2GE3A

Crystal structure of probable acetyltransferase from agrobacterium tumefaciens
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
164
structure length
164
Chain Sequence
DTVTIKPIRAEHVESFHRALDAVSRERKYLSFLEAPPLEAVRAFVLDMIENDHPQFVAIADGDVIGWCDIRRQDRATRAHCGTLGMGILPAYRNKGLGARLMRRTLDAAHEFGLHRIELSVHADNARAIALYEKIGFAHEGRARDAVSIDGHYIDSLNMAIIFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords probable acetyltransferase
publication title Crystal structure of Probable acetyltransferase from Agrobacterium tumefaciens
rcsb
source organism Agrobacterium tumefaciens
molecule tags Transferase
total genus 44
structure length 164
sequence length 164
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2ge3A00
4KUBA 1IYLA 2Z10A 1LRZA 3F5BA 1WK4A 5F49A 3W91A 3NE7A 2JEVA 4CAWA 4IF5A 2B5GB 3DNSA 1CJWA 1L0CA 4MJ8A 1K4JA 5C82A 2VZYA 4KOWA 3WR7A 3GYAA 1I21A 3V8IA 1B87A 3B8GA 4JWPA 1M44A 2P6EA 1YVOA 4M3SA 4PK2A 1Y9KA 2PQ8A 1Y9WA 3D2PA 2REFA 4NCZA 3D8PA 4NF1A 4ZBGA 4QVTA 2P6GA 2PDOA 2H5MA 4KOTA 4U9ZA 2PR8A 4KOSA 4L8AA 1YREA 5DWMA 4PSWA 1GHEA 2VI7A 1VKCA 4KUAA 3SXOA 1M4IA 2CNTA 2FE7A 4I49A 3SHPA 1M4GA 5KTCA 4JJXA 1Q2DA 3D2MA 2BL1A 3S6FA 5IB0A 1RXTA 5E96A 1I12A 1QSOA 2CNMA 1NE9A 2K5TA 4XPDB 2NMTA 2G0BA 2OZGA 4OADA 3VWEA 2Z11A 4KZTA 4PK3A 2J8RA 3TO7A 1Y7RA 3S6GA 2VEZA 4CAVA 4CS0B 2F5IA 3P2FA 3TO6A 2VQYA 4OLLA 2G3AA 4BMHA 3R9FA 2VXKA 2GANA 3EXNA 1QSRA 2AJ6A 3ZJ0A 1BO4A 2B4BA 4UWJA 4FD6A 4CAXA 3K9UA 4UWIA 4DNCA 2R8VA 4AVCA 2ZXVA 2ZW7A 3TCVA 3BLNA 4QC6A 4R3KA 3TOAA 2Q4VA 1KZFA 5FVJA 3W6XA 2BSWA 2O28A 3FRMA 5JPHA 1UFHA 1Q2CA 3T90A 3T9YA 1S7LA 4KORA 2ARHA 2DXQA 3G8WA 3R9EA 2JLMA 4ORFA 3FIXA 1M1DA 4KOVA 3P2HA 2CY2A 2OU2A 2Q4YA 3EFAA 4QB9A 3MGDA 1P4NA 4YRHA 1IB1E 3TTHA 2B3VA 2OB0A 4AB7A 2A4NA 4QBJA 4NXYA 4GS4A 4L89A 3GY9A 2B58A 2PRBA 4AVAA 5EBVA 3I3GA 2FIWA 3E0KA 5C88A 4R3LA 5J8FA 1MJAA 4NEXA 3D3SA 1NMTA 4HNWB 3QB8A 3LD2A 4RI1A 1S7FA 1KUXA 4M85A 1XIXA 1V0CA 3G3SA 5I0CA 3FB3A 3F8KA 3CXQA 4MY3A 1SQHA 1YX0A 2ATRA 3JUWA 4AVBA 4UBRA 3BJ7A 1B6BA 4Y49B 1XEBA 4HNXB 4XPLA 1P0HA 2BUEA 4XPDC 1IYKA 2OZHA 4NSQA 1BOBA 3R9GA 3F0AA 2GIVA 1QSTA 3N7ZA 2I00A 2ZPAA 3R1KA 4PV6A 4H6ZA 1OZPA 1QSMA 2J8NA 1Z4RA 4MBUA 2D4OA 4XNHC 2PR1A 2D4PA 3DDDA 2REEA 2J8MA 2EVNA 1U6MA 3UY5A 1ON0A 3VWDA 3FBUA 3EC4A 2VZZA 1PU9A 4ONUA 4XNHB 1Q2YA 4JLYA 3C26A 2FT0A 1MJBA 2FCKA 2GE3A 1M4DA 3IWGA 4LUAA 4JD6A 3QAHA 2IL4A 4K30A 1XF8A 4R57A 2B4DA 4E8OA 2HQYA 4UA3A 2B3UA 2Q44A 3TFYA 2FS5A 3GKRA 4FD4A 1YR0A 3S6HA 1I1DA 3TT2A 4R9MA 2R7HA 4HKFA 4U5YA 2OZUA 1IICA 3FYNA 4RS2A 3R95A 3PGPA 4FD5A 4F0YA 3DR8A 4CRZB 5ISVA 2ZW6A 3CXSA 3DR6A 2PC1A 2FXFA 3I9SA 4KOYA 1VHSA 5H86A 2KCWA 4XPKA 3FNCA 3CXPA 4YFJA 4IUSA 1QSNA 4J3GA 4KLVA 1R57A 4Y49C 1WWZA 3R96A 1XE4A 1Z4EA 4B5PA 4H6UA 1PUAA 2HV2A 2Q7BA 2BEIA 3KKWA 4CRYB 1NSLA 1KUYA 5DWNA 1RO5A 1YGHA 2CNSA 3RYOA 2JDCA 2G3TA 5J8CA 2HUZA 2RC4A 4FD7A 2PSWA 5JQ4A 4MY0A 2FL4A 4KLWA 4LX9A 1S7KA 4KVME 2R1IA 5F47A 3LODA 4YGOA 5F48A 4KVOE 2JDDA 3PZJA 2B5GA 2Z0ZA 3BJ8A 4AG9A 5KTDA 2QMLA 4JXQA 4X5KA 1Z9UA 2EUIA 2AE6A 2B4DB 1IIDA 5HH1A 1S5KA 5EC4A 5IV0A 1N71A 2P6FA 2WPXA 4EVYA 1YK3A 2OH1A 4KOUA 4OAEA 1S7NA 3TE4A 4U9YA 3S6KA 4KOXA 1J4JA 3SXNA 4F6AA 2I79A 1S3ZA 3W6SA 1YLEA 2ZW4A 3JVNA 1CM0A 3H4QA 3DSBA 4B5OA 3EO4A 5IX3A 2Y0MA 1YVKA 5H84A 2VBQA 4MHDA 1MK4A 4E2AA 2R98A 4MI4A 5HMNA 4PSXA 3PP9A 2X7BA 2P0WA 5CNPA 4E0AA 1MJ9A 4R87A 3OWCA 4II9A 1TIQA 4H89A 1KUVA 1FY7A 2FSRA 4B5PB 3TOBA 2QECA 3ZZIA 2QIRA 2Q0YA 3IGRA 1XMTA 4HNYB 3FXTA 4JXRA 5F46A 3EY5A 4AG7A 4KVXA 3TO9A 5GCNA 2ZW5A 4QUSA 2C27A 2WPWA 5KTAA 1S60A 2Q04A 2FIAA
chains in the Genus database with same CATH superfamily
4M6IA 2ZENA 2ZELA 3RO0A 2PJ0A 4Q38A 2V8DA 4MCPA 4KUBA 2PCUA 5G20A 2DPSA 3B3CA 4ZGYB 1IYLA 2Z10A 1LRZA 3F5BA 1DTDA 3B2YA 5HVFA 1WK4A 5F49A 3W91A 3IFEA 3NE7A 1TF8A 2JEVA 4CAWA 1Y0YA 2B5GB 4IF5A 3DNSA 4P6YA 1CJWA 1L0CA 2ZEDA 3B3TA 4CAFA 4MJ8A 2ZEPA 1K4JA 2PVVA 2RB7A 4MRIA 5C82A 2PJ6A 2VZYA 4UCNA 3ISZA 4KOWA 4A2ZA 3WR7A 3GYAA 4UFWA 3H8GA 2DEAA 1I21A 2IQ6A 3V8IA 4A39A 1B87A 1F2OA 4PXCA 4CYPA 3B8GA 4JWPA 1M44A 1XOVA 4UEFA 2P6EA 1YVOA 1BLLE 4M3SA 4PK2A 5AG6A 3RBUA 4CGNA 1Y9KA 4F9UA 1YLOA 2PQ8A 4UCMA 1ARMA 1Y9WA 3D2PA 2REFA 1ZLHA 5A28A 1JQGA 4NCZA 3D8PA 3NH8A 4NF1A 2CIJA 4ZBGA 4QVTA 2P6GA 1AYEA 4IAVA 4B13A 2PDOA 2H5MA 4MCSA 4F9VA 4KOTA 4HPSA 4MCRA 4U9ZA 2PR8A 4PXEA 3WT4A 3DGVA 4KOSA 4L8AA 3FJUA 1YREA 5DWMA 2Z3NA 5IB9A 4PSWA 1GHEA 2VI7A 2PVWA 4IK2A 1VKCA 4KUAA 3SXOA 4RN7A 1M4IA 1X10A 2CNTA 2FE7A 4I49A 1M4GA 3SHPA 4MHPA 3S9NA 5KTCA 4JJXA 1Q2DA 3D2MA 2WZNA 2VL1A 2ZOFA 2BL1A 3S6FA 5IB0A 4M6HA 1XFOA 3VATA 4CYOA 1RXTA 1GYTA 1HDQA 4MFQA 4X2TA 5E96A 1I12A 1QSOA 2CNMA 2V8VA 4ZY2A 1NE9A 2K5TA 3B3VA 4XPDB 1ELLP 2PJ7A 2NMTA 4F0XA 1AUGA 2G0BA 2AFUA 2OZGA 3VH9A 4OADA 4P45A 1TKFA 3VWEA 2Q51A 3T8WA 5JGFA 2Z11A 4KZTA 4PK3A 2J8RA 3TO7A 2WSAA 3FVLA 2XEJA 1Y7RA 3KL9A 4MFLA 3S6GA 2EWBA 2VEZA 4C2YA 2NYQA 4CAVA 4CS0B 2EK9A 1IOFA 3A9LA 5AG7A 4DJLA 2F5IA 4ZY0A 3P2FA 1LAPA 2PJ3A 3TO6A 2VQYA 1TF9A 4OLLA 2G3AA 4BMHA 2O4HA 3PFEA 3R9FA 2VXKA 2GANA 3FEEA 2AFZA 2ZEEA 3EXNA 3PEIA 1LANA 4OC3A 1ELMP 2Z3OA 1QSRA 1UWYA 2AJ6A 4B6ZA 3ZJ0A 3DLJA 2I3CA 2AFXA 4ZYQA 2ZEMA 1BO4A 2B4BA 4NJRA 3PBEA 1Z8TA 4UWJA 4FD6A 4CAXA 4F8ZA 4A33A 4CGLA 3K9UA 4UWIA 2PJ9A 2PJ2A 4DNCA 2R8VA 4AVCA 2ZXVA 3GLJA 2ZW7A 3D7HA 3SI1A 3TCVA 3BLNA 2O53A 2BCOA 3B35A 3MN8A 4QC6A 3SJGA 2DPTA 1LFWA 4R3KA 4DUKA 5JH9A 3TOAA 3KI9A 2PJ8A 2Q4VA 3KHXA 1KZFA 4ZX8A 5FVJA 3W6XA 2BSWA 5F09A 2O28A 3FRMA 5JPHA 1UFHA 1Q2CA 2GLFA 3T90A 4B12A 3CPAA 3T9YA 1JWQA 2C6CA 1HEEA 1S7LA 3NFZA 4KORA 4MXUA 4KSIA 2ARHA 4P4DA 2DXQA 3G8WA 2PE3A 3R9EA 2YNEA 4WJBA 2Q04A 2JLMA 3FH4A 3IIBA 4ORFA 4C2XA 3FIXA 1M1DA 3IWEA 4KOVA 4ZY1A 2ODFA 3P2HA 3CDXA 5K8PA 2CY2A 2OU2A 2Q4YA 2BOAA 3EFAA 3IU2A 4QB9A 2NSMA 3KGQA 3D67A 4NGMA 1X12A 1VHEA 2AFWA 1P4NA 3MGDA 4MFJA 3KHZA 4YRHA 1IB1E 4K3NA 3TTHA 3D66A 2QYVA 3D7FA 2B3VA 2OB0A 4AB7A 2A4NA 4QBJA 3WC6A 2JBKA 4NXYA 4GS4A 4L89A 1CX8A 3GY9A 5HVHA 2B58A 2PRBA 3PRTA 5LYLA 4Q36A 5AG5A 4AVAA 5EBVA 3I3GA 2FIWA 3E0KA 5C88A 1FT7A 4KSFA 1MJAA 4R3LA 5J8FA 4NEXA 4NGRA 3K2KA 4MFKA 5EMIA 3D3SA 4P4FA 1NMTA 4HNWB 5K8NA 3QB8A 3LD2A 4RI1A 1S7FA 4GXHA 2ZOGA 1KUXA 2ANPA 1QMUA 2PRQA 4M85A 1XIXA 1V0CA 3GIUA 3G3SA 5I0CA 3FB3A 3F8KA 3CXQA 1Z5RA 4MY3A 3QAYA 4UIAA 4A95A 1SQHA 1YX0A 2ATRA 2V8HA 3JUWA 4NGQA 4AVBA 4LQ6A 5G22A 4KS9A 4P44A 1M4LA 2EBJA 4UBRA 3BJ7A 1B6BA 4MFZA 1XEBA 4Y49B 4HNXB 4XPLA 1P0HA 2BUEA 4XPDC 5G21A 3S9MA 5LYFA 1IYKA 2OZHA 4NSQA 3FEDA 2YNCC 1BOBA 1HDUA 3R9GA 3F0AA 3KR5A 2GIVA 1NSAA 1R3NA 3GB0A 1DE4C 3IU1A 4CYQA 1ARLA 1QSTA 3SI0A 2RFHA 3N7ZA 2I00A 2ZPAA 1XRYA 4CGMA 4RUHA 4UF4A 3FX6A 3R1KA 3BHXA 2EK8A 4PV6A 4H6ZA 1OZPA 1VGYA 3PB6X 1QSMA 2J8NA 3D68A 1Z4RA 3V7ZA 4P4EA 1TKJA 4MBUA 4OC1A 2D4OA 2G9DA 3IO1A 4P4IA 4XNHC 1IU8A 2AFOA 2PR1A 2ZEGA 2Q43A 2D4PA 3DDDA 4OC4A 2REEA 2CF4A 1BPNA 4LQGA 4R76A 2PIZA 2EO8A 2ZEFA 5AGEA 4ZX9A 2J8MA 1PCAA 3D7DA 4A37A 2EVNA 4A30A 5K8MA 4JZ0A 4NGNA 1U6MA 5K8OA 3UY5A 1ON0A 3VWDA 1YW4A 1Q7LA 4Z65A 2PJBA 2Z3MA 4WWVA 3FBUA 2C6PA 2XEIA 3LACA 3EC4A 5D29A 4OMEA 2VZZA 1PU9A 4EFDA 4ONUA 4P4JA 2F7VA 4XNHB 1Q2YA 1Y0RA 4JLYA 1QQ9A 3C26A 2FT0A 1R43A 4NGPA 1MJBA 2FCKA 3H5ZA 2GE3A 1M4DA 2PJ1A 3PBBA 3H8EA 3IWGA 4C2ZA 1OBRA 2PJ4A 4LUAA 3BI0A 4JD6A 3RAMA 3QAHA 1CG2A 2IL4A 4K30A 1XF8A 5LRGA 1VHOA 2QJ8A 4R57A 1VIXA 7CPAA 4FUUA 2B4DA 4E8OA 4IHMA 2HQYA 4UA3A 3H8FA 2B3UA 1BPMA 3KQXA 2PJCA 3CT9A 2Q44A 3LMSA 2YGWA 3TFYA 2XEGA 2FS5A 3BI1A 3RZAA 3GKRA 4FD4A 1YR0A 4R8FA 1I1DA 3S6HA 3TT2A 3KZWA 4R9MA 4X3RA 1CP6A 2R7HA 4HKFA 4U5YA 2XEFA 2OZUA 1IICA 3ISXA 3FYNA 3JRUA 4RS2A 3R95A 2Z3KA 3TC8A 8CPAA 1LAMA 3PB8X 3PGPA 3JTKA 4FD5A 3DR8A 4CGOA 4CRZB 4F0YA 4ZI6A 2ZW6A 3CXSA 2ZEOA 4R7MA 2GU2A 3DR6A 2V77A 2PC1A 2OR4A 4OIWA 4C7HA 3IEHA 2FXFA 2V8GA 3QNVA 4UFVA 3I9SA 1LCPA 4KOYA 1KWMA 2CTBA 5ISVA 4EWTA 1VHSA 4MFPA 2FVGA 5H86A 2KCWA 3PB4X 3FNCA 4XPKA 3CXPA 5CBMA 4G1PA 4YFJA 2Q4ZA 4YU9A 1ZLIA 1YSJA 4AXVA 1IOIA 4IUSA 3B3WA 1ZG7A 4M6GA 2IJZA 1QSNA 1TKHA 4J3GA 4KLVA 4A38A 1R57A 4Y49C 3RNZA 1WWZA 3R96A 1Z8XA 1XE4A 3FMCA 4OC5A 1Z4EA 4CYNA 1F2PA 5DS0A 4B5PA 4UIBA 1EE3P 5A27A 4FWUA 4H6UA 1PUAA 2HV2A 1CBXA 2AFSA 5ELYA 1AMPA 2HC9A 4OKOA 2Q7BA 3B3SA 1PYTB 2BEIA 2F8HA 3KKWA 3WC7A 1H8LA 2GREA 3I1UA 1Z2LA 2Z3LA 2WYRA 3VARA 4A31A 4CRYB 4H2KA 3SJFA 2GFQA 2JBJA 6CPAA 4NFRA 2WUUA 3N5FA 1NSLA 3FECA 2ABZA 1KUYA 4UCPA 5LYIA 5DWNA 4TNUA 2PJAA 5CPAA 1RO5A 1YGHA 1ZG8A 2CNSA 3IJ3A 2ZEHA 3IWWA 3RYOA 2JDCA 2G3TA 4UEZA 1XJOA 4MHYA 5J8CA 3CZXA 3B7IA 2HUZA 2RC4A 3BXMA 2C6GA 2CTCA 4FD7A 2PSWA 4MMOA 2POKA 3NA6A 5JQ4A 3NH4A 4MY0A 2FL4A 2GLJA 4KLWA 4FAIA 4P10A 4LX9A 4CPAA 1S7KA 4KVME 2JEWA 4MCQA 3SI2A 2R1IA 5F47A 3LODA 2IMOA 4BINA 3SJEA 4W9YA 5G1ZA 3IC1A 4A94A 4YGOA 3D4UA 4NGSA 1A2ZA 5F48A 4OIDA 4KVOE 5JM6A 1CP7A 2JDDA 3PZJA 2B5GA 5LRKA 3KR4A 2Z0ZA 3BJ8A 4AG9A 3MRUA 5KTDA 4JYWA 2QMLA 4OC0A 4JXQA 5HXDA 4X5KA 3NH5A 1Z9UA 3LWUA 2DF5A 4YWYA 2EUIA 3FF3A 4A32A 5THWA 1ZG9A 2AE6A 3L2NA 2B4DB 2CXAA 2PIYA 4NJQA 3S9LA 3NE8A 1IIDA 5HH1A 1S5KA 5EC4A 1YMEA 5IV0A 2P6FA 2WPXA 4X8IA 1YK3A 4EVYA 2OH1A 2BO9A 4EMEA 3HLPA 4KOUA 4MHNA 4OAEA 1S7NA 3TE4A 4U9YA 3S6KA 4KOXA 4R6TA 1J4JA 3PFOA 1TXRA 3SXNA 4UEEA 1IY7A 4F6AA 2I79A 1S3ZA 3W6SA 1YLEA 2ZW4A 3JVNA 1CM0A 2QVPA 3H4QA 5AG4A 4B10A 3DSBA 4B5OA 2PJ5A 3GUXA 3EO4A 3V38A 5IX3A 2Y0MA 4GM5A 5HVGA 4FBEA 2Q7SA 3D7GA 4NGTA 1YVKA 1LOKA 5H84A 3CPXA 1XMBA 5BWAB 2VBQA 4MHDA 1MK4A 4C7IA 2OOTA 4E2AA 2R98A 3PB9X 4MI4A 5LYDA 5HMNA 1XBUA 3KASA 4PSXA 2YNCA 1RTQA 4C68A 2AFMA 3PP9A 2X7BA 2P0WA 4PXDA 1CPSA 5CNPA 3WC5A 4E0AA 3HUVA 4Q7AA 3TX8A 1YW6A 4B11A 1Y7EA 5LRJA 4CAEA 1MJ9A 1BAVA 4PPZA 4KSAA 3OWCA 4R87A 4TWEA 4II9A 1TIQA 4H89A 1KUVA 4CGPA 4PXBA 1FY7A 2FSRA 1Z8WA 3KQZA 4MHZA 4B5PB 3TOBA 1ZO0A 2QECA 1FNOA 3PB7X 4ONWA 4O23A 3ZZIA 2QIRA 4BBHA 1YQEA 4DYOA 4PQAA 2J9AA 4P4BA 2Q0YA 5D8NA 3IGRA 5I4MA 2Z3PA 1XMTA 1F57A 2YNDA 1Z8LA 4HNYB 1CPXA 3K9TA 3FXTA 1IGBA 4JXRA 4OC2A 5F46A 3EY5A 4AG7A 2C1CA 4BD9A 4KVXA 3TO9A 4UFXA 5GCNA 2ZW5A 4QUSA 4B14A 2C27A 5J1QA 2WPWA 2HB6A 3SJXA 5KTAA 3WABA 1S60A 1N71A 2FIAA 4OP4A
chains in the Genus database with same CATH topology
4Q38A 4KUBA 5G20A 2DPSA 4ZGYB 1IYLA 2Z10A 1LRZA 3F5BA 1WK4A 5F49A 3W91A 3NE7A 2JEVA 4CAWA 4IF5A 2B5GB 3DNSA 1CJWA 1L0CA 4CAFA 4MJ8A 1K4JA 5C82A 2VZYA 4UCNA 4KOWA 4A2ZA 3WR7A 3GYAA 4UFWA 1I21A 3V8IA 1B87A 4CYPA 3B8GA 4JWPA 1M44A 2P6EA 1YVOA 4M3SA 4PK2A 5AG6A 4CGNA 1Y9KA 2PQ8A 4UCMA 1Y9WA 3D2PA 2REFA 5A28A 4NCZA 3D8PA 4NF1A 4ZBGA 4QVTA 2P6GA 4B13A 2PDOA 2H5MA 4KOTA 4U9ZA 2PR8A 4KOSA 4L8AA 1YREA 5DWMA 2Z3NA 4PSWA 1GHEA 2VI7A 1VKCA 4KUAA 3SXOA 1M4IA 2CNTA 2FE7A 4I49A 3SHPA 1M4GA 5KTCA 4JJXA 1Q2DA 3D2MA 2BL1A 3S6FA 5IB0A 4CYOA 1RXTA 4MFQA 5E96A 1I12A 1QSOA 2CNMA 1NE9A 2K5TA 4XPDB 2NMTA 4F0XA 2G0BA 2OZGA 4OADA 3VWEA 2Z11A 4KZTA 4PK3A 2J8RA 3TO7A 2WSAA 1Y7RA 4MFLA 3S6GA 4C2YA 2VEZA 4CAVA 4CS0B 3A9LA 5AG7A 2F5IA 3P2FA 3TO6A 2VQYA 4OLLA 2G3AA 4BMHA 3R9FA 2VXKA 2GANA 3EXNA 2Z3OA 1QSRA 2AJ6A 3ZJ0A 1BO4A 2B4BA 4UWJA 4FD6A 4CAXA 4A33A 4CGLA 3K9UA 4UWIA 4DNCA 2R8VA 4AVCA 2ZXVA 2ZW7A 3TCVA 3BLNA 4QC6A 2DPTA 4R3KA 3TOAA 2Q4VA 1KZFA 5FVJA 3W6XA 2BSWA 2O28A 3FRMA 5JPHA 1UFHA 1Q2CA 3T90A 4B12A 3T9YA 1S7LA 4KORA 2ARHA 2DXQA 3G8WA 3R9EA 2YNEA 2JLMA 4ORFA 4C2XA 3FIXA 1M1DA 3IWEA 4KOVA 3P2HA 2CY2A 2OU2A 2Q4YA 3EFAA 3IU2A 4QB9A 3MGDA 4MFJA 1P4NA 4YRHA 1IB1E 3TTHA 2B3VA 2OB0A 4AB7A 2A4NA 4QBJA 4NXYA 4GS4A 4L89A 3GY9A 2B58A 2PRBA 4Q36A 5AG5A 4AVAA 5EBVA 3I3GA 2FIWA 3E0KA 5C88A 4R3LA 4KSFA 1MJAA 5J8FA 4NEXA 4MFKA 3D3SA 1NMTA 4HNWB 3QB8A 3LD2A 4RI1A 1S7FA 1KUXA 4M85A 1XIXA 1V0CA 3G3SA 5I0CA 3FB3A 3F8KA 3CXQA 4A95A 4MY3A 1SQHA 1YX0A 2ATRA 3JUWA 4AVBA 5G22A 4KS9A 4UBRA 3BJ7A 1B6BA 4MFZA 1XEBA 4Y49B 4HNXB 4XPLA 1P0HA 2BUEA 4XPDC 5G21A 1IYKA 2OZHA 4NSQA 2YNCC 1BOBA 3R9GA 3F0AA 2GIVA 4CYQA 3IU1A 1QSTA 3N7ZA 2I00A 2ZPAA 4CGMA 3R1KA 4PV6A 4H6ZA 1OZPA 1QSMA 2J8NA 1Z4RA 4MBUA 2D4OA 4XNHC 2PR1A 2D4PA 3DDDA 2REEA 5AGEA 2J8MA 2EVNA 4A30A 1U6MA 3UY5A 1ON0A 3VWDA 2Z3MA 3FBUA 3EC4A 2VZZA 1PU9A 4ONUA 4XNHB 1Q2YA 4JLYA 3C26A 2FT0A 1MJBA 2FCKA 3H5ZA 2GE3A 1M4DA 4C2ZA 3IWGA 4LUAA 4JD6A 3QAHA 2IL4A 4K30A 1XF8A 4R57A 2B4DA 4E8OA 2HQYA 4UA3A 2B3UA 2Q44A 2YGWA 3TFYA 2FS5A 3GKRA 4FD4A 1YR0A 3S6HA 1I1DA 3TT2A 4R9MA 2R7HA 4HKFA 4U5YA 2OZUA 1IICA 3FYNA 4RS2A 3R95A 2Z3KA 3PGPA 3JTKA 4FD5A 3DR8A 4CGOA 4CRZB 4F0YA 5ISVA 2ZW6A 3CXSA 3DR6A 2PC1A 4C7HA 2FXFA 4UFVA 3I9SA 4KOYA 1VHSA 4MFPA 5H86A 2KCWA 4XPKA 3FNCA 3CXPA 4YFJA 4IUSA 1QSNA 4J3GA 4KLVA 1R57A 4Y49C 1WWZA 3R96A 1XE4A 1Z4EA 4CYNA 4B5PA 5A27A 4H6UA 1PUAA 2HV2A 2Q7BA 2BEIA 3KKWA 2Z3LA 4A31A 4CRYB 2WUUA 1NSLA 1KUYA 4UCPA 5DWNA 1RO5A 1YGHA 2CNSA 3RYOA 2JDCA 2G3TA 5J8CA 2HUZA 2RC4A 4FD7A 2PSWA 5JQ4A 4MY0A 2FL4A 4KLWA 4LX9A 1S7KA 4KVME 2R1IA 5F47A 3LODA 5G1ZA 4YGOA 5F48A 4KVOE 2JDDA 3PZJA 2B5GA 2Z0ZA 3BJ8A 4AG9A 5KTDA 2QMLA 4JXQA 4X5KA 1Z9UA 2EUIA 4A32A 2AE6A 2B4DB 2CXAA 1IIDA 5HH1A 1S5KA 5EC4A 5IV0A 1N71A 2P6FA 2WPXA 4EVYA 1YK3A 2OH1A 4KOUA 4OAEA 1S7NA 3TE4A 4U9YA 3S6KA 4KOXA 1J4JA 3SXNA 4F6AA 2I79A 1S3ZA 3W6SA 1YLEA 2ZW4A 3JVNA 1CM0A 3H4QA 5AG4A 4B10A 3DSBA 4B5OA 3EO4A 5IX3A 2Y0MA 1YVKA 5H84A 5BWAB 2VBQA 4MHDA 1MK4A 4C7IA 4E2AA 2R98A 4MI4A 5HMNA 4PSXA 2YNCA 4C68A 3PP9A 2X7BA 2P0WA 5CNPA 4E0AA 4B11A 4CAEA 1MJ9A 4KSAA 3OWCA 4R87A 4II9A 1TIQA 4H89A 1KUVA 4CGPA 1FY7A 2FSRA 4B5PB 3TOBA 1ZO0A 2QECA 3ZZIA 2QIRA 4BBHA 2Q0YA 3IGRA 2Z3PA 1XMTA 2YNDA 4HNYB 3FXTA 4JXRA 5F46A 3EY5A 4AG7A 4KVXA 3TO9A 4UFXA 5GCNA 2ZW5A 4QUSA 4B14A 2C27A 2WPWA 5KTAA 1S60A 2Q04A 2FIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KUB A;  1IYL A;  2Z10 A;  1LRZ A;  3F5B A;  1WK4 A;  5F49 A;  3W91 A;  3NE7 A;  2JEV A;  4CAW A;  4IF5 A;  2B5G B;  3DNS A;  1CJW A;  1L0C A;  4MJ8 A;  1K4J A;  5C82 A;  2VZY A;  4KOW A;  3WR7 A;  3GYA A;  1I21 A;  3V8I A;  1B87 A;  3B8G A;  4JWP A;  1M44 A;  2P6E A;  1YVO A;  4M3S A;  4PK2 A;  1Y9K A;  2PQ8 A;  1Y9W A;  3D2P A;  2REF A;  4NCZ A;  3D8P A;  4NF1 A;  4ZBG A;  4QVT A;  2P6G A;  2PDO A;  2H5M A;  4KOT A;  4U9Z A;  2PR8 A;  4KOS A;  4L8A A;  1YRE A;  5DWM A;  4PSW A;  1GHE A;  2VI7 A;  1VKC A;  4KUA A;  3SXO A;  1M4I A;  2CNT A;  2FE7 A;  4I49 A;  3SHP A;  1M4G A;  5KTC A;  4JJX A;  1Q2D A;  3D2M A;  2BL1 A;  3S6F A;  5IB0 A;  1RXT A;  5E96 A;  1I12 A;  1QSO A;  2CNM A;  1NE9 A;  2K5T A;  4XPD B;  2NMT A;  2G0B A;  2OZG A;  4OAD A;  3VWE A;  2Z11 A;  4KZT A;  4PK3 A;  2J8R A;  3TO7 A;  1Y7R A;  3S6G A;  2VEZ A;  4CAV A;  4CS0 B;  2F5I A;  3P2F A;  3TO6 A;  2VQY A;  4OLL A;  2G3A A;  4BMH A;  3R9F A;  2VXK A;  2GAN A;  3EXN A;  1QSR A;  2AJ6 A;  3ZJ0 A;  1BO4 A;  2B4B A;  4UWJ A;  4FD6 A;  4CAX A;  3K9U A;  4UWI A;  4DNC A;  2R8V A;  4AVC A;  2ZXV A;  2ZW7 A;  3TCV A;  3BLN A;  4QC6 A;  4R3K A;  3TOA A;  2Q4V A;  1KZF A;  5FVJ A;  3W6X A;  2BSW A;  2O28 A;  3FRM A;  5JPH A;  1UFH A;  1Q2C A;  3T90 A;  3T9Y A;  1S7L A;  4KOR A;  2ARH A;  2DXQ A;  3G8W A;  3R9E A;  2JLM A;  4ORF A;  3FIX A;  1M1D A;  4KOV A;  3P2H A;  2CY2 A;  2OU2 A;  2Q4Y A;  3EFA A;  4QB9 A;  3MGD A;  1P4N A;  4YRH A;  1IB1 E;  3TTH A;  2B3V A;  2OB0 A;  4AB7 A;  2A4N A;  4QBJ A;  4NXY A;  4GS4 A;  4L89 A;  3GY9 A;  2B58 A;  2PRB A;  4AVA A;  5EBV A;  3I3G A;  2FIW A;  3E0K A;  5C88 A;  4R3L A;  5J8F A;  1MJA A;  4NEX A;  3D3S A;  1NMT A;  4HNW B;  3QB8 A;  3LD2 A;  4RI1 A;  1S7F A;  1KUX A;  4M85 A;  1XIX A;  1V0C A;  3G3S A;  5I0C A;  3FB3 A;  3F8K A;  3CXQ A;  4MY3 A;  1SQH A;  1YX0 A;  2ATR A;  3JUW A;  4AVB A;  4UBR A;  3BJ7 A;  1B6B A;  4Y49 B;  1XEB A;  4HNX B;  4XPL A;  1P0H A;  2BUE A;  4XPD C;  1IYK A;  2OZH A;  4NSQ A;  1BOB A;  3R9G A;  3F0A A;  2GIV A;  1QST A;  3N7Z A;  2I00 A;  2ZPA A;  3R1K A;  4PV6 A;  4H6Z A;  1OZP A;  1QSM A;  2J8N A;  1Z4R A;  4MBU A;  2D4O A;  4XNH C;  2PR1 A;  2D4P A;  3DDD A;  2REE A;  2J8M A;  2EVN A;  1U6M A;  3UY5 A;  1ON0 A;  3VWD A;  3FBU A;  3EC4 A;  2VZZ A;  1PU9 A;  4ONU A;  4XNH B;  1Q2Y A;  4JLY A;  3C26 A;  2FT0 A;  1MJB A;  2FCK A;  2GE3 A;  1M4D A;  3IWG A;  4LUA A;  4JD6 A;  3QAH A;  2IL4 A;  4K30 A;  1XF8 A;  4R57 A;  2B4D A;  4E8O A;  2HQY A;  4UA3 A;  2B3U A;  2Q44 A;  3TFY A;  2FS5 A;  3GKR A;  4FD4 A;  1YR0 A;  3S6H A;  1I1D A;  3TT2 A;  4R9M A;  2R7H A;  4HKF A;  4U5Y A;  2OZU A;  1IIC A;  3FYN A;  4RS2 A;  3R95 A;  3PGP A;  4FD5 A;  4F0Y A;  3DR8 A;  4CRZ B;  5ISV A;  2ZW6 A;  3CXS A;  3DR6 A;  2PC1 A;  2FXF A;  3I9S A;  4KOY A;  1VHS A;  5H86 A;  2KCW A;  4XPK A;  3FNC A;  3CXP A;  4YFJ A;  4IUS A;  1QSN A;  4J3G A;  4KLV A;  1R57 A;  4Y49 C;  1WWZ A;  3R96 A;  1XE4 A;  1Z4E A;  4B5P A;  4H6U A;  1PUA A;  2HV2 A;  2Q7B A;  2BEI A;  3KKW A;  4CRY B;  1NSL A;  1KUY A;  5DWN A;  1RO5 A;  1YGH A;  2CNS A;  3RYO A;  2JDC A;  2G3T A;  5J8C A;  2HUZ A;  2RC4 A;  4FD7 A;  2PSW A;  5JQ4 A;  4MY0 A;  2FL4 A;  4KLW A;  4LX9 A;  1S7K A;  4KVM E;  2R1I A;  5F47 A;  3LOD A;  4YGO A;  5F48 A;  4KVO E;  2JDD A;  3PZJ A;  2B5G A;  2Z0Z A;  3BJ8 A;  4AG9 A;  5KTD A;  2QML A;  4JXQ A;  4X5K A;  1Z9U A;  2EUI A;  2AE6 A;  2B4D B;  1IID A;  5HH1 A;  1S5K A;  5EC4 A;  5IV0 A;  1N71 A;  2P6F A;  2WPX A;  4EVY A;  1YK3 A;  2OH1 A;  4KOU A;  4OAE A;  1S7N A;  3TE4 A;  4U9Y A;  3S6K A;  4KOX A;  1J4J A;  3SXN A;  4F6A A;  2I79 A;  1S3Z A;  3W6S A;  1YLE A;  2ZW4 A;  3JVN A;  1CM0 A;  3H4Q A;  3DSB A;  4B5O A;  3EO4 A;  5IX3 A;  2Y0M A;  1YVK A;  5H84 A;  2VBQ A;  4MHD A;  1MK4 A;  4E2A A;  2R98 A;  4MI4 A;  5HMN A;  4PSX A;  3PP9 A;  2X7B A;  2P0W A;  5CNP A;  4E0A A;  1MJ9 A;  4R87 A;  3OWC A;  4II9 A;  1TIQ A;  4H89 A;  1KUV A;  1FY7 A;  2FSR A;  4B5P B;  3TOB A;  2QEC A;  3ZZI A;  2QIR A;  2Q0Y A;  3IGR A;  1XMT A;  4HNY B;  3FXT A;  4JXR A;  5F46 A;  3EY5 A;  4AG7 A;  4KVX A;  3TO9 A;  5GCN A;  2ZW5 A;  4QUS A;  2C27 A;  2WPW A;  5KTA A;  1S60 A;  2Q04 A;  2FIA A; 
#chains in the Genus database with same CATH topology
 4M6I A;  2ZEN A;  2ZEL A;  3RO0 A;  2PJ0 A;  4Q38 A;  2V8D A;  4MCP A;  4KUB A;  2PCU A;  5G20 A;  2DPS A;  3B3C A;  4ZGY B;  1IYL A;  2Z10 A;  1LRZ A;  3F5B A;  1DTD A;  3B2Y A;  5HVF A;  1WK4 A;  5F49 A;  3W91 A;  3IFE A;  3NE7 A;  1TF8 A;  2JEV A;  4CAW A;  1Y0Y A;  2B5G B;  4IF5 A;  3DNS A;  4P6Y A;  1CJW A;  1L0C A;  2ZED A;  3B3T A;  4CAF A;  4MJ8 A;  2ZEP A;  1K4J A;  2PVV A;  2RB7 A;  4MRI A;  5C82 A;  2PJ6 A;  2VZY A;  4UCN A;  3ISZ A;  4KOW A;  4A2Z A;  3WR7 A;  3GYA A;  4UFW A;  3H8G A;  2DEA A;  1I21 A;  2IQ6 A;  3V8I A;  4A39 A;  1B87 A;  1F2O A;  4PXC A;  4CYP A;  3B8G A;  4JWP A;  1M44 A;  1XOV A;  4UEF A;  2P6E A;  1YVO A;  1BLL E;  4M3S A;  4PK2 A;  5AG6 A;  3RBU A;  4CGN A;  1Y9K A;  4F9U A;  1YLO A;  2PQ8 A;  4UCM A;  1ARM A;  1Y9W A;  3D2P A;  2REF A;  1ZLH A;  5A28 A;  1JQG A;  4NCZ A;  3D8P A;  3NH8 A;  4NF1 A;  2CIJ A;  4ZBG A;  4QVT A;  2P6G A;  1AYE A;  4IAV A;  4B13 A;  2PDO A;  2H5M A;  4MCS A;  4F9V A;  4KOT A;  4HPS A;  4MCR A;  4U9Z A;  2PR8 A;  4PXE A;  3WT4 A;  3DGV A;  4KOS A;  4L8A A;  3FJU A;  1YRE A;  5DWM A;  2Z3N A;  5IB9 A;  4PSW A;  1GHE A;  2VI7 A;  2PVW A;  4IK2 A;  1VKC A;  4KUA A;  3SXO A;  4RN7 A;  1M4I A;  1X10 A;  2CNT A;  2FE7 A;  4I49 A;  1M4G A;  3SHP A;  4MHP A;  3S9N A;  5KTC A;  4JJX A;  1Q2D A;  3D2M A;  2WZN A;  2VL1 A;  2ZOF A;  2BL1 A;  3S6F A;  5IB0 A;  4M6H A;  1XFO A;  3VAT A;  4CYO A;  1RXT A;  1GYT A;  1HDQ A;  4MFQ A;  4X2T A;  5E96 A;  1I12 A;  1QSO A;  2CNM A;  2V8V A;  4ZY2 A;  1NE9 A;  2K5T A;  3B3V A;  4XPD B;  1ELL P;  2PJ7 A;  2NMT A;  4F0X A;  1AUG A;  2G0B A;  2AFU A;  2OZG A;  3VH9 A;  4OAD A;  4P45 A;  1TKF A;  3VWE A;  2Q51 A;  3T8W A;  5JGF A;  2Z11 A;  4KZT A;  4PK3 A;  2J8R A;  3TO7 A;  2WSA A;  3FVL A;  2XEJ A;  1Y7R A;  3KL9 A;  4MFL A;  3S6G A;  2EWB A;  2VEZ A;  4C2Y A;  2NYQ A;  4CAV A;  4CS0 B;  2EK9 A;  1IOF A;  3A9L A;  5AG7 A;  4DJL A;  2F5I A;  4ZY0 A;  3P2F A;  1LAP A;  2PJ3 A;  3TO6 A;  2VQY A;  1TF9 A;  4OLL A;  2G3A A;  4BMH A;  2O4H A;  3PFE A;  3R9F A;  2VXK A;  2GAN A;  3FEE A;  2AFZ A;  2ZEE A;  3EXN A;  3PEI A;  1LAN A;  4OC3 A;  1ELM P;  2Z3O A;  1QSR A;  1UWY A;  2AJ6 A;  4B6Z A;  3ZJ0 A;  3DLJ A;  2I3C A;  2AFX A;  4ZYQ A;  2ZEM A;  1BO4 A;  2B4B A;  4NJR A;  3PBE A;  1Z8T A;  4UWJ A;  4FD6 A;  4CAX A;  4F8Z A;  4A33 A;  4CGL A;  3K9U A;  4UWI A;  2PJ9 A;  2PJ2 A;  4DNC A;  2R8V A;  4AVC A;  2ZXV A;  3GLJ A;  2ZW7 A;  3D7H A;  3SI1 A;  3TCV A;  3BLN A;  2O53 A;  2BCO A;  3B35 A;  3MN8 A;  4QC6 A;  3SJG A;  2DPT A;  1LFW A;  4R3K A;  4DUK A;  5JH9 A;  3TOA A;  3KI9 A;  2PJ8 A;  2Q4V A;  3KHX A;  1KZF A;  4ZX8 A;  5FVJ A;  3W6X A;  2BSW A;  5F09 A;  2O28 A;  3FRM A;  5JPH A;  1UFH A;  1Q2C A;  2GLF A;  3T90 A;  4B12 A;  3CPA A;  3T9Y A;  1JWQ A;  2C6C A;  1HEE A;  1S7L A;  3NFZ A;  4KOR A;  4MXU A;  4KSI A;  2ARH A;  4P4D A;  2DXQ A;  3G8W A;  2PE3 A;  3R9E A;  2YNE A;  4WJB A;  2Q04 A;  2JLM A;  3FH4 A;  3IIB A;  4ORF A;  4C2X A;  3FIX A;  1M1D A;  3IWE A;  4KOV A;  4ZY1 A;  2ODF A;  3P2H A;  3CDX A;  5K8P A;  2CY2 A;  2OU2 A;  2Q4Y A;  2BOA A;  3EFA A;  3IU2 A;  4QB9 A;  2NSM A;  3KGQ A;  3D67 A;  4NGM A;  1X12 A;  1VHE A;  2AFW A;  1P4N A;  3MGD A;  4MFJ A;  3KHZ A;  4YRH A;  1IB1 E;  4K3N A;  3TTH A;  3D66 A;  2QYV A;  3D7F A;  2B3V A;  2OB0 A;  4AB7 A;  2A4N A;  4QBJ A;  3WC6 A;  2JBK A;  4NXY A;  4GS4 A;  4L89 A;  1CX8 A;  3GY9 A;  5HVH A;  2B58 A;  2PRB A;  3PRT A;  5LYL A;  4Q36 A;  5AG5 A;  4AVA A;  5EBV A;  3I3G A;  2FIW A;  3E0K A;  5C88 A;  1FT7 A;  4KSF A;  1MJA A;  4R3L A;  5J8F A;  4NEX A;  4NGR A;  3K2K A;  4MFK A;  5EMI A;  3D3S A;  4P4F A;  1NMT A;  4HNW B;  5K8N A;  3QB8 A;  3LD2 A;  4RI1 A;  1S7F A;  4GXH A;  2ZOG A;  1KUX A;  2ANP A;  1QMU A;  2PRQ A;  4M85 A;  1XIX A;  1V0C A;  3GIU A;  3G3S A;  5I0C A;  3FB3 A;  3F8K A;  3CXQ A;  1Z5R A;  4MY3 A;  3QAY A;  4UIA A;  4A95 A;  1SQH A;  1YX0 A;  2ATR A;  2V8H A;  3JUW A;  4NGQ A;  4AVB A;  4LQ6 A;  5G22 A;  4KS9 A;  4P44 A;  1M4L A;  2EBJ A;  4UBR A;  3BJ7 A;  1B6B A;  4MFZ A;  1XEB A;  4Y49 B;  4HNX B;  4XPL A;  1P0H A;  2BUE A;  4XPD C;  5G21 A;  3S9M A;  5LYF A;  1IYK A;  2OZH A;  4NSQ A;  3FED A;  2YNC C;  1BOB A;  1HDU A;  3R9G A;  3F0A A;  3KR5 A;  2GIV A;  1NSA A;  1R3N A;  3GB0 A;  1DE4 C;  3IU1 A;  4CYQ A;  1ARL A;  1QST A;  3SI0 A;  2RFH A;  3N7Z A;  2I00 A;  2ZPA A;  1XRY A;  4CGM A;  4RUH A;  4UF4 A;  3FX6 A;  3R1K A;  3BHX A;  2EK8 A;  4PV6 A;  4H6Z A;  1OZP A;  1VGY A;  3PB6 X;  1QSM A;  2J8N A;  3D68 A;  1Z4R A;  3V7Z A;  4P4E A;  1TKJ A;  4MBU A;  4OC1 A;  2D4O A;  2G9D A;  3IO1 A;  4P4I A;  4XNH C;  1IU8 A;  2AFO A;  2PR1 A;  2ZEG A;  2Q43 A;  2D4P A;  3DDD A;  4OC4 A;  2REE A;  2CF4 A;  1BPN A;  4LQG A;  4R76 A;  2PIZ A;  2EO8 A;  2ZEF A;  5AGE A;  4ZX9 A;  2J8M A;  1PCA A;  3D7D A;  4A37 A;  2EVN A;  4A30 A;  5K8M A;  4JZ0 A;  4NGN A;  1U6M A;  5K8O A;  3UY5 A;  1ON0 A;  3VWD A;  1YW4 A;  1Q7L A;  4Z65 A;  2PJB A;  2Z3M A;  4WWV A;  3FBU A;  2C6P A;  2XEI A;  3LAC A;  3EC4 A;  5D29 A;  4OME A;  2VZZ A;  1PU9 A;  4EFD A;  4ONU A;  4P4J A;  2F7V A;  4XNH B;  1Q2Y A;  1Y0R A;  4JLY A;  1QQ9 A;  3C26 A;  2FT0 A;  1R43 A;  4NGP A;  1MJB A;  2FCK A;  3H5Z A;  2GE3 A;  1M4D A;  2PJ1 A;  3PBB A;  3H8E A;  3IWG A;  4C2Z A;  1OBR A;  2PJ4 A;  4LUA A;  3BI0 A;  4JD6 A;  3RAM A;  3QAH A;  1CG2 A;  2IL4 A;  4K30 A;  1XF8 A;  5LRG A;  1VHO A;  2QJ8 A;  4R57 A;  1VIX A;  7CPA A;  4FUU A;  2B4D A;  4E8O A;  4IHM A;  2HQY A;  4UA3 A;  3H8F A;  2B3U A;  1BPM A;  3KQX A;  2PJC A;  3CT9 A;  2Q44 A;  3LMS A;  2YGW A;  3TFY A;  2XEG A;  2FS5 A;  3BI1 A;  3RZA A;  3GKR A;  4FD4 A;  1YR0 A;  4R8F A;  1I1D A;  3S6H A;  3TT2 A;  3KZW A;  4R9M A;  4X3R A;  1CP6 A;  2R7H A;  4HKF A;  4U5Y A;  2XEF A;  2OZU A;  1IIC A;  3ISX A;  3FYN A;  3JRU A;  4RS2 A;  3R95 A;  2Z3K A;  3TC8 A;  8CPA A;  1LAM A;  3PB8 X;  3PGP A;  3JTK A;  4FD5 A;  3DR8 A;  4CGO A;  4CRZ B;  4F0Y A;  4ZI6 A;  2ZW6 A;  3CXS A;  2ZEO A;  4R7M A;  2GU2 A;  3DR6 A;  2V77 A;  2PC1 A;  2OR4 A;  4OIW A;  4C7H A;  3IEH A;  2FXF A;  2V8G A;  3QNV A;  4UFV A;  3I9S A;  1LCP A;  4KOY A;  1KWM A;  2CTB A;  5ISV A;  4EWT A;  1VHS A;  4MFP A;  2FVG A;  5H86 A;  2KCW A;  3PB4 X;  3FNC A;  4XPK A;  3CXP A;  5CBM A;  4G1P A;  4YFJ A;  2Q4Z A;  4YU9 A;  1ZLI A;  1YSJ A;  4AXV A;  1IOI A;  4IUS A;  3B3W A;  1ZG7 A;  4M6G A;  2IJZ A;  1QSN A;  1TKH A;  4J3G A;  4KLV A;  4A38 A;  1R57 A;  4Y49 C;  3RNZ A;  1WWZ A;  3R96 A;  1Z8X A;  1XE4 A;  3FMC A;  4OC5 A;  1Z4E A;  4CYN A;  1F2P A;  5DS0 A;  4B5P A;  4UIB A;  1EE3 P;  5A27 A;  4FWU A;  4H6U A;  1PUA A;  2HV2 A;  1CBX A;  2AFS A;  5ELY A;  1AMP A;  2HC9 A;  4OKO A;  2Q7B A;  3B3S A;  1PYT B;  2BEI A;  2F8H A;  3KKW A;  3WC7 A;  1H8L A;  2GRE A;  3I1U A;  1Z2L A;  2Z3L A;  2WYR A;  3VAR A;  4A31 A;  4CRY B;  4H2K A;  3SJF A;  2GFQ A;  2JBJ A;  6CPA A;  4NFR A;  2WUU A;  3N5F A;  1NSL A;  3FEC A;  2ABZ A;  1KUY A;  4UCP A;  5LYI A;  5DWN A;  4TNU A;  2PJA A;  5CPA A;  1RO5 A;  1YGH A;  1ZG8 A;  2CNS A;  3IJ3 A;  2ZEH A;  3IWW A;  3RYO A;  2JDC A;  2G3T A;  4UEZ A;  1XJO A;  4MHY A;  5J8C A;  3CZX A;  3B7I A;  2HUZ A;  2RC4 A;  3BXM A;  2C6G A;  2CTC A;  4FD7 A;  2PSW A;  4MMO A;  2POK A;  3NA6 A;  5JQ4 A;  3NH4 A;  4MY0 A;  2FL4 A;  2GLJ A;  4KLW A;  4FAI A;  4P10 A;  4LX9 A;  4CPA A;  1S7K A;  4KVM E;  2JEW A;  4MCQ A;  3SI2 A;  2R1I A;  5F47 A;  3LOD A;  2IMO A;  4BIN A;  3SJE A;  4W9Y A;  5G1Z A;  3IC1 A;  4A94 A;  4YGO A;  3D4U A;  4NGS A;  1A2Z A;  5F48 A;  4OID A;  4KVO E;  5JM6 A;  1CP7 A;  2JDD A;  3PZJ A;  2B5G A;  5LRK A;  3KR4 A;  2Z0Z A;  3BJ8 A;  4AG9 A;  3MRU A;  5KTD A;  4JYW A;  2QML A;  4OC0 A;  4JXQ A;  5HXD A;  4X5K A;  3NH5 A;  1Z9U A;  3LWU A;  2DF5 A;  4YWY A;  2EUI A;  3FF3 A;  4A32 A;  5THW A;  1ZG9 A;  2AE6 A;  3L2N A;  2B4D B;  2CXA A;  2PIY A;  4NJQ A;  3S9L A;  3NE8 A;  1IID A;  5HH1 A;  1S5K A;  5EC4 A;  1YME A;  5IV0 A;  2P6F A;  2WPX A;  4X8I A;  1YK3 A;  4EVY A;  2OH1 A;  2BO9 A;  4EME A;  3HLP A;  4KOU A;  4MHN A;  4OAE A;  1S7N A;  3TE4 A;  4U9Y A;  3S6K A;  4KOX A;  4R6T A;  1J4J A;  3PFO A;  1TXR A;  3SXN A;  4UEE A;  1IY7 A;  4F6A A;  2I79 A;  1S3Z A;  3W6S A;  1YLE A;  2ZW4 A;  3JVN A;  1CM0 A;  2QVP A;  3H4Q A;  5AG4 A;  4B10 A;  3DSB A;  4B5O A;  2PJ5 A;  3GUX A;  3EO4 A;  3V38 A;  5IX3 A;  2Y0M A;  4GM5 A;  5HVG A;  4FBE A;  2Q7S A;  3D7G A;  4NGT A;  1YVK A;  1LOK A;  5H84 A;  3CPX A;  1XMB A;  5BWA B;  2VBQ A;  4MHD A;  1MK4 A;  4C7I A;  2OOT A;  4E2A A;  2R98 A;  3PB9 X;  4MI4 A;  5LYD A;  5HMN A;  1XBU A;  3KAS A;  4PSX A;  2YNC A;  1RTQ A;  4C68 A;  2AFM A;  3PP9 A;  2X7B A;  2P0W A;  4PXD A;  1CPS A;  5CNP A;  3WC5 A;  4E0A A;  3HUV A;  4Q7A A;  3TX8 A;  1YW6 A;  4B11 A;  1Y7E A;  5LRJ A;  4CAE A;  1MJ9 A;  1BAV A;  4PPZ A;  4KSA A;  3OWC A;  4R87 A;  4TWE A;  4II9 A;  1TIQ A;  4H89 A;  1KUV A;  4CGP A;  4PXB A;  1FY7 A;  2FSR A;  1Z8W A;  3KQZ A;  4MHZ A;  4B5P B;  3TOB A;  1ZO0 A;  2QEC A;  1FNO A;  3PB7 X;  4ONW A;  4O23 A;  3ZZI A;  2QIR A;  4BBH A;  1YQE A;  4DYO A;  4PQA A;  2J9A A;  4P4B A;  2Q0Y A;  5D8N A;  3IGR A;  5I4M A;  2Z3P A;  1XMT A;  1F57 A;  2YND A;  1Z8L A;  4HNY B;  1CPX A;  3K9T A;  3FXT A;  1IGB A;  4JXR A;  4OC2 A;  5F46 A;  3EY5 A;  4AG7 A;  2C1C A;  4BD9 A;  4KVX A;  3TO9 A;  4UFX A;  5GCN A;  2ZW5 A;  4QUS A;  4B14 A;  2C27 A;  5J1Q A;  2WPW A;  2HB6 A;  3SJX A;  5KTA A;  3WAB A;  1S60 A;  1N71 A;  2FIA A;  4OP4 A; 
#chains in the Genus database with same CATH homology
 4Q38 A;  4KUB A;  5G20 A;  2DPS A;  4ZGY B;  1IYL A;  2Z10 A;  1LRZ A;  3F5B A;  1WK4 A;  5F49 A;  3W91 A;  3NE7 A;  2JEV A;  4CAW A;  4IF5 A;  2B5G B;  3DNS A;  1CJW A;  1L0C A;  4CAF A;  4MJ8 A;  1K4J A;  5C82 A;  2VZY A;  4UCN A;  4KOW A;  4A2Z A;  3WR7 A;  3GYA A;  4UFW A;  1I21 A;  3V8I A;  1B87 A;  4CYP A;  3B8G A;  4JWP A;  1M44 A;  2P6E A;  1YVO A;  4M3S A;  4PK2 A;  5AG6 A;  4CGN A;  1Y9K A;  2PQ8 A;  4UCM A;  1Y9W A;  3D2P A;  2REF A;  5A28 A;  4NCZ A;  3D8P A;  4NF1 A;  4ZBG A;  4QVT A;  2P6G A;  4B13 A;  2PDO A;  2H5M A;  4KOT A;  4U9Z A;  2PR8 A;  4KOS A;  4L8A A;  1YRE A;  5DWM A;  2Z3N A;  4PSW A;  1GHE A;  2VI7 A;  1VKC A;  4KUA A;  3SXO A;  1M4I A;  2CNT A;  2FE7 A;  4I49 A;  3SHP A;  1M4G A;  5KTC A;  4JJX A;  1Q2D A;  3D2M A;  2BL1 A;  3S6F A;  5IB0 A;  4CYO A;  1RXT A;  4MFQ A;  5E96 A;  1I12 A;  1QSO A;  2CNM A;  1NE9 A;  2K5T A;  4XPD B;  2NMT A;  4F0X A;  2G0B A;  2OZG A;  4OAD A;  3VWE A;  2Z11 A;  4KZT A;  4PK3 A;  2J8R A;  3TO7 A;  2WSA A;  1Y7R A;  4MFL A;  3S6G A;  4C2Y A;  2VEZ A;  4CAV A;  4CS0 B;  3A9L A;  5AG7 A;  2F5I A;  3P2F A;  3TO6 A;  2VQY A;  4OLL A;  2G3A A;  4BMH A;  3R9F A;  2VXK A;  2GAN A;  3EXN A;  2Z3O A;  1QSR A;  2AJ6 A;  3ZJ0 A;  1BO4 A;  2B4B A;  4UWJ A;  4FD6 A;  4CAX A;  4A33 A;  4CGL A;  3K9U A;  4UWI A;  4DNC A;  2R8V A;  4AVC A;  2ZXV A;  2ZW7 A;  3TCV A;  3BLN A;  4QC6 A;  2DPT A;  4R3K A;  3TOA A;  2Q4V A;  1KZF A;  5FVJ A;  3W6X A;  2BSW A;  2O28 A;  3FRM A;  5JPH A;  1UFH A;  1Q2C A;  3T90 A;  4B12 A;  3T9Y A;  1S7L A;  4KOR A;  2ARH A;  2DXQ A;  3G8W A;  3R9E A;  2YNE A;  2JLM A;  4ORF A;  4C2X A;  3FIX A;  1M1D A;  3IWE A;  4KOV A;  3P2H A;  2CY2 A;  2OU2 A;  2Q4Y A;  3EFA A;  3IU2 A;  4QB9 A;  3MGD A;  4MFJ A;  1P4N A;  4YRH A;  1IB1 E;  3TTH A;  2B3V A;  2OB0 A;  4AB7 A;  2A4N A;  4QBJ A;  4NXY A;  4GS4 A;  4L89 A;  3GY9 A;  2B58 A;  2PRB A;  4Q36 A;  5AG5 A;  4AVA A;  5EBV A;  3I3G A;  2FIW A;  3E0K A;  5C88 A;  4R3L A;  4KSF A;  1MJA A;  5J8F A;  4NEX A;  4MFK A;  3D3S A;  1NMT A;  4HNW B;  3QB8 A;  3LD2 A;  4RI1 A;  1S7F A;  1KUX A;  4M85 A;  1XIX A;  1V0C A;  3G3S A;  5I0C A;  3FB3 A;  3F8K A;  3CXQ A;  4A95 A;  4MY3 A;  1SQH A;  1YX0 A;  2ATR A;  3JUW A;  4AVB A;  5G22 A;  4KS9 A;  4UBR A;  3BJ7 A;  1B6B A;  4MFZ A;  1XEB A;  4Y49 B;  4HNX B;  4XPL A;  1P0H A;  2BUE A;  4XPD C;  5G21 A;  1IYK A;  2OZH A;  4NSQ A;  2YNC C;  1BOB A;  3R9G A;  3F0A A;  2GIV A;  4CYQ A;  3IU1 A;  1QST A;  3N7Z A;  2I00 A;  2ZPA A;  4CGM A;  3R1K A;  4PV6 A;  4H6Z A;  1OZP A;  1QSM A;  2J8N A;  1Z4R A;  4MBU A;  2D4O A;  4XNH C;  2PR1 A;  2D4P A;  3DDD A;  2REE A;  5AGE A;  2J8M A;  2EVN A;  4A30 A;  1U6M A;  3UY5 A;  1ON0 A;  3VWD A;  2Z3M A;  3FBU A;  3EC4 A;  2VZZ A;  1PU9 A;  4ONU A;  4XNH B;  1Q2Y A;  4JLY A;  3C26 A;  2FT0 A;  1MJB A;  2FCK A;  3H5Z A;  2GE3 A;  1M4D A;  4C2Z A;  3IWG A;  4LUA A;  4JD6 A;  3QAH A;  2IL4 A;  4K30 A;  1XF8 A;  4R57 A;  2B4D A;  4E8O A;  2HQY A;  4UA3 A;  2B3U A;  2Q44 A;  2YGW A;  3TFY A;  2FS5 A;  3GKR A;  4FD4 A;  1YR0 A;  3S6H A;  1I1D A;  3TT2 A;  4R9M A;  2R7H A;  4HKF A;  4U5Y A;  2OZU A;  1IIC A;  3FYN A;  4RS2 A;  3R95 A;  2Z3K A;  3PGP A;  3JTK A;  4FD5 A;  3DR8 A;  4CGO A;  4CRZ B;  4F0Y A;  5ISV A;  2ZW6 A;  3CXS A;  3DR6 A;  2PC1 A;  4C7H A;  2FXF A;  4UFV A;  3I9S A;  4KOY A;  1VHS A;  4MFP A;  5H86 A;  2KCW A;  4XPK A;  3FNC A;  3CXP A;  4YFJ A;  4IUS A;  1QSN A;  4J3G A;  4KLV A;  1R57 A;  4Y49 C;  1WWZ A;  3R96 A;  1XE4 A;  1Z4E A;  4CYN A;  4B5P A;  5A27 A;  4H6U A;  1PUA A;  2HV2 A;  2Q7B A;  2BEI A;  3KKW A;  2Z3L A;  4A31 A;  4CRY B;  2WUU A;  1NSL A;  1KUY A;  4UCP A;  5DWN A;  1RO5 A;  1YGH A;  2CNS A;  3RYO A;  2JDC A;  2G3T A;  5J8C A;  2HUZ A;  2RC4 A;  4FD7 A;  2PSW A;  5JQ4 A;  4MY0 A;  2FL4 A;  4KLW A;  4LX9 A;  1S7K A;  4KVM E;  2R1I A;  5F47 A;  3LOD A;  5G1Z A;  4YGO A;  5F48 A;  4KVO E;  2JDD A;  3PZJ A;  2B5G A;  2Z0Z A;  3BJ8 A;  4AG9 A;  5KTD A;  2QML A;  4JXQ A;  4X5K A;  1Z9U A;  2EUI A;  4A32 A;  2AE6 A;  2B4D B;  2CXA A;  1IID A;  5HH1 A;  1S5K A;  5EC4 A;  5IV0 A;  1N71 A;  2P6F A;  2WPX A;  4EVY A;  1YK3 A;  2OH1 A;  4KOU A;  4OAE A;  1S7N A;  3TE4 A;  4U9Y A;  3S6K A;  4KOX A;  1J4J A;  3SXN A;  4F6A A;  2I79 A;  1S3Z A;  3W6S A;  1YLE A;  2ZW4 A;  3JVN A;  1CM0 A;  3H4Q A;  5AG4 A;  4B10 A;  3DSB A;  4B5O A;  3EO4 A;  5IX3 A;  2Y0M A;  1YVK A;  5H84 A;  5BWA B;  2VBQ A;  4MHD A;  1MK4 A;  4C7I A;  4E2A A;  2R98 A;  4MI4 A;  5HMN A;  4PSX A;  2YNC A;  4C68 A;  3PP9 A;  2X7B A;  2P0W A;  5CNP A;  4E0A A;  4B11 A;  4CAE A;  1MJ9 A;  4KSA A;  3OWC A;  4R87 A;  4II9 A;  1TIQ A;  4H89 A;  1KUV A;  4CGP A;  1FY7 A;  2FSR A;  4B5P B;  3TOB A;  1ZO0 A;  2QEC A;  3ZZI A;  2QIR A;  4BBH A;  2Q0Y A;  3IGR A;  2Z3P A;  1XMT A;  2YND A;  4HNY B;  3FXT A;  4JXR A;  5F46 A;  3EY5 A;  4AG7 A;  4KVX A;  3TO9 A;  4UFX A;  5GCN A;  2ZW5 A;  4QUS A;  4B14 A;  2C27 A;  2WPW A;  5KTA A;  1S60 A;  2Q04 A;  2FIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...