3R9EA

Crystal structure of microcin c7 self immunity acetyltransferase mcce in complex with coenzyme a and aspartyl sulfamoyl adenosine (dsa)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
180
structure length
180
Chain Sequence
DVSLTPSGIKVNDEITLLYPALKYAEELYLLINQNKINFIKSMAWPAFVNNISDSVSFIEQSMIDNQNEKALILFIKYKTKIAGVVSFNIIDHANKTAYIGYWLGANFQGKGIVTNAINKLIQEYGDSGVIKRFVIKCIVDNKKSNATALRCGFTLEGVLQKAEILNGVSYDQNIYSKVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccE protein
publication title Structural Basis for Microcin C7 Inactivation by the MccE Acetyltransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 55
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3r9eA00
4FD7A 1M4IA 4R3KA 2HUZA 3F5BA 1S7FA 3R95A 2A4NA 3KKWA 4YRHA 1QSNA 1YR0A 5E96A 2C27A 2PR1A 4UA3A 1ON0A 1IYLA 2PC1A 3VWEA 3W6SA 2R98A 4KOWA 2FT0A 1VKCA 1I1DA 1BOBA 1B87A 2FIAA 4NXYA 2Q44A 4OAEA 1PUAA 4PV6A 4MY3A 2ZW7A 3TE4A 5ISVA 4MY0A 4FD6A 1YLEA 1XF8A 3DSBA 2PDOA 4PK3A 2Q0YA 2FCKA 3C26A 4NF1A 3BJ7A 3S6KA 2ATRA 1KUYA 1K4JA 1RO5A 1YREA 3UY5A 2G3TA 3FYNA 4JWPA 5C88A 2J8RA 2IL4A 3T9YA 1M4GA 1YX0A 2R7HA 1Z4EA 2Z11A 1YK3A 4MHDA 4CAWA 2VBQA 2QMLA 4CAVA 4CS0B 2ZPAA 5I0CA 2VZYA 4JJXA 4OLLA 3H4QA 3FB3A 4AG7A 5IV0A 1IIDA 3LD2A 4Y49B 4XNHC 1Z9UA 4RI1A 3JVNA 1KUXA 5J8FA 4M85A 3RYOA 2B3UA 2X7BA 1TIQA 4HNYB 4J3GA 3F0AA 3DR8A 5IX3A 3B8GA 3WR7A 2BSWA 1M1DA 2JEVA 4R9MA 1FY7A 3D2MA 4H6ZA 1YVKA 1KZFA 2B4DB 2ZW6A 2ZW5A 2OZGA 2VZZA 4R3LA 4CRYB 1L0CA 4GS4A 4E0AA 3DR6A 2B5GB 5JPHA 1OZPA 4JXQA 5IB0A 2Y0MA 3FNCA 3PZJA 4XPKA 4UWIA 4X5KA 3NE7A 4KORA 3D2PA 1CM0A 2DXQA 3SXOA 2PQ8A 4CAXA 3GKRA 1PU9A 4KVXA 5F48A 2H5MA 3IWGA 3GYAA 3R1KA 3IGRA 4DNCA 1QSRA 1Z4RA 1MJ9A 4NEXA 3R96A 2BEIA 4Y49C 1WWZA 2B58A 2VI7A 4ONUA 3R9FA 3F8KA 1QSOA 2HQYA 1N71A 1UFHA 4AB7A 4B5PB 2CNSA 1S5KA 1WK4A 4QB9A 4XPLA 2FE7A 2Z0ZA 2K5TA 3EFAA 4K30A 2Z10A 3P2HA 2ARHA 4PSWA 2FSRA 5DWNA 5F46A 2HV2A 4E2AA 3DDDA 3R9EA 1IB1E 3D8PA 2OU2A 2BUEA 2PR8A 2B4BA 4MJ8A 2P6FA 2G3AA 3TCVA 2P6GA 3V8IA 4FD4A 4L8AA 3TO9A 4JXRA 1YVOA 3FIXA 4JD6A 3FBUA 5CNPA 4KOTA 5EBVA 4IUSA 4XPDC 2R1IA 1I21A 4FD5A 1Y7RA 1YGHA 1XEBA 4LUAA 2B3VA 1XE4A 1QSTA 2D4OA 5JQ4A 4KZTA 3G3SA 1Q2YA 3I9SA 4LX9A 2D4PA 2FIWA 3TOBA 3PGPA 3CXSA 3D3SA 4KOXA 3FRMA 4QVTA 2BL1A 3JUWA 4KOYA 4KOUA 3S6HA 4IF5A 2Q04A 4E8OA 1V0CA 3CXPA 3LODA 4R87A 2WPWA 1NSLA 1RXTA 2VQYA 4QUSA 2I79A 4JLYA 2I00A 2GE3A 1QSMA 2EVNA 3TOAA 5FVJA 2R8VA 4PK2A 1LRZA 3R9GA 1Q2DA 1MJBA 4UBRA 4F0YA 2FL4A 4U5YA 2P6EA 4U9ZA 1KUVA 1S3ZA 2GANA 1Y9KA 3S6FA 2OZHA 1M4DA 3CXQA 2CY2A 4NCZA 4OADA 4HNXB 3K9UA 4KOVA 3FXTA 4M3SA 2PSWA 4BMHA 3SXNA 3SHPA 4XNHB 2F5IA 5KTDA 2Q4VA 5H86A 3S6GA 3BJ8A 4AVAA 1S7NA 3VWDA 2Q4YA 5KTCA 5DWMA 4H89A 4ORFA 2REFA 1VHSA 4II9A 4L89A 4KVME 1CJWA 2VXKA 5HH1A 4RS2A 1U6MA 4YGOA 3ZJ0A 1MK4A 5F49A 4F6AA 4QC6A 1GHEA 1P0HA 1R57A 2OH1A 4KUAA 1S7KA 4MBUA 5J8CA 4R57A 3DNSA 3GY9A 3EY5A 2RC4A 2ZW4A 2PRBA 2JDCA 4QBJA 3W91A 1NMTA 3TT2A 5C82A 5GCNA 2JLMA 3G8WA 2AJ6A 4I49A 2QECA 3QB8A 5KTAA 2WPXA 1M44A 1BO4A 4HNWB 5HMNA 3PP9A 3QAHA 3OWCA 5F47A 2B4DA 2FXFA 4KVOE 3N7ZA 1I12A 2ZXVA 4EVYA 5H84A 1IICA 3T90A 2FS5A 2B5GA 3EO4A 1J4JA 2CNMA 4KLWA 2O28A 2REEA 3EXNA 2JDDA 3BLNA 1MJAA 2J8MA 4AG9A 3MGDA 4KUBA 3W6XA 4MI4A 1XMTA 4AVBA 2OZUA 2KCWA 3TO7A 4B5OA 1B6BA 4KLVA 4U9YA 2EUIA 4ZBGA 3ZZIA 2J8NA 2NMTA 3I3GA 4AVCA 3TO6A 1XIXA 3TTHA 2GIVA 1IYKA 3TFYA 2P0WA 1P4NA 5EC4A 1S60A 2AE6A 4HKFA 1NE9A 1Y9WA 2Q7BA 4KOSA 4CRZB 4B5PA 2QIRA 3EC4A 2VEZA 4XPDB 3P2FA 1Q2CA 2G0BA 4PSXA 1SQHA 4UWJA 1S7LA 2OB0A 4H6UA 4NSQA 2CNTA 4YFJA 3E0KA
chains in the Genus database with same CATH superfamily
4FD7A 1M4IA 4R3KA 2HUZA 2PJ8A 5AG5A 3F5BA 1ZG7A 2O53A 1S7FA 3R95A 4PXCA 2A4NA 3KKWA 3B3WA 3IFEA 4YRHA 5HVGA 1QSNA 1YR0A 4CYQA 1X10A 5E96A 3NH8A 2C27A 4MFJA 3PB8X 3SJFA 2PR1A 4UA3A 1ON0A 3KR5A 4A33A 4A30A 1IYLA 2PC1A 3VWEA 3W6SA 2R98A 3T8WA 4P10A 3V38A 4NFRA 3ISXA 4M6IA 5K8MA 4KOWA 3GUXA 5G21A 1AUGA 2NSMA 1VKCA 2FT0A 1I1DA 4B13A 1FT7A 1BOBA 3IEHA 4PXBA 5BWAB 1B87A 2FIAA 3GLJA 4NXYA 2Q44A 4ONWA 4OAEA 4MRIA 1PUAA 4NGNA 4PV6A 4MY3A 2ZW7A 4P44A 3TE4A 5ISVA 4MY0A 4FD6A 2Z3NA 1YLEA 4MMOA 5HXDA 1XF8A 3DSBA 2PDOA 4PK3A 2Q0YA 2FCKA 4MFKA 4MCSA 4RN7A 4UCNA 4C7HA 2PVWA 1H8LA 3C26A 3BJ7A 2QJ8A 4NF1A 3H8GA 3B3VA 1HEEA 2ATRA 1KUYA 1Y7EA 2PJ3A 4W9YA 3S6KA 4FAIA 1K4JA 1RO5A 1YREA 3B3CA 3UY5A 1YW6A 2G3TA 4CAEA 1RTQA 3FYNA 4JWPA 2Q43A 2J8RA 2IL4A 5C88A 5HVHA 3T9YA 1M4GA 1YX0A 2R7HA 3KR4A 1VHOA 1Z4EA 2ZENA 2IJZA 2XEGA 2ZOFA 2Z11A 1YK3A 5IB9A 1AMPA 4MHDA 1YSJA 2VBQA 3SI2A 4CAWA 2QMLA 4CAVA 4CS0B 2ZPAA 4P4FA 5I0CA 2VZYA 4JJXA 4KSFA 3H4QA 4OLLA 3FB3A 4AG7A 5IV0A 1IIDA 3LD2A 4OC0A 4HPSA 1TF8A 5D8NA 5K8OA 3BXMA 2WZNA 4Y49B 4XNHC 1Z9UA 3K2KA 4RI1A 3PBEA 2PJBA 3BI0A 5LYIA 1ZLIA 1KUXA 1XMBA 3JVNA 1CPXA 1BPNA 4MHPA 4M85A 5J8FA 4A39A 4Z65A 3RYOA 1VIXA 1F2PA 2B3UA 4BD9A 2X7BA 1TKHA 3D7FA 2ZEFA 7CPAA 4FBEA 1TIQA 1TKFA 4HNYB 4J3GA 4P4EA 3F0AA 3DR8A 5IX3A 3B8GA 3WR7A 4OC3A 2BSWA 4KSAA 1M1DA 2JEVA 4R9MA 1FY7A 3D2MA 4MXUA 1BAVA 4M6HA 4H6ZA 5G1ZA 2BO9A 1YVKA 2NYQA 1KZFA 1YQEA 4LQGA 2B4DB 2ZW6A 3FJUA 1ARMA 2ZW5A 4R6TA 2OZGA 2VZZA 1R43A 3FX6A 4R3LA 4CRYB 3MN8A 1L0CA 2PJ5A 1YLOA 3S9MA 4GS4A 4E0AA 3DR6A 2B5GB 3RO0A 3CDXA 4FWUA 5JPHA 4UEZA 1OZPA 5EMIA 2AFUA 1HDQA 4PQAA 4JZ0A 4JXQA 3PFOA 2Y0MA 3JTKA 3FNCA 5IB0A 3PZJA 4XPKA 2ABZA 1IY7A 1ZG8A 4UWIA 4X5KA 2DPTA 3NE7A 3LWUA 4C68A 4KORA 3D2PA 1CM0A 3IC1A 2DXQA 3SXOA 2PQ8A 4UEFA 3GKRA 1M4LA 1PU9A 4KVXA 3KQXA 4CAXA 4F8ZA 4ZGYB 4LQ6A 3KHZA 2ZEEA 5F48A 2H5MA 3IWGA 3L2NA 4G1PA 3GYAA 4OKOA 2AFWA 1ELMP 3R1KA 4NJRA 1ELLP 4Q36A 2Z3MA 2CTBA 3ISZA 3IGRA 4A94A 2AFSA 3K9TA 4DNCA 3PB7X 1LOKA 1QSRA 1Z4RA 4UIBA 5CPAA 1PYTB 4MHZA 2F7VA 1MJ9A 4NEXA 3R96A 2BEIA 4Y49C 3KQZA 2PJ1A 1WWZA 2B58A 3D66A 3NA6A 2I3CA 3A9LA 1ZO0A 4IAVA 2VI7A 4ONUA 3R9FA 3F8KA 3FEEA 1QSOA 2HQYA 4CYPA 3PBBA 3D7DA 1N71A 1LANA 1UFHA 4AB7A 4B5PB 2CNSA 4BINA 2Z3LA 1S5KA 1WK4A 4QB9A 1IU8A 5J1QA 4Q7AA 2GLFA 2FE7A 2Z0ZA 4XPLA 5LYFA 2K5TA 3EFAA 1TKJA 2Z10A 4K30A 3P2HA 1CX8A 3H8FA 3D7GA 2ARHA 4PSWA 5K8PA 2FSRA 2PCUA 5DWNA 1OBRA 4A37A 5F46A 2HV2A 4UF4A 4E2AA 3DLJA 3SI0A 3DDDA 3R9EA 1Z8WA 1IB1E 3D8PA 3HLPA 4IK2A 4Q38A 2OU2A 4GM5A 2DEAA 5A28A 2BUEA 3TC8A 3TX8A 2PR8A 2B4BA 1BPMA 2PJAA 4MJ8A 2P6FA 2G3AA 3TCVA 3SJGA 4EWTA 2P6GA 4OC4A 3V8IA 2V8GA 3B3TA 4FD4A 4L8AA 3TO9A 4JXRA 3WT4A 1LFWA 1LCPA 1YVOA 4P4IA 1ZG9A 1XJOA 3FIXA 2XEJA 4JD6A 5F09A 3S9LA 3CZXA 3FBUA 2PJ6A 4MCQA 5CNPA 4KOTA 4P4BA 3D68A 4IUSA 3CPAA 4XPDC 2JEWA 3H8EA 2R1IA 5EBVA 4JYWA 4UEEA 1I21A 2PVVA 4FD5A 4NGQA 4EMEA 5AG4A 1Y7RA 1NSAA 3WC5A 1YGHA 4PPZA 1XEBA 4PXEA 4LUAA 3TOBA 2B3VA 1XE4A 1QSTA 1FNOA 2D4OA 4EFDA 5JQ4A 4KZTA 3G3SA 4NJQA 1Q2YA 3I9SA 4LX9A 5ELYA 2D4PA 2FIWA 1F2OA 2RB7A 2IMOA 1JQGA 2F8HA 4CPAA 2ZOGA 3FECA 4NGPA 3PGPA 3CXSA 3D3SA 4KSIA 2CF4A 4KOXA 2GLJA 2WUUA 4P45A 3FRMA 4QVTA 2ZEGA 2BL1A 4NGSA 3BI1A 3JUWA 4KOYA 4KOUA 4ZY0A 1F57A 3S6HA 4IF5A 1IOFA 2IQ6A 2Q04A 4E8OA 1V0CA 1KWMA 3CXPA 3LODA 4R87A 2WPWA 1NSLA 3SJXA 1RXTA 2VQYA 4QUSA 2I79A 4DYOA 1CBXA 3WABA 4JLYA 4DUKA 1DTDA 2G9DA 1QMUA 3VH9A 1IGBA 2I00A 2ZELA 2GE3A 1QSMA 2EVNA 3GB0A 4CGMA 4TWEA 5FVJA 3TOAA 2R8VA 5AG7A 1YMEA 3IU1A 3JRUA 4PK2A 2GREA 1VHEA 3B7IA 4WWVA 1LRZA 4UIAA 3R9GA 1Q2DA 2GU2A 4C2ZA 4UFVA 1MJBA 4CAFA 4UBRA 4MFZA 4BMHA 4F0YA 3S9NA 2FL4A 1XRYA 4F9VA 4U5YA 4F0XA 3B3SA 1Z8LA 2WSAA 3WC7A 2P6EA 4DJLA 5JH9A 4U9ZA 1KUVA 1S3ZA 2GANA 4CYOA 4F9UA 1Y9KA 2PRQA 3S6FA 2OZHA 5CBMA 1XBUA 2BCOA 1M4DA 2EO8A 3CXQA 2Q4ZA 5AG6A 5THWA 4P6YA 1VGYA 4K3NA 3IIBA 2CY2A 4MCPA 4ZY2A 4NCZA 1CG2A 4OADA 3IO1A 3MRUA 4GXHA 1EE3P 4HNXB 3NH5A 3KASA 2V8HA 3K9UA 2Z3KA 3FMCA 4KOVA 4TNUA 3SJEA 3B2YA 1XOVA 3FXTA 3HUVA 3WC6A 4M3SA 2PSWA 1CP7A 5G20A 2AFOA 2QVPA 4O23A 4X8IA 3PB9X 2C6PA 3FH4A 3RZAA 2POKA 3V7ZA 4B12A 3SXNA 3D67A 3SHPA 3D4UA 2F5IA 4XNHB 4NGTA 2Q4VA 4OIWA 5H86A 5KTDA 3S6GA 3BJ8A 5JGFA 4BBHA 4CGPA 1ZLHA 1LAPA 3VATA 2ZEPA 4CGOA 2ANPA 4AVAA 2DPSA 4YU9A 1S7NA 4MHYA 8CPAA 3CPXA 2AFXA 1Z5RA 4UCPA 4P4DA 3VWDA 4MFQA 2Q4YA 5A27A 2XEIA 2EK9A 5KTCA 5DWMA 2OOTA 4H89A 4MFPA 4ORFA 1Q7LA 3RNZA 2ZEHA 2REFA 1VHSA 4II9A 1DE4C 4L89A 4MFLA 4KVME 2Q7SA 4MCRA 4A31A 1CJWA 2YNDA 2VXKA 4P4JA 3PFEA 1U6MA 4RS2A 4YGOA 5HH1A 3SI1A 3ZJ0A 1MK4A 5F49A 1Y0YA 3NH4A 4QC6A 4F6AA 1GHEA 1P0HA 1TF9A 3KHXA 5D29A 3VARA 1R57A 2WYRA 2PJ7A 3I1UA 3IWWA 4OC2A 2OH1A 1UWYA 4B10A 1GYTA 3KL9A 2BOAA 4KUAA 1S7KA 3BHXA 1Z8XA 4OC1A 4MBUA 2PIYA 5J8CA 2PJ4A 3PEIA 2V77A 4R57A 3DNSA 2PJCA 4PXDA 2HC9A 2V8DA 5JM6A 1A2ZA 2EWBA 2EBJA 3GY9A 1CPSA 1X12A 2O4HA 2Q51A 4UFXA 3EY5A 2RC4A 1PCAA 2OR4A 2ZW4A 3KZWA 2PRBA 1QQ9A 2AFMA 2JDCA 2ZEMA 1NMTA 3DGVA 3TT2A 3W91A 4QBJA 5C82A 5GCNA 2JLMA 3G8WA 4OC5A 2AJ6A 4I49A 4ZYQA 2JBKA 2QECA 3QB8A 5KTAA 2YGWA 2WPXA 2VL1A 2YNEA 3FVLA 4C2XA 2EK8A 4OMEA 4RUHA 3N5FA 1M44A 2FVGA 4CYNA 1BO4A 5K8NA 4HNWB 4X3RA 3LMSA 3PRTA 3IWEA 5HMNA 2CTCA 3PP9A 3QAHA 3OWCA 4AXVA 3PB6X 4X2TA 5F47A 2DF5A 2RFHA 3IU2A 5G22A 2B4DA 2FXFA 3FF3A 3GIUA 3N7ZA 4KVOE 1I12A 2ZXVA 4EVYA 4YWYA 1Z8TA 2C1CA 5H84A 1IICA 3T90A 5DS0A 2FS5A 4OIDA 2AFZA 2B5GA 3EO4A 4NGMA 1J4JA 3PB4X 2CNMA 4C7IA 3IJ3A 4KS9A 4B14A 4KLWA 2O28A 4M6GA 1TXRA 1AYEA 2XEFA 3D7HA 4ZI6A 3RAMA 2REEA 3EXNA 1CP6A 2PE3A 4B6ZA 4A2ZA 4IHMA 3RBUA 2JDDA 2CIJA 3H5ZA 3BLNA 4R8FA 4A95A 1R3NA 2PJ9A 2V8VA 3KI9A 4WJBA 1MJAA 2J8MA 5HVFA 3MGDA 4AG9A 4KUBA 3W6XA 5AGEA 4MI4A 2YNCC 1XMTA 4AVBA 2OZUA 2KCWA 2ODFA 3KGQA 3TO7A 4B5OA 2ZEDA 1B6BA 4CGLA 5LYLA 4KLVA 4U9YA 2EUIA 4ZBGA 3ZZIA 4ZY1A 5LRKA 2J8NA 2NMTA 3I3GA 4AVCA 3TO6A 4UFWA 1XIXA 3TTHA 5I4MA 2GIVA 1JWQA 1IYKA 3TFYA 4A38A 2C6CA 1LAMA 5LRJA 1Z2LA 2P0WA 4B11A 1ARLA 2J9AA 3NFZA 1IOIA 3B35A 1P4NA 5EC4A 3CT9A 1Y0RA 1S60A 6CPAA 2C6GA 2AE6A 2PIZA 4HKFA 2Z3PA 2JBJA 1NE9A 1BLLE 1Y9WA 3QNVA 2GFQA 2Z3OA 4ZX8A 2Q7BA 4C2YA 4KOSA 4CGNA 2PJ2A 4OP4A 4CRZB 4R76A 2PJ0A 4B5PA 2QIRA 3NE8A 2HB6A 3EC4A 1HDUA 2QYVA 4ZX9A 2VEZA 4XPDB 3P2FA 2ZEOA 3FEDA 5LRGA 4H2KA 1Q2CA 4MHNA 2G0BA 4PSXA 4NGRA 1YW4A 4A32A 1SQHA 4UWJA 1S7LA 4R7MA 2OB0A 4H6UA 2CXAA 2YNCA 4NSQA 3QAYA 1XFOA 2CNTA 3E0KA 4FUUA 4UCMA 4YFJA 3LACA 5LYDA
chains in the Genus database with same CATH topology
4FD7A 1M4IA 4R3KA 2HUZA 5AG5A 3F5BA 1S7FA 3R95A 2A4NA 3KKWA 4YRHA 1QSNA 1YR0A 4CYQA 5E96A 4MFJA 2C27A 2PR1A 4UA3A 1ON0A 4A30A 4A33A 1IYLA 2PC1A 3VWEA 3W6SA 2R98A 4KOWA 5G21A 2FT0A 1VKCA 1I1DA 4B13A 1BOBA 5BWAB 1B87A 2FIAA 4NXYA 2Q44A 4OAEA 1PUAA 4PV6A 4MY3A 2ZW7A 3TE4A 5ISVA 4MY0A 4FD6A 2Z3NA 1YLEA 1XF8A 3DSBA 2PDOA 4PK3A 2Q0YA 2FCKA 4MFKA 4UCNA 4C7HA 3C26A 4NF1A 3BJ7A 3S6KA 2ATRA 1KUYA 1K4JA 1RO5A 1YREA 3UY5A 2G3TA 4CAEA 3FYNA 4JWPA 5C88A 2J8RA 2IL4A 3T9YA 1M4GA 1YX0A 2R7HA 1Z4EA 2Z11A 1YK3A 4MHDA 4CAWA 2VBQA 2QMLA 4CAVA 4CS0B 2ZPAA 5I0CA 2VZYA 4JJXA 4KSFA 3H4QA 4OLLA 3FB3A 4AG7A 5IV0A 1IIDA 3LD2A 4Y49B 4XNHC 1Z9UA 4RI1A 3JVNA 1KUXA 5J8FA 4M85A 3RYOA 2B3UA 2X7BA 1TIQA 4HNYB 4J3GA 3F0AA 3DR8A 5IX3A 3B8GA 3WR7A 2BSWA 4KSAA 1M1DA 2JEVA 4R9MA 1FY7A 3D2MA 4H6ZA 5G1ZA 1YVKA 1KZFA 2B4DB 2ZW6A 2ZW5A 2OZGA 2VZZA 4R3LA 4CRYB 1L0CA 4GS4A 4E0AA 3DR6A 2B5GB 5JPHA 1OZPA 4JXQA 5IB0A 2Y0MA 3JTKA 3FNCA 3PZJA 4XPKA 4UWIA 4X5KA 2DPTA 3NE7A 4C68A 4KORA 3D2PA 1CM0A 2DXQA 3SXOA 2PQ8A 4CAXA 3GKRA 1PU9A 4ZGYB 4KVXA 5F48A 2H5MA 3IWGA 3GYAA 3R1KA 4Q36A 2Z3MA 3IGRA 4DNCA 1QSRA 1Z4RA 1MJ9A 4NEXA 3R96A 2BEIA 4Y49C 1WWZA 2B58A 3A9LA 1ZO0A 2VI7A 4ONUA 3R9FA 3F8KA 1QSOA 2HQYA 4CYPA 1N71A 1UFHA 4AB7A 4B5PB 2CNSA 2Z3LA 1S5KA 1WK4A 4QB9A 4XPLA 2FE7A 2Z0ZA 2K5TA 3EFAA 4K30A 2Z10A 3P2HA 2ARHA 4PSWA 2FSRA 5DWNA 5F46A 2HV2A 4E2AA 3DDDA 3R9EA 1IB1E 3D8PA 4Q38A 2OU2A 5A28A 2BUEA 2PR8A 2B4BA 4MJ8A 2P6FA 2G3AA 3TCVA 2P6GA 3V8IA 4FD4A 4L8AA 3TO9A 4JXRA 1YVOA 3FIXA 4JD6A 3FBUA 5CNPA 4KOTA 5EBVA 4IUSA 4XPDC 2R1IA 1I21A 4FD5A 5AG4A 1Y7RA 1YGHA 1XEBA 4LUAA 2B3VA 1XE4A 1QSTA 2D4OA 5JQ4A 4KZTA 3G3SA 1Q2YA 3I9SA 4LX9A 2D4PA 2FIWA 3TOBA 3PGPA 3CXSA 3D3SA 4KOXA 2WUUA 3FRMA 4QVTA 2BL1A 3JUWA 4KOYA 4KOUA 3S6HA 4IF5A 2Q04A 4E8OA 1V0CA 3CXPA 3LODA 4R87A 2WPWA 1NSLA 1RXTA 2VQYA 4QUSA 2I79A 4JLYA 2I00A 2GE3A 1QSMA 2EVNA 4CGMA 3TOAA 5FVJA 2R8VA 5AG7A 3IU1A 4PK2A 1LRZA 3R9GA 1Q2DA 4C2ZA 4UFVA 1MJBA 4CAFA 4UBRA 4MFZA 4F0YA 2FL4A 4U5YA 4F0XA 2WSAA 2P6EA 4U9ZA 1KUVA 1S3ZA 2GANA 4CYOA 1Y9KA 3S6FA 2OZHA 5AG6A 1M4DA 3CXQA 2CY2A 4NCZA 4OADA 4HNXB 3K9UA 4KOVA 2Z3KA 3FXTA 4M3SA 2PSWA 4BMHA 5G20A 4B12A 3SXNA 3SHPA 4XNHB 2F5IA 5KTDA 2Q4VA 5H86A 3S6GA 3BJ8A 4BBHA 4CGPA 4CGOA 4AVAA 2DPSA 1S7NA 3VWDA 4UCPA 5A27A 4MFQA 2Q4YA 5KTCA 5DWMA 4H89A 4MFPA 4ORFA 2REFA 1VHSA 4II9A 4L89A 4MFLA 4KVME 4A31A 1CJWA 2YNDA 2VXKA 5HH1A 4RS2A 1U6MA 4YGOA 3ZJ0A 1MK4A 5F49A 4F6AA 4QC6A 1GHEA 1P0HA 1R57A 2OH1A 4B10A 4KUAA 1S7KA 4MBUA 5J8CA 4R57A 3DNSA 3GY9A 4UFXA 3EY5A 2RC4A 2ZW4A 2PRBA 2JDCA 4QBJA 3W91A 1NMTA 3TT2A 5C82A 5GCNA 2JLMA 3G8WA 2AJ6A 4I49A 2QECA 3QB8A 5KTAA 2YGWA 2WPXA 2YNEA 4C2XA 1M44A 4CYNA 1BO4A 4HNWB 3IWEA 5HMNA 3PP9A 3QAHA 3OWCA 5F47A 5G22A 3IU2A 2B4DA 2FXFA 4KVOE 3N7ZA 1I12A 2ZXVA 4EVYA 5H84A 1IICA 3T90A 2FS5A 2B5GA 3EO4A 1J4JA 2CNMA 4C7IA 4KS9A 4B14A 4KLWA 2O28A 2REEA 3EXNA 4A2ZA 2JDDA 3H5ZA 3BLNA 4A95A 1MJAA 2J8MA 4AG9A 3MGDA 4KUBA 3W6XA 5AGEA 4MI4A 2YNCC 1XMTA 4AVBA 2OZUA 2KCWA 3TO7A 4B5OA 1B6BA 4CGLA 4KLVA 4U9YA 2EUIA 4ZBGA 3ZZIA 2J8NA 2NMTA 3I3GA 4AVCA 3TO6A 4UFWA 1XIXA 3TTHA 2GIVA 1IYKA 3TFYA 2P0WA 4B11A 1P4NA 5EC4A 1S60A 2AE6A 4HKFA 2Z3PA 1NE9A 1Y9WA 4C2YA 2Z3OA 2Q7BA 4CGNA 4KOSA 4CRZB 4B5PA 2QIRA 3EC4A 2VEZA 4XPDB 3P2FA 1Q2CA 2G0BA 4PSXA 4A32A 1SQHA 4UWJA 1S7LA 2OB0A 4H6UA 2CXAA 2YNCA 4NSQA 2CNTA 4UCMA 3E0KA 4YFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FD7 A;  1M4I A;  4R3K A;  2HUZ A;  3F5B A;  1S7F A;  3R95 A;  2A4N A;  3KKW A;  4YRH A;  1QSN A;  1YR0 A;  5E96 A;  2C27 A;  2PR1 A;  4UA3 A;  1ON0 A;  1IYL A;  2PC1 A;  3VWE A;  3W6S A;  2R98 A;  4KOW A;  2FT0 A;  1VKC A;  1I1D A;  1BOB A;  1B87 A;  2FIA A;  4NXY A;  2Q44 A;  4OAE A;  1PUA A;  4PV6 A;  4MY3 A;  2ZW7 A;  3TE4 A;  5ISV A;  4MY0 A;  4FD6 A;  1YLE A;  1XF8 A;  3DSB A;  2PDO A;  4PK3 A;  2Q0Y A;  2FCK A;  3C26 A;  4NF1 A;  3BJ7 A;  3S6K A;  2ATR A;  1KUY A;  1K4J A;  1RO5 A;  1YRE A;  3UY5 A;  2G3T A;  3FYN A;  4JWP A;  5C88 A;  2J8R A;  2IL4 A;  3T9Y A;  1M4G A;  1YX0 A;  2R7H A;  1Z4E A;  2Z11 A;  1YK3 A;  4MHD A;  4CAW A;  2VBQ A;  2QML A;  4CAV A;  4CS0 B;  2ZPA A;  5I0C A;  2VZY A;  4JJX A;  4OLL A;  3H4Q A;  3FB3 A;  4AG7 A;  5IV0 A;  1IID A;  3LD2 A;  4Y49 B;  4XNH C;  1Z9U A;  4RI1 A;  3JVN A;  1KUX A;  5J8F A;  4M85 A;  3RYO A;  2B3U A;  2X7B A;  1TIQ A;  4HNY B;  4J3G A;  3F0A A;  3DR8 A;  5IX3 A;  3B8G A;  3WR7 A;  2BSW A;  1M1D A;  2JEV A;  4R9M A;  1FY7 A;  3D2M A;  4H6Z A;  1YVK A;  1KZF A;  2B4D B;  2ZW6 A;  2ZW5 A;  2OZG A;  2VZZ A;  4R3L A;  4CRY B;  1L0C A;  4GS4 A;  4E0A A;  3DR6 A;  2B5G B;  5JPH A;  1OZP A;  4JXQ A;  5IB0 A;  2Y0M A;  3FNC A;  3PZJ A;  4XPK A;  4UWI A;  4X5K A;  3NE7 A;  4KOR A;  3D2P A;  1CM0 A;  2DXQ A;  3SXO A;  2PQ8 A;  4CAX A;  3GKR A;  1PU9 A;  4KVX A;  5F48 A;  2H5M A;  3IWG A;  3GYA A;  3R1K A;  3IGR A;  4DNC A;  1QSR A;  1Z4R A;  1MJ9 A;  4NEX A;  3R96 A;  2BEI A;  4Y49 C;  1WWZ A;  2B58 A;  2VI7 A;  4ONU A;  3R9F A;  3F8K A;  1QSO A;  2HQY A;  1N71 A;  1UFH A;  4AB7 A;  4B5P B;  2CNS A;  1S5K A;  1WK4 A;  4QB9 A;  4XPL A;  2FE7 A;  2Z0Z A;  2K5T A;  3EFA A;  4K30 A;  2Z10 A;  3P2H A;  2ARH A;  4PSW A;  2FSR A;  5DWN A;  5F46 A;  2HV2 A;  4E2A A;  3DDD A;  3R9E A;  1IB1 E;  3D8P A;  2OU2 A;  2BUE A;  2PR8 A;  2B4B A;  4MJ8 A;  2P6F A;  2G3A A;  3TCV A;  2P6G A;  3V8I A;  4FD4 A;  4L8A A;  3TO9 A;  4JXR A;  1YVO A;  3FIX A;  4JD6 A;  3FBU A;  5CNP A;  4KOT A;  5EBV A;  4IUS A;  4XPD C;  2R1I A;  1I21 A;  4FD5 A;  1Y7R A;  1YGH A;  1XEB A;  4LUA A;  2B3V A;  1XE4 A;  1QST A;  2D4O A;  5JQ4 A;  4KZT A;  3G3S A;  1Q2Y A;  3I9S A;  4LX9 A;  2D4P A;  2FIW A;  3TOB A;  3PGP A;  3CXS A;  3D3S A;  4KOX A;  3FRM A;  4QVT A;  2BL1 A;  3JUW A;  4KOY A;  4KOU A;  3S6H A;  4IF5 A;  2Q04 A;  4E8O A;  1V0C A;  3CXP A;  3LOD A;  4R87 A;  2WPW A;  1NSL A;  1RXT A;  2VQY A;  4QUS A;  2I79 A;  4JLY A;  2I00 A;  2GE3 A;  1QSM A;  2EVN A;  3TOA A;  5FVJ A;  2R8V A;  4PK2 A;  1LRZ A;  3R9G A;  1Q2D A;  1MJB A;  4UBR A;  4F0Y A;  2FL4 A;  4U5Y A;  2P6E A;  4U9Z A;  1KUV A;  1S3Z A;  2GAN A;  1Y9K A;  3S6F A;  2OZH A;  1M4D A;  3CXQ A;  2CY2 A;  4NCZ A;  4OAD A;  4HNX B;  3K9U A;  4KOV A;  3FXT A;  4M3S A;  2PSW A;  4BMH A;  3SXN A;  3SHP A;  4XNH B;  2F5I A;  5KTD A;  2Q4V A;  5H86 A;  3S6G A;  3BJ8 A;  4AVA A;  1S7N A;  3VWD A;  2Q4Y A;  5KTC A;  5DWM A;  4H89 A;  4ORF A;  2REF A;  1VHS A;  4II9 A;  4L89 A;  4KVM E;  1CJW A;  2VXK A;  5HH1 A;  4RS2 A;  1U6M A;  4YGO A;  3ZJ0 A;  1MK4 A;  5F49 A;  4F6A A;  4QC6 A;  1GHE A;  1P0H A;  1R57 A;  2OH1 A;  4KUA A;  1S7K A;  4MBU A;  5J8C A;  4R57 A;  3DNS A;  3GY9 A;  3EY5 A;  2RC4 A;  2ZW4 A;  2PRB A;  2JDC A;  4QBJ A;  3W91 A;  1NMT A;  3TT2 A;  5C82 A;  5GCN A;  2JLM A;  3G8W A;  2AJ6 A;  4I49 A;  2QEC A;  3QB8 A;  5KTA A;  2WPX A;  1M44 A;  1BO4 A;  4HNW B;  5HMN A;  3PP9 A;  3QAH A;  3OWC A;  5F47 A;  2B4D A;  2FXF A;  4KVO E;  3N7Z A;  1I12 A;  2ZXV A;  4EVY A;  5H84 A;  1IIC A;  3T90 A;  2FS5 A;  2B5G A;  3EO4 A;  1J4J A;  2CNM A;  4KLW A;  2O28 A;  2REE A;  3EXN A;  2JDD A;  3BLN A;  1MJA A;  2J8M A;  4AG9 A;  3MGD A;  4KUB A;  3W6X A;  4MI4 A;  1XMT A;  4AVB A;  2OZU A;  2KCW A;  3TO7 A;  4B5O A;  1B6B A;  4KLV A;  4U9Y A;  2EUI A;  4ZBG A;  3ZZI A;  2J8N A;  2NMT A;  3I3G A;  4AVC A;  3TO6 A;  1XIX A;  3TTH A;  2GIV A;  1IYK A;  3TFY A;  2P0W A;  1P4N A;  5EC4 A;  1S60 A;  2AE6 A;  4HKF A;  1NE9 A;  1Y9W A;  2Q7B A;  4KOS A;  4CRZ B;  4B5P A;  2QIR A;  3EC4 A;  2VEZ A;  4XPD B;  3P2F A;  1Q2C A;  2G0B A;  4PSX A;  1SQH A;  4UWJ A;  1S7L A;  2OB0 A;  4H6U A;  4NSQ A;  2CNT A;  4YFJ A;  3E0K A; 
#chains in the Genus database with same CATH topology
 4FD7 A;  1M4I A;  4R3K A;  2HUZ A;  2PJ8 A;  5AG5 A;  3F5B A;  1ZG7 A;  2O53 A;  1S7F A;  3R95 A;  4PXC A;  2A4N A;  3KKW A;  3B3W A;  3IFE A;  4YRH A;  5HVG A;  1QSN A;  1YR0 A;  4CYQ A;  1X10 A;  5E96 A;  3NH8 A;  2C27 A;  4MFJ A;  3PB8 X;  3SJF A;  2PR1 A;  4UA3 A;  1ON0 A;  3KR5 A;  4A33 A;  4A30 A;  1IYL A;  2PC1 A;  3VWE A;  3W6S A;  2R98 A;  3T8W A;  4P10 A;  3V38 A;  4NFR A;  3ISX A;  4M6I A;  5K8M A;  4KOW A;  3GUX A;  5G21 A;  1AUG A;  2NSM A;  1VKC A;  2FT0 A;  1I1D A;  4B13 A;  1FT7 A;  1BOB A;  3IEH A;  4PXB A;  5BWA B;  1B87 A;  2FIA A;  3GLJ A;  4NXY A;  2Q44 A;  4ONW A;  4OAE A;  4MRI A;  1PUA A;  4NGN A;  4PV6 A;  4MY3 A;  2ZW7 A;  4P44 A;  3TE4 A;  5ISV A;  4MY0 A;  4FD6 A;  2Z3N A;  1YLE A;  4MMO A;  5HXD A;  1XF8 A;  3DSB A;  2PDO A;  4PK3 A;  2Q0Y A;  2FCK A;  4MFK A;  4MCS A;  4RN7 A;  4UCN A;  4C7H A;  2PVW A;  1H8L A;  3C26 A;  3BJ7 A;  2QJ8 A;  4NF1 A;  3H8G A;  3B3V A;  1HEE A;  2ATR A;  1KUY A;  1Y7E A;  2PJ3 A;  4W9Y A;  3S6K A;  4FAI A;  1K4J A;  1RO5 A;  1YRE A;  3B3C A;  3UY5 A;  1YW6 A;  2G3T A;  4CAE A;  1RTQ A;  3FYN A;  4JWP A;  2Q43 A;  2J8R A;  2IL4 A;  5C88 A;  5HVH A;  3T9Y A;  1M4G A;  1YX0 A;  2R7H A;  3KR4 A;  1VHO A;  1Z4E A;  2ZEN A;  2IJZ A;  2XEG A;  2ZOF A;  2Z11 A;  1YK3 A;  5IB9 A;  1AMP A;  4MHD A;  1YSJ A;  2VBQ A;  3SI2 A;  4CAW A;  2QML A;  4CAV A;  4CS0 B;  2ZPA A;  4P4F A;  5I0C A;  2VZY A;  4JJX A;  4KSF A;  3H4Q A;  4OLL A;  3FB3 A;  4AG7 A;  5IV0 A;  1IID A;  3LD2 A;  4OC0 A;  4HPS A;  1TF8 A;  5D8N A;  5K8O A;  3BXM A;  2WZN A;  4Y49 B;  4XNH C;  1Z9U A;  3K2K A;  4RI1 A;  3PBE A;  2PJB A;  3BI0 A;  5LYI A;  1ZLI A;  1KUX A;  1XMB A;  3JVN A;  1CPX A;  1BPN A;  4MHP A;  4M85 A;  5J8F A;  4A39 A;  4Z65 A;  3RYO A;  1VIX A;  1F2P A;  2B3U A;  4BD9 A;  2X7B A;  1TKH A;  3D7F A;  2ZEF A;  7CPA A;  4FBE A;  1TIQ A;  1TKF A;  4HNY B;  4J3G A;  4P4E A;  3F0A A;  3DR8 A;  5IX3 A;  3B8G A;  3WR7 A;  4OC3 A;  2BSW A;  4KSA A;  1M1D A;  2JEV A;  4R9M A;  1FY7 A;  3D2M A;  4MXU A;  1BAV A;  4M6H A;  4H6Z A;  5G1Z A;  2BO9 A;  1YVK A;  2NYQ A;  1KZF A;  1YQE A;  4LQG A;  2B4D B;  2ZW6 A;  3FJU A;  1ARM A;  2ZW5 A;  4R6T A;  2OZG A;  2VZZ A;  1R43 A;  3FX6 A;  4R3L A;  4CRY B;  3MN8 A;  1L0C A;  2PJ5 A;  1YLO A;  3S9M A;  4GS4 A;  4E0A A;  3DR6 A;  2B5G B;  3RO0 A;  3CDX A;  4FWU A;  5JPH A;  4UEZ A;  1OZP A;  5EMI A;  2AFU A;  1HDQ A;  4PQA A;  4JZ0 A;  4JXQ A;  3PFO A;  2Y0M A;  3JTK A;  3FNC A;  5IB0 A;  3PZJ A;  4XPK A;  2ABZ A;  1IY7 A;  1ZG8 A;  4UWI A;  4X5K A;  2DPT A;  3NE7 A;  3LWU A;  4C68 A;  4KOR A;  3D2P A;  1CM0 A;  3IC1 A;  2DXQ A;  3SXO A;  2PQ8 A;  4UEF A;  3GKR A;  1M4L A;  1PU9 A;  4KVX A;  3KQX A;  4CAX A;  4F8Z A;  4ZGY B;  4LQ6 A;  3KHZ A;  2ZEE A;  5F48 A;  2H5M A;  3IWG A;  3L2N A;  4G1P A;  3GYA A;  4OKO A;  2AFW A;  1ELM P;  3R1K A;  4NJR A;  1ELL P;  4Q36 A;  2Z3M A;  2CTB A;  3ISZ A;  3IGR A;  4A94 A;  2AFS A;  3K9T A;  4DNC A;  3PB7 X;  1LOK A;  1QSR A;  1Z4R A;  4UIB A;  5CPA A;  1PYT B;  4MHZ A;  2F7V A;  1MJ9 A;  4NEX A;  3R96 A;  2BEI A;  4Y49 C;  3KQZ A;  2PJ1 A;  1WWZ A;  2B58 A;  3D66 A;  3NA6 A;  2I3C A;  3A9L A;  1ZO0 A;  4IAV A;  2VI7 A;  4ONU A;  3R9F A;  3F8K A;  3FEE A;  1QSO A;  2HQY A;  4CYP A;  3PBB A;  3D7D A;  1N71 A;  1LAN A;  1UFH A;  4AB7 A;  4B5P B;  2CNS A;  4BIN A;  2Z3L A;  1S5K A;  1WK4 A;  4QB9 A;  1IU8 A;  5J1Q A;  4Q7A A;  2GLF A;  2FE7 A;  2Z0Z A;  4XPL A;  5LYF A;  2K5T A;  3EFA A;  1TKJ A;  2Z10 A;  4K30 A;  3P2H A;  1CX8 A;  3H8F A;  3D7G A;  2ARH A;  4PSW A;  5K8P A;  2FSR A;  2PCU A;  5DWN A;  1OBR A;  4A37 A;  5F46 A;  2HV2 A;  4UF4 A;  4E2A A;  3DLJ A;  3SI0 A;  3DDD A;  3R9E A;  1Z8W A;  1IB1 E;  3D8P A;  3HLP A;  4IK2 A;  4Q38 A;  2OU2 A;  4GM5 A;  2DEA A;  5A28 A;  2BUE A;  3TC8 A;  3TX8 A;  2PR8 A;  2B4B A;  1BPM A;  2PJA A;  4MJ8 A;  2P6F A;  2G3A A;  3TCV A;  3SJG A;  4EWT A;  2P6G A;  4OC4 A;  3V8I A;  2V8G A;  3B3T A;  4FD4 A;  4L8A A;  3TO9 A;  4JXR A;  3WT4 A;  1LFW A;  1LCP A;  1YVO A;  4P4I A;  1ZG9 A;  1XJO A;  3FIX A;  2XEJ A;  4JD6 A;  5F09 A;  3S9L A;  3CZX A;  3FBU A;  2PJ6 A;  4MCQ A;  5CNP A;  4KOT A;  4P4B A;  3D68 A;  4IUS A;  3CPA A;  4XPD C;  2JEW A;  3H8E A;  2R1I A;  5EBV A;  4JYW A;  4UEE A;  1I21 A;  2PVV A;  4FD5 A;  4NGQ A;  4EME A;  5AG4 A;  1Y7R A;  1NSA A;  3WC5 A;  1YGH A;  4PPZ A;  1XEB A;  4PXE A;  4LUA A;  3TOB A;  2B3V A;  1XE4 A;  1QST A;  1FNO A;  2D4O A;  4EFD A;  5JQ4 A;  4KZT A;  3G3S A;  4NJQ A;  1Q2Y A;  3I9S A;  4LX9 A;  5ELY A;  2D4P A;  2FIW A;  1F2O A;  2RB7 A;  2IMO A;  1JQG A;  2F8H A;  4CPA A;  2ZOG A;  3FEC A;  4NGP A;  3PGP A;  3CXS A;  3D3S A;  4KSI A;  2CF4 A;  4KOX A;  2GLJ A;  2WUU A;  4P45 A;  3FRM A;  4QVT A;  2ZEG A;  2BL1 A;  4NGS A;  3BI1 A;  3JUW A;  4KOY A;  4KOU A;  4ZY0 A;  1F57 A;  3S6H A;  4IF5 A;  1IOF A;  2IQ6 A;  2Q04 A;  4E8O A;  1V0C A;  1KWM A;  3CXP A;  3LOD A;  4R87 A;  2WPW A;  1NSL A;  3SJX A;  1RXT A;  2VQY A;  4QUS A;  2I79 A;  4DYO A;  1CBX A;  3WAB A;  4JLY A;  4DUK A;  1DTD A;  2G9D A;  1QMU A;  3VH9 A;  1IGB A;  2I00 A;  2ZEL A;  2GE3 A;  1QSM A;  2EVN A;  3GB0 A;  4CGM A;  4TWE A;  5FVJ A;  3TOA A;  2R8V A;  5AG7 A;  1YME A;  3IU1 A;  3JRU A;  4PK2 A;  2GRE A;  1VHE A;  3B7I A;  4WWV A;  1LRZ A;  4UIA A;  3R9G A;  1Q2D A;  2GU2 A;  4C2Z A;  4UFV A;  1MJB A;  4CAF A;  4UBR A;  4MFZ A;  4BMH A;  4F0Y A;  3S9N A;  2FL4 A;  1XRY A;  4F9V A;  4U5Y A;  4F0X A;  3B3S A;  1Z8L A;  2WSA A;  3WC7 A;  2P6E A;  4DJL A;  5JH9 A;  4U9Z A;  1KUV A;  1S3Z A;  2GAN A;  4CYO A;  4F9U A;  1Y9K A;  2PRQ A;  3S6F A;  2OZH A;  5CBM A;  1XBU A;  2BCO A;  1M4D A;  2EO8 A;  3CXQ A;  2Q4Z A;  5AG6 A;  5THW A;  4P6Y A;  1VGY A;  4K3N A;  3IIB A;  2CY2 A;  4MCP A;  4ZY2 A;  4NCZ A;  1CG2 A;  4OAD A;  3IO1 A;  3MRU A;  4GXH A;  1EE3 P;  4HNX B;  3NH5 A;  3KAS A;  2V8H A;  3K9U A;  2Z3K A;  3FMC A;  4KOV A;  4TNU A;  3SJE A;  3B2Y A;  1XOV A;  3FXT A;  3HUV A;  3WC6 A;  4M3S A;  2PSW A;  1CP7 A;  5G20 A;  2AFO A;  2QVP A;  4O23 A;  4X8I A;  3PB9 X;  2C6P A;  3FH4 A;  3RZA A;  2POK A;  3V7Z A;  4B12 A;  3SXN A;  3D67 A;  3SHP A;  3D4U A;  2F5I A;  4XNH B;  4NGT A;  2Q4V A;  4OIW A;  5H86 A;  5KTD A;  3S6G A;  3BJ8 A;  5JGF A;  4BBH A;  4CGP A;  1ZLH A;  1LAP A;  3VAT A;  2ZEP A;  4CGO A;  2ANP A;  4AVA A;  2DPS A;  4YU9 A;  1S7N A;  4MHY A;  8CPA A;  3CPX A;  2AFX A;  1Z5R A;  4UCP A;  4P4D A;  3VWD A;  4MFQ A;  2Q4Y A;  5A27 A;  2XEI A;  2EK9 A;  5KTC A;  5DWM A;  2OOT A;  4H89 A;  4MFP A;  4ORF A;  1Q7L A;  3RNZ A;  2ZEH A;  2REF A;  1VHS A;  4II9 A;  1DE4 C;  4L89 A;  4MFL A;  4KVM E;  2Q7S A;  4MCR A;  4A31 A;  1CJW A;  2YND A;  2VXK A;  4P4J A;  3PFE A;  1U6M A;  4RS2 A;  4YGO A;  5HH1 A;  3SI1 A;  3ZJ0 A;  1MK4 A;  5F49 A;  1Y0Y A;  3NH4 A;  4QC6 A;  4F6A A;  1GHE A;  1P0H A;  1TF9 A;  3KHX A;  5D29 A;  3VAR A;  1R57 A;  2WYR A;  2PJ7 A;  3I1U A;  3IWW A;  4OC2 A;  2OH1 A;  1UWY A;  4B10 A;  1GYT A;  3KL9 A;  2BOA A;  4KUA A;  1S7K A;  3BHX A;  1Z8X A;  4OC1 A;  4MBU A;  2PIY A;  5J8C A;  2PJ4 A;  3PEI A;  2V77 A;  4R57 A;  3DNS A;  2PJC A;  4PXD A;  2HC9 A;  2V8D A;  5JM6 A;  1A2Z A;  2EWB A;  2EBJ A;  3GY9 A;  1CPS A;  1X12 A;  2O4H A;  2Q51 A;  4UFX A;  3EY5 A;  2RC4 A;  1PCA A;  2OR4 A;  2ZW4 A;  3KZW A;  2PRB A;  1QQ9 A;  2AFM A;  2JDC A;  2ZEM A;  1NMT A;  3DGV A;  3TT2 A;  3W91 A;  4QBJ A;  5C82 A;  5GCN A;  2JLM A;  3G8W A;  4OC5 A;  2AJ6 A;  4I49 A;  4ZYQ A;  2JBK A;  2QEC A;  3QB8 A;  5KTA A;  2YGW A;  2WPX A;  2VL1 A;  2YNE A;  3FVL A;  4C2X A;  2EK8 A;  4OME A;  4RUH A;  3N5F A;  1M44 A;  2FVG A;  4CYN A;  1BO4 A;  5K8N A;  4HNW B;  4X3R A;  3LMS A;  3PRT A;  3IWE A;  5HMN A;  2CTC A;  3PP9 A;  3QAH A;  3OWC A;  4AXV A;  3PB6 X;  4X2T A;  5F47 A;  2DF5 A;  2RFH A;  3IU2 A;  5G22 A;  2B4D A;  2FXF A;  3FF3 A;  3GIU A;  3N7Z A;  4KVO E;  1I12 A;  2ZXV A;  4EVY A;  4YWY A;  1Z8T A;  2C1C A;  5H84 A;  1IIC A;  3T90 A;  5DS0 A;  2FS5 A;  4OID A;  2AFZ A;  2B5G A;  3EO4 A;  4NGM A;  1J4J A;  3PB4 X;  2CNM A;  4C7I A;  3IJ3 A;  4KS9 A;  4B14 A;  4KLW A;  2O28 A;  4M6G A;  1TXR A;  1AYE A;  2XEF A;  3D7H A;  4ZI6 A;  3RAM A;  2REE A;  3EXN A;  1CP6 A;  2PE3 A;  4B6Z A;  4A2Z A;  4IHM A;  3RBU A;  2JDD A;  2CIJ A;  3H5Z A;  3BLN A;  4R8F A;  4A95 A;  1R3N A;  2PJ9 A;  2V8V A;  3KI9 A;  4WJB A;  1MJA A;  2J8M A;  5HVF A;  3MGD A;  4AG9 A;  4KUB A;  3W6X A;  5AGE A;  4MI4 A;  2YNC C;  1XMT A;  4AVB A;  2OZU A;  2KCW A;  2ODF A;  3KGQ A;  3TO7 A;  4B5O A;  2ZED A;  1B6B A;  4CGL A;  5LYL A;  4KLV A;  4U9Y A;  2EUI A;  4ZBG A;  3ZZI A;  4ZY1 A;  5LRK A;  2J8N A;  2NMT A;  3I3G A;  4AVC A;  3TO6 A;  4UFW A;  1XIX A;  3TTH A;  5I4M A;  2GIV A;  1JWQ A;  1IYK A;  3TFY A;  4A38 A;  2C6C A;  1LAM A;  5LRJ A;  1Z2L A;  2P0W A;  4B11 A;  1ARL A;  2J9A A;  3NFZ A;  1IOI A;  3B35 A;  1P4N A;  5EC4 A;  3CT9 A;  1Y0R A;  1S60 A;  6CPA A;  2C6G A;  2AE6 A;  2PIZ A;  4HKF A;  2Z3P A;  2JBJ A;  1NE9 A;  1BLL E;  1Y9W A;  3QNV A;  2GFQ A;  2Z3O A;  4ZX8 A;  2Q7B A;  4C2Y A;  4KOS A;  4CGN A;  2PJ2 A;  4OP4 A;  4CRZ B;  4R76 A;  2PJ0 A;  4B5P A;  2QIR A;  3NE8 A;  2HB6 A;  3EC4 A;  1HDU A;  2QYV A;  4ZX9 A;  2VEZ A;  4XPD B;  3P2F A;  2ZEO A;  3FED A;  5LRG A;  4H2K A;  1Q2C A;  4MHN A;  2G0B A;  4PSX A;  4NGR A;  1YW4 A;  4A32 A;  1SQH A;  4UWJ A;  1S7L A;  4R7M A;  2OB0 A;  4H6U A;  2CXA A;  2YNC A;  4NSQ A;  3QAY A;  1XFO A;  2CNT A;  3E0K A;  4FUU A;  4UCM A;  4YFJ A;  3LAC A;  5LYD A; 
#chains in the Genus database with same CATH homology
 4FD7 A;  1M4I A;  4R3K A;  2HUZ A;  5AG5 A;  3F5B A;  1S7F A;  3R95 A;  2A4N A;  3KKW A;  4YRH A;  1QSN A;  1YR0 A;  4CYQ A;  5E96 A;  4MFJ A;  2C27 A;  2PR1 A;  4UA3 A;  1ON0 A;  4A30 A;  4A33 A;  1IYL A;  2PC1 A;  3VWE A;  3W6S A;  2R98 A;  4KOW A;  5G21 A;  2FT0 A;  1VKC A;  1I1D A;  4B13 A;  1BOB A;  5BWA B;  1B87 A;  2FIA A;  4NXY A;  2Q44 A;  4OAE A;  1PUA A;  4PV6 A;  4MY3 A;  2ZW7 A;  3TE4 A;  5ISV A;  4MY0 A;  4FD6 A;  2Z3N A;  1YLE A;  1XF8 A;  3DSB A;  2PDO A;  4PK3 A;  2Q0Y A;  2FCK A;  4MFK A;  4UCN A;  4C7H A;  3C26 A;  4NF1 A;  3BJ7 A;  3S6K A;  2ATR A;  1KUY A;  1K4J A;  1RO5 A;  1YRE A;  3UY5 A;  2G3T A;  4CAE A;  3FYN A;  4JWP A;  5C88 A;  2J8R A;  2IL4 A;  3T9Y A;  1M4G A;  1YX0 A;  2R7H A;  1Z4E A;  2Z11 A;  1YK3 A;  4MHD A;  4CAW A;  2VBQ A;  2QML A;  4CAV A;  4CS0 B;  2ZPA A;  5I0C A;  2VZY A;  4JJX A;  4KSF A;  3H4Q A;  4OLL A;  3FB3 A;  4AG7 A;  5IV0 A;  1IID A;  3LD2 A;  4Y49 B;  4XNH C;  1Z9U A;  4RI1 A;  3JVN A;  1KUX A;  5J8F A;  4M85 A;  3RYO A;  2B3U A;  2X7B A;  1TIQ A;  4HNY B;  4J3G A;  3F0A A;  3DR8 A;  5IX3 A;  3B8G A;  3WR7 A;  2BSW A;  4KSA A;  1M1D A;  2JEV A;  4R9M A;  1FY7 A;  3D2M A;  4H6Z A;  5G1Z A;  1YVK A;  1KZF A;  2B4D B;  2ZW6 A;  2ZW5 A;  2OZG A;  2VZZ A;  4R3L A;  4CRY B;  1L0C A;  4GS4 A;  4E0A A;  3DR6 A;  2B5G B;  5JPH A;  1OZP A;  4JXQ A;  5IB0 A;  2Y0M A;  3JTK A;  3FNC A;  3PZJ A;  4XPK A;  4UWI A;  4X5K A;  2DPT A;  3NE7 A;  4C68 A;  4KOR A;  3D2P A;  1CM0 A;  2DXQ A;  3SXO A;  2PQ8 A;  4CAX A;  3GKR A;  1PU9 A;  4ZGY B;  4KVX A;  5F48 A;  2H5M A;  3IWG A;  3GYA A;  3R1K A;  4Q36 A;  2Z3M A;  3IGR A;  4DNC A;  1QSR A;  1Z4R A;  1MJ9 A;  4NEX A;  3R96 A;  2BEI A;  4Y49 C;  1WWZ A;  2B58 A;  3A9L A;  1ZO0 A;  2VI7 A;  4ONU A;  3R9F A;  3F8K A;  1QSO A;  2HQY A;  4CYP A;  1N71 A;  1UFH A;  4AB7 A;  4B5P B;  2CNS A;  2Z3L A;  1S5K A;  1WK4 A;  4QB9 A;  4XPL A;  2FE7 A;  2Z0Z A;  2K5T A;  3EFA A;  4K30 A;  2Z10 A;  3P2H A;  2ARH A;  4PSW A;  2FSR A;  5DWN A;  5F46 A;  2HV2 A;  4E2A A;  3DDD A;  3R9E A;  1IB1 E;  3D8P A;  4Q38 A;  2OU2 A;  5A28 A;  2BUE A;  2PR8 A;  2B4B A;  4MJ8 A;  2P6F A;  2G3A A;  3TCV A;  2P6G A;  3V8I A;  4FD4 A;  4L8A A;  3TO9 A;  4JXR A;  1YVO A;  3FIX A;  4JD6 A;  3FBU A;  5CNP A;  4KOT A;  5EBV A;  4IUS A;  4XPD C;  2R1I A;  1I21 A;  4FD5 A;  5AG4 A;  1Y7R A;  1YGH A;  1XEB A;  4LUA A;  2B3V A;  1XE4 A;  1QST A;  2D4O A;  5JQ4 A;  4KZT A;  3G3S A;  1Q2Y A;  3I9S A;  4LX9 A;  2D4P A;  2FIW A;  3TOB A;  3PGP A;  3CXS A;  3D3S A;  4KOX A;  2WUU A;  3FRM A;  4QVT A;  2BL1 A;  3JUW A;  4KOY A;  4KOU A;  3S6H A;  4IF5 A;  2Q04 A;  4E8O A;  1V0C A;  3CXP A;  3LOD A;  4R87 A;  2WPW A;  1NSL A;  1RXT A;  2VQY A;  4QUS A;  2I79 A;  4JLY A;  2I00 A;  2GE3 A;  1QSM A;  2EVN A;  4CGM A;  3TOA A;  5FVJ A;  2R8V A;  5AG7 A;  3IU1 A;  4PK2 A;  1LRZ A;  3R9G A;  1Q2D A;  4C2Z A;  4UFV A;  1MJB A;  4CAF A;  4UBR A;  4MFZ A;  4F0Y A;  2FL4 A;  4U5Y A;  4F0X A;  2WSA A;  2P6E A;  4U9Z A;  1KUV A;  1S3Z A;  2GAN A;  4CYO A;  1Y9K A;  3S6F A;  2OZH A;  5AG6 A;  1M4D A;  3CXQ A;  2CY2 A;  4NCZ A;  4OAD A;  4HNX B;  3K9U A;  4KOV A;  2Z3K A;  3FXT A;  4M3S A;  2PSW A;  4BMH A;  5G20 A;  4B12 A;  3SXN A;  3SHP A;  4XNH B;  2F5I A;  5KTD A;  2Q4V A;  5H86 A;  3S6G A;  3BJ8 A;  4BBH A;  4CGP A;  4CGO A;  4AVA A;  2DPS A;  1S7N A;  3VWD A;  4UCP A;  5A27 A;  4MFQ A;  2Q4Y A;  5KTC A;  5DWM A;  4H89 A;  4MFP A;  4ORF A;  2REF A;  1VHS A;  4II9 A;  4L89 A;  4MFL A;  4KVM E;  4A31 A;  1CJW A;  2YND A;  2VXK A;  5HH1 A;  4RS2 A;  1U6M A;  4YGO A;  3ZJ0 A;  1MK4 A;  5F49 A;  4F6A A;  4QC6 A;  1GHE A;  1P0H A;  1R57 A;  2OH1 A;  4B10 A;  4KUA A;  1S7K A;  4MBU A;  5J8C A;  4R57 A;  3DNS A;  3GY9 A;  4UFX A;  3EY5 A;  2RC4 A;  2ZW4 A;  2PRB A;  2JDC A;  4QBJ A;  3W91 A;  1NMT A;  3TT2 A;  5C82 A;  5GCN A;  2JLM A;  3G8W A;  2AJ6 A;  4I49 A;  2QEC A;  3QB8 A;  5KTA A;  2YGW A;  2WPX A;  2YNE A;  4C2X A;  1M44 A;  4CYN A;  1BO4 A;  4HNW B;  3IWE A;  5HMN A;  3PP9 A;  3QAH A;  3OWC A;  5F47 A;  5G22 A;  3IU2 A;  2B4D A;  2FXF A;  4KVO E;  3N7Z A;  1I12 A;  2ZXV A;  4EVY A;  5H84 A;  1IIC A;  3T90 A;  2FS5 A;  2B5G A;  3EO4 A;  1J4J A;  2CNM A;  4C7I A;  4KS9 A;  4B14 A;  4KLW A;  2O28 A;  2REE A;  3EXN A;  4A2Z A;  2JDD A;  3H5Z A;  3BLN A;  4A95 A;  1MJA A;  2J8M A;  4AG9 A;  3MGD A;  4KUB A;  3W6X A;  5AGE A;  4MI4 A;  2YNC C;  1XMT A;  4AVB A;  2OZU A;  2KCW A;  3TO7 A;  4B5O A;  1B6B A;  4CGL A;  4KLV A;  4U9Y A;  2EUI A;  4ZBG A;  3ZZI A;  2J8N A;  2NMT A;  3I3G A;  4AVC A;  3TO6 A;  4UFW A;  1XIX A;  3TTH A;  2GIV A;  1IYK A;  3TFY A;  2P0W A;  4B11 A;  1P4N A;  5EC4 A;  1S60 A;  2AE6 A;  4HKF A;  2Z3P A;  1NE9 A;  1Y9W A;  4C2Y A;  2Z3O A;  2Q7B A;  4CGN A;  4KOS A;  4CRZ B;  4B5P A;  2QIR A;  3EC4 A;  2VEZ A;  4XPD B;  3P2F A;  1Q2C A;  2G0B A;  4PSX A;  4A32 A;  1SQH A;  4UWJ A;  1S7L A;  2OB0 A;  4H6U A;  2CXA A;  2YNC A;  4NSQ A;  2CNT A;  4UCM A;  3E0K A;  4YFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...