3R9EA

Crystal structure of microcin c7 self immunity acetyltransferase mcce in complex with coenzyme a and aspartyl sulfamoyl adenosine (dsa)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
180
structure length
180
Chain Sequence
DVSLTPSGIKVNDEITLLYPALKYAEELYLLINQNKINFIKSMAWPAFVNNISDSVSFIEQSMIDNQNEKALILFIKYKTKIAGVVSFNIIDHANKTAYIGYWLGANFQGKGIVTNAINKLIQEYGDSGVIKRFVIKCIVDNKKSNATALRCGFTLEGVLQKAEILNGVSYDQNIYSKVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccE protein
publication title Structural Basis for Microcin C7 Inactivation by the MccE Acetyltransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 55
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3r9eA00
5J8CA 1M44A 1QSMA 1Q2CA 2Q44A 3FXTA 4FD4A 5HH1A 2JEVA 2D4PA 4MJ8A 2Q4VA 1N71A 1S7NA 3SXNA 1XMTA 4NSQA 4AVBA 2KCWA 3CXQA 4ORFA 2A4NA 2H5MA 4F6AA 3B8GA 5F49A 1IIDA 4FD7A 3W91A 2F5IA 3GYAA 1XF8A 2VBQA 2GANA 2VI7A 2VQYA 2VZZA 1S7KA 4LUAA 2P6EA 4UWJA 4F0YA 4KOUA 3F8KA 2PQ8A 1R57A 3DSBA 4QUSA 5F48A 4Y49B 4NF1A 4R9MA 4B5PB 2VXKA 3T90A 5F46A 3FB3A 4AG9A 1QSTA 2FIAA 3TT2A 2WPXA 1B87A 3TO9A 4QC6A 5H86A 1VKCA 4B5PA 4UBRA 2RC4A 3OWCA 3S6GA 4HNWB 4YFJA 2REEA 4HNXB 4HNYB 2B4DB 1PU9A 4CAXA 3E0KA 5J8FA 1I21A 3VWEA 3EXNA 2BSWA 4QBJA 4LX9A 4RI1A 2P6GA 2PDOA 2EVNA 2PC1A 1CJWA 2B4DA 1OZPA 3TOBA 4JXQA 3H4QA 1Y9KA 4KORA 1SQHA 2Y0MA 2BUEA 3CXPA 1IYLA 2B5GB 3EFAA 4GS4A 2Q0YA 1S60A 4KOXA 4H6ZA 4L8AA 4DNCA 2G3AA 2BEIA 2REFA 4CRZB 1P4NA 4YRHA 5H84A 3W6XA 3SXOA 1V0CA 4H89A 1BOBA 3S6KA 1Y9WA 2B5GA 4FD5A 1Y7RA 2ZW7A 3MGDA 3ZZIA 2ZW5A 1Q2DA 3EC4A 4KVME 5CNPA 2OZUA 1KUVA 2DXQA 2PRBA 2HV2A 2Z10A 1U6MA 2R1IA 2JLMA 4UWIA 5E96A 1NMTA 3GKRA 3SHPA 3G3SA 4E8OA 1KUXA 3N7ZA 4PSWA 1L0CA 2FCKA 2P0WA 2QMLA 5FVJA 4KOSA 2ATRA 2ARHA 3QB8A 3TFYA 4OADA 4I49A 4MI4A 3V8IA 5KTCA 2IL4A 2GE3A 2BL1A 4ZBGA 3GY9A 3IGRA 1KUYA 3T9YA 4AB7A 1Q2YA 4XPLA 1XIXA 3VWDA 1I1DA 3DNSA 2R8VA 2OH1A 3K9UA 4KOVA 4OLLA 2PR1A 3R9EA 5KTDA 1BO4A 1I12A 2ZW6A 1NE9A 3D2MA 4AVAA 4Y49C 3C26A 3IWGA 2ZW4A 2JDCA 3TCVA 1YX0A 3CXSA 3G8WA 2CNSA 3LD2A 2FT0A 3P2HA 1M4DA 5C88A 5EBVA 3DR8A 2FS5A 1FY7A 2HUZA 3JUWA 1MJ9A 4AG7A 3R95A 2FIWA 4R3KA 3BJ7A 2JDDA 4NEXA 3WR7A 1S7LA 1CM0A 3DR6A 4MY3A 4E2AA 5C82A 5JQ4A 2X7BA 4NCZA 3S6HA 2I79A 4OAEA 5HMNA 1KZFA 4CRYB 1LRZA 4JLYA 1NSLA 4R87A 2OZHA 3FNCA 2P6FA 4L89A 1MJAA 2B3UA 4CAVA 4PSXA 3TTHA 2O28A 5F47A 2Z0ZA 3TO7A 2QECA 3QAHA 4ONUA 3P2FA 4U9ZA 1YVKA 3D2PA 2CY2A 5KTAA 3R9FA 2G0BA 4CS0B 1ON0A 3BJ8A 5JPHA 4KOWA 4PK2A 4XNHB 3UY5A 3EO4A 3I9SA 3FIXA 3EY5A 4BMHA 1B6BA 1YGHA 5DWMA 3TE4A 2Z11A 4XPDB 2AE6A 3JVNA 4IUSA 4XPDC 1VHSA 2Q04A 4MY0A 3W6SA 3F0AA 3FBUA 2C27A 1YREA 2HQYA 5IV0A 2G3TA 2FXFA 1MJBA 3ZJ0A 4KUAA 4KOTA 4XPKA 4R3LA 4U5YA 4AVCA 4II9A 1J4JA 5IB0A 1MK4A 1QSOA 2EUIA 1QSRA 3I3GA 1S7FA 1M4IA 1S5KA 4KVXA 2Q4YA 4IF5A 3TO6A 4QVTA 3D8PA 4M85A 4HKFA 3FYNA 1P0HA 2Q7BA 3TOAA 1RXTA 2CNTA 2OZGA 3LODA 1IB1E 5EC4A 1XEBA 2PSWA 2GIVA 2VEZA 5GCNA 1WWZA 2VZYA 1GHEA 5DWNA 4FD6A 3F5BA 4UA3A 4YGOA 3R9GA 4E0AA 4KUBA 3R96A 1IYKA 4MHDA 2FL4A 1RO5A 4KVOE 2QIRA 4PK3A 2ZPAA 3BLNA 4B5OA 4RS2A 2D4OA 2FE7A 4MBUA 1IICA 4J3GA 3RYOA 4M3SA 3PGPA 1M4GA 2R98A 3FRMA 2PR8A 4QB9A 1Z4RA 1YVOA 4X5KA 4JD6A 5IX3A 4JJXA 2J8NA 4JWPA 3R1KA 1YLEA 2R7HA 2K5TA 1YR0A 4KLWA 2CNMA 4CAWA 4NXYA 3PP9A 1UFHA 4JXRA 4EVYA 4XNHC 4PV6A 1QSNA 4H6UA 1XE4A 3NE7A 4U9YA 2FSRA 3DDDA 1TIQA 2J8RA 4R57A 2I00A 3D3SA 4KZTA 5I0CA 1Z9UA 4K30A 4KOYA 1S3ZA 2AJ6A 2B58A 2WPWA 2OB0A 2OU2A 3KKWA 1WK4A 1YK3A 3PZJA 2B3VA 1PUAA 3S6FA 1K4JA 1M1DA 2NMTA 2B4BA 2J8MA 1Z4EA 5ISVA 2ZXVA 4KLVA
chains in the Genus database with same CATH superfamily
1HDQA 4C2YA 3FJUA 4GXHA 5J8CA 3VATA 1M44A 1XBUA 3KASA 1QSMA 2V8DA 3KZWA 2F8HA 2PJBA 1Q2CA 1AUGA 2Q44A 3FXTA 4FD4A 5HH1A 1ARMA 2JEVA 2D4PA 3NH5A 4AXVA 4MJ8A 1IY7A 1ZLHA 2Q4VA 1N71A 1Z2LA 1S7NA 3SXNA 1XMTA 2GLFA 4NSQA 4AVBA 2KCWA 1X12A 1XRYA 3CXQA 4ORFA 2A4NA 2H5MA 1F57A 4B12A 4F6AA 3B8GA 2ZEEA 1IOFA 1TKHA 4PPZA 5F49A 1IIDA 5JM6A 4ZY2A 4FD7A 3W91A 2PJ9A 2F5IA 3GYAA 1Y0YA 1IU8A 1XF8A 2GANA 2VBQA 2VI7A 3PRTA 2VQYA 4NJRA 5LYIA 2Z3MA 4FAIA 4F9UA 5HVHA 2VZZA 3GLJA 2C6GA 5LYDA 1S7KA 4LUAA 4OMEA 3WABA 3B3WA 2P6EA 4UWJA 4F0YA 4KOUA 3F8KA 2CTBA 1FT7A 2EBJA 2PQ8A 1R57A 3DSBA 5JGFA 5HVFA 4QUSA 1FNOA 1ZG8A 2HB6A 3DLJA 5F48A 2NSMA 4Y49B 4NF1A 4R9MA 4C7HA 4WWVA 5K8OA 4B5PB 4A30A 4CYPA 2VXKA 3T90A 1TKFA 1TF8A 1ELMP 3GUXA 5AG4A 5F46A 4MRIA 3RAMA 3FB3A 2FVGA 1QSTA 3RBUA 4AG9A 2FIAA 1TXRA 1CX8A 2Z3OA 2WPXA 3TT2A 1B87A 2PJAA 4UCNA 3TO9A 1LCPA 3WC6A 4QC6A 1DE4C 5H86A 1VKCA 4B5PA 4MMOA 4C68A 1LOKA 4M6GA 2RC4A 3OWCA 4MCQA 4UBRA 3S6GA 4ZYQA 4HNWB 5DS0A 4YFJA 1KWMA 3D68A 4MFJA 6CPAA 3TC8A 5G22A 2REEA 4HNXB 4HNYB 3MN8A 2B4DB 3SJXA 4CAEA 3FF3A 1PU9A 4CAXA 3E0KA 5D8NA 2O53A 5J8FA 1I21A 2EO8A 4CYQA 2EK8A 3ISZA 5BWAB 1OBRA 2RFHA 3EXNA 2BSWA 4MCPA 3VWEA 2PJCA 4QBJA 4LX9A 4RI1A 4EMEA 5AGEA 2P6GA 2PDOA 2EVNA 2PIYA 2PC1A 4KSFA 3NE8A 3D4UA 2WZNA 2ZEFA 1CJWA 2B4DA 4NJQA 1OZPA 2QVPA 4OIWA 3TOBA 4A32A 4B13A 4MFZA 5CBMA 4JXQA 5LRKA 3H4QA 1Y9KA 2C6PA 1VGYA 3D67A 5K8PA 1UWYA 5JH9A 2DPSA 1R43A 4KORA 1SQHA 2Y0MA 3RZAA 1EE3P 2BUEA 1YSJA 2PJ3A 3SJGA 4CGPA 1ZO0A 1TKJA 2ZOFA 1QQ9A 4OIDA 4C2XA 3D7HA 4M6IA 4Q36A 3CXPA 1IYLA 1AMPA 2PJ7A 4BINA 2B5GB 1YLOA 3EFAA 4CYNA 5EMIA 2PJ0A 1Z8LA 4GS4A 2Q0YA 1S60A 2GLJA 3KGQA 4KOXA 1IOIA 4H6ZA 4L8AA 4P4DA 4DNCA 2G3AA 2ZEMA 5A28A 1XJOA 4OC1A 2BEIA 2REFA 2YNCC 4NGMA 4OC3A 1P4NA 4YRHA 3H8FA 5LRJA 5H84A 3W6XA 4CRZB 3IO1A 4KS9A 5LYFA 2NYQA 4NGRA 3SXOA 1V0CA 2PJ4A 4H89A 2JEWA 1BOBA 3RO0A 4YWYA 1Y9WA 2B5GA 3NA6A 1Y7RA 4FD5A 3S6KA 4M6HA 4B10A 2ZW7A 3BXMA 3MGDA 3LWUA 2AFSA 2ZW5A 3ZZIA 1Q2DA 4A31A 3EC4A 4KVME 4JZ0A 5CNPA 3SI2A 4MFLA 4A39A 4MHZA 2OZUA 4A2ZA 1KUVA 2CXAA 2DXQA 2PRBA 2HV2A 3D66A 1JQGA 1XMBA 2Z10A 1U6MA 4UFVA 2R1IA 4P10A 3JTKA 2ANPA 2QJ8A 2PJ1A 2JLMA 4UWIA 1AYEA 5E96A 1NMTA 2Q7SA 4MFKA 1JWQA 4P4FA 3GKRA 4CAFA 3SHPA 3IFEA 3G3SA 4WJBA 4E8OA 1KUXA 1BAVA 3N7ZA 3PFEA 4PSWA 1L0CA 2FCKA 3KR4A 4OC4A 4UCPA 4CGOA 2P0WA 4B14A 1Y0RA 2QMLA 2PJ2A 5ELYA 5FVJA 2I3CA 3BI1A 4KOSA 4MFPA 2ATRA 3FVLA 5AG6A 2GU2A 2BOAA 4UEFA 2ARHA 3QB8A 3TFYA 4OADA 3SJEA 4I49A 4MI4A 1BLLE 2XEJA 3V8IA 5KTCA 5F09A 2IL4A 3NFZA 4DJLA 1ELLP 2GE3A 2BL1A 1BPMA 1Z8WA 2Q43A 3CZXA 3KR5A 4OC5A 4ZBGA 3GY9A 2ODFA 3IGRA 1KUYA 3T9YA 4AB7A 1Q2YA 4XPLA 3SI1A 1XIXA 2DF5A 3VWDA 1I1DA 3DNSA 2R8VA 2OH1A 3K9UA 4KOVA 3KI9A 4A37A 4OLLA 2PR1A 3R9EA 2ABZA 4MHYA 5KTDA 1BO4A 1I12A 4CGMA 1Y7EA 2ZW6A 1NE9A 3D2MA 3IEHA 4AVAA 4Y49C 3PB8X 4NGSA 3C26A 3MRUA 3IWGA 4RUHA 2AFZA 3FEEA 2ZW4A 3IWEA 3B2YA 2JDCA 3TCVA 4ZY1A 1YX0A 4JYWA 3CXSA 3G8WA 2CNSA 2PIZA 3LD2A 2FT0A 3P2HA 2C6CA 4A95A 1M4DA 3PB4X 5AG7A 5C88A 5EBVA 1LAMA 1H8LA 3DR8A 2FS5A 4IHMA 1FY7A 1RTQA 2HUZA 4EFDA 3JUWA 1Z5RA 1CG2A 2CF4A 4X8IA 1MJ9A 2JBKA 4AG7A 4BBHA 2PJ8A 4CPAA 4BD9A 3S9LA 1CBXA 3FH4A 3R95A 2FIWA 4R3KA 3BJ7A 3T8WA 3B35A 3QNVA 4PXEA 5D29A 3FEDA 3K2KA 2JDDA 2WSAA 4NEXA 3WR7A 1S7LA 1CM0A 2PRQA 3DR6A 4MY3A 4E2AA 1IGBA 2V8HA 5C82A 1PCAA 5JQ4A 2X7BA 1BPNA 4NCZA 1LFWA 2F7VA 1TF9A 2I79A 2YNEA 4OAEA 3S6HA 4C2ZA 5HMNA 1YMEA 1KZFA 4CRYB 1LRZA 4JLYA 4P4EA 1NSLA 4CYOA 4R87A 2OZHA 4IK2A 3FNCA 2P6FA 4L89A 1MJAA 2B3UA 2ZENA 4FBEA 4MFQA 4CAVA 2POKA 4PSXA 3TTHA 2EWBA 4P44A 1Z8XA 4ZX9A 3NH8A 1DTDA 3CPAA 3WC5A 3PFOA 4B11A 2O28A 5F47A 2EK9A 2Z0ZA 3TO7A 2V8VA 2QECA 3QAHA 4ONUA 3P2FA 4U9ZA 3SJFA 4P4JA 5K8NA 1YVKA 3D2PA 2CY2A 5KTAA 5G21A 3S9MA 3TX8A 4F9VA 4NFRA 2Z3LA 3R9FA 1ZG9A 4GM5A 3PB9X 2DEAA 2G0BA 4CS0B 2CIJA 1ON0A 3V38A 3BJ8A 2OOTA 4KOWA 4PK2A 5JPHA 1A2ZA 2AFUA 2GFQA 4XNHB 3UY5A 4OC2A 2YNDA 3EO4A 3I9SA 3FIXA 3RNZA 5G20A 2V8GA 3EY5A 2DPTA 1B6BA 1YGHA 2IMOA 4NGNA 4BMHA 5DWMA 1HEEA 3B3VA 3TE4A 2Z11A 4XPDB 2AE6A 4FWUA 1F2OA 3QAYA 3A9LA 3JVNA 4IUSA 2OR4A 4XPDC 4UCMA 1VHOA 2J9AA 3JRUA 1VHSA 2Q04A 4TNUA 2XEIA 4MY0A 3VH9A 3W6SA 5LYLA 3F0AA 2AFMA 2C27A 3FBUA 4NGPA 1YREA 4PXCA 7CPAA 2HQYA 5IV0A 2G3TA 2IJZA 2FXFA 3PB6X 4UIAA 1MJBA 4OP4A 2CTCA 4A94A 3BHXA 1ZG7A 4MCSA 3ZJ0A 1VHEA 1CP6A 4KUAA 4KOTA 1CP7A 2GREA 4P4BA 4P4IA 5THWA 4XPKA 4TWEA 3WC7A 4R3LA 4U5YA 4DUKA 1F2PA 4AVCA 4II9A 1J4JA 5I4MA 1X10A 1MK4A 5IB0A 1QSOA 2RB7A 4R76A 1VIXA 3GB0A 1ARLA 2EUIA 3PEIA 3H5ZA 3B3TA 3V7ZA 4O23A 1QSRA 3I3GA 4Q38A 2QYVA 1S7FA 3PB7X 4ZX8A 1ZLIA 1M4IA 1S5KA 3LACA 4KVXA 4LQGA 4A38A 4UIBA 2Q4YA 2WUUA 4IF5A 1NSAA 3ISXA 3TO6A 4KSAA 4QVTA 3D8PA 4M85A 4HKFA 2BCOA 2PE3A 3FYNA 1P0HA 4UFXA 2Q7BA 4ZI6A 3K9TA 8CPAA 4B6ZA 3TOAA 5HXDA 1RXTA 2CNTA 2OZGA 3LODA 4ZGYB 1IB1E 3FECA 5EC4A 1LANA 1Q7LA 3PBEA 1XEBA 2PSWA 2GIVA 3NH4A 3S9NA 2VEZA 5GCNA 1Z8TA 3B7IA 3CDXA 3H8EA 4OC0A 2HC9A 2ZELA 1WWZA 3I1UA 1YW6A 2PCUA 3IU2A 2VZYA 3KHXA 3N5FA 4C7IA 1GHEA 4RN7A 1GYTA 2C1CA 3B3SA 4FD6A 5DWNA 3F5BA 4UA3A 2ZEDA 4YGOA 3R9GA 2PVVA 4A33A 4E0AA 3FMCA 4KUBA 4MHNA 4W9YA 5A27A 3R96A 4OKOA 1IYKA 2ZEGA 4MHDA 2FL4A 3CPXA 5LRGA 5K8MA 4UF4A 4CGNA 1RO5A 4KVOE 2QIRA 4PK3A 4P6YA 2ZPAA 3BLNA 4EWTA 1PYTB 5CPAA 4UFWA 3HUVA 4ONWA 4B5OA 4RS2A 2D4OA 3WT4A 4CGLA 4ZY0A 2FE7A 4MBUA 2ZOGA 5AG5A 1IICA 4J3GA 3RYOA 1CPXA 3KQXA 4M3SA 4K3NA 2JBJA 3PGPA 2PJ5A 2YGWA 2VL1A 3HLPA 4IAVA 1M4GA 2BO9A 2R98A 3IJ3A 4FUUA 3FRMA 2PR8A 2IQ6A 3GIUA 4QB9A 1Z4RA 1YVOA 1HDUA 2WYRA 3IU1A 4KSIA 4JD6A 4X5KA 3D7DA 4R7MA 4H2KA 5IX3A 2G9DA 4JJXA 2J8NA 4JWPA 3R1KA 4UEEA 1YLEA 2PJ6A 2R7HA 3IC1A 2K5TA 1YR0A 3D7FA 2Z3KA 2ZEPA 3D7GA 2ZEOA 2Q4ZA 4KLWA 4PXBA 4UEZA 2CNMA 4CAWA 4MHPA 3SI0A 4NXYA 2V77A 5J1QA 3PP9A 4P45A 1UFHA 2AFXA 3L2NA 4JXRA 2Z3PA 3FX6A 4LQ6A 4F0XA 4EVYA 4XNHC 4PV6A 3LMSA 5HVGA 4X2TA 2PVWA 4DYOA 4MXUA 2Q51A 3KQZA 1QSNA 4H6UA 1XE4A 2O4HA 3NE7A 4U9YA 2FSRA 1YW4A 1XFOA 4PXDA 3VARA 3DDDA 3B3CA 1TIQA 4F8ZA 2J8RA 4R57A 2Z3NA 2I00A 3D3SA 2AFWA 4KZTA 3IWWA 4R6TA 1M4LA 2XEFA 5I0CA 1YQEA 3KHZA 4R8FA 1R3NA 3IIBA 1Z9UA 4K30A 4KOYA 2XEGA 4X3RA 1S3ZA 2AJ6A 4Q7AA 2B58A 2WPWA 3PBBA 2OB0A 2OU2A 3KKWA 1WK4A 1YK3A 2YNCA 3PZJA 4Z65A 2AFOA 1XOVA 2B3VA 1PUAA 4NGQA 3H8GA 3S6FA 4YU9A 2ZEHA 1K4JA 1M1DA 1QMUA 4PQAA 3DGVA 4HPSA 4NGTA 2NMTA 1CPSA 2B4BA 4MCRA 3KL9A 3CT9A 2J8MA 1Z4EA 5ISVA 3BI0A 5IB9A 5G1ZA 2ZXVA 4KLVA 1LAPA 4G1PA
chains in the Genus database with same CATH topology
4C2YA 5J8CA 1M44A 1QSMA 1Q2CA 2Q44A 3FXTA 4FD4A 5HH1A 2JEVA 2D4PA 4MJ8A 2Q4VA 1N71A 1S7NA 3SXNA 1XMTA 4NSQA 4AVBA 2KCWA 3CXQA 4ORFA 2A4NA 2H5MA 4B12A 4F6AA 3B8GA 5F49A 1IIDA 4FD7A 3W91A 2F5IA 3GYAA 1XF8A 2VBQA 2GANA 2VI7A 2VQYA 2Z3MA 2VZZA 1S7KA 4LUAA 2P6EA 4UWJA 4F0YA 4KOUA 3F8KA 2PQ8A 1R57A 3DSBA 4QUSA 5F48A 4C7HA 4Y49B 4NF1A 4R9MA 4B5PB 4A30A 4CYPA 2VXKA 3T90A 5AG4A 5F46A 3FB3A 4AG9A 1QSTA 2FIAA 2Z3OA 3TT2A 2WPXA 1B87A 4UCNA 3TO9A 4QC6A 4C68A 5H86A 1VKCA 4B5PA 4UBRA 2RC4A 3OWCA 3S6GA 4HNWB 4YFJA 4MFJA 5G22A 2REEA 4HNXB 4HNYB 2B4DB 4CAEA 1PU9A 4CAXA 3E0KA 5J8FA 1I21A 4CYQA 5BWAB 3VWEA 3EXNA 2BSWA 4QBJA 4LX9A 4RI1A 5AGEA 2P6GA 2PDOA 2EVNA 4KSFA 2PC1A 1CJWA 2B4DA 1OZPA 3TOBA 4A32A 4B13A 4MFZA 4JXQA 3H4QA 1Y9KA 2DPSA 4KORA 1SQHA 2Y0MA 2BUEA 4CGPA 1ZO0A 4C2XA 4Q36A 3CXPA 1IYLA 2B5GB 3EFAA 4CYNA 4GS4A 2Q0YA 1S60A 4KOXA 4H6ZA 4L8AA 4DNCA 2G3AA 5A28A 2BEIA 2REFA 2YNCC 4CRZB 1P4NA 4YRHA 5H84A 3W6XA 4KS9A 3SXOA 1V0CA 4H89A 1BOBA 3S6KA 1Y9WA 2B5GA 4FD5A 1Y7RA 4B10A 2ZW7A 3MGDA 3ZZIA 2ZW5A 1Q2DA 4A31A 3EC4A 4KVME 5CNPA 4MFLA 2OZUA 4A2ZA 1KUVA 2CXAA 2DXQA 2PRBA 2HV2A 2Z10A 1U6MA 4UFVA 2R1IA 3JTKA 2JLMA 4UWIA 5E96A 1NMTA 4MFKA 4CAFA 3GKRA 3SHPA 3G3SA 4E8OA 1KUXA 3N7ZA 4PSWA 1L0CA 2FCKA 4UCPA 4CGOA 2P0WA 4B14A 2QMLA 5FVJA 4KOSA 4MFPA 2ATRA 5AG6A 2ARHA 3QB8A 3TFYA 4OADA 4I49A 4MI4A 3V8IA 5KTCA 2IL4A 2GE3A 2BL1A 4ZBGA 3GY9A 3IGRA 1KUYA 3T9YA 4AB7A 1Q2YA 4XPLA 1XIXA 3VWDA 1I1DA 3DNSA 2R8VA 2OH1A 3K9UA 4KOVA 4OLLA 2PR1A 3R9EA 5KTDA 1BO4A 1I12A 4CGMA 2ZW6A 1NE9A 3D2MA 4AVAA 4Y49C 3C26A 3IWGA 2ZW4A 3IWEA 2JDCA 3TCVA 1YX0A 3CXSA 3G8WA 2CNSA 3LD2A 2FT0A 3P2HA 4A95A 1M4DA 5AG7A 5C88A 5EBVA 3DR8A 2FS5A 1FY7A 2HUZA 3JUWA 1MJ9A 4AG7A 4BBHA 3R95A 2FIWA 4R3KA 3BJ7A 2JDDA 2WSAA 4NEXA 3WR7A 1S7LA 1CM0A 3DR6A 4MY3A 4E2AA 5C82A 5JQ4A 2X7BA 4NCZA 3S6HA 2I79A 2YNEA 4OAEA 4C2ZA 5HMNA 1KZFA 4CRYB 1LRZA 4JLYA 1NSLA 4CYOA 4R87A 2OZHA 3FNCA 2P6FA 4L89A 1MJAA 2B3UA 4MFQA 4CAVA 4PSXA 3TTHA 4B11A 2O28A 5F47A 2Z0ZA 3TO7A 2QECA 3QAHA 4ONUA 3P2FA 4U9ZA 1YVKA 3D2PA 2CY2A 5KTAA 5G21A 2Z3LA 3R9FA 2G0BA 4CS0B 1ON0A 3BJ8A 5JPHA 4KOWA 4PK2A 4XNHB 3UY5A 2YNDA 3I9SA 3EO4A 3FIXA 5G20A 3EY5A 2DPTA 1B6BA 1YGHA 4BMHA 5DWMA 3TE4A 2Z11A 4XPDB 2AE6A 3A9LA 3JVNA 4IUSA 4XPDC 4UCMA 1VHSA 2Q04A 4MY0A 3W6SA 3F0AA 3FBUA 2C27A 1YREA 2HQYA 5IV0A 2G3TA 2FXFA 1MJBA 3ZJ0A 4KUAA 4KOTA 4XPKA 4R3LA 4U5YA 4AVCA 4II9A 1J4JA 5IB0A 1MK4A 1QSOA 2EUIA 3H5ZA 1QSRA 3I3GA 4Q38A 1S7FA 1M4IA 1S5KA 4KVXA 2Q4YA 2WUUA 4IF5A 3TO6A 4KSAA 4QVTA 3D8PA 4M85A 4HKFA 4UFXA 3FYNA 1P0HA 2Q7BA 3TOAA 1RXTA 2CNTA 2OZGA 3LODA 4ZGYB 1IB1E 5EC4A 1XEBA 2PSWA 2GIVA 2VEZA 5GCNA 1WWZA 3IU2A 2VZYA 4C7IA 1GHEA 5DWNA 4FD6A 3F5BA 4UA3A 4YGOA 3R9GA 4A33A 4E0AA 4KUBA 5A27A 3R96A 1IYKA 4MHDA 2FL4A 4CGNA 1RO5A 4KVOE 2QIRA 4PK3A 2ZPAA 3BLNA 4UFWA 4B5OA 4RS2A 2D4OA 4CGLA 2FE7A 4MBUA 5AG5A 1IICA 4J3GA 3RYOA 4M3SA 3PGPA 2YGWA 1M4GA 2R98A 3FRMA 2PR8A 4QB9A 1Z4RA 1YVOA 3IU1A 4X5KA 4JD6A 5IX3A 4JJXA 2J8NA 4JWPA 3R1KA 1YLEA 2R7HA 2K5TA 1YR0A 2Z3KA 4KLWA 2CNMA 4CAWA 4NXYA 3PP9A 1UFHA 4JXRA 2Z3PA 4F0XA 4EVYA 4XNHC 4PV6A 1QSNA 4H6UA 1XE4A 3NE7A 4U9YA 2FSRA 3DDDA 1TIQA 2J8RA 4R57A 2Z3NA 2I00A 3D3SA 4KZTA 5I0CA 1Z9UA 4K30A 4KOYA 1S3ZA 2AJ6A 2B58A 2WPWA 2OB0A 2OU2A 3KKWA 1WK4A 1YK3A 2YNCA 3PZJA 2B3VA 1PUAA 3S6FA 1K4JA 1M1DA 2NMTA 2B4BA 2J8MA 1Z4EA 5ISVA 5G1ZA 2ZXVA 4KLVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J8C A;  1M44 A;  1QSM A;  1Q2C A;  2Q44 A;  3FXT A;  4FD4 A;  5HH1 A;  2JEV A;  2D4P A;  4MJ8 A;  2Q4V A;  1N71 A;  1S7N A;  3SXN A;  1XMT A;  4NSQ A;  4AVB A;  2KCW A;  3CXQ A;  4ORF A;  2A4N A;  2H5M A;  4F6A A;  3B8G A;  5F49 A;  1IID A;  4FD7 A;  3W91 A;  2F5I A;  3GYA A;  1XF8 A;  2VBQ A;  2GAN A;  2VI7 A;  2VQY A;  2VZZ A;  1S7K A;  4LUA A;  2P6E A;  4UWJ A;  4F0Y A;  4KOU A;  3F8K A;  2PQ8 A;  1R57 A;  3DSB A;  4QUS A;  5F48 A;  4Y49 B;  4NF1 A;  4R9M A;  4B5P B;  2VXK A;  3T90 A;  5F46 A;  3FB3 A;  4AG9 A;  1QST A;  2FIA A;  3TT2 A;  2WPX A;  1B87 A;  3TO9 A;  4QC6 A;  5H86 A;  1VKC A;  4B5P A;  4UBR A;  2RC4 A;  3OWC A;  3S6G A;  4HNW B;  4YFJ A;  2REE A;  4HNX B;  4HNY B;  2B4D B;  1PU9 A;  4CAX A;  3E0K A;  5J8F A;  1I21 A;  3VWE A;  3EXN A;  2BSW A;  4QBJ A;  4LX9 A;  4RI1 A;  2P6G A;  2PDO A;  2EVN A;  2PC1 A;  1CJW A;  2B4D A;  1OZP A;  3TOB A;  4JXQ A;  3H4Q A;  1Y9K A;  4KOR A;  1SQH A;  2Y0M A;  2BUE A;  3CXP A;  1IYL A;  2B5G B;  3EFA A;  4GS4 A;  2Q0Y A;  1S60 A;  4KOX A;  4H6Z A;  4L8A A;  4DNC A;  2G3A A;  2BEI A;  2REF A;  4CRZ B;  1P4N A;  4YRH A;  5H84 A;  3W6X A;  3SXO A;  1V0C A;  4H89 A;  1BOB A;  3S6K A;  1Y9W A;  2B5G A;  4FD5 A;  1Y7R A;  2ZW7 A;  3MGD A;  3ZZI A;  2ZW5 A;  1Q2D A;  3EC4 A;  4KVM E;  5CNP A;  2OZU A;  1KUV A;  2DXQ A;  2PRB A;  2HV2 A;  2Z10 A;  1U6M A;  2R1I A;  2JLM A;  4UWI A;  5E96 A;  1NMT A;  3GKR A;  3SHP A;  3G3S A;  4E8O A;  1KUX A;  3N7Z A;  4PSW A;  1L0C A;  2FCK A;  2P0W A;  2QML A;  5FVJ A;  4KOS A;  2ATR A;  2ARH A;  3QB8 A;  3TFY A;  4OAD A;  4I49 A;  4MI4 A;  3V8I A;  5KTC A;  2IL4 A;  2GE3 A;  2BL1 A;  4ZBG A;  3GY9 A;  3IGR A;  1KUY A;  3T9Y A;  4AB7 A;  1Q2Y A;  4XPL A;  1XIX A;  3VWD A;  1I1D A;  3DNS A;  2R8V A;  2OH1 A;  3K9U A;  4KOV A;  4OLL A;  2PR1 A;  3R9E A;  5KTD A;  1BO4 A;  1I12 A;  2ZW6 A;  1NE9 A;  3D2M A;  4AVA A;  4Y49 C;  3C26 A;  3IWG A;  2ZW4 A;  2JDC A;  3TCV A;  1YX0 A;  3CXS A;  3G8W A;  2CNS A;  3LD2 A;  2FT0 A;  3P2H A;  1M4D A;  5C88 A;  5EBV A;  3DR8 A;  2FS5 A;  1FY7 A;  2HUZ A;  3JUW A;  1MJ9 A;  4AG7 A;  3R95 A;  2FIW A;  4R3K A;  3BJ7 A;  2JDD A;  4NEX A;  3WR7 A;  1S7L A;  1CM0 A;  3DR6 A;  4MY3 A;  4E2A A;  5C82 A;  5JQ4 A;  2X7B A;  4NCZ A;  3S6H A;  2I79 A;  4OAE A;  5HMN A;  1KZF A;  4CRY B;  1LRZ A;  4JLY A;  1NSL A;  4R87 A;  2OZH A;  3FNC A;  2P6F A;  4L89 A;  1MJA A;  2B3U A;  4CAV A;  4PSX A;  3TTH A;  2O28 A;  5F47 A;  2Z0Z A;  3TO7 A;  2QEC A;  3QAH A;  4ONU A;  3P2F A;  4U9Z A;  1YVK A;  3D2P A;  2CY2 A;  5KTA A;  3R9F A;  2G0B A;  4CS0 B;  1ON0 A;  3BJ8 A;  5JPH A;  4KOW A;  4PK2 A;  4XNH B;  3UY5 A;  3EO4 A;  3I9S A;  3FIX A;  3EY5 A;  4BMH A;  1B6B A;  1YGH A;  5DWM A;  3TE4 A;  2Z11 A;  4XPD B;  2AE6 A;  3JVN A;  4IUS A;  4XPD C;  1VHS A;  2Q04 A;  4MY0 A;  3W6S A;  3F0A A;  3FBU A;  2C27 A;  1YRE A;  2HQY A;  5IV0 A;  2G3T A;  2FXF A;  1MJB A;  3ZJ0 A;  4KUA A;  4KOT A;  4XPK A;  4R3L A;  4U5Y A;  4AVC A;  4II9 A;  1J4J A;  5IB0 A;  1MK4 A;  1QSO A;  2EUI A;  1QSR A;  3I3G A;  1S7F A;  1M4I A;  1S5K A;  4KVX A;  2Q4Y A;  4IF5 A;  3TO6 A;  4QVT A;  3D8P A;  4M85 A;  4HKF A;  3FYN A;  1P0H A;  2Q7B A;  3TOA A;  1RXT A;  2CNT A;  2OZG A;  3LOD A;  1IB1 E;  5EC4 A;  1XEB A;  2PSW A;  2GIV A;  2VEZ A;  5GCN A;  1WWZ A;  2VZY A;  1GHE A;  5DWN A;  4FD6 A;  3F5B A;  4UA3 A;  4YGO A;  3R9G A;  4E0A A;  4KUB A;  3R96 A;  1IYK A;  4MHD A;  2FL4 A;  1RO5 A;  4KVO E;  2QIR A;  4PK3 A;  2ZPA A;  3BLN A;  4B5O A;  4RS2 A;  2D4O A;  2FE7 A;  4MBU A;  1IIC A;  4J3G A;  3RYO A;  4M3S A;  3PGP A;  1M4G A;  2R98 A;  3FRM A;  2PR8 A;  4QB9 A;  1Z4R A;  1YVO A;  4X5K A;  4JD6 A;  5IX3 A;  4JJX A;  2J8N A;  4JWP A;  3R1K A;  1YLE A;  2R7H A;  2K5T A;  1YR0 A;  4KLW A;  2CNM A;  4CAW A;  4NXY A;  3PP9 A;  1UFH A;  4JXR A;  4EVY A;  4XNH C;  4PV6 A;  1QSN A;  4H6U A;  1XE4 A;  3NE7 A;  4U9Y A;  2FSR A;  3DDD A;  1TIQ A;  2J8R A;  4R57 A;  2I00 A;  3D3S A;  4KZT A;  5I0C A;  1Z9U A;  4K30 A;  4KOY A;  1S3Z A;  2AJ6 A;  2B58 A;  2WPW A;  2OB0 A;  2OU2 A;  3KKW A;  1WK4 A;  1YK3 A;  3PZJ A;  2B3V A;  1PUA A;  3S6F A;  1K4J A;  1M1D A;  2NMT A;  2B4B A;  2J8M A;  1Z4E A;  5ISV A;  2ZXV A;  4KLV A; 
#chains in the Genus database with same CATH topology
 1HDQ A;  4C2Y A;  3FJU A;  4GXH A;  5J8C A;  3VAT A;  1M44 A;  1XBU A;  3KAS A;  1QSM A;  2V8D A;  3KZW A;  2F8H A;  2PJB A;  1Q2C A;  1AUG A;  2Q44 A;  3FXT A;  4FD4 A;  5HH1 A;  1ARM A;  2JEV A;  2D4P A;  3NH5 A;  4AXV A;  4MJ8 A;  1IY7 A;  1ZLH A;  2Q4V A;  1N71 A;  1Z2L A;  1S7N A;  3SXN A;  1XMT A;  2GLF A;  4NSQ A;  4AVB A;  2KCW A;  1X12 A;  1XRY A;  3CXQ A;  4ORF A;  2A4N A;  2H5M A;  1F57 A;  4B12 A;  4F6A A;  3B8G A;  2ZEE A;  1IOF A;  1TKH A;  4PPZ A;  5F49 A;  1IID A;  5JM6 A;  4ZY2 A;  4FD7 A;  3W91 A;  2PJ9 A;  2F5I A;  3GYA A;  1Y0Y A;  1IU8 A;  1XF8 A;  2GAN A;  2VBQ A;  2VI7 A;  3PRT A;  2VQY A;  4NJR A;  5LYI A;  2Z3M A;  4FAI A;  4F9U A;  5HVH A;  2VZZ A;  3GLJ A;  2C6G A;  5LYD A;  1S7K A;  4LUA A;  4OME A;  3WAB A;  3B3W A;  2P6E A;  4UWJ A;  4F0Y A;  4KOU A;  3F8K A;  2CTB A;  1FT7 A;  2EBJ A;  2PQ8 A;  1R57 A;  3DSB A;  5JGF A;  5HVF A;  4QUS A;  1FNO A;  1ZG8 A;  2HB6 A;  3DLJ A;  5F48 A;  2NSM A;  4Y49 B;  4NF1 A;  4R9M A;  4C7H A;  4WWV A;  5K8O A;  4B5P B;  4A30 A;  4CYP A;  2VXK A;  3T90 A;  1TKF A;  1TF8 A;  1ELM P;  3GUX A;  5AG4 A;  5F46 A;  4MRI A;  3RAM A;  3FB3 A;  2FVG A;  1QST A;  3RBU A;  4AG9 A;  2FIA A;  1TXR A;  1CX8 A;  2Z3O A;  2WPX A;  3TT2 A;  1B87 A;  2PJA A;  4UCN A;  3TO9 A;  1LCP A;  3WC6 A;  4QC6 A;  1DE4 C;  5H86 A;  1VKC A;  4B5P A;  4MMO A;  4C68 A;  1LOK A;  4M6G A;  2RC4 A;  3OWC A;  4MCQ A;  4UBR A;  3S6G A;  4ZYQ A;  4HNW B;  5DS0 A;  4YFJ A;  1KWM A;  3D68 A;  4MFJ A;  6CPA A;  3TC8 A;  5G22 A;  2REE A;  4HNX B;  4HNY B;  3MN8 A;  2B4D B;  3SJX A;  4CAE A;  3FF3 A;  1PU9 A;  4CAX A;  3E0K A;  5D8N A;  2O53 A;  5J8F A;  1I21 A;  2EO8 A;  4CYQ A;  2EK8 A;  3ISZ A;  5BWA B;  1OBR A;  2RFH A;  3EXN A;  2BSW A;  4MCP A;  3VWE A;  2PJC A;  4QBJ A;  4LX9 A;  4RI1 A;  4EME A;  5AGE A;  2P6G A;  2PDO A;  2EVN A;  2PIY A;  2PC1 A;  4KSF A;  3NE8 A;  3D4U A;  2WZN A;  2ZEF A;  1CJW A;  2B4D A;  4NJQ A;  1OZP A;  2QVP A;  4OIW A;  3TOB A;  4A32 A;  4B13 A;  4MFZ A;  5CBM A;  4JXQ A;  5LRK A;  3H4Q A;  1Y9K A;  2C6P A;  1VGY A;  3D67 A;  5K8P A;  1UWY A;  5JH9 A;  2DPS A;  1R43 A;  4KOR A;  1SQH A;  2Y0M A;  3RZA A;  1EE3 P;  2BUE A;  1YSJ A;  2PJ3 A;  3SJG A;  4CGP A;  1ZO0 A;  1TKJ A;  2ZOF A;  1QQ9 A;  4OID A;  4C2X A;  3D7H A;  4M6I A;  4Q36 A;  3CXP A;  1IYL A;  1AMP A;  2PJ7 A;  4BIN A;  2B5G B;  1YLO A;  3EFA A;  4CYN A;  5EMI A;  2PJ0 A;  1Z8L A;  4GS4 A;  2Q0Y A;  1S60 A;  2GLJ A;  3KGQ A;  4KOX A;  1IOI A;  4H6Z A;  4L8A A;  4P4D A;  4DNC A;  2G3A A;  2ZEM A;  5A28 A;  1XJO A;  4OC1 A;  2BEI A;  2REF A;  2YNC C;  4NGM A;  4OC3 A;  1P4N A;  4YRH A;  3H8F A;  5LRJ A;  5H84 A;  3W6X A;  4CRZ B;  3IO1 A;  4KS9 A;  5LYF A;  2NYQ A;  4NGR A;  3SXO A;  1V0C A;  2PJ4 A;  4H89 A;  2JEW A;  1BOB A;  3RO0 A;  4YWY A;  1Y9W A;  2B5G A;  3NA6 A;  1Y7R A;  4FD5 A;  3S6K A;  4M6H A;  4B10 A;  2ZW7 A;  3BXM A;  3MGD A;  3LWU A;  2AFS A;  2ZW5 A;  3ZZI A;  1Q2D A;  4A31 A;  3EC4 A;  4KVM E;  4JZ0 A;  5CNP A;  3SI2 A;  4MFL A;  4A39 A;  4MHZ A;  2OZU A;  4A2Z A;  1KUV A;  2CXA A;  2DXQ A;  2PRB A;  2HV2 A;  3D66 A;  1JQG A;  1XMB A;  2Z10 A;  1U6M A;  4UFV A;  2R1I A;  4P10 A;  3JTK A;  2ANP A;  2QJ8 A;  2PJ1 A;  2JLM A;  4UWI A;  1AYE A;  5E96 A;  1NMT A;  2Q7S A;  4MFK A;  1JWQ A;  4P4F A;  3GKR A;  4CAF A;  3SHP A;  3IFE A;  3G3S A;  4WJB A;  4E8O A;  1KUX A;  1BAV A;  3N7Z A;  3PFE A;  4PSW A;  1L0C A;  2FCK A;  3KR4 A;  4OC4 A;  4UCP A;  4CGO A;  2P0W A;  4B14 A;  1Y0R A;  2QML A;  2PJ2 A;  5ELY A;  5FVJ A;  2I3C A;  3BI1 A;  4KOS A;  4MFP A;  2ATR A;  3FVL A;  5AG6 A;  2GU2 A;  2BOA A;  4UEF A;  2ARH A;  3QB8 A;  3TFY A;  4OAD A;  3SJE A;  4I49 A;  4MI4 A;  1BLL E;  2XEJ A;  3V8I A;  5KTC A;  5F09 A;  2IL4 A;  3NFZ A;  4DJL A;  1ELL P;  2GE3 A;  2BL1 A;  1BPM A;  1Z8W A;  2Q43 A;  3CZX A;  3KR5 A;  4OC5 A;  4ZBG A;  3GY9 A;  2ODF A;  3IGR A;  1KUY A;  3T9Y A;  4AB7 A;  1Q2Y A;  4XPL A;  3SI1 A;  1XIX A;  2DF5 A;  3VWD A;  1I1D A;  3DNS A;  2R8V A;  2OH1 A;  3K9U A;  4KOV A;  3KI9 A;  4A37 A;  4OLL A;  2PR1 A;  3R9E A;  2ABZ A;  4MHY A;  5KTD A;  1BO4 A;  1I12 A;  4CGM A;  1Y7E A;  2ZW6 A;  1NE9 A;  3D2M A;  3IEH A;  4AVA A;  4Y49 C;  3PB8 X;  4NGS A;  3C26 A;  3MRU A;  3IWG A;  4RUH A;  2AFZ A;  3FEE A;  2ZW4 A;  3IWE A;  3B2Y A;  2JDC A;  3TCV A;  4ZY1 A;  1YX0 A;  4JYW A;  3CXS A;  3G8W A;  2CNS A;  2PIZ A;  3LD2 A;  2FT0 A;  3P2H A;  2C6C A;  4A95 A;  1M4D A;  3PB4 X;  5AG7 A;  5C88 A;  5EBV A;  1LAM A;  1H8L A;  3DR8 A;  2FS5 A;  4IHM A;  1FY7 A;  1RTQ A;  2HUZ A;  4EFD A;  3JUW A;  1Z5R A;  1CG2 A;  2CF4 A;  4X8I A;  1MJ9 A;  2JBK A;  4AG7 A;  4BBH A;  2PJ8 A;  4CPA A;  4BD9 A;  3S9L A;  1CBX A;  3FH4 A;  3R95 A;  2FIW A;  4R3K A;  3BJ7 A;  3T8W A;  3B35 A;  3QNV A;  4PXE A;  5D29 A;  3FED A;  3K2K A;  2JDD A;  2WSA A;  4NEX A;  3WR7 A;  1S7L A;  1CM0 A;  2PRQ A;  3DR6 A;  4MY3 A;  4E2A A;  1IGB A;  2V8H A;  5C82 A;  1PCA A;  5JQ4 A;  2X7B A;  1BPN A;  4NCZ A;  1LFW A;  2F7V A;  1TF9 A;  2I79 A;  2YNE A;  4OAE A;  3S6H A;  4C2Z A;  5HMN A;  1YME A;  1KZF A;  4CRY B;  1LRZ A;  4JLY A;  4P4E A;  1NSL A;  4CYO A;  4R87 A;  2OZH A;  4IK2 A;  3FNC A;  2P6F A;  4L89 A;  1MJA A;  2B3U A;  2ZEN A;  4FBE A;  4MFQ A;  4CAV A;  2POK A;  4PSX A;  3TTH A;  2EWB A;  4P44 A;  1Z8X A;  4ZX9 A;  3NH8 A;  1DTD A;  3CPA A;  3WC5 A;  3PFO A;  4B11 A;  2O28 A;  5F47 A;  2EK9 A;  2Z0Z A;  3TO7 A;  2V8V A;  2QEC A;  3QAH A;  4ONU A;  3P2F A;  4U9Z A;  3SJF A;  4P4J A;  5K8N A;  1YVK A;  3D2P A;  2CY2 A;  5KTA A;  5G21 A;  3S9M A;  3TX8 A;  4F9V A;  4NFR A;  2Z3L A;  3R9F A;  1ZG9 A;  4GM5 A;  3PB9 X;  2DEA A;  2G0B A;  4CS0 B;  2CIJ A;  1ON0 A;  3V38 A;  3BJ8 A;  2OOT A;  4KOW A;  4PK2 A;  5JPH A;  1A2Z A;  2AFU A;  2GFQ A;  4XNH B;  3UY5 A;  4OC2 A;  2YND A;  3EO4 A;  3I9S A;  3FIX A;  3RNZ A;  5G20 A;  2V8G A;  3EY5 A;  2DPT A;  1B6B A;  1YGH A;  2IMO A;  4NGN A;  4BMH A;  5DWM A;  1HEE A;  3B3V A;  3TE4 A;  2Z11 A;  4XPD B;  2AE6 A;  4FWU A;  1F2O A;  3QAY A;  3A9L A;  3JVN A;  4IUS A;  2OR4 A;  4XPD C;  4UCM A;  1VHO A;  2J9A A;  3JRU A;  1VHS A;  2Q04 A;  4TNU A;  2XEI A;  4MY0 A;  3VH9 A;  3W6S A;  5LYL A;  3F0A A;  2AFM A;  2C27 A;  3FBU A;  4NGP A;  1YRE A;  4PXC A;  7CPA A;  2HQY A;  5IV0 A;  2G3T A;  2IJZ A;  2FXF A;  3PB6 X;  4UIA A;  1MJB A;  4OP4 A;  2CTC A;  4A94 A;  3BHX A;  1ZG7 A;  4MCS A;  3ZJ0 A;  1VHE A;  1CP6 A;  4KUA A;  4KOT A;  1CP7 A;  2GRE A;  4P4B A;  4P4I A;  5THW A;  4XPK A;  4TWE A;  3WC7 A;  4R3L A;  4U5Y A;  4DUK A;  1F2P A;  4AVC A;  4II9 A;  1J4J A;  5I4M A;  1X10 A;  1MK4 A;  5IB0 A;  1QSO A;  2RB7 A;  4R76 A;  1VIX A;  3GB0 A;  1ARL A;  2EUI A;  3PEI A;  3H5Z A;  3B3T A;  3V7Z A;  4O23 A;  1QSR A;  3I3G A;  4Q38 A;  2QYV A;  1S7F A;  3PB7 X;  4ZX8 A;  1ZLI A;  1M4I A;  1S5K A;  3LAC A;  4KVX A;  4LQG A;  4A38 A;  4UIB A;  2Q4Y A;  2WUU A;  4IF5 A;  1NSA A;  3ISX A;  3TO6 A;  4KSA A;  4QVT A;  3D8P A;  4M85 A;  4HKF A;  2BCO A;  2PE3 A;  3FYN A;  1P0H A;  4UFX A;  2Q7B A;  4ZI6 A;  3K9T A;  8CPA A;  4B6Z A;  3TOA A;  5HXD A;  1RXT A;  2CNT A;  2OZG A;  3LOD A;  4ZGY B;  1IB1 E;  3FEC A;  5EC4 A;  1LAN A;  1Q7L A;  3PBE A;  1XEB A;  2PSW A;  2GIV A;  3NH4 A;  3S9N A;  2VEZ A;  5GCN A;  1Z8T A;  3B7I A;  3CDX A;  3H8E A;  4OC0 A;  2HC9 A;  2ZEL A;  1WWZ A;  3I1U A;  1YW6 A;  2PCU A;  3IU2 A;  2VZY A;  3KHX A;  3N5F A;  4C7I A;  1GHE A;  4RN7 A;  1GYT A;  2C1C A;  3B3S A;  4FD6 A;  5DWN A;  3F5B A;  4UA3 A;  2ZED A;  4YGO A;  3R9G A;  2PVV A;  4A33 A;  4E0A A;  3FMC A;  4KUB A;  4MHN A;  4W9Y A;  5A27 A;  3R96 A;  4OKO A;  1IYK A;  2ZEG A;  4MHD A;  2FL4 A;  3CPX A;  5LRG A;  5K8M A;  4UF4 A;  4CGN A;  1RO5 A;  4KVO E;  2QIR A;  4PK3 A;  4P6Y A;  2ZPA A;  3BLN A;  4EWT A;  1PYT B;  5CPA A;  4UFW A;  3HUV A;  4ONW A;  4B5O A;  4RS2 A;  2D4O A;  3WT4 A;  4CGL A;  4ZY0 A;  2FE7 A;  4MBU A;  2ZOG A;  5AG5 A;  1IIC A;  4J3G A;  3RYO A;  1CPX A;  3KQX A;  4M3S A;  4K3N A;  2JBJ A;  3PGP A;  2PJ5 A;  2YGW A;  2VL1 A;  3HLP A;  4IAV A;  1M4G A;  2BO9 A;  2R98 A;  3IJ3 A;  4FUU A;  3FRM A;  2PR8 A;  2IQ6 A;  3GIU A;  4QB9 A;  1Z4R A;  1YVO A;  1HDU A;  2WYR A;  3IU1 A;  4KSI A;  4JD6 A;  4X5K A;  3D7D A;  4R7M A;  4H2K A;  5IX3 A;  2G9D A;  4JJX A;  2J8N A;  4JWP A;  3R1K A;  4UEE A;  1YLE A;  2PJ6 A;  2R7H A;  3IC1 A;  2K5T A;  1YR0 A;  3D7F A;  2Z3K A;  2ZEP A;  3D7G A;  2ZEO A;  2Q4Z A;  4KLW A;  4PXB A;  4UEZ A;  2CNM A;  4CAW A;  4MHP A;  3SI0 A;  4NXY A;  2V77 A;  5J1Q A;  3PP9 A;  4P45 A;  1UFH A;  2AFX A;  3L2N A;  4JXR A;  2Z3P A;  3FX6 A;  4LQ6 A;  4F0X A;  4EVY A;  4XNH C;  4PV6 A;  3LMS A;  5HVG A;  4X2T A;  2PVW A;  4DYO A;  4MXU A;  2Q51 A;  3KQZ A;  1QSN A;  4H6U A;  1XE4 A;  2O4H A;  3NE7 A;  4U9Y A;  2FSR A;  1YW4 A;  1XFO A;  4PXD A;  3VAR A;  3DDD A;  3B3C A;  1TIQ A;  4F8Z A;  2J8R A;  4R57 A;  2Z3N A;  2I00 A;  3D3S A;  2AFW A;  4KZT A;  3IWW A;  4R6T A;  1M4L A;  2XEF A;  5I0C A;  1YQE A;  3KHZ A;  4R8F A;  1R3N A;  3IIB A;  1Z9U A;  4K30 A;  4KOY A;  2XEG A;  4X3R A;  1S3Z A;  2AJ6 A;  4Q7A A;  2B58 A;  2WPW A;  3PBB A;  2OB0 A;  2OU2 A;  3KKW A;  1WK4 A;  1YK3 A;  2YNC A;  3PZJ A;  4Z65 A;  2AFO A;  1XOV A;  2B3V A;  1PUA A;  4NGQ A;  3H8G A;  3S6F A;  4YU9 A;  2ZEH A;  1K4J A;  1M1D A;  1QMU A;  4PQA A;  3DGV A;  4HPS A;  4NGT A;  2NMT A;  1CPS A;  2B4B A;  4MCR A;  3KL9 A;  3CT9 A;  2J8M A;  1Z4E A;  5ISV A;  3BI0 A;  5IB9 A;  5G1Z A;  2ZXV A;  4KLV A;  1LAP A;  4G1P A; 
#chains in the Genus database with same CATH homology
 4C2Y A;  5J8C A;  1M44 A;  1QSM A;  1Q2C A;  2Q44 A;  3FXT A;  4FD4 A;  5HH1 A;  2JEV A;  2D4P A;  4MJ8 A;  2Q4V A;  1N71 A;  1S7N A;  3SXN A;  1XMT A;  4NSQ A;  4AVB A;  2KCW A;  3CXQ A;  4ORF A;  2A4N A;  2H5M A;  4B12 A;  4F6A A;  3B8G A;  5F49 A;  1IID A;  4FD7 A;  3W91 A;  2F5I A;  3GYA A;  1XF8 A;  2VBQ A;  2GAN A;  2VI7 A;  2VQY A;  2Z3M A;  2VZZ A;  1S7K A;  4LUA A;  2P6E A;  4UWJ A;  4F0Y A;  4KOU A;  3F8K A;  2PQ8 A;  1R57 A;  3DSB A;  4QUS A;  5F48 A;  4C7H A;  4Y49 B;  4NF1 A;  4R9M A;  4B5P B;  4A30 A;  4CYP A;  2VXK A;  3T90 A;  5AG4 A;  5F46 A;  3FB3 A;  4AG9 A;  1QST A;  2FIA A;  2Z3O A;  3TT2 A;  2WPX A;  1B87 A;  4UCN A;  3TO9 A;  4QC6 A;  4C68 A;  5H86 A;  1VKC A;  4B5P A;  4UBR A;  2RC4 A;  3OWC A;  3S6G A;  4HNW B;  4YFJ A;  4MFJ A;  5G22 A;  2REE A;  4HNX B;  4HNY B;  2B4D B;  4CAE A;  1PU9 A;  4CAX A;  3E0K A;  5J8F A;  1I21 A;  4CYQ A;  5BWA B;  3VWE A;  3EXN A;  2BSW A;  4QBJ A;  4LX9 A;  4RI1 A;  5AGE A;  2P6G A;  2PDO A;  2EVN A;  4KSF A;  2PC1 A;  1CJW A;  2B4D A;  1OZP A;  3TOB A;  4A32 A;  4B13 A;  4MFZ A;  4JXQ A;  3H4Q A;  1Y9K A;  2DPS A;  4KOR A;  1SQH A;  2Y0M A;  2BUE A;  4CGP A;  1ZO0 A;  4C2X A;  4Q36 A;  3CXP A;  1IYL A;  2B5G B;  3EFA A;  4CYN A;  4GS4 A;  2Q0Y A;  1S60 A;  4KOX A;  4H6Z A;  4L8A A;  4DNC A;  2G3A A;  5A28 A;  2BEI A;  2REF A;  2YNC C;  4CRZ B;  1P4N A;  4YRH A;  5H84 A;  3W6X A;  4KS9 A;  3SXO A;  1V0C A;  4H89 A;  1BOB A;  3S6K A;  1Y9W A;  2B5G A;  4FD5 A;  1Y7R A;  4B10 A;  2ZW7 A;  3MGD A;  3ZZI A;  2ZW5 A;  1Q2D A;  4A31 A;  3EC4 A;  4KVM E;  5CNP A;  4MFL A;  2OZU A;  4A2Z A;  1KUV A;  2CXA A;  2DXQ A;  2PRB A;  2HV2 A;  2Z10 A;  1U6M A;  4UFV A;  2R1I A;  3JTK A;  2JLM A;  4UWI A;  5E96 A;  1NMT A;  4MFK A;  4CAF A;  3GKR A;  3SHP A;  3G3S A;  4E8O A;  1KUX A;  3N7Z A;  4PSW A;  1L0C A;  2FCK A;  4UCP A;  4CGO A;  2P0W A;  4B14 A;  2QML A;  5FVJ A;  4KOS A;  4MFP A;  2ATR A;  5AG6 A;  2ARH A;  3QB8 A;  3TFY A;  4OAD A;  4I49 A;  4MI4 A;  3V8I A;  5KTC A;  2IL4 A;  2GE3 A;  2BL1 A;  4ZBG A;  3GY9 A;  3IGR A;  1KUY A;  3T9Y A;  4AB7 A;  1Q2Y A;  4XPL A;  1XIX A;  3VWD A;  1I1D A;  3DNS A;  2R8V A;  2OH1 A;  3K9U A;  4KOV A;  4OLL A;  2PR1 A;  3R9E A;  5KTD A;  1BO4 A;  1I12 A;  4CGM A;  2ZW6 A;  1NE9 A;  3D2M A;  4AVA A;  4Y49 C;  3C26 A;  3IWG A;  2ZW4 A;  3IWE A;  2JDC A;  3TCV A;  1YX0 A;  3CXS A;  3G8W A;  2CNS A;  3LD2 A;  2FT0 A;  3P2H A;  4A95 A;  1M4D A;  5AG7 A;  5C88 A;  5EBV A;  3DR8 A;  2FS5 A;  1FY7 A;  2HUZ A;  3JUW A;  1MJ9 A;  4AG7 A;  4BBH A;  3R95 A;  2FIW A;  4R3K A;  3BJ7 A;  2JDD A;  2WSA A;  4NEX A;  3WR7 A;  1S7L A;  1CM0 A;  3DR6 A;  4MY3 A;  4E2A A;  5C82 A;  5JQ4 A;  2X7B A;  4NCZ A;  3S6H A;  2I79 A;  2YNE A;  4OAE A;  4C2Z A;  5HMN A;  1KZF A;  4CRY B;  1LRZ A;  4JLY A;  1NSL A;  4CYO A;  4R87 A;  2OZH A;  3FNC A;  2P6F A;  4L89 A;  1MJA A;  2B3U A;  4MFQ A;  4CAV A;  4PSX A;  3TTH A;  4B11 A;  2O28 A;  5F47 A;  2Z0Z A;  3TO7 A;  2QEC A;  3QAH A;  4ONU A;  3P2F A;  4U9Z A;  1YVK A;  3D2P A;  2CY2 A;  5KTA A;  5G21 A;  2Z3L A;  3R9F A;  2G0B A;  4CS0 B;  1ON0 A;  3BJ8 A;  5JPH A;  4KOW A;  4PK2 A;  4XNH B;  3UY5 A;  2YND A;  3I9S A;  3EO4 A;  3FIX A;  5G20 A;  3EY5 A;  2DPT A;  1B6B A;  1YGH A;  4BMH A;  5DWM A;  3TE4 A;  2Z11 A;  4XPD B;  2AE6 A;  3A9L A;  3JVN A;  4IUS A;  4XPD C;  4UCM A;  1VHS A;  2Q04 A;  4MY0 A;  3W6S A;  3F0A A;  3FBU A;  2C27 A;  1YRE A;  2HQY A;  5IV0 A;  2G3T A;  2FXF A;  1MJB A;  3ZJ0 A;  4KUA A;  4KOT A;  4XPK A;  4R3L A;  4U5Y A;  4AVC A;  4II9 A;  1J4J A;  5IB0 A;  1MK4 A;  1QSO A;  2EUI A;  3H5Z A;  1QSR A;  3I3G A;  4Q38 A;  1S7F A;  1M4I A;  1S5K A;  4KVX A;  2Q4Y A;  2WUU A;  4IF5 A;  3TO6 A;  4KSA A;  4QVT A;  3D8P A;  4M85 A;  4HKF A;  4UFX A;  3FYN A;  1P0H A;  2Q7B A;  3TOA A;  1RXT A;  2CNT A;  2OZG A;  3LOD A;  4ZGY B;  1IB1 E;  5EC4 A;  1XEB A;  2PSW A;  2GIV A;  2VEZ A;  5GCN A;  1WWZ A;  3IU2 A;  2VZY A;  4C7I A;  1GHE A;  5DWN A;  4FD6 A;  3F5B A;  4UA3 A;  4YGO A;  3R9G A;  4A33 A;  4E0A A;  4KUB A;  5A27 A;  3R96 A;  1IYK A;  4MHD A;  2FL4 A;  4CGN A;  1RO5 A;  4KVO E;  2QIR A;  4PK3 A;  2ZPA A;  3BLN A;  4UFW A;  4B5O A;  4RS2 A;  2D4O A;  4CGL A;  2FE7 A;  4MBU A;  5AG5 A;  1IIC A;  4J3G A;  3RYO A;  4M3S A;  3PGP A;  2YGW A;  1M4G A;  2R98 A;  3FRM A;  2PR8 A;  4QB9 A;  1Z4R A;  1YVO A;  3IU1 A;  4X5K A;  4JD6 A;  5IX3 A;  4JJX A;  2J8N A;  4JWP A;  3R1K A;  1YLE A;  2R7H A;  2K5T A;  1YR0 A;  2Z3K A;  4KLW A;  2CNM A;  4CAW A;  4NXY A;  3PP9 A;  1UFH A;  4JXR A;  2Z3P A;  4F0X A;  4EVY A;  4XNH C;  4PV6 A;  1QSN A;  4H6U A;  1XE4 A;  3NE7 A;  4U9Y A;  2FSR A;  3DDD A;  1TIQ A;  2J8R A;  4R57 A;  2Z3N A;  2I00 A;  3D3S A;  4KZT A;  5I0C A;  1Z9U A;  4K30 A;  4KOY A;  1S3Z A;  2AJ6 A;  2B58 A;  2WPW A;  2OB0 A;  2OU2 A;  3KKW A;  1WK4 A;  1YK3 A;  2YNC A;  3PZJ A;  2B3V A;  1PUA A;  3S6F A;  1K4J A;  1M1D A;  2NMT A;  2B4B A;  2J8M A;  1Z4E A;  5ISV A;  5G1Z A;  2ZXV A;  4KLV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...