3R9EA

Crystal structure of microcin c7 self immunity acetyltransferase mcce in complex with coenzyme a and aspartyl sulfamoyl adenosine (dsa)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
180
structure length
180
Chain Sequence
b'DVSLTPSGIKVNDEITLLYPALKYAEELYLLINQNKINFIKSMAWPAFVNNISDSVSFIEQSMIDNQNEKALILFIKYKTKIAGVVSFNIIDHANKTAYIGYWLGANFQGKGIVTNAINKLIQEYGDSGVIKRFVIKCIVDNKKSNATALRCGFTLEGVLQKAEILNGVSYDQNIYSKVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccE protein
publication title Structural Basis for Microcin C7 Inactivation by the MccE Acetyltransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 55
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3r9eA00
3I9SA 3F0AA 1Z4EA 2FIWA 1IIDA 2FS5A 2WPWA 5JPHA 4JLYA 2Z11A 4DNCA 3DDDA 3DNSA 4RS2A 3TOAA 1Z4RA 3FIXA 1L0CA 1Y9KA 4KOYA 5ISVA 5KTCA 2OZHA 3BJ7A 3PGPA 5EBVA 2EUIA 1XF8A 2RC4A 1XIXA 4XNHB 2BL1A 5F48A 4KOUA 4QB9A 2D4OA 3TE4A 1IICA 3T9YA 4AVAA 3OWCA 2I79A 1QSNA 2Y0MA 2GE3A 3D2PA 1BO4A 4MJ8A 1YK3A 4KOWA 2BEIA 3FYNA 2PC1A 4E2AA 1VHSA 4LUAA 4JJXA 3T90A 2JDCA 3LD2A 3SXOA 4U9ZA 3S6GA 3SXNA 1NSLA 4UA3A 3FRMA 2GANA 4X5KA 3D2MA 2ZW6A 2JLMA 3W6XA 2Z10A 4MY3A 2FIAA 1YX0A 5DWMA 2R98A 5CNPA 3SHPA 2BSWA 1S7FA 4FD7A 3PP9A 2CNTA 3S6FA 4Y49C 4NSQA 2VZZA 5H86A 4KORA 5EC4A 1UFHA 3FBUA 4KLVA 3G3SA 3R9FA 2D4PA 4KUAA 5IX3A 4IF5A 2FE7A 1P4NA 4CRYB 4U9YA 2AJ6A 1MJAA 2ZXVA 4AG7A 2PR8A 2ARHA 1KZFA 5F49A 1S5KA 2P0WA 1NMTA 4OLLA 3RYOA 3TTHA 1M4IA 3R95A 2R7HA 2FSRA 3FXTA 2Q4YA 1KUYA 4PSWA 4FD4A 4HKFA 3EXNA 3TO7A 2ZW5A 3GYAA 2B3UA 4U5YA 1YVOA 1K4JA 4OAEA 2PR1A 4H89A 5FVJA 2Q4VA 2PRBA 2J8RA 1M4GA 4JD6A 1VKCA 1J4JA 2B3VA 3E0KA 4R9MA 2J8MA 1LRZA 1YREA 1MJ9A 2NMTA 1B87A 4QUSA 4KVXA 4MY0A 2ZPAA 1B6BA 3H4QA 1S7LA 3GY9A 3CXQA 1QSOA 3G8WA 3S6KA 3FNCA 1PUAA 4KZTA 5J8CA 2ZW4A 4CAXA 3PZJA 2O28A 2P6FA 3R96A 4XPDC 1V0CA 4YGOA 2B5GB 2ZW7A 4YFJA 1P0HA 3V8IA 2OB0A 2VI7A 4UWJA 5HH1A 3QAHA 1CM0A 1OZPA 1U6MA 2VZYA 5KTDA 4PSXA 1XE4A 3UY5A 1PU9A 2C27A 2B4DB 1Y7RA 3TO9A 1XEBA 2FL4A 3P2HA 4MBUA 3IGRA 2P6GA 2Z0ZA 4CAVA 5F47A 3R1KA 1N71A 2Q04A 3LODA 3TOBA 1MK4A 4QBJA 4CAWA 2K5TA 2F5IA 4OADA 1S3ZA 1WWZA 1KUXA 3KKWA 4LX9A 3CXPA 1Q2CA 3F8KA 1S7NA 4KVOE 4NCZA 4F0YA 4F6AA 2VBQA 4XPDB 4R57A 1S60A 3NE7A 1Z9UA 5J8FA 2R8VA 3S6HA 2G3TA 2PSWA 2OH1A 2WPXA 4MI4A 5H84A 1BOBA 2I00A 1YR0A 1YGHA 2B4BA 1QSRA 1R57A 1YLEA 1KUVA 3EY5A 2R1IA 4JXRA 3R9GA 1NE9A 2B5GA 4UBRA 4J3GA 4JXQA 4II9A 2EVNA 4KLWA 1I1DA 2IL4A 3TO6A 3D3SA 5JQ4A 2Q7BA 4FD5A 4AG9A 5DWNA 4QVTA 1Q2YA 2HUZA 2VQYA 1RXTA 2B4DA 3C26A 3QB8A 3CXSA 4PV6A 3N7ZA 4KVME 2G0BA 3BLNA 2ATRA 4KOSA 4KOXA 3WR7A 4AVBA 4M85A 1RO5A 4XPLA 2FXFA 4E8OA 4ONUA 3JVNA 1Y9WA 3VWDA 4K30A 4B5PB 4Y49B 1TIQA 4XNHC 5E96A 4PK3A 2CY2A 4M3SA 2GIVA 2DXQA 3GKRA 2G3AA 4HNYB 4BMHA 2CNSA 4QC6A 2CNMA 1M1DA 4YRHA 4H6ZA 4CS0B 3BJ8A 3ZJ0A 4KUBA 4NF1A 1QSTA 3IWGA 2QIRA 2P6EA 5IV0A 1SQHA 3B8GA 1M4DA 4HNWB 2X7BA 4H6UA 5F46A 4L8AA 3W91A 2REFA 4KOVA 4AB7A 2KCWA 5C88A 4L89A 1I12A 1IYLA 3MGDA 2B58A 2JEVA 3EC4A 4GS4A 3EFAA 5GCNA 2Q0YA 2PDOA 3TCVA 3VWEA 1GHEA 1IYKA 4ZBGA 4CRZB 1S7KA 1FY7A 3ZZIA 4AVCA 4B5PA 4NEXA 2HV2A 2VXKA 1Q2DA 3EO4A 2QECA 4EVYA 4RI1A 5C82A 3DR8A 2BUEA 3W6SA 3D8PA 3TT2A 1WK4A 2J8NA 4XPKA 1ON0A 2JDDA 4UWIA 4JWPA 2OU2A 4MHDA 3P2FA 1M44A 2QMLA 2OZGA 4R87A 5IB0A 2H5MA 2FT0A 3FB3A 4E0AA 2FCKA 4R3LA 4ORFA 4B5OA 3DR6A 4IUSA 3R9EA 2AE6A 1IB1E 3JUWA 3F5BA 1I21A 1QSMA 4FD6A 1XMTA 2VEZA 3K9UA 2REEA 5I0CA 2OZUA 2HQYA 2Q44A 5HMNA 4PK2A 4I49A 1YVKA 1MJBA 3I3GA 4HNXB 4KOTA 4NXYA 1CJWA 5KTAA 2A4NA 3DSBA 3TFYA 2PQ8A 4R3KA
chains in the Genus database with same CATH superfamily
3I9SA 3F0AA 1Z4EA 3GLJA 2FIWA 4X8IA 3B3VA 1IIDA 1VHEA 2FS5A 2GLFA 2WPWA 3KI9A 3B3SA 4B10A 3PEIA 5JPHA 4JLYA 1RTQA 4B13A 3JRUA 2HC9A 1YW4A 2Z11A 4DNCA 3DDDA 2PJ3A 2PIYA 3DNSA 5JGFA 3TFYA 4RS2A 3IFEA 1BPMA 4CYQA 2YNCC 3KQZA 1PCAA 2PJ4A 3FEDA 3T8WA 1YMEA 2ZEOA 3TOAA 4OC3A 4P4BA 4MCPA 1Z4RA 3FIXA 1L0CA 1Y9KA 1AYEA 4KOYA 4MFZA 5ISVA 3SI2A 3FF3A 3GIUA 1FNOA 2OZHA 5KTCA 3BJ7A 3PGPA 5EBVA 2EUIA 2AFXA 2Z3OA 1XF8A 3N5FA 3TC8A 2RC4A 2PJ5A 1XIXA 2GREA 4XNHB 2BL1A 3PB8X 3FJUA 5F48A 4MFLA 4KOUA 2CF4A 4QB9A 5LRJA 2D4OA 4MFKA 3TE4A 1IICA 1BAVA 3T9YA 4AVAA 1A2ZA 3OWCA 2I79A 4NGQA 1QSNA 2Y0MA 4LQ6A 2GE3A 1AMPA 2NYQA 3D2PA 1BO4A 4MJ8A 1YK3A 4KOWA 4NGRA 3HLPA 4GXHA 2BEIA 4NGMA 1ELMP 3FYNA 2PC1A 4E2AA 1Z8XA 1VHOA 1VHSA 4LUAA 4JJXA 4CGNA 2QYVA 1EE3P 3T90A 2JDCA 3LD2A 3D7GA 4P44A 4CGMA 3SXOA 4KSAA 4P6YA 2V8VA 2NSMA 3TX8A 4U9ZA 3S6GA 4ZGYB 4G1PA 5LYDA 4MRIA 1NSLA 4UA3A 3MN8A 3SXNA 3FRMA 2GANA 1TKJA 4X5KA 3DLJA 1IOIA 4PXCA 3VH9A 3D2MA 2ZW6A 4B12A 2JLMA 3W6XA 4BBHA 1BPNA 1TF9A 2Z10A 3K2KA 4NGTA 3PB9X 1KWMA 2FIAA 4MY3A 3FECA 1R3NA 1YX0A 2PCUA 2WUUA 4NGNA 4OMEA 3SI1A 2RB7A 5DWMA 4CYPA 5LYLA 2R98A 1CBXA 2EK9A 3BXMA 5CNPA 4YWYA 3S9LA 1QQ9A 3D7FA 4MFJA 1IY7A 3SHPA 2BSWA 1S7FA 4FD7A 4B11A 4UEZA 2QJ8A 3PP9A 5CBMA 2Z3KA 3D66A 2CNTA 3S6FA 4Y49C 5LYIA 4PXDA 4NSQA 3B3CA 2VZZA 3B3WA 5H86A 4KORA 5EC4A 3H8EA 1ARMA 1UFHA 3PFOA 2JBJA 1F2PA 2WSAA 4P10A 1VGYA 1AUGA 2ZEDA 3FBUA 3PB4X 4KLVA 3G3SA 3V7ZA 1YQEA 2PJBA 2D4PA 4KUAA 3R9FA 5IX3A 4IF5A 2FE7A 1Z8TA 1P4NA 4M6IA 2J9AA 4TNUA 2PJ1A 1Z8LA 4U9YA 5CPAA 2AJ6A 3B3TA 1MJAA 2ZXVA 3ISZA 3KR5A 4UEFA 4AG7A 2PR8A 4C7HA 2ARHA 1KZFA 5F49A 1S5KA 4KSIA 4F8ZA 2IJZA 3GB0A 2P0WA 3V38A 1ARLA 4C2XA 4NFRA 3NA6A 2PJ0A 1NMTA 2Z3PA 4NJQA 4OLLA 4MHZA 1M4IA 3RYOA 3TTHA 2AFZA 4DUKA 4UFXA 3R95A 1CPSA 2R7HA 2FSRA 3NH4A 4DJLA 3FXTA 2Q4YA 5HVFA 1TF8A 1HDQA 4WWVA 1KUYA 2PJAA 4PSWA 4FD4A 4HKFA 3EXNA 4MHYA 3TO7A 5G1ZA 4A2ZA 2ZW5A 3LACA 3GYAA 1XFOA 2B3UA 4U5YA 1XRYA 1Z8WA 3LWUA 4NGSA 4JZ0A 4A39A 1YVOA 4B14A 2DEAA 4NGPA 5A27A 1K4JA 3IU2A 4OAEA 4ZY2A 2PR1A 4H89A 5AG6A 5FVJA 2Q4VA 1XBUA 2DPTA 2J8RA 2PRBA 4ZY0A 2CTBA 1M4GA 4JD6A 2GLJA 1J4JA 2B3VA 4A94A 3E0KA 2PRQA 5K8NA 3KQXA 3GUXA 4OIWA 2J8MA 4R9MA 5LRKA 3CPAA 2ANPA 2Z3NA 1LRZA 3FMCA 1YREA 4F0XA 1MJ9A 3D7DA 2NMTA 1B87A 4QUSA 4KVXA 3KGQA 2JEWA 2AFMA 2C6CA 4MY0A 4F9UA 1JWQA 2EK8A 2ZPAA 4CAEA 1B6BA 3D68A 1LANA 3H4QA 1IOFA 1S7LA 3FVLA 3H8FA 8CPAA 3GY9A 1CP7A 2O4HA 1QSOA 3CXQA 3PRTA 4KSFA 3WC7A 3K9TA 3L2NA 1YW6A 3G8WA 3S6KA 1LAPA 4MHPA 4CAFA 3FNCA 5K8OA 1PUAA 2PJ7A 4KZTA 5J1QA 4CPAA 5J8CA 2ZEMA 2Z3MA 2ZW4A 4CAXA 3PZJA 3IU1A 2O28A 2P6FA 5BWAB 4X2TA 3R96A 4A33A 4GM5A 2ZEFA 4ZI6A 2Q7SA 4XPDC 4FUUA 2GFQA 4JYWA 4OC4A 4UIAA 1V0CA 4YGOA 2B5GB 2ZW7A 4YFJA 1P0HA 1JQGA 2BCOA 4ZY1A 2FVGA 4OC0A 3FEEA 3V8IA 2OB0A 2PJ2A 2VI7A 1X12A 3PB6X 4UWJA 5HH1A 1TKHA 2Q4ZA 3QAHA 1CM0A 5JM6A 1OZPA 3KASA 1U6MA 2VZYA 2Q51A 2PIZA 5KTDA 4A95A 3S9MA 4PSXA 1XE4A 3UY5A 1PU9A 2JBKA 4EMEA 3WC5A 2C27A 2B4DB 1Y7RA 6CPAA 3TO9A 2PVVA 1XEBA 5D29A 3KR4A 2V77A 2FL4A 3CT9A 4M6HA 3P2HA 4MBUA 2G9DA 4YU9A 2PJ9A 3IGRA 3SJEA 2P6GA 2Z0ZA 3NFZA 4C7IA 4CAVA 4P4EA 2BO9A 5F47A 3R1KA 1N71A 2Q04A 3LODA 3RNZA 1Q7LA 3TOBA 4MHNA 4CYOA 1MK4A 2PE3A 3ISXA 4QBJA 4CAWA 2K5TA 4Q36A 2F5IA 2OR4A 2QVPA 4OADA 1F2OA 5THWA 1QMUA 1S3ZA 2BOAA 2XEIA 3MRUA 4KS9A 1WWZA 1KUXA 3KKWA 4LX9A 5HVHA 3CXPA 1Q2CA 3F8KA 4FBEA 1S7NA 2Q43A 4KVOE 4MMOA 4NCZA 4F0YA 4F6AA 3IWEA 2VBQA 4M6GA 4XPDB 4R57A 1S60A 4CYNA 2WYRA 2IMOA 1Z9UA 3NE7A 4X3RA 1ZLIA 5J8FA 2R8VA 3KHXA 3S6HA 2G3TA 4MFPA 2PSWA 2ABZA 2OH1A 2WPXA 4H2KA 1BOBA 4MI4A 5H84A 2I00A 1YR0A 2PQ8A 4B6ZA 5JH9A 1YGHA 2B4BA 1QSRA 1R57A 1YLEA 1KUVA 2IQ6A 1FT7A 3CZXA 3EY5A 2R1IA 3IO1A 4JXRA 4K3NA 5G20A 3CPXA 3R9GA 1NE9A 2CIJA 2B5GA 3IC1A 4UBRA 4P4FA 4AXVA 4J3GA 3SI0A 1UWYA 4JXQA 1VIXA 4IK2A 5AG4A 4II9A 3RAMA 4OC1A 2EVNA 4KLWA 1I1DA 1CX8A 2IL4A 3TO6A 3WC6A 4BD9A 4P45A 4CGOA 2V8DA 3D3SA 5JQ4A 2Q7BA 4FD5A 2XEGA 3IEHA 2RFHA 4AG9A 1HEEA 5DWNA 1YLOA 1YSJA 1HDUA 4P4DA 4QVTA 1Q2YA 1Z2LA 2HUZA 2VQYA 4UCNA 1RXTA 2B4DA 4P4JA 4BINA 3SJFA 3C26A 3QB8A 4MCQA 5G22A 4O23A 2AFSA 3CXSA 4PV6A 3N7ZA 3VARA 1X10A 4KVME 2G0BA 3H5ZA 1TKFA 3BLNA 2ATRA 1CP6A 3DGVA 4A31A 4PXBA 2YNCA 1DE4C 1LCPA 3A9LA 4KOSA 4OKOA 4KOXA 2OOTA 3WR7A 4AVBA 1IGBA 2EO8A 2GU2A 2O53A 4M85A 4RUHA 3B7IA 1RO5A 4XPLA 2FXFA 2ZEGA 3D67A 4ONUA 3RBUA 4E8OA 2ZEHA 1Y9WA 3JVNA 4Q7AA 4UEEA 3VWDA 4CRYB 4K30A 3B2YA 4Y49B 1CG2A 4B5PB 3PB7X 1TIQA 4NJRA 4XNHC 5E96A 4PK3A 2CY2A 4M3SA 4C2ZA 2GIVA 1Y7EA 2DXQA 4UCPA 3GKRA 2G3AA 4HNYB 4MCSA 1XOVA 4BMHA 2CNSA 4QC6A 1LFWA 2PVWA 1ZG8A 4ZYQA 2CNMA 3FX6A 5D8NA 5HVGA 2POKA 1M1DA 2HB6A 1ZLHA 4YRHA 4H6ZA 4CS0B 3FH4A 3BJ8A 2EBJA 3ZJ0A 4C2YA 5G21A 4KUBA 4NF1A 1QSTA 4PXEA 3IWGA 5IB9A 3NE8A 3I1UA 2QIRA 1M4LA 1XMBA 2I3CA 2P6EA 4F9VA 4A32A 5IV0A 3KZWA 2ZENA 3SJGA 4LQGA 1SQHA 2EWBA 2PJ6A 3RZAA 1F57A 3B8GA 4UCMA 1M4DA 4MCRA 4HNWB 2YNEA 2X7BA 4H6UA 5F46A 4MFQA 4L8AA 3W91A 2REFA 4UFWA 4KOVA 4AB7A 4UIBA 2KCWA 1LAMA 3H8GA 3BHXA 5C88A 1XJOA 4L89A 1I12A 1IYLA 5A28A 2Z3LA 3MGDA 2B58A 1ZG9A 2JEVA 3EC4A 3HUVA 4GS4A 4MXUA 3EFAA 5GCNA 3WABA 2Q0YA 3QAYA 2C6GA 2PDOA 3TCVA 4RN7A 3RO0A 3VWEA 1GHEA 1IYKA 2ODFA 3NH8A 4ZBGA 4CGLA 2CTCA 2C1CA 4ONWA 4DYOA 2WZNA 5DS0A 7CPAA 5ELYA 5LYFA 3PFEA 4CRZB 1S7KA 3PBEA 4R76A 4OC5A 4C68A 3IJ3A 1FY7A 3ZZIA 4AVCA 2C6PA 4B5PA 4NEXA 3D4UA 2HV2A 4R7MA 2XEFA 3JTKA 5AG5A 1ZG7A 2XEJA 4WJBA 1CPXA 4OC2A 2VXKA 1Q2DA 4PPZA 2AFUA 3EO4A 2QECA 4EVYA 4RI1A 4W9YA 5C82A 4OP4A 3DR8A 1BLLE 2BUEA 3W6SA 3D8PA 3TT2A 2DPSA 2ZEEA 5EMIA 1WK4A 2J8NA 2AFWA 4XPKA 1NSAA 1ON0A 2JDDA 4UWIA 4JWPA 3IIBA 2VL1A 4TWEA 2F8HA 2OU2A 3WT4A 4MHDA 3P2FA 1PYTB 1M44A 2QMLA 3BI0A 2ZEPA 4FAIA 4A38A 1DTDA 2OZGA 4R87A 3D7HA 3B35A 3QNVA 3KL9A 5IB0A 2PJ8A 2H5MA 2FT0A 3FB3A 1TXRA 4E0AA 2FCKA 4R3LA 2F7VA 2DF5A 4ORFA 4B5OA 4A37A 4P4IA 1ELLP 1OBRA 2CXAA 3DR6A 4Z65A 5K8PA 2YGWA 4IUSA 1LOKA 2AFOA 3R9EA 1R43A 1IB1E 2AE6A 4R8FA 4CGPA 3JUWA 4EWTA 1ZO0A 4ZX9A 5F09A 3F5BA 4R6TA 4A30A 1I21A 3CDXA 3KHZA 5K8MA 1QSMA 3PBBA 4FD6A 4FWUA 3BI1A 1XMTA 1IU8A 1Z5RA 4OIDA 4EFDA 2VEZA 3K9UA 3SJXA 2REEA 4Q38A 4ZX8A 1GYTA 5I0CA 1Y0YA 2OZUA 2PJCA 2HQYA 3VATA 2Q44A 5LRGA 5HMNA 4PQAA 3IWWA 3LMSA 4PK2A 2ZELA 4I49A 5AG7A 1YVKA 4HPSA 5HXDA 2ZOGA 1MJBA 4UF4A 3I3GA 2V8GA 3NH5A 4HNXB 2YNDA 4KOTA 2ZOFA 4NXYA 1CJWA 1Y0RA 2V8HA 5KTAA 4IHMA 4UFVA 2A4NA 3DSBA 5AGEA 1H8LA 5I4MA 3S9NA 4IAVA 1VKCA 4R3KA
chains in the Genus database with same CATH topology
3I9SA 3F0AA 1Z4EA 2FIWA 1IIDA 2FS5A 2WPWA 4B10A 5JPHA 4JLYA 4B13A 2Z11A 4DNCA 3DDDA 3DNSA 4RS2A 4CYQA 2YNCC 3TOAA 1Z4RA 3FIXA 1L0CA 1Y9KA 4KOYA 4MFZA 5ISVA 5KTCA 2OZHA 3BJ7A 3PGPA 5EBVA 2EUIA 2Z3OA 1XF8A 2RC4A 1XIXA 4XNHB 2BL1A 5F48A 4MFLA 4KOUA 4QB9A 2D4OA 4MFKA 3TE4A 1IICA 3T9YA 4AVAA 3OWCA 2I79A 1QSNA 2Y0MA 2GE3A 3D2PA 1BO4A 4MJ8A 1YK3A 4KOWA 2BEIA 3FYNA 2PC1A 4E2AA 1VHSA 4LUAA 4JJXA 4CGNA 3T90A 2JDCA 3LD2A 4CGMA 3SXOA 4KSAA 4U9ZA 3S6GA 4ZGYB 3SXNA 1NSLA 4UA3A 3FRMA 2GANA 4X5KA 3D2MA 2ZW6A 4B12A 2JLMA 3W6XA 4BBHA 2Z10A 4MY3A 2FIAA 1YX0A 2WUUA 5DWMA 4CYPA 2R98A 5CNPA 4MFJA 3SHPA 2BSWA 1S7FA 4FD7A 4B11A 3PP9A 2Z3KA 2CNTA 3S6FA 4Y49C 4NSQA 2VZZA 5H86A 4KORA 5EC4A 1UFHA 2WSAA 3FBUA 4KLVA 3G3SA 3R9FA 2D4PA 4KUAA 5IX3A 4IF5A 2FE7A 1P4NA 4CRYB 4U9YA 2AJ6A 1MJAA 2ZXVA 4AG7A 4C7HA 2PR8A 2ARHA 1KZFA 5F49A 1S5KA 2P0WA 4C2XA 1NMTA 2Z3PA 4OLLA 3RYOA 3TTHA 1M4IA 4UFXA 3R95A 2R7HA 2FSRA 3FXTA 2Q4YA 1KUYA 4PSWA 4FD4A 4HKFA 3EXNA 3TO7A 5G1ZA 4A2ZA 2ZW5A 3GYAA 2B3UA 4U5YA 1YVOA 4B14A 5A27A 1K4JA 3IU2A 4OAEA 2PR1A 4H89A 5AG6A 5FVJA 2Q4VA 2DPTA 2J8RA 2PRBA 1M4GA 4JD6A 1VKCA 1J4JA 2B3VA 3E0KA 4R9MA 2J8MA 2Z3NA 1LRZA 4F0XA 1YREA 1MJ9A 2NMTA 1B87A 4QUSA 4KVXA 4MY0A 2ZPAA 4CAEA 1B6BA 3H4QA 1S7LA 3GY9A 3CXQA 1QSOA 4KSFA 3G8WA 3S6KA 4CAFA 3FNCA 1PUAA 4KZTA 5J8CA 2ZW4A 2Z3MA 4CAXA 3PZJA 3IU1A 2O28A 2P6FA 5BWAB 3R96A 4A33A 4XPDC 1V0CA 4YGOA 2B5GB 2ZW7A 4YFJA 1P0HA 3V8IA 2OB0A 2VI7A 4UWJA 5HH1A 3QAHA 1CM0A 1OZPA 1U6MA 2VZYA 5KTDA 4A95A 4PSXA 1XE4A 3UY5A 1PU9A 2C27A 2B4DB 1Y7RA 3TO9A 1XEBA 2FL4A 3P2HA 4MBUA 3IGRA 2P6GA 2Z0ZA 4C7IA 4CAVA 5F47A 3R1KA 1N71A 2Q04A 3LODA 3TOBA 4CYOA 1MK4A 4QBJA 4CAWA 2K5TA 4Q36A 2F5IA 4OADA 1S3ZA 4KS9A 1WWZA 1KUXA 3KKWA 4LX9A 3CXPA 1Q2CA 3F8KA 1S7NA 4KVOE 4NCZA 4F0YA 4F6AA 3IWEA 2VBQA 4XPDB 4R57A 1S60A 4CYNA 3NE7A 1Z9UA 5J8FA 2R8VA 3S6HA 2G3TA 4MFPA 2PSWA 2OH1A 2WPXA 4MI4A 5H84A 1BOBA 2I00A 1YR0A 1YGHA 2B4BA 1QSRA 1R57A 1YLEA 1KUVA 3EY5A 2R1IA 4JXRA 5G20A 3R9GA 1NE9A 2B5GA 4UBRA 4J3GA 4JXQA 4II9A 5AG4A 2EVNA 4KLWA 1I1DA 2IL4A 4CGOA 3TO6A 3D3SA 5JQ4A 2Q7BA 4FD5A 4AG9A 5DWNA 4QVTA 1Q2YA 2HUZA 2VQYA 4UCNA 1RXTA 2B4DA 3C26A 3QB8A 5G22A 3CXSA 4PV6A 3N7ZA 4KVME 2G0BA 3H5ZA 3BLNA 2ATRA 4A31A 2YNCA 3A9LA 4KOSA 4KOXA 3WR7A 4AVBA 4M85A 1RO5A 4XPLA 2FXFA 4E8OA 4ONUA 3JVNA 1Y9WA 3VWDA 4K30A 4B5PB 4Y49B 1TIQA 4XNHC 5E96A 4PK3A 2CY2A 4M3SA 4C2ZA 2GIVA 2DXQA 4UCPA 3GKRA 2G3AA 4HNYB 4BMHA 2CNSA 4QC6A 2CNMA 1M1DA 4YRHA 4H6ZA 4CS0B 3BJ8A 3ZJ0A 4C2YA 5G21A 4KUBA 4NF1A 1QSTA 3IWGA 2QIRA 2P6EA 4A32A 5IV0A 1SQHA 3B8GA 4UCMA 1M4DA 4HNWB 2YNEA 2X7BA 4H6UA 5F46A 4MFQA 4L8AA 3W91A 2REFA 4UFWA 4KOVA 4AB7A 2KCWA 5C88A 4L89A 1I12A 1IYLA 5A28A 2Z3LA 3MGDA 2B58A 2JEVA 3EC4A 4GS4A 3EFAA 5GCNA 2Q0YA 2PDOA 3TCVA 3VWEA 1GHEA 1IYKA 4ZBGA 4CGLA 4CRZB 1S7KA 4C68A 1FY7A 3ZZIA 4AVCA 4B5PA 4NEXA 2HV2A 3JTKA 5AG5A 2VXKA 1Q2DA 3EO4A 2QECA 4EVYA 4RI1A 5C82A 3DR8A 2BUEA 3W6SA 3D8PA 3TT2A 2DPSA 1WK4A 2J8NA 4XPKA 1ON0A 2JDDA 4UWIA 4JWPA 2OU2A 4MHDA 3P2FA 1M44A 2QMLA 2OZGA 4R87A 5IB0A 2H5MA 2FT0A 3FB3A 4E0AA 2FCKA 4R3LA 4ORFA 4B5OA 2CXAA 3DR6A 2YGWA 4IUSA 3R9EA 2AE6A 1IB1E 4CGPA 3JUWA 1ZO0A 3F5BA 4A30A 1I21A 1QSMA 4FD6A 1XMTA 2VEZA 3K9UA 2REEA 4Q38A 5I0CA 2OZUA 2HQYA 2Q44A 5HMNA 4PK2A 4I49A 5AG7A 1YVKA 1MJBA 3I3GA 4HNXB 2YNDA 4KOTA 4NXYA 1CJWA 5KTAA 4UFVA 2A4NA 3DSBA 5AGEA 3TFYA 2PQ8A 4R3KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I9S A;  3F0A A;  1Z4E A;  2FIW A;  1IID A;  2FS5 A;  2WPW A;  5JPH A;  4JLY A;  2Z11 A;  4DNC A;  3DDD A;  3DNS A;  4RS2 A;  3TOA A;  1Z4R A;  3FIX A;  1L0C A;  1Y9K A;  4KOY A;  5ISV A;  5KTC A;  2OZH A;  3BJ7 A;  3PGP A;  5EBV A;  2EUI A;  1XF8 A;  2RC4 A;  1XIX A;  4XNH B;  2BL1 A;  5F48 A;  4KOU A;  4QB9 A;  2D4O A;  3TE4 A;  1IIC A;  3T9Y A;  4AVA A;  3OWC A;  2I79 A;  1QSN A;  2Y0M A;  2GE3 A;  3D2P A;  1BO4 A;  4MJ8 A;  1YK3 A;  4KOW A;  2BEI A;  3FYN A;  2PC1 A;  4E2A A;  1VHS A;  4LUA A;  4JJX A;  3T90 A;  2JDC A;  3LD2 A;  3SXO A;  4U9Z A;  3S6G A;  3SXN A;  1NSL A;  4UA3 A;  3FRM A;  2GAN A;  4X5K A;  3D2M A;  2ZW6 A;  2JLM A;  3W6X A;  2Z10 A;  4MY3 A;  2FIA A;  1YX0 A;  5DWM A;  2R98 A;  5CNP A;  3SHP A;  2BSW A;  1S7F A;  4FD7 A;  3PP9 A;  2CNT A;  3S6F A;  4Y49 C;  4NSQ A;  2VZZ A;  5H86 A;  4KOR A;  5EC4 A;  1UFH A;  3FBU A;  4KLV A;  3G3S A;  3R9F A;  2D4P A;  4KUA A;  5IX3 A;  4IF5 A;  2FE7 A;  1P4N A;  4CRY B;  4U9Y A;  2AJ6 A;  1MJA A;  2ZXV A;  4AG7 A;  2PR8 A;  2ARH A;  1KZF A;  5F49 A;  1S5K A;  2P0W A;  1NMT A;  4OLL A;  3RYO A;  3TTH A;  1M4I A;  3R95 A;  2R7H A;  2FSR A;  3FXT A;  2Q4Y A;  1KUY A;  4PSW A;  4FD4 A;  4HKF A;  3EXN A;  3TO7 A;  2ZW5 A;  3GYA A;  2B3U A;  4U5Y A;  1YVO A;  1K4J A;  4OAE A;  2PR1 A;  4H89 A;  5FVJ A;  2Q4V A;  2PRB A;  2J8R A;  1M4G A;  4JD6 A;  1VKC A;  1J4J A;  2B3V A;  3E0K A;  4R9M A;  2J8M A;  1LRZ A;  1YRE A;  1MJ9 A;  2NMT A;  1B87 A;  4QUS A;  4KVX A;  4MY0 A;  2ZPA A;  1B6B A;  3H4Q A;  1S7L A;  3GY9 A;  3CXQ A;  1QSO A;  3G8W A;  3S6K A;  3FNC A;  1PUA A;  4KZT A;  5J8C A;  2ZW4 A;  4CAX A;  3PZJ A;  2O28 A;  2P6F A;  3R96 A;  4XPD C;  1V0C A;  4YGO A;  2B5G B;  2ZW7 A;  4YFJ A;  1P0H A;  3V8I A;  2OB0 A;  2VI7 A;  4UWJ A;  5HH1 A;  3QAH A;  1CM0 A;  1OZP A;  1U6M A;  2VZY A;  5KTD A;  4PSX A;  1XE4 A;  3UY5 A;  1PU9 A;  2C27 A;  2B4D B;  1Y7R A;  3TO9 A;  1XEB A;  2FL4 A;  3P2H A;  4MBU A;  3IGR A;  2P6G A;  2Z0Z A;  4CAV A;  5F47 A;  3R1K A;  1N71 A;  2Q04 A;  3LOD A;  3TOB A;  1MK4 A;  4QBJ A;  4CAW A;  2K5T A;  2F5I A;  4OAD A;  1S3Z A;  1WWZ A;  1KUX A;  3KKW A;  4LX9 A;  3CXP A;  1Q2C A;  3F8K A;  1S7N A;  4KVO E;  4NCZ A;  4F0Y A;  4F6A A;  2VBQ A;  4XPD B;  4R57 A;  1S60 A;  3NE7 A;  1Z9U A;  5J8F A;  2R8V A;  3S6H A;  2G3T A;  2PSW A;  2OH1 A;  2WPX A;  4MI4 A;  5H84 A;  1BOB A;  2I00 A;  1YR0 A;  1YGH A;  2B4B A;  1QSR A;  1R57 A;  1YLE A;  1KUV A;  3EY5 A;  2R1I A;  4JXR A;  3R9G A;  1NE9 A;  2B5G A;  4UBR A;  4J3G A;  4JXQ A;  4II9 A;  2EVN A;  4KLW A;  1I1D A;  2IL4 A;  3TO6 A;  3D3S A;  5JQ4 A;  2Q7B A;  4FD5 A;  4AG9 A;  5DWN A;  4QVT A;  1Q2Y A;  2HUZ A;  2VQY A;  1RXT A;  2B4D A;  3C26 A;  3QB8 A;  3CXS A;  4PV6 A;  3N7Z A;  4KVM E;  2G0B A;  3BLN A;  2ATR A;  4KOS A;  4KOX A;  3WR7 A;  4AVB A;  4M85 A;  1RO5 A;  4XPL A;  2FXF A;  4E8O A;  4ONU A;  3JVN A;  1Y9W A;  3VWD A;  4K30 A;  4B5P B;  4Y49 B;  1TIQ A;  4XNH C;  5E96 A;  4PK3 A;  2CY2 A;  4M3S A;  2GIV A;  2DXQ A;  3GKR A;  2G3A A;  4HNY B;  4BMH A;  2CNS A;  4QC6 A;  2CNM A;  1M1D A;  4YRH A;  4H6Z A;  4CS0 B;  3BJ8 A;  3ZJ0 A;  4KUB A;  4NF1 A;  1QST A;  3IWG A;  2QIR A;  2P6E A;  5IV0 A;  1SQH A;  3B8G A;  1M4D A;  4HNW B;  2X7B A;  4H6U A;  5F46 A;  4L8A A;  3W91 A;  2REF A;  4KOV A;  4AB7 A;  2KCW A;  5C88 A;  4L89 A;  1I12 A;  1IYL A;  3MGD A;  2B58 A;  2JEV A;  3EC4 A;  4GS4 A;  3EFA A;  5GCN A;  2Q0Y A;  2PDO A;  3TCV A;  3VWE A;  1GHE A;  1IYK A;  4ZBG A;  4CRZ B;  1S7K A;  1FY7 A;  3ZZI A;  4AVC A;  4B5P A;  4NEX A;  2HV2 A;  2VXK A;  1Q2D A;  3EO4 A;  2QEC A;  4EVY A;  4RI1 A;  5C82 A;  3DR8 A;  2BUE A;  3W6S A;  3D8P A;  3TT2 A;  1WK4 A;  2J8N A;  4XPK A;  1ON0 A;  2JDD A;  4UWI A;  4JWP A;  2OU2 A;  4MHD A;  3P2F A;  1M44 A;  2QML A;  2OZG A;  4R87 A;  5IB0 A;  2H5M A;  2FT0 A;  3FB3 A;  4E0A A;  2FCK A;  4R3L A;  4ORF A;  4B5O A;  3DR6 A;  4IUS A;  3R9E A;  2AE6 A;  1IB1 E;  3JUW A;  3F5B A;  1I21 A;  1QSM A;  4FD6 A;  1XMT A;  2VEZ A;  3K9U A;  2REE A;  5I0C A;  2OZU A;  2HQY A;  2Q44 A;  5HMN A;  4PK2 A;  4I49 A;  1YVK A;  1MJB A;  3I3G A;  4HNX B;  4KOT A;  4NXY A;  1CJW A;  5KTA A;  2A4N A;  3DSB A;  3TFY A;  2PQ8 A;  4R3K A; 
#chains in the Genus database with same CATH topology
 3I9S A;  3F0A A;  1Z4E A;  3GLJ A;  2FIW A;  4X8I A;  3B3V A;  1IID A;  1VHE A;  2FS5 A;  2GLF A;  2WPW A;  3KI9 A;  3B3S A;  4B10 A;  3PEI A;  5JPH A;  4JLY A;  1RTQ A;  4B13 A;  3JRU A;  2HC9 A;  1YW4 A;  2Z11 A;  4DNC A;  3DDD A;  2PJ3 A;  2PIY A;  3DNS A;  5JGF A;  3TFY A;  4RS2 A;  3IFE A;  1BPM A;  4CYQ A;  2YNC C;  3KQZ A;  1PCA A;  2PJ4 A;  3FED A;  3T8W A;  1YME A;  2ZEO A;  3TOA A;  4OC3 A;  4P4B A;  4MCP A;  1Z4R A;  3FIX A;  1L0C A;  1Y9K A;  1AYE A;  4KOY A;  4MFZ A;  5ISV A;  3SI2 A;  3FF3 A;  3GIU A;  1FNO A;  2OZH A;  5KTC A;  3BJ7 A;  3PGP A;  5EBV A;  2EUI A;  2AFX A;  2Z3O A;  1XF8 A;  3N5F A;  3TC8 A;  2RC4 A;  2PJ5 A;  1XIX A;  2GRE A;  4XNH B;  2BL1 A;  3PB8 X;  3FJU A;  5F48 A;  4MFL A;  4KOU A;  2CF4 A;  4QB9 A;  5LRJ A;  2D4O A;  4MFK A;  3TE4 A;  1IIC A;  1BAV A;  3T9Y A;  4AVA A;  1A2Z A;  3OWC A;  2I79 A;  4NGQ A;  1QSN A;  2Y0M A;  4LQ6 A;  2GE3 A;  1AMP A;  2NYQ A;  3D2P A;  1BO4 A;  4MJ8 A;  1YK3 A;  4KOW A;  4NGR A;  3HLP A;  4GXH A;  2BEI A;  4NGM A;  1ELM P;  3FYN A;  2PC1 A;  4E2A A;  1Z8X A;  1VHO A;  1VHS A;  4LUA A;  4JJX A;  4CGN A;  2QYV A;  1EE3 P;  3T90 A;  2JDC A;  3LD2 A;  3D7G A;  4P44 A;  4CGM A;  3SXO A;  4KSA A;  4P6Y A;  2V8V A;  2NSM A;  3TX8 A;  4U9Z A;  3S6G A;  4ZGY B;  4G1P A;  5LYD A;  4MRI A;  1NSL A;  4UA3 A;  3MN8 A;  3SXN A;  3FRM A;  2GAN A;  1TKJ A;  4X5K A;  3DLJ A;  1IOI A;  4PXC A;  3VH9 A;  3D2M A;  2ZW6 A;  4B12 A;  2JLM A;  3W6X A;  4BBH A;  1BPN A;  1TF9 A;  2Z10 A;  3K2K A;  4NGT A;  3PB9 X;  1KWM A;  2FIA A;  4MY3 A;  3FEC A;  1R3N A;  1YX0 A;  2PCU A;  2WUU A;  4NGN A;  4OME A;  3SI1 A;  2RB7 A;  5DWM A;  4CYP A;  5LYL A;  2R98 A;  1CBX A;  2EK9 A;  3BXM A;  5CNP A;  4YWY A;  3S9L A;  1QQ9 A;  3D7F A;  4MFJ A;  1IY7 A;  3SHP A;  2BSW A;  1S7F A;  4FD7 A;  4B11 A;  4UEZ A;  2QJ8 A;  3PP9 A;  5CBM A;  2Z3K A;  3D66 A;  2CNT A;  3S6F A;  4Y49 C;  5LYI A;  4PXD A;  4NSQ A;  3B3C A;  2VZZ A;  3B3W A;  5H86 A;  4KOR A;  5EC4 A;  3H8E A;  1ARM A;  1UFH A;  3PFO A;  2JBJ A;  1F2P A;  2WSA A;  4P10 A;  1VGY A;  1AUG A;  2ZED A;  3FBU A;  3PB4 X;  4KLV A;  3G3S A;  3V7Z A;  1YQE A;  2PJB A;  2D4P A;  4KUA A;  3R9F A;  5IX3 A;  4IF5 A;  2FE7 A;  1Z8T A;  1P4N A;  4M6I A;  2J9A A;  4TNU A;  2PJ1 A;  1Z8L A;  4U9Y A;  5CPA A;  2AJ6 A;  3B3T A;  1MJA A;  2ZXV A;  3ISZ A;  3KR5 A;  4UEF A;  4AG7 A;  2PR8 A;  4C7H A;  2ARH A;  1KZF A;  5F49 A;  1S5K A;  4KSI A;  4F8Z A;  2IJZ A;  3GB0 A;  2P0W A;  3V38 A;  1ARL A;  4C2X A;  4NFR A;  3NA6 A;  2PJ0 A;  1NMT A;  2Z3P A;  4NJQ A;  4OLL A;  4MHZ A;  1M4I A;  3RYO A;  3TTH A;  2AFZ A;  4DUK A;  4UFX A;  3R95 A;  1CPS A;  2R7H A;  2FSR A;  3NH4 A;  4DJL A;  3FXT A;  2Q4Y A;  5HVF A;  1TF8 A;  1HDQ A;  4WWV A;  1KUY A;  2PJA A;  4PSW A;  4FD4 A;  4HKF A;  3EXN A;  4MHY A;  3TO7 A;  5G1Z A;  4A2Z A;  2ZW5 A;  3LAC A;  3GYA A;  1XFO A;  2B3U A;  4U5Y A;  1XRY A;  1Z8W A;  3LWU A;  4NGS A;  4JZ0 A;  4A39 A;  1YVO A;  4B14 A;  2DEA A;  4NGP A;  5A27 A;  1K4J A;  3IU2 A;  4OAE A;  4ZY2 A;  2PR1 A;  4H89 A;  5AG6 A;  5FVJ A;  2Q4V A;  1XBU A;  2DPT A;  2J8R A;  2PRB A;  4ZY0 A;  2CTB A;  1M4G A;  4JD6 A;  2GLJ A;  1J4J A;  2B3V A;  4A94 A;  3E0K A;  2PRQ A;  5K8N A;  3KQX A;  3GUX A;  4OIW A;  2J8M A;  4R9M A;  5LRK A;  3CPA A;  2ANP A;  2Z3N A;  1LRZ A;  3FMC A;  1YRE A;  4F0X A;  1MJ9 A;  3D7D A;  2NMT A;  1B87 A;  4QUS A;  4KVX A;  3KGQ A;  2JEW A;  2AFM A;  2C6C A;  4MY0 A;  4F9U A;  1JWQ A;  2EK8 A;  2ZPA A;  4CAE A;  1B6B A;  3D68 A;  1LAN A;  3H4Q A;  1IOF A;  1S7L A;  3FVL A;  3H8F A;  8CPA A;  3GY9 A;  1CP7 A;  2O4H A;  1QSO A;  3CXQ A;  3PRT A;  4KSF A;  3WC7 A;  3K9T A;  3L2N A;  1YW6 A;  3G8W A;  3S6K A;  1LAP A;  4MHP A;  4CAF A;  3FNC A;  5K8O A;  1PUA A;  2PJ7 A;  4KZT A;  5J1Q A;  4CPA A;  5J8C A;  2ZEM A;  2Z3M A;  2ZW4 A;  4CAX A;  3PZJ A;  3IU1 A;  2O28 A;  2P6F A;  5BWA B;  4X2T A;  3R96 A;  4A33 A;  4GM5 A;  2ZEF A;  4ZI6 A;  2Q7S A;  4XPD C;  4FUU A;  2GFQ A;  4JYW A;  4OC4 A;  4UIA A;  1V0C A;  4YGO A;  2B5G B;  2ZW7 A;  4YFJ A;  1P0H A;  1JQG A;  2BCO A;  4ZY1 A;  2FVG A;  4OC0 A;  3FEE A;  3V8I A;  2OB0 A;  2PJ2 A;  2VI7 A;  1X12 A;  3PB6 X;  4UWJ A;  5HH1 A;  1TKH A;  2Q4Z A;  3QAH A;  1CM0 A;  5JM6 A;  1OZP A;  3KAS A;  1U6M A;  2VZY A;  2Q51 A;  2PIZ A;  5KTD A;  4A95 A;  3S9M A;  4PSX A;  1XE4 A;  3UY5 A;  1PU9 A;  2JBK A;  4EME A;  3WC5 A;  2C27 A;  2B4D B;  1Y7R A;  6CPA A;  3TO9 A;  2PVV A;  1XEB A;  5D29 A;  3KR4 A;  2V77 A;  2FL4 A;  3CT9 A;  4M6H A;  3P2H A;  4MBU A;  2G9D A;  4YU9 A;  2PJ9 A;  3IGR A;  3SJE A;  2P6G A;  2Z0Z A;  3NFZ A;  4C7I A;  4CAV A;  4P4E A;  2BO9 A;  5F47 A;  3R1K A;  1N71 A;  2Q04 A;  3LOD A;  3RNZ A;  1Q7L A;  3TOB A;  4MHN A;  4CYO A;  1MK4 A;  2PE3 A;  3ISX A;  4QBJ A;  4CAW A;  2K5T A;  4Q36 A;  2F5I A;  2OR4 A;  2QVP A;  4OAD A;  1F2O A;  5THW A;  1QMU A;  1S3Z A;  2BOA A;  2XEI A;  3MRU A;  4KS9 A;  1WWZ A;  1KUX A;  3KKW A;  4LX9 A;  5HVH A;  3CXP A;  1Q2C A;  3F8K A;  4FBE A;  1S7N A;  2Q43 A;  4KVO E;  4MMO A;  4NCZ A;  4F0Y A;  4F6A A;  3IWE A;  2VBQ A;  4M6G A;  4XPD B;  4R57 A;  1S60 A;  4CYN A;  2WYR A;  2IMO A;  1Z9U A;  3NE7 A;  4X3R A;  1ZLI A;  5J8F A;  2R8V A;  3KHX A;  3S6H A;  2G3T A;  4MFP A;  2PSW A;  2ABZ A;  2OH1 A;  2WPX A;  4H2K A;  1BOB A;  4MI4 A;  5H84 A;  2I00 A;  1YR0 A;  2PQ8 A;  4B6Z A;  5JH9 A;  1YGH A;  2B4B A;  1QSR A;  1R57 A;  1YLE A;  1KUV A;  2IQ6 A;  1FT7 A;  3CZX A;  3EY5 A;  2R1I A;  3IO1 A;  4JXR A;  4K3N A;  5G20 A;  3CPX A;  3R9G A;  1NE9 A;  2CIJ A;  2B5G A;  3IC1 A;  4UBR A;  4P4F A;  4AXV A;  4J3G A;  3SI0 A;  1UWY A;  4JXQ A;  1VIX A;  4IK2 A;  5AG4 A;  4II9 A;  3RAM A;  4OC1 A;  2EVN A;  4KLW A;  1I1D A;  1CX8 A;  2IL4 A;  3TO6 A;  3WC6 A;  4BD9 A;  4P45 A;  4CGO A;  2V8D A;  3D3S A;  5JQ4 A;  2Q7B A;  4FD5 A;  2XEG A;  3IEH A;  2RFH A;  4AG9 A;  1HEE A;  5DWN A;  1YLO A;  1YSJ A;  1HDU A;  4P4D A;  4QVT A;  1Q2Y A;  1Z2L A;  2HUZ A;  2VQY A;  4UCN A;  1RXT A;  2B4D A;  4P4J A;  4BIN A;  3SJF A;  3C26 A;  3QB8 A;  4MCQ A;  5G22 A;  4O23 A;  2AFS A;  3CXS A;  4PV6 A;  3N7Z A;  3VAR A;  1X10 A;  4KVM E;  2G0B A;  3H5Z A;  1TKF A;  3BLN A;  2ATR A;  1CP6 A;  3DGV A;  4A31 A;  4PXB A;  2YNC A;  1DE4 C;  1LCP A;  3A9L A;  4KOS A;  4OKO A;  4KOX A;  2OOT A;  3WR7 A;  4AVB A;  1IGB A;  2EO8 A;  2GU2 A;  2O53 A;  4M85 A;  4RUH A;  3B7I A;  1RO5 A;  4XPL A;  2FXF A;  2ZEG A;  3D67 A;  4ONU A;  3RBU A;  4E8O A;  2ZEH A;  1Y9W A;  3JVN A;  4Q7A A;  4UEE A;  3VWD A;  4CRY B;  4K30 A;  3B2Y A;  4Y49 B;  1CG2 A;  4B5P B;  3PB7 X;  1TIQ A;  4NJR A;  4XNH C;  5E96 A;  4PK3 A;  2CY2 A;  4M3S A;  4C2Z A;  2GIV A;  1Y7E A;  2DXQ A;  4UCP A;  3GKR A;  2G3A A;  4HNY B;  4MCS A;  1XOV A;  4BMH A;  2CNS A;  4QC6 A;  1LFW A;  2PVW A;  1ZG8 A;  4ZYQ A;  2CNM A;  3FX6 A;  5D8N A;  5HVG A;  2POK A;  1M1D A;  2HB6 A;  1ZLH A;  4YRH A;  4H6Z A;  4CS0 B;  3FH4 A;  3BJ8 A;  2EBJ A;  3ZJ0 A;  4C2Y A;  5G21 A;  4KUB A;  4NF1 A;  1QST A;  4PXE A;  3IWG A;  5IB9 A;  3NE8 A;  3I1U A;  2QIR A;  1M4L A;  1XMB A;  2I3C A;  2P6E A;  4F9V A;  4A32 A;  5IV0 A;  3KZW A;  2ZEN A;  3SJG A;  4LQG A;  1SQH A;  2EWB A;  2PJ6 A;  3RZA A;  1F57 A;  3B8G A;  4UCM A;  1M4D A;  4MCR A;  4HNW B;  2YNE A;  2X7B A;  4H6U A;  5F46 A;  4MFQ A;  4L8A A;  3W91 A;  2REF A;  4UFW A;  4KOV A;  4AB7 A;  4UIB A;  2KCW A;  1LAM A;  3H8G A;  3BHX A;  5C88 A;  1XJO A;  4L89 A;  1I12 A;  1IYL A;  5A28 A;  2Z3L A;  3MGD A;  2B58 A;  1ZG9 A;  2JEV A;  3EC4 A;  3HUV A;  4GS4 A;  4MXU A;  3EFA A;  5GCN A;  3WAB A;  2Q0Y A;  3QAY A;  2C6G A;  2PDO A;  3TCV A;  4RN7 A;  3RO0 A;  3VWE A;  1GHE A;  1IYK A;  2ODF A;  3NH8 A;  4ZBG A;  4CGL A;  2CTC A;  2C1C A;  4ONW A;  4DYO A;  2WZN A;  5DS0 A;  7CPA A;  5ELY A;  5LYF A;  3PFE A;  4CRZ B;  1S7K A;  3PBE A;  4R76 A;  4OC5 A;  4C68 A;  3IJ3 A;  1FY7 A;  3ZZI A;  4AVC A;  2C6P A;  4B5P A;  4NEX A;  3D4U A;  2HV2 A;  4R7M A;  2XEF A;  3JTK A;  5AG5 A;  1ZG7 A;  2XEJ A;  4WJB A;  1CPX A;  4OC2 A;  2VXK A;  1Q2D A;  4PPZ A;  2AFU A;  3EO4 A;  2QEC A;  4EVY A;  4RI1 A;  4W9Y A;  5C82 A;  4OP4 A;  3DR8 A;  1BLL E;  2BUE A;  3W6S A;  3D8P A;  3TT2 A;  2DPS A;  2ZEE A;  5EMI A;  1WK4 A;  2J8N A;  2AFW A;  4XPK A;  1NSA A;  1ON0 A;  2JDD A;  4UWI A;  4JWP A;  3IIB A;  2VL1 A;  4TWE A;  2F8H A;  2OU2 A;  3WT4 A;  4MHD A;  3P2F A;  1PYT B;  1M44 A;  2QML A;  3BI0 A;  2ZEP A;  4FAI A;  4A38 A;  1DTD A;  2OZG A;  4R87 A;  3D7H A;  3B35 A;  3QNV A;  3KL9 A;  5IB0 A;  2PJ8 A;  2H5M A;  2FT0 A;  3FB3 A;  1TXR A;  4E0A A;  2FCK A;  4R3L A;  2F7V A;  2DF5 A;  4ORF A;  4B5O A;  4A37 A;  4P4I A;  1ELL P;  1OBR A;  2CXA A;  3DR6 A;  4Z65 A;  5K8P A;  2YGW A;  4IUS A;  1LOK A;  2AFO A;  3R9E A;  1R43 A;  1IB1 E;  2AE6 A;  4R8F A;  4CGP A;  3JUW A;  4EWT A;  1ZO0 A;  4ZX9 A;  5F09 A;  3F5B A;  4R6T A;  4A30 A;  1I21 A;  3CDX A;  3KHZ A;  5K8M A;  1QSM A;  3PBB A;  4FD6 A;  4FWU A;  3BI1 A;  1XMT A;  1IU8 A;  1Z5R A;  4OID A;  4EFD A;  2VEZ A;  3K9U A;  3SJX A;  2REE A;  4Q38 A;  4ZX8 A;  1GYT A;  5I0C A;  1Y0Y A;  2OZU A;  2PJC A;  2HQY A;  3VAT A;  2Q44 A;  5LRG A;  5HMN A;  4PQA A;  3IWW A;  3LMS A;  4PK2 A;  2ZEL A;  4I49 A;  5AG7 A;  1YVK A;  4HPS A;  5HXD A;  2ZOG A;  1MJB A;  4UF4 A;  3I3G A;  2V8G A;  3NH5 A;  4HNX B;  2YND A;  4KOT A;  2ZOF A;  4NXY A;  1CJW A;  1Y0R A;  2V8H A;  5KTA A;  4IHM A;  4UFV A;  2A4N A;  3DSB A;  5AGE A;  1H8L A;  5I4M A;  3S9N A;  4IAV A;  1VKC A;  4R3K A; 
#chains in the Genus database with same CATH homology
 3I9S A;  3F0A A;  1Z4E A;  2FIW A;  1IID A;  2FS5 A;  2WPW A;  4B10 A;  5JPH A;  4JLY A;  4B13 A;  2Z11 A;  4DNC A;  3DDD A;  3DNS A;  4RS2 A;  4CYQ A;  2YNC C;  3TOA A;  1Z4R A;  3FIX A;  1L0C A;  1Y9K A;  4KOY A;  4MFZ A;  5ISV A;  5KTC A;  2OZH A;  3BJ7 A;  3PGP A;  5EBV A;  2EUI A;  2Z3O A;  1XF8 A;  2RC4 A;  1XIX A;  4XNH B;  2BL1 A;  5F48 A;  4MFL A;  4KOU A;  4QB9 A;  2D4O A;  4MFK A;  3TE4 A;  1IIC A;  3T9Y A;  4AVA A;  3OWC A;  2I79 A;  1QSN A;  2Y0M A;  2GE3 A;  3D2P A;  1BO4 A;  4MJ8 A;  1YK3 A;  4KOW A;  2BEI A;  3FYN A;  2PC1 A;  4E2A A;  1VHS A;  4LUA A;  4JJX A;  4CGN A;  3T90 A;  2JDC A;  3LD2 A;  4CGM A;  3SXO A;  4KSA A;  4U9Z A;  3S6G A;  4ZGY B;  3SXN A;  1NSL A;  4UA3 A;  3FRM A;  2GAN A;  4X5K A;  3D2M A;  2ZW6 A;  4B12 A;  2JLM A;  3W6X A;  4BBH A;  2Z10 A;  4MY3 A;  2FIA A;  1YX0 A;  2WUU A;  5DWM A;  4CYP A;  2R98 A;  5CNP A;  4MFJ A;  3SHP A;  2BSW A;  1S7F A;  4FD7 A;  4B11 A;  3PP9 A;  2Z3K A;  2CNT A;  3S6F A;  4Y49 C;  4NSQ A;  2VZZ A;  5H86 A;  4KOR A;  5EC4 A;  1UFH A;  2WSA A;  3FBU A;  4KLV A;  3G3S A;  3R9F A;  2D4P A;  4KUA A;  5IX3 A;  4IF5 A;  2FE7 A;  1P4N A;  4CRY B;  4U9Y A;  2AJ6 A;  1MJA A;  2ZXV A;  4AG7 A;  4C7H A;  2PR8 A;  2ARH A;  1KZF A;  5F49 A;  1S5K A;  2P0W A;  4C2X A;  1NMT A;  2Z3P A;  4OLL A;  3RYO A;  3TTH A;  1M4I A;  4UFX A;  3R95 A;  2R7H A;  2FSR A;  3FXT A;  2Q4Y A;  1KUY A;  4PSW A;  4FD4 A;  4HKF A;  3EXN A;  3TO7 A;  5G1Z A;  4A2Z A;  2ZW5 A;  3GYA A;  2B3U A;  4U5Y A;  1YVO A;  4B14 A;  5A27 A;  1K4J A;  3IU2 A;  4OAE A;  2PR1 A;  4H89 A;  5AG6 A;  5FVJ A;  2Q4V A;  2DPT A;  2J8R A;  2PRB A;  1M4G A;  4JD6 A;  1VKC A;  1J4J A;  2B3V A;  3E0K A;  4R9M A;  2J8M A;  2Z3N A;  1LRZ A;  4F0X A;  1YRE A;  1MJ9 A;  2NMT A;  1B87 A;  4QUS A;  4KVX A;  4MY0 A;  2ZPA A;  4CAE A;  1B6B A;  3H4Q A;  1S7L A;  3GY9 A;  3CXQ A;  1QSO A;  4KSF A;  3G8W A;  3S6K A;  4CAF A;  3FNC A;  1PUA A;  4KZT A;  5J8C A;  2ZW4 A;  2Z3M A;  4CAX A;  3PZJ A;  3IU1 A;  2O28 A;  2P6F A;  5BWA B;  3R96 A;  4A33 A;  4XPD C;  1V0C A;  4YGO A;  2B5G B;  2ZW7 A;  4YFJ A;  1P0H A;  3V8I A;  2OB0 A;  2VI7 A;  4UWJ A;  5HH1 A;  3QAH A;  1CM0 A;  1OZP A;  1U6M A;  2VZY A;  5KTD A;  4A95 A;  4PSX A;  1XE4 A;  3UY5 A;  1PU9 A;  2C27 A;  2B4D B;  1Y7R A;  3TO9 A;  1XEB A;  2FL4 A;  3P2H A;  4MBU A;  3IGR A;  2P6G A;  2Z0Z A;  4C7I A;  4CAV A;  5F47 A;  3R1K A;  1N71 A;  2Q04 A;  3LOD A;  3TOB A;  4CYO A;  1MK4 A;  4QBJ A;  4CAW A;  2K5T A;  4Q36 A;  2F5I A;  4OAD A;  1S3Z A;  4KS9 A;  1WWZ A;  1KUX A;  3KKW A;  4LX9 A;  3CXP A;  1Q2C A;  3F8K A;  1S7N A;  4KVO E;  4NCZ A;  4F0Y A;  4F6A A;  3IWE A;  2VBQ A;  4XPD B;  4R57 A;  1S60 A;  4CYN A;  3NE7 A;  1Z9U A;  5J8F A;  2R8V A;  3S6H A;  2G3T A;  4MFP A;  2PSW A;  2OH1 A;  2WPX A;  4MI4 A;  5H84 A;  1BOB A;  2I00 A;  1YR0 A;  1YGH A;  2B4B A;  1QSR A;  1R57 A;  1YLE A;  1KUV A;  3EY5 A;  2R1I A;  4JXR A;  5G20 A;  3R9G A;  1NE9 A;  2B5G A;  4UBR A;  4J3G A;  4JXQ A;  4II9 A;  5AG4 A;  2EVN A;  4KLW A;  1I1D A;  2IL4 A;  4CGO A;  3TO6 A;  3D3S A;  5JQ4 A;  2Q7B A;  4FD5 A;  4AG9 A;  5DWN A;  4QVT A;  1Q2Y A;  2HUZ A;  2VQY A;  4UCN A;  1RXT A;  2B4D A;  3C26 A;  3QB8 A;  5G22 A;  3CXS A;  4PV6 A;  3N7Z A;  4KVM E;  2G0B A;  3H5Z A;  3BLN A;  2ATR A;  4A31 A;  2YNC A;  3A9L A;  4KOS A;  4KOX A;  3WR7 A;  4AVB A;  4M85 A;  1RO5 A;  4XPL A;  2FXF A;  4E8O A;  4ONU A;  3JVN A;  1Y9W A;  3VWD A;  4K30 A;  4B5P B;  4Y49 B;  1TIQ A;  4XNH C;  5E96 A;  4PK3 A;  2CY2 A;  4M3S A;  4C2Z A;  2GIV A;  2DXQ A;  4UCP A;  3GKR A;  2G3A A;  4HNY B;  4BMH A;  2CNS A;  4QC6 A;  2CNM A;  1M1D A;  4YRH A;  4H6Z A;  4CS0 B;  3BJ8 A;  3ZJ0 A;  4C2Y A;  5G21 A;  4KUB A;  4NF1 A;  1QST A;  3IWG A;  2QIR A;  2P6E A;  4A32 A;  5IV0 A;  1SQH A;  3B8G A;  4UCM A;  1M4D A;  4HNW B;  2YNE A;  2X7B A;  4H6U A;  5F46 A;  4MFQ A;  4L8A A;  3W91 A;  2REF A;  4UFW A;  4KOV A;  4AB7 A;  2KCW A;  5C88 A;  4L89 A;  1I12 A;  1IYL A;  5A28 A;  2Z3L A;  3MGD A;  2B58 A;  2JEV A;  3EC4 A;  4GS4 A;  3EFA A;  5GCN A;  2Q0Y A;  2PDO A;  3TCV A;  3VWE A;  1GHE A;  1IYK A;  4ZBG A;  4CGL A;  4CRZ B;  1S7K A;  4C68 A;  1FY7 A;  3ZZI A;  4AVC A;  4B5P A;  4NEX A;  2HV2 A;  3JTK A;  5AG5 A;  2VXK A;  1Q2D A;  3EO4 A;  2QEC A;  4EVY A;  4RI1 A;  5C82 A;  3DR8 A;  2BUE A;  3W6S A;  3D8P A;  3TT2 A;  2DPS A;  1WK4 A;  2J8N A;  4XPK A;  1ON0 A;  2JDD A;  4UWI A;  4JWP A;  2OU2 A;  4MHD A;  3P2F A;  1M44 A;  2QML A;  2OZG A;  4R87 A;  5IB0 A;  2H5M A;  2FT0 A;  3FB3 A;  4E0A A;  2FCK A;  4R3L A;  4ORF A;  4B5O A;  2CXA A;  3DR6 A;  2YGW A;  4IUS A;  3R9E A;  2AE6 A;  1IB1 E;  4CGP A;  3JUW A;  1ZO0 A;  3F5B A;  4A30 A;  1I21 A;  1QSM A;  4FD6 A;  1XMT A;  2VEZ A;  3K9U A;  2REE A;  4Q38 A;  5I0C A;  2OZU A;  2HQY A;  2Q44 A;  5HMN A;  4PK2 A;  4I49 A;  5AG7 A;  1YVK A;  1MJB A;  3I3G A;  4HNX B;  2YND A;  4KOT A;  4NXY A;  1CJW A;  5KTA A;  4UFV A;  2A4N A;  3DSB A;  5AGE A;  3TFY A;  2PQ8 A;  4R3K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...