3R9EA

Crystal structure of microcin c7 self immunity acetyltransferase mcce in complex with coenzyme a and aspartyl sulfamoyl adenosine (dsa)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
180
structure length
180
Chain Sequence
DVSLTPSGIKVNDEITLLYPALKYAEELYLLINQNKINFIKSMAWPAFVNNISDSVSFIEQSMIDNQNEKALILFIKYKTKIAGVVSFNIIDHANKTAYIGYWLGANFQGKGIVTNAINKLIQEYGDSGVIKRFVIKCIVDNKKSNATALRCGFTLEGVLQKAEILNGVSYDQNIYSKVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MccE protein
publication title Structural Basis for Microcin C7 Inactivation by the MccE Acetyltransferase.
pubmed doi rcsb
source organism Escherichia coli
total genus 55
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3r9eA00
4L89A 2PR1A 4CRYB 1U6MA 4LX9A 4OAEA 2Q4YA 4MJ8A 2VQYA 3TO6A 1IYKA 3D3SA 4QVTA 1S7FA 2WPXA 2AJ6A 4QUSA 2ATRA 4CS0B 4K30A 3T9YA 4U9YA 2B3VA 4MBUA 3TT2A 1MJBA 2FS5A 4AG7A 1VHSA 3QB8A 3CXSA 3G8WA 2K5TA 4NCZA 1XF8A 4KORA 5IB0A 2B4DB 2ZW7A 2Q4VA 3FBUA 4KVXA 2FCKA 3SXOA 1I21A 3FRMA 4JD6A 2Z10A 2JDCA 4JXQA 1L0CA 4UWIA 1M4IA 4Y49B 4PK3A 1IICA 1YX0A 5J8CA 4HNXB 2D4OA 3UY5A 4JLYA 4JWPA 4M85A 2FSRA 3EFAA 2R1IA 4AVBA 3JUWA 4AG9A 3LD2A 4MI4A 4YGOA 2O28A 2Q44A 3PZJA 4BMHA 4NXYA 3PGPA 5F47A 2REEA 1V0CA 4H6UA 2AE6A 4CAXA 2B58A 2BL1A 3OWCA 2P0WA 4KOTA 1S60A 3DR6A 4QB9A 3D2MA 3I9SA 2R7HA 1IB1E 2X7BA 4CRZB 1KZFA 2B4BA 3TO9A 1Y7RA 5EBVA 1M4DA 5DWNA 2R8VA 4ONUA 4R3LA 2CY2A 2ZXVA 5F49A 2BUEA 3B8GA 3DDDA 2FL4A 2G3AA 1Q2DA 4FD5A 4QC6A 3GKRA 2HQYA 1I1DA 1MJAA 1BOBA 4AB7A 2VZYA 3S6GA 2KCWA 2GANA 4MY3A 1B6BA 2OZHA 4YRHA 3W91A 1IIDA 1SQHA 2B4DA 2FIWA 2R98A 2ZW5A 4KOYA 4PV6A 4H6ZA 4KOVA 4R57A 2VZZA 4L8AA 1VKCA 4MY0A 3G3SA 2CNTA 4FD7A 4PSXA 4QBJA 1XMTA 2ARHA 2A4NA 1Q2YA 3EC4A 1OZPA 3QAHA 2G0BA 4PK2A 4HKFA 1CM0A 2EUIA 4KUBA 2HV2A 3DSBA 5FVJA 2VBQA 3S6FA 4KOSA 4UA3A 4KVOE 3LODA 1Z9UA 2VEZA 5C82A 4F0YA 1ON0A 4B5PB 2JDDA 5JPHA 3VWDA 3V8IA 1Z4EA 3R9GA 1QSRA 1KUVA 5I0CA 1YK3A 2ZW4A 2PRBA 4GS4A 4KLWA 4PSWA 4R3KA 3FB3A 5E96A 3CXPA 2G3TA 3R95A 1QSOA 1BO4A 4JJXA 1Y9WA 1R57A 2Y0MA 2QIRA 4H89A 2EVNA 1MK4A 2I00A 3DR8A 3E0KA 3FYNA 3TOAA 2QECA 4II9A 4XPDC 5HH1A 1J4JA 1M1DA 2Q0YA 1P4NA 2FIAA 4IUSA 1M4GA 4UWJA 3D2PA 3P2FA 3R1KA 2CNSA 4J3GA 4KOWA 2REFA 5EC4A 1RO5A 4KVME 3W6SA 2IL4A 3RYOA 4I49A 1M44A 2OB0A 1TIQA 1UFHA 1B87A 4FD6A 1QSNA 3F8KA 3PP9A 3TCVA 1Z4RA 3W6XA 1QSMA 3IGRA 3BLNA 2JEVA 2DXQA 2B3UA 5H84A 2J8MA 4CAWA 4OLLA 5C88A 2P6FA 1XIXA 5F48A 3TE4A 2PR8A 2GE3A 1S7KA 5KTCA 1XEBA 4XPKA 4B5PA 4ORFA 1KUXA 2JLMA 4R87A 3ZJ0A 3R9FA 1NSLA 3WR7A 3F5BA 1Q2CA 3JVNA 2I79A 4F6AA 1NE9A 3I3GA 4NF1A 2GIVA 4U5YA 4XNHC 2BSWA 4HNWB 2J8NA 2H5MA 2OZUA 4OADA 3P2HA 3SHPA 5JQ4A 1WK4A 3VWEA 2Z0ZA 1YVKA 4KOUA 3S6HA 5CNPA 2ZPAA 2PSWA 4XPLA 1S7LA 3EY5A 1S3ZA 2CNMA 4MHDA 5DWMA 2FT0A 2OU2A 3D8PA 4NSQA 1WWZA 2Z11A 3FIXA 4IF5A 4E8OA 3H4QA 1YREA 4E2AA 1S5KA 3R96A 2QMLA 3FNCA 4ZBGA 3IWGA 1MJ9A 3BJ8A 5GCNA 1FY7A 1PU9A 4UBRA 3MGDA 4JXRA 2OH1A 1NMTA 3CXQA 1PUAA 4Y49C 2FE7A 4E0AA 5KTAA 2B5GB 2PDOA 2F5IA 4NEXA 5HMNA 5IV0A 1QSTA 5ISVA 2J8RA 4XPDB 2VXKA 3F0AA 4KLVA 2Q7BA 1XE4A 1YVOA 2C27A 3KKWA 2FXFA 3S6KA 2P6EA 4B5OA 3TOBA 1YGHA 3C26A 2OZGA 3DNSA 3EO4A 4R9MA 2HUZA 5KTDA 4M3SA 3TO7A 1Y9KA 4KUAA 2VI7A 1IYLA 2PQ8A 5F46A 4HNYB 1CJWA 3N7ZA 1N71A 3EXNA 1K4JA 2PC1A 1YR0A 4RS2A 4DNCA 3T90A 3SXNA 4EVYA 2D4PA 3NE7A 1RXTA 4YFJA 3TFYA 3R9EA 2P6GA 3ZZIA 3BJ7A 3FXTA 4AVCA 4FD4A 3TTHA 4RI1A 2Q04A 4LUAA 1I12A 3K9UA 4AVAA 1P0HA 4KZTA 4XNHB 5H86A 2NMTA 1S7NA 2RC4A 4CAVA 4KOXA 2WPWA 4X5KA 1LRZA 1GHEA 3GYAA 2B5GA 2ZW6A 5IX3A 3GY9A 5J8FA 2BEIA 4U9ZA 1KUYA 1YLEA
chains in the Genus database with same CATH superfamily
1XFOA 1XJOA 2PJ4A 4L89A 2IQ6A 3IJ3A 4MFPA 1XBUA 2PE3A 2PR1A 2Q51A 1DTDA 1EE3P 3WC7A 1U6MA 2FVGA 2PJ1A 3IU1A 2AFSA 2YNCA 4LX9A 4YWYA 4CRYB 4R76A 3KGQA 4OAEA 2Z3MA 2ZEHA 3WABA 4OC2A 2Q4YA 4MJ8A 2VQYA 3TO6A 4A37A 1IYKA 3D3SA 3LACA 5G22A 4QVTA 1S7FA 2WPXA 3SI0A 2ZELA 2AJ6A 2PJ6A 4QUSA 2ATRA 4FBEA 1ZG9A 4K30A 1HDUA 3T9YA 1AYEA 4CS0B 4U9YA 4UF4A 2B3VA 4MBUA 4UCMA 3TT2A 1MJBA 2FS5A 4MFJA 2BOAA 4MFQA 4P4FA 4AG7A 1HEEA 1VHSA 3PFEA 3QB8A 4R8FA 3CXSA 3B35A 1DE4C 2AFXA 3SJFA 3G8WA 2K5TA 4OIWA 3SJXA 4NCZA 1XF8A 2XEGA 4KORA 2B4DB 2ZW7A 5IB0A 2Q4VA 3FBUA 4R9MA 4KVXA 2FCKA 3SXOA 1I21A 3FRMA 4IAVA 4JD6A 4NGNA 4UIBA 2Z10A 4MRIA 7CPAA 2JDCA 1YQEA 2ZENA 1ARMA 2CIJA 4JXQA 1L0CA 1RTQA 4UWIA 1M4IA 4OP4A 4Y49B 3GB0A 1KWMA 4MFLA 2ZEDA 4R6TA 4W9YA 3FX6A 5CPAA 4PK3A 4PQAA 5ELYA 1IICA 1YX0A 3K9TA 5J8CA 4HNXB 2D4OA 3UY5A 2Z3PA 3RAMA 3RO0A 4JLYA 2POKA 4JWPA 3PFOA 4M85A 4P10A 2FSRA 3EFAA 4ZX9A 5DS0A 4TWEA 4MCPA 2R1IA 4TNUA 4MHYA 4AVBA 3JUWA 4WWVA 4AG9A 2YNEA 3LD2A 3PB4X 4MI4A 1CBXA 1QMUA 4O23A 4YGOA 2O28A 2Q44A 3PZJA 4BBHA 4BMHA 4NXYA 3PGPA 4NJQA 4P44A 3PB6X 4DUKA 1FNOA 3CPAA 5F47A 2REEA 3TX8A 1V0CA 2C6GA 4NGPA 3KR4A 3D7FA 3QNVA 4MCQA 4H6UA 2AE6A 4CAXA 2B58A 2RB7A 4UEZA 4MFKA 2BL1A 4JZ0A 1ZLHA 4A2ZA 3OWCA 2P0WA 4KOTA 4CYNA 1IOIA 5F09A 1S60A 1YMEA 3DR6A 4QB9A 3D2MA 2PJ3A 3I9SA 5JM6A 3CZXA 3D66A 2GLJA 2R7HA 1IB1E 2X7BA 5G21A 4CRZB 2JEWA 1KZFA 4PXBA 2B4BA 3SJEA 3TO9A 5A28A 4GXHA 1Y7RA 5EBVA 1M4DA 5DWNA 2R8VA 1ELLP 4ONUA 4R3LA 1IGBA 2PJCA 2CY2A 5EMIA 1F2PA 2ZXVA 5F49A 2BUEA 5BWAB 3B8GA 3H5ZA 3DDDA 4A39A 4NGTA 2FL4A 3HUVA 5G1ZA 3VARA 4OC0A 2G3AA 1Q2DA 3JTKA 4FD5A 4NJRA 4QC6A 2ZEMA 1I1DA 2HQYA 1MJAA 3GKRA 1BOBA 4PXEA 4AB7A 4P6YA 5K8MA 3PBBA 2VZYA 3FF3A 3D7HA 1AMPA 2EK9A 3S6GA 1R3NA 2KCWA 1LAPA 2GANA 1LAMA 3IWEA 4MY3A 4P45A 1B6BA 2OZHA 2Q43A 3B3VA 1ZO0A 4YRHA 3W91A 1IIDA 3KQXA 3FEEA 4UFVA 1CPXA 1SQHA 2B4DA 4X2TA 5HVFA 2FIWA 4GM5A 2R98A 2ZW5A 3MN8A 5AG6A 2ZEPA 4KOYA 4OC1A 4PV6A 4H6ZA 3FH4A 4KOVA 4MHPA 2RFHA 4R57A 2VZZA 3DLJA 1CG2A 1VKCA 4L8AA 3B3SA 2PCUA 3SI2A 3PRTA 4MY0A 3G3SA 2CNTA 4FD7A 4PSXA 4QBJA 3KR5A 1XMTA 2ARHA 2XEJA 2A4NA 1Q2YA 2QVPA 1OZPA 3EC4A 3QAHA 1Z5RA 3BHXA 4P4IA 3D68A 2G0BA 4PK2A 4HKFA 1CM0A 4C7IA 1BLLE 2EUIA 4ZYQA 4KUBA 4M6HA 2HV2A 2V8DA 3DSBA 4KSAA 4MCRA 5FVJA 2VBQA 3S6FA 2F8HA 3L2NA 1UWYA 4CYPA 3PB9X 4KOSA 4UA3A 4KVOE 3LODA 4R7MA 4CGPA 2GREA 4LQGA 1Z9UA 2VEZA 5C82A 3B3TA 1X10A 4F0YA 1ON0A 2ODFA 1GYTA 2AFZA 4B5PB 1H8LA 1ZG8A 2JDDA 5JPHA 3VWDA 3D7GA 1OBRA 4M6IA 3V8IA 1Z4EA 1CP7A 3D67A 1Z8TA 4CAFA 3R9GA 1QSRA 1KUVA 1CPSA 5AG5A 5I4MA 1QQ9A 5I0CA 1YK3A 3A9LA 1IOFA 5D29A 2HB6A 1VHEA 2ZW4A 2EWBA 2PRBA 4GS4A 4KLWA 4P4BA 4PSWA 4R3KA 4CPAA 4ZY1A 3FB3A 5E96A 3CXPA 2G3TA 3R95A 1QSOA 1BO4A 4JJXA 1Y9WA 2HC9A 1R57A 2PJ5A 3CPXA 3BXMA 3GIUA 2Y0MA 3MRUA 3NFZA 3T8WA 4UFWA 5HVGA 2I3CA 4NGMA 2QIRA 4H89A 1Z8XA 2EVNA 2Q4ZA 3FECA 1MK4A 1F2OA 2I00A 3IC1A 4DYOA 5A27A 3DR8A 3E0KA 3FYNA 3IIBA 3TOAA 4F9VA 1Y7EA 2QECA 4NGRA 4II9A 2WUUA 2ZOGA 3VATA 1ELMP 1BAVA 4B11A 4XPDC 1TF8A 3SI1A 1TF9A 1XMBA 5HH1A 3IU2A 4P4JA 1J4JA 3NH8A 2AFMA 1JWQA 1M1DA 2Q0YA 1P4NA 2FIAA 4IUSA 2Z3OA 2AFOA 2C1CA 1M4GA 2EK8A 4PPZA 4UWJA 3D2PA 2Z3NA 3P2FA 3R1KA 1Z2LA 2CNSA 4J3GA 3BI0A 2BCOA 2ZEEA 4KOWA 4MHNA 2REFA 3FVLA 4A33A 2Z3LA 3QAYA 5EC4A 1RO5A 4IHMA 3NE8A 4KVME 3PB7X 3W6SA 2IL4A 2O53A 3RYOA 3PEIA 3IWWA 4I49A 3ISXA 4X8IA 4F9UA 1M44A 2OB0A 3NH4A 5LRJA 4EFDA 1YW4A 1PCAA 1TIQA 1UFHA 4KSIA 5LRGA 2OR4A 2OOTA 3B7IA 1B87A 4FD6A 1QSNA 3F8KA 3PP9A 3TCVA 1TXRA 1Z4RA 3W6XA 3RZAA 1QSMA 3IGRA 3TC8A 3HLPA 3BLNA 1LFWA 2DXQA 2B3UA 2JEVA 5H84A 2J8MA 4MMOA 4CAWA 4OLLA 5C88A 3DGVA 2P6FA 1XIXA 2Q7SA 5F48A 4UIAA 5IB9A 3PB8X 2QYVA 4NGSA 5G20A 3I1UA 4ZGYB 3TE4A 2PR8A 2ZEOA 2GE3A 3ISZA 1S7KA 5KTCA 2G9DA 2V77A 5LYLA 1XEBA 2NYQA 3H8EA 4WJBA 2ZOFA 4XPKA 5HVHA 4B5PA 1FT7A 4ORFA 1VHOA 1KUXA 2JLMA 4R87A 1Q7LA 3ZJ0A 4Q7AA 4CAEA 1BPMA 1Z8WA 2GFQA 1NSLA 3R9FA 2PJ7A 1Z8LA 2AFWA 1Q2CA 3F5BA 2I79A 3JVNA 3WR7A 3KZWA 3NA6A 4F6AA 1NE9A 5LYFA 3I3GA 4NF1A 4Q38A 1CP6A 2Z3KA 3WC5A 2GIVA 4C68A 4U5YA 4XNHC 2AFUA 4UEEA 2BSWA 4LQ6A 2IJZA 2IMOA 4C2YA 5K8OA 2CXAA 2O4HA 4HNWB 2J8NA 2H5MA 3NH5A 2OZUA 4OADA 3P2HA 2DEAA 3KASA 3SHPA 2EO8A 5JQ4A 5JGFA 5CBMA 1WK4A 3VWEA 2Z0ZA 4MXUA 1YVKA 2WZNA 4KOUA 3S6HA 4A31A 4C7HA 5CNPA 4BD9A 3IEHA 2CF4A 2ZPAA 1IU8A 3S9MA 4P4DA 4OIDA 2PSWA 2V8HA 4XPLA 1S7LA 2JBJA 3EY5A 3FJUA 5AG7A 1S3ZA 2CNMA 3KQZA 4KSFA 4MHDA 3D4UA 5DWMA 2FT0A 2C6PA 2OU2A 3D8PA 5LRKA 2EBJA 5AG4A 4NSQA 1WWZA 2PIYA 4P4EA 2Z11A 3FIXA 4IF5A 4FUUA 3D7DA 4E8OA 3CT9A 3JRUA 2BO9A 2V8GA 1F57A 3H4QA 2PVWA 1IY7A 4IK2A 1YREA 4E2AA 1XRYA 1S5KA 4MFZA 4EMEA 5AGEA 4BINA 3R96A 2YNDA 2QMLA 3FNCA 4OKOA 4ZBGA 3IWGA 3PBEA 4Z65A 1LCPA 1MJ9A 3FMCA 5K8NA 1ARLA 3BJ8A 1FY7A 1PU9A 4HPSA 5GCNA 3V7ZA 1ZLIA 2JBKA 2WYRA 4UFXA 3H8GA 2YGWA 3MGDA 4UBRA 2PJ2A 4JXRA 2OH1A 1NMTA 4DJLA 4M6GA 3CXQA 1AUGA 1M4LA 1PUAA 2VL1A 4Y49C 4X3RA 2FE7A 4E0AA 5KTAA 2PJBA 2B5GB 2C6CA 1VIXA 4ZX8A 2PDOA 2YNCC 4A30A 1X12A 2F5IA 4NEXA 4ONWA 5HMNA 4EWTA 1YLOA 4JYWA 1BPNA 4OMEA 5IV0A 1XOVA 2F7VA 3K2KA 4CGMA 2CTBA 2V8VA 1QSTA 4G1PA 5ISVA 2J8RA 4XPDB 4OC4A 3KHZA 2DPSA 2VXKA 3F0AA 4MCSA 4OC3A 3WC6A 4KLVA 2ZEFA 4H2KA 5LYDA 2Q7BA 1XE4A 1YVOA 4RUHA 5HXDA 1Y0RA 2C27A 3KKWA 2FXFA 1ZG7A 4CGOA 3IFEA 3S6KA 2ANPA 2CTCA 1TKFA 2P6EA 3N5FA 4B5OA 2DPTA 4CYOA 3H8FA 4RN7A 3TOBA 1YGHA 1JQGA 3GUXA 4B10A 3IO1A 4FWUA 5THWA 4A32A 3C26A 3GLJA 4UCPA 2OZGA 1YW6A 3DNSA 1A2ZA 2HUZA 3EO4A 4M3SA 2GU2A 2NSMA 1CX8A 5KTDA 1NSAA 1Y9KA 2QJ8A 3TO7A 4KUAA 4ZI6A 2PJ8A 4NFRA 3WT4A 2DF5A 2VI7A 1VGYA 1IYLA 1HDQA 2PQ8A 5F46A 1R43A 6CPAA 4HNYB 2GLFA 4MHZA 4A95A 4FAIA 2PRQA 2XEIA 1CJWA 3CDXA 3LWUA 3N7ZA 5LYIA 1N71A 3EXNA 4CGNA 1K4JA 3BI1A 2PC1A 2WSAA 1YR0A 2ZEGA 4PXDA 4RS2A 2PVVA 5J1QA 5D8NA 4DNCA 3T90A 3SXNA 4PXCA 4EVYA 2D4PA 4NGQA 3NE7A 1RXTA 4YFJA 3TFYA 2PJAA 3RNZA 3R9EA 1TKHA 2PJ9A 4UCNA 2PIZA 2P6GA 3V38A 4YU9A 3ZZIA 3VH9A 3BJ7A 4Q36A 3FXTA 4CGLA 4AVCA 1YSJA 1Y0YA 3B3CA 4FD4A 4ZY2A 3TTHA 4RI1A 4B14A 2Q04A 4LUAA 4ZY0A 4B12A 1I12A 4CYQA 3K9UA 4AXVA 4AVAA 2PJ0A 3RBUA 2XEFA 3LMSA 2ABZA 4KS9A 3B3WA 3B2YA 4A94A 4C2ZA 1P0HA 4F8ZA 8CPAA 4KZTA 1PYTB 4C2XA 4XNHB 5H86A 5K8PA 2NMTA 1S7NA 2RC4A 3KHXA 4CAVA 1TKJA 3S9NA 4KOXA 2WPWA 3FEDA 3S9LA 1LANA 4X5KA 1LRZA 3KI9A 4F0XA 1GHEA 3GYAA 4B13A 2B5GA 2ZW6A 5IX3A 3GY9A 3KL9A 5J8FA 2BEIA 4U9ZA 3SJGA 4A38A 5JH9A 4K3NA 4UEFA 1LOKA 2J9AA 4OC5A 1KUYA 4B6ZA 1YLEA
chains in the Genus database with same CATH topology
4L89A 4MFPA 2PR1A 4CRYB 1U6MA 3IU1A 2YNCA 4LX9A 4OAEA 2Z3MA 2Q4YA 4MJ8A 2VQYA 3TO6A 1IYKA 3D3SA 5G22A 4QVTA 1S7FA 2WPXA 2AJ6A 4QUSA 2ATRA 4CS0B 4K30A 3T9YA 4U9YA 2B3VA 4MBUA 4UCMA 3TT2A 1MJBA 2FS5A 4MFJA 4MFQA 4AG7A 1VHSA 3QB8A 3CXSA 3G8WA 2K5TA 4NCZA 1XF8A 4KORA 5IB0A 2B4DB 2ZW7A 2Q4VA 3FBUA 4KVXA 2FCKA 3SXOA 1I21A 3FRMA 4JD6A 2Z10A 2JDCA 4JXQA 1L0CA 4UWIA 1M4IA 4Y49B 4MFLA 4PK3A 1IICA 1YX0A 5J8CA 4HNXB 2D4OA 3UY5A 2Z3PA 4JLYA 4JWPA 4M85A 2FSRA 3EFAA 2R1IA 4AVBA 3JUWA 4AG9A 2YNEA 3LD2A 4MI4A 4YGOA 2O28A 2Q44A 3PZJA 4BBHA 4BMHA 4NXYA 3PGPA 5F47A 2REEA 1V0CA 4H6UA 2AE6A 4CAXA 2B58A 4MFKA 2BL1A 4A2ZA 3OWCA 2P0WA 4KOTA 4CYNA 1S60A 3DR6A 4QB9A 3D2MA 3I9SA 2R7HA 1IB1E 2X7BA 5G21A 4CRZB 1KZFA 2B4BA 3TO9A 5A28A 1Y7RA 5EBVA 1M4DA 5DWNA 2R8VA 4ONUA 4R3LA 2CY2A 2ZXVA 5F49A 2BUEA 5BWAB 3B8GA 3H5ZA 3DDDA 2FL4A 5G1ZA 2G3AA 1Q2DA 3JTKA 4FD5A 4QC6A 3GKRA 2HQYA 1I1DA 1MJAA 1BOBA 4AB7A 2VZYA 3S6GA 2KCWA 3IWEA 2GANA 4MY3A 1B6BA 2OZHA 1ZO0A 4YRHA 3W91A 1IIDA 4UFVA 1SQHA 2B4DA 2FIWA 2R98A 2ZW5A 5AG6A 4KOYA 4PV6A 4H6ZA 4KOVA 4R57A 2VZZA 4L8AA 1VKCA 4MY0A 3G3SA 2CNTA 4FD7A 4PSXA 4QBJA 1XMTA 2ARHA 2A4NA 1Q2YA 3EC4A 1OZPA 3QAHA 2G0BA 4PK2A 4HKFA 1CM0A 4C7IA 2EUIA 4KUBA 2HV2A 4KSAA 3DSBA 5FVJA 2VBQA 3S6FA 4CYPA 4KOSA 4UA3A 4KVOE 3LODA 4CGPA 1Z9UA 2VEZA 5C82A 4F0YA 1ON0A 4B5PB 2JDDA 5JPHA 3VWDA 3V8IA 1Z4EA 4CAFA 3R9GA 1QSRA 1KUVA 5AG5A 5I0CA 1YK3A 3A9LA 2ZW4A 2PRBA 4GS4A 4KLWA 4PSWA 4R3KA 3FB3A 5E96A 3CXPA 2G3TA 3R95A 1QSOA 1BO4A 4JJXA 1Y9WA 1R57A 2Y0MA 4UFWA 2QIRA 4H89A 2EVNA 1MK4A 2I00A 5A27A 3DR8A 3E0KA 3FYNA 3TOAA 2QECA 4II9A 2WUUA 4B11A 4XPDC 5HH1A 3IU2A 1J4JA 1M1DA 2Q0YA 1P4NA 2FIAA 4IUSA 2Z3OA 1M4GA 4UWJA 3D2PA 2Z3NA 3P2FA 3R1KA 4J3GA 2CNSA 4KOWA 4A33A 2REFA 2Z3LA 5EC4A 1RO5A 4KVME 3W6SA 2IL4A 3RYOA 4I49A 1M44A 2OB0A 1TIQA 1UFHA 1B87A 4FD6A 1QSNA 3F8KA 3PP9A 3TCVA 1Z4RA 3W6XA 1QSMA 3IGRA 3BLNA 2JEVA 2DXQA 2B3UA 5H84A 2J8MA 4CAWA 4OLLA 5C88A 2P6FA 1XIXA 5F48A 5G20A 4ZGYB 3TE4A 2PR8A 2GE3A 1S7KA 5KTCA 1XEBA 4XPKA 4B5PA 4ORFA 1KUXA 2JLMA 4R87A 3ZJ0A 4CAEA 3R9FA 1NSLA 3WR7A 3F5BA 1Q2CA 3JVNA 2I79A 4F6AA 1NE9A 3I3GA 4NF1A 4Q38A 2Z3KA 4C68A 2GIVA 4U5YA 4XNHC 2BSWA 4C2YA 2CXAA 4HNWB 2J8NA 2H5MA 2OZUA 4OADA 3P2HA 3SHPA 5JQ4A 1WK4A 3VWEA 2Z0ZA 1YVKA 4KOUA 3S6HA 4A31A 4C7HA 5CNPA 2ZPAA 2PSWA 4XPLA 1S7LA 3EY5A 5AG7A 1S3ZA 2CNMA 4KSFA 4MHDA 5DWMA 2FT0A 2OU2A 3D8PA 5AG4A 4NSQA 1WWZA 2Z11A 3FIXA 4IF5A 4E8OA 3H4QA 1YREA 4E2AA 1S5KA 4MFZA 5AGEA 3R96A 2YNDA 2QMLA 3FNCA 4ZBGA 3IWGA 1MJ9A 3BJ8A 5GCNA 1FY7A 1PU9A 4UFXA 2YGWA 3MGDA 4UBRA 4JXRA 2OH1A 1NMTA 3CXQA 1PUAA 4Y49C 2FE7A 4E0AA 5KTAA 2B5GB 2PDOA 2YNCC 4A30A 2F5IA 4NEXA 5HMNA 5IV0A 4CGMA 1QSTA 5ISVA 2J8RA 4XPDB 2DPSA 2VXKA 3F0AA 4KLVA 2Q7BA 1XE4A 1YVOA 2C27A 3KKWA 2FXFA 4CGOA 3S6KA 2P6EA 4B5OA 2DPTA 4CYOA 3TOBA 1YGHA 4B10A 4A32A 3C26A 4UCPA 2OZGA 3DNSA 3EO4A 4R9MA 2HUZA 5KTDA 4M3SA 3TO7A 1Y9KA 4KUAA 2VI7A 1IYLA 2PQ8A 5F46A 4HNYB 4A95A 1CJWA 3N7ZA 1N71A 3EXNA 4CGNA 1K4JA 2PC1A 2WSAA 1YR0A 4RS2A 4DNCA 3T90A 3SXNA 4EVYA 2D4PA 3NE7A 1RXTA 4YFJA 3TFYA 3R9EA 4UCNA 2P6GA 3ZZIA 3BJ7A 4Q36A 3FXTA 4CGLA 4AVCA 4FD4A 3TTHA 4RI1A 4B14A 2Q04A 4LUAA 4B12A 1I12A 4CYQA 3K9UA 4AVAA 4KS9A 4C2ZA 1P0HA 4KZTA 4C2XA 4XNHB 5H86A 2NMTA 1S7NA 2RC4A 4CAVA 4KOXA 2WPWA 4X5KA 1LRZA 4F0XA 1GHEA 3GYAA 4B13A 2B5GA 2ZW6A 5IX3A 3GY9A 5J8FA 2BEIA 4U9ZA 1KUYA 1YLEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L89 A;  2PR1 A;  4CRY B;  1U6M A;  4LX9 A;  4OAE A;  2Q4Y A;  4MJ8 A;  2VQY A;  3TO6 A;  1IYK A;  3D3S A;  4QVT A;  1S7F A;  2WPX A;  2AJ6 A;  4QUS A;  2ATR A;  4CS0 B;  4K30 A;  3T9Y A;  4U9Y A;  2B3V A;  4MBU A;  3TT2 A;  1MJB A;  2FS5 A;  4AG7 A;  1VHS A;  3QB8 A;  3CXS A;  3G8W A;  2K5T A;  4NCZ A;  1XF8 A;  4KOR A;  5IB0 A;  2B4D B;  2ZW7 A;  2Q4V A;  3FBU A;  4KVX A;  2FCK A;  3SXO A;  1I21 A;  3FRM A;  4JD6 A;  2Z10 A;  2JDC A;  4JXQ A;  1L0C A;  4UWI A;  1M4I A;  4Y49 B;  4PK3 A;  1IIC A;  1YX0 A;  5J8C A;  4HNX B;  2D4O A;  3UY5 A;  4JLY A;  4JWP A;  4M85 A;  2FSR A;  3EFA A;  2R1I A;  4AVB A;  3JUW A;  4AG9 A;  3LD2 A;  4MI4 A;  4YGO A;  2O28 A;  2Q44 A;  3PZJ A;  4BMH A;  4NXY A;  3PGP A;  5F47 A;  2REE A;  1V0C A;  4H6U A;  2AE6 A;  4CAX A;  2B58 A;  2BL1 A;  3OWC A;  2P0W A;  4KOT A;  1S60 A;  3DR6 A;  4QB9 A;  3D2M A;  3I9S A;  2R7H A;  1IB1 E;  2X7B A;  4CRZ B;  1KZF A;  2B4B A;  3TO9 A;  1Y7R A;  5EBV A;  1M4D A;  5DWN A;  2R8V A;  4ONU A;  4R3L A;  2CY2 A;  2ZXV A;  5F49 A;  2BUE A;  3B8G A;  3DDD A;  2FL4 A;  2G3A A;  1Q2D A;  4FD5 A;  4QC6 A;  3GKR A;  2HQY A;  1I1D A;  1MJA A;  1BOB A;  4AB7 A;  2VZY A;  3S6G A;  2KCW A;  2GAN A;  4MY3 A;  1B6B A;  2OZH A;  4YRH A;  3W91 A;  1IID A;  1SQH A;  2B4D A;  2FIW A;  2R98 A;  2ZW5 A;  4KOY A;  4PV6 A;  4H6Z A;  4KOV A;  4R57 A;  2VZZ A;  4L8A A;  1VKC A;  4MY0 A;  3G3S A;  2CNT A;  4FD7 A;  4PSX A;  4QBJ A;  1XMT A;  2ARH A;  2A4N A;  1Q2Y A;  3EC4 A;  1OZP A;  3QAH A;  2G0B A;  4PK2 A;  4HKF A;  1CM0 A;  2EUI A;  4KUB A;  2HV2 A;  3DSB A;  5FVJ A;  2VBQ A;  3S6F A;  4KOS A;  4UA3 A;  4KVO E;  3LOD A;  1Z9U A;  2VEZ A;  5C82 A;  4F0Y A;  1ON0 A;  4B5P B;  2JDD A;  5JPH A;  3VWD A;  3V8I A;  1Z4E A;  3R9G A;  1QSR A;  1KUV A;  5I0C A;  1YK3 A;  2ZW4 A;  2PRB A;  4GS4 A;  4KLW A;  4PSW A;  4R3K A;  3FB3 A;  5E96 A;  3CXP A;  2G3T A;  3R95 A;  1QSO A;  1BO4 A;  4JJX A;  1Y9W A;  1R57 A;  2Y0M A;  2QIR A;  4H89 A;  2EVN A;  1MK4 A;  2I00 A;  3DR8 A;  3E0K A;  3FYN A;  3TOA A;  2QEC A;  4II9 A;  4XPD C;  5HH1 A;  1J4J A;  1M1D A;  2Q0Y A;  1P4N A;  2FIA A;  4IUS A;  1M4G A;  4UWJ A;  3D2P A;  3P2F A;  3R1K A;  2CNS A;  4J3G A;  4KOW A;  2REF A;  5EC4 A;  1RO5 A;  4KVM E;  3W6S A;  2IL4 A;  3RYO A;  4I49 A;  1M44 A;  2OB0 A;  1TIQ A;  1UFH A;  1B87 A;  4FD6 A;  1QSN A;  3F8K A;  3PP9 A;  3TCV A;  1Z4R A;  3W6X A;  1QSM A;  3IGR A;  3BLN A;  2JEV A;  2DXQ A;  2B3U A;  5H84 A;  2J8M A;  4CAW A;  4OLL A;  5C88 A;  2P6F A;  1XIX A;  5F48 A;  3TE4 A;  2PR8 A;  2GE3 A;  1S7K A;  5KTC A;  1XEB A;  4XPK A;  4B5P A;  4ORF A;  1KUX A;  2JLM A;  4R87 A;  3ZJ0 A;  3R9F A;  1NSL A;  3WR7 A;  3F5B A;  1Q2C A;  3JVN A;  2I79 A;  4F6A A;  1NE9 A;  3I3G A;  4NF1 A;  2GIV A;  4U5Y A;  4XNH C;  2BSW A;  4HNW B;  2J8N A;  2H5M A;  2OZU A;  4OAD A;  3P2H A;  3SHP A;  5JQ4 A;  1WK4 A;  3VWE A;  2Z0Z A;  1YVK A;  4KOU A;  3S6H A;  5CNP A;  2ZPA A;  2PSW A;  4XPL A;  1S7L A;  3EY5 A;  1S3Z A;  2CNM A;  4MHD A;  5DWM A;  2FT0 A;  2OU2 A;  3D8P A;  4NSQ A;  1WWZ A;  2Z11 A;  3FIX A;  4IF5 A;  4E8O A;  3H4Q A;  1YRE A;  4E2A A;  1S5K A;  3R96 A;  2QML A;  3FNC A;  4ZBG A;  3IWG A;  1MJ9 A;  3BJ8 A;  5GCN A;  1FY7 A;  1PU9 A;  4UBR A;  3MGD A;  4JXR A;  2OH1 A;  1NMT A;  3CXQ A;  1PUA A;  4Y49 C;  2FE7 A;  4E0A A;  5KTA A;  2B5G B;  2PDO A;  2F5I A;  4NEX A;  5HMN A;  5IV0 A;  1QST A;  5ISV A;  2J8R A;  4XPD B;  2VXK A;  3F0A A;  4KLV A;  2Q7B A;  1XE4 A;  1YVO A;  2C27 A;  3KKW A;  2FXF A;  3S6K A;  2P6E A;  4B5O A;  3TOB A;  1YGH A;  3C26 A;  2OZG A;  3DNS A;  3EO4 A;  4R9M A;  2HUZ A;  5KTD A;  4M3S A;  3TO7 A;  1Y9K A;  4KUA A;  2VI7 A;  1IYL A;  2PQ8 A;  5F46 A;  4HNY B;  1CJW A;  3N7Z A;  1N71 A;  3EXN A;  1K4J A;  2PC1 A;  1YR0 A;  4RS2 A;  4DNC A;  3T90 A;  3SXN A;  4EVY A;  2D4P A;  3NE7 A;  1RXT A;  4YFJ A;  3TFY A;  3R9E A;  2P6G A;  3ZZI A;  3BJ7 A;  3FXT A;  4AVC A;  4FD4 A;  3TTH A;  4RI1 A;  2Q04 A;  4LUA A;  1I12 A;  3K9U A;  4AVA A;  1P0H A;  4KZT A;  4XNH B;  5H86 A;  2NMT A;  1S7N A;  2RC4 A;  4CAV A;  4KOX A;  2WPW A;  4X5K A;  1LRZ A;  1GHE A;  3GYA A;  2B5G A;  2ZW6 A;  5IX3 A;  3GY9 A;  5J8F A;  2BEI A;  4U9Z A;  1KUY A;  1YLE A; 
#chains in the Genus database with same CATH topology
 1XFO A;  1XJO A;  2PJ4 A;  4L89 A;  2IQ6 A;  3IJ3 A;  4MFP A;  1XBU A;  2PE3 A;  2PR1 A;  2Q51 A;  1DTD A;  1EE3 P;  3WC7 A;  1U6M A;  2FVG A;  2PJ1 A;  3IU1 A;  2AFS A;  2YNC A;  4LX9 A;  4YWY A;  4CRY B;  4R76 A;  3KGQ A;  4OAE A;  2Z3M A;  2ZEH A;  3WAB A;  4OC2 A;  2Q4Y A;  4MJ8 A;  2VQY A;  3TO6 A;  4A37 A;  1IYK A;  3D3S A;  3LAC A;  5G22 A;  4QVT A;  1S7F A;  2WPX A;  3SI0 A;  2ZEL A;  2AJ6 A;  2PJ6 A;  4QUS A;  2ATR A;  4FBE A;  1ZG9 A;  4K30 A;  1HDU A;  3T9Y A;  1AYE A;  4CS0 B;  4U9Y A;  4UF4 A;  2B3V A;  4MBU A;  4UCM A;  3TT2 A;  1MJB A;  2FS5 A;  4MFJ A;  2BOA A;  4MFQ A;  4P4F A;  4AG7 A;  1HEE A;  1VHS A;  3PFE A;  3QB8 A;  4R8F A;  3CXS A;  3B35 A;  1DE4 C;  2AFX A;  3SJF A;  3G8W A;  2K5T A;  4OIW A;  3SJX A;  4NCZ A;  1XF8 A;  2XEG A;  4KOR A;  2B4D B;  2ZW7 A;  5IB0 A;  2Q4V A;  3FBU A;  4R9M A;  4KVX A;  2FCK A;  3SXO A;  1I21 A;  3FRM A;  4IAV A;  4JD6 A;  4NGN A;  4UIB A;  2Z10 A;  4MRI A;  7CPA A;  2JDC A;  1YQE A;  2ZEN A;  1ARM A;  2CIJ A;  4JXQ A;  1L0C A;  1RTQ A;  4UWI A;  1M4I A;  4OP4 A;  4Y49 B;  3GB0 A;  1KWM A;  4MFL A;  2ZED A;  4R6T A;  4W9Y A;  3FX6 A;  5CPA A;  4PK3 A;  4PQA A;  5ELY A;  1IIC A;  1YX0 A;  3K9T A;  5J8C A;  4HNX B;  2D4O A;  3UY5 A;  2Z3P A;  3RAM A;  3RO0 A;  4JLY A;  2POK A;  4JWP A;  3PFO A;  4M85 A;  4P10 A;  2FSR A;  3EFA A;  4ZX9 A;  5DS0 A;  4TWE A;  4MCP A;  2R1I A;  4TNU A;  4MHY A;  4AVB A;  3JUW A;  4WWV A;  4AG9 A;  2YNE A;  3LD2 A;  3PB4 X;  4MI4 A;  1CBX A;  1QMU A;  4O23 A;  4YGO A;  2O28 A;  2Q44 A;  3PZJ A;  4BBH A;  4BMH A;  4NXY A;  3PGP A;  4NJQ A;  4P44 A;  3PB6 X;  4DUK A;  1FNO A;  3CPA A;  5F47 A;  2REE A;  3TX8 A;  1V0C A;  2C6G A;  4NGP A;  3KR4 A;  3D7F A;  3QNV A;  4MCQ A;  4H6U A;  2AE6 A;  4CAX A;  2B58 A;  2RB7 A;  4UEZ A;  4MFK A;  2BL1 A;  4JZ0 A;  1ZLH A;  4A2Z A;  3OWC A;  2P0W A;  4KOT A;  4CYN A;  1IOI A;  5F09 A;  1S60 A;  1YME A;  3DR6 A;  4QB9 A;  3D2M A;  2PJ3 A;  3I9S A;  5JM6 A;  3CZX A;  3D66 A;  2GLJ A;  2R7H A;  1IB1 E;  2X7B A;  5G21 A;  4CRZ B;  2JEW A;  1KZF A;  4PXB A;  2B4B A;  3SJE A;  3TO9 A;  5A28 A;  4GXH A;  1Y7R A;  5EBV A;  1M4D A;  5DWN A;  2R8V A;  1ELL P;  4ONU A;  4R3L A;  1IGB A;  2PJC A;  2CY2 A;  5EMI A;  1F2P A;  2ZXV A;  5F49 A;  2BUE A;  5BWA B;  3B8G A;  3H5Z A;  3DDD A;  4A39 A;  4NGT A;  2FL4 A;  3HUV A;  5G1Z A;  3VAR A;  4OC0 A;  2G3A A;  1Q2D A;  3JTK A;  4FD5 A;  4NJR A;  4QC6 A;  2ZEM A;  1I1D A;  2HQY A;  1MJA A;  3GKR A;  1BOB A;  4PXE A;  4AB7 A;  4P6Y A;  5K8M A;  3PBB A;  2VZY A;  3FF3 A;  3D7H A;  1AMP A;  2EK9 A;  3S6G A;  1R3N A;  2KCW A;  1LAP A;  2GAN A;  1LAM A;  3IWE A;  4MY3 A;  4P45 A;  1B6B A;  2OZH A;  2Q43 A;  3B3V A;  1ZO0 A;  4YRH A;  3W91 A;  1IID A;  3KQX A;  3FEE A;  4UFV A;  1CPX A;  1SQH A;  2B4D A;  4X2T A;  5HVF A;  2FIW A;  4GM5 A;  2R98 A;  2ZW5 A;  3MN8 A;  5AG6 A;  2ZEP A;  4KOY A;  4OC1 A;  4PV6 A;  4H6Z A;  3FH4 A;  4KOV A;  4MHP A;  2RFH A;  4R57 A;  2VZZ A;  3DLJ A;  1CG2 A;  1VKC A;  4L8A A;  3B3S A;  2PCU A;  3SI2 A;  3PRT A;  4MY0 A;  3G3S A;  2CNT A;  4FD7 A;  4PSX A;  4QBJ A;  3KR5 A;  1XMT A;  2ARH A;  2XEJ A;  2A4N A;  1Q2Y A;  2QVP A;  1OZP A;  3EC4 A;  3QAH A;  1Z5R A;  3BHX A;  4P4I A;  3D68 A;  2G0B A;  4PK2 A;  4HKF A;  1CM0 A;  4C7I A;  1BLL E;  2EUI A;  4ZYQ A;  4KUB A;  4M6H A;  2HV2 A;  2V8D A;  3DSB A;  4KSA A;  4MCR A;  5FVJ A;  2VBQ A;  3S6F A;  2F8H A;  3L2N A;  1UWY A;  4CYP A;  3PB9 X;  4KOS A;  4UA3 A;  4KVO E;  3LOD A;  4R7M A;  4CGP A;  2GRE A;  4LQG A;  1Z9U A;  2VEZ A;  5C82 A;  3B3T A;  1X10 A;  4F0Y A;  1ON0 A;  2ODF A;  1GYT A;  2AFZ A;  4B5P B;  1H8L A;  1ZG8 A;  2JDD A;  5JPH A;  3VWD A;  3D7G A;  1OBR A;  4M6I A;  3V8I A;  1Z4E A;  1CP7 A;  3D67 A;  1Z8T A;  4CAF A;  3R9G A;  1QSR A;  1KUV A;  1CPS A;  5AG5 A;  5I4M A;  1QQ9 A;  5I0C A;  1YK3 A;  3A9L A;  1IOF A;  5D29 A;  2HB6 A;  1VHE A;  2ZW4 A;  2EWB A;  2PRB A;  4GS4 A;  4KLW A;  4P4B A;  4PSW A;  4R3K A;  4CPA A;  4ZY1 A;  3FB3 A;  5E96 A;  3CXP A;  2G3T A;  3R95 A;  1QSO A;  1BO4 A;  4JJX A;  1Y9W A;  2HC9 A;  1R57 A;  2PJ5 A;  3CPX A;  3BXM A;  3GIU A;  2Y0M A;  3MRU A;  3NFZ A;  3T8W A;  4UFW A;  5HVG A;  2I3C A;  4NGM A;  2QIR A;  4H89 A;  1Z8X A;  2EVN A;  2Q4Z A;  3FEC A;  1MK4 A;  1F2O A;  2I00 A;  3IC1 A;  4DYO A;  5A27 A;  3DR8 A;  3E0K A;  3FYN A;  3IIB A;  3TOA A;  4F9V A;  1Y7E A;  2QEC A;  4NGR A;  4II9 A;  2WUU A;  2ZOG A;  3VAT A;  1ELM P;  1BAV A;  4B11 A;  4XPD C;  1TF8 A;  3SI1 A;  1TF9 A;  1XMB A;  5HH1 A;  3IU2 A;  4P4J A;  1J4J A;  3NH8 A;  2AFM A;  1JWQ A;  1M1D A;  2Q0Y A;  1P4N A;  2FIA A;  4IUS A;  2Z3O A;  2AFO A;  2C1C A;  1M4G A;  2EK8 A;  4PPZ A;  4UWJ A;  3D2P A;  2Z3N A;  3P2F A;  3R1K A;  1Z2L A;  2CNS A;  4J3G A;  3BI0 A;  2BCO A;  2ZEE A;  4KOW A;  4MHN A;  2REF A;  3FVL A;  4A33 A;  2Z3L A;  3QAY A;  5EC4 A;  1RO5 A;  4IHM A;  3NE8 A;  4KVM E;  3PB7 X;  3W6S A;  2IL4 A;  2O53 A;  3RYO A;  3PEI A;  3IWW A;  4I49 A;  3ISX A;  4X8I A;  4F9U A;  1M44 A;  2OB0 A;  3NH4 A;  5LRJ A;  4EFD A;  1YW4 A;  1PCA A;  1TIQ A;  1UFH A;  4KSI A;  5LRG A;  2OR4 A;  2OOT A;  3B7I A;  1B87 A;  4FD6 A;  1QSN A;  3F8K A;  3PP9 A;  3TCV A;  1TXR A;  1Z4R A;  3W6X A;  3RZA A;  1QSM A;  3IGR A;  3TC8 A;  3HLP A;  3BLN A;  1LFW A;  2DXQ A;  2B3U A;  2JEV A;  5H84 A;  2J8M A;  4MMO A;  4CAW A;  4OLL A;  5C88 A;  3DGV A;  2P6F A;  1XIX A;  2Q7S A;  5F48 A;  4UIA A;  5IB9 A;  3PB8 X;  2QYV A;  4NGS A;  5G20 A;  3I1U A;  4ZGY B;  3TE4 A;  2PR8 A;  2ZEO A;  2GE3 A;  3ISZ A;  1S7K A;  5KTC A;  2G9D A;  2V77 A;  5LYL A;  1XEB A;  2NYQ A;  3H8E A;  4WJB A;  2ZOF A;  4XPK A;  5HVH A;  4B5P A;  1FT7 A;  4ORF A;  1VHO A;  1KUX A;  2JLM A;  4R87 A;  1Q7L A;  3ZJ0 A;  4Q7A A;  4CAE A;  1BPM A;  1Z8W A;  2GFQ A;  1NSL A;  3R9F A;  2PJ7 A;  1Z8L A;  2AFW A;  1Q2C A;  3F5B A;  2I79 A;  3JVN A;  3WR7 A;  3KZW A;  3NA6 A;  4F6A A;  1NE9 A;  5LYF A;  3I3G A;  4NF1 A;  4Q38 A;  1CP6 A;  2Z3K A;  3WC5 A;  2GIV A;  4C68 A;  4U5Y A;  4XNH C;  2AFU A;  4UEE A;  2BSW A;  4LQ6 A;  2IJZ A;  2IMO A;  4C2Y A;  5K8O A;  2CXA A;  2O4H A;  4HNW B;  2J8N A;  2H5M A;  3NH5 A;  2OZU A;  4OAD A;  3P2H A;  2DEA A;  3KAS A;  3SHP A;  2EO8 A;  5JQ4 A;  5JGF A;  5CBM A;  1WK4 A;  3VWE A;  2Z0Z A;  4MXU A;  1YVK A;  2WZN A;  4KOU A;  3S6H A;  4A31 A;  4C7H A;  5CNP A;  4BD9 A;  3IEH A;  2CF4 A;  2ZPA A;  1IU8 A;  3S9M A;  4P4D A;  4OID A;  2PSW A;  2V8H A;  4XPL A;  1S7L A;  2JBJ A;  3EY5 A;  3FJU A;  5AG7 A;  1S3Z A;  2CNM A;  3KQZ A;  4KSF A;  4MHD A;  3D4U A;  5DWM A;  2FT0 A;  2C6P A;  2OU2 A;  3D8P A;  5LRK A;  2EBJ A;  5AG4 A;  4NSQ A;  1WWZ A;  2PIY A;  4P4E A;  2Z11 A;  3FIX A;  4IF5 A;  4FUU A;  3D7D A;  4E8O A;  3CT9 A;  3JRU A;  2BO9 A;  2V8G A;  1F57 A;  3H4Q A;  2PVW A;  1IY7 A;  4IK2 A;  1YRE A;  4E2A A;  1XRY A;  1S5K A;  4MFZ A;  4EME A;  5AGE A;  4BIN A;  3R96 A;  2YND A;  2QML A;  3FNC A;  4OKO A;  4ZBG A;  3IWG A;  3PBE A;  4Z65 A;  1LCP A;  1MJ9 A;  3FMC A;  5K8N A;  1ARL A;  3BJ8 A;  1FY7 A;  1PU9 A;  4HPS A;  5GCN A;  3V7Z A;  1ZLI A;  2JBK A;  2WYR A;  4UFX A;  3H8G A;  2YGW A;  3MGD A;  4UBR A;  2PJ2 A;  4JXR A;  2OH1 A;  1NMT A;  4DJL A;  4M6G A;  3CXQ A;  1AUG A;  1M4L A;  1PUA A;  2VL1 A;  4Y49 C;  4X3R A;  2FE7 A;  4E0A A;  5KTA A;  2PJB A;  2B5G B;  2C6C A;  1VIX A;  4ZX8 A;  2PDO A;  2YNC C;  4A30 A;  1X12 A;  2F5I A;  4NEX A;  4ONW A;  5HMN A;  4EWT A;  1YLO A;  4JYW A;  1BPN A;  4OME A;  5IV0 A;  1XOV A;  2F7V A;  3K2K A;  4CGM A;  2CTB A;  2V8V A;  1QST A;  4G1P A;  5ISV A;  2J8R A;  4XPD B;  4OC4 A;  3KHZ A;  2DPS A;  2VXK A;  3F0A A;  4MCS A;  4OC3 A;  3WC6 A;  4KLV A;  2ZEF A;  4H2K A;  5LYD A;  2Q7B A;  1XE4 A;  1YVO A;  4RUH A;  5HXD A;  1Y0R A;  2C27 A;  3KKW A;  2FXF A;  1ZG7 A;  4CGO A;  3IFE A;  3S6K A;  2ANP A;  2CTC A;  1TKF A;  2P6E A;  3N5F A;  4B5O A;  2DPT A;  4CYO A;  3H8F A;  4RN7 A;  3TOB A;  1YGH A;  1JQG A;  3GUX A;  4B10 A;  3IO1 A;  4FWU A;  5THW A;  4A32 A;  3C26 A;  3GLJ A;  4UCP A;  2OZG A;  1YW6 A;  3DNS A;  1A2Z A;  2HUZ A;  3EO4 A;  4M3S A;  2GU2 A;  2NSM A;  1CX8 A;  5KTD A;  1NSA A;  1Y9K A;  2QJ8 A;  3TO7 A;  4KUA A;  4ZI6 A;  2PJ8 A;  4NFR A;  3WT4 A;  2DF5 A;  2VI7 A;  1VGY A;  1IYL A;  1HDQ A;  2PQ8 A;  5F46 A;  1R43 A;  6CPA A;  4HNY B;  2GLF A;  4MHZ A;  4A95 A;  4FAI A;  2PRQ A;  2XEI A;  1CJW A;  3CDX A;  3LWU A;  3N7Z A;  5LYI A;  1N71 A;  3EXN A;  4CGN A;  1K4J A;  3BI1 A;  2PC1 A;  2WSA A;  1YR0 A;  2ZEG A;  4PXD A;  4RS2 A;  2PVV A;  5J1Q A;  5D8N A;  4DNC A;  3T90 A;  3SXN A;  4PXC A;  4EVY A;  2D4P A;  4NGQ A;  3NE7 A;  1RXT A;  4YFJ A;  3TFY A;  2PJA A;  3RNZ A;  3R9E A;  1TKH A;  2PJ9 A;  4UCN A;  2PIZ A;  2P6G A;  3V38 A;  4YU9 A;  3ZZI A;  3VH9 A;  3BJ7 A;  4Q36 A;  3FXT A;  4CGL A;  4AVC A;  1YSJ A;  1Y0Y A;  3B3C A;  4FD4 A;  4ZY2 A;  3TTH A;  4RI1 A;  4B14 A;  2Q04 A;  4LUA A;  4ZY0 A;  4B12 A;  1I12 A;  4CYQ A;  3K9U A;  4AXV A;  4AVA A;  2PJ0 A;  3RBU A;  2XEF A;  3LMS A;  2ABZ A;  4KS9 A;  3B3W A;  3B2Y A;  4A94 A;  4C2Z A;  1P0H A;  4F8Z A;  8CPA A;  4KZT A;  1PYT B;  4C2X A;  4XNH B;  5H86 A;  5K8P A;  2NMT A;  1S7N A;  2RC4 A;  3KHX A;  4CAV A;  1TKJ A;  3S9N A;  4KOX A;  2WPW A;  3FED A;  3S9L A;  1LAN A;  4X5K A;  1LRZ A;  3KI9 A;  4F0X A;  1GHE A;  3GYA A;  4B13 A;  2B5G A;  2ZW6 A;  5IX3 A;  3GY9 A;  3KL9 A;  5J8F A;  2BEI A;  4U9Z A;  3SJG A;  4A38 A;  5JH9 A;  4K3N A;  4UEF A;  1LOK A;  2J9A A;  4OC5 A;  1KUY A;  4B6Z A;  1YLE A; 
#chains in the Genus database with same CATH homology
 4L89 A;  4MFP A;  2PR1 A;  4CRY B;  1U6M A;  3IU1 A;  2YNC A;  4LX9 A;  4OAE A;  2Z3M A;  2Q4Y A;  4MJ8 A;  2VQY A;  3TO6 A;  1IYK A;  3D3S A;  5G22 A;  4QVT A;  1S7F A;  2WPX A;  2AJ6 A;  4QUS A;  2ATR A;  4CS0 B;  4K30 A;  3T9Y A;  4U9Y A;  2B3V A;  4MBU A;  4UCM A;  3TT2 A;  1MJB A;  2FS5 A;  4MFJ A;  4MFQ A;  4AG7 A;  1VHS A;  3QB8 A;  3CXS A;  3G8W A;  2K5T A;  4NCZ A;  1XF8 A;  4KOR A;  5IB0 A;  2B4D B;  2ZW7 A;  2Q4V A;  3FBU A;  4KVX A;  2FCK A;  3SXO A;  1I21 A;  3FRM A;  4JD6 A;  2Z10 A;  2JDC A;  4JXQ A;  1L0C A;  4UWI A;  1M4I A;  4Y49 B;  4MFL A;  4PK3 A;  1IIC A;  1YX0 A;  5J8C A;  4HNX B;  2D4O A;  3UY5 A;  2Z3P A;  4JLY A;  4JWP A;  4M85 A;  2FSR A;  3EFA A;  2R1I A;  4AVB A;  3JUW A;  4AG9 A;  2YNE A;  3LD2 A;  4MI4 A;  4YGO A;  2O28 A;  2Q44 A;  3PZJ A;  4BBH A;  4BMH A;  4NXY A;  3PGP A;  5F47 A;  2REE A;  1V0C A;  4H6U A;  2AE6 A;  4CAX A;  2B58 A;  4MFK A;  2BL1 A;  4A2Z A;  3OWC A;  2P0W A;  4KOT A;  4CYN A;  1S60 A;  3DR6 A;  4QB9 A;  3D2M A;  3I9S A;  2R7H A;  1IB1 E;  2X7B A;  5G21 A;  4CRZ B;  1KZF A;  2B4B A;  3TO9 A;  5A28 A;  1Y7R A;  5EBV A;  1M4D A;  5DWN A;  2R8V A;  4ONU A;  4R3L A;  2CY2 A;  2ZXV A;  5F49 A;  2BUE A;  5BWA B;  3B8G A;  3H5Z A;  3DDD A;  2FL4 A;  5G1Z A;  2G3A A;  1Q2D A;  3JTK A;  4FD5 A;  4QC6 A;  3GKR A;  2HQY A;  1I1D A;  1MJA A;  1BOB A;  4AB7 A;  2VZY A;  3S6G A;  2KCW A;  3IWE A;  2GAN A;  4MY3 A;  1B6B A;  2OZH A;  1ZO0 A;  4YRH A;  3W91 A;  1IID A;  4UFV A;  1SQH A;  2B4D A;  2FIW A;  2R98 A;  2ZW5 A;  5AG6 A;  4KOY A;  4PV6 A;  4H6Z A;  4KOV A;  4R57 A;  2VZZ A;  4L8A A;  1VKC A;  4MY0 A;  3G3S A;  2CNT A;  4FD7 A;  4PSX A;  4QBJ A;  1XMT A;  2ARH A;  2A4N A;  1Q2Y A;  3EC4 A;  1OZP A;  3QAH A;  2G0B A;  4PK2 A;  4HKF A;  1CM0 A;  4C7I A;  2EUI A;  4KUB A;  2HV2 A;  4KSA A;  3DSB A;  5FVJ A;  2VBQ A;  3S6F A;  4CYP A;  4KOS A;  4UA3 A;  4KVO E;  3LOD A;  4CGP A;  1Z9U A;  2VEZ A;  5C82 A;  4F0Y A;  1ON0 A;  4B5P B;  2JDD A;  5JPH A;  3VWD A;  3V8I A;  1Z4E A;  4CAF A;  3R9G A;  1QSR A;  1KUV A;  5AG5 A;  5I0C A;  1YK3 A;  3A9L A;  2ZW4 A;  2PRB A;  4GS4 A;  4KLW A;  4PSW A;  4R3K A;  3FB3 A;  5E96 A;  3CXP A;  2G3T A;  3R95 A;  1QSO A;  1BO4 A;  4JJX A;  1Y9W A;  1R57 A;  2Y0M A;  4UFW A;  2QIR A;  4H89 A;  2EVN A;  1MK4 A;  2I00 A;  5A27 A;  3DR8 A;  3E0K A;  3FYN A;  3TOA A;  2QEC A;  4II9 A;  2WUU A;  4B11 A;  4XPD C;  5HH1 A;  3IU2 A;  1J4J A;  1M1D A;  2Q0Y A;  1P4N A;  2FIA A;  4IUS A;  2Z3O A;  1M4G A;  4UWJ A;  3D2P A;  2Z3N A;  3P2F A;  3R1K A;  4J3G A;  2CNS A;  4KOW A;  4A33 A;  2REF A;  2Z3L A;  5EC4 A;  1RO5 A;  4KVM E;  3W6S A;  2IL4 A;  3RYO A;  4I49 A;  1M44 A;  2OB0 A;  1TIQ A;  1UFH A;  1B87 A;  4FD6 A;  1QSN A;  3F8K A;  3PP9 A;  3TCV A;  1Z4R A;  3W6X A;  1QSM A;  3IGR A;  3BLN A;  2JEV A;  2DXQ A;  2B3U A;  5H84 A;  2J8M A;  4CAW A;  4OLL A;  5C88 A;  2P6F A;  1XIX A;  5F48 A;  5G20 A;  4ZGY B;  3TE4 A;  2PR8 A;  2GE3 A;  1S7K A;  5KTC A;  1XEB A;  4XPK A;  4B5P A;  4ORF A;  1KUX A;  2JLM A;  4R87 A;  3ZJ0 A;  4CAE A;  3R9F A;  1NSL A;  3WR7 A;  3F5B A;  1Q2C A;  3JVN A;  2I79 A;  4F6A A;  1NE9 A;  3I3G A;  4NF1 A;  4Q38 A;  2Z3K A;  4C68 A;  2GIV A;  4U5Y A;  4XNH C;  2BSW A;  4C2Y A;  2CXA A;  4HNW B;  2J8N A;  2H5M A;  2OZU A;  4OAD A;  3P2H A;  3SHP A;  5JQ4 A;  1WK4 A;  3VWE A;  2Z0Z A;  1YVK A;  4KOU A;  3S6H A;  4A31 A;  4C7H A;  5CNP A;  2ZPA A;  2PSW A;  4XPL A;  1S7L A;  3EY5 A;  5AG7 A;  1S3Z A;  2CNM A;  4KSF A;  4MHD A;  5DWM A;  2FT0 A;  2OU2 A;  3D8P A;  5AG4 A;  4NSQ A;  1WWZ A;  2Z11 A;  3FIX A;  4IF5 A;  4E8O A;  3H4Q A;  1YRE A;  4E2A A;  1S5K A;  4MFZ A;  5AGE A;  3R96 A;  2YND A;  2QML A;  3FNC A;  4ZBG A;  3IWG A;  1MJ9 A;  3BJ8 A;  5GCN A;  1FY7 A;  1PU9 A;  4UFX A;  2YGW A;  3MGD A;  4UBR A;  4JXR A;  2OH1 A;  1NMT A;  3CXQ A;  1PUA A;  4Y49 C;  2FE7 A;  4E0A A;  5KTA A;  2B5G B;  2PDO A;  2YNC C;  4A30 A;  2F5I A;  4NEX A;  5HMN A;  5IV0 A;  4CGM A;  1QST A;  5ISV A;  2J8R A;  4XPD B;  2DPS A;  2VXK A;  3F0A A;  4KLV A;  2Q7B A;  1XE4 A;  1YVO A;  2C27 A;  3KKW A;  2FXF A;  4CGO A;  3S6K A;  2P6E A;  4B5O A;  2DPT A;  4CYO A;  3TOB A;  1YGH A;  4B10 A;  4A32 A;  3C26 A;  4UCP A;  2OZG A;  3DNS A;  3EO4 A;  4R9M A;  2HUZ A;  5KTD A;  4M3S A;  3TO7 A;  1Y9K A;  4KUA A;  2VI7 A;  1IYL A;  2PQ8 A;  5F46 A;  4HNY B;  4A95 A;  1CJW A;  3N7Z A;  1N71 A;  3EXN A;  4CGN A;  1K4J A;  2PC1 A;  2WSA A;  1YR0 A;  4RS2 A;  4DNC A;  3T90 A;  3SXN A;  4EVY A;  2D4P A;  3NE7 A;  1RXT A;  4YFJ A;  3TFY A;  3R9E A;  4UCN A;  2P6G A;  3ZZI A;  3BJ7 A;  4Q36 A;  3FXT A;  4CGL A;  4AVC A;  4FD4 A;  3TTH A;  4RI1 A;  4B14 A;  2Q04 A;  4LUA A;  4B12 A;  1I12 A;  4CYQ A;  3K9U A;  4AVA A;  4KS9 A;  4C2Z A;  1P0H A;  4KZT A;  4C2X A;  4XNH B;  5H86 A;  2NMT A;  1S7N A;  2RC4 A;  4CAV A;  4KOX A;  2WPW A;  4X5K A;  1LRZ A;  4F0X A;  1GHE A;  3GYA A;  4B13 A;  2B5G A;  2ZW6 A;  5IX3 A;  3GY9 A;  5J8F A;  2BEI A;  4U9Z A;  1KUY A;  1YLE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...