2GE3A

Crystal structure of probable acetyltransferase from agrobacterium tumefaciens
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
164
structure length
164
Chain Sequence
DTVTIKPIRAEHVESFHRALDAVSRERKYLSFLEAPPLEAVRAFVLDMIENDHPQFVAIADGDVIGWCDIRRQDRATRAHCGTLGMGILPAYRNKGLGARLMRRTLDAAHEFGLHRIELSVHADNARAIALYEKIGFAHEGRARDAVSIDGHYIDSLNMAIIFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords probable acetyltransferase
publication title Crystal structure of Probable acetyltransferase from Agrobacterium tumefaciens
rcsb
source organism Agrobacterium tumefaciens
total genus 44
structure length 164
sequence length 164
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2ge3A00
4NXYA 4MY3A 4CAVA 4CS0B 3DR6A 3LODA 4YFJA 1WK4A 1UFHA 3LD2A 5JPHA 3E0KA 3GY9A 1Q2YA 4QC6A 4AVCA 4YGOA 4MI4A 5HH1A 3DNSA 3TO6A 2B5GB 4IF5A 4U5YA 3BLNA 5KTAA 5GCNA 4CAWA 3FXTA 2WPXA 3SXOA 1NMTA 2CNMA 2PR1A 4LUAA 4KVME 4E2AA 2R8VA 4NSQA 2GE3A 5J8FA 2Z0ZA 4II9A 3IWGA 4NF1A 1QSOA 1XEBA 4Y49C 2Z10A 2Z11A 1RO5A 2PDOA 2FL4A 4MBUA 2ZW5A 3GKRA 3G8WA 2JEVA 1MJ9A 3R96A 3T9YA 3TT2A 1Z4EA 1Y9WA 3FNCA 2D4OA 3EO4A 4U9ZA 4HNYB 2NMTA 4OADA 3FYNA 1YVKA 4CRYB 5DWMA 3TOBA 4EVYA 2BUEA 5F46A 1R57A 5DWNA 1Y9KA 2OZHA 4JLYA 1N71A 3P2FA 3VWDA 1M4GA 3GYAA 3FRMA 2B3VA 4QUSA 2ZXVA 2REFA 2Y0MA 1P0HA 1I21A 2IL4A 3TCVA 4AVAA 2AE6A 2JLMA 4H6UA 2G3TA 1YVOA 1I12A 1ON0A 4CRZB 1BOBA 2OU2A 3V8IA 3EFAA 5EBVA 4E0AA 1OZPA 1KUXA 3UY5A 4M85A 4PK2A 4R9MA 2OZUA 1NSLA 3RYOA 2Q04A 1S7LA 2J8RA 3TO7A 4UWJA 3IGRA 3PZJA 5KTCA 4YRHA 2OB0A 2HV2A 3C26A 3D8PA 2R98A 4AG9A 4KOSA 2ZW7A 1WWZA 5H84A 1QSRA 2ARHA 4R87A 4XNHB 3N7ZA 4F6AA 3W6SA 4FD7A 4B5PA 3P2HA 3K9UA 4OAEA 4AB7A 2ZW4A 5CNPA 2O28A 2KCWA 1Z9UA 2WPWA 4U9YA 2P6FA 1VHSA 1FY7A 2VZYA 4KOUA 1V0CA 2EUIA 4AG7A 2FXFA 2B3UA 3W6XA 5IV0A 3G3SA 4BMHA 1U6MA 3EXNA 1YK3A 4KVOE 3EY5A 1XIXA 5KTDA 2I79A 4KOYA 3BJ8A 1RXTA 2RC4A 2Q44A 2R1IA 5IB0A 1S5KA 2ZW6A 5H86A 3SHPA 3JVNA 4J3GA 2BSWA 2X7BA 5EC4A 1P4NA 1CM0A 4ZBGA 1PUAA 3TE4A 4E8OA 3W91A 4LX9A 2P0WA 2B5GA 4HNXB 5IX3A 2JDCA 2I00A 3DDDA 4F0YA 3FIXA 2C27A 3F8KA 2PR8A 3F0AA 4XPLA 1YX0A 3TO9A 4JXQA 4FD4A 4XNHC 4PSXA 4KVXA 2BEIA 2CY2A 3NE7A 2B4BA 1M44A 4PSWA 1LRZA 1VKCA 1Z4RA 4FD5A 1MJBA 3QB8A 3DR8A 2BL1A 2VI7A 2FSRA 5I0CA 2FS5A 1S7NA 4XPKA 2J8NA 4UA3A 1Y7RA 1IYLA 3SXNA 2JDDA 4QVTA 4H6ZA 3DSBA 2HQYA 5C82A 3R9FA 2G0BA 1KZFA 1QSMA 1CJWA 2GIVA 4PK3A 4ORFA 3TOAA 2P6EA 4KLWA 2Q4YA 3TTHA 2PSWA 2EVNA 5F47A 4MJ8A 1BO4A 2ZPAA 3TFYA 5HMNA 1Q2DA 3EC4A 3R95A 4AVBA 1XMTA 1NE9A 1SQHA 1YREA 2F5IA 2PRBA 1K4JA 4XPDC 4GS4A 3CXPA 4R57A 4PV6A 1KUYA 2DXQA 3R9EA 4FD6A 2D4PA 4UBRA 2J8MA 4IUSA 4K30A 4B5OA 3CXQA 2QMLA 1TIQA 3S6KA 3BJ7A 2AJ6A 3F5BA 1QSTA 1GHEA 4OLLA 4MHDA 2OZGA 4R3KA 2Q4VA 3QAHA 4M3SA 5FVJA 4H89A 3R1KA 3KKWA 4KUAA 2OH1A 3JUWA 2QIRA 1YLEA 1B6BA 1IICA 1S3ZA 1IYKA 1YR0A 4MY0A 4CAXA 4RS2A 4R3LA 2HUZA 3WR7A 4I49A 1XE4A 2B58A 2PC1A 4HNWB 4QB9A 1IIDA 2FIWA 1M1DA 2CNSA 4NEXA 4XPDB 3MGDA 5F48A 4KORA 1KUVA 3D3SA 4KLVA 2P6GA 4DNCA 3FB3A 1YGHA 3VWEA 1XF8A 3PP9A 3CXSA 1PU9A 4HKFA 4JD6A 3I3GA 1Q2CA 3PGPA 2K5TA 1IB1E 2FIAA 4KOWA 3S6GA 1I1DA 4X5KA 4KOXA 4QBJA 5F49A 2B4DB 2FCKA 3OWCA 1S60A 3T90A 1J4JA 2CNTA 4L89A 1S7FA 3I9SA 4NCZA 2Q7BA 3ZJ0A 5C88A 5JQ4A 4B5PB 2VXKA 3R9GA 2VEZA 2H5MA 1B87A 1L0CA 2REEA 4Y49B 4KOVA 1M4IA 4JJXA 2QECA 3FBUA 2Q0YA 5E96A 1QSNA 2FT0A 1S7KA 4KOTA 2ATRA 2VQYA 4ONUA 3D2MA 4UWIA 2FE7A 2PQ8A 5ISVA 1M4DA 1MK4A 2GANA 4L8AA 4KUBA 4JWPA 2B4DA 3ZZIA 3H4QA 3S6HA 2R7HA 4RI1A 2G3AA 2VZZA 4JXRA 4KZTA 2A4NA 3B8GA 5J8CA 2VBQA 1MJAA 3D2PA 3S6FA
chains in the Genus database with same CATH superfamily
1XOVA 4NXYA 4MY3A 4CAVA 4MRIA 3DR6A 4CS0B 3N5FA 5LRKA 4OMEA 1M4LA 4C7IA 4UEFA 3LODA 3KQXA 1Z8WA 3NFZA 4YFJA 3RAMA 1GYTA 1WK4A 4MFKA 1UFHA 2Q4ZA 3H8FA 4M6GA 2WYRA 3LD2A 5JPHA 4YWYA 3E0KA 3GY9A 1Q2YA 4B11A 4QC6A 4AVCA 4YGOA 1VGYA 4MI4A 5HH1A 3DNSA 2ANPA 4DYOA 3IO1A 3TO6A 4JZ0A 2B5GB 4IF5A 4NGPA 2Z3LA 4NGTA 1YLOA 4U5YA 1ELLP 2PIZA 1CG2A 3BLNA 5KTAA 5GCNA 2IMOA 3FXTA 4P6YA 4PXEA 4A32A 4CAWA 2WPXA 4MCSA 3SXOA 1NMTA 3BI1A 3FVLA 3D4UA 2CNMA 2PR1A 1RTQA 3B7IA 2XEGA 1XMBA 4IK2A 2DPSA 4LUAA 4KVME 2ZENA 4E2AA 2R8VA 4NSQA 5EMIA 2ZEMA 2GE3A 3B3VA 2IJZA 5J8FA 2Z0ZA 4II9A 3IWGA 4NF1A 4NGNA 1QSOA 1XEBA 4Y49C 5ELYA 3SI2A 3SJEA 2Z10A 3JRUA 3CPAA 2Z11A 3GLJA 1RO5A 4RN7A 2ZEGA 2PDOA 2FL4A 2PVWA 1IOFA 4X2TA 2V77A 4ZY0A 4MBUA 2ZW5A 3GKRA 3G8WA 1QQ9A 4PXBA 2JEVA 3QAYA 3KI9A 1MJ9A 2OR4A 3R96A 3T9YA 2JBJA 3TT2A 1Z4EA 1Y9WA 3BHXA 3FNCA 3IWEA 4CAEA 1PCAA 2D4OA 3EO4A 2Z3NA 4CYQA 4U9ZA 2PJAA 4HNYB 4ZY1A 2NMTA 3IIBA 4RUHA 2QVPA 3FF3A 3FYNA 4OADA 4C68A 1AUGA 1YVKA 2AFXA 3FH4A 4OC1A 5DWMA 4CRYB 3TOBA 4Q38A 3NA6A 4B12A 2BUEA 4CGLA 4EVYA 3KASA 2F8HA 5D29A 5F46A 3WC7A 1R57A 1XJOA 1ZG9A 3V38A 4FWUA 5DWNA 4A37A 1Y9KA 3PB8X 2XEFA 2EK9A 4NJQA 5G20A 2OZHA 4JLYA 4M6HA 4OKOA 1N71A 3P2FA 3KR5A 2VL1A 2BO9A 4DJLA 3VWDA 1M4GA 2O4HA 3GYAA 3FRMA 2EK8A 2B3VA 1LANA 4QUSA 5G1ZA 4F0XA 3H8EA 3IEHA 4MHZA 2ZXVA 2REFA 1CBXA 2Y0MA 1P0HA 4NGRA 1FNOA 1I21A 4ONWA 2IL4A 3FJUA 3TCVA 2AE6A 4AVAA 2JLMA 1NSAA 2PJ7A 2YNCC 2G3TA 1BPNA 1YVOA 4H6UA 1I12A 5A28A 1ON0A 4P10A 1YSJA 3PFOA 3CPXA 1PYTB 4CRZB 1KWMA 1BOBA 2OU2A 2PCUA 2PJ6A 2ODFA 3EFAA 3V8IA 5EBVA 4E0AA 5AGEA 2JBKA 1Y0YA 2PJCA 3IU1A 1OZPA 1KUXA 3SJGA 3UY5A 2Q7SA 4M85A 5LYDA 4PK2A 1HDQA 4R9MA 2OZUA 1YQEA 3KR4A 4UCNA 5LYIA 3RBUA 3S9MA 1TKFA 1NSLA 3RYOA 3TC8A 2Q04A 8CPAA 2PJ5A 2RFHA 5A27A 3D68A 1S7LA 2WSAA 4R76A 2J8RA 3TO7A 4OIDA 1Y0RA 4UWJA 3IGRA 2CTBA 3PZJA 1CP7A 5K8PA 2AFZA 1EE3P 4YRHA 2OB0A 2HV2A 3C26A 5KTCA 3D8PA 1A2ZA 3PB6X 3MRUA 2R98A 2YGWA 1BAVA 4AG9A 2PJ4A 4KOSA 3D7FA 2ZW7A 1WWZA 5LYFA 4KSFA 5H84A 4MXUA 1QSRA 2ARHA 5AG7A 4R87A 4XNHB 1VHEA 1Z8XA 3N7ZA 4F6AA 2ZEEA 3W6SA 1JQGA 2I3CA 3B2YA 4FD7A 1CP6A 2Z3OA 4B5PA 3B3WA 3P2HA 2V8HA 3FX6A 1TF8A 3K9UA 4P4BA 4OAEA 5THWA 4ZX9A 4AB7A 4ZY2A 2GLJA 4PPZA 2ZW4A 5CNPA 4R8FA 4A31A 3IJ3A 2O28A 2NYQA 4NGMA 2KCWA 4JYWA 4EWTA 1DE4C 1Z9UA 2WPWA 4U9YA 4IAVA 2P6FA 1VHSA 2O53A 1FY7A 2VZYA 4KOUA 2IQ6A 3KL9A 1V0CA 2EUIA 5DS0A 2FXFA 2PJ0A 4AG7A 2B3UA 3W6XA 5IV0A 2ZELA 3G3SA 4FBEA 4OIWA 4BMHA 1U6MA 1YW6A 3T8WA 3EXNA 2YNEA 4A33A 3NH8A 4P45A 4A30A 1DTDA 1ZLIA 2PIYA 1YK3A 2EO8A 1ARLA 1Y7EA 4R6TA 1BPMA 4KVOE 3PEIA 4EMEA 5LRGA 5HVGA 2ZOGA 3ISZA 2XEIA 3EY5A 1XIXA 3KZWA 2CF4A 4PQAA 3RO0A 4YU9A 4UEZA 5KTDA 4DUKA 2I79A 4KOYA 3BJ8A 1RXTA 2RC4A 2Q44A 2Q43A 2R1IA 5IB0A 1S5KA 5HXDA 2ZW6A 4P44A 5H86A 3BI0A 4BD9A 4NJRA 3SHPA 3JVNA 1AYEA 4G1PA 4J3GA 4ZGYB 2BSWA 2X7BA 3SI1A 3LMSA 1VHOA 5EC4A 1UWYA 4WJBA 5LYLA 4MMOA 1P4NA 2GU2A 1CM0A 4ZBGA 2PJBA 1F2OA 1PUAA 2C6PA 3TE4A 4E8OA 2PE3A 1TXRA 3W91A 2YNCA 4LX9A 4KSAA 5G22A 1Q7LA 2P0WA 4ZX8A 4MHYA 2B5GA 2CTCA 4HNXB 4OC2A 5IX3A 5J1QA 1CPXA 1YW4A 2JDCA 2I00A 3DDDA 4UIBA 5CBMA 1Z8LA 4F0YA 3FIXA 2HC9A 3MN8A 2C27A 3F8KA 2PR8A 4UCMA 3F0AA 3D7GA 4C2YA 4XPLA 4PXDA 1YX0A 1AMPA 4UFXA 4JXQA 4FD4A 3TO9A 3PBBA 2WUUA 4P4FA 4XNHC 1FT7A 4PSXA 2BOAA 3V7ZA 4KVXA 4MHPA 2BEIA 2CY2A 4AXVA 3NE7A 2B4BA 2C6CA 5K8NA 1IOIA 1M44A 2PJ9A 2QJ8A 4TNUA 4PSWA 1LRZA 1IGBA 1VKCA 1F57A 1Z4RA 3B3CA 4FD5A 1MJBA 4GXHA 2V8DA 3HUVA 4M6IA 3SJFA 4CGNA 3QB8A 3B3TA 3DR8A 4OC4A 3VH9A 2BL1A 2GREA 2FSRA 2VI7A 4NFRA 4F9UA 5I0CA 2XEJA 2FS5A 2PJ1A 1S7NA 4WWVA 2NSMA 4XPKA 5K8OA 2J8NA 2DEAA 3KHZA 4UA3A 1Y7RA 1IYLA 3BXMA 3SXNA 2JDDA 4QVTA 5G21A 3WC5A 2V8VA 3HLPA 4H6ZA 1LFWA 2BCOA 3TX8A 3DGVA 3NH4A 4P4JA 4C2ZA 3DSBA 2HQYA 3KHXA 1CPSA 2ZOFA 3R9FA 5C82A 5HVHA 2G0BA 3JTKA 1KZFA 3A9LA 1QSMA 1CJWA 3LACA 4MCQA 3RZAA 2GIVA 4PK3A 4ORFA 3TOAA 1ZO0A 2Q51A 2AFOA 2P6EA 2AFWA 2Q4YA 3D67A 4KLWA 2PJ3A 4OC0A 3TTHA 2PSWA 4MFLA 2EVNA 3FEEA 4B6ZA 1Z8TA 5F47A 3SJXA 4P4IA 4MJ8A 4KS9A 4CGPA 2AFMA 1BO4A 2ZPAA 2POKA 3I1UA 3TFYA 1ZG8A 5HMNA 1Q2DA 3EC4A 5HVFA 5IB9A 2ZEHA 2OOTA 3R95A 4Z65A 4AVBA 1XMTA 1HDUA 1NE9A 1ARMA 3NE8A 1SQHA 1YREA 2AFUA 4MFQA 2F5IA 2PRBA 1HEEA 3B3SA 4K3NA 4PXCA 1K4JA 4UIAA 4XPDC 4GS4A 3CXPA 2J9AA 3D7HA 4R57A 1CX8A 4PV6A 3RNZA 1KUYA 2DXQA 4B10A 3R9EA 4FD6A 2D4PA 4UBRA 2J8MA 4IUSA 4K30A 4X8IA 3S9NA 4B5OA 4P4DA 4CGOA 4TWEA 3CXQA 3L2NA 2QMLA 1TIQA 4CYOA 4EFDA 3DLJA 3S6KA 1OBRA 3BJ7A 2AJ6A 4CPAA 3F5BA 2ZEDA 1QSTA 5CPAA 1GHEA 2EWBA 4OLLA 4MHDA 4A94A 4C7HA 3IU2A 4A95A 2OZGA 2PJ8A 4R3KA 2Q4VA 3H5ZA 3QAHA 3SI0A 5BWAB 5JM6A 3CT9A 4MCRA 4KSIA 3K9TA 4M3SA 5FVJA 4H89A 3R1KA 4O23A 1R43A 3KKWA 1JWQA 4KUAA 3IC1A 3LWUA 1X10A 4NGSA 2OH1A 3JUWA 2QIRA 4BBHA 1Z5RA 1YLEA 2PVVA 4W9YA 1B6BA 3FECA 2DF5A 2RB7A 4GM5A 3PB9X 1IICA 4A39A 1S3ZA 1IYKA 3K2KA 1XRYA 1XFOA 1YR0A 4MY0A 4CAXA 4RS2A 3H8GA 3PFEA 1ZLHA 4X3RA 3PBEA 7CPAA 3WT4A 4R3LA 4C2XA 2HUZA 1Z2LA 3WR7A 2C1CA 4I49A 4OC3A 3WC6A 2FVGA 3D66A 4UCPA 4B13A 2EBJA 3ISXA 2G9DA 2F7VA 1XE4A 2B58A 3NH5A 5K8MA 5AG4A 4MFZA 2PC1A 4HNWB 4QB9A 3IWWA 4P4EA 3S9LA 4LQ6A 5JH9A 4CGMA 2WZNA 2ABZA 1IIDA 2FIWA 5LRJA 5F09A 1M1DA 2CNSA 2ZEOA 4NEXA 4R7MA 3KQZA 3PB4X 4XPDB 1YMEA 3GIUA 1ZG7A 3MGDA 5F48A 4KORA 4MHNA 1KUVA 3D3SA 4BINA 3PRTA 4KLVA 4MFJA 1LAMA 3FEDA 4NGQA 2JEWA 2P6GA 4DNCA 3FB3A 2AFSA 2GFQA 5D8NA 1YGHA 5I4MA 3VWEA 4CYPA 1XF8A 1TF9A 3CXSA 3PP9A 1PU9A 4HKFA 4JD6A 2Z3KA 2YNDA 3I3GA 1Q2CA 1IU8A 2K5TA 3PGPA 4OP4A 4A2ZA 4CAFA 1IB1E 2FIAA 4KOWA 3S6GA 2ZEPA 4H2KA 4F9VA 1I1DA 4X5KA 4KOXA 2V8GA 1LCPA 4QBJA 5F49A 3WABA 2B4DB 2FCKA 5AG5A 1XBUA 3PB7X 4UF4A 4LQGA 3OWCA 4UFVA 3CDXA 1R3NA 1S60A 4UFWA 4Q36A 3CZXA 3KGQA 3T90A 1J4JA 4HPSA 6CPAA 2CNTA 4L89A 1S7FA 3FMCA 1F2PA 3I9SA 4NCZA 2Q7BA 3ZJ0A 5C88A 2ZEFA 2Z3MA 4B5PB 5JQ4A 2VXKA 3R9GA 2C6GA 1ELMP 2H5MA 2VEZA 4CYNA 1B87A 4UEEA 3QNVA 4ZI6A 1LAPA 2QYVA 3D7DA 1L0CA 1BLLE 2PJ2A 2REEA 4Y49B 4KOVA 4F8ZA 1M4IA 5JGFA 4OC5A 1LOKA 1VIXA 4JJXA 4MFPA 2QECA 2HB6A 2PRQA 2Z3PA 2CIJA 4FUUA 2CXAA 5AG6A 3FBUA 4B14A 2Q0YA 5E96A 4FAIA 1QSNA 3GUXA 2FT0A 1S7KA 3GB0A 4KOTA 3IFEA 2GLFA 2ATRA 4ZYQA 2VQYA 4Q7AA 4ONUA 3VATA 4MCPA 1X12A 1H8LA 3D2MA 4UWIA 2FE7A 1IY7A 3VARA 2PQ8A 5ISVA 1TKHA 1M4DA 1MK4A 2DPTA 2GANA 4L8AA 1TKJA 4KUBA 3B35A 4JWPA 2B4DA 3ZZIA 3H4QA 3S6HA 2R7HA 4RI1A 2G3AA 2VZZA 4A38A 4JXRA 4KZTA 2A4NA 1QMUA 3B8GA 5J8CA 2VBQA 4IHMA 1MJAA 3D2PA 3S6FA
chains in the Genus database with same CATH topology
4NXYA 4MY3A 4CAVA 4CS0B 3DR6A 4C7IA 3LODA 4YFJA 4MFKA 1WK4A 1UFHA 3LD2A 5JPHA 3E0KA 3GY9A 1Q2YA 4B11A 4QC6A 4AVCA 4YGOA 4MI4A 5HH1A 3DNSA 3TO6A 2B5GB 4IF5A 2Z3LA 4U5YA 3BLNA 5KTAA 5GCNA 4CAWA 3FXTA 4A32A 2WPXA 3SXOA 1NMTA 2CNMA 2PR1A 2DPSA 4LUAA 4KVME 4E2AA 2R8VA 4NSQA 2GE3A 5J8FA 2Z0ZA 4II9A 3IWGA 4NF1A 1QSOA 1XEBA 4Y49C 2Z10A 2Z11A 1RO5A 2PDOA 2FL4A 4MBUA 2ZW5A 3GKRA 3G8WA 2JEVA 1MJ9A 3R96A 3T9YA 3TT2A 1Z4EA 1Y9WA 3FNCA 3IWEA 4CAEA 2D4OA 3EO4A 2Z3NA 4CYQA 4U9ZA 4HNYB 2NMTA 4OADA 3FYNA 4C68A 1YVKA 4CRYB 5DWMA 3TOBA 4Q38A 4B12A 4CGLA 2BUEA 4EVYA 5F46A 1R57A 5DWNA 1Y9KA 5G20A 2OZHA 4JLYA 1N71A 3P2FA 3VWDA 1M4GA 3GYAA 3FRMA 2B3VA 4QUSA 5G1ZA 4F0XA 2ZXVA 2REFA 2Y0MA 1P0HA 1I21A 2IL4A 3TCVA 4AVAA 2AE6A 4H6UA 2JLMA 2YNCC 2G3TA 5A28A 1YVOA 1I12A 1ON0A 4CRZB 1BOBA 2OU2A 3V8IA 3EFAA 5EBVA 4E0AA 5AGEA 3IU1A 1OZPA 1KUXA 3UY5A 4M85A 4PK2A 4R9MA 2OZUA 4UCNA 1NSLA 3RYOA 2Q04A 5A27A 1S7LA 2WSAA 2J8RA 3TO7A 4UWJA 3IGRA 3PZJA 5KTCA 4YRHA 2OB0A 2HV2A 3C26A 3D8PA 2R98A 2YGWA 4AG9A 4KOSA 2ZW7A 1WWZA 4KSFA 5H84A 1QSRA 2ARHA 5AG7A 4R87A 4XNHB 3N7ZA 4F6AA 3W6SA 4FD7A 4B5PA 2Z3OA 3P2HA 3K9UA 4OAEA 4AB7A 2ZW4A 5CNPA 4A31A 2O28A 2KCWA 1Z9UA 2WPWA 4U9YA 2P6FA 1VHSA 1FY7A 2VZYA 4KOUA 1V0CA 2EUIA 4AG7A 2FXFA 2B3UA 3W6XA 5IV0A 3G3SA 4BMHA 1U6MA 4A33A 3EXNA 2YNEA 4A30A 1YK3A 4KVOE 3EY5A 1XIXA 5KTDA 2I79A 4KOYA 3BJ8A 1RXTA 2RC4A 2Q44A 2R1IA 5IB0A 1S5KA 2ZW6A 5H86A 3SHPA 3JVNA 4J3GA 4ZGYB 2BSWA 2X7BA 5EC4A 1P4NA 1CM0A 4ZBGA 1PUAA 3TE4A 4E8OA 3W91A 2YNCA 4LX9A 4KSAA 5G22A 2P0WA 2B5GA 4HNXB 5IX3A 2JDCA 2I00A 3DDDA 4F0YA 3FIXA 2C27A 3F8KA 2PR8A 4UCMA 3F0AA 4C2YA 4XPLA 1YX0A 4UFXA 4JXQA 4FD4A 3TO9A 2WUUA 4XNHC 4PSXA 4KVXA 2BEIA 2CY2A 3NE7A 2B4BA 1M44A 4PSWA 1LRZA 1VKCA 1Z4RA 4FD5A 1MJBA 4CGNA 3QB8A 3DR8A 2BL1A 2VI7A 2FSRA 5I0CA 2FS5A 1S7NA 4XPKA 2J8NA 4UA3A 1Y7RA 1IYLA 3SXNA 2JDDA 4QVTA 5G21A 4H6ZA 4C2ZA 3DSBA 2HQYA 5C82A 3R9FA 2G0BA 3JTKA 1KZFA 3A9LA 1QSMA 1CJWA 2GIVA 4PK3A 4ORFA 3TOAA 1ZO0A 2P6EA 4KLWA 2Q4YA 3TTHA 2PSWA 4MFLA 2EVNA 5F47A 4MJ8A 4KS9A 4CGPA 1BO4A 2ZPAA 3TFYA 5HMNA 1Q2DA 3EC4A 3R95A 4AVBA 1XMTA 1NE9A 1SQHA 1YREA 4MFQA 2F5IA 2PRBA 1K4JA 4XPDC 4GS4A 3CXPA 4R57A 4PV6A 1KUYA 2DXQA 4B10A 3R9EA 4FD6A 2D4PA 4UBRA 2J8MA 4IUSA 4K30A 4B5OA 4CGOA 3CXQA 2QMLA 1TIQA 4CYOA 3S6KA 3BJ7A 2AJ6A 3F5BA 1QSTA 4C7HA 1GHEA 4OLLA 4MHDA 3IU2A 4A95A 2OZGA 4R3KA 2Q4VA 3H5ZA 3QAHA 5BWAB 4M3SA 5FVJA 4H89A 3R1KA 3KKWA 4KUAA 2OH1A 3JUWA 2QIRA 4BBHA 1YLEA 1B6BA 1IICA 1S3ZA 1IYKA 1YR0A 4MY0A 4CAXA 4RS2A 4R3LA 4C2XA 2HUZA 3WR7A 4I49A 4B13A 4UCPA 1XE4A 2B58A 5AG4A 4MFZA 2PC1A 4HNWB 4QB9A 4CGMA 1IIDA 2FIWA 1M1DA 2CNSA 4NEXA 4XPDB 3MGDA 5F48A 4KORA 1KUVA 3D3SA 4KLVA 4MFJA 2P6GA 4DNCA 3FB3A 1YGHA 3VWEA 4CYPA 1XF8A 3PP9A 3CXSA 1PU9A 4HKFA 4JD6A 2Z3KA 2YNDA 3I3GA 1Q2CA 3PGPA 2K5TA 4A2ZA 4CAFA 1IB1E 2FIAA 4KOWA 3S6GA 1I1DA 4X5KA 4KOXA 4QBJA 5F49A 2B4DB 2FCKA 5AG5A 3OWCA 4UFVA 1S60A 4UFWA 4Q36A 3T90A 1J4JA 2CNTA 4L89A 1S7FA 3I9SA 4NCZA 2Q7BA 3ZJ0A 5C88A 2Z3MA 4B5PB 5JQ4A 2VXKA 3R9GA 2VEZA 2H5MA 4CYNA 1B87A 1L0CA 2REEA 4Y49B 4KOVA 1M4IA 4JJXA 4MFPA 2QECA 2Z3PA 2CXAA 5AG6A 3FBUA 4B14A 2Q0YA 5E96A 1QSNA 2FT0A 1S7KA 4KOTA 2ATRA 2VQYA 4ONUA 3D2MA 4UWIA 2FE7A 2PQ8A 5ISVA 1M4DA 1MK4A 2DPTA 2GANA 4L8AA 4KUBA 4JWPA 2B4DA 3ZZIA 3H4QA 3S6HA 2R7HA 4RI1A 2G3AA 2VZZA 4JXRA 4KZTA 2A4NA 3B8GA 5J8CA 2VBQA 1MJAA 3D2PA 3S6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXY A;  4MY3 A;  4CAV A;  4CS0 B;  3DR6 A;  3LOD A;  4YFJ A;  1WK4 A;  1UFH A;  3LD2 A;  5JPH A;  3E0K A;  3GY9 A;  1Q2Y A;  4QC6 A;  4AVC A;  4YGO A;  4MI4 A;  5HH1 A;  3DNS A;  3TO6 A;  2B5G B;  4IF5 A;  4U5Y A;  3BLN A;  5KTA A;  5GCN A;  4CAW A;  3FXT A;  2WPX A;  3SXO A;  1NMT A;  2CNM A;  2PR1 A;  4LUA A;  4KVM E;  4E2A A;  2R8V A;  4NSQ A;  2GE3 A;  5J8F A;  2Z0Z A;  4II9 A;  3IWG A;  4NF1 A;  1QSO A;  1XEB A;  4Y49 C;  2Z10 A;  2Z11 A;  1RO5 A;  2PDO A;  2FL4 A;  4MBU A;  2ZW5 A;  3GKR A;  3G8W A;  2JEV A;  1MJ9 A;  3R96 A;  3T9Y A;  3TT2 A;  1Z4E A;  1Y9W A;  3FNC A;  2D4O A;  3EO4 A;  4U9Z A;  4HNY B;  2NMT A;  4OAD A;  3FYN A;  1YVK A;  4CRY B;  5DWM A;  3TOB A;  4EVY A;  2BUE A;  5F46 A;  1R57 A;  5DWN A;  1Y9K A;  2OZH A;  4JLY A;  1N71 A;  3P2F A;  3VWD A;  1M4G A;  3GYA A;  3FRM A;  2B3V A;  4QUS A;  2ZXV A;  2REF A;  2Y0M A;  1P0H A;  1I21 A;  2IL4 A;  3TCV A;  4AVA A;  2AE6 A;  2JLM A;  4H6U A;  2G3T A;  1YVO A;  1I12 A;  1ON0 A;  4CRZ B;  1BOB A;  2OU2 A;  3V8I A;  3EFA A;  5EBV A;  4E0A A;  1OZP A;  1KUX A;  3UY5 A;  4M85 A;  4PK2 A;  4R9M A;  2OZU A;  1NSL A;  3RYO A;  2Q04 A;  1S7L A;  2J8R A;  3TO7 A;  4UWJ A;  3IGR A;  3PZJ A;  5KTC A;  4YRH A;  2OB0 A;  2HV2 A;  3C26 A;  3D8P A;  2R98 A;  4AG9 A;  4KOS A;  2ZW7 A;  1WWZ A;  5H84 A;  1QSR A;  2ARH A;  4R87 A;  4XNH B;  3N7Z A;  4F6A A;  3W6S A;  4FD7 A;  4B5P A;  3P2H A;  3K9U A;  4OAE A;  4AB7 A;  2ZW4 A;  5CNP A;  2O28 A;  2KCW A;  1Z9U A;  2WPW A;  4U9Y A;  2P6F A;  1VHS A;  1FY7 A;  2VZY A;  4KOU A;  1V0C A;  2EUI A;  4AG7 A;  2FXF A;  2B3U A;  3W6X A;  5IV0 A;  3G3S A;  4BMH A;  1U6M A;  3EXN A;  1YK3 A;  4KVO E;  3EY5 A;  1XIX A;  5KTD A;  2I79 A;  4KOY A;  3BJ8 A;  1RXT A;  2RC4 A;  2Q44 A;  2R1I A;  5IB0 A;  1S5K A;  2ZW6 A;  5H86 A;  3SHP A;  3JVN A;  4J3G A;  2BSW A;  2X7B A;  5EC4 A;  1P4N A;  1CM0 A;  4ZBG A;  1PUA A;  3TE4 A;  4E8O A;  3W91 A;  4LX9 A;  2P0W A;  2B5G A;  4HNX B;  5IX3 A;  2JDC A;  2I00 A;  3DDD A;  4F0Y A;  3FIX A;  2C27 A;  3F8K A;  2PR8 A;  3F0A A;  4XPL A;  1YX0 A;  3TO9 A;  4JXQ A;  4FD4 A;  4XNH C;  4PSX A;  4KVX A;  2BEI A;  2CY2 A;  3NE7 A;  2B4B A;  1M44 A;  4PSW A;  1LRZ A;  1VKC A;  1Z4R A;  4FD5 A;  1MJB A;  3QB8 A;  3DR8 A;  2BL1 A;  2VI7 A;  2FSR A;  5I0C A;  2FS5 A;  1S7N A;  4XPK A;  2J8N A;  4UA3 A;  1Y7R A;  1IYL A;  3SXN A;  2JDD A;  4QVT A;  4H6Z A;  3DSB A;  2HQY A;  5C82 A;  3R9F A;  2G0B A;  1KZF A;  1QSM A;  1CJW A;  2GIV A;  4PK3 A;  4ORF A;  3TOA A;  2P6E A;  4KLW A;  2Q4Y A;  3TTH A;  2PSW A;  2EVN A;  5F47 A;  4MJ8 A;  1BO4 A;  2ZPA A;  3TFY A;  5HMN A;  1Q2D A;  3EC4 A;  3R95 A;  4AVB A;  1XMT A;  1NE9 A;  1SQH A;  1YRE A;  2F5I A;  2PRB A;  1K4J A;  4XPD C;  4GS4 A;  3CXP A;  4R57 A;  4PV6 A;  1KUY A;  2DXQ A;  3R9E A;  4FD6 A;  2D4P A;  4UBR A;  2J8M A;  4IUS A;  4K30 A;  4B5O A;  3CXQ A;  2QML A;  1TIQ A;  3S6K A;  3BJ7 A;  2AJ6 A;  3F5B A;  1QST A;  1GHE A;  4OLL A;  4MHD A;  2OZG A;  4R3K A;  2Q4V A;  3QAH A;  4M3S A;  5FVJ A;  4H89 A;  3R1K A;  3KKW A;  4KUA A;  2OH1 A;  3JUW A;  2QIR A;  1YLE A;  1B6B A;  1IIC A;  1S3Z A;  1IYK A;  1YR0 A;  4MY0 A;  4CAX A;  4RS2 A;  4R3L A;  2HUZ A;  3WR7 A;  4I49 A;  1XE4 A;  2B58 A;  2PC1 A;  4HNW B;  4QB9 A;  1IID A;  2FIW A;  1M1D A;  2CNS A;  4NEX A;  4XPD B;  3MGD A;  5F48 A;  4KOR A;  1KUV A;  3D3S A;  4KLV A;  2P6G A;  4DNC A;  3FB3 A;  1YGH A;  3VWE A;  1XF8 A;  3PP9 A;  3CXS A;  1PU9 A;  4HKF A;  4JD6 A;  3I3G A;  1Q2C A;  3PGP A;  2K5T A;  1IB1 E;  2FIA A;  4KOW A;  3S6G A;  1I1D A;  4X5K A;  4KOX A;  4QBJ A;  5F49 A;  2B4D B;  2FCK A;  3OWC A;  1S60 A;  3T90 A;  1J4J A;  2CNT A;  4L89 A;  1S7F A;  3I9S A;  4NCZ A;  2Q7B A;  3ZJ0 A;  5C88 A;  5JQ4 A;  4B5P B;  2VXK A;  3R9G A;  2VEZ A;  2H5M A;  1B87 A;  1L0C A;  2REE A;  4Y49 B;  4KOV A;  1M4I A;  4JJX A;  2QEC A;  3FBU A;  2Q0Y A;  5E96 A;  1QSN A;  2FT0 A;  1S7K A;  4KOT A;  2ATR A;  2VQY A;  4ONU A;  3D2M A;  4UWI A;  2FE7 A;  2PQ8 A;  5ISV A;  1M4D A;  1MK4 A;  2GAN A;  4L8A A;  4KUB A;  4JWP A;  2B4D A;  3ZZI A;  3H4Q A;  3S6H A;  2R7H A;  4RI1 A;  2G3A A;  2VZZ A;  4JXR A;  4KZT A;  2A4N A;  3B8G A;  5J8C A;  2VBQ A;  1MJA A;  3D2P A;  3S6F A; 
#chains in the Genus database with same CATH topology
 1XOV A;  4NXY A;  4MY3 A;  4CAV A;  4MRI A;  3DR6 A;  4CS0 B;  3N5F A;  5LRK A;  4OME A;  1M4L A;  4C7I A;  4UEF A;  3LOD A;  3KQX A;  1Z8W A;  3NFZ A;  4YFJ A;  3RAM A;  1GYT A;  1WK4 A;  4MFK A;  1UFH A;  2Q4Z A;  3H8F A;  4M6G A;  2WYR A;  3LD2 A;  5JPH A;  4YWY A;  3E0K A;  3GY9 A;  1Q2Y A;  4B11 A;  4QC6 A;  4AVC A;  4YGO A;  1VGY A;  4MI4 A;  5HH1 A;  3DNS A;  2ANP A;  4DYO A;  3IO1 A;  3TO6 A;  4JZ0 A;  2B5G B;  4IF5 A;  4NGP A;  2Z3L A;  4NGT A;  1YLO A;  4U5Y A;  1ELL P;  2PIZ A;  1CG2 A;  3BLN A;  5KTA A;  5GCN A;  2IMO A;  3FXT A;  4P6Y A;  4PXE A;  4A32 A;  4CAW A;  2WPX A;  4MCS A;  3SXO A;  1NMT A;  3BI1 A;  3FVL A;  3D4U A;  2CNM A;  2PR1 A;  1RTQ A;  3B7I A;  2XEG A;  1XMB A;  4IK2 A;  2DPS A;  4LUA A;  4KVM E;  2ZEN A;  4E2A A;  2R8V A;  4NSQ A;  5EMI A;  2ZEM A;  2GE3 A;  3B3V A;  2IJZ A;  5J8F A;  2Z0Z A;  4II9 A;  3IWG A;  4NF1 A;  4NGN A;  1QSO A;  1XEB A;  4Y49 C;  5ELY A;  3SI2 A;  3SJE A;  2Z10 A;  3JRU A;  3CPA A;  2Z11 A;  3GLJ A;  1RO5 A;  4RN7 A;  2ZEG A;  2PDO A;  2FL4 A;  2PVW A;  1IOF A;  4X2T A;  2V77 A;  4ZY0 A;  4MBU A;  2ZW5 A;  3GKR A;  3G8W A;  1QQ9 A;  4PXB A;  2JEV A;  3QAY A;  3KI9 A;  1MJ9 A;  2OR4 A;  3R96 A;  3T9Y A;  2JBJ A;  3TT2 A;  1Z4E A;  1Y9W A;  3BHX A;  3FNC A;  3IWE A;  4CAE A;  1PCA A;  2D4O A;  3EO4 A;  2Z3N A;  4CYQ A;  4U9Z A;  2PJA A;  4HNY B;  4ZY1 A;  2NMT A;  3IIB A;  4RUH A;  2QVP A;  3FF3 A;  3FYN A;  4OAD A;  4C68 A;  1AUG A;  1YVK A;  2AFX A;  3FH4 A;  4OC1 A;  5DWM A;  4CRY B;  3TOB A;  4Q38 A;  3NA6 A;  4B12 A;  2BUE A;  4CGL A;  4EVY A;  3KAS A;  2F8H A;  5D29 A;  5F46 A;  3WC7 A;  1R57 A;  1XJO A;  1ZG9 A;  3V38 A;  4FWU A;  5DWN A;  4A37 A;  1Y9K A;  3PB8 X;  2XEF A;  2EK9 A;  4NJQ A;  5G20 A;  2OZH A;  4JLY A;  4M6H A;  4OKO A;  1N71 A;  3P2F A;  3KR5 A;  2VL1 A;  2BO9 A;  4DJL A;  3VWD A;  1M4G A;  2O4H A;  3GYA A;  3FRM A;  2EK8 A;  2B3V A;  1LAN A;  4QUS A;  5G1Z A;  4F0X A;  3H8E A;  3IEH A;  4MHZ A;  2ZXV A;  2REF A;  1CBX A;  2Y0M A;  1P0H A;  4NGR A;  1FNO A;  1I21 A;  4ONW A;  2IL4 A;  3FJU A;  3TCV A;  2AE6 A;  4AVA A;  2JLM A;  1NSA A;  2PJ7 A;  2YNC C;  2G3T A;  1BPN A;  1YVO A;  4H6U A;  1I12 A;  5A28 A;  1ON0 A;  4P10 A;  1YSJ A;  3PFO A;  3CPX A;  1PYT B;  4CRZ B;  1KWM A;  1BOB A;  2OU2 A;  2PCU A;  2PJ6 A;  2ODF A;  3EFA A;  3V8I A;  5EBV A;  4E0A A;  5AGE A;  2JBK A;  1Y0Y A;  2PJC A;  3IU1 A;  1OZP A;  1KUX A;  3SJG A;  3UY5 A;  2Q7S A;  4M85 A;  5LYD A;  4PK2 A;  1HDQ A;  4R9M A;  2OZU A;  1YQE A;  3KR4 A;  4UCN A;  5LYI A;  3RBU A;  3S9M A;  1TKF A;  1NSL A;  3RYO A;  3TC8 A;  2Q04 A;  8CPA A;  2PJ5 A;  2RFH A;  5A27 A;  3D68 A;  1S7L A;  2WSA A;  4R76 A;  2J8R A;  3TO7 A;  4OID A;  1Y0R A;  4UWJ A;  3IGR A;  2CTB A;  3PZJ A;  1CP7 A;  5K8P A;  2AFZ A;  1EE3 P;  4YRH A;  2OB0 A;  2HV2 A;  3C26 A;  5KTC A;  3D8P A;  1A2Z A;  3PB6 X;  3MRU A;  2R98 A;  2YGW A;  1BAV A;  4AG9 A;  2PJ4 A;  4KOS A;  3D7F A;  2ZW7 A;  1WWZ A;  5LYF A;  4KSF A;  5H84 A;  4MXU A;  1QSR A;  2ARH A;  5AG7 A;  4R87 A;  4XNH B;  1VHE A;  1Z8X A;  3N7Z A;  4F6A A;  2ZEE A;  3W6S A;  1JQG A;  2I3C A;  3B2Y A;  4FD7 A;  1CP6 A;  2Z3O A;  4B5P A;  3B3W A;  3P2H A;  2V8H A;  3FX6 A;  1TF8 A;  3K9U A;  4P4B A;  4OAE A;  5THW A;  4ZX9 A;  4AB7 A;  4ZY2 A;  2GLJ A;  4PPZ A;  2ZW4 A;  5CNP A;  4R8F A;  4A31 A;  3IJ3 A;  2O28 A;  2NYQ A;  4NGM A;  2KCW A;  4JYW A;  4EWT A;  1DE4 C;  1Z9U A;  2WPW A;  4U9Y A;  4IAV A;  2P6F A;  1VHS A;  2O53 A;  1FY7 A;  2VZY A;  4KOU A;  2IQ6 A;  3KL9 A;  1V0C A;  2EUI A;  5DS0 A;  2FXF A;  2PJ0 A;  4AG7 A;  2B3U A;  3W6X A;  5IV0 A;  2ZEL A;  3G3S A;  4FBE A;  4OIW A;  4BMH A;  1U6M A;  1YW6 A;  3T8W A;  3EXN A;  2YNE A;  4A33 A;  3NH8 A;  4P45 A;  4A30 A;  1DTD A;  1ZLI A;  2PIY A;  1YK3 A;  2EO8 A;  1ARL A;  1Y7E A;  4R6T A;  1BPM A;  4KVO E;  3PEI A;  4EME A;  5LRG A;  5HVG A;  2ZOG A;  3ISZ A;  2XEI A;  3EY5 A;  1XIX A;  3KZW A;  2CF4 A;  4PQA A;  3RO0 A;  4YU9 A;  4UEZ A;  5KTD A;  4DUK A;  2I79 A;  4KOY A;  3BJ8 A;  1RXT A;  2RC4 A;  2Q44 A;  2Q43 A;  2R1I A;  5IB0 A;  1S5K A;  5HXD A;  2ZW6 A;  4P44 A;  5H86 A;  3BI0 A;  4BD9 A;  4NJR A;  3SHP A;  3JVN A;  1AYE A;  4G1P A;  4J3G A;  4ZGY B;  2BSW A;  2X7B A;  3SI1 A;  3LMS A;  1VHO A;  5EC4 A;  1UWY A;  4WJB A;  5LYL A;  4MMO A;  1P4N A;  2GU2 A;  1CM0 A;  4ZBG A;  2PJB A;  1F2O A;  1PUA A;  2C6P A;  3TE4 A;  4E8O A;  2PE3 A;  1TXR A;  3W91 A;  2YNC A;  4LX9 A;  4KSA A;  5G22 A;  1Q7L A;  2P0W A;  4ZX8 A;  4MHY A;  2B5G A;  2CTC A;  4HNX B;  4OC2 A;  5IX3 A;  5J1Q A;  1CPX A;  1YW4 A;  2JDC A;  2I00 A;  3DDD A;  4UIB A;  5CBM A;  1Z8L A;  4F0Y A;  3FIX A;  2HC9 A;  3MN8 A;  2C27 A;  3F8K A;  2PR8 A;  4UCM A;  3F0A A;  3D7G A;  4C2Y A;  4XPL A;  4PXD A;  1YX0 A;  1AMP A;  4UFX A;  4JXQ A;  4FD4 A;  3TO9 A;  3PBB A;  2WUU A;  4P4F A;  4XNH C;  1FT7 A;  4PSX A;  2BOA A;  3V7Z A;  4KVX A;  4MHP A;  2BEI A;  2CY2 A;  4AXV A;  3NE7 A;  2B4B A;  2C6C A;  5K8N A;  1IOI A;  1M44 A;  2PJ9 A;  2QJ8 A;  4TNU A;  4PSW A;  1LRZ A;  1IGB A;  1VKC A;  1F57 A;  1Z4R A;  3B3C A;  4FD5 A;  1MJB A;  4GXH A;  2V8D A;  3HUV A;  4M6I A;  3SJF A;  4CGN A;  3QB8 A;  3B3T A;  3DR8 A;  4OC4 A;  3VH9 A;  2BL1 A;  2GRE A;  2FSR A;  2VI7 A;  4NFR A;  4F9U A;  5I0C A;  2XEJ A;  2FS5 A;  2PJ1 A;  1S7N A;  4WWV A;  2NSM A;  4XPK A;  5K8O A;  2J8N A;  2DEA A;  3KHZ A;  4UA3 A;  1Y7R A;  1IYL A;  3BXM A;  3SXN A;  2JDD A;  4QVT A;  5G21 A;  3WC5 A;  2V8V A;  3HLP A;  4H6Z A;  1LFW A;  2BCO A;  3TX8 A;  3DGV A;  3NH4 A;  4P4J A;  4C2Z A;  3DSB A;  2HQY A;  3KHX A;  1CPS A;  2ZOF A;  3R9F A;  5C82 A;  5HVH A;  2G0B A;  3JTK A;  1KZF A;  3A9L A;  1QSM A;  1CJW A;  3LAC A;  4MCQ A;  3RZA A;  2GIV A;  4PK3 A;  4ORF A;  3TOA A;  1ZO0 A;  2Q51 A;  2AFO A;  2P6E A;  2AFW A;  2Q4Y A;  3D67 A;  4KLW A;  2PJ3 A;  4OC0 A;  3TTH A;  2PSW A;  4MFL A;  2EVN A;  3FEE A;  4B6Z A;  1Z8T A;  5F47 A;  3SJX A;  4P4I A;  4MJ8 A;  4KS9 A;  4CGP A;  2AFM A;  1BO4 A;  2ZPA A;  2POK A;  3I1U A;  3TFY A;  1ZG8 A;  5HMN A;  1Q2D A;  3EC4 A;  5HVF A;  5IB9 A;  2ZEH A;  2OOT A;  3R95 A;  4Z65 A;  4AVB A;  1XMT A;  1HDU A;  1NE9 A;  1ARM A;  3NE8 A;  1SQH A;  1YRE A;  2AFU A;  4MFQ A;  2F5I A;  2PRB A;  1HEE A;  3B3S A;  4K3N A;  4PXC A;  1K4J A;  4UIA A;  4XPD C;  4GS4 A;  3CXP A;  2J9A A;  3D7H A;  4R57 A;  1CX8 A;  4PV6 A;  3RNZ A;  1KUY A;  2DXQ A;  4B10 A;  3R9E A;  4FD6 A;  2D4P A;  4UBR A;  2J8M A;  4IUS A;  4K30 A;  4X8I A;  3S9N A;  4B5O A;  4P4D A;  4CGO A;  4TWE A;  3CXQ A;  3L2N A;  2QML A;  1TIQ A;  4CYO A;  4EFD A;  3DLJ A;  3S6K A;  1OBR A;  3BJ7 A;  2AJ6 A;  4CPA A;  3F5B A;  2ZED A;  1QST A;  5CPA A;  1GHE A;  2EWB A;  4OLL A;  4MHD A;  4A94 A;  4C7H A;  3IU2 A;  4A95 A;  2OZG A;  2PJ8 A;  4R3K A;  2Q4V A;  3H5Z A;  3QAH A;  3SI0 A;  5BWA B;  5JM6 A;  3CT9 A;  4MCR A;  4KSI A;  3K9T A;  4M3S A;  5FVJ A;  4H89 A;  3R1K A;  4O23 A;  1R43 A;  3KKW A;  1JWQ A;  4KUA A;  3IC1 A;  3LWU A;  1X10 A;  4NGS A;  2OH1 A;  3JUW A;  2QIR A;  4BBH A;  1Z5R A;  1YLE A;  2PVV A;  4W9Y A;  1B6B A;  3FEC A;  2DF5 A;  2RB7 A;  4GM5 A;  3PB9 X;  1IIC A;  4A39 A;  1S3Z A;  1IYK A;  3K2K A;  1XRY A;  1XFO A;  1YR0 A;  4MY0 A;  4CAX A;  4RS2 A;  3H8G A;  3PFE A;  1ZLH A;  4X3R A;  3PBE A;  7CPA A;  3WT4 A;  4R3L A;  4C2X A;  2HUZ A;  1Z2L A;  3WR7 A;  2C1C A;  4I49 A;  4OC3 A;  3WC6 A;  2FVG A;  3D66 A;  4UCP A;  4B13 A;  2EBJ A;  3ISX A;  2G9D A;  2F7V A;  1XE4 A;  2B58 A;  3NH5 A;  5K8M A;  5AG4 A;  4MFZ A;  2PC1 A;  4HNW B;  4QB9 A;  3IWW A;  4P4E A;  3S9L A;  4LQ6 A;  5JH9 A;  4CGM A;  2WZN A;  2ABZ A;  1IID A;  2FIW A;  5LRJ A;  5F09 A;  1M1D A;  2CNS A;  2ZEO A;  4NEX A;  4R7M A;  3KQZ A;  3PB4 X;  4XPD B;  1YME A;  3GIU A;  1ZG7 A;  3MGD A;  5F48 A;  4KOR A;  4MHN A;  1KUV A;  3D3S A;  4BIN A;  3PRT A;  4KLV A;  4MFJ A;  1LAM A;  3FED A;  4NGQ A;  2JEW A;  2P6G A;  4DNC A;  3FB3 A;  2AFS A;  2GFQ A;  5D8N A;  1YGH A;  5I4M A;  3VWE A;  4CYP A;  1XF8 A;  1TF9 A;  3CXS A;  3PP9 A;  1PU9 A;  4HKF A;  4JD6 A;  2Z3K A;  2YND A;  3I3G A;  1Q2C A;  1IU8 A;  2K5T A;  3PGP A;  4OP4 A;  4A2Z A;  4CAF A;  1IB1 E;  2FIA A;  4KOW A;  3S6G A;  2ZEP A;  4H2K A;  4F9V A;  1I1D A;  4X5K A;  4KOX A;  2V8G A;  1LCP A;  4QBJ A;  5F49 A;  3WAB A;  2B4D B;  2FCK A;  5AG5 A;  1XBU A;  3PB7 X;  4UF4 A;  4LQG A;  3OWC A;  4UFV A;  3CDX A;  1R3N A;  1S60 A;  4UFW A;  4Q36 A;  3CZX A;  3KGQ A;  3T90 A;  1J4J A;  4HPS A;  6CPA A;  2CNT A;  4L89 A;  1S7F A;  3FMC A;  1F2P A;  3I9S A;  4NCZ A;  2Q7B A;  3ZJ0 A;  5C88 A;  2ZEF A;  2Z3M A;  4B5P B;  5JQ4 A;  2VXK A;  3R9G A;  2C6G A;  1ELM P;  2H5M A;  2VEZ A;  4CYN A;  1B87 A;  4UEE A;  3QNV A;  4ZI6 A;  1LAP A;  2QYV A;  3D7D A;  1L0C A;  1BLL E;  2PJ2 A;  2REE A;  4Y49 B;  4KOV A;  4F8Z A;  1M4I A;  5JGF A;  4OC5 A;  1LOK A;  1VIX A;  4JJX A;  4MFP A;  2QEC A;  2HB6 A;  2PRQ A;  2Z3P A;  2CIJ A;  4FUU A;  2CXA A;  5AG6 A;  3FBU A;  4B14 A;  2Q0Y A;  5E96 A;  4FAI A;  1QSN A;  3GUX A;  2FT0 A;  1S7K A;  3GB0 A;  4KOT A;  3IFE A;  2GLF A;  2ATR A;  4ZYQ A;  2VQY A;  4Q7A A;  4ONU A;  3VAT A;  4MCP A;  1X12 A;  1H8L A;  3D2M A;  4UWI A;  2FE7 A;  1IY7 A;  3VAR A;  2PQ8 A;  5ISV A;  1TKH A;  1M4D A;  1MK4 A;  2DPT A;  2GAN A;  4L8A A;  1TKJ A;  4KUB A;  3B35 A;  4JWP A;  2B4D A;  3ZZI A;  3H4Q A;  3S6H A;  2R7H A;  4RI1 A;  2G3A A;  2VZZ A;  4A38 A;  4JXR A;  4KZT A;  2A4N A;  1QMU A;  3B8G A;  5J8C A;  2VBQ A;  4IHM A;  1MJA A;  3D2P A;  3S6F A; 
#chains in the Genus database with same CATH homology
 4NXY A;  4MY3 A;  4CAV A;  4CS0 B;  3DR6 A;  4C7I A;  3LOD A;  4YFJ A;  4MFK A;  1WK4 A;  1UFH A;  3LD2 A;  5JPH A;  3E0K A;  3GY9 A;  1Q2Y A;  4B11 A;  4QC6 A;  4AVC A;  4YGO A;  4MI4 A;  5HH1 A;  3DNS A;  3TO6 A;  2B5G B;  4IF5 A;  2Z3L A;  4U5Y A;  3BLN A;  5KTA A;  5GCN A;  4CAW A;  3FXT A;  4A32 A;  2WPX A;  3SXO A;  1NMT A;  2CNM A;  2PR1 A;  2DPS A;  4LUA A;  4KVM E;  4E2A A;  2R8V A;  4NSQ A;  2GE3 A;  5J8F A;  2Z0Z A;  4II9 A;  3IWG A;  4NF1 A;  1QSO A;  1XEB A;  4Y49 C;  2Z10 A;  2Z11 A;  1RO5 A;  2PDO A;  2FL4 A;  4MBU A;  2ZW5 A;  3GKR A;  3G8W A;  2JEV A;  1MJ9 A;  3R96 A;  3T9Y A;  3TT2 A;  1Z4E A;  1Y9W A;  3FNC A;  3IWE A;  4CAE A;  2D4O A;  3EO4 A;  2Z3N A;  4CYQ A;  4U9Z A;  4HNY B;  2NMT A;  4OAD A;  3FYN A;  4C68 A;  1YVK A;  4CRY B;  5DWM A;  3TOB A;  4Q38 A;  4B12 A;  4CGL A;  2BUE A;  4EVY A;  5F46 A;  1R57 A;  5DWN A;  1Y9K A;  5G20 A;  2OZH A;  4JLY A;  1N71 A;  3P2F A;  3VWD A;  1M4G A;  3GYA A;  3FRM A;  2B3V A;  4QUS A;  5G1Z A;  4F0X A;  2ZXV A;  2REF A;  2Y0M A;  1P0H A;  1I21 A;  2IL4 A;  3TCV A;  4AVA A;  2AE6 A;  4H6U A;  2JLM A;  2YNC C;  2G3T A;  5A28 A;  1YVO A;  1I12 A;  1ON0 A;  4CRZ B;  1BOB A;  2OU2 A;  3V8I A;  3EFA A;  5EBV A;  4E0A A;  5AGE A;  3IU1 A;  1OZP A;  1KUX A;  3UY5 A;  4M85 A;  4PK2 A;  4R9M A;  2OZU A;  4UCN A;  1NSL A;  3RYO A;  2Q04 A;  5A27 A;  1S7L A;  2WSA A;  2J8R A;  3TO7 A;  4UWJ A;  3IGR A;  3PZJ A;  5KTC A;  4YRH A;  2OB0 A;  2HV2 A;  3C26 A;  3D8P A;  2R98 A;  2YGW A;  4AG9 A;  4KOS A;  2ZW7 A;  1WWZ A;  4KSF A;  5H84 A;  1QSR A;  2ARH A;  5AG7 A;  4R87 A;  4XNH B;  3N7Z A;  4F6A A;  3W6S A;  4FD7 A;  4B5P A;  2Z3O A;  3P2H A;  3K9U A;  4OAE A;  4AB7 A;  2ZW4 A;  5CNP A;  4A31 A;  2O28 A;  2KCW A;  1Z9U A;  2WPW A;  4U9Y A;  2P6F A;  1VHS A;  1FY7 A;  2VZY A;  4KOU A;  1V0C A;  2EUI A;  4AG7 A;  2FXF A;  2B3U A;  3W6X A;  5IV0 A;  3G3S A;  4BMH A;  1U6M A;  4A33 A;  3EXN A;  2YNE A;  4A30 A;  1YK3 A;  4KVO E;  3EY5 A;  1XIX A;  5KTD A;  2I79 A;  4KOY A;  3BJ8 A;  1RXT A;  2RC4 A;  2Q44 A;  2R1I A;  5IB0 A;  1S5K A;  2ZW6 A;  5H86 A;  3SHP A;  3JVN A;  4J3G A;  4ZGY B;  2BSW A;  2X7B A;  5EC4 A;  1P4N A;  1CM0 A;  4ZBG A;  1PUA A;  3TE4 A;  4E8O A;  3W91 A;  2YNC A;  4LX9 A;  4KSA A;  5G22 A;  2P0W A;  2B5G A;  4HNX B;  5IX3 A;  2JDC A;  2I00 A;  3DDD A;  4F0Y A;  3FIX A;  2C27 A;  3F8K A;  2PR8 A;  4UCM A;  3F0A A;  4C2Y A;  4XPL A;  1YX0 A;  4UFX A;  4JXQ A;  4FD4 A;  3TO9 A;  2WUU A;  4XNH C;  4PSX A;  4KVX A;  2BEI A;  2CY2 A;  3NE7 A;  2B4B A;  1M44 A;  4PSW A;  1LRZ A;  1VKC A;  1Z4R A;  4FD5 A;  1MJB A;  4CGN A;  3QB8 A;  3DR8 A;  2BL1 A;  2VI7 A;  2FSR A;  5I0C A;  2FS5 A;  1S7N A;  4XPK A;  2J8N A;  4UA3 A;  1Y7R A;  1IYL A;  3SXN A;  2JDD A;  4QVT A;  5G21 A;  4H6Z A;  4C2Z A;  3DSB A;  2HQY A;  5C82 A;  3R9F A;  2G0B A;  3JTK A;  1KZF A;  3A9L A;  1QSM A;  1CJW A;  2GIV A;  4PK3 A;  4ORF A;  3TOA A;  1ZO0 A;  2P6E A;  4KLW A;  2Q4Y A;  3TTH A;  2PSW A;  4MFL A;  2EVN A;  5F47 A;  4MJ8 A;  4KS9 A;  4CGP A;  1BO4 A;  2ZPA A;  3TFY A;  5HMN A;  1Q2D A;  3EC4 A;  3R95 A;  4AVB A;  1XMT A;  1NE9 A;  1SQH A;  1YRE A;  4MFQ A;  2F5I A;  2PRB A;  1K4J A;  4XPD C;  4GS4 A;  3CXP A;  4R57 A;  4PV6 A;  1KUY A;  2DXQ A;  4B10 A;  3R9E A;  4FD6 A;  2D4P A;  4UBR A;  2J8M A;  4IUS A;  4K30 A;  4B5O A;  4CGO A;  3CXQ A;  2QML A;  1TIQ A;  4CYO A;  3S6K A;  3BJ7 A;  2AJ6 A;  3F5B A;  1QST A;  4C7H A;  1GHE A;  4OLL A;  4MHD A;  3IU2 A;  4A95 A;  2OZG A;  4R3K A;  2Q4V A;  3H5Z A;  3QAH A;  5BWA B;  4M3S A;  5FVJ A;  4H89 A;  3R1K A;  3KKW A;  4KUA A;  2OH1 A;  3JUW A;  2QIR A;  4BBH A;  1YLE A;  1B6B A;  1IIC A;  1S3Z A;  1IYK A;  1YR0 A;  4MY0 A;  4CAX A;  4RS2 A;  4R3L A;  4C2X A;  2HUZ A;  3WR7 A;  4I49 A;  4B13 A;  4UCP A;  1XE4 A;  2B58 A;  5AG4 A;  4MFZ A;  2PC1 A;  4HNW B;  4QB9 A;  4CGM A;  1IID A;  2FIW A;  1M1D A;  2CNS A;  4NEX A;  4XPD B;  3MGD A;  5F48 A;  4KOR A;  1KUV A;  3D3S A;  4KLV A;  4MFJ A;  2P6G A;  4DNC A;  3FB3 A;  1YGH A;  3VWE A;  4CYP A;  1XF8 A;  3PP9 A;  3CXS A;  1PU9 A;  4HKF A;  4JD6 A;  2Z3K A;  2YND A;  3I3G A;  1Q2C A;  3PGP A;  2K5T A;  4A2Z A;  4CAF A;  1IB1 E;  2FIA A;  4KOW A;  3S6G A;  1I1D A;  4X5K A;  4KOX A;  4QBJ A;  5F49 A;  2B4D B;  2FCK A;  5AG5 A;  3OWC A;  4UFV A;  1S60 A;  4UFW A;  4Q36 A;  3T90 A;  1J4J A;  2CNT A;  4L89 A;  1S7F A;  3I9S A;  4NCZ A;  2Q7B A;  3ZJ0 A;  5C88 A;  2Z3M A;  4B5P B;  5JQ4 A;  2VXK A;  3R9G A;  2VEZ A;  2H5M A;  4CYN A;  1B87 A;  1L0C A;  2REE A;  4Y49 B;  4KOV A;  1M4I A;  4JJX A;  4MFP A;  2QEC A;  2Z3P A;  2CXA A;  5AG6 A;  3FBU A;  4B14 A;  2Q0Y A;  5E96 A;  1QSN A;  2FT0 A;  1S7K A;  4KOT A;  2ATR A;  2VQY A;  4ONU A;  3D2M A;  4UWI A;  2FE7 A;  2PQ8 A;  5ISV A;  1M4D A;  1MK4 A;  2DPT A;  2GAN A;  4L8A A;  4KUB A;  4JWP A;  2B4D A;  3ZZI A;  3H4Q A;  3S6H A;  2R7H A;  4RI1 A;  2G3A A;  2VZZ A;  4JXR A;  4KZT A;  2A4N A;  3B8G A;  5J8C A;  2VBQ A;  1MJA A;  3D2P A;  3S6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...