1Y9WA

Structural genomics, 1.9a crystal structure of an acetyltransferase from bacillus cereus atcc 14579
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
140
structure length
140
Chain Sequence
MYMKHIENGTRIEGEYIKNKVIQYNMSILTDEVKQPMEEVSLVVKNEEGKIFGGVTGTMYFYHLHIDFLWVDESVRHDGYGSQLLHEIEGIAKEKGCRLILLDSFSFQAPEFYKKHGYREYGVVEDHPKGHSQHFFEKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Acetyltransferase
publication title 1.9A crystal structure of an acetyltransferase from Bacillus cereus ATCC 14579
rcsb
source organism Bacillus cereus
total genus 36
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1y9wA01
2WPXA 3KKWA 2ZPAA 4KOWA 2Q04A 1J4JA 1YVOA 2Q44A 4LX9A 2Q4VA 1M4IA 2FCKA 4KORA 2HQYA 4KOVA 3EY5A 2ATRA 2R7HA 4GS4A 2BUEA 4R87A 4AG7A 2PC1A 4MHDA 1YVKA 3UY5A 3FYNA 4Y49C 3DDDA 1M1DA 4HNYB 2PQ8A 4B5PA 1YLEA 1WK4A 2I00A 2BSWA 1IB1E 3CXPA 2QECA 4PK3A 4R9MA 1S7LA 2JDDA 3ZJ0A 1XF8A 3NE7A 1YK3A 2R1IA 2OZGA 1B6BA 5HH1A 3H4QA 3CXQA 2P6EA 4HKFA 3GY9A 3R9FA 3GKRA 2H5MA 4CAXA 1S7KA 3BJ8A 1MK4A 1S7FA 2VEZA 1I21A 2CNTA 3S6GA 1M4DA 2GIVA 2P6FA 3IWGA 2PSWA 4XPDB 2Q4YA 5HMNA 2Q7BA 1NE9A 1VKCA 4JD6A 2ZW5A 1XIXA 2REEA 3DSBA 4KVME 4AVCA 4MI4A 1Z4EA 1M44A 2PR1A 3BJ7A 1P0HA 3QB8A 5DWNA 5F49A 1S5KA 3TO9A 2PRBA 3OWCA 1S3ZA 3R9GA 1YR0A 4OADA 5E96A 2AE6A 3TO7A 4KOSA 4H6UA 4KOXA 4XPDC 4M3SA 4EVYA 4HNWB 1Z4RA 2B4DB 4L8AA 3DNSA 3JUWA 4H6ZA 1KZFA 4AVBA 5KTCA 2VZZA 4KZTA 3D3SA 3FXTA 1Z9UA 1R57A 4U9ZA 4F0YA 3FB3A 4JLYA 4U9YA 3DR6A 1I1DA 2OZHA 1KUVA 3LODA 4PSXA 1QSRA 1XMTA 1LRZA 4B5OA 2F5IA 3G8WA 3D2MA 3G3SA 4QB9A 2QIRA 3TO6A 1K4JA 4AVAA 4FD5A 3IGRA 5F48A 3VWEA 3C26A 1Q2YA 3FIXA 2CNSA 4MY0A 3F0AA 2HUZA 2NMTA 4PSWA 2FT0A 4AG9A 4CS0B 2OZUA 4NXYA 3S6KA 4KVOE 2ARHA 2Z11A 4XNHB 2IL4A 3P2HA 3SXOA 1NMTA 2OB0A 5DWMA 4RI1A 3W6SA 2FXFA 3R96A 4JXRA 3FRMA 2G3TA 4FD7A 2OH1A 2P0WA 5J8FA 3EFAA 3R1KA 4JWPA 4CAWA 1Q2CA 3K9UA 5JQ4A 2K5TA 1FY7A 2B4DA 2FE7A 2JDCA 1NSLA 1B87A 2CNMA 4KUAA 2VI7A 2G0BA 4ONUA 4QC6A 3TOAA 3MGDA 4E2AA 1MJ9A 2B5GB 5IB0A 3V8IA 4XNHC 4MBUA 1Y9KA 5H86A 2I79A 4XPKA 2ZW4A 4ORFA 1BO4A 3TOBA 4KOTA 4R3LA 2FL4A 2PR8A 3S6HA 4AB7A 3JVNA 1XE4A 4ZBGA 2Q0YA 4OAEA 4MY3A 1IIDA 3T9YA 4CRYB 1I12A 4H89A 4FD4A 2PDOA 1PUAA 2J8NA 4PV6A 1YGHA 4HNXB 5KTAA 2B3UA 4RS2A 3TT2A 4E0AA 3TFYA 2EVNA 3ZZIA 4BMHA 2REFA 1V0CA 4F6AA 1IYLA 1YX0A 2JLMA 1TIQA 3D2PA 1IICA 4QVTA 3D8PA 4K30A 4UA3A 3LD2A 2R98A 5ISVA 1UFHA 2VBQA 2B4BA 3CXSA 3SHPA 2C27A 3F5BA 2B5GA 4U5YA 2O28A 4YFJA 5H84A 1IYKA 3PZJA 5IV0A 2ZW6A 1CM0A 4J3GA 3I3GA 3W6XA 2CY2A 1KUYA 3E0KA 2VQYA 4DNCA 5EC4A 4QBJA 5C88A 4OLLA 2Z0ZA 2D4PA 2R8VA 2B3VA 1MJAA 3TCVA 3R9EA 3WR7A 3VWDA 2JEVA 3I9SA 3TE4A 2QMLA 4JJXA 4YGOA 5F46A 1KUXA 4KOYA 4KLVA 2D4OA 1RXTA 4KUBA 4JXQA 1P4NA 1QSNA 4UBRA 4LUAA 1QSTA 1Y9WA 4KVXA 3PGPA 2GE3A 3SXNA 4MJ8A 2FSRA 4R3KA 4QUSA 1QSOA 3B8GA 4M85A 4L89A 2EUIA 1CJWA 2A4NA 3EO4A 2OU2A 1XEBA 3P2FA 5GCNA 3TTHA 2FS5A 1Y7RA 2Y0MA 4IUSA 1SQHA 5C82A 1OZPA 4I49A 1MJBA 1QSMA 2FIAA 4CRZB 5I0CA 5FVJA 1WWZA 1M4GA 1BOBA 1S7NA 1YREA 1N71A 2ZW7A 2WPWA 1VHSA 1PU9A 3R95A 5F47A 3QAHA 3W91A 5CNPA 5J8CA 2DXQA 2VZYA 5JPHA 2BL1A 5KTDA 2FIWA 4X5KA 1U6MA 3N7ZA 3DR8A 4KLWA 2J8RA 2ZXVA 2G3AA 2X7BA 3F8KA 4UWIA 2J8MA 4IF5A 4NCZA 3BLNA 4KOUA 4II9A 4NEXA 3FBUA 3GYAA 2HV2A 4B5PB 3RYOA 3S6FA 4UWJA 4CAVA 2P6GA 1Q2DA 1S60A 4NF1A 4R57A 4XPLA 2KCWA 1GHEA 2VXKA 1L0CA 3EXNA 5IX3A 3EC4A 4E8OA 2GANA 2AJ6A 2B58A 2Z10A 1RO5A 4Y49B 2RC4A 4FD6A 4NSQA 1ON0A 3T90A 2BEIA 5EBVA 4PK2A 3FNCA 3PP9A 4YRHA
chains in the Genus database with same CATH superfamily
3H5ZA 5AGEA 2Z3LA 1PYTB 2C6CA 2WPXA 1Z8LA 3ISXA 3B3TA 4CYOA 3CZXA 3KKWA 2ZPAA 4KOWA 4P4IA 5I4MA 4OIDA 4CGLA 4OMEA 4OC2A 2Q04A 4UF4A 1J4JA 3SI0A 1YSJA 1YVOA 4KSFA 2Q44A 3PFOA 4LX9A 4Q38A 3TC8A 2Q4VA 5BWAB 1M4IA 1NSAA 2FCKA 4KORA 2HQYA 4KOVA 4M6GA 3EY5A 4P4JA 2ZEPA 4PXDA 1ELLP 1XBUA 2ATRA 2R7HA 4C2YA 4GS4A 2BUEA 4OC5A 2RB7A 3IJ3A 3KQZA 5K8MA 4R87A 3FVLA 4AG7A 2PC1A 5A27A 1IU8A 2POKA 4K3NA 4MHDA 1YVKA 3V7ZA 3UY5A 3FYNA 3GB0A 3D7DA 2C6PA 4PPZA 3DDDA 4Y49C 1BAVA 4OC1A 1M1DA 3PB4X 4EMEA 4DYOA 4HNYB 2PQ8A 3L2NA 3PBBA 1ARMA 4B5PA 1YLEA 1WK4A 2I00A 4H2KA 2BSWA 1IB1E 3CXPA 4FUUA 1LCPA 1Z8TA 4IHMA 2QECA 4ZY0A 1QMUA 5ELYA 4PK3A 4R9MA 4PQAA 1S7LA 4R7MA 2JDDA 4C7IA 3ZJ0A 4BBHA 3NH8A 1XF8A 5A28A 3NE7A 1YK3A 2R1IA 1CPSA 2OZGA 3SJXA 1B6BA 4ZYQA 5HH1A 1XRYA 3VARA 1TKHA 2EK9A 3WC5A 3D68A 5AG4A 3H4QA 5K8PA 1LFWA 3NA6A 3CXQA 5DS0A 1HEEA 4F0XA 2P6EA 4HKFA 3GY9A 4F9VA 1CP6A 3R9FA 5HVFA 1VGYA 3GKRA 2H5MA 4CAXA 5CPAA 1S7KA 2QYVA 2Z3NA 2O4HA 3BJ8A 4OC4A 5K8NA 2HB6A 1MK4A 1X10A 4UEZA 4Z65A 1S7FA 2PJ2A 2VEZA 1I21A 2CNTA 4PXEA 4KSIA 4NJQA 1M4DA 3S6GA 1YLOA 2GIVA 3SJEA 2P6FA 3IWGA 2PSWA 3JTKA 2Q4YA 4GXHA 4XPDB 5HMNA 5IB9A 2PJ0A 2Q7BA 1NE9A 1VKCA 3IIBA 3LMSA 3FJUA 1Q7LA 4JD6A 5K8OA 2ZW5A 1XIXA 2REEA 3DSBA 3PRTA 4KVME 2V8GA 4F8ZA 4UFVA 4AVCA 4MI4A 1Z4EA 2V8VA 1M44A 2PR1A 3BJ7A 3B3CA 1XOVA 3IEHA 1P0HA 1ZG8A 3QB8A 5DWNA 5JGFA 4B12A 3MRUA 5F49A 1S5KA 2PJ7A 5JM6A 3TO9A 5THWA 2DEAA 2PRBA 3OWCA 5LYIA 4DUKA 3D67A 2IJZA 4EFDA 1S3ZA 1F2OA 2PJ6A 3PB7X 3R9GA 1YR0A 4OADA 2V8DA 5E96A 2JBJA 1PCAA 2AE6A 3TO7A 3IU2A 4MFPA 4UCPA 4KOSA 4P44A 5JH9A 2C1CA 3KQXA 4H6UA 5LYFA 4P4DA 3KHZA 1YMEA 1Y7EA 2PJBA 4KOXA 3IWWA 4XPDC 3KGQA 1JWQA 2QVPA 2V8HA 4M3SA 4EVYA 4HNWB 2PCUA 1Z4RA 4X3RA 2B4DB 4L8AA 3FEEA 3DNSA 3JUWA 1CPXA 4H6ZA 1KZFA 1CX8A 4AVBA 4NGNA 4ZY2A 4A37A 4P45A 5KTCA 2VZZA 2IQ6A 1DE4C 4WWVA 2WSAA 4KZTA 4B14A 3D3SA 3FXTA 3N5FA 5G1ZA 5HVHA 4CGMA 4MHZA 3PB9X 3FECA 1Z9UA 1R57A 4U9ZA 3FF3A 4F0YA 3HUVA 3FB3A 4JLYA 4U9YA 3DR6A 1I1DA 2OZHA 3S9MA 1KUVA 3LODA 4NGPA 4PSXA 4A2ZA 1QSRA 1XMTA 4TWEA 1LRZA 2Z3MA 4B5OA 2F5IA 1X12A 2WZNA 2AFWA 3MN8A 4X8IA 3G8WA 2DPSA 3D2MA 3G3SA 4QB9A 3IFEA 4M6IA 3D4UA 2QIRA 4KS9A 3FH4A 3TO6A 4UCNA 1VHEA 1K4JA 3WABA 1BPNA 4FD5A 3IGRA 5F48A 3VWEA 4JZ0A 1HDUA 4MHNA 3C26A 5LRKA 4OIWA 1Q2YA 3FIXA 2CNSA 2ZELA 4MY0A 3VH9A 3F0AA 4MCRA 8CPAA 2HUZA 2NMTA 4G1PA 2FT0A 4NFRA 4PSWA 4AG9A 4CS0B 2OZUA 4NXYA 3S6KA 5F09A 1VHOA 2C6GA 4KVOE 2GLFA 2ARHA 2YGWA 1AYEA 2ZOGA 4A95A 2Z11A 4XNHB 2IL4A 4CYNA 3P2HA 3SXOA 5AG7A 1NMTA 2OB0A 4MCQA 4B13A 5HVGA 1EE3P 2EK8A 1ELMP 3CPXA 1YW4A 1H8LA 2ZEMA 1YW6A 3H8EA 4RI1A 5DWMA 2Q51A 3W6SA 4UCMA 2FXFA 4BINA 3R96A 4JXRA 1XJOA 2PJ9A 3B2YA 3FRMA 4NGRA 4RN7A 2G3TA 1CBXA 3H8FA 4FD7A 2OH1A 1Z2LA 2P0WA 4YRHA 4ZX8A 5J8FA 2IMOA 3EFAA 4LQGA 3R1KA 4JWPA 4CAWA 4R76A 1Q2CA 3K9UA 5JQ4A 2K5TA 2YNEA 1FY7A 2B4DA 2FE7A 1IOFA 2JDCA 2AFUA 2JEWA 1BLLE 4ONWA 4P6YA 1NSLA 2F8HA 1B87A 3CDXA 4P4EA 2CNMA 4KUAA 3RO0A 2VI7A 2G0BA 4ONUA 4QC6A 3WC7A 3TOAA 3MGDA 4E2AA 3KI9A 2PE3A 3GUXA 1MJ9A 2B5GB 5IB0A 4OKOA 1Y0YA 3D7FA 3V8IA 4XNHC 3NFZA 2ZEGA 4MBUA 1Y9KA 4MFQA 1UWYA 5H86A 4RUHA 1KWMA 4PXCA 2I79A 2XEFA 4XPKA 2ZW4A 4ORFA 1BO4A 4M6HA 4C2ZA 1ZLIA 3NH4A 4MRIA 5LRGA 3TOBA 4KOTA 4R3LA 2FL4A 2PR8A 3CPAA 3S6HA 4AB7A 4NJRA 3JVNA 1XE4A 2G9DA 4A38A 4MXUA 1TKJA 2Z3KA 4ZBGA 1XFOA 2OOTA 2Q0YA 3BI1A 4OAEA 4MY3A 4ZY1A 3NH5A 1IIDA 3T9YA 2EBJA 4MHPA 1I12A 4H89A 4P4BA 4Q7AA 3RZAA 4C2XA 4CRYB 3KZWA 2ZEHA 4CGNA 4FD4A 2PDOA 1PUAA 2J8NA 1ZO0A 4UFXA 4PV6A 1YGHA 2VL1A 1OBRA 4HNXB 4B11A 2B3UA 4RS2A 5KTAA 4FAIA 2CF4A 3TT2A 4E0AA 3TFYA 4WJBA 2EVNA 3ZZIA 3KHXA 2PJAA 4A31A 1TF9A 4PXBA 4BMHA 2GREA 4MFLA 4TNUA 2REFA 4ZI6A 1V0CA 4F6AA 1IYLA 1YX0A 4F9UA 1AMPA 2JLMA 2PVVA 5LYDA 5AG5A 4NGQA 1TIQA 3D2PA 1IICA 4QVTA 3D8PA 2JBKA 4K30A 3LD2A 4UA3A 3IO1A 5G20A 2Z3OA 2R98A 4IK2A 1UFHA 3JRUA 2EO8A 4B10A 5ISVA 2VBQA 5HXDA 3CT9A 1ARLA 2B4BA 2ZENA 3CXSA 3PB8X 4IAVA 3SHPA 2C27A 3F5BA 2B5GA 4U5YA 2O28A 1FNOA 2CIJA 4YFJA 5H84A 4CYQA 1ZLHA 3B3VA 1IYKA 3PZJA 1Y0RA 2ZW6A 4P10A 2RFHA 5IV0A 4C68A 5LRJA 1CM0A 4J3GA 3I3GA 1JQGA 4UEFA 3RBUA 3W6XA 2CY2A 1KUYA 3S9NA 3E0KA 2AFXA 2VQYA 4DNCA 5EC4A 4QBJA 5C88A 4OLLA 2Z0ZA 2D4PA 2R8VA 3LWUA 2B3VA 2BOAA 3IWEA 1MJAA 3TCVA 2ZEEA 4R8FA 3R9EA 4C7HA 3A9LA 1Z5RA 3WR7A 3VWDA 4NGSA 3FMCA 2JEVA 2ODFA 3I9SA 3TE4A 2QMLA 5D29A 3KR4A 2GFQA 4LQ6A 4JJXA 4A30A 2PJ5A 4Q36A 4YGOA 1VIXA 2YNDA 2DF5A 3B35A 5F46A 2YNCA 3PFEA 1KUXA 2Q7SA 4O23A 5D8NA 4KOYA 4KLVA 4NGMA 2EWBA 3D7HA 2PRQA 1QQ9A 2D4OA 2J9AA 2GLJA 3GIUA 1RXTA 2QJ8A 3D66A 3I1UA 1P4NA 1GYTA 1QSNA 4JXQA 4KUBA 4UBRA 2Q4ZA 4LUAA 1Z8XA 1QSTA 1Y9WA 4KVXA 1BPMA 3BHXA 3PGPA 3KASA 1AUGA 2GE3A 2AFSA 3SXNA 1IOIA 1LAPA 4MJ8A 2FSRA 4OC0A 4CGPA 3SJFA 4R3KA 1XMBA 4QUSA 1QSOA 3B8GA 5LYLA 1RTQA 3ISZA 2PJ3A 4M85A 2OR4A 2EUIA 2XEIA 4HPSA 4L89A 2ZOFA 4CYPA 1CJWA 4R6TA 1M4LA 2A4NA 2ZEFA 3EO4A 4ZX9A 1Z8WA 3QAYA 4A32A 2AFOA 3BXMA 1IY7A 3LACA 2FVGA 1FT7A 2OU2A 1HDQA 1DTDA 2F7VA 1F57A 5EMIA 4YU9A 1XEBA 1ZG7A 3IU1A 3P2FA 4UIBA 3D7GA 3DLJA 5GCNA 5G22A 4W9YA 4YWYA 3TTHA 3SI1A 3HLPA 4ZGYB 2FS5A 1Y7RA 2Y0MA 4IUSA 3WC6A 1SQHA 5C82A 2CTBA 3FX6A 4FBEA 1OZPA 4I49A 1MJBA 3PEIA 3TX8A 1QSMA 2FIAA 4CRZB 1TF8A 4MCSA 1A2ZA 1LAMA 3SI2A 5I0CA 1ZG9A 4CGOA 4MMOA 4GM5A 5FVJA 1LANA 4CAEA 1WWZA 1M4GA 3RNZA 1BOBA 1S7NA 1YREA 1N71A 2ZW7A 3DGVA 2WPWA 1VHSA 5J1QA 2DPTA 1PU9A 2I3CA 3R95A 5CBMA 2AFZA 2Q43A 1LOKA 2ZEOA 3RAMA 3B3WA 2PIZA 2ANPA 3NE8A 4UFWA 5F47A 1CG2A 2BCOA 4UEEA 2PVWA 3QAHA 5G21A 2BO9A 3W91A 3PB6X 2PJ4A 3H8GA 5CNPA 5J8CA 2DXQA 2VZYA 4OC3A 3T8WA 4CAFA 5JPHA 4MCPA 2BL1A 2PJCA 2NSMA 4MFZA 5KTDA 1YQEA 2FIWA 4P4FA 4X2TA 6CPAA 4X5KA 1U6MA 3B7IA 3N7ZA 3DR8A 4B6ZA 4A39A 4KLWA 4JYWA 2ABZA 2J8RA 3KL9A 4BD9A 3GLJA 1TXRA 2ZXVA 4MHYA 4CPAA 2G3AA 2X7BA 3F8KA 3KR5A 3S9LA 4OP4A 4UWIA 3K9TA 5AG6A 2J8MA 3B3SA 4IF5A 4NCZA 3BLNA 4KOUA 1R3NA 4II9A 3QNVA 4NEXA 3FBUA 3FEDA 3IC1A 2AFMA 3SJGA 3GYAA 2HV2A 2XEGA 4B5PB 2XEJA 1R43A 3RYOA 3S6FA 4UWJA 2V77A 3V38A 4CAVA 4DJLA 1F2PA 3K2KA 2P6GA 2NYQA 1CP7A 2CTCA 2WUUA 2YNCC 3PBEA 7CPAA 2ZEDA 1Q2DA 1S60A 4KSAA 2HC9A 4NF1A 4R57A 4XPLA 2KCWA 1TKFA 3WT4A 2GU2A 1GHEA 1IGBA 2VXKA 1L0CA 3EXNA 2Z3PA 4AXVA 4MFJA 2CXAA 3EC4A 5IX3A 4E8OA 3BI0A 2PIYA 2GANA 2AJ6A 2B58A 2Z10A 4A33A 1RO5A 4NGTA 4Y49B 4A94A 2RC4A 2O53A 4AVAA 4MFKA 4FD6A 4NSQA 2PJ1A 4UIAA 1ON0A 3T90A 4FWUA 3VATA 2BEIA 5EBVA 4PK2A 3FNCA 3PP9A 4EWTA 2PJ8A 2WYRA
chains in the Genus database with same CATH topology
3H5ZA 5AGEA 2Z3LA 2WPXA 4CYOA 3KKWA 2ZPAA 4KOWA 4CGLA 2Q04A 1J4JA 1YVOA 4KSFA 2Q44A 4LX9A 4Q38A 2Q4VA 5BWAB 1M4IA 2FCKA 4KORA 2HQYA 4KOVA 3EY5A 2ATRA 2R7HA 4C2YA 4GS4A 2BUEA 4R87A 4AG7A 2PC1A 5A27A 4MHDA 1YVKA 3UY5A 3FYNA 4Y49C 3DDDA 1M1DA 4HNYB 2PQ8A 4B5PA 1YLEA 1WK4A 2I00A 2BSWA 1IB1E 3CXPA 2QECA 4PK3A 4R9MA 1S7LA 2JDDA 4C7IA 3ZJ0A 4BBHA 1XF8A 5A28A 3NE7A 1YK3A 2R1IA 2OZGA 1B6BA 5HH1A 5AG4A 3H4QA 3CXQA 4F0XA 2P6EA 4HKFA 3GY9A 3R9FA 3GKRA 2H5MA 4CAXA 1S7KA 2Z3NA 3BJ8A 1MK4A 1S7FA 2VEZA 1I21A 2CNTA 3S6GA 1M4DA 2GIVA 2P6FA 3IWGA 2PSWA 3JTKA 2Q4YA 4XPDB 5HMNA 2Q7BA 1NE9A 1VKCA 4JD6A 2ZW5A 1XIXA 2REEA 3DSBA 4KVME 4UFVA 4AVCA 4MI4A 1Z4EA 1M44A 2PR1A 3BJ7A 1P0HA 3QB8A 5DWNA 4B12A 5F49A 1S5KA 3TO9A 2PRBA 3OWCA 1S3ZA 3R9GA 1YR0A 4OADA 5E96A 2AE6A 3TO7A 3IU2A 4MFPA 4UCPA 4KOSA 4H6UA 4KOXA 4XPDC 4M3SA 4EVYA 4HNWB 1Z4RA 2B4DB 4L8AA 3DNSA 3JUWA 4H6ZA 1KZFA 4AVBA 5KTCA 2VZZA 4B14A 2WSAA 4KZTA 3D3SA 3FXTA 5G1ZA 4CGMA 1Z9UA 1R57A 4U9ZA 4F0YA 3FB3A 4JLYA 4U9YA 3DR6A 1I1DA 2OZHA 1KUVA 3LODA 4PSXA 4A2ZA 1QSRA 1XMTA 1LRZA 2Z3MA 4B5OA 2F5IA 3G8WA 2DPSA 3D2MA 3G3SA 4QB9A 2QIRA 4KS9A 3TO6A 4UCNA 1K4JA 4AVAA 4FD5A 3IGRA 5F48A 3VWEA 3C26A 1Q2YA 3FIXA 2CNSA 4MY0A 3F0AA 2HUZA 2NMTA 4PSWA 2FT0A 4AG9A 4CS0B 2OZUA 4NXYA 3S6KA 4A95A 4KVOE 2YGWA 2ARHA 4CYNA 2Z11A 4XNHB 2IL4A 3P2HA 3SXOA 5AG7A 1NMTA 2OB0A 4B13A 5DWMA 4RI1A 3W6SA 4UCMA 2FXFA 3R96A 4JXRA 3FRMA 2G3TA 4FD7A 2OH1A 2P0WA 5J8FA 3EFAA 3R1KA 4JWPA 4CAWA 1Q2CA 3K9UA 5JQ4A 2K5TA 2YNEA 1FY7A 2B4DA 2FE7A 2JDCA 1NSLA 1B87A 2CNMA 4KUAA 2VI7A 2G0BA 4ONUA 4QC6A 3TOAA 3MGDA 4E2AA 1MJ9A 2B5GB 5IB0A 3V8IA 4XNHC 4MBUA 1Y9KA 4MFQA 5H86A 2I79A 4XPKA 2ZW4A 4ORFA 1BO4A 4C2ZA 3TOBA 4KOTA 4R3LA 2FL4A 2PR8A 3S6HA 4AB7A 3JVNA 1XE4A 2Z3KA 4ZBGA 2Q0YA 4OAEA 4MY3A 1IIDA 3T9YA 4CRYB 1I12A 4H89A 4C2XA 4CGNA 4FD4A 2PDOA 1PUAA 2J8NA 1ZO0A 4UFXA 4PV6A 1YGHA 4HNXB 4B11A 2B3UA 4RS2A 5KTAA 3TT2A 4E0AA 3TFYA 2EVNA 3ZZIA 4A31A 4BMHA 4MFLA 2REFA 1V0CA 4F6AA 1IYLA 1YX0A 2JLMA 5AG5A 1TIQA 3D2PA 1IICA 4QVTA 3D8PA 4K30A 4UA3A 3LD2A 5G20A 2Z3OA 2R98A 4B10A 1UFHA 5ISVA 2VBQA 2B4BA 3CXSA 3SHPA 2C27A 3F5BA 2B5GA 4U5YA 2O28A 4YFJA 5H84A 4CYQA 1IYKA 3PZJA 5IV0A 2ZW6A 4C68A 1CM0A 4J3GA 3I3GA 3W6XA 2CY2A 1KUYA 3E0KA 2VQYA 4DNCA 5EC4A 4QBJA 5C88A 4OLLA 2Z0ZA 2D4PA 2R8VA 2B3VA 3IWEA 1MJAA 3TCVA 4C7HA 3R9EA 3A9LA 3WR7A 3VWDA 2JEVA 3I9SA 3TE4A 2QMLA 4A30A 4JJXA 4Q36A 4YGOA 2YNDA 5F46A 2YNCA 1KUXA 4KOYA 4KLVA 2D4OA 1RXTA 4KUBA 4JXQA 1P4NA 1QSNA 4UBRA 4LUAA 1QSTA 1Y9WA 4KVXA 3PGPA 2GE3A 3SXNA 4MJ8A 2FSRA 4CGPA 4R3KA 4QUSA 1QSOA 3B8GA 4M85A 4L89A 2EUIA 4CYPA 1CJWA 2A4NA 3EO4A 4A32A 2OU2A 1XEBA 3IU1A 3P2FA 5GCNA 5G22A 3TTHA 4ZGYB 2FS5A 1Y7RA 2Y0MA 4IUSA 1SQHA 5C82A 1OZPA 4I49A 1MJBA 1QSMA 2FIAA 4CRZB 5I0CA 4CGOA 5FVJA 4CAEA 1WWZA 1M4GA 1BOBA 1S7NA 1YREA 1N71A 2ZW7A 2WPWA 1VHSA 2DPTA 1PU9A 3R95A 4UFWA 5F47A 3QAHA 5G21A 3W91A 5CNPA 5J8CA 2DXQA 2VZYA 4CAFA 5JPHA 2BL1A 4MFZA 5KTDA 2FIWA 4X5KA 1U6MA 3N7ZA 3DR8A 4KLWA 2J8RA 2ZXVA 2G3AA 2X7BA 3F8KA 4UWIA 5AG6A 2J8MA 4IF5A 4NCZA 3BLNA 4KOUA 4II9A 4NEXA 3FBUA 3GYAA 2HV2A 4B5PB 3RYOA 3S6FA 4UWJA 4CAVA 2P6GA 2WUUA 2YNCC 1Q2DA 1S60A 4KSAA 4NF1A 4R57A 4XPLA 2KCWA 1GHEA 2VXKA 1L0CA 3EXNA 2Z3PA 4MFJA 2CXAA 3EC4A 5IX3A 4E8OA 2GANA 2AJ6A 2B58A 2Z10A 4A33A 1RO5A 4Y49B 2RC4A 4MFKA 4FD6A 4NSQA 1ON0A 3T90A 2BEIA 5EBVA 4PK2A 3FNCA 3PP9A 4YRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WPX A;  3KKW A;  2ZPA A;  4KOW A;  2Q04 A;  1J4J A;  1YVO A;  2Q44 A;  4LX9 A;  2Q4V A;  1M4I A;  2FCK A;  4KOR A;  2HQY A;  4KOV A;  3EY5 A;  2ATR A;  2R7H A;  4GS4 A;  2BUE A;  4R87 A;  4AG7 A;  2PC1 A;  4MHD A;  1YVK A;  3UY5 A;  3FYN A;  4Y49 C;  3DDD A;  1M1D A;  4HNY B;  2PQ8 A;  4B5P A;  1YLE A;  1WK4 A;  2I00 A;  2BSW A;  1IB1 E;  3CXP A;  2QEC A;  4PK3 A;  4R9M A;  1S7L A;  2JDD A;  3ZJ0 A;  1XF8 A;  3NE7 A;  1YK3 A;  2R1I A;  2OZG A;  1B6B A;  5HH1 A;  3H4Q A;  3CXQ A;  2P6E A;  4HKF A;  3GY9 A;  3R9F A;  3GKR A;  2H5M A;  4CAX A;  1S7K A;  3BJ8 A;  1MK4 A;  1S7F A;  2VEZ A;  1I21 A;  2CNT A;  3S6G A;  1M4D A;  2GIV A;  2P6F A;  3IWG A;  2PSW A;  4XPD B;  2Q4Y A;  5HMN A;  2Q7B A;  1NE9 A;  1VKC A;  4JD6 A;  2ZW5 A;  1XIX A;  2REE A;  3DSB A;  4KVM E;  4AVC A;  4MI4 A;  1Z4E A;  1M44 A;  2PR1 A;  3BJ7 A;  1P0H A;  3QB8 A;  5DWN A;  5F49 A;  1S5K A;  3TO9 A;  2PRB A;  3OWC A;  1S3Z A;  3R9G A;  1YR0 A;  4OAD A;  5E96 A;  2AE6 A;  3TO7 A;  4KOS A;  4H6U A;  4KOX A;  4XPD C;  4M3S A;  4EVY A;  4HNW B;  1Z4R A;  2B4D B;  4L8A A;  3DNS A;  3JUW A;  4H6Z A;  1KZF A;  4AVB A;  5KTC A;  2VZZ A;  4KZT A;  3D3S A;  3FXT A;  1Z9U A;  1R57 A;  4U9Z A;  4F0Y A;  3FB3 A;  4JLY A;  4U9Y A;  3DR6 A;  1I1D A;  2OZH A;  1KUV A;  3LOD A;  4PSX A;  1QSR A;  1XMT A;  1LRZ A;  4B5O A;  2F5I A;  3G8W A;  3D2M A;  3G3S A;  4QB9 A;  2QIR A;  3TO6 A;  1K4J A;  4AVA A;  4FD5 A;  3IGR A;  5F48 A;  3VWE A;  3C26 A;  1Q2Y A;  3FIX A;  2CNS A;  4MY0 A;  3F0A A;  2HUZ A;  2NMT A;  4PSW A;  2FT0 A;  4AG9 A;  4CS0 B;  2OZU A;  4NXY A;  3S6K A;  4KVO E;  2ARH A;  2Z11 A;  4XNH B;  2IL4 A;  3P2H A;  3SXO A;  1NMT A;  2OB0 A;  5DWM A;  4RI1 A;  3W6S A;  2FXF A;  3R96 A;  4JXR A;  3FRM A;  2G3T A;  4FD7 A;  2OH1 A;  2P0W A;  5J8F A;  3EFA A;  3R1K A;  4JWP A;  4CAW A;  1Q2C A;  3K9U A;  5JQ4 A;  2K5T A;  1FY7 A;  2B4D A;  2FE7 A;  2JDC A;  1NSL A;  1B87 A;  2CNM A;  4KUA A;  2VI7 A;  2G0B A;  4ONU A;  4QC6 A;  3TOA A;  3MGD A;  4E2A A;  1MJ9 A;  2B5G B;  5IB0 A;  3V8I A;  4XNH C;  4MBU A;  1Y9K A;  5H86 A;  2I79 A;  4XPK A;  2ZW4 A;  4ORF A;  1BO4 A;  3TOB A;  4KOT A;  4R3L A;  2FL4 A;  2PR8 A;  3S6H A;  4AB7 A;  3JVN A;  1XE4 A;  4ZBG A;  2Q0Y A;  4OAE A;  4MY3 A;  1IID A;  3T9Y A;  4CRY B;  1I12 A;  4H89 A;  4FD4 A;  2PDO A;  1PUA A;  2J8N A;  4PV6 A;  1YGH A;  4HNX B;  5KTA A;  2B3U A;  4RS2 A;  3TT2 A;  4E0A A;  3TFY A;  2EVN A;  3ZZI A;  4BMH A;  2REF A;  1V0C A;  4F6A A;  1IYL A;  1YX0 A;  2JLM A;  1TIQ A;  3D2P A;  1IIC A;  4QVT A;  3D8P A;  4K30 A;  4UA3 A;  3LD2 A;  2R98 A;  5ISV A;  1UFH A;  2VBQ A;  2B4B A;  3CXS A;  3SHP A;  2C27 A;  3F5B A;  2B5G A;  4U5Y A;  2O28 A;  4YFJ A;  5H84 A;  1IYK A;  3PZJ A;  5IV0 A;  2ZW6 A;  1CM0 A;  4J3G A;  3I3G A;  3W6X A;  2CY2 A;  1KUY A;  3E0K A;  2VQY A;  4DNC A;  5EC4 A;  4QBJ A;  5C88 A;  4OLL A;  2Z0Z A;  2D4P A;  2R8V A;  2B3V A;  1MJA A;  3TCV A;  3R9E A;  3WR7 A;  3VWD A;  2JEV A;  3I9S A;  3TE4 A;  2QML A;  4JJX A;  4YGO A;  5F46 A;  1KUX A;  4KOY A;  4KLV A;  2D4O A;  1RXT A;  4KUB A;  4JXQ A;  1P4N A;  1QSN A;  4UBR A;  4LUA A;  1QST A;  1Y9W A;  4KVX A;  3PGP A;  2GE3 A;  3SXN A;  4MJ8 A;  2FSR A;  4R3K A;  4QUS A;  1QSO A;  3B8G A;  4M85 A;  4L89 A;  2EUI A;  1CJW A;  2A4N A;  3EO4 A;  2OU2 A;  1XEB A;  3P2F A;  5GCN A;  3TTH A;  2FS5 A;  1Y7R A;  2Y0M A;  4IUS A;  1SQH A;  5C82 A;  1OZP A;  4I49 A;  1MJB A;  1QSM A;  2FIA A;  4CRZ B;  5I0C A;  5FVJ A;  1WWZ A;  1M4G A;  1BOB A;  1S7N A;  1YRE A;  1N71 A;  2ZW7 A;  2WPW A;  1VHS A;  1PU9 A;  3R95 A;  5F47 A;  3QAH A;  3W91 A;  5CNP A;  5J8C A;  2DXQ A;  2VZY A;  5JPH A;  2BL1 A;  5KTD A;  2FIW A;  4X5K A;  1U6M A;  3N7Z A;  3DR8 A;  4KLW A;  2J8R A;  2ZXV A;  2G3A A;  2X7B A;  3F8K A;  4UWI A;  2J8M A;  4IF5 A;  4NCZ A;  3BLN A;  4KOU A;  4II9 A;  4NEX A;  3FBU A;  3GYA A;  2HV2 A;  4B5P B;  3RYO A;  3S6F A;  4UWJ A;  4CAV A;  2P6G A;  1Q2D A;  1S60 A;  4NF1 A;  4R57 A;  4XPL A;  2KCW A;  1GHE A;  2VXK A;  1L0C A;  3EXN A;  5IX3 A;  3EC4 A;  4E8O A;  2GAN A;  2AJ6 A;  2B58 A;  2Z10 A;  1RO5 A;  4Y49 B;  2RC4 A;  4FD6 A;  4NSQ A;  1ON0 A;  3T90 A;  2BEI A;  5EBV A;  4PK2 A;  3FNC A;  3PP9 A;  4YRH A; 
#chains in the Genus database with same CATH topology
 3H5Z A;  5AGE A;  2Z3L A;  1PYT B;  2C6C A;  2WPX A;  1Z8L A;  3ISX A;  3B3T A;  4CYO A;  3CZX A;  3KKW A;  2ZPA A;  4KOW A;  4P4I A;  5I4M A;  4OID A;  4CGL A;  4OME A;  4OC2 A;  2Q04 A;  4UF4 A;  1J4J A;  3SI0 A;  1YSJ A;  1YVO A;  4KSF A;  2Q44 A;  3PFO A;  4LX9 A;  4Q38 A;  3TC8 A;  2Q4V A;  5BWA B;  1M4I A;  1NSA A;  2FCK A;  4KOR A;  2HQY A;  4KOV A;  4M6G A;  3EY5 A;  4P4J A;  2ZEP A;  4PXD A;  1ELL P;  1XBU A;  2ATR A;  2R7H A;  4C2Y A;  4GS4 A;  2BUE A;  4OC5 A;  2RB7 A;  3IJ3 A;  3KQZ A;  5K8M A;  4R87 A;  3FVL A;  4AG7 A;  2PC1 A;  5A27 A;  1IU8 A;  2POK A;  4K3N A;  4MHD A;  1YVK A;  3V7Z A;  3UY5 A;  3FYN A;  3GB0 A;  3D7D A;  2C6P A;  4PPZ A;  3DDD A;  4Y49 C;  1BAV A;  4OC1 A;  1M1D A;  3PB4 X;  4EME A;  4DYO A;  4HNY B;  2PQ8 A;  3L2N A;  3PBB A;  1ARM A;  4B5P A;  1YLE A;  1WK4 A;  2I00 A;  4H2K A;  2BSW A;  1IB1 E;  3CXP A;  4FUU A;  1LCP A;  1Z8T A;  4IHM A;  2QEC A;  4ZY0 A;  1QMU A;  5ELY A;  4PK3 A;  4R9M A;  4PQA A;  1S7L A;  4R7M A;  2JDD A;  4C7I A;  3ZJ0 A;  4BBH A;  3NH8 A;  1XF8 A;  5A28 A;  3NE7 A;  1YK3 A;  2R1I A;  1CPS A;  2OZG A;  3SJX A;  1B6B A;  4ZYQ A;  5HH1 A;  1XRY A;  3VAR A;  1TKH A;  2EK9 A;  3WC5 A;  3D68 A;  5AG4 A;  3H4Q A;  5K8P A;  1LFW A;  3NA6 A;  3CXQ A;  5DS0 A;  1HEE A;  4F0X A;  2P6E A;  4HKF A;  3GY9 A;  4F9V A;  1CP6 A;  3R9F A;  5HVF A;  1VGY A;  3GKR A;  2H5M A;  4CAX A;  5CPA A;  1S7K A;  2QYV A;  2Z3N A;  2O4H A;  3BJ8 A;  4OC4 A;  5K8N A;  2HB6 A;  1MK4 A;  1X10 A;  4UEZ A;  4Z65 A;  1S7F A;  2PJ2 A;  2VEZ A;  1I21 A;  2CNT A;  4PXE A;  4KSI A;  4NJQ A;  1M4D A;  3S6G A;  1YLO A;  2GIV A;  3SJE A;  2P6F A;  3IWG A;  2PSW A;  3JTK A;  2Q4Y A;  4GXH A;  4XPD B;  5HMN A;  5IB9 A;  2PJ0 A;  2Q7B A;  1NE9 A;  1VKC A;  3IIB A;  3LMS A;  3FJU A;  1Q7L A;  4JD6 A;  5K8O A;  2ZW5 A;  1XIX A;  2REE A;  3DSB A;  3PRT A;  4KVM E;  2V8G A;  4F8Z A;  4UFV A;  4AVC A;  4MI4 A;  1Z4E A;  2V8V A;  1M44 A;  2PR1 A;  3BJ7 A;  3B3C A;  1XOV A;  3IEH A;  1P0H A;  1ZG8 A;  3QB8 A;  5DWN A;  5JGF A;  4B12 A;  3MRU A;  5F49 A;  1S5K A;  2PJ7 A;  5JM6 A;  3TO9 A;  5THW A;  2DEA A;  2PRB A;  3OWC A;  5LYI A;  4DUK A;  3D67 A;  2IJZ A;  4EFD A;  1S3Z A;  1F2O A;  2PJ6 A;  3PB7 X;  3R9G A;  1YR0 A;  4OAD A;  2V8D A;  5E96 A;  2JBJ A;  1PCA A;  2AE6 A;  3TO7 A;  3IU2 A;  4MFP A;  4UCP A;  4KOS A;  4P44 A;  5JH9 A;  2C1C A;  3KQX A;  4H6U A;  5LYF A;  4P4D A;  3KHZ A;  1YME A;  1Y7E A;  2PJB A;  4KOX A;  3IWW A;  4XPD C;  3KGQ A;  1JWQ A;  2QVP A;  2V8H A;  4M3S A;  4EVY A;  4HNW B;  2PCU A;  1Z4R A;  4X3R A;  2B4D B;  4L8A A;  3FEE A;  3DNS A;  3JUW A;  1CPX A;  4H6Z A;  1KZF A;  1CX8 A;  4AVB A;  4NGN A;  4ZY2 A;  4A37 A;  4P45 A;  5KTC A;  2VZZ A;  2IQ6 A;  1DE4 C;  4WWV A;  2WSA A;  4KZT A;  4B14 A;  3D3S A;  3FXT A;  3N5F A;  5G1Z A;  5HVH A;  4CGM A;  4MHZ A;  3PB9 X;  3FEC A;  1Z9U A;  1R57 A;  4U9Z A;  3FF3 A;  4F0Y A;  3HUV A;  3FB3 A;  4JLY A;  4U9Y A;  3DR6 A;  1I1D A;  2OZH A;  3S9M A;  1KUV A;  3LOD A;  4NGP A;  4PSX A;  4A2Z A;  1QSR A;  1XMT A;  4TWE A;  1LRZ A;  2Z3M A;  4B5O A;  2F5I A;  1X12 A;  2WZN A;  2AFW A;  3MN8 A;  4X8I A;  3G8W A;  2DPS A;  3D2M A;  3G3S A;  4QB9 A;  3IFE A;  4M6I A;  3D4U A;  2QIR A;  4KS9 A;  3FH4 A;  3TO6 A;  4UCN A;  1VHE A;  1K4J A;  3WAB A;  1BPN A;  4FD5 A;  3IGR A;  5F48 A;  3VWE A;  4JZ0 A;  1HDU A;  4MHN A;  3C26 A;  5LRK A;  4OIW A;  1Q2Y A;  3FIX A;  2CNS A;  2ZEL A;  4MY0 A;  3VH9 A;  3F0A A;  4MCR A;  8CPA A;  2HUZ A;  2NMT A;  4G1P A;  2FT0 A;  4NFR A;  4PSW A;  4AG9 A;  4CS0 B;  2OZU A;  4NXY A;  3S6K A;  5F09 A;  1VHO A;  2C6G A;  4KVO E;  2GLF A;  2ARH A;  2YGW A;  1AYE A;  2ZOG A;  4A95 A;  2Z11 A;  4XNH B;  2IL4 A;  4CYN A;  3P2H A;  3SXO A;  5AG7 A;  1NMT A;  2OB0 A;  4MCQ A;  4B13 A;  5HVG A;  1EE3 P;  2EK8 A;  1ELM P;  3CPX A;  1YW4 A;  1H8L A;  2ZEM A;  1YW6 A;  3H8E A;  4RI1 A;  5DWM A;  2Q51 A;  3W6S A;  4UCM A;  2FXF A;  4BIN A;  3R96 A;  4JXR A;  1XJO A;  2PJ9 A;  3B2Y A;  3FRM A;  4NGR A;  4RN7 A;  2G3T A;  1CBX A;  3H8F A;  4FD7 A;  2OH1 A;  1Z2L A;  2P0W A;  4YRH A;  4ZX8 A;  5J8F A;  2IMO A;  3EFA A;  4LQG A;  3R1K A;  4JWP A;  4CAW A;  4R76 A;  1Q2C A;  3K9U A;  5JQ4 A;  2K5T A;  2YNE A;  1FY7 A;  2B4D A;  2FE7 A;  1IOF A;  2JDC A;  2AFU A;  2JEW A;  1BLL E;  4ONW A;  4P6Y A;  1NSL A;  2F8H A;  1B87 A;  3CDX A;  4P4E A;  2CNM A;  4KUA A;  3RO0 A;  2VI7 A;  2G0B A;  4ONU A;  4QC6 A;  3WC7 A;  3TOA A;  3MGD A;  4E2A A;  3KI9 A;  2PE3 A;  3GUX A;  1MJ9 A;  2B5G B;  5IB0 A;  4OKO A;  1Y0Y A;  3D7F A;  3V8I A;  4XNH C;  3NFZ A;  2ZEG A;  4MBU A;  1Y9K A;  4MFQ A;  1UWY A;  5H86 A;  4RUH A;  1KWM A;  4PXC A;  2I79 A;  2XEF A;  4XPK A;  2ZW4 A;  4ORF A;  1BO4 A;  4M6H A;  4C2Z A;  1ZLI A;  3NH4 A;  4MRI A;  5LRG A;  3TOB A;  4KOT A;  4R3L A;  2FL4 A;  2PR8 A;  3CPA A;  3S6H A;  4AB7 A;  4NJR A;  3JVN A;  1XE4 A;  2G9D A;  4A38 A;  4MXU A;  1TKJ A;  2Z3K A;  4ZBG A;  1XFO A;  2OOT A;  2Q0Y A;  3BI1 A;  4OAE A;  4MY3 A;  4ZY1 A;  3NH5 A;  1IID A;  3T9Y A;  2EBJ A;  4MHP A;  1I12 A;  4H89 A;  4P4B A;  4Q7A A;  3RZA A;  4C2X A;  4CRY B;  3KZW A;  2ZEH A;  4CGN A;  4FD4 A;  2PDO A;  1PUA A;  2J8N A;  1ZO0 A;  4UFX A;  4PV6 A;  1YGH A;  2VL1 A;  1OBR A;  4HNX B;  4B11 A;  2B3U A;  4RS2 A;  5KTA A;  4FAI A;  2CF4 A;  3TT2 A;  4E0A A;  3TFY A;  4WJB A;  2EVN A;  3ZZI A;  3KHX A;  2PJA A;  4A31 A;  1TF9 A;  4PXB A;  4BMH A;  2GRE A;  4MFL A;  4TNU A;  2REF A;  4ZI6 A;  1V0C A;  4F6A A;  1IYL A;  1YX0 A;  4F9U A;  1AMP A;  2JLM A;  2PVV A;  5LYD A;  5AG5 A;  4NGQ A;  1TIQ A;  3D2P A;  1IIC A;  4QVT A;  3D8P A;  2JBK A;  4K30 A;  3LD2 A;  4UA3 A;  3IO1 A;  5G20 A;  2Z3O A;  2R98 A;  4IK2 A;  1UFH A;  3JRU A;  2EO8 A;  4B10 A;  5ISV A;  2VBQ A;  5HXD A;  3CT9 A;  1ARL A;  2B4B A;  2ZEN A;  3CXS A;  3PB8 X;  4IAV A;  3SHP A;  2C27 A;  3F5B A;  2B5G A;  4U5Y A;  2O28 A;  1FNO A;  2CIJ A;  4YFJ A;  5H84 A;  4CYQ A;  1ZLH A;  3B3V A;  1IYK A;  3PZJ A;  1Y0R A;  2ZW6 A;  4P10 A;  2RFH A;  5IV0 A;  4C68 A;  5LRJ A;  1CM0 A;  4J3G A;  3I3G A;  1JQG A;  4UEF A;  3RBU A;  3W6X A;  2CY2 A;  1KUY A;  3S9N A;  3E0K A;  2AFX A;  2VQY A;  4DNC A;  5EC4 A;  4QBJ A;  5C88 A;  4OLL A;  2Z0Z A;  2D4P A;  2R8V A;  3LWU A;  2B3V A;  2BOA A;  3IWE A;  1MJA A;  3TCV A;  2ZEE A;  4R8F A;  3R9E A;  4C7H A;  3A9L A;  1Z5R A;  3WR7 A;  3VWD A;  4NGS A;  3FMC A;  2JEV A;  2ODF A;  3I9S A;  3TE4 A;  2QML A;  5D29 A;  3KR4 A;  2GFQ A;  4LQ6 A;  4JJX A;  4A30 A;  2PJ5 A;  4Q36 A;  4YGO A;  1VIX A;  2YND A;  2DF5 A;  3B35 A;  5F46 A;  2YNC A;  3PFE A;  1KUX A;  2Q7S A;  4O23 A;  5D8N A;  4KOY A;  4KLV A;  4NGM A;  2EWB A;  3D7H A;  2PRQ A;  1QQ9 A;  2D4O A;  2J9A A;  2GLJ A;  3GIU A;  1RXT A;  2QJ8 A;  3D66 A;  3I1U A;  1P4N A;  1GYT A;  1QSN A;  4JXQ A;  4KUB A;  4UBR A;  2Q4Z A;  4LUA A;  1Z8X A;  1QST A;  1Y9W A;  4KVX A;  1BPM A;  3BHX A;  3PGP A;  3KAS A;  1AUG A;  2GE3 A;  2AFS A;  3SXN A;  1IOI A;  1LAP A;  4MJ8 A;  2FSR A;  4OC0 A;  4CGP A;  3SJF A;  4R3K A;  1XMB A;  4QUS A;  1QSO A;  3B8G A;  5LYL A;  1RTQ A;  3ISZ A;  2PJ3 A;  4M85 A;  2OR4 A;  2EUI A;  2XEI A;  4HPS A;  4L89 A;  2ZOF A;  4CYP A;  1CJW A;  4R6T A;  1M4L A;  2A4N A;  2ZEF A;  3EO4 A;  4ZX9 A;  1Z8W A;  3QAY A;  4A32 A;  2AFO A;  3BXM A;  1IY7 A;  3LAC A;  2FVG A;  1FT7 A;  2OU2 A;  1HDQ A;  1DTD A;  2F7V A;  1F57 A;  5EMI A;  4YU9 A;  1XEB A;  1ZG7 A;  3IU1 A;  3P2F A;  4UIB A;  3D7G A;  3DLJ A;  5GCN A;  5G22 A;  4W9Y A;  4YWY A;  3TTH A;  3SI1 A;  3HLP A;  4ZGY B;  2FS5 A;  1Y7R A;  2Y0M A;  4IUS A;  3WC6 A;  1SQH A;  5C82 A;  2CTB A;  3FX6 A;  4FBE A;  1OZP A;  4I49 A;  1MJB A;  3PEI A;  3TX8 A;  1QSM A;  2FIA A;  4CRZ B;  1TF8 A;  4MCS A;  1A2Z A;  1LAM A;  3SI2 A;  5I0C A;  1ZG9 A;  4CGO A;  4MMO A;  4GM5 A;  5FVJ A;  1LAN A;  4CAE A;  1WWZ A;  1M4G A;  3RNZ A;  1BOB A;  1S7N A;  1YRE A;  1N71 A;  2ZW7 A;  3DGV A;  2WPW A;  1VHS A;  5J1Q A;  2DPT A;  1PU9 A;  2I3C A;  3R95 A;  5CBM A;  2AFZ A;  2Q43 A;  1LOK A;  2ZEO A;  3RAM A;  3B3W A;  2PIZ A;  2ANP A;  3NE8 A;  4UFW A;  5F47 A;  1CG2 A;  2BCO A;  4UEE A;  2PVW A;  3QAH A;  5G21 A;  2BO9 A;  3W91 A;  3PB6 X;  2PJ4 A;  3H8G A;  5CNP A;  5J8C A;  2DXQ A;  2VZY A;  4OC3 A;  3T8W A;  4CAF A;  5JPH A;  4MCP A;  2BL1 A;  2PJC A;  2NSM A;  4MFZ A;  5KTD A;  1YQE A;  2FIW A;  4P4F A;  4X2T A;  6CPA A;  4X5K A;  1U6M A;  3B7I A;  3N7Z A;  3DR8 A;  4B6Z A;  4A39 A;  4KLW A;  4JYW A;  2ABZ A;  2J8R A;  3KL9 A;  4BD9 A;  3GLJ A;  1TXR A;  2ZXV A;  4MHY A;  4CPA A;  2G3A A;  2X7B A;  3F8K A;  3KR5 A;  3S9L A;  4OP4 A;  4UWI A;  3K9T A;  5AG6 A;  2J8M A;  3B3S A;  4IF5 A;  4NCZ A;  3BLN A;  4KOU A;  1R3N A;  4II9 A;  3QNV A;  4NEX A;  3FBU A;  3FED A;  3IC1 A;  2AFM A;  3SJG A;  3GYA A;  2HV2 A;  2XEG A;  4B5P B;  2XEJ A;  1R43 A;  3RYO A;  3S6F A;  4UWJ A;  2V77 A;  3V38 A;  4CAV A;  4DJL A;  1F2P A;  3K2K A;  2P6G A;  2NYQ A;  1CP7 A;  2CTC A;  2WUU A;  2YNC C;  3PBE A;  7CPA A;  2ZED A;  1Q2D A;  1S60 A;  4KSA A;  2HC9 A;  4NF1 A;  4R57 A;  4XPL A;  2KCW A;  1TKF A;  3WT4 A;  2GU2 A;  1GHE A;  1IGB A;  2VXK A;  1L0C A;  3EXN A;  2Z3P A;  4AXV A;  4MFJ A;  2CXA A;  3EC4 A;  5IX3 A;  4E8O A;  3BI0 A;  2PIY A;  2GAN A;  2AJ6 A;  2B58 A;  2Z10 A;  4A33 A;  1RO5 A;  4NGT A;  4Y49 B;  4A94 A;  2RC4 A;  2O53 A;  4AVA A;  4MFK A;  4FD6 A;  4NSQ A;  2PJ1 A;  4UIA A;  1ON0 A;  3T90 A;  4FWU A;  3VAT A;  2BEI A;  5EBV A;  4PK2 A;  3FNC A;  3PP9 A;  4EWT A;  2PJ8 A;  2WYR A; 
#chains in the Genus database with same CATH homology
 3H5Z A;  5AGE A;  2Z3L A;  2WPX A;  4CYO A;  3KKW A;  2ZPA A;  4KOW A;  4CGL A;  2Q04 A;  1J4J A;  1YVO A;  4KSF A;  2Q44 A;  4LX9 A;  4Q38 A;  2Q4V A;  5BWA B;  1M4I A;  2FCK A;  4KOR A;  2HQY A;  4KOV A;  3EY5 A;  2ATR A;  2R7H A;  4C2Y A;  4GS4 A;  2BUE A;  4R87 A;  4AG7 A;  2PC1 A;  5A27 A;  4MHD A;  1YVK A;  3UY5 A;  3FYN A;  4Y49 C;  3DDD A;  1M1D A;  4HNY B;  2PQ8 A;  4B5P A;  1YLE A;  1WK4 A;  2I00 A;  2BSW A;  1IB1 E;  3CXP A;  2QEC A;  4PK3 A;  4R9M A;  1S7L A;  2JDD A;  4C7I A;  3ZJ0 A;  4BBH A;  1XF8 A;  5A28 A;  3NE7 A;  1YK3 A;  2R1I A;  2OZG A;  1B6B A;  5HH1 A;  5AG4 A;  3H4Q A;  3CXQ A;  4F0X A;  2P6E A;  4HKF A;  3GY9 A;  3R9F A;  3GKR A;  2H5M A;  4CAX A;  1S7K A;  2Z3N A;  3BJ8 A;  1MK4 A;  1S7F A;  2VEZ A;  1I21 A;  2CNT A;  3S6G A;  1M4D A;  2GIV A;  2P6F A;  3IWG A;  2PSW A;  3JTK A;  2Q4Y A;  4XPD B;  5HMN A;  2Q7B A;  1NE9 A;  1VKC A;  4JD6 A;  2ZW5 A;  1XIX A;  2REE A;  3DSB A;  4KVM E;  4UFV A;  4AVC A;  4MI4 A;  1Z4E A;  1M44 A;  2PR1 A;  3BJ7 A;  1P0H A;  3QB8 A;  5DWN A;  4B12 A;  5F49 A;  1S5K A;  3TO9 A;  2PRB A;  3OWC A;  1S3Z A;  3R9G A;  1YR0 A;  4OAD A;  5E96 A;  2AE6 A;  3TO7 A;  3IU2 A;  4MFP A;  4UCP A;  4KOS A;  4H6U A;  4KOX A;  4XPD C;  4M3S A;  4EVY A;  4HNW B;  1Z4R A;  2B4D B;  4L8A A;  3DNS A;  3JUW A;  4H6Z A;  1KZF A;  4AVB A;  5KTC A;  2VZZ A;  4B14 A;  2WSA A;  4KZT A;  3D3S A;  3FXT A;  5G1Z A;  4CGM A;  1Z9U A;  1R57 A;  4U9Z A;  4F0Y A;  3FB3 A;  4JLY A;  4U9Y A;  3DR6 A;  1I1D A;  2OZH A;  1KUV A;  3LOD A;  4PSX A;  4A2Z A;  1QSR A;  1XMT A;  1LRZ A;  2Z3M A;  4B5O A;  2F5I A;  3G8W A;  2DPS A;  3D2M A;  3G3S A;  4QB9 A;  2QIR A;  4KS9 A;  3TO6 A;  4UCN A;  1K4J A;  4AVA A;  4FD5 A;  3IGR A;  5F48 A;  3VWE A;  3C26 A;  1Q2Y A;  3FIX A;  2CNS A;  4MY0 A;  3F0A A;  2HUZ A;  2NMT A;  4PSW A;  2FT0 A;  4AG9 A;  4CS0 B;  2OZU A;  4NXY A;  3S6K A;  4A95 A;  4KVO E;  2YGW A;  2ARH A;  4CYN A;  2Z11 A;  4XNH B;  2IL4 A;  3P2H A;  3SXO A;  5AG7 A;  1NMT A;  2OB0 A;  4B13 A;  5DWM A;  4RI1 A;  3W6S A;  4UCM A;  2FXF A;  3R96 A;  4JXR A;  3FRM A;  2G3T A;  4FD7 A;  2OH1 A;  2P0W A;  5J8F A;  3EFA A;  3R1K A;  4JWP A;  4CAW A;  1Q2C A;  3K9U A;  5JQ4 A;  2K5T A;  2YNE A;  1FY7 A;  2B4D A;  2FE7 A;  2JDC A;  1NSL A;  1B87 A;  2CNM A;  4KUA A;  2VI7 A;  2G0B A;  4ONU A;  4QC6 A;  3TOA A;  3MGD A;  4E2A A;  1MJ9 A;  2B5G B;  5IB0 A;  3V8I A;  4XNH C;  4MBU A;  1Y9K A;  4MFQ A;  5H86 A;  2I79 A;  4XPK A;  2ZW4 A;  4ORF A;  1BO4 A;  4C2Z A;  3TOB A;  4KOT A;  4R3L A;  2FL4 A;  2PR8 A;  3S6H A;  4AB7 A;  3JVN A;  1XE4 A;  2Z3K A;  4ZBG A;  2Q0Y A;  4OAE A;  4MY3 A;  1IID A;  3T9Y A;  4CRY B;  1I12 A;  4H89 A;  4C2X A;  4CGN A;  4FD4 A;  2PDO A;  1PUA A;  2J8N A;  1ZO0 A;  4UFX A;  4PV6 A;  1YGH A;  4HNX B;  4B11 A;  2B3U A;  4RS2 A;  5KTA A;  3TT2 A;  4E0A A;  3TFY A;  2EVN A;  3ZZI A;  4A31 A;  4BMH A;  4MFL A;  2REF A;  1V0C A;  4F6A A;  1IYL A;  1YX0 A;  2JLM A;  5AG5 A;  1TIQ A;  3D2P A;  1IIC A;  4QVT A;  3D8P A;  4K30 A;  4UA3 A;  3LD2 A;  5G20 A;  2Z3O A;  2R98 A;  4B10 A;  1UFH A;  5ISV A;  2VBQ A;  2B4B A;  3CXS A;  3SHP A;  2C27 A;  3F5B A;  2B5G A;  4U5Y A;  2O28 A;  4YFJ A;  5H84 A;  4CYQ A;  1IYK A;  3PZJ A;  5IV0 A;  2ZW6 A;  4C68 A;  1CM0 A;  4J3G A;  3I3G A;  3W6X A;  2CY2 A;  1KUY A;  3E0K A;  2VQY A;  4DNC A;  5EC4 A;  4QBJ A;  5C88 A;  4OLL A;  2Z0Z A;  2D4P A;  2R8V A;  2B3V A;  3IWE A;  1MJA A;  3TCV A;  4C7H A;  3R9E A;  3A9L A;  3WR7 A;  3VWD A;  2JEV A;  3I9S A;  3TE4 A;  2QML A;  4A30 A;  4JJX A;  4Q36 A;  4YGO A;  2YND A;  5F46 A;  2YNC A;  1KUX A;  4KOY A;  4KLV A;  2D4O A;  1RXT A;  4KUB A;  4JXQ A;  1P4N A;  1QSN A;  4UBR A;  4LUA A;  1QST A;  1Y9W A;  4KVX A;  3PGP A;  2GE3 A;  3SXN A;  4MJ8 A;  2FSR A;  4CGP A;  4R3K A;  4QUS A;  1QSO A;  3B8G A;  4M85 A;  4L89 A;  2EUI A;  4CYP A;  1CJW A;  2A4N A;  3EO4 A;  4A32 A;  2OU2 A;  1XEB A;  3IU1 A;  3P2F A;  5GCN A;  5G22 A;  3TTH A;  4ZGY B;  2FS5 A;  1Y7R A;  2Y0M A;  4IUS A;  1SQH A;  5C82 A;  1OZP A;  4I49 A;  1MJB A;  1QSM A;  2FIA A;  4CRZ B;  5I0C A;  4CGO A;  5FVJ A;  4CAE A;  1WWZ A;  1M4G A;  1BOB A;  1S7N A;  1YRE A;  1N71 A;  2ZW7 A;  2WPW A;  1VHS A;  2DPT A;  1PU9 A;  3R95 A;  4UFW A;  5F47 A;  3QAH A;  5G21 A;  3W91 A;  5CNP A;  5J8C A;  2DXQ A;  2VZY A;  4CAF A;  5JPH A;  2BL1 A;  4MFZ A;  5KTD A;  2FIW A;  4X5K A;  1U6M A;  3N7Z A;  3DR8 A;  4KLW A;  2J8R A;  2ZXV A;  2G3A A;  2X7B A;  3F8K A;  4UWI A;  5AG6 A;  2J8M A;  4IF5 A;  4NCZ A;  3BLN A;  4KOU A;  4II9 A;  4NEX A;  3FBU A;  3GYA A;  2HV2 A;  4B5P B;  3RYO A;  3S6F A;  4UWJ A;  4CAV A;  2P6G A;  2WUU A;  2YNC C;  1Q2D A;  1S60 A;  4KSA A;  4NF1 A;  4R57 A;  4XPL A;  2KCW A;  1GHE A;  2VXK A;  1L0C A;  3EXN A;  2Z3P A;  4MFJ A;  2CXA A;  3EC4 A;  5IX3 A;  4E8O A;  2GAN A;  2AJ6 A;  2B58 A;  2Z10 A;  4A33 A;  1RO5 A;  4Y49 B;  2RC4 A;  4MFK A;  4FD6 A;  4NSQ A;  1ON0 A;  3T90 A;  2BEI A;  5EBV A;  4PK2 A;  3FNC A;  3PP9 A;  4YRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...