1Y9WA

Structural genomics, 1.9a crystal structure of an acetyltransferase from bacillus cereus atcc 14579
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
140
structure length
140
Chain Sequence
MYMKHIENGTRIEGEYIKNKVIQYNMSILTDEVKQPMEEVSLVVKNEEGKIFGGVTGTMYFYHLHIDFLWVDESVRHDGYGSQLLHEIEGIAKEKGCRLILLDSFSFQAPEFYKKHGYREYGVVEDHPKGHSQHFFEKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyltransferase
publication title 1.9A crystal structure of an acetyltransferase from Bacillus cereus ATCC 14579
rcsb
source organism Bacillus cereus
molecule tags Transferase
total genus 36
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1y9wA01
1QSNA 4QVTA 1CM0A 4IUSA 3ZZIA 1MJ9A 4AG9A 3S6FA 2B5GA 4J3GA 2OH1A 4UWIA 3D3SA 4PSWA 4CAWA 5KTDA 2Q4YA 1BOBA 3EXNA 2R8VA 4X5KA 2Y0MA 2FS5A 4NCZA 4FD7A 4R87A 4NXYA 4F0YA 3IWGA 5F49A 3TFYA 1RXTA 3R96A 4R3LA 4HNXB 3PP9A 2X7BA 3DNSA 3FXTA 4LX9A 1YGHA 4H6ZA 4EVYA 2Q04A 2PRBA 2CNTA 2FSRA 3R9EA 2FT0A 4FD6A 2P0WA 2PC1A 4JXQA 3RYOA 3BJ8A 2AE6A 2OZGA 2B4DB 4AB7A 4H89A 2PQ8A 4U9YA 5ISVA 2ZW6A 4MI4A 2P6GA 4MY3A 1B6BA 1J4JA 1PU9A 2ZXVA 4R9MA 3CXSA 1N71A 5CNPA 5KTAA 3SXOA 3D2MA 4NSQA 4F6AA 1Z4EA 4OADA 1YLEA 2WPWA 3B8GA 2G3TA 3SHPA 2ZW7A 2VZYA 2QIRA 4M3SA 1OZPA 3GKRA 5EC4A 3S6HA 1XEBA 3QAHA 5H84A 2NMTA 5C88A 3F8KA 4HNWB 2REFA 4PV6A 2J8NA 3H4QA 5DWMA 1KUXA 5I0CA 3SXNA 1S60A 3FB3A 4L8AA 3OWCA 3VWDA 5C82A 2PDOA 2EUIA 1Y9WA 1NSLA 4KLVA 3NE7A 4YFJA 3W6XA 2BL1A 4Y49C 2FXFA 1ON0A 1I1DA 4KLWA 1XIXA 1QSTA 2Z10A 2PR1A 3C26A 2B3VA 2WPXA 2J8MA 2B58A 4CS0B 2OB0A 2IL4A 4AVAA 1PUAA 4KOVA 4RS2A 4FD5A 4XPDB 4BMHA 2J8RA 2GANA 1MJBA 1Q2DA 4U5YA 3JUWA 1WWZA 2A4NA 4UWJA 4ONUA 1XF8A 4XNHB 2Q4VA 1IIDA 4NEXA 2H5MA 4YRHA 5F48A 5DWNA 2CNMA 3JVNA 1MJAA 1I12A 2JLMA 2VBQA 4PK2A 4JWPA 4MJ8A 4KOTA 3PZJA 2ATRA 5IX3A 2P6EA 4UBRA 1SQHA 4B5PA 2Q0YA 4ZBGA 4KVXA 1IYKA 2ZPAA 1WK4A 2HUZA 2OZUA 2D4PA 3W6SA 3P2FA 1I21A 1P0HA 4QC6A 2G3AA 2I79A 3CXPA 2OU2A 2BSWA 1XMTA 3LODA 4AVCA 1Z4RA 3QB8A 5JPHA 4OAEA 4R3KA 2EVNA 5H86A 1VKCA 4M85A 1M1DA 1S7KA 2FIAA 4E2AA 4AG7A 2Z11A 3UY5A 4GS4A 4JD6A 4B5OA 2O28A 1S3ZA 4R57A 2I00A 3ZJ0A 4JJXA 2ZW5A 4KOXA 5FVJA 4CRYB 3I9SA 5JQ4A 3D2PA 1Y7RA 1KZFA 3TOAA 4MHDA 1IB1E 3TTHA 2RC4A 3FRMA 2KCWA 1TIQA 2B5GB 3DDDA 1R57A 1Y9KA 1B87A 3EY5A 3R9GA 4XPKA 1YVOA 4KOYA 1S7NA 2VQYA 2B4DA 2DXQA 2GE3A 4OLLA 5IB0A 3DR6A 4QUSA 5J8FA 4JXRA 5F47A 1IICA 4HKFA 3WR7A 3S6KA 1S5KA 1Z9UA 1S7FA 3T90A 1LRZA 2PR8A 2HQYA 4PSXA 3G3SA 3GYAA 2VZZA 1VHSA 3D8PA 4KUBA 2Q7BA 2GIVA 4QB9A 3F5BA 4NF1A 2FIWA 3S6GA 2B4BA 1Q2YA 5J8CA 3G8WA 1M4IA 2R98A 4KOWA 4KOSA 4KVOE 1IYLA 4XPDC 1MK4A 3TO7A 3TO6A 3EC4A 3BLNA 2Z0ZA 1S7LA 3VWEA 2ARHA 2JEVA 5KTCA 3P2HA 2R7HA 4XNHC 5IV0A 3LD2A 3R1KA 3V8IA 4KUAA 3N7ZA 3T9YA 3IGRA 3K9UA 3I3GA 2Q44A 2VI7A 4DNCA 2JDDA 4KZTA 1CJWA 1Q2CA 1UFHA 4AVBA 1KUYA 5EBVA 1GHEA 4U9ZA 2PSWA 4L89A 3PGPA 1P4NA 1K4JA 1QSRA 3E0KA 1V0CA 4E8OA 1YVKA 1YK3A 2FCKA 3EFAA 4ORFA 3W91A 2QECA 4II9A 3FIXA 4K30A 3DR8A 1YR0A 1XE4A 2VEZA 4FD4A 4QBJA 2F5IA 4CAVA 5HH1A 3FNCA 5E96A 3EO4A 2QMLA 2B3UA 3DSBA 4KORA 4H6UA 1QSMA 4IF5A 3BJ7A 2D4OA 2BEIA 3CXQA 3FBUA 4KVME 2CY2A 1BO4A 3F0AA 4CAXA 4CRZB 2G0BA 1L0CA 2AJ6A 4MY0A 2FE7A 4I49A 4JLYA 4MBUA 4PK3A 4YGOA 2FL4A 4XPLA 2ZW4A 2REEA 1RO5A 3TCVA 2K5TA 2CNSA 4E0AA 2HV2A 1M44A 3KKWA 3GY9A 1U6MA 1NMTA 3TOBA 5GCNA 2P6FA 4KOUA 4Y49B 2JDCA 1QSOA 3FYNA 4RI1A 2BUEA 1M4GA 2OZHA 3TT2A 2R1IA 1YREA 1KUVA 1YX0A 4B5PB 2C27A 5HMNA 4UA3A 3TE4A 2VXKA 1M4DA 5F46A 4LUAA 3R9FA 4HNYB 3MGDA 3R95A 1NE9A 3TO9A 1FY7A
chains in the Genus database with same CATH superfamily
3SI1A 3NH4A 1QSNA 3KGQA 2AFOA 2Q7SA 4QVTA 5HVGA 1CM0A 3LMSA 4IUSA 4P4FA 3VATA 3V7ZA 4B14A 1XJOA 3ZZIA 1MJ9A 4AG9A 4PPZA 3S6FA 4B6ZA 3DGVA 2ZEEA 2B5GA 4ZY2A 4J3GA 2DPSA 3DLJA 2OH1A 1R3NA 4UWIA 3FEDA 4A39A 2PJ4A 3D3SA 1ZG7A 1KWMA 3HUVA 4PSWA 4CAWA 2CF4A 2G9DA 5KTDA 1YQEA 4CGNA 2Q4YA 2CXAA 2PRQA 1BOBA 3EXNA 4A38A 2EO8A 1A2ZA 2R8VA 2PCUA 4FAIA 4MCQA 4X5KA 4UCNA 2DPTA 1BPMA 1XFOA 4OC0A 2Y0MA 2FS5A 1Z5RA 4FD7A 4NCZA 4R87A 4NXYA 5HVFA 4F0YA 4UIAA 3IWGA 4PQAA 5F49A 3NH5A 4BBHA 1F2PA 3TFYA 3S9NA 1RXTA 3R96A 1LFWA 1TXRA 4NJRA 2Z3NA 1Y0RA 2BCOA 4R3LA 4HNXB 4MMOA 2YNEA 3PP9A 5I4MA 2X7BA 3DNSA 3FXTA 4LX9A 4PXCA 3IWWA 1YGHA 4H6ZA 4EVYA 2Q04A 1LOKA 3FEEA 4B10A 2PRBA 1TF8A 4P4JA 2CNTA 5LRJA 4C68A 4ZX9A 2Z3LA 4R7MA 2FSRA 3R9EA 3WC6A 2FT0A 1FT7A 1QQ9A 4PXEA 4A95A 4FD6A 4EWTA 2J9AA 2P0WA 1IY7A 3FMCA 4O23A 2EWBA 2PC1A 4UEZA 4JXQA 3GUXA 3RYOA 4B13A 3BJ8A 2AE6A 1LANA 2OZGA 3TC8A 4MRIA 4FBEA 2B4DB 2ZEMA 4AB7A 5EMIA 3IU1A 4H89A 5D8NA 3PBBA 2PQ8A 3IJ3A 4U9YA 5ISVA 2ZW6A 4MI4A 3I1UA 3WC5A 2P6GA 3BXMA 4MY3A 4Q38A 1B6BA 1J4JA 3FX6A 3NA6A 2EBJA 1PU9A 2ZXVA 4R9MA 3CXSA 1N71A 3KR5A 5CNPA 5JGFA 5KTAA 1UWYA 4F9VA 3SXOA 5HXDA 3D2MA 4NSQA 4YWYA 4F6AA 1BLLE 1Z4EA 4FUUA 4OADA 1LAMA 1YLEA 2WPWA 4MXUA 4A2ZA 3GIUA 5CBMA 2IMOA 3B8GA 2G3TA 3SHPA 2ZW7A 4Q7AA 3T8WA 4A37A 2VZYA 1TKHA 2QIRA 5CPAA 3D7DA 3IIBA 3SJFA 4CGLA 4M3SA 1OZPA 2C6PA 3GKRA 1BAVA 2V8DA 5EC4A 1XEBA 3S6HA 4B11A 3QAHA 5AG5A 5H84A 4C2YA 4UFXA 4CGMA 4MHPA 4ZGYB 4CYNA 3B2YA 3D68A 2NMTA 3CPXA 3KR4A 2GLFA 5C88A 3PRTA 3F8KA 3B3TA 1CG2A 3NH8A 2REFA 2JEWA 4HNWB 4WWVA 1Z8LA 4PV6A 4ZY1A 2J8NA 4OC3A 3H4QA 5DWMA 5AG6A 2RB7A 1TF9A 4R6TA 3TX8A 4UCMA 2WSAA 3IFEA 4OKOA 4CYPA 1KUXA 4OIWA 5I0CA 3SXNA 1S60A 2PJ7A 3FB3A 1X12A 4L8AA 1LAPA 1ZO0A 3OWCA 2PJBA 2PJ9A 3B3WA 3VWDA 4OC5A 5C82A 3KQZA 2PJ0A 2PDOA 2AFUA 2EUIA 1Y9WA 1NSLA 4KLVA 3B3SA 3NE7A 2AFSA 5THWA 3W6XA 2ANPA 2BL1A 2PE3A 2V8VA 4YFJA 2PJ3A 2FXFA 4PXBA 2O4HA 4Y49C 1ON0A 3RBUA 1I1DA 4KLWA 3CPAA 1XIXA 1ELLP 4P44A 4EFDA 3PEIA 1QSTA 2VL1A 2GLJA 2Z10A 2PR1A 3C26A 2B3VA 3B3VA 3JTKA 2WPXA 2J8MA 3RO0A 4ZYQA 2B58A 1CX8A 4NFRA 5JH9A 3IWEA 3D67A 3FF3A 3RNZA 4CS0B 2OB0A 2IL4A 2YGWA 4AVAA 1PUAA 4KOVA 4RS2A 4WJBA 2PIZA 2HB6A 4FD5A 4MCSA 4XPDB 4BMHA 5ELYA 1VIXA 2Z3MA 3PB8X 4NGRA 2J8RA 2GANA 4DJLA 1MJBA 1YLOA 2F7VA 1Q2DA 4U5YA 2Z3OA 2FVGA 1VHOA 1M4LA 1WWZA 3JUWA 2GU2A 6CPAA 3LACA 2A4NA 4UWJA 4ONUA 5LYFA 1XF8A 4XNHB 2Q4VA 3B7IA 3B3CA 1XMBA 1IIDA 1H8LA 3L2NA 4UCPA 4NEXA 2H5MA 5AG7A 2WYRA 4P4IA 4EMEA 1HDUA 4YRHA 5F48A 5DWNA 2CNMA 3FVLA 2NYQA 3JVNA 2GREA 1MJAA 1I12A 3QAYA 3SJXA 2Q4ZA 2JLMA 2VBQA 4MFQA 5K8NA 1XOVA 4PK2A 2GFQA 4JWPA 4CYQA 4MJ8A 2C6CA 4KOTA 3PZJA 2ATRA 5IX3A 2P6EA 4UBRA 1SQHA 4B5PA 2Q0YA 4ZBGA 4KVXA 1IYKA 2ZPAA 5A27A 3PFOA 4ZX8A 1WK4A 2AFWA 2HUZA 2OZUA 2D4PA 3GLJA 3VH9A 2PJ1A 4CAFA 3W6SA 3IEHA 4JYWA 2CIJA 3PFEA 3KL9A 1I21A 2ABZA 2QJ8A 3P2FA 1P0HA 4HPSA 2F8HA 4H2KA 4QC6A 2BOAA 2IQ6A 2ZOFA 5G1ZA 2G3AA 2Z3PA 4UEEA 2I79A 4RN7A 4C7HA 4A31A 4W9YA 3KHZA 3CXPA 2OU2A 2ZEOA 3A9LA 3B35A 4M6GA 4Z65A 3JRUA 2BSWA 1XMTA 4CYOA 3LODA 2CTCA 2PJCA 1CPSA 4AVCA 3SI0A 2ODFA 5LYIA 1Z4RA 3QB8A 5JPHA 4OAEA 1VHEA 4JZ0A 4K3NA 1Z8WA 4R3KA 2EVNA 5LYLA 2XEIA 1YMEA 3D66A 5H86A 1VKCA 4M85A 3CDXA 1Y7EA 1M1DA 4GXHA 1S7KA 2FIAA 4E2AA 4F8ZA 3BHXA 3D4UA 4AG7A 4DUKA 1PCAA 2Z11A 3UY5A 1AMPA 4GS4A 1CP6A 4LQ6A 2C6GA 2XEGA 5LRGA 4JD6A 4B5OA 2PVVA 2O28A 1S3ZA 2ZELA 2I00A 4R57A 1R43A 3ZJ0A 4JJXA 2ZW5A 4KOXA 4ONWA 5G22A 5FVJA 4CRYB 5K8PA 3SJGA 3I9SA 5JQ4A 3D2PA 4NGPA 1ELMP 1Y7RA 3QNVA 3NFZA 1ZG8A 1KZFA 3K9TA 3NE8A 3TOAA 4MHDA 1IB1E 3TTHA 2RC4A 3FRMA 2KCWA 3KI9A 4Q36A 3HLPA 4CGPA 1BPNA 4KSIA 1TIQA 1LCPA 2ZEFA 4MCRA 1QMUA 1Z8TA 2B5GB 2Q43A 3DDDA 1IOIA 1R57A 2ZEHA 1YW4A 1Y9KA 3KHXA 4B12A 2HC9A 1B87A 2Z3KA 3EY5A 3GB0A 4X3RA 3R9GA 5BWAB 4XPKA 4OC4A 3FH4A 2EK8A 4CPAA 1YSJA 1YVOA 4KOYA 1S7NA 4CGOA 3PB9X 2VQYA 1TKFA 2B4DA 2DXQA 2GE3A 3D7HA 4OLLA 4A94A 5IB0A 5K8OA 3DR6A 3H8EA 4QUSA 5J8FA 5G21A 4JXRA 5F47A 1IICA 1PYTB 1EE3P 4HKFA 4RUHA 3WR7A 4MHZA 4P10A 4NGTA 1ZG9A 2AFXA 1S5KA 1Z9UA 3KZWA 3S6KA 1S7FA 3T90A 3IC1A 1CPXA 1F2OA 1LRZA 3ISXA 3WC7A 4OC1A 2PR8A 5AGEA 4MFPA 1ZLHA 2HQYA 3LWUA 4PSXA 2NSMA 3G3SA 3GYAA 2VZZA 1VHSA 3D8PA 4KUBA 2Q7BA 5LRKA 5A28A 2GIVA 4QB9A 3F5BA 4OP4A 4NF1A 2FIWA 3S6GA 2B4BA 1Q2YA 7CPAA 5K8MA 4UEFA 4X2TA 2O53A 5J8CA 1GYTA 3KQXA 3S9MA 3G8WA 4KSAA 1M4IA 2R98A 4NJQA 1DTDA 4KOWA 4FWUA 4KOSA 2ZENA 4KVOE 1IYLA 1DE4C 3RZAA 5IB9A 3ISZA 4XPDC 1MK4A 4KSFA 4P6YA 2OOTA 3EC4A 3TO7A 3TO6A 3BLNA 3VARA 4MHYA 2V8HA 1S7LA 1Z8XA 2Z0ZA 4UFVA 5LYDA 3VWEA 2ARHA 2JEVA 5KTCA 4P4EA 3P2HA 3SJEA 3H8GA 2R7HA 4R8FA 4XNHC 3LD2A 5IV0A 3R1KA 2XEJA 3V8IA 2YNCA 4KUAA 3N7ZA 3T9YA 2PIYA 2WUUA 2CTBA 4A33A 1ZLIA 3IGRA 3RAMA 3K9UA 3I3GA 4GM5A 4IHMA 3WT4A 2JBKA 4MFKA 4MFLA 1NSAA 4X8IA 4MCPA 2Q44A 2AFMA 2VI7A 3IU2A 4KS9A 2WZNA 4BD9A 4DNCA 2JDDA 4KZTA 1AYEA 1CJWA 4TWEA 1Q2CA 1UFHA 2PJ8A 4UFWA 4IK2A 4AVBA 1KUYA 2RFHA 3KASA 3BI1A 3D7FA 5EBVA 1GHEA 4R76A 3CT9A 2I3CA 4U9ZA 4A32A 5HVHA 2PJ2A 4OC2A 2PSWA 4L89A 4M6IA 3BI0A 3PGPA 4C2ZA 1P4NA 1OBRA 4A30A 1K4JA 1QSRA 3E0KA 2ZEDA 4MFZA 1CP7A 1V0CA 3H8FA 3PBEA 4TNUA 4E8OA 2YNDA 1YVKA 5AG4A 1IOFA 1YK3A 2FCKA 3EFAA 3IO1A 4ORFA 3W91A 2QECA 4II9A 3FIXA 4K30A 2QVPA 1F57A 2PJ6A 3DR8A 1YR0A 3FECA 1JWQA 1XE4A 2VEZA 5J1QA 4M6HA 4FD4A 5D29A 4QBJA 2F5IA 5JM6A 2EK9A 1ARLA 2V77A 2OR4A 4CAVA 2V8GA 5HH1A 4ZI6A 2POKA 3FNCA 5E96A 3EO4A 1X10A 2QMLA 5DS0A 2B3UA 3DSBA 4KORA 1RTQA 4C2XA 4H6UA 1QSMA 4IF5A 1AUGA 4UIBA 3BJ7A 2D4OA 2BEIA 3CXQA 5F09A 3FBUA 4KVME 4NGSA 2CY2A 2DF5A 1XRYA 4CAEA 1BO4A 3F0AA 4OIDA 4BINA 4CAXA 3SI2A 4CRZB 2G0BA 1L0CA 2AJ6A 3V38A 4MY0A 4P4BA 2FE7A 4G1PA 4MFJA 4I49A 2IJZA 1IU8A 3PB6X 1Q7LA 4F0XA 2ZEGA 2AFZA 4JLYA 4MBUA 3FJUA 4LQGA 4PK3A 4YGOA 2FL4A 4NGQA 1CBXA 1TKJA 2QYVA 3MN8A 4P4DA 4XPLA 2ZOGA 2ZW4A 2REEA 3K2KA 1RO5A 3H5ZA 2JBJA 2BO9A 2K5TA 4IAVA 3TCVA 4AXVA 2CNSA 4E0AA 2Q51A 3D7GA 2HV2A 4C7IA 1IGBA 1M44A 2PJAA 3KKWA 4ZY0A 4UF4A 3GY9A 2C1CA 5G20A 1U6MA 1NMTA 1Z2LA 3TOBA 5GCNA 4MHNA 2P6FA 4KOUA 4Y49B 8CPAA 2JDCA 1QSOA 1XBUA 3FYNA 1JQGA 4NGMA 3N5FA 1HEEA 2ZEPA 1VGYA 4RI1A 3S9LA 3PB4X 1Y0YA 2PVWA 4OMEA 2DEAA 2PJ5A 2YNCC 2BUEA 1M4GA 2OZHA 1ARMA 3TT2A 2R1IA 1YREA 1FNOA 1KUVA 1YW6A 2XEFA 4PXDA 1YX0A 3CZXA 4B5PB 2C27A 3MRUA 4UA3A 3WABA 4DYOA 2VXKA 5HMNA 3TE4A 4F9UA 1M4DA 5F46A 4LUAA 3R9FA 4HNYB 4YU9A 3MGDA 3PB7X 3R95A 1NE9A 4NGNA 4P45A 3TO9A 1FY7A 1HDQA
chains in the Genus database with same CATH topology
1QSNA 4QVTA 1CM0A 4IUSA 4B14A 3ZZIA 1MJ9A 4AG9A 3S6FA 2B5GA 4J3GA 2DPSA 2OH1A 4UWIA 3D3SA 4PSWA 4CAWA 5KTDA 4CGNA 2Q4YA 2CXAA 1BOBA 3EXNA 2R8VA 4X5KA 4UCNA 2DPTA 2Y0MA 2FS5A 4NCZA 4FD7A 4R87A 4NXYA 4F0YA 3IWGA 5F49A 4BBHA 3TFYA 1RXTA 3R96A 2Z3NA 4R3LA 4HNXB 2YNEA 3PP9A 2X7BA 3DNSA 3FXTA 4LX9A 1YGHA 4H6ZA 4EVYA 2Q04A 4B10A 2PRBA 2CNTA 4C68A 2Z3LA 2FSRA 3R9EA 2FT0A 4A95A 4FD6A 2P0WA 2PC1A 4JXQA 3RYOA 4B13A 3BJ8A 2AE6A 2OZGA 2B4DB 4AB7A 3IU1A 4H89A 2PQ8A 4U9YA 5ISVA 2ZW6A 4MI4A 2P6GA 4MY3A 4Q38A 1B6BA 1J4JA 1PU9A 2ZXVA 4R9MA 3CXSA 1N71A 5CNPA 5KTAA 3SXOA 3D2MA 4NSQA 4F6AA 1Z4EA 4OADA 4A2ZA 1YLEA 2WPWA 3B8GA 2G3TA 3SHPA 2ZW7A 2VZYA 2QIRA 4CGLA 4M3SA 1OZPA 3GKRA 5EC4A 3S6HA 1XEBA 4B11A 4C2YA 3QAHA 5AG5A 5H84A 4ZGYB 4UFXA 4CGMA 4CYNA 2NMTA 5C88A 3F8KA 4HNWB 2REFA 4PV6A 2J8NA 3H4QA 5DWMA 5AG6A 4UCMA 2WSAA 4CYPA 1KUXA 5I0CA 3SXNA 1S60A 3FB3A 4L8AA 1ZO0A 3OWCA 3VWDA 5C82A 2PDOA 2EUIA 1Y9WA 1NSLA 4KLVA 3NE7A 4YFJA 3W6XA 2BL1A 4Y49C 2FXFA 1ON0A 1I1DA 4KLWA 1XIXA 1QSTA 2Z10A 2PR1A 3C26A 2B3VA 3JTKA 2WPXA 2J8MA 2B58A 3IWEA 4CS0B 2OB0A 2IL4A 2YGWA 4AVAA 1PUAA 4KOVA 4RS2A 4FD5A 4XPDB 4BMHA 2Z3MA 2J8RA 2GANA 1MJBA 1Q2DA 4U5YA 2Z3OA 3JUWA 1WWZA 2A4NA 4UWJA 4ONUA 1XF8A 4XNHB 2Q4VA 1IIDA 4UCPA 4NEXA 2H5MA 5AG7A 4YRHA 5F48A 5DWNA 2CNMA 3JVNA 1MJAA 1I12A 2JLMA 2VBQA 4MFQA 4PK2A 4JWPA 4CYQA 4MJ8A 4KOTA 3PZJA 2ATRA 5IX3A 2P6EA 4UBRA 1SQHA 4B5PA 2Q0YA 4ZBGA 4KVXA 1IYKA 2ZPAA 5A27A 1WK4A 4CAFA 2HUZA 2OZUA 2D4PA 3W6SA 3P2FA 1I21A 1P0HA 4QC6A 5G1ZA 2G3AA 2Z3PA 2I79A 4C7HA 4A31A 3CXPA 2OU2A 3A9LA 2BSWA 1XMTA 4CYOA 3LODA 4AVCA 1Z4RA 3QB8A 5JPHA 4OAEA 4R3KA 2EVNA 5H86A 1VKCA 4M85A 1M1DA 1S7KA 2FIAA 4E2AA 4AG7A 2Z11A 3UY5A 4GS4A 4JD6A 4B5OA 2O28A 1S3ZA 4R57A 2I00A 3ZJ0A 4JJXA 2ZW5A 4KOXA 5G22A 5FVJA 4CRYB 3I9SA 5JQ4A 3D2PA 1Y7RA 1KZFA 3TOAA 4MHDA 1IB1E 3TTHA 2RC4A 3FRMA 2KCWA 4Q36A 4CGPA 1TIQA 2B5GB 3DDDA 1R57A 1Y9KA 4B12A 1B87A 2Z3KA 3EY5A 3R9GA 5BWAB 4XPKA 1YVOA 4KOYA 1S7NA 4CGOA 2VQYA 2B4DA 2DXQA 2GE3A 4OLLA 5IB0A 3DR6A 4QUSA 5J8FA 5G21A 4JXRA 5F47A 1IICA 4HKFA 3WR7A 3S6KA 1S5KA 1Z9UA 1S7FA 3T90A 1LRZA 2PR8A 5AGEA 4MFPA 2HQYA 4PSXA 3G3SA 3GYAA 2VZZA 1VHSA 3D8PA 4KUBA 2Q7BA 5A28A 2GIVA 4QB9A 3F5BA 4NF1A 2FIWA 3S6GA 2B4BA 1Q2YA 5J8CA 3G8WA 4KSAA 1M4IA 2R98A 4KOWA 4KOSA 4KVOE 1IYLA 4XPDC 1MK4A 4KSFA 3TO7A 3TO6A 3EC4A 3BLNA 2Z0ZA 1S7LA 4UFVA 3VWEA 2ARHA 2JEVA 5KTCA 3P2HA 2R7HA 4XNHC 5IV0A 3LD2A 3R1KA 3V8IA 2YNCA 4KUAA 3N7ZA 3T9YA 2WUUA 4A33A 3IGRA 3K9UA 3I3GA 4MFKA 4MFLA 2Q44A 2VI7A 3IU2A 4KS9A 4DNCA 2JDDA 4KZTA 1CJWA 1Q2CA 1UFHA 4UFWA 4AVBA 1KUYA 5EBVA 1GHEA 4U9ZA 4A32A 2PSWA 4L89A 3PGPA 4C2ZA 1P4NA 4A30A 1K4JA 1QSRA 3E0KA 4MFZA 1V0CA 4E8OA 2YNDA 1YVKA 5AG4A 1YK3A 2FCKA 3EFAA 4ORFA 3W91A 2QECA 4II9A 3FIXA 4K30A 3DR8A 1YR0A 1XE4A 2VEZA 4FD4A 4QBJA 2F5IA 4CAVA 5HH1A 3FNCA 5E96A 3EO4A 2QMLA 2B3UA 3DSBA 4KORA 4C2XA 4H6UA 1QSMA 4IF5A 3BJ7A 2D4OA 2BEIA 3CXQA 3FBUA 4KVME 2CY2A 4CAEA 1BO4A 3F0AA 4CAXA 4CRZB 2G0BA 1L0CA 2AJ6A 4MY0A 2FE7A 4MFJA 4I49A 4F0XA 4JLYA 4MBUA 4PK3A 4YGOA 2FL4A 4XPLA 2ZW4A 2REEA 1RO5A 3H5ZA 3TCVA 2K5TA 2CNSA 4E0AA 4C7IA 2HV2A 1M44A 3KKWA 3GY9A 5G20A 1U6MA 1NMTA 3TOBA 5GCNA 2P6FA 4KOUA 4Y49B 2JDCA 1QSOA 3FYNA 4RI1A 2YNCC 2BUEA 1M4GA 2OZHA 3TT2A 2R1IA 1YREA 1KUVA 1YX0A 4B5PB 2C27A 5HMNA 4UA3A 3TE4A 2VXKA 1M4DA 5F46A 4LUAA 3R9FA 4HNYB 3MGDA 3R95A 1NE9A 3TO9A 1FY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QSN A;  4QVT A;  1CM0 A;  4IUS A;  3ZZI A;  1MJ9 A;  4AG9 A;  3S6F A;  2B5G A;  4J3G A;  2OH1 A;  4UWI A;  3D3S A;  4PSW A;  4CAW A;  5KTD A;  2Q4Y A;  1BOB A;  3EXN A;  2R8V A;  4X5K A;  2Y0M A;  2FS5 A;  4NCZ A;  4FD7 A;  4R87 A;  4NXY A;  4F0Y A;  3IWG A;  5F49 A;  3TFY A;  1RXT A;  3R96 A;  4R3L A;  4HNX B;  3PP9 A;  2X7B A;  3DNS A;  3FXT A;  4LX9 A;  1YGH A;  4H6Z A;  4EVY A;  2Q04 A;  2PRB A;  2CNT A;  2FSR A;  3R9E A;  2FT0 A;  4FD6 A;  2P0W A;  2PC1 A;  4JXQ A;  3RYO A;  3BJ8 A;  2AE6 A;  2OZG A;  2B4D B;  4AB7 A;  4H89 A;  2PQ8 A;  4U9Y A;  5ISV A;  2ZW6 A;  4MI4 A;  2P6G A;  4MY3 A;  1B6B A;  1J4J A;  1PU9 A;  2ZXV A;  4R9M A;  3CXS A;  1N71 A;  5CNP A;  5KTA A;  3SXO A;  3D2M A;  4NSQ A;  4F6A A;  1Z4E A;  4OAD A;  1YLE A;  2WPW A;  3B8G A;  2G3T A;  3SHP A;  2ZW7 A;  2VZY A;  2QIR A;  4M3S A;  1OZP A;  3GKR A;  5EC4 A;  3S6H A;  1XEB A;  3QAH A;  5H84 A;  2NMT A;  5C88 A;  3F8K A;  4HNW B;  2REF A;  4PV6 A;  2J8N A;  3H4Q A;  5DWM A;  1KUX A;  5I0C A;  3SXN A;  1S60 A;  3FB3 A;  4L8A A;  3OWC A;  3VWD A;  5C82 A;  2PDO A;  2EUI A;  1Y9W A;  1NSL A;  4KLV A;  3NE7 A;  4YFJ A;  3W6X A;  2BL1 A;  4Y49 C;  2FXF A;  1ON0 A;  1I1D A;  4KLW A;  1XIX A;  1QST A;  2Z10 A;  2PR1 A;  3C26 A;  2B3V A;  2WPX A;  2J8M A;  2B58 A;  4CS0 B;  2OB0 A;  2IL4 A;  4AVA A;  1PUA A;  4KOV A;  4RS2 A;  4FD5 A;  4XPD B;  4BMH A;  2J8R A;  2GAN A;  1MJB A;  1Q2D A;  4U5Y A;  3JUW A;  1WWZ A;  2A4N A;  4UWJ A;  4ONU A;  1XF8 A;  4XNH B;  2Q4V A;  1IID A;  4NEX A;  2H5M A;  4YRH A;  5F48 A;  5DWN A;  2CNM A;  3JVN A;  1MJA A;  1I12 A;  2JLM A;  2VBQ A;  4PK2 A;  4JWP A;  4MJ8 A;  4KOT A;  3PZJ A;  2ATR A;  5IX3 A;  2P6E A;  4UBR A;  1SQH A;  4B5P A;  2Q0Y A;  4ZBG A;  4KVX A;  1IYK A;  2ZPA A;  1WK4 A;  2HUZ A;  2OZU A;  2D4P A;  3W6S A;  3P2F A;  1I21 A;  1P0H A;  4QC6 A;  2G3A A;  2I79 A;  3CXP A;  2OU2 A;  2BSW A;  1XMT A;  3LOD A;  4AVC A;  1Z4R A;  3QB8 A;  5JPH A;  4OAE A;  4R3K A;  2EVN A;  5H86 A;  1VKC A;  4M85 A;  1M1D A;  1S7K A;  2FIA A;  4E2A A;  4AG7 A;  2Z11 A;  3UY5 A;  4GS4 A;  4JD6 A;  4B5O A;  2O28 A;  1S3Z A;  4R57 A;  2I00 A;  3ZJ0 A;  4JJX A;  2ZW5 A;  4KOX A;  5FVJ A;  4CRY B;  3I9S A;  5JQ4 A;  3D2P A;  1Y7R A;  1KZF A;  3TOA A;  4MHD A;  1IB1 E;  3TTH A;  2RC4 A;  3FRM A;  2KCW A;  1TIQ A;  2B5G B;  3DDD A;  1R57 A;  1Y9K A;  1B87 A;  3EY5 A;  3R9G A;  4XPK A;  1YVO A;  4KOY A;  1S7N A;  2VQY A;  2B4D A;  2DXQ A;  2GE3 A;  4OLL A;  5IB0 A;  3DR6 A;  4QUS A;  5J8F A;  4JXR A;  5F47 A;  1IIC A;  4HKF A;  3WR7 A;  3S6K A;  1S5K A;  1Z9U A;  1S7F A;  3T90 A;  1LRZ A;  2PR8 A;  2HQY A;  4PSX A;  3G3S A;  3GYA A;  2VZZ A;  1VHS A;  3D8P A;  4KUB A;  2Q7B A;  2GIV A;  4QB9 A;  3F5B A;  4NF1 A;  2FIW A;  3S6G A;  2B4B A;  1Q2Y A;  5J8C A;  3G8W A;  1M4I A;  2R98 A;  4KOW A;  4KOS A;  4KVO E;  1IYL A;  4XPD C;  1MK4 A;  3TO7 A;  3TO6 A;  3EC4 A;  3BLN A;  2Z0Z A;  1S7L A;  3VWE A;  2ARH A;  2JEV A;  5KTC A;  3P2H A;  2R7H A;  4XNH C;  5IV0 A;  3LD2 A;  3R1K A;  3V8I A;  4KUA A;  3N7Z A;  3T9Y A;  3IGR A;  3K9U A;  3I3G A;  2Q44 A;  2VI7 A;  4DNC A;  2JDD A;  4KZT A;  1CJW A;  1Q2C A;  1UFH A;  4AVB A;  1KUY A;  5EBV A;  1GHE A;  4U9Z A;  2PSW A;  4L89 A;  3PGP A;  1P4N A;  1K4J A;  1QSR A;  3E0K A;  1V0C A;  4E8O A;  1YVK A;  1YK3 A;  2FCK A;  3EFA A;  4ORF A;  3W91 A;  2QEC A;  4II9 A;  3FIX A;  4K30 A;  3DR8 A;  1YR0 A;  1XE4 A;  2VEZ A;  4FD4 A;  4QBJ A;  2F5I A;  4CAV A;  5HH1 A;  3FNC A;  5E96 A;  3EO4 A;  2QML A;  2B3U A;  3DSB A;  4KOR A;  4H6U A;  1QSM A;  4IF5 A;  3BJ7 A;  2D4O A;  2BEI A;  3CXQ A;  3FBU A;  4KVM E;  2CY2 A;  1BO4 A;  3F0A A;  4CAX A;  4CRZ B;  2G0B A;  1L0C A;  2AJ6 A;  4MY0 A;  2FE7 A;  4I49 A;  4JLY A;  4MBU A;  4PK3 A;  4YGO A;  2FL4 A;  4XPL A;  2ZW4 A;  2REE A;  1RO5 A;  3TCV A;  2K5T A;  2CNS A;  4E0A A;  2HV2 A;  1M44 A;  3KKW A;  3GY9 A;  1U6M A;  1NMT A;  3TOB A;  5GCN A;  2P6F A;  4KOU A;  4Y49 B;  2JDC A;  1QSO A;  3FYN A;  4RI1 A;  2BUE A;  1M4G A;  2OZH A;  3TT2 A;  2R1I A;  1YRE A;  1KUV A;  1YX0 A;  4B5P B;  2C27 A;  5HMN A;  4UA3 A;  3TE4 A;  2VXK A;  1M4D A;  5F46 A;  4LUA A;  3R9F A;  4HNY B;  3MGD A;  3R95 A;  1NE9 A;  3TO9 A;  1FY7 A; 
#chains in the Genus database with same CATH topology
 3SI1 A;  3NH4 A;  1QSN A;  3KGQ A;  2AFO A;  2Q7S A;  4QVT A;  5HVG A;  1CM0 A;  3LMS A;  4IUS A;  4P4F A;  3VAT A;  3V7Z A;  4B14 A;  1XJO A;  3ZZI A;  1MJ9 A;  4AG9 A;  4PPZ A;  3S6F A;  4B6Z A;  3DGV A;  2ZEE A;  2B5G A;  4ZY2 A;  4J3G A;  2DPS A;  3DLJ A;  2OH1 A;  1R3N A;  4UWI A;  3FED A;  4A39 A;  2PJ4 A;  3D3S A;  1ZG7 A;  1KWM A;  3HUV A;  4PSW A;  4CAW A;  2CF4 A;  2G9D A;  5KTD A;  1YQE A;  4CGN A;  2Q4Y A;  2CXA A;  2PRQ A;  1BOB A;  3EXN A;  4A38 A;  2EO8 A;  1A2Z A;  2R8V A;  2PCU A;  4FAI A;  4MCQ A;  4X5K A;  4UCN A;  2DPT A;  1BPM A;  1XFO A;  4OC0 A;  2Y0M A;  2FS5 A;  1Z5R A;  4FD7 A;  4NCZ A;  4R87 A;  4NXY A;  5HVF A;  4F0Y A;  4UIA A;  3IWG A;  4PQA A;  5F49 A;  3NH5 A;  4BBH A;  1F2P A;  3TFY A;  3S9N A;  1RXT A;  3R96 A;  1LFW A;  1TXR A;  4NJR A;  2Z3N A;  1Y0R A;  2BCO A;  4R3L A;  4HNX B;  4MMO A;  2YNE A;  3PP9 A;  5I4M A;  2X7B A;  3DNS A;  3FXT A;  4LX9 A;  4PXC A;  3IWW A;  1YGH A;  4H6Z A;  4EVY A;  2Q04 A;  1LOK A;  3FEE A;  4B10 A;  2PRB A;  1TF8 A;  4P4J A;  2CNT A;  5LRJ A;  4C68 A;  4ZX9 A;  2Z3L A;  4R7M A;  2FSR A;  3R9E A;  3WC6 A;  2FT0 A;  1FT7 A;  1QQ9 A;  4PXE A;  4A95 A;  4FD6 A;  4EWT A;  2J9A A;  2P0W A;  1IY7 A;  3FMC A;  4O23 A;  2EWB A;  2PC1 A;  4UEZ A;  4JXQ A;  3GUX A;  3RYO A;  4B13 A;  3BJ8 A;  2AE6 A;  1LAN A;  2OZG A;  3TC8 A;  4MRI A;  4FBE A;  2B4D B;  2ZEM A;  4AB7 A;  5EMI A;  3IU1 A;  4H89 A;  5D8N A;  3PBB A;  2PQ8 A;  3IJ3 A;  4U9Y A;  5ISV A;  2ZW6 A;  4MI4 A;  3I1U A;  3WC5 A;  2P6G A;  3BXM A;  4MY3 A;  4Q38 A;  1B6B A;  1J4J A;  3FX6 A;  3NA6 A;  2EBJ A;  1PU9 A;  2ZXV A;  4R9M A;  3CXS A;  1N71 A;  3KR5 A;  5CNP A;  5JGF A;  5KTA A;  1UWY A;  4F9V A;  3SXO A;  5HXD A;  3D2M A;  4NSQ A;  4YWY A;  4F6A A;  1BLL E;  1Z4E A;  4FUU A;  4OAD A;  1LAM A;  1YLE A;  2WPW A;  4MXU A;  4A2Z A;  3GIU A;  5CBM A;  2IMO A;  3B8G A;  2G3T A;  3SHP A;  2ZW7 A;  4Q7A A;  3T8W A;  4A37 A;  2VZY A;  1TKH A;  2QIR A;  5CPA A;  3D7D A;  3IIB A;  3SJF A;  4CGL A;  4M3S A;  1OZP A;  2C6P A;  3GKR A;  1BAV A;  2V8D A;  5EC4 A;  1XEB A;  3S6H A;  4B11 A;  3QAH A;  5AG5 A;  5H84 A;  4C2Y A;  4UFX A;  4CGM A;  4MHP A;  4ZGY B;  4CYN A;  3B2Y A;  3D68 A;  2NMT A;  3CPX A;  3KR4 A;  2GLF A;  5C88 A;  3PRT A;  3F8K A;  3B3T A;  1CG2 A;  3NH8 A;  2REF A;  2JEW A;  4HNW B;  4WWV A;  1Z8L A;  4PV6 A;  4ZY1 A;  2J8N A;  4OC3 A;  3H4Q A;  5DWM A;  5AG6 A;  2RB7 A;  1TF9 A;  4R6T A;  3TX8 A;  4UCM A;  2WSA A;  3IFE A;  4OKO A;  4CYP A;  1KUX A;  4OIW A;  5I0C A;  3SXN A;  1S60 A;  2PJ7 A;  3FB3 A;  1X12 A;  4L8A A;  1LAP A;  1ZO0 A;  3OWC A;  2PJB A;  2PJ9 A;  3B3W A;  3VWD A;  4OC5 A;  5C82 A;  3KQZ A;  2PJ0 A;  2PDO A;  2AFU A;  2EUI A;  1Y9W A;  1NSL A;  4KLV A;  3B3S A;  3NE7 A;  2AFS A;  5THW A;  3W6X A;  2ANP A;  2BL1 A;  2PE3 A;  2V8V A;  4YFJ A;  2PJ3 A;  2FXF A;  4PXB A;  2O4H A;  4Y49 C;  1ON0 A;  3RBU A;  1I1D A;  4KLW A;  3CPA A;  1XIX A;  1ELL P;  4P44 A;  4EFD A;  3PEI A;  1QST A;  2VL1 A;  2GLJ A;  2Z10 A;  2PR1 A;  3C26 A;  2B3V A;  3B3V A;  3JTK A;  2WPX A;  2J8M A;  3RO0 A;  4ZYQ A;  2B58 A;  1CX8 A;  4NFR A;  5JH9 A;  3IWE A;  3D67 A;  3FF3 A;  3RNZ A;  4CS0 B;  2OB0 A;  2IL4 A;  2YGW A;  4AVA A;  1PUA A;  4KOV A;  4RS2 A;  4WJB A;  2PIZ A;  2HB6 A;  4FD5 A;  4MCS A;  4XPD B;  4BMH A;  5ELY A;  1VIX A;  2Z3M A;  3PB8 X;  4NGR A;  2J8R A;  2GAN A;  4DJL A;  1MJB A;  1YLO A;  2F7V A;  1Q2D A;  4U5Y A;  2Z3O A;  2FVG A;  1VHO A;  1M4L A;  1WWZ A;  3JUW A;  2GU2 A;  6CPA A;  3LAC A;  2A4N A;  4UWJ A;  4ONU A;  5LYF A;  1XF8 A;  4XNH B;  2Q4V A;  3B7I A;  3B3C A;  1XMB A;  1IID A;  1H8L A;  3L2N A;  4UCP A;  4NEX A;  2H5M A;  5AG7 A;  2WYR A;  4P4I A;  4EME A;  1HDU A;  4YRH A;  5F48 A;  5DWN A;  2CNM A;  3FVL A;  2NYQ A;  3JVN A;  2GRE A;  1MJA A;  1I12 A;  3QAY A;  3SJX A;  2Q4Z A;  2JLM A;  2VBQ A;  4MFQ A;  5K8N A;  1XOV A;  4PK2 A;  2GFQ A;  4JWP A;  4CYQ A;  4MJ8 A;  2C6C A;  4KOT A;  3PZJ A;  2ATR A;  5IX3 A;  2P6E A;  4UBR A;  1SQH A;  4B5P A;  2Q0Y A;  4ZBG A;  4KVX A;  1IYK A;  2ZPA A;  5A27 A;  3PFO A;  4ZX8 A;  1WK4 A;  2AFW A;  2HUZ A;  2OZU A;  2D4P A;  3GLJ A;  3VH9 A;  2PJ1 A;  4CAF A;  3W6S A;  3IEH A;  4JYW A;  2CIJ A;  3PFE A;  3KL9 A;  1I21 A;  2ABZ A;  2QJ8 A;  3P2F A;  1P0H A;  4HPS A;  2F8H A;  4H2K A;  4QC6 A;  2BOA A;  2IQ6 A;  2ZOF A;  5G1Z A;  2G3A A;  2Z3P A;  4UEE A;  2I79 A;  4RN7 A;  4C7H A;  4A31 A;  4W9Y A;  3KHZ A;  3CXP A;  2OU2 A;  2ZEO A;  3A9L A;  3B35 A;  4M6G A;  4Z65 A;  3JRU A;  2BSW A;  1XMT A;  4CYO A;  3LOD A;  2CTC A;  2PJC A;  1CPS A;  4AVC A;  3SI0 A;  2ODF A;  5LYI A;  1Z4R A;  3QB8 A;  5JPH A;  4OAE A;  1VHE A;  4JZ0 A;  4K3N A;  1Z8W A;  4R3K A;  2EVN A;  5LYL A;  2XEI A;  1YME A;  3D66 A;  5H86 A;  1VKC A;  4M85 A;  3CDX A;  1Y7E A;  1M1D A;  4GXH A;  1S7K A;  2FIA A;  4E2A A;  4F8Z A;  3BHX A;  3D4U A;  4AG7 A;  4DUK A;  1PCA A;  2Z11 A;  3UY5 A;  1AMP A;  4GS4 A;  1CP6 A;  4LQ6 A;  2C6G A;  2XEG A;  5LRG A;  4JD6 A;  4B5O A;  2PVV A;  2O28 A;  1S3Z A;  2ZEL A;  2I00 A;  4R57 A;  1R43 A;  3ZJ0 A;  4JJX A;  2ZW5 A;  4KOX A;  4ONW A;  5G22 A;  5FVJ A;  4CRY B;  5K8P A;  3SJG A;  3I9S A;  5JQ4 A;  3D2P A;  4NGP A;  1ELM P;  1Y7R A;  3QNV A;  3NFZ A;  1ZG8 A;  1KZF A;  3K9T A;  3NE8 A;  3TOA A;  4MHD A;  1IB1 E;  3TTH A;  2RC4 A;  3FRM A;  2KCW A;  3KI9 A;  4Q36 A;  3HLP A;  4CGP A;  1BPN A;  4KSI A;  1TIQ A;  1LCP A;  2ZEF A;  4MCR A;  1QMU A;  1Z8T A;  2B5G B;  2Q43 A;  3DDD A;  1IOI A;  1R57 A;  2ZEH A;  1YW4 A;  1Y9K A;  3KHX A;  4B12 A;  2HC9 A;  1B87 A;  2Z3K A;  3EY5 A;  3GB0 A;  4X3R A;  3R9G A;  5BWA B;  4XPK A;  4OC4 A;  3FH4 A;  2EK8 A;  4CPA A;  1YSJ A;  1YVO A;  4KOY A;  1S7N A;  4CGO A;  3PB9 X;  2VQY A;  1TKF A;  2B4D A;  2DXQ A;  2GE3 A;  3D7H A;  4OLL A;  4A94 A;  5IB0 A;  5K8O A;  3DR6 A;  3H8E A;  4QUS A;  5J8F A;  5G21 A;  4JXR A;  5F47 A;  1IIC A;  1PYT B;  1EE3 P;  4HKF A;  4RUH A;  3WR7 A;  4MHZ A;  4P10 A;  4NGT A;  1ZG9 A;  2AFX A;  1S5K A;  1Z9U A;  3KZW A;  3S6K A;  1S7F A;  3T90 A;  3IC1 A;  1CPX A;  1F2O A;  1LRZ A;  3ISX A;  3WC7 A;  4OC1 A;  2PR8 A;  5AGE A;  4MFP A;  1ZLH A;  2HQY A;  3LWU A;  4PSX A;  2NSM A;  3G3S A;  3GYA A;  2VZZ A;  1VHS A;  3D8P A;  4KUB A;  2Q7B A;  5LRK A;  5A28 A;  2GIV A;  4QB9 A;  3F5B A;  4OP4 A;  4NF1 A;  2FIW A;  3S6G A;  2B4B A;  1Q2Y A;  7CPA A;  5K8M A;  4UEF A;  4X2T A;  2O53 A;  5J8C A;  1GYT A;  3KQX A;  3S9M A;  3G8W A;  4KSA A;  1M4I A;  2R98 A;  4NJQ A;  1DTD A;  4KOW A;  4FWU A;  4KOS A;  2ZEN A;  4KVO E;  1IYL A;  1DE4 C;  3RZA A;  5IB9 A;  3ISZ A;  4XPD C;  1MK4 A;  4KSF A;  4P6Y A;  2OOT A;  3EC4 A;  3TO7 A;  3TO6 A;  3BLN A;  3VAR A;  4MHY A;  2V8H A;  1S7L A;  1Z8X A;  2Z0Z A;  4UFV A;  5LYD A;  3VWE A;  2ARH A;  2JEV A;  5KTC A;  4P4E A;  3P2H A;  3SJE A;  3H8G A;  2R7H A;  4R8F A;  4XNH C;  3LD2 A;  5IV0 A;  3R1K A;  2XEJ A;  3V8I A;  2YNC A;  4KUA A;  3N7Z A;  3T9Y A;  2PIY A;  2WUU A;  2CTB A;  4A33 A;  1ZLI A;  3IGR A;  3RAM A;  3K9U A;  3I3G A;  4GM5 A;  4IHM A;  3WT4 A;  2JBK A;  4MFK A;  4MFL A;  1NSA A;  4X8I A;  4MCP A;  2Q44 A;  2AFM A;  2VI7 A;  3IU2 A;  4KS9 A;  2WZN A;  4BD9 A;  4DNC A;  2JDD A;  4KZT A;  1AYE A;  1CJW A;  4TWE A;  1Q2C A;  1UFH A;  2PJ8 A;  4UFW A;  4IK2 A;  4AVB A;  1KUY A;  2RFH A;  3KAS A;  3BI1 A;  3D7F A;  5EBV A;  1GHE A;  4R76 A;  3CT9 A;  2I3C A;  4U9Z A;  4A32 A;  5HVH A;  2PJ2 A;  4OC2 A;  2PSW A;  4L89 A;  4M6I A;  3BI0 A;  3PGP A;  4C2Z A;  1P4N A;  1OBR A;  4A30 A;  1K4J A;  1QSR A;  3E0K A;  2ZED A;  4MFZ A;  1CP7 A;  1V0C A;  3H8F A;  3PBE A;  4TNU A;  4E8O A;  2YND A;  1YVK A;  5AG4 A;  1IOF A;  1YK3 A;  2FCK A;  3EFA A;  3IO1 A;  4ORF A;  3W91 A;  2QEC A;  4II9 A;  3FIX A;  4K30 A;  2QVP A;  1F57 A;  2PJ6 A;  3DR8 A;  1YR0 A;  3FEC A;  1JWQ A;  1XE4 A;  2VEZ A;  5J1Q A;  4M6H A;  4FD4 A;  5D29 A;  4QBJ A;  2F5I A;  5JM6 A;  2EK9 A;  1ARL A;  2V77 A;  2OR4 A;  4CAV A;  2V8G A;  5HH1 A;  4ZI6 A;  2POK A;  3FNC A;  5E96 A;  3EO4 A;  1X10 A;  2QML A;  5DS0 A;  2B3U A;  3DSB A;  4KOR A;  1RTQ A;  4C2X A;  4H6U A;  1QSM A;  4IF5 A;  1AUG A;  4UIB A;  3BJ7 A;  2D4O A;  2BEI A;  3CXQ A;  5F09 A;  3FBU A;  4KVM E;  4NGS A;  2CY2 A;  2DF5 A;  1XRY A;  4CAE A;  1BO4 A;  3F0A A;  4OID A;  4BIN A;  4CAX A;  3SI2 A;  4CRZ B;  2G0B A;  1L0C A;  2AJ6 A;  3V38 A;  4MY0 A;  4P4B A;  2FE7 A;  4G1P A;  4MFJ A;  4I49 A;  2IJZ A;  1IU8 A;  3PB6 X;  1Q7L A;  4F0X A;  2ZEG A;  2AFZ A;  4JLY A;  4MBU A;  3FJU A;  4LQG A;  4PK3 A;  4YGO A;  2FL4 A;  4NGQ A;  1CBX A;  1TKJ A;  2QYV A;  3MN8 A;  4P4D A;  4XPL A;  2ZOG A;  2ZW4 A;  2REE A;  3K2K A;  1RO5 A;  3H5Z A;  2JBJ A;  2BO9 A;  2K5T A;  4IAV A;  3TCV A;  4AXV A;  2CNS A;  4E0A A;  2Q51 A;  3D7G A;  2HV2 A;  4C7I A;  1IGB A;  1M44 A;  2PJA A;  3KKW A;  4ZY0 A;  4UF4 A;  3GY9 A;  2C1C A;  5G20 A;  1U6M A;  1NMT A;  1Z2L A;  3TOB A;  5GCN A;  4MHN A;  2P6F A;  4KOU A;  4Y49 B;  8CPA A;  2JDC A;  1QSO A;  1XBU A;  3FYN A;  1JQG A;  4NGM A;  3N5F A;  1HEE A;  2ZEP A;  1VGY A;  4RI1 A;  3S9L A;  3PB4 X;  1Y0Y A;  2PVW A;  4OME A;  2DEA A;  2PJ5 A;  2YNC C;  2BUE A;  1M4G A;  2OZH A;  1ARM A;  3TT2 A;  2R1I A;  1YRE A;  1FNO A;  1KUV A;  1YW6 A;  2XEF A;  4PXD A;  1YX0 A;  3CZX A;  4B5P B;  2C27 A;  3MRU A;  4UA3 A;  3WAB A;  4DYO A;  2VXK A;  5HMN A;  3TE4 A;  4F9U A;  1M4D A;  5F46 A;  4LUA A;  3R9F A;  4HNY B;  4YU9 A;  3MGD A;  3PB7 X;  3R95 A;  1NE9 A;  4NGN A;  4P45 A;  3TO9 A;  1FY7 A;  1HDQ A; 
#chains in the Genus database with same CATH homology
 1QSN A;  4QVT A;  1CM0 A;  4IUS A;  4B14 A;  3ZZI A;  1MJ9 A;  4AG9 A;  3S6F A;  2B5G A;  4J3G A;  2DPS A;  2OH1 A;  4UWI A;  3D3S A;  4PSW A;  4CAW A;  5KTD A;  4CGN A;  2Q4Y A;  2CXA A;  1BOB A;  3EXN A;  2R8V A;  4X5K A;  4UCN A;  2DPT A;  2Y0M A;  2FS5 A;  4NCZ A;  4FD7 A;  4R87 A;  4NXY A;  4F0Y A;  3IWG A;  5F49 A;  4BBH A;  3TFY A;  1RXT A;  3R96 A;  2Z3N A;  4R3L A;  4HNX B;  2YNE A;  3PP9 A;  2X7B A;  3DNS A;  3FXT A;  4LX9 A;  1YGH A;  4H6Z A;  4EVY A;  2Q04 A;  4B10 A;  2PRB A;  2CNT A;  4C68 A;  2Z3L A;  2FSR A;  3R9E A;  2FT0 A;  4A95 A;  4FD6 A;  2P0W A;  2PC1 A;  4JXQ A;  3RYO A;  4B13 A;  3BJ8 A;  2AE6 A;  2OZG A;  2B4D B;  4AB7 A;  3IU1 A;  4H89 A;  2PQ8 A;  4U9Y A;  5ISV A;  2ZW6 A;  4MI4 A;  2P6G A;  4MY3 A;  4Q38 A;  1B6B A;  1J4J A;  1PU9 A;  2ZXV A;  4R9M A;  3CXS A;  1N71 A;  5CNP A;  5KTA A;  3SXO A;  3D2M A;  4NSQ A;  4F6A A;  1Z4E A;  4OAD A;  4A2Z A;  1YLE A;  2WPW A;  3B8G A;  2G3T A;  3SHP A;  2ZW7 A;  2VZY A;  2QIR A;  4CGL A;  4M3S A;  1OZP A;  3GKR A;  5EC4 A;  3S6H A;  1XEB A;  4B11 A;  4C2Y A;  3QAH A;  5AG5 A;  5H84 A;  4ZGY B;  4UFX A;  4CGM A;  4CYN A;  2NMT A;  5C88 A;  3F8K A;  4HNW B;  2REF A;  4PV6 A;  2J8N A;  3H4Q A;  5DWM A;  5AG6 A;  4UCM A;  2WSA A;  4CYP A;  1KUX A;  5I0C A;  3SXN A;  1S60 A;  3FB3 A;  4L8A A;  1ZO0 A;  3OWC A;  3VWD A;  5C82 A;  2PDO A;  2EUI A;  1Y9W A;  1NSL A;  4KLV A;  3NE7 A;  4YFJ A;  3W6X A;  2BL1 A;  4Y49 C;  2FXF A;  1ON0 A;  1I1D A;  4KLW A;  1XIX A;  1QST A;  2Z10 A;  2PR1 A;  3C26 A;  2B3V A;  3JTK A;  2WPX A;  2J8M A;  2B58 A;  3IWE A;  4CS0 B;  2OB0 A;  2IL4 A;  2YGW A;  4AVA A;  1PUA A;  4KOV A;  4RS2 A;  4FD5 A;  4XPD B;  4BMH A;  2Z3M A;  2J8R A;  2GAN A;  1MJB A;  1Q2D A;  4U5Y A;  2Z3O A;  3JUW A;  1WWZ A;  2A4N A;  4UWJ A;  4ONU A;  1XF8 A;  4XNH B;  2Q4V A;  1IID A;  4UCP A;  4NEX A;  2H5M A;  5AG7 A;  4YRH A;  5F48 A;  5DWN A;  2CNM A;  3JVN A;  1MJA A;  1I12 A;  2JLM A;  2VBQ A;  4MFQ A;  4PK2 A;  4JWP A;  4CYQ A;  4MJ8 A;  4KOT A;  3PZJ A;  2ATR A;  5IX3 A;  2P6E A;  4UBR A;  1SQH A;  4B5P A;  2Q0Y A;  4ZBG A;  4KVX A;  1IYK A;  2ZPA A;  5A27 A;  1WK4 A;  4CAF A;  2HUZ A;  2OZU A;  2D4P A;  3W6S A;  3P2F A;  1I21 A;  1P0H A;  4QC6 A;  5G1Z A;  2G3A A;  2Z3P A;  2I79 A;  4C7H A;  4A31 A;  3CXP A;  2OU2 A;  3A9L A;  2BSW A;  1XMT A;  4CYO A;  3LOD A;  4AVC A;  1Z4R A;  3QB8 A;  5JPH A;  4OAE A;  4R3K A;  2EVN A;  5H86 A;  1VKC A;  4M85 A;  1M1D A;  1S7K A;  2FIA A;  4E2A A;  4AG7 A;  2Z11 A;  3UY5 A;  4GS4 A;  4JD6 A;  4B5O A;  2O28 A;  1S3Z A;  4R57 A;  2I00 A;  3ZJ0 A;  4JJX A;  2ZW5 A;  4KOX A;  5G22 A;  5FVJ A;  4CRY B;  3I9S A;  5JQ4 A;  3D2P A;  1Y7R A;  1KZF A;  3TOA A;  4MHD A;  1IB1 E;  3TTH A;  2RC4 A;  3FRM A;  2KCW A;  4Q36 A;  4CGP A;  1TIQ A;  2B5G B;  3DDD A;  1R57 A;  1Y9K A;  4B12 A;  1B87 A;  2Z3K A;  3EY5 A;  3R9G A;  5BWA B;  4XPK A;  1YVO A;  4KOY A;  1S7N A;  4CGO A;  2VQY A;  2B4D A;  2DXQ A;  2GE3 A;  4OLL A;  5IB0 A;  3DR6 A;  4QUS A;  5J8F A;  5G21 A;  4JXR A;  5F47 A;  1IIC A;  4HKF A;  3WR7 A;  3S6K A;  1S5K A;  1Z9U A;  1S7F A;  3T90 A;  1LRZ A;  2PR8 A;  5AGE A;  4MFP A;  2HQY A;  4PSX A;  3G3S A;  3GYA A;  2VZZ A;  1VHS A;  3D8P A;  4KUB A;  2Q7B A;  5A28 A;  2GIV A;  4QB9 A;  3F5B A;  4NF1 A;  2FIW A;  3S6G A;  2B4B A;  1Q2Y A;  5J8C A;  3G8W A;  4KSA A;  1M4I A;  2R98 A;  4KOW A;  4KOS A;  4KVO E;  1IYL A;  4XPD C;  1MK4 A;  4KSF A;  3TO7 A;  3TO6 A;  3EC4 A;  3BLN A;  2Z0Z A;  1S7L A;  4UFV A;  3VWE A;  2ARH A;  2JEV A;  5KTC A;  3P2H A;  2R7H A;  4XNH C;  5IV0 A;  3LD2 A;  3R1K A;  3V8I A;  2YNC A;  4KUA A;  3N7Z A;  3T9Y A;  2WUU A;  4A33 A;  3IGR A;  3K9U A;  3I3G A;  4MFK A;  4MFL A;  2Q44 A;  2VI7 A;  3IU2 A;  4KS9 A;  4DNC A;  2JDD A;  4KZT A;  1CJW A;  1Q2C A;  1UFH A;  4UFW A;  4AVB A;  1KUY A;  5EBV A;  1GHE A;  4U9Z A;  4A32 A;  2PSW A;  4L89 A;  3PGP A;  4C2Z A;  1P4N A;  4A30 A;  1K4J A;  1QSR A;  3E0K A;  4MFZ A;  1V0C A;  4E8O A;  2YND A;  1YVK A;  5AG4 A;  1YK3 A;  2FCK A;  3EFA A;  4ORF A;  3W91 A;  2QEC A;  4II9 A;  3FIX A;  4K30 A;  3DR8 A;  1YR0 A;  1XE4 A;  2VEZ A;  4FD4 A;  4QBJ A;  2F5I A;  4CAV A;  5HH1 A;  3FNC A;  5E96 A;  3EO4 A;  2QML A;  2B3U A;  3DSB A;  4KOR A;  4C2X A;  4H6U A;  1QSM A;  4IF5 A;  3BJ7 A;  2D4O A;  2BEI A;  3CXQ A;  3FBU A;  4KVM E;  2CY2 A;  4CAE A;  1BO4 A;  3F0A A;  4CAX A;  4CRZ B;  2G0B A;  1L0C A;  2AJ6 A;  4MY0 A;  2FE7 A;  4MFJ A;  4I49 A;  4F0X A;  4JLY A;  4MBU A;  4PK3 A;  4YGO A;  2FL4 A;  4XPL A;  2ZW4 A;  2REE A;  1RO5 A;  3H5Z A;  3TCV A;  2K5T A;  2CNS A;  4E0A A;  4C7I A;  2HV2 A;  1M44 A;  3KKW A;  3GY9 A;  5G20 A;  1U6M A;  1NMT A;  3TOB A;  5GCN A;  2P6F A;  4KOU A;  4Y49 B;  2JDC A;  1QSO A;  3FYN A;  4RI1 A;  2YNC C;  2BUE A;  1M4G A;  2OZH A;  3TT2 A;  2R1I A;  1YRE A;  1KUV A;  1YX0 A;  4B5P B;  2C27 A;  5HMN A;  4UA3 A;  3TE4 A;  2VXK A;  1M4D A;  5F46 A;  4LUA A;  3R9F A;  4HNY B;  3MGD A;  3R95 A;  1NE9 A;  3TO9 A;  1FY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...