1Y9WA

Structural genomics, 1.9a crystal structure of an acetyltransferase from bacillus cereus atcc 14579
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
140
structure length
140
Chain Sequence
MYMKHIENGTRIEGEYIKNKVIQYNMSILTDEVKQPMEEVSLVVKNEEGKIFGGVTGTMYFYHLHIDFLWVDESVRHDGYGSQLLHEIEGIAKEKGCRLILLDSFSFQAPEFYKKHGYREYGVVEDHPKGHSQHFFEKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyltransferase
publication title 1.9A crystal structure of an acetyltransferase from Bacillus cereus ATCC 14579
rcsb
source organism Bacillus cereus
molecule tags Transferase
total genus 36
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1y9wA01
4NCZA 3EFAA 1XE4A 1YVKA 4KLWA 3VWDA 4QUSA 3CXSA 5HMNA 4HNYB 4BMHA 1PU9A 4R87A 2HUZA 1YREA 2OZHA 4JWPA 1Y9WA 1S7LA 4RI1A 5JPHA 3TE4A 1QSTA 2PQ8A 2PDOA 3BJ7A 2EUIA 3EO4A 2GIVA 2B5GB 2FL4A 4R9MA 1TIQA 5EC4A 4E8OA 2HQYA 3W6XA 2B3UA 2D4PA 3KKWA 2VBQA 1S60A 4M85A 2CNTA 3TO6A 5H86A 4YGOA 1IICA 1S7NA 2JLMA 3C26A 4KVOE 1NSLA 2PC1A 2ZW6A 4NXYA 3TOAA 3UY5A 3FB3A 2FS5A 3R9EA 2OZUA 2BEIA 4NEXA 3F0AA 2I00A 2JEVA 3FXTA 1XIXA 5I0CA 2B4DB 1MK4A 3TFYA 4CRYB 1IIDA 5KTAA 4JXQA 4OADA 3EY5A 3F5BA 2G3TA 4KUBA 3R9FA 4UWJA 3T9YA 2AJ6A 1QSOA 2BSWA 4AVAA 3N7ZA 1S7FA 2FXFA 2P6FA 3FNCA 2EVNA 2VI7A 4R57A 3TTHA 1KZFA 1YK3A 3S6GA 3GKRA 1K4JA 2ZXVA 4KOVA 1XEBA 3JVNA 4KOXA 4Y49B 3BLNA 4JD6A 4QVTA 2BL1A 4YRHA 3JUWA 4MBUA 2Q44A 4ONUA 4R3LA 2G0BA 1I21A 4KOSA 4YFJA 3PGPA 2R1IA 3PZJA 3SHPA 5KTCA 4UBRA 4MJ8A 2J8NA 4ORFA 2AE6A 5C82A 2DXQA 2BUEA 4KVXA 1BO4A 3H4QA 3MGDA 2RC4A 1MJBA 2ATRA 5F46A 3LD2A 1S5KA 2WPWA 3P2HA 2QIRA 2B4DA 4MHDA 4KOUA 2PSWA 4PSWA 4J3GA 5C88A 3I9SA 3IGRA 4JLYA 4H6ZA 2OZGA 5F49A 4U9ZA 2FT0A 4B5OA 3K9UA 4KZTA 4KOTA 1WK4A 1GHEA 2HV2A 3D2PA 3D3SA 3D8PA 4H89A 1ON0A 1R57A 1V0CA 2B58A 3R95A 1L0CA 1U6MA 2GANA 5IX3A 3P2FA 4CRZB 3BJ8A 2JDDA 1Y7RA 1YX0A 4U9YA 4IUSA 2FSRA 4MY0A 2FIWA 3R9GA 3W91A 2PR8A 1SQHA 4B5PB 3DNSA 2R7HA 3TT2A 5ISVA 2A4NA 3T90A 2REFA 4PK2A 2ZW7A 1M4GA 2Z10A 2J8MA 3S6FA 4FD5A 4EVYA 2JDCA 4HKFA 1Q2CA 1YLEA 4DNCA 1Z9UA 2H5MA 3F8KA 2KCWA 1S7KA 1PUAA 4K30A 1QSMA 1M44A 1KUYA 4KOYA 1I12A 3WR7A 4H6UA 4Y49C 2NMTA 3DR8A 3GY9A 4L89A 3CXQA 4XNHB 4AG7A 2VQYA 1M4IA 4LX9A 4MY3A 2FE7A 2IL4A 2B3VA 2FIAA 2WPXA 5JQ4A 3NE7A 1M1DA 2ZPAA 2VZYA 1YR0A 1Z4RA 3CXPA 3B8GA 2CNMA 1XMTA 1Q2DA 2F5IA 3V8IA 1YVOA 2ARHA 3D2MA 2VEZA 3TOBA 2Q04A 4CAWA 1Q2YA 4F6AA 3FRMA 4X5KA 4R3KA 1WWZA 4FD4A 2I79A 1UFHA 4JJXA 4E2AA 2Y0MA 1QSRA 3G8WA 4CS0B 2CY2A 4HNXB 3DSBA 1M4DA 4AB7A 4AG9A 3QB8A 4NSQA 4LUAA 2Q4YA 4M3SA 3ZJ0A 4B5PA 3SXNA 5IV0A 2R8VA 1KUXA 2OH1A 4OAEA 4PK3A 1P0HA 4F0YA 4QC6A 3DDDA 2R98A 3E0KA 3RYOA 3TO7A 4FD6A 1P4NA 2VZZA 3ZZIA 5FVJA 1MJAA 1VHSA 1NE9A 1IB1E 3EXNA 3VWEA 4AVCA 2Z0ZA 5E96A 4I49A 3FIXA 2REEA 4PSXA 4XPKA 1CJWA 4KVME 1IYLA 2P0WA 2PR1A 2OU2A 4XPDB 1CM0A 5F48A 2Q4VA 3TCVA 4KUAA 4ZBGA 4QB9A 3OWCA 1NMTA 1VKCA 4FD7A 4RS2A 5EBVA 1IYKA 2Z11A 4XNHC 3I3GA 1XF8A 2QMLA 3EC4A 1RXTA 5CNPA 1MJ9A 2G3AA 1Y9KA 1BOBA 4HNWB 2C27A 4UWIA 1Z4EA 2Q7BA 1QSNA 2ZW5A 5J8FA 3G3SA 2CNSA 2O28A 4GS4A 5IB0A 2PRBA 3DR6A 2K5TA 2FCKA 4PV6A 2J8RA 1LRZA 4E0AA 3IWGA 3PP9A 2P6EA 5DWMA 1S3ZA 2ZW4A 3LODA 5KTDA 1N71A 2OB0A 4IF5A 5DWNA 4KLVA 1FY7A 4JXRA 1KUVA 4KOWA 4MI4A 5F47A 5GCNA 3QAHA 2D4OA 2GE3A 4KORA 2QECA 3R96A 4QBJA 4U5YA 2P6GA 3GYAA 3R1KA 4L8AA 1YGHA 3TO9A 2B5GA 3SXOA 1RO5A 2X7BA 4XPLA 2VXKA 1B6BA 4OLLA 3FYNA 1I1DA 2Q0YA 1B87A 1J4JA 3FBUA 5H84A 3S6KA 3S6HA 4CAVA 2B4BA 4XPDC 1OZPA 4AVBA 3W6SA 5HH1A 4II9A 4CAXA 4NF1A 4UA3A 5J8CA
chains in the Genus database with same CATH superfamily
3SJGA 4NCZA 3EFAA 1XE4A 1YVKA 1ARMA 4KLWA 1VHEA 2HB6A 2XEJA 3VWDA 2Q51A 4QUSA 1ZG9A 2AFSA 3CXSA 2WYRA 2PJ6A 3PFEA 5G1ZA 5HMNA 4HNYB 2ABZA 1DE4C 2PVVA 4A37A 4BMHA 1PU9A 4R87A 2HUZA 4OC0A 2OR4A 1YREA 2OZHA 3PBEA 4JWPA 1Y9WA 1S7LA 4OKOA 3TX8A 2O4HA 4RI1A 3BI1A 1X10A 5JPHA 3TE4A 1QSTA 2PQ8A 2PDOA 3PB4X 3BJ7A 2XEIA 2EUIA 2GREA 3EO4A 2GIVA 6CPAA 2B5GB 2ZEDA 2FL4A 4NGRA 4R9MA 1TIQA 1ZG8A 5EC4A 3IWEA 4MFLA 4UFXA 4E8OA 2HQYA 3W6XA 2B3UA 4IAVA 1TXRA 1YSJA 2ANPA 3H5ZA 3PBBA 4CAEA 1LANA 4UEZA 2D4PA 3KKWA 3IC1A 3HLPA 1LOKA 3ISZA 2VBQA 1S60A 2IJZA 3RNZA 4M85A 1TF8A 2CNTA 3TO6A 5H86A 4C2ZA 2C6CA 1Y7EA 2ZEGA 4YGOA 1IICA 1S7NA 2JLMA 3C26A 1Z5RA 2ZEPA 4CGOA 4KVOE 4PXEA 1NSLA 4G1PA 4EMEA 4Q7AA 2YGWA 2PC1A 2ZW6A 4X8IA 4CYQA 4NXYA 3TOAA 3UY5A 3FB3A 2FS5A 3R9EA 2OZUA 2BEIA 4NEXA 1XJOA 3F0AA 2BO9A 2I00A 2JEVA 2JBJA 4UCNA 5K8PA 3FXTA 1Y0RA 5JH9A 2EWBA 1IGBA 4OC3A 1XIXA 1XRYA 1ARLA 3B3TA 1VHOA 2PJBA 3RO0A 5I0CA 2WSAA 1YW4A 1R43A 1OBRA 3GUXA 4ZY0A 1A2ZA 2B4DB 1MK4A 3L2NA 3TFYA 1BLLE 4OC5A 2POKA 4CRYB 2PJ9A 2C1CA 1IIDA 4UCPA 4C2YA 5KTAA 4JXQA 4OADA 3EY5A 3F5BA 2CF4A 1RTQA 1YLOA 2PJCA 2G3TA 3KL9A 4KUBA 3R9FA 4UWJA 3T9YA 1Z2LA 3NA6A 2AJ6A 1QSOA 2BSWA 4CAFA 4FBEA 4AVAA 4P4DA 3N7ZA 1S7FA 4UEFA 2BOAA 2FXFA 2P6FA 4PXDA 3CZXA 5K8OA 2PJAA 2WUUA 1YQEA 3FNCA 2AFMA 2EVNA 2VI7A 3GLJA 2DF5A 5HXDA 4KSAA 4R57A 1BPNA 2EO8A 3FF3A 4CYOA 3FH4A 4MMOA 1TKHA 3TTHA 2HC9A 4B14A 1KZFA 3SJXA 1YK3A 3B2YA 1DTDA 3GKRA 1K4JA 3ISXA 1ZG7A 2ZXVA 4KOVA 1XEBA 3S6GA 2VL1A 1LCPA 2PRQA 2Z3PA 4PQAA 3JVNA 2EBJA 4KOXA 3BLNA 4Y49B 1XOVA 4JD6A 2BL1A 2Q7SA 4QVTA 5I4MA 4YRHA 1M4LA 4P4JA 3SI2A 4P10A 3PB9X 1EE3P 1AUGA 2PJ5A 2YNDA 5J1QA 3JUWA 4MBUA 3B35A 4DYOA 4X3RA 3FX6A 2Q44A 3V7ZA 4ONUA 3FECA 2IQ6A 4R3LA 2RB7A 4MHNA 2G0BA 1I21A 4KOSA 4YFJA 1BPMA 1F2PA 3PGPA 2R1IA 1ELLP 3PZJA 3SHPA 5KTCA 4UBRA 4MJ8A 2EK8A 2J8NA 2Q43A 4ORFA 4BBHA 1X12A 2ZEFA 4NJRA 3WABA 2AE6A 5C82A 2DXQA 3D68A 2PJ1A 2BUEA 3K2KA 4UFVA 3RZAA 4KVXA 4RUHA 1BO4A 3H4QA 4MCPA 1PCAA 2V8HA 3MGDA 2XEFA 2RC4A 1MJBA 2PVWA 2ATRA 5F46A 4A38A 4WWVA 3LD2A 4NGQA 5K8MA 4CGNA 1S5KA 2DPTA 3CPXA 3D7HA 4UFWA 2WPWA 1Z8XA 3D7GA 3FMCA 3P2HA 1FT7A 2QIRA 4F8ZA 2RFHA 2DPSA 2B4DA 3BHXA 4UIAA 3FVLA 3BXMA 4MHDA 4KOUA 1IY7A 4P4FA 2PSWA 4OC1A 4PSWA 4J3GA 4ZX8A 5C88A 3I9SA 3IGRA 4Z65A 2ZENA 4JLYA 4NFRA 4H6ZA 4CYPA 2CTBA 2OZGA 5F49A 4U9ZA 2FT0A 4B5OA 3K9UA 4KZTA 1FNOA 4KOTA 1NSAA 1WK4A 1GHEA 2HV2A 3D2PA 3D3SA 3D8PA 3MN8A 4H89A 4ONWA 4C2XA 1ON0A 1R57A 1V0CA 2B58A 1IOIA 4YU9A 3R95A 1HDUA 1ZLIA 2ZEOA 1L0CA 1U6MA 4MHYA 2GANA 5IX3A 3P2FA 4CRZB 3BJ8A 2JDDA 1Y7RA 1YX0A 4U9YA 4IUSA 3I1UA 5LYLA 5AG4A 1ELMP 2FSRA 4MY0A 4PPZA 2FIWA 3R9GA 1QQ9A 5LYIA 4A33A 4C68A 3W91A 2PR8A 1R3NA 3IFEA 1SQHA 4NGSA 4TNUA 2AFUA 3PFOA 4B5PB 2I3CA 2BCOA 3D7FA 4MCQA 3DNSA 2R7HA 4FAIA 3NH4A 4F9UA 3TT2A 4R8FA 1IU8A 5ISVA 1BAVA 2A4NA 2Z3OA 3T90A 4B10A 3JRUA 2REFA 3IO1A 4PK2A 2ZW7A 1M4GA 4ZGYB 2Z10A 3KHXA 2J8MA 4OC4A 3S6FA 4FD5A 4EVYA 2JDCA 3LMSA 4HKFA 4GM5A 4W9YA 1Q2CA 1YLEA 2ZEMA 4DNCA 1Z9UA 4B6ZA 5EMIA 1IOFA 2H5MA 3GB0A 3F8KA 2PIZA 4MHPA 4CGPA 4CGLA 2KCWA 4JZ0A 1S7KA 3VH9A 4OIDA 1GYTA 1PUAA 4K30A 1XMBA 4KS9A 1QSMA 5LRKA 1M44A 4Q36A 1KUYA 4KOYA 3WC6A 1XBUA 1I12A 2PIYA 3B3WA 3D67A 3KGQA 4H6UA 4Y49C 2NMTA 3DR8A 3GY9A 1TKJA 3NH5A 3WR7A 5F09A 4L89A 4OC2A 3PB6X 3CXQA 2EK9A 4XNHB 2V77A 4AG7A 2VQYA 4FUUA 4NGNA 2PJ4A 4K3NA 1M4IA 4LX9A 4MY3A 2FE7A 2IL4A 4UCMA 4ZYQA 2B3VA 2FIAA 5K8NA 2WPXA 4MCRA 5JQ4A 3NE7A 2F7VA 1M1DA 4UEEA 2ZPAA 3H8FA 1HEEA 2VZYA 1YR0A 4TWEA 5D8NA 1Z4RA 3DLJA 4M6GA 3RAMA 2NYQA 2PE3A 3KR5A 4DUKA 3CXPA 3KASA 4R6TA 2ODFA 3B8GA 4B13A 4FWUA 2CNMA 1XMTA 3FEEA 3H8GA 4CGMA 1Q2DA 2F5IA 3SI1A 4MRIA 1TKFA 1YVOA 2ARHA 2AFWA 3V8IA 3D2MA 4MHZA 4H2KA 4A95A 2VEZA 7CPAA 3TOBA 1Z8TA 3S9LA 3CPAA 3WC5A 2Q04A 2CXAA 3PB7X 4CAWA 1Q2YA 4F6AA 3FRMA 3IEHA 3A9LA 4X5KA 3IU1A 3S9NA 4OMEA 4R3KA 4KSFA 1WWZA 1AMPA 2I79A 4FD4A 3B3CA 4X2TA 1CPXA 1UFHA 1XFOA 4JJXA 4E2AA 2Y0MA 1QSRA 4CPAA 4LQ6A 3KQXA 5G22A 4P44A 3G8WA 4CS0B 1AYEA 2CY2A 3CT9A 4HNXB 4IHMA 2NSMA 3DSBA 5A27A 2YNEA 3GIUA 1M4DA 1ZO0A 4AB7A 3NH8A 3PB8X 2FVGA 4AG9A 2Z3LA 3MRUA 4MFJA 4BINA 1Q7LA 3QB8A 5CPAA 4NSQA 4LUAA 4Q38A 5JGFA 2Q4YA 3N5FA 2YNCA 4M3SA 4B12A 5HVFA 3ZJ0A 5D29A 4B5PA 3SXNA 3FJUA 4P4IA 1TF9A 3V38A 2R8VA 4EFDA 1KUXA 5IV0A 2OH1A 4OAEA 4F0XA 4PK3A 2Q4ZA 4ZX9A 3PEIA 1P0HA 4F0YA 4QC6A 4P6YA 1JWQA 3SJFA 3K9TA 3DDDA 2R98A 3E0KA 2GLFA 3RYOA 3TO7A 4A94A 4FD6A 1P4NA 2VZZA 3ZZIA 2QYVA 5FVJA 1MJAA 3KQZA 2Z3NA 5G20A 1Y0YA 3NE8A 1VHSA 3KZWA 1NE9A 4MFPA 2PJ0A 1IB1E 2YNCC 1CP6A 3EXNA 3VWEA 4AVCA 2Z0ZA 3S9MA 5E96A 4UF4A 4R7MA 4I49A 3B7IA 3FIXA 3H8EA 2REEA 2IMOA 3QAYA 4PSXA 1Z8WA 4XPKA 1CJWA 4KVME 5ELYA 1Z8LA 1IYLA 3D4UA 4MXUA 4CYNA 2P0WA 2PR1A 1H8LA 2OU2A 4XPDB 3LACA 1CM0A 5F48A 4LQGA 4PXBA 2Q4VA 3TCVA 4KUAA 5AG7A 4ZBGA 4QB9A 2PJ7A 5G21A 5LYFA 4ZY1A 1KWMA 3OWCA 4HPSA 1NMTA 5DS0A 1HDQA 4C7HA 4NGTA 4MFZA 4MFKA 2V8GA 1VKCA 5LYDA 4FD7A 4RS2A 4EWTA 2QJ8A 1IYKA 1ZLHA 5EBVA 2Z11A 4XNHC 3SI0A 3TC8A 3WT4A 3D66A 3I3GA 3LWUA 1XF8A 2WZNA 2QMLA 2AFXA 4YWYA 3KI9A 3EC4A 4MCSA 1CP7A 1RXTA 5CNPA 1MJ9A 2C6PA 2DEAA 2G3AA 1Y9KA 3B3SA 2PJ3A 2Z3KA 4RN7A 1BOBA 3RBUA 3JTKA 4HNWB 2GFQA 4M6HA 8CPAA 4NGMA 2C27A 5AGEA 3B3VA 3VATA 1PYTB 4UWIA 2ZEEA 1Z4EA 2Q7BA 2XEGA 3KHZA 1F57A 1QSNA 2QVPA 3IU2A 2V8DA 2ZW5A 5CBMA 5J8FA 3G3SA 2CNSA 2O28A 2V8VA 3BI0A 4F9VA 4GS4A 3DGVA 5IB0A 2PRBA 3NFZA 3DR6A 2K5TA 4OP4A 2AFZA 5A28A 2FCKA 4NGPA 4PV6A 2PCUA 2GLJA 2Z3MA 4AXVA 5HVHA 2J8RA 1LRZA 1LAMA 3IWWA 2PJ8A 4E0AA 2CIJA 3IWGA 3HUVA 2GU2A 3PP9A 2P6EA 5DWMA 1S3ZA 1F2OA 2CTCA 1QMUA 2ZW4A 3LODA 4A31A 5LRJA 4B11A 5KTDA 1N71A 2OB0A 2ZOFA 3PRTA 2C6GA 4IF5A 4M6IA 5DWNA 2ZELA 4KLVA 1FY7A 4PXCA 5LRGA 5JM6A 4JXRA 4A30A 1KUVA 4ZI6A 4KOWA 3SJEA 4MI4A 3KR4A 3T8WA 5IB9A 4NJQA 5F47A 5GCNA 2JEWA 2OOTA 4A39A 2PJ2A 3CDXA 1CX8A 4P4EA 1CG2A 4P45A 4P4BA 5HVGA 2G9DA 3QAHA 5AG5A 4MFQA 1LFWA 2O53A 2D4OA 2GE3A 1UWYA 4KORA 2QECA 3R96A 4QBJA 4A32A 4U5YA 2P6GA 5THWA 3GYAA 3R1KA 4KSIA 3IIBA 4DJLA 4GXHA 1YW6A 4L8AA 3FEDA 1YGHA 3TO9A 2ZEHA 2B5GA 3IJ3A 3SXOA 3WC7A 1RO5A 4JYWA 3D7DA 4R76A 2J9AA 4A2ZA 4BD9A 4WJBA 2X7BA 1LAPA 2VXKA 4XPLA 3VARA 1B6BA 5BWAB 4OLLA 3FYNA 4C7IA 4UIBA 1I1DA 4IK2A 1CBXA 5AG6A 1VIXA 1VGYA 1CPSA 2Q0YA 1B87A 1J4JA 1JQGA 2AFOA 3FBUA 3QNVA 5H84A 4O23A 4OIWA 3S6KA 3S6HA 4CAVA 2JBKA 1YMEA 2B4BA 4XPDC 1OZPA 4AVBA 3W6SA 5HH1A 4II9A 4CAXA 2F8HA 4NF1A 4ZY2A 4UA3A 2ZOGA 5J8CA
chains in the Genus database with same CATH topology
4NCZA 3EFAA 1XE4A 1YVKA 4KLWA 3VWDA 4QUSA 3CXSA 5G1ZA 5HMNA 4HNYB 4BMHA 1PU9A 4R87A 2HUZA 1YREA 2OZHA 4JWPA 1Y9WA 1S7LA 4RI1A 5JPHA 3TE4A 1QSTA 2PQ8A 2PDOA 3BJ7A 2EUIA 3EO4A 2GIVA 2B5GB 2FL4A 4R9MA 1TIQA 5EC4A 3IWEA 4MFLA 4UFXA 4E8OA 2HQYA 3W6XA 2B3UA 3H5ZA 4CAEA 2D4PA 3KKWA 2VBQA 1S60A 4M85A 2CNTA 3TO6A 5H86A 4C2ZA 4YGOA 1IICA 1S7NA 2JLMA 3C26A 4CGOA 4KVOE 1NSLA 2YGWA 2PC1A 2ZW6A 4CYQA 4NXYA 3TOAA 3UY5A 3FB3A 2FS5A 3R9EA 2OZUA 2BEIA 4NEXA 3F0AA 2I00A 2JEVA 4UCNA 3FXTA 1XIXA 5I0CA 2WSAA 2B4DB 1MK4A 3TFYA 4CRYB 4C2YA 1IIDA 4UCPA 5KTAA 4JXQA 4OADA 3EY5A 3F5BA 2G3TA 4KUBA 3R9FA 4UWJA 3T9YA 4CAFA 2AJ6A 1QSOA 2BSWA 4AVAA 3N7ZA 1S7FA 2FXFA 2P6FA 2WUUA 3FNCA 2EVNA 2VI7A 4KSAA 4R57A 4CYOA 3TTHA 4B14A 1KZFA 1YK3A 3S6GA 3GKRA 1K4JA 2ZXVA 4KOVA 1XEBA 2Z3PA 3JVNA 4KOXA 4Y49B 3BLNA 4JD6A 4QVTA 2BL1A 4YRHA 2YNDA 3JUWA 4MBUA 2Q44A 4ONUA 4R3LA 2G0BA 1I21A 4KOSA 4YFJA 3PGPA 2R1IA 3PZJA 3SHPA 5KTCA 4UBRA 4MJ8A 2J8NA 4ORFA 4BBHA 2AE6A 5C82A 2DXQA 2BUEA 4UFVA 4KVXA 1BO4A 3H4QA 3MGDA 2RC4A 1MJBA 2ATRA 5F46A 3LD2A 4CGNA 1S5KA 2DPTA 4UFWA 2WPWA 3P2HA 2QIRA 2DPSA 2B4DA 4MHDA 4KOUA 2PSWA 4PSWA 4J3GA 5C88A 3I9SA 3IGRA 4JLYA 4H6ZA 4CYPA 2OZGA 5F49A 4U9ZA 2FT0A 4B5OA 3K9UA 4KZTA 4KOTA 1WK4A 1GHEA 2HV2A 3D2PA 3D3SA 3D8PA 4H89A 4C2XA 1ON0A 1R57A 1V0CA 2B58A 3R95A 1L0CA 1U6MA 2GANA 5IX3A 3P2FA 4CRZB 3BJ8A 2JDDA 1Y7RA 1YX0A 4U9YA 4IUSA 5AG4A 2FSRA 4MY0A 2FIWA 3R9GA 4A33A 4C68A 3W91A 2PR8A 1SQHA 4B5PB 3DNSA 2R7HA 3TT2A 5ISVA 2A4NA 2Z3OA 3T90A 4B10A 2REFA 4PK2A 2ZW7A 1M4GA 4ZGYB 2Z10A 2J8MA 3S6FA 4FD5A 4EVYA 2JDCA 4HKFA 1Q2CA 1YLEA 4DNCA 1Z9UA 2H5MA 3F8KA 4CGPA 4CGLA 2KCWA 1S7KA 1PUAA 4K30A 4KS9A 1QSMA 1M44A 4Q36A 1KUYA 4KOYA 1I12A 4A2ZA 3WR7A 4H6UA 4Y49C 2NMTA 3DR8A 3GY9A 4L89A 3CXQA 4XNHB 4AG7A 2VQYA 1M4IA 4LX9A 4MY3A 2FE7A 2IL4A 4UCMA 2B3VA 2FIAA 2WPXA 5JQ4A 3NE7A 1M1DA 2ZPAA 2VZYA 1YR0A 1Z4RA 3CXPA 4B13A 3B8GA 2CNMA 1XMTA 4CGMA 1Q2DA 2F5IA 3V8IA 1YVOA 2ARHA 3D2MA 4A95A 2VEZA 3TOBA 2Q04A 2CXAA 4CAWA 1Q2YA 4F6AA 3FRMA 3A9LA 4X5KA 3IU1A 4R3KA 4KSFA 1WWZA 4FD4A 2I79A 1UFHA 4JJXA 4E2AA 2Y0MA 1QSRA 5G22A 3G8WA 4CS0B 2CY2A 4HNXB 3DSBA 5A27A 2YNEA 1M4DA 1ZO0A 4AB7A 4AG9A 2Z3LA 4MFJA 3QB8A 4NSQA 4LUAA 4Q38A 2Q4YA 2YNCA 4M3SA 4B12A 3ZJ0A 4B5PA 3SXNA 5IV0A 2R8VA 1KUXA 2OH1A 4OAEA 4F0XA 4PK3A 1P0HA 4F0YA 4QC6A 3DDDA 2R98A 3E0KA 3RYOA 3TO7A 4FD6A 1P4NA 2VZZA 3ZZIA 5FVJA 1MJAA 2Z3NA 5G20A 1VHSA 1NE9A 4MFPA 1IB1E 2YNCC 3EXNA 3VWEA 4AVCA 2Z0ZA 5E96A 4I49A 3FIXA 2REEA 4PSXA 4XPKA 1CJWA 4KVME 1IYLA 4CYNA 2P0WA 2PR1A 2OU2A 4XPDB 1CM0A 5F48A 2Q4VA 3TCVA 4KUAA 5AG7A 4ZBGA 4QB9A 5G21A 3OWCA 1NMTA 4C7HA 4MFZA 4MFKA 1VKCA 4FD7A 4RS2A 5EBVA 1IYKA 2Z11A 4XNHC 3I3GA 1XF8A 2QMLA 3EC4A 1RXTA 5CNPA 1MJ9A 2G3AA 1Y9KA 2Z3KA 1BOBA 3JTKA 4HNWB 2C27A 5AGEA 4UWIA 1Z4EA 2Q7BA 3IU2A 1QSNA 2ZW5A 5J8FA 3G3SA 2CNSA 2O28A 4GS4A 5IB0A 2PRBA 3DR6A 2K5TA 5A28A 2FCKA 4PV6A 2Z3MA 2J8RA 1LRZA 4E0AA 3IWGA 3PP9A 2P6EA 5DWMA 1S3ZA 2ZW4A 3LODA 4B11A 4A31A 5KTDA 1N71A 2OB0A 4IF5A 5DWNA 4KLVA 1FY7A 4JXRA 4A30A 1KUVA 4KOWA 4MI4A 5F47A 5GCNA 3QAHA 5AG5A 4MFQA 2D4OA 2GE3A 4KORA 2QECA 3R96A 4QBJA 4A32A 4U5YA 2P6GA 3GYAA 3R1KA 4L8AA 1YGHA 3TO9A 2B5GA 3SXOA 1RO5A 2X7BA 4XPLA 2VXKA 5BWAB 1B6BA 4OLLA 3FYNA 4C7IA 1I1DA 5AG6A 2Q0YA 1B87A 1J4JA 3FBUA 5H84A 3S6KA 3S6HA 4CAVA 2B4BA 4XPDC 1OZPA 4AVBA 3W6SA 5HH1A 4II9A 4CAXA 4NF1A 4UA3A 5J8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NCZ A;  3EFA A;  1XE4 A;  1YVK A;  4KLW A;  3VWD A;  4QUS A;  3CXS A;  5HMN A;  4HNY B;  4BMH A;  1PU9 A;  4R87 A;  2HUZ A;  1YRE A;  2OZH A;  4JWP A;  1Y9W A;  1S7L A;  4RI1 A;  5JPH A;  3TE4 A;  1QST A;  2PQ8 A;  2PDO A;  3BJ7 A;  2EUI A;  3EO4 A;  2GIV A;  2B5G B;  2FL4 A;  4R9M A;  1TIQ A;  5EC4 A;  4E8O A;  2HQY A;  3W6X A;  2B3U A;  2D4P A;  3KKW A;  2VBQ A;  1S60 A;  4M85 A;  2CNT A;  3TO6 A;  5H86 A;  4YGO A;  1IIC A;  1S7N A;  2JLM A;  3C26 A;  4KVO E;  1NSL A;  2PC1 A;  2ZW6 A;  4NXY A;  3TOA A;  3UY5 A;  3FB3 A;  2FS5 A;  3R9E A;  2OZU A;  2BEI A;  4NEX A;  3F0A A;  2I00 A;  2JEV A;  3FXT A;  1XIX A;  5I0C A;  2B4D B;  1MK4 A;  3TFY A;  4CRY B;  1IID A;  5KTA A;  4JXQ A;  4OAD A;  3EY5 A;  3F5B A;  2G3T A;  4KUB A;  3R9F A;  4UWJ A;  3T9Y A;  2AJ6 A;  1QSO A;  2BSW A;  4AVA A;  3N7Z A;  1S7F A;  2FXF A;  2P6F A;  3FNC A;  2EVN A;  2VI7 A;  4R57 A;  3TTH A;  1KZF A;  1YK3 A;  3S6G A;  3GKR A;  1K4J A;  2ZXV A;  4KOV A;  1XEB A;  3JVN A;  4KOX A;  4Y49 B;  3BLN A;  4JD6 A;  4QVT A;  2BL1 A;  4YRH A;  3JUW A;  4MBU A;  2Q44 A;  4ONU A;  4R3L A;  2G0B A;  1I21 A;  4KOS A;  4YFJ A;  3PGP A;  2R1I A;  3PZJ A;  3SHP A;  5KTC A;  4UBR A;  4MJ8 A;  2J8N A;  4ORF A;  2AE6 A;  5C82 A;  2DXQ A;  2BUE A;  4KVX A;  1BO4 A;  3H4Q A;  3MGD A;  2RC4 A;  1MJB A;  2ATR A;  5F46 A;  3LD2 A;  1S5K A;  2WPW A;  3P2H A;  2QIR A;  2B4D A;  4MHD A;  4KOU A;  2PSW A;  4PSW A;  4J3G A;  5C88 A;  3I9S A;  3IGR A;  4JLY A;  4H6Z A;  2OZG A;  5F49 A;  4U9Z A;  2FT0 A;  4B5O A;  3K9U A;  4KZT A;  4KOT A;  1WK4 A;  1GHE A;  2HV2 A;  3D2P A;  3D3S A;  3D8P A;  4H89 A;  1ON0 A;  1R57 A;  1V0C A;  2B58 A;  3R95 A;  1L0C A;  1U6M A;  2GAN A;  5IX3 A;  3P2F A;  4CRZ B;  3BJ8 A;  2JDD A;  1Y7R A;  1YX0 A;  4U9Y A;  4IUS A;  2FSR A;  4MY0 A;  2FIW A;  3R9G A;  3W91 A;  2PR8 A;  1SQH A;  4B5P B;  3DNS A;  2R7H A;  3TT2 A;  5ISV A;  2A4N A;  3T90 A;  2REF A;  4PK2 A;  2ZW7 A;  1M4G A;  2Z10 A;  2J8M A;  3S6F A;  4FD5 A;  4EVY A;  2JDC A;  4HKF A;  1Q2C A;  1YLE A;  4DNC A;  1Z9U A;  2H5M A;  3F8K A;  2KCW A;  1S7K A;  1PUA A;  4K30 A;  1QSM A;  1M44 A;  1KUY A;  4KOY A;  1I12 A;  3WR7 A;  4H6U A;  4Y49 C;  2NMT A;  3DR8 A;  3GY9 A;  4L89 A;  3CXQ A;  4XNH B;  4AG7 A;  2VQY A;  1M4I A;  4LX9 A;  4MY3 A;  2FE7 A;  2IL4 A;  2B3V A;  2FIA A;  2WPX A;  5JQ4 A;  3NE7 A;  1M1D A;  2ZPA A;  2VZY A;  1YR0 A;  1Z4R A;  3CXP A;  3B8G A;  2CNM A;  1XMT A;  1Q2D A;  2F5I A;  3V8I A;  1YVO A;  2ARH A;  3D2M A;  2VEZ A;  3TOB A;  2Q04 A;  4CAW A;  1Q2Y A;  4F6A A;  3FRM A;  4X5K A;  4R3K A;  1WWZ A;  4FD4 A;  2I79 A;  1UFH A;  4JJX A;  4E2A A;  2Y0M A;  1QSR A;  3G8W A;  4CS0 B;  2CY2 A;  4HNX B;  3DSB A;  1M4D A;  4AB7 A;  4AG9 A;  3QB8 A;  4NSQ A;  4LUA A;  2Q4Y A;  4M3S A;  3ZJ0 A;  4B5P A;  3SXN A;  5IV0 A;  2R8V A;  1KUX A;  2OH1 A;  4OAE A;  4PK3 A;  1P0H A;  4F0Y A;  4QC6 A;  3DDD A;  2R98 A;  3E0K A;  3RYO A;  3TO7 A;  4FD6 A;  1P4N A;  2VZZ A;  3ZZI A;  5FVJ A;  1MJA A;  1VHS A;  1NE9 A;  1IB1 E;  3EXN A;  3VWE A;  4AVC A;  2Z0Z A;  5E96 A;  4I49 A;  3FIX A;  2REE A;  4PSX A;  4XPK A;  1CJW A;  4KVM E;  1IYL A;  2P0W A;  2PR1 A;  2OU2 A;  4XPD B;  1CM0 A;  5F48 A;  2Q4V A;  3TCV A;  4KUA A;  4ZBG A;  4QB9 A;  3OWC A;  1NMT A;  1VKC A;  4FD7 A;  4RS2 A;  5EBV A;  1IYK A;  2Z11 A;  4XNH C;  3I3G A;  1XF8 A;  2QML A;  3EC4 A;  1RXT A;  5CNP A;  1MJ9 A;  2G3A A;  1Y9K A;  1BOB A;  4HNW B;  2C27 A;  4UWI A;  1Z4E A;  2Q7B A;  1QSN A;  2ZW5 A;  5J8F A;  3G3S A;  2CNS A;  2O28 A;  4GS4 A;  5IB0 A;  2PRB A;  3DR6 A;  2K5T A;  2FCK A;  4PV6 A;  2J8R A;  1LRZ A;  4E0A A;  3IWG A;  3PP9 A;  2P6E A;  5DWM A;  1S3Z A;  2ZW4 A;  3LOD A;  5KTD A;  1N71 A;  2OB0 A;  4IF5 A;  5DWN A;  4KLV A;  1FY7 A;  4JXR A;  1KUV A;  4KOW A;  4MI4 A;  5F47 A;  5GCN A;  3QAH A;  2D4O A;  2GE3 A;  4KOR A;  2QEC A;  3R96 A;  4QBJ A;  4U5Y A;  2P6G A;  3GYA A;  3R1K A;  4L8A A;  1YGH A;  3TO9 A;  2B5G A;  3SXO A;  1RO5 A;  2X7B A;  4XPL A;  2VXK A;  1B6B A;  4OLL A;  3FYN A;  1I1D A;  2Q0Y A;  1B87 A;  1J4J A;  3FBU A;  5H84 A;  3S6K A;  3S6H A;  4CAV A;  2B4B A;  4XPD C;  1OZP A;  4AVB A;  3W6S A;  5HH1 A;  4II9 A;  4CAX A;  4NF1 A;  4UA3 A;  5J8C A; 
#chains in the Genus database with same CATH topology
 3SJG A;  4NCZ A;  3EFA A;  1XE4 A;  1YVK A;  1ARM A;  4KLW A;  1VHE A;  2HB6 A;  2XEJ A;  3VWD A;  2Q51 A;  4QUS A;  1ZG9 A;  2AFS A;  3CXS A;  2WYR A;  2PJ6 A;  3PFE A;  5G1Z A;  5HMN A;  4HNY B;  2ABZ A;  1DE4 C;  2PVV A;  4A37 A;  4BMH A;  1PU9 A;  4R87 A;  2HUZ A;  4OC0 A;  2OR4 A;  1YRE A;  2OZH A;  3PBE A;  4JWP A;  1Y9W A;  1S7L A;  4OKO A;  3TX8 A;  2O4H A;  4RI1 A;  3BI1 A;  1X10 A;  5JPH A;  3TE4 A;  1QST A;  2PQ8 A;  2PDO A;  3PB4 X;  3BJ7 A;  2XEI A;  2EUI A;  2GRE A;  3EO4 A;  2GIV A;  6CPA A;  2B5G B;  2ZED A;  2FL4 A;  4NGR A;  4R9M A;  1TIQ A;  1ZG8 A;  5EC4 A;  3IWE A;  4MFL A;  4UFX A;  4E8O A;  2HQY A;  3W6X A;  2B3U A;  4IAV A;  1TXR A;  1YSJ A;  2ANP A;  3H5Z A;  3PBB A;  4CAE A;  1LAN A;  4UEZ A;  2D4P A;  3KKW A;  3IC1 A;  3HLP A;  1LOK A;  3ISZ A;  2VBQ A;  1S60 A;  2IJZ A;  3RNZ A;  4M85 A;  1TF8 A;  2CNT A;  3TO6 A;  5H86 A;  4C2Z A;  2C6C A;  1Y7E A;  2ZEG A;  4YGO A;  1IIC A;  1S7N A;  2JLM A;  3C26 A;  1Z5R A;  2ZEP A;  4CGO A;  4KVO E;  4PXE A;  1NSL A;  4G1P A;  4EME A;  4Q7A A;  2YGW A;  2PC1 A;  2ZW6 A;  4X8I A;  4CYQ A;  4NXY A;  3TOA A;  3UY5 A;  3FB3 A;  2FS5 A;  3R9E A;  2OZU A;  2BEI A;  4NEX A;  1XJO A;  3F0A A;  2BO9 A;  2I00 A;  2JEV A;  2JBJ A;  4UCN A;  5K8P A;  3FXT A;  1Y0R A;  5JH9 A;  2EWB A;  1IGB A;  4OC3 A;  1XIX A;  1XRY A;  1ARL A;  3B3T A;  1VHO A;  2PJB A;  3RO0 A;  5I0C A;  2WSA A;  1YW4 A;  1R43 A;  1OBR A;  3GUX A;  4ZY0 A;  1A2Z A;  2B4D B;  1MK4 A;  3L2N A;  3TFY A;  1BLL E;  4OC5 A;  2POK A;  4CRY B;  2PJ9 A;  2C1C A;  1IID A;  4UCP A;  4C2Y A;  5KTA A;  4JXQ A;  4OAD A;  3EY5 A;  3F5B A;  2CF4 A;  1RTQ A;  1YLO A;  2PJC A;  2G3T A;  3KL9 A;  4KUB A;  3R9F A;  4UWJ A;  3T9Y A;  1Z2L A;  3NA6 A;  2AJ6 A;  1QSO A;  2BSW A;  4CAF A;  4FBE A;  4AVA A;  4P4D A;  3N7Z A;  1S7F A;  4UEF A;  2BOA A;  2FXF A;  2P6F A;  4PXD A;  3CZX A;  5K8O A;  2PJA A;  2WUU A;  1YQE A;  3FNC A;  2AFM A;  2EVN A;  2VI7 A;  3GLJ A;  2DF5 A;  5HXD A;  4KSA A;  4R57 A;  1BPN A;  2EO8 A;  3FF3 A;  4CYO A;  3FH4 A;  4MMO A;  1TKH A;  3TTH A;  2HC9 A;  4B14 A;  1KZF A;  3SJX A;  1YK3 A;  3B2Y A;  1DTD A;  3GKR A;  1K4J A;  3ISX A;  1ZG7 A;  2ZXV A;  4KOV A;  1XEB A;  3S6G A;  2VL1 A;  1LCP A;  2PRQ A;  2Z3P A;  4PQA A;  3JVN A;  2EBJ A;  4KOX A;  3BLN A;  4Y49 B;  1XOV A;  4JD6 A;  2BL1 A;  2Q7S A;  4QVT A;  5I4M A;  4YRH A;  1M4L A;  4P4J A;  3SI2 A;  4P10 A;  3PB9 X;  1EE3 P;  1AUG A;  2PJ5 A;  2YND A;  5J1Q A;  3JUW A;  4MBU A;  3B35 A;  4DYO A;  4X3R A;  3FX6 A;  2Q44 A;  3V7Z A;  4ONU A;  3FEC A;  2IQ6 A;  4R3L A;  2RB7 A;  4MHN A;  2G0B A;  1I21 A;  4KOS A;  4YFJ A;  1BPM A;  1F2P A;  3PGP A;  2R1I A;  1ELL P;  3PZJ A;  3SHP A;  5KTC A;  4UBR A;  4MJ8 A;  2EK8 A;  2J8N A;  2Q43 A;  4ORF A;  4BBH A;  1X12 A;  2ZEF A;  4NJR A;  3WAB A;  2AE6 A;  5C82 A;  2DXQ A;  3D68 A;  2PJ1 A;  2BUE A;  3K2K A;  4UFV A;  3RZA A;  4KVX A;  4RUH A;  1BO4 A;  3H4Q A;  4MCP A;  1PCA A;  2V8H A;  3MGD A;  2XEF A;  2RC4 A;  1MJB A;  2PVW A;  2ATR A;  5F46 A;  4A38 A;  4WWV A;  3LD2 A;  4NGQ A;  5K8M A;  4CGN A;  1S5K A;  2DPT A;  3CPX A;  3D7H A;  4UFW A;  2WPW A;  1Z8X A;  3D7G A;  3FMC A;  3P2H A;  1FT7 A;  2QIR A;  4F8Z A;  2RFH A;  2DPS A;  2B4D A;  3BHX A;  4UIA A;  3FVL A;  3BXM A;  4MHD A;  4KOU A;  1IY7 A;  4P4F A;  2PSW A;  4OC1 A;  4PSW A;  4J3G A;  4ZX8 A;  5C88 A;  3I9S A;  3IGR A;  4Z65 A;  2ZEN A;  4JLY A;  4NFR A;  4H6Z A;  4CYP A;  2CTB A;  2OZG A;  5F49 A;  4U9Z A;  2FT0 A;  4B5O A;  3K9U A;  4KZT A;  1FNO A;  4KOT A;  1NSA A;  1WK4 A;  1GHE A;  2HV2 A;  3D2P A;  3D3S A;  3D8P A;  3MN8 A;  4H89 A;  4ONW A;  4C2X A;  1ON0 A;  1R57 A;  1V0C A;  2B58 A;  1IOI A;  4YU9 A;  3R95 A;  1HDU A;  1ZLI A;  2ZEO A;  1L0C A;  1U6M A;  4MHY A;  2GAN A;  5IX3 A;  3P2F A;  4CRZ B;  3BJ8 A;  2JDD A;  1Y7R A;  1YX0 A;  4U9Y A;  4IUS A;  3I1U A;  5LYL A;  5AG4 A;  1ELM P;  2FSR A;  4MY0 A;  4PPZ A;  2FIW A;  3R9G A;  1QQ9 A;  5LYI A;  4A33 A;  4C68 A;  3W91 A;  2PR8 A;  1R3N A;  3IFE A;  1SQH A;  4NGS A;  4TNU A;  2AFU A;  3PFO A;  4B5P B;  2I3C A;  2BCO A;  3D7F A;  4MCQ A;  3DNS A;  2R7H A;  4FAI A;  3NH4 A;  4F9U A;  3TT2 A;  4R8F A;  1IU8 A;  5ISV A;  1BAV A;  2A4N A;  2Z3O A;  3T90 A;  4B10 A;  3JRU A;  2REF A;  3IO1 A;  4PK2 A;  2ZW7 A;  1M4G A;  4ZGY B;  2Z10 A;  3KHX A;  2J8M A;  4OC4 A;  3S6F A;  4FD5 A;  4EVY A;  2JDC A;  3LMS A;  4HKF A;  4GM5 A;  4W9Y A;  1Q2C A;  1YLE A;  2ZEM A;  4DNC A;  1Z9U A;  4B6Z A;  5EMI A;  1IOF A;  2H5M A;  3GB0 A;  3F8K A;  2PIZ A;  4MHP A;  4CGP A;  4CGL A;  2KCW A;  4JZ0 A;  1S7K A;  3VH9 A;  4OID A;  1GYT A;  1PUA A;  4K30 A;  1XMB A;  4KS9 A;  1QSM A;  5LRK A;  1M44 A;  4Q36 A;  1KUY A;  4KOY A;  3WC6 A;  1XBU A;  1I12 A;  2PIY A;  3B3W A;  3D67 A;  3KGQ A;  4H6U A;  4Y49 C;  2NMT A;  3DR8 A;  3GY9 A;  1TKJ A;  3NH5 A;  3WR7 A;  5F09 A;  4L89 A;  4OC2 A;  3PB6 X;  3CXQ A;  2EK9 A;  4XNH B;  2V77 A;  4AG7 A;  2VQY A;  4FUU A;  4NGN A;  2PJ4 A;  4K3N A;  1M4I A;  4LX9 A;  4MY3 A;  2FE7 A;  2IL4 A;  4UCM A;  4ZYQ A;  2B3V A;  2FIA A;  5K8N A;  2WPX A;  4MCR A;  5JQ4 A;  3NE7 A;  2F7V A;  1M1D A;  4UEE A;  2ZPA A;  3H8F A;  1HEE A;  2VZY A;  1YR0 A;  4TWE A;  5D8N A;  1Z4R A;  3DLJ A;  4M6G A;  3RAM A;  2NYQ A;  2PE3 A;  3KR5 A;  4DUK A;  3CXP A;  3KAS A;  4R6T A;  2ODF A;  3B8G A;  4B13 A;  4FWU A;  2CNM A;  1XMT A;  3FEE A;  3H8G A;  4CGM A;  1Q2D A;  2F5I A;  3SI1 A;  4MRI A;  1TKF A;  1YVO A;  2ARH A;  2AFW A;  3V8I A;  3D2M A;  4MHZ A;  4H2K A;  4A95 A;  2VEZ A;  7CPA A;  3TOB A;  1Z8T A;  3S9L A;  3CPA A;  3WC5 A;  2Q04 A;  2CXA A;  3PB7 X;  4CAW A;  1Q2Y A;  4F6A A;  3FRM A;  3IEH A;  3A9L A;  4X5K A;  3IU1 A;  3S9N A;  4OME A;  4R3K A;  4KSF A;  1WWZ A;  1AMP A;  2I79 A;  4FD4 A;  3B3C A;  4X2T A;  1CPX A;  1UFH A;  1XFO A;  4JJX A;  4E2A A;  2Y0M A;  1QSR A;  4CPA A;  4LQ6 A;  3KQX A;  5G22 A;  4P44 A;  3G8W A;  4CS0 B;  1AYE A;  2CY2 A;  3CT9 A;  4HNX B;  4IHM A;  2NSM A;  3DSB A;  5A27 A;  2YNE A;  3GIU A;  1M4D A;  1ZO0 A;  4AB7 A;  3NH8 A;  3PB8 X;  2FVG A;  4AG9 A;  2Z3L A;  3MRU A;  4MFJ A;  4BIN A;  1Q7L A;  3QB8 A;  5CPA A;  4NSQ A;  4LUA A;  4Q38 A;  5JGF A;  2Q4Y A;  3N5F A;  2YNC A;  4M3S A;  4B12 A;  5HVF A;  3ZJ0 A;  5D29 A;  4B5P A;  3SXN A;  3FJU A;  4P4I A;  1TF9 A;  3V38 A;  2R8V A;  4EFD A;  1KUX A;  5IV0 A;  2OH1 A;  4OAE A;  4F0X A;  4PK3 A;  2Q4Z A;  4ZX9 A;  3PEI A;  1P0H A;  4F0Y A;  4QC6 A;  4P6Y A;  1JWQ A;  3SJF A;  3K9T A;  3DDD A;  2R98 A;  3E0K A;  2GLF A;  3RYO A;  3TO7 A;  4A94 A;  4FD6 A;  1P4N A;  2VZZ A;  3ZZI A;  2QYV A;  5FVJ A;  1MJA A;  3KQZ A;  2Z3N A;  5G20 A;  1Y0Y A;  3NE8 A;  1VHS A;  3KZW A;  1NE9 A;  4MFP A;  2PJ0 A;  1IB1 E;  2YNC C;  1CP6 A;  3EXN A;  3VWE A;  4AVC A;  2Z0Z A;  3S9M A;  5E96 A;  4UF4 A;  4R7M A;  4I49 A;  3B7I A;  3FIX A;  3H8E A;  2REE A;  2IMO A;  3QAY A;  4PSX A;  1Z8W A;  4XPK A;  1CJW A;  4KVM E;  5ELY A;  1Z8L A;  1IYL A;  3D4U A;  4MXU A;  4CYN A;  2P0W A;  2PR1 A;  1H8L A;  2OU2 A;  4XPD B;  3LAC A;  1CM0 A;  5F48 A;  4LQG A;  4PXB A;  2Q4V A;  3TCV A;  4KUA A;  5AG7 A;  4ZBG A;  4QB9 A;  2PJ7 A;  5G21 A;  5LYF A;  4ZY1 A;  1KWM A;  3OWC A;  4HPS A;  1NMT A;  5DS0 A;  1HDQ A;  4C7H A;  4NGT A;  4MFZ A;  4MFK A;  2V8G A;  1VKC A;  5LYD A;  4FD7 A;  4RS2 A;  4EWT A;  2QJ8 A;  1IYK A;  1ZLH A;  5EBV A;  2Z11 A;  4XNH C;  3SI0 A;  3TC8 A;  3WT4 A;  3D66 A;  3I3G A;  3LWU A;  1XF8 A;  2WZN A;  2QML A;  2AFX A;  4YWY A;  3KI9 A;  3EC4 A;  4MCS A;  1CP7 A;  1RXT A;  5CNP A;  1MJ9 A;  2C6P A;  2DEA A;  2G3A A;  1Y9K A;  3B3S A;  2PJ3 A;  2Z3K A;  4RN7 A;  1BOB A;  3RBU A;  3JTK A;  4HNW B;  2GFQ A;  4M6H A;  8CPA A;  4NGM A;  2C27 A;  5AGE A;  3B3V A;  3VAT A;  1PYT B;  4UWI A;  2ZEE A;  1Z4E A;  2Q7B A;  2XEG A;  3KHZ A;  1F57 A;  1QSN A;  2QVP A;  3IU2 A;  2V8D A;  2ZW5 A;  5CBM A;  5J8F A;  3G3S A;  2CNS A;  2O28 A;  2V8V A;  3BI0 A;  4F9V A;  4GS4 A;  3DGV A;  5IB0 A;  2PRB A;  3NFZ A;  3DR6 A;  2K5T A;  4OP4 A;  2AFZ A;  5A28 A;  2FCK A;  4NGP A;  4PV6 A;  2PCU A;  2GLJ A;  2Z3M A;  4AXV A;  5HVH A;  2J8R A;  1LRZ A;  1LAM A;  3IWW A;  2PJ8 A;  4E0A A;  2CIJ A;  3IWG A;  3HUV A;  2GU2 A;  3PP9 A;  2P6E A;  5DWM A;  1S3Z A;  1F2O A;  2CTC A;  1QMU A;  2ZW4 A;  3LOD A;  4A31 A;  5LRJ A;  4B11 A;  5KTD A;  1N71 A;  2OB0 A;  2ZOF A;  3PRT A;  2C6G A;  4IF5 A;  4M6I A;  5DWN A;  2ZEL A;  4KLV A;  1FY7 A;  4PXC A;  5LRG A;  5JM6 A;  4JXR A;  4A30 A;  1KUV A;  4ZI6 A;  4KOW A;  3SJE A;  4MI4 A;  3KR4 A;  3T8W A;  5IB9 A;  4NJQ A;  5F47 A;  5GCN A;  2JEW A;  2OOT A;  4A39 A;  2PJ2 A;  3CDX A;  1CX8 A;  4P4E A;  1CG2 A;  4P45 A;  4P4B A;  5HVG A;  2G9D A;  3QAH A;  5AG5 A;  4MFQ A;  1LFW A;  2O53 A;  2D4O A;  2GE3 A;  1UWY A;  4KOR A;  2QEC A;  3R96 A;  4QBJ A;  4A32 A;  4U5Y A;  2P6G A;  5THW A;  3GYA A;  3R1K A;  4KSI A;  3IIB A;  4DJL A;  4GXH A;  1YW6 A;  4L8A A;  3FED A;  1YGH A;  3TO9 A;  2ZEH A;  2B5G A;  3IJ3 A;  3SXO A;  3WC7 A;  1RO5 A;  4JYW A;  3D7D A;  4R76 A;  2J9A A;  4A2Z A;  4BD9 A;  4WJB A;  2X7B A;  1LAP A;  2VXK A;  4XPL A;  3VAR A;  1B6B A;  5BWA B;  4OLL A;  3FYN A;  4C7I A;  4UIB A;  1I1D A;  4IK2 A;  1CBX A;  5AG6 A;  1VIX A;  1VGY A;  1CPS A;  2Q0Y A;  1B87 A;  1J4J A;  1JQG A;  2AFO A;  3FBU A;  3QNV A;  5H84 A;  4O23 A;  4OIW A;  3S6K A;  3S6H A;  4CAV A;  2JBK A;  1YME A;  2B4B A;  4XPD C;  1OZP A;  4AVB A;  3W6S A;  5HH1 A;  4II9 A;  4CAX A;  2F8H A;  4NF1 A;  4ZY2 A;  4UA3 A;  2ZOG A;  5J8C A; 
#chains in the Genus database with same CATH homology
 4NCZ A;  3EFA A;  1XE4 A;  1YVK A;  4KLW A;  3VWD A;  4QUS A;  3CXS A;  5G1Z A;  5HMN A;  4HNY B;  4BMH A;  1PU9 A;  4R87 A;  2HUZ A;  1YRE A;  2OZH A;  4JWP A;  1Y9W A;  1S7L A;  4RI1 A;  5JPH A;  3TE4 A;  1QST A;  2PQ8 A;  2PDO A;  3BJ7 A;  2EUI A;  3EO4 A;  2GIV A;  2B5G B;  2FL4 A;  4R9M A;  1TIQ A;  5EC4 A;  3IWE A;  4MFL A;  4UFX A;  4E8O A;  2HQY A;  3W6X A;  2B3U A;  3H5Z A;  4CAE A;  2D4P A;  3KKW A;  2VBQ A;  1S60 A;  4M85 A;  2CNT A;  3TO6 A;  5H86 A;  4C2Z A;  4YGO A;  1IIC A;  1S7N A;  2JLM A;  3C26 A;  4CGO A;  4KVO E;  1NSL A;  2YGW A;  2PC1 A;  2ZW6 A;  4CYQ A;  4NXY A;  3TOA A;  3UY5 A;  3FB3 A;  2FS5 A;  3R9E A;  2OZU A;  2BEI A;  4NEX A;  3F0A A;  2I00 A;  2JEV A;  4UCN A;  3FXT A;  1XIX A;  5I0C A;  2WSA A;  2B4D B;  1MK4 A;  3TFY A;  4CRY B;  4C2Y A;  1IID A;  4UCP A;  5KTA A;  4JXQ A;  4OAD A;  3EY5 A;  3F5B A;  2G3T A;  4KUB A;  3R9F A;  4UWJ A;  3T9Y A;  4CAF A;  2AJ6 A;  1QSO A;  2BSW A;  4AVA A;  3N7Z A;  1S7F A;  2FXF A;  2P6F A;  2WUU A;  3FNC A;  2EVN A;  2VI7 A;  4KSA A;  4R57 A;  4CYO A;  3TTH A;  4B14 A;  1KZF A;  1YK3 A;  3S6G A;  3GKR A;  1K4J A;  2ZXV A;  4KOV A;  1XEB A;  2Z3P A;  3JVN A;  4KOX A;  4Y49 B;  3BLN A;  4JD6 A;  4QVT A;  2BL1 A;  4YRH A;  2YND A;  3JUW A;  4MBU A;  2Q44 A;  4ONU A;  4R3L A;  2G0B A;  1I21 A;  4KOS A;  4YFJ A;  3PGP A;  2R1I A;  3PZJ A;  3SHP A;  5KTC A;  4UBR A;  4MJ8 A;  2J8N A;  4ORF A;  4BBH A;  2AE6 A;  5C82 A;  2DXQ A;  2BUE A;  4UFV A;  4KVX A;  1BO4 A;  3H4Q A;  3MGD A;  2RC4 A;  1MJB A;  2ATR A;  5F46 A;  3LD2 A;  4CGN A;  1S5K A;  2DPT A;  4UFW A;  2WPW A;  3P2H A;  2QIR A;  2DPS A;  2B4D A;  4MHD A;  4KOU A;  2PSW A;  4PSW A;  4J3G A;  5C88 A;  3I9S A;  3IGR A;  4JLY A;  4H6Z A;  4CYP A;  2OZG A;  5F49 A;  4U9Z A;  2FT0 A;  4B5O A;  3K9U A;  4KZT A;  4KOT A;  1WK4 A;  1GHE A;  2HV2 A;  3D2P A;  3D3S A;  3D8P A;  4H89 A;  4C2X A;  1ON0 A;  1R57 A;  1V0C A;  2B58 A;  3R95 A;  1L0C A;  1U6M A;  2GAN A;  5IX3 A;  3P2F A;  4CRZ B;  3BJ8 A;  2JDD A;  1Y7R A;  1YX0 A;  4U9Y A;  4IUS A;  5AG4 A;  2FSR A;  4MY0 A;  2FIW A;  3R9G A;  4A33 A;  4C68 A;  3W91 A;  2PR8 A;  1SQH A;  4B5P B;  3DNS A;  2R7H A;  3TT2 A;  5ISV A;  2A4N A;  2Z3O A;  3T90 A;  4B10 A;  2REF A;  4PK2 A;  2ZW7 A;  1M4G A;  4ZGY B;  2Z10 A;  2J8M A;  3S6F A;  4FD5 A;  4EVY A;  2JDC A;  4HKF A;  1Q2C A;  1YLE A;  4DNC A;  1Z9U A;  2H5M A;  3F8K A;  4CGP A;  4CGL A;  2KCW A;  1S7K A;  1PUA A;  4K30 A;  4KS9 A;  1QSM A;  1M44 A;  4Q36 A;  1KUY A;  4KOY A;  1I12 A;  4A2Z A;  3WR7 A;  4H6U A;  4Y49 C;  2NMT A;  3DR8 A;  3GY9 A;  4L89 A;  3CXQ A;  4XNH B;  4AG7 A;  2VQY A;  1M4I A;  4LX9 A;  4MY3 A;  2FE7 A;  2IL4 A;  4UCM A;  2B3V A;  2FIA A;  2WPX A;  5JQ4 A;  3NE7 A;  1M1D A;  2ZPA A;  2VZY A;  1YR0 A;  1Z4R A;  3CXP A;  4B13 A;  3B8G A;  2CNM A;  1XMT A;  4CGM A;  1Q2D A;  2F5I A;  3V8I A;  1YVO A;  2ARH A;  3D2M A;  4A95 A;  2VEZ A;  3TOB A;  2Q04 A;  2CXA A;  4CAW A;  1Q2Y A;  4F6A A;  3FRM A;  3A9L A;  4X5K A;  3IU1 A;  4R3K A;  4KSF A;  1WWZ A;  4FD4 A;  2I79 A;  1UFH A;  4JJX A;  4E2A A;  2Y0M A;  1QSR A;  5G22 A;  3G8W A;  4CS0 B;  2CY2 A;  4HNX B;  3DSB A;  5A27 A;  2YNE A;  1M4D A;  1ZO0 A;  4AB7 A;  4AG9 A;  2Z3L A;  4MFJ A;  3QB8 A;  4NSQ A;  4LUA A;  4Q38 A;  2Q4Y A;  2YNC A;  4M3S A;  4B12 A;  3ZJ0 A;  4B5P A;  3SXN A;  5IV0 A;  2R8V A;  1KUX A;  2OH1 A;  4OAE A;  4F0X A;  4PK3 A;  1P0H A;  4F0Y A;  4QC6 A;  3DDD A;  2R98 A;  3E0K A;  3RYO A;  3TO7 A;  4FD6 A;  1P4N A;  2VZZ A;  3ZZI A;  5FVJ A;  1MJA A;  2Z3N A;  5G20 A;  1VHS A;  1NE9 A;  4MFP A;  1IB1 E;  2YNC C;  3EXN A;  3VWE A;  4AVC A;  2Z0Z A;  5E96 A;  4I49 A;  3FIX A;  2REE A;  4PSX A;  4XPK A;  1CJW A;  4KVM E;  1IYL A;  4CYN A;  2P0W A;  2PR1 A;  2OU2 A;  4XPD B;  1CM0 A;  5F48 A;  2Q4V A;  3TCV A;  4KUA A;  5AG7 A;  4ZBG A;  4QB9 A;  5G21 A;  3OWC A;  1NMT A;  4C7H A;  4MFZ A;  4MFK A;  1VKC A;  4FD7 A;  4RS2 A;  5EBV A;  1IYK A;  2Z11 A;  4XNH C;  3I3G A;  1XF8 A;  2QML A;  3EC4 A;  1RXT A;  5CNP A;  1MJ9 A;  2G3A A;  1Y9K A;  2Z3K A;  1BOB A;  3JTK A;  4HNW B;  2C27 A;  5AGE A;  4UWI A;  1Z4E A;  2Q7B A;  3IU2 A;  1QSN A;  2ZW5 A;  5J8F A;  3G3S A;  2CNS A;  2O28 A;  4GS4 A;  5IB0 A;  2PRB A;  3DR6 A;  2K5T A;  5A28 A;  2FCK A;  4PV6 A;  2Z3M A;  2J8R A;  1LRZ A;  4E0A A;  3IWG A;  3PP9 A;  2P6E A;  5DWM A;  1S3Z A;  2ZW4 A;  3LOD A;  4B11 A;  4A31 A;  5KTD A;  1N71 A;  2OB0 A;  4IF5 A;  5DWN A;  4KLV A;  1FY7 A;  4JXR A;  4A30 A;  1KUV A;  4KOW A;  4MI4 A;  5F47 A;  5GCN A;  3QAH A;  5AG5 A;  4MFQ A;  2D4O A;  2GE3 A;  4KOR A;  2QEC A;  3R96 A;  4QBJ A;  4A32 A;  4U5Y A;  2P6G A;  3GYA A;  3R1K A;  4L8A A;  1YGH A;  3TO9 A;  2B5G A;  3SXO A;  1RO5 A;  2X7B A;  4XPL A;  2VXK A;  5BWA B;  1B6B A;  4OLL A;  3FYN A;  4C7I A;  1I1D A;  5AG6 A;  2Q0Y A;  1B87 A;  1J4J A;  3FBU A;  5H84 A;  3S6K A;  3S6H A;  4CAV A;  2B4B A;  4XPD C;  1OZP A;  4AVB A;  3W6S A;  5HH1 A;  4II9 A;  4CAX A;  4NF1 A;  4UA3 A;  5J8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...