;  3SXO A;  4OID A;  3WC7 A;  2VZZ A;  1X10 A;  2J8M A;  4KOU A;  4ZBG A;  3RZA A;  4E2A A;  3L2N A;  4KOS A;  5I4M A;  5AG7 A;  5G22 A;  3ISX A;  2ZXV A;  4X5K A;  1TXR A;  4MY0 A;  4KOX A;  4UEZ A;  3QB8 A;  4QVT A;  1YSJ A;  4HNW B;  2PJ0 A;  3KL9 A;  5C82 A;  4WJB A;  1JQG A;  2AFS A;  3WAB A;  4GS4 A;  4NGN A;  4M85 A;  4RUH A;  1NSA A;  1VHE A;  2ZEP A;  4UIB A;  1ARM A;  2PR1 A;  1Q2D A;  3LD2 A;  2JBJ A;  3IWG A;  4OLL A;  4CRY B;  1ZLI A;  3BXM A;  3JVN A;  2ARH A;  3FIX A;  3KAS A;  3R1K A;  3V38 A;  1YVK A;  3T8W A;  3BHX A;  4KVO E;  3KQZ A;  4AG9 A;  3D7F A;  4A95 A;  1YR0 A;  2OZH A;  4X8I A;  1XF8 A;  2ZEO A;  1L0C A;  2FE7 A;  3TE4 A;  2B4D A;  1CBX A;  2CNT A;  1I1D A;  2ZW6 A;  3IC1 A;  1ZLH A;  4OC4 A;  3F0A A;  3ISZ A;  4NGT A;  4A31 A;  2G3A A;  1H8L A;  3N5F A;  4BD9 A;  3PFO A;  4R76 A;  5LYI A;  3D68 A;  1MJB A;  2BSW A;  3KI9 A;  4MFZ A;  2HB6 A;  4B11 A;  4IF5 A;  3B2Y A;  5H86 A;  1XMT A;  2FL4 A;  3FMC A;  4A32 A;  3W91 A;  1F2O A;  4M3S A;  4C7I A;  1VHO A;  1JWQ A;  2Q4Z A;  3IU2 A;  3I3G A;  2PJB A;  3H8E A;  3TO6 A;  2AFO A;  2Z10 A;  5LYD A;  3ZJ0 A;  2VI7 A;  3VAT A;  5JQ4 A;  2K5T A;  4MRI A;  3BLN A;  4MFJ A;  1CP7 A;  2PCU A;  4LUA A;  4UBR A;  1F57 A;  2G0B A;  2ZW7 A;  5IX3 A;  4Q7A A;  4MFL A;  1RTQ A;  2PSW A;  3B3T A;  3MN8 A;  2V8D A;  2EBJ A;  3FVL A;  2B4D B;  2OU2 A;  1IID A;  4EWT A;  2CXA A;  4KOR A;  3WT4 A;  3FRM A;  4FAI A;  3H8F A;  4NGQ A;  4UFX A;  2R98 A;  1QSN A;  4B6Z A;  1YQE A;  3GIU A;  4K3N A;  5A28 A;  1S60 A;  3BJ8 A;  3KHX A;  4H6U A;  5G1Z A;  3RO0 A;  3FBU A;  2G3T A;  1S7L A;  4FUU A;  3DR6 A;  2WUU A;  3R9E A;  1Y0R A;  1Y9K A;  2FSR A;  2RB7 A;  3EXN A;  3B8G A;  5J8C A;  4EFD A;  3EC4 A;  4Y49 B;  3S9M A;  3OWC A;  4HKF A;  4PK3 A;  4EVY A;  3DDD A;  5AGE A;  4KOY A;  5DWN A;  2PIZ A;  2POK A;  1UWY A;  1KWM A;  3H4Q A;  1Z5R A;  1V0C A;  2CTB A;  2PRB A;  1KUV A;  1IOF A;  4X3R A;  5G20 A;  4QB9 A;  4PK2 A;  4W9Y A;  3IU1 A;  3P2H A;  2YNC C;  4YRH A;  1CX8 A;  2QEC A;  4CAF A;  1CJW A;  4CAE A;  3FED A;  2OB0 A;  4BBH A;  3NFZ A;  1I12 A;  2CY2 A;  2R7H A;  4MCQ A;  3RYO A;  4R9M A;  2AFZ A;  1NMT A;  4CAW A;  3IFE A;  5LRJ A;  2V8H A;  3FX6 A;  2D4P A;  4P44 A;  4KOW A;  3SJF A;  4CGP A;  3PB7 X;  2RFH A;  4P6Y A;  1M4G A;  3F8K A;  2WPX A;  4UEF A;  4X2T A;  5AG5 A;  2PE3 A;  4UFW A;  4CGM A;  5IV0 A;  2VBQ A;  1NE9 A;  4AG7 A;  1P0H A;  3NH4 A;  3TTH A;  1YGH A;  3TFY A;  4UCN A;  4PSX A;  2B4B A;  5E96 A;  4NJR A;  4MFK A;  3PB4 X;  4MXU A;  2Q51 A;  4CGL A;  4DYO A;  4NJQ A;  4IK2 A;  1Y7R A;  1BLL E;  3W6S A;  2HV2 A;  4A30 A;  4A38 A;  1CM0 A;  2PJA A;  4OME A;  3SJX A;  4AVC A;  2PJ6 A;  1KUX A;  2EWB A;  4PXE A;  1YLO A;  1ELL P;  4UWJ A;  4UIA A;  2YNE A;  4KUB A;  1UFH A;  3D67 A;  4K30 A;  1M4D A;  2GAN A;  3KR4 A;  4FD4 A;  2OOT A;  4TNU A;  1FT7 A;  3LWU A;  4JJX A;  2JEW A;  4E8O A;  4ONU A;  4Q36 A;  4NGR A;  4MCR A;  3S9N A;  1PCA A;  4I49 A;  4YWY A;  5AG4 A;  1LFW A;  3FEE A;  2PJ7 A;  2Z3L A;  1Y9W A;  3B3V A;  5JH9 A;  1QQ9 A;  1YVO A;  1YW6 A;  3CXS A;  4MHN A;  2C1C A;  2I3C A;  4NSQ A;  2JBK A;  3PBB A;  3KZW A;  5GCN A;  1J4J A;  2CIJ A;  2ZPA A;  3DSB A;  3QAY A;  2O28 A;  2PJC A;  4MCP A;  2C27 A;  2DXQ A;  2QYV A;  4GM5 A;  4ONW A;  5J8F A;  4ZY1 A;  1ZO0 A;  4JYW A;  4JXQ A;  2P0W A;  2ZW5 A;  2JDD A;  1Q2C A;  2F7V A;  3EY5 A;  4KLW A;  2VL1 A;  1ON0 A;  5K8M A;  2PJ4 A;  2F8H A;  1R43 A;  4JWP A;  3SXN A;  1SQH A;  2ANP A;  2FXF A;  4FD6 A;  4MCS A;  4GXH A;  3TOB A;  3WC6 A;  3JUW A;  5ISV A;  1IYL A;  3DGV A;  2FCK A;  2VQY A;  4KVX A;  4UF4 A;  3GUX A;  3S6H A;  4B13 A;  3CXP A;  4H89 A;  3H8G A;  4MJ8 A;  1ZG7 A;  3TO7 A;  4KSI A;  2AFW A;  2WSA A;  2GE3 A;  3TCV A;  3PB8 X;  4AB7 A;  4JXR A;  1EE3 P;  2FT0 A;  5D29 A;  4RI1 A;  1M44 A;  4B14 A;  2JDC A;  5LYF A;  2CTC A;  2Q04 A;  1S5K A;  2GFQ A;  1BO4 A;  5LRG A;  4P45 A;  2VZY A;  4DUK A;  1HEE A;  2ZEL A;  5BWA B;  4B5P B;  2EK8 A;  5JM6 A;  5HXD A;  4KVM E;  1Z4E A;  2EUI A;  4OC0 A;  1Z8X A;  4LQ6 A;  1BOB A;  4IAV A;  1IY7 A;  3SJE A;  2NYQ A;  4MBU A;  3GB0 A;  4KS9 A;  1IYK A;  3HLP A;  4M6H A;  2R8V A;  2VXK A;  3V7Z A;  1ARL A;  2YNC A;  4NEX A;  2BEI A;  1Z9U A;  4MHY A;  1VIX A;  2PJ1 A;  2KCW A;  4CAX A;  1PYT B;  4Z65 A;  2Q4V A;  4L8A A;  3EO4 A;  4MHZ A;  4F9U A;  5KTD A;  4CPA A;  3GLJ A;  3JRU A; 
#chains in the Genus database with same CATH homology
 2PQ8 A;  3D3S A;  1YX0 A;  1VHS A;  1XEB A;  1MJA A;  4NCZ A;  2Y0M A;  4R87 A;  4ORF A;  2NMT A;  5F49 A;  4XNH B;  4QUS A;  3NE7 A;  4U9Z A;  5AG6 A;  2B3U A;  3G8W A;  4XPD C;  2ATR A;  4KOT A;  1IB1 E;  5JPH A;  2D4O A;  2P6E A;  3UY5 A;  1GHE A;  2QML A;  5F46 A;  5DWM A;  2HUZ A;  3TOA A;  5G21 A;  1K4J A;  3P2F A;  3FXT A;  4R3L A;  2Q7B A;  1RXT A;  2OH1 A;  2Q0Y A;  4HNX B;  5C88 A;  4CAV A;  3KKW A;  1YRE A;  3R9F A;  4J3G A;  1KUY A;  4B5O A;  2AJ6 A;  3TT2 A;  3W6X A;  2Z3N A;  3FNC A;  1FY7 A;  1MJ9 A;  1PU9 A;  1VKC A;  2OZU A;  1LRZ A;  1S7N A;  2DPT A;  4H6Z A;  4MHD A;  5IB0 A;  2IL4 A;  3PZJ A;  4KSF A;  3FYN A;  2GIV A;  1MK4 A;  4CRZ B;  2Z3O A;  2PR8 A;  3TO9 A;  3A9L A;  4KOV A;  3T90 A;  4DNC A;  4XPD B;  2PDO A;  4FD7 A;  2J8N A;  3CXQ A;  2FS5 A;  4NF1 A;  3R96 A;  3QAH A;  1WK4 A;  2CNM A;  4L89 A;  4IUS A;  4KUA A;  4C2Z A;  5KTA A;  5HH1 A;  4U5Y A;  4A2Z A;  4Y49 C;  4E0A A;  3R95 A;  2REF A;  1Z4R A;  3GKR A;  2BL1 A;  1IIC A;  3ZZI A;  2P6G A;  1NSL A;  4OAE A;  1R57 A;  2PC1 A;  4UCP A;  3H5Z A;  4ZGY B;  4KLV A;  3E0K A;  2REE A;  4FD5 A;  4F0X A;  5KTC A;  2JLM A;  4B5P A;  2OZG A;  2A4N A;  3S6G A;  3FB3 A;  4KSA A;  5H84 A;  4HNY B;  2Q4Y A;  5CNP A;  3S6K A;  1U6M A;  2Z11 A;  1B87 A;  4B12 A;  1M4I A;  3IWE A;  4CGO A;  1I21 A;  3N7Z A;  4MFQ A;  4C7H A;  2B5G A;  4JLY A;  4C2Y A;  5A27 A;  4RS2 A;  4C2X A;  3S6F A;  4II9 A;  2B58 A;  5I0C A;  5HMN A;  2J8R A;  2X7B A;  3F5B A;  3GY9 A;  1Q2Y A;  4BMH A;  2EVN A;  3K9U A;  1QSO A;  1N71 A;  2FIA A;  4CYO A;  2YGW A;  4LX9 A;  1PUA A;  2R1I A;  2RC4 A;  4UA3 A;  4B10 A;  4NXY A;  4JD6 A;  1P4N A;  1QSR A;  1OZP A;  4CYQ A;  2YND A;  3G3S A;  2Z3M A;  4PSW A;  4QC6 A;  1M1D A;  4F6A A;  3T9Y A;  3WR7 A;  2B5G B;  3D2P A;  3I9S A;  4YGO A;  2I79 A;  4OAD A;  3VWE A;  5EBV A;  3EFA A;  4U9Y A;  2DPS A;  2VEZ A;  3BJ7 A;  4A33 A;  3SHP A;  4MY3 A;  4CYN A;  3JTK A;  2H5M A;  3LOD A;  2B3V A;  2FIW A;  4F0Y A;  1WWZ A;  3D2M A;  4UWI A;  1KZF A;  2Z3K A;  4R57 A;  1S3Z A;  2ZW4 A;  2I00 A;  2Q44 A;  4CGN A;  1B6B A;  2P6F A;  1RO5 A;  4XPL A;  4PV6 A;  1S7K A;  4UFV A;  4AVA A;  3DNS A;  4XNH C;  5F47 A;  4MFP A;  1YK3 A;  4UCM A;  2JEV A;  1XE4 A;  2WPW A;  1YLE A;  2F5I A;  3V8I A;  4CS0 B;  1XIX A;  3C26 A;  3MGD A;  5FVJ A;  1QSM A;  2AE6 A;  5EC4 A;  4YFJ A;  1S7F A;  4Q38 A;  3GYA A;  2Z0Z A;  4XPK A;  4C68 A;  3PP9 A;  3IGR A;  4KZT A;  4QBJ A;  5F48 A;  2Z3P A;  3VWD A;  1QST A;  3PGP A;  4R3K A;  2HQY A;  3R9G A;  1TIQ A;  2QIR A;  2BUE A;  3D8P A;  3DR8 A;  2CNS A;  4MI4 A;  3SXO A;  2VZZ A;  2J8M A;  4KOU A;  4ZBG A;  4E2A A;  4KOS A;  5AG7 A;  5G22 A;  2ZXV A;  4X5K A;  4MY0 A;  4KOX A;  3QB8 A;  4QVT A;  4HNW B;  5C82 A;  4GS4 A;  4M85 A;  2PR1 A;  1Q2D A;  3LD2 A;  4CRY B;  3IWG A;  4OLL A;  3JVN A;  2ARH A;  3FIX A;  3R1K A;  1YVK A;  4KVO E;  4AG9 A;  4A95 A;  1YR0 A;  2OZH A;  1XF8 A;  1L0C A;  2FE7 A;  3TE4 A;  2B4D A;  2CNT A;  1I1D A;  2ZW6 A;  3F0A A;  4A31 A;  2G3A A;  1MJB A;  2BSW A;  4B11 A;  4MFZ A;  4IF5 A;  5H86 A;  1XMT A;  2FL4 A;  4A32 A;  3W91 A;  4M3S A;  4C7I A;  3IU2 A;  3I3G A;  3TO6 A;  2Z10 A;  3ZJ0 A;  2VI7 A;  5JQ4 A;  2K5T A;  3BLN A;  4MFJ A;  4LUA A;  4UBR A;  5IX3 A;  2G0B A;  2ZW7 A;  4MFL A;  2PSW A;  2B4D B;  2OU2 A;  1IID A;  2CXA A;  4KOR A;  3FRM A;  4UFX A;  2R98 A;  1QSN A;  5A28 A;  1S60 A;  3BJ8 A;  4H6U A;  5G1Z A;  3FBU A;  2G3T A;  1S7L A;  3DR6 A;  2WUU A;  3R9E A;  1Y9K A;  2FSR A;  3EXN A;  3B8G A;  5J8C A;  3EC4 A;  4Y49 B;  3OWC A;  4HKF A;  4PK3 A;  4EVY A;  3DDD A;  5AGE A;  4KOY A;  5DWN A;  3H4Q A;  2PRB A;  1V0C A;  1KUV A;  4AVB A;  5G20 A;  4QB9 A;  4PK2 A;  4YRH A;  3IU1 A;  3P2H A;  2YNC C;  4CAF A;  4CAE A;  2QEC A;  1CJW A;  2OB0 A;  4BBH A;  1I12 A;  2CY2 A;  2R7H A;  3RYO A;  4CAW A;  4R9M A;  1NMT A;  2D4P A;  4KOW A;  4CGP A;  5AG5 A;  1M4G A;  3F8K A;  2WPX A;  4UFW A;  4CGM A;  5IV0 A;  2VBQ A;  1NE9 A;  4AG7 A;  1P0H A;  3TTH A;  1YGH A;  3TFY A;  4UCN A;  4PSX A;  2B4B A;  5E96 A;  4MFK A;  4CGL A;  1Y7R A;  3W6S A;  2HV2 A;  4A30 A;  1CM0 A;  4AVC A;  1KUX A;  4UWJ A;  2YNE A;  4KUB A;  1UFH A;  4K30 A;  1M4D A;  2GAN A;  4FD4 A;  4JJX A;  4E8O A;  4ONU A;  4Q36 A;  4I49 A;  5AG4 A;  2Z3L A;  1Y9W A;  1YVO A;  3CXS A;  4NSQ A;  5GCN A;  1J4J A;  2ZPA A;  3DSB A;  2O28 A;  2C27 A;  2DXQ A;  5J8F A;  1ZO0 A;  4JXQ A;  2P0W A;  2ZW5 A;  2JDD A;  1Q2C A;  3EY5 A;  4KLW A;  1ON0 A;  4JWP A;  3SXN A;  4CYP A;  1SQH A;  2FXF A;  4FD6 A;  3TOB A;  3JUW A;  5ISV A;  1IYL A;  2FCK A;  2VQY A;  4KVX A;  3S6H A;  4B13 A;  3CXP A;  4H89 A;  4MJ8 A;  3TO7 A;  3TCV A;  2WSA A;  2GE3 A;  4AB7 A;  4JXR A;  2FT0 A;  4RI1 A;  1M44 A;  4B14 A;  2JDC A;  2Q04 A;  1S5K A;  1BO4 A;  2VZY A;  5BWA B;  4B5P B;  4KVM E;  1Z4E A;  2EUI A;  1BOB A;  4MBU A;  4KS9 A;  1IYK A;  2R8V A;  2VXK A;  2YNC A;  4NEX A;  2BEI A;  1Z9U A;  2KCW A;  4CAX A;  2Q4V A;  4L8A A;  3EO4 A;  5KTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...