5BWAB

Crystal structure of odc-plp-az1 ternary complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
127
structure length
121
Chain Sequence
b'NLFYSDDRLNVTEEDKTRILNVQSRLTDAKRINWRTVLSGGSLYIEIPGGALPEGSKDSFAVLLEFAEEQLRADHVFICFHKNREDRAALLRTFSFLGFEIVRPGHPLVRPDACFMAYTFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ornithine decarboxylase
publication title Structural basis of Ornithine Decarboxylase inactivation and accelerated degradation by polyamine sensor Antizyme1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase/lyase inhibitor
total genus 22
structure length 121
sequence length 127
ec nomenclature
pdb deposition date 2015-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02100 ODC_AZ Ornithine decarboxylase antizyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.60 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5bwaB00
4ZGYB 1ZO0A 5BWAB
chains in the Genus database with same CATH superfamily
1A2ZA 1YREA 3ISZA 2ZELA 3NA6A 1MJBA 1YVOA 4XPKA 2ZW7A 4UWIA 4KS9A 1LOKA 1Y9KA 3CXSA 1TKHA 2BSWA 4NJQA 4NSQA 4UA3A 5HVHA 4FWUA 3PB6X 3FEEA 4AG9A 1TXRA 2OZGA 4Q7AA 2DPSA 4CRYB 1Z2LA 4DUKA 4OLLA 1OBRA 1DTDA 1YW6A 1YLOA 1BO4A 3R9EA 3T9YA 2P0WA 3GUXA 5HVFA 2EUIA 2FS5A 2Z3KA 2H5MA 4R9MA 1Z8TA 4YU9A 1XBUA 2C6PA 2Q04A 1P4NA 4ZI6A 2ZEDA 3EO4A 5DWNA 1CPXA 1M4IA 3R96A 2Z11A 4OC1A 4RN7A 5ISVA 2OH1A 2Q7BA 2OOTA 5I4MA 2AJ6A 4A31A 4B5PB 4P6YA 3FECA 3H8FA 5KTDA 1IOFA 4R8FA 4UF4A 2ZENA 3A9LA 4P4EA 5H86A 3R95A 2XEFA 2V77A 2FCKA 4R3KA 4AG7A 5LYLA 2X7BA 4E2AA 4MHDA 2EWBA 4NXYA 2OZHA 1Q2CA 3F8KA 4DJLA 4KOWA 2NYQA 1BLLE 1IU8A 2C27A 1IICA 2EVNA 3D7DA 2F5IA 4MRIA 1VHEA 1XF8A 3QB8A 3WT4A 4O23A 2G0BA 2GREA 1YR0A 1Z8WA 1CPSA 2CF4A 1KUYA 4PV6A 3KQZA 1HDUA 2B4DA 4PXBA 4YWYA 1MJ9A 4EWTA 1VKCA 2AFSA 2O4HA 3DR8A 3TO6A 3QNVA 3PFOA 4ZY1A 3D7FA 4II9A 1XMBA 4ZBGA 2R7HA 2V8GA 3VARA 3D4UA 3MN8A 3QAYA 2VL1A 1S7FA 2FL4A 5AG6A 1K4JA 2NMTA 2VI7A 3GY9A 4MFZA 4OP4A 2D4OA 3RAMA 4CGLA 3G3SA 4MCQA 1TKFA 1QSNA 3E0KA 1FNOA 1NE9A 4IHMA 2FXFA 4R87A 5LYFA 4KOUA 1YLEA 2B4BA 2RFHA 4JZ0A 4UFXA 1B87A 2Q43A 4BMHA 6CPAA 2HB6A 2GANA 5F46A 2B58A 2PJCA 5LRKA 2FIWA 2QJ8A 3NE8A 5F49A 2XEIA 4A37A 3SI0A 1BPMA 4A94A 3VWDA 4L89A 4NCZA 4CGPA 2GE3A 2B5GB 2AFUA 4JYWA 1QQ9A 4NGMA 3KQXA 4B10A 4P44A 3PRTA 3KKWA 2GLJA 4P4DA 4EMEA 2P6GA 1Y9WA 4KOVA 4A39A 1HEEA 3BJ8A 4C68A 4CAFA 2KCWA 4EVYA 4MFQA 5ELYA 2PJ3A 2Q44A 3S9NA 3ISXA 3FJUA 2WYRA 2WZNA 3K9TA 4OAEA 1XFOA 2GIVA 2WUUA 1ZG8A 3HLPA 2V8HA 3PEIA 4UCMA 3T90A 3PFEA 3RBUA 2ANPA 2F7VA 4MFKA 3I3GA 4B13A 3GLJA 4L8AA 2PIZA 2JDCA 2VZYA 4YRHA 2Q4ZA 2PR1A 1YX0A 3H5ZA 3FIXA 4B6ZA 3D67A 2Z3OA 3V8IA 1I21A 4FD4A 3TX8A 4CAXA 2JEVA 4LUAA 4H6UA 3BI0A 4GM5A 5F09A 1IYLA 4JJXA 3PB9X 2O53A 2PVWA 3TFYA 2ZOGA 3MGDA 2CIJA 2PJ7A 1ZG9A 2G3AA 3CXQA 3H8EA 5JPHA 5J1QA 5EMIA 1LFWA 3FRMA 4KLWA 2FIAA 4CYPA 3FNCA 4CGNA 2Z3MA 1UWYA 4P4IA 4XNHC 1S5KA 2PJ2A 5A28A 4A2ZA 1QSMA 5JGFA 3TTHA 3IFEA 3N5FA 4KUAA 3TOAA 3F5BA 2Q4YA 4MCPA 1XMTA 1QSRA 5IB0A 2P6FA 2PCUA 1LAPA 1R3NA 3D66A 3FYNA 1Z5RA 2ZW4A 4OC4A 3S9MA 4IK2A 4MCSA 2V8DA 4CYQA 2AFOA 4JWPA 8CPAA 2YNEA 2PJ1A 2D4PA 2PE3A 3CDXA 4ZX8A 4ONWA 5KTAA 3BJ7A 4UCPA 4FAIA 2ZEOA 3SI1A 2PJ9A 4CAEA 1RXTA 4CGMA 3B3VA 2QECA 4LQGA 3TE4A 3LWUA 4G1PA 5A27A 4FD5A 2C6CA 1VIXA 3KI9A 1LRZA 1ZLIA 4A38A 4MFJA 1YMEA 5G1ZA 4NGQA 3FX6A 3CXPA 1DE4C 4NEXA 1Z8LA 2PRBA 3D2PA 1Y0RA 3SI2A 4MHZA 4A32A 1JWQA 4B11A 4EFDA 4J3GA 5EC4A 2K5TA 4ZX9A 4ZYQA 4YGOA 4C7HA 2ZEMA 4B14A 1S7KA 2POKA 4JLYA 4TWEA 5DS0A 2RC4A 1FT7A 5LYIA 5K8MA 2JBKA 1CJWA 2Z3PA 1PUAA 4PXCA 5AG4A 1Z4RA 3JRUA 4KZTA 3D7HA 2FT0A 1ELMP 2NSMA 4W9YA 5HH1A 3IU2A 1PYTB 2Q7SA 4WWVA 3F0AA 3EXNA 1ON0A 4ONUA 3IC1A 2WSAA 4KVXA 3KHXA 3DGVA 4QBJA 3V38A 4JD6A 2QIRA 3B8GA 2VBQA 2XEJA 3K9UA 4X5KA 3V7ZA 3HUVA 4QVTA 2PDOA 3D3SA 1CM0A 1S7NA 4X8IA 4JXRA 4YFJA 1ZG7A 4KUBA 4AVBA 1ZO0A 4KORA 1Q2DA 2PJ6A 4RI1A 5D29A 4B5PA 1OZPA 1VGYA 2ZOFA 1LCPA 2B3UA 2B3VA 5BWAB 5C82A 2P6EA 2Z10A 2ZEFA 2DPTA 3PB7X 4FBEA 4R57A 4NGPA 4OC2A 3DR6A 2O28A 3PBEA 2I3CA 4OKOA 3ZJ0A 4Q38A 1EE3P 2C1CA 3FMCA 2R8VA 3IU1A 1BAVA 4R7MA 1Q7LA 3T8WA 5I0CA 2ODFA 1X10A 3R1KA 1AUGA 2PR8A 1BOBA 1F2PA 2CNTA 4K30A 1UFHA 3IWEA 1V0CA 3SJEA 2VXKA 1S60A 4H89A 1N71A 1TF8A 3S6KA 3SXNA 2PIYA 4RUHA 5LRGA 2YNCA 4MHPA 1ELLP 4NJRA 3RO0A 4C2ZA 4A33A 5HMNA 2G3TA 2ZEHA 2R1IA 4KVOE 4NF1A 4UEZA 1M44A 3B3SA 4HNWB 3GKRA 4HPSA 3RYOA 1IIDA 4M6HA 3VATA 2Q0YA 1CX8A 3QAHA 4PK3A 3N7ZA 4OC3A 4M6IA 1YSJA 2DXQA 4C2YA 4Q36A 1IYKA 2PJAA 4KOXA 1U6MA 1GHEA 2CTBA 1Y7EA 2Y0MA 1XRYA 4AXVA 4H2KA 5THWA 2ZEPA 2A4NA 2ZW5A 4NFRA 1Y0YA 3LODA 4PK2A 1XJOA 3DDDA 4MFLA 3SJXA 1CP7A 2J9AA 1SQHA 3MRUA 3NFZA 4MXUA 1H8LA 3FXTA 5AG7A 4AVAA 2B5GA 4MMOA 4Y49C 3GIUA 2GLFA 2J8RA 4DYOA 3B7IA 1LANA 2ZPAA 4MJ8A 3S6GA 1QMUA 3WABA 4DNCA 3JUWA 5KTCA 3B3TA 3L2NA 4PPZA 4CAVA 1NMTA 4R76A 2OR4A 4PXDA 4E0AA 1F2OA 3H8GA 4KOYA 3C26A 1GYTA 5GCNA 4B5OA 4F0YA 4M3SA 5FVJA 1CG2A 5HVGA 5LRJA 2QVPA 4GXHA 2QMLA 4XNHB 2VEZA 2HV2A 3FB3A 4C2XA 4NGNA 2EBJA 2YNDA 1XE4A 7CPAA 2CTCA 2VZZA 4QUSA 2BO9A 5J8FA 5AGEA 2IQ6A 3DSBA 3PB4X 5DWMA 3TC8A 5F47A 4CYOA 4BBHA 1P0HA 1MJAA 3EFAA 4K3NA 3TT2A 4OADA 3P2HA 1KUVA 3B35A 3GYAA 1F57A 2FE7A 3UY5A 3FBUA 1VHOA 2IJZA 4UEEA 4IAVA 5IV0A 2PJ4A 3IWGA 1AMPA 1J4JA 1LAMA 4MHNA 5CPAA 2ATRA 4UBRA 1NSAA 2R98A 4UEFA 4QC6A 4U5YA 2OU2A 4MCRA 4OMEA 3S6FA 3KASA 5CBMA 1TKJA 1YK3A 2QYVA 2VQYA 2PJBA 3LACA 4NGTA 2PJ5A 3H4QA 4PSXA 4X2TA 5JM6A 4QB9A 2HQYA 3EC4A 1NSLA 4MY0A 2PVVA 4JXQA 2EK8A 4UFVA 2CY2A 3W91A 3PP9A 4UIBA 2RB7A 4F9UA 3IWWA 3P2FA 4KSFA 4M85A 2Q4VA 4KLVA 4MI4A 2DEAA 1R57A 2Z3NA 4AVCA 5JH9A 4MFPA 4A95A 1IGBA 4TNUA 4XPLA 1KWMA 3VH9A 4ZGYB 5EBVA 1L0CA 3LMSA 4P45A 1CBXA 5C88A 5H84A 4ZY0A 3NE7A 1IY7A 1PCAA 4P4JA 2C6GA 2I79A 1BPNA 1HDQA 2AFZA 3I9SA 2Z0ZA 4UWJA 5K8PA 1VHSA 3TOBA 2BEIA 2B4DB 3R9FA 5K8NA 1S3ZA 1S7LA 4XPDC 2WPXA 4XPDB 4ORFA 3JVNA 3PB8X 2PQ8A 3WC5A 4BD9A 4PSWA 1ARLA 2ARHA 1R43A 1Q2YA 1XIXA 2BOAA 2ZEGA 4OIDA 4P4BA 2EK9A 2Z3LA 2J8NA 2AE6A 1B6BA 2GFQA 4FUUA 3KR4A 4MBUA 3RZAA 4WJBA 3NH8A 3D68A 2GU2A 2I00A 2REFA 2ZW6A 4R3LA 4UIAA 3FF3A 1RTQA 2AFMA 3CT9A 3FEDA 4MY3A 3ZZIA 3BXMA 1YGHA 4CYNA 4NGSA 3FH4A 2YNCC 3DNSA 4KOSA 5D8NA 2OZUA 1FY7A 3IIBA 3EY5A 2PJ8A 4F0XA 4HNXB 1RO5A 2JDDA 3KHZA 2ZXVA 2AFXA 3S6HA 2PRQA 4F8ZA 2EO8A 2PC1A 2J8MA 4UCNA 5AG5A 4IF5A 5J8CA 3K2KA 3R9GA 2PSWA 1WK4A 3BI1A 4E8OA 4RS2A 1AYEA 3B3WA 5HXDA 5JQ4A 1Z8XA 2AFWA 3BHXA 3NH4A 5IB9A 3JTKA 4IUSA 4UFWA 4F9VA 4AB7A 3GB0A 2IMOA 4P10A 4OC5A 3FVLA 4BINA 5IX3A 4B12A 3IGRA 1I12A 3W6SA 3DLJA 4M6GA 5E96A 3G8WA 4CAWA 2YGWA 2HC9A 2JBJA 2Q51A 1XEBA 1TF9A 3CZXA 3I1UA 3NH5A 4FD6A 4LQ6A 2REEA 3CPXA 4U9YA 1WWZA 3LD2A 2ZEEA 3PBBA 3IJ3A 4PQAA 4Y49B 5G22A 4MHYA 4KSAA 4NGRA 2WPWA 4R6TA 3KL9A 2HUZA 2G9DA 1Y7RA 2XEGA 4H6ZA 4HKFA 2CNSA 4CRZB 3BLNA 2PJ0A 3D8PA 3PGPA 2FVGA 3SJFA 1X12A 1YQEA 2BUEA 3VWEA 2JEWA 5LYDA 2CNMA 3SHPA 4U9ZA 3W6XA 2JLMA 1YW4A 3IEHA 4PXEA 4P4FA 3WR7A 4FD7A 3TO9A 3KGQA 1M4GA 4HNYB 3B2YA 1Z9UA 3TCVA 1PU9A 1IOIA 5K8OA 1KUXA 3D2MA 4X3RA 3SXOA 5CNPA 1I1DA 3OWCA 1M4LA 4OC0A 3WC6A 3SJGA 1MK4A 4OIWA 1IB1E 2FSRA 2DF5A 5G21A 2V8VA 5G20A 1QSTA 2BCOA 2F8HA 3CPAA 4Z65A 3IO1A 4LX9A 1YVKA 3KR5A 4CGOA 4GS4A 4KSIA 1JQGA 3B3CA 1Z4EA 4CS0B 4ZY2A 4KOTA 1KZFA 5F48A 1TIQA 1ZLHA 3TO7A 1QSOA 3D7GA 2IL4A 4C7IA 2CXAA 2BL1A 3PZJA 1ARMA 2OB0A 3KZWA 4I49A 4KVME 1CP6A 1M4DA 4F6AA 3S9LA 1M1DA 2ABZA 4CPAA 3WC7A 1XOVA 3RNZA 4A30A
chains in the Genus database with same CATH topology
1YREA 1MJBA 1YVOA 4XPKA 2ZW7A 4UWIA 4KS9A 1Y9KA 3CXSA 2BSWA 4NSQA 4UA3A 4AG9A 2OZGA 2DPSA 4CRYB 4OLLA 1BO4A 3R9EA 3T9YA 2P0WA 2EUIA 2FS5A 2Z3KA 2H5MA 4R9MA 2Q04A 1P4NA 3EO4A 5DWNA 1M4IA 3R96A 2Z11A 5ISVA 2OH1A 2Q7BA 2AJ6A 4A31A 4B5PB 5KTDA 3A9LA 5H86A 3R95A 2FCKA 4R3KA 4AG7A 2X7BA 4E2AA 4MHDA 4NXYA 2OZHA 1Q2CA 3F8KA 4KOWA 2C27A 1IICA 2EVNA 2F5IA 1XF8A 3QB8A 2G0BA 1YR0A 1KUYA 4PV6A 2B4DA 1MJ9A 1VKCA 3DR8A 3TO6A 4II9A 4ZBGA 2R7HA 1S7FA 2FL4A 5AG6A 1K4JA 2NMTA 2VI7A 3GY9A 4MFZA 2D4OA 3G3SA 3E0KA 1QSNA 1NE9A 2FXFA 4R87A 4KOUA 1YLEA 2B4BA 4UFXA 4BMHA 1B87A 5F46A 2GANA 2B58A 2FIWA 5F49A 3VWDA 4L89A 4NCZA 4CGPA 2GE3A 2B5GB 4B10A 3KKWA 2P6GA 1Y9WA 4KOVA 4C68A 4EVYA 3BJ8A 4CAFA 2KCWA 4MFQA 2Q44A 4OAEA 2WUUA 2GIVA 4UCMA 3T90A 4MFKA 3I3GA 4B13A 4L8AA 2JDCA 2VZYA 4YRHA 2PR1A 1YX0A 3H5ZA 3FIXA 2Z3OA 3V8IA 1I21A 4FD4A 4CAXA 2JEVA 4LUAA 4H6UA 1IYLA 4JJXA 3TFYA 3MGDA 5JPHA 2G3AA 3CXQA 3FRMA 4KLWA 2FIAA 4CYPA 3FNCA 4CGNA 2Z3MA 4XNHC 1S5KA 5A28A 4A2ZA 1QSMA 3TTHA 4KUAA 3TOAA 3F5BA 2Q4YA 1XMTA 1QSRA 5IB0A 2P6FA 3FYNA 2ZW4A 4CYQA 4JWPA 2YNEA 2D4PA 5KTAA 3BJ7A 4UCPA 4CGMA 4CAEA 1RXTA 2QECA 3TE4A 5A27A 4FD5A 1LRZA 4MFJA 5G1ZA 3CXPA 4NEXA 2PRBA 3D2PA 4A32A 4B11A 4J3GA 5EC4A 2K5TA 4YGOA 4C7HA 4B14A 1S7KA 4JLYA 2RC4A 1CJWA 2Z3PA 1PUAA 5AG4A 1Z4RA 4KZTA 2FT0A 5HH1A 3IU2A 3F0AA 3EXNA 1ON0A 4ONUA 2WSAA 4KVXA 4QBJA 4JD6A 2QIRA 3B8GA 2VBQA 3K9UA 4X5KA 4QVTA 2PDOA 3D3SA 1CM0A 1S7NA 4JXRA 4YFJA 4KUBA 4AVBA 1ZO0A 4KORA 1Q2DA 4B5PA 4RI1A 1OZPA 2B3UA 2B3VA 5BWAB 5C82A 2P6EA 2Z10A 2DPTA 4R57A 3DR6A 2O28A 3ZJ0A 4Q38A 2R8VA 3IU1A 5I0CA 3R1KA 2PR8A 1BOBA 2CNTA 4K30A 1UFHA 3IWEA 1V0CA 2VXKA 1S60A 4H89A 1N71A 3S6KA 3SXNA 2YNCA 4C2ZA 4A33A 5HMNA 2G3TA 4KVOE 2R1IA 4NF1A 4CGLA 1M44A 4HNWB 3GKRA 3RYOA 1IIDA 2Q0YA 3QAHA 4PK3A 3N7ZA 2DXQA 4C2YA 4Q36A 1IYKA 4KOXA 1U6MA 1GHEA 2Y0MA 2A4NA 2ZW5A 3LODA 4PK2A 3DDDA 4MFLA 1SQHA 4AVAA 3FXTA 5AG7A 2B5GA 4Y49C 2J8RA 4DNCA 2ZPAA 4MJ8A 3S6GA 5KTCA 3JUWA 4CAVA 1NMTA 4E0AA 4KOYA 3C26A 5GCNA 4B5OA 4F0YA 4M3SA 5FVJA 4XNHB 2QMLA 2VEZA 2HV2A 3FB3A 4C2XA 2YNDA 1XE4A 2VZZA 4QUSA 5J8FA 5AGEA 3DSBA 5DWMA 5F47A 4CYOA 4BBHA 1P0HA 1MJAA 3EFAA 3TT2A 4OADA 3P2HA 1KUVA 3GYAA 2FE7A 3UY5A 3FBUA 5IV0A 3IWGA 1J4JA 2ATRA 4UBRA 2R98A 4QC6A 4U5YA 2OU2A 3S6FA 1YK3A 2VQYA 4PSXA 3H4QA 4QB9A 2HQYA 3EC4A 1NSLA 4MY0A 4JXQA 3W91A 4UFVA 2CY2A 3PP9A 3P2FA 4KSFA 4M85A 2Q4VA 4KLVA 4MI4A 1R57A 2Z3NA 4AVCA 4MFPA 4A95A 4XPLA 4ZGYB 5EBVA 1L0CA 5C88A 5H84A 3NE7A 2I79A 3I9SA 2Z0ZA 4UWJA 1VHSA 3TOBA 2BEIA 2B4DB 3R9FA 1S3ZA 1S7LA 4XPDC 2WPXA 4XPDB 4ORFA 3JVNA 2PQ8A 4PSWA 2ARHA 1Q2YA 1XIXA 2Z3LA 2J8NA 2AE6A 1B6BA 4MBUA 2I00A 2REFA 2ZW6A 4R3LA 4MY3A 3ZZIA 1YGHA 4CYNA 2YNCC 3DNSA 4KOSA 2OZUA 1FY7A 3EY5A 4F0XA 4HNXB 1RO5A 2JDDA 2ZXVA 3S6HA 2PC1A 2J8MA 4UCNA 5AG5A 4IF5A 5J8CA 3R9GA 2PSWA 1WK4A 4E8OA 4RS2A 5JQ4A 3JTKA 4IUSA 4UFWA 4AB7A 5IX3A 4B12A 3IGRA 1I12A 3W6SA 5E96A 3G8WA 4CAWA 2YGWA 1XEBA 4FD6A 2REEA 4U9YA 1WWZA 3LD2A 4Y49B 5G22A 4KSAA 2WPWA 2HUZA 4H6ZA 4HKFA 1Y7RA 2CNSA 4CRZB 3BLNA 3D8PA 3PGPA 3VWEA 2BUEA 2CNMA 3SHPA 4U9ZA 3W6XA 2JLMA 3WR7A 4FD7A 3TO9A 1M4GA 4HNYB 3TCVA 1Z9UA 1PU9A 1KUXA 3D2MA 3SXOA 5CNPA 1I1DA 3OWCA 1MK4A 1IB1E 2FSRA 5G21A 5G20A 1QSTA 4LX9A 1YVKA 4CGOA 4GS4A 4CS0B 1Z4EA 4KOTA 1KZFA 5F48A 1TIQA 3TO7A 1QSOA 2IL4A 4C7IA 2CXAA 2BL1A 3PZJA 2OB0A 4I49A 4KVME 1M4DA 4F6AA 1M1DA 4A30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZGY B;  1ZO0 A;  5BWA B; 
#chains in the Genus database with same CATH topology
 1A2Z A;  1YRE A;  3ISZ A;  2ZEL A;  3NA6 A;  1MJB A;  1YVO A;  4XPK A;  2ZW7 A;  4UWI A;  4KS9 A;  1LOK A;  1Y9K A;  3CXS A;  1TKH A;  2BSW A;  4NJQ A;  4NSQ A;  4UA3 A;  5HVH A;  4FWU A;  3PB6 X;  3FEE A;  4AG9 A;  1TXR A;  2OZG A;  4Q7A A;  2DPS A;  4CRY B;  1Z2L A;  4DUK A;  4OLL A;  1OBR A;  1DTD A;  1YW6 A;  1YLO A;  1BO4 A;  3R9E A;  3T9Y A;  2P0W A;  3GUX A;  5HVF A;  2EUI A;  2FS5 A;  2Z3K A;  2H5M A;  4R9M A;  1Z8T A;  4YU9 A;  1XBU A;  2C6P A;  2Q04 A;  1P4N A;  4ZI6 A;  2ZED A;  3EO4 A;  5DWN A;  1CPX A;  1M4I A;  3R96 A;  2Z11 A;  4OC1 A;  4RN7 A;  5ISV A;  2OH1 A;  2Q7B A;  2OOT A;  5I4M A;  2AJ6 A;  4A31 A;  4B5P B;  4P6Y A;  3FEC A;  3H8F A;  5KTD A;  1IOF A;  4R8F A;  4UF4 A;  2ZEN A;  3A9L A;  4P4E A;  5H86 A;  3R95 A;  2XEF A;  2V77 A;  2FCK A;  4R3K A;  4AG7 A;  5LYL A;  2X7B A;  4E2A A;  4MHD A;  2EWB A;  4NXY A;  2OZH A;  1Q2C A;  3F8K A;  4DJL A;  4KOW A;  2NYQ A;  1BLL E;  1IU8 A;  2C27 A;  1IIC A;  2EVN A;  3D7D A;  2F5I A;  4MRI A;  1VHE A;  1XF8 A;  3QB8 A;  3WT4 A;  4O23 A;  2G0B A;  2GRE A;  1YR0 A;  1Z8W A;  1CPS A;  2CF4 A;  1KUY A;  4PV6 A;  3KQZ A;  1HDU A;  2B4D A;  4PXB A;  4YWY A;  1MJ9 A;  4EWT A;  1VKC A;  2AFS A;  2O4H A;  3DR8 A;  3TO6 A;  3QNV A;  3PFO A;  4ZY1 A;  3D7F A;  4II9 A;  1XMB A;  4ZBG A;  2R7H A;  2V8G A;  3VAR A;  3D4U A;  3MN8 A;  3QAY A;  2VL1 A;  1S7F A;  2FL4 A;  5AG6 A;  1K4J A;  2NMT A;  2VI7 A;  3GY9 A;  4MFZ A;  4OP4 A;  2D4O A;  3RAM A;  4CGL A;  3G3S A;  4MCQ A;  1TKF A;  1QSN A;  3E0K A;  1FNO A;  1NE9 A;  4IHM A;  2FXF A;  4R87 A;  5LYF A;  4KOU A;  1YLE A;  2B4B A;  2RFH A;  4JZ0 A;  4UFX A;  1B87 A;  2Q43 A;  4BMH A;  6CPA A;  2HB6 A;  2GAN A;  5F46 A;  2B58 A;  2PJC A;  5LRK A;  2FIW A;  2QJ8 A;  3NE8 A;  5F49 A;  2XEI A;  4A37 A;  3SI0 A;  1BPM A;  4A94 A;  3VWD A;  4L89 A;  4NCZ A;  4CGP A;  2GE3 A;  2B5G B;  2AFU A;  4JYW A;  1QQ9 A;  4NGM A;  3KQX A;  4B10 A;  4P44 A;  3PRT A;  3KKW A;  2GLJ A;  4P4D A;  4EME A;  2P6G A;  1Y9W A;  4KOV A;  4A39 A;  1HEE A;  3BJ8 A;  4C68 A;  4CAF A;  2KCW A;  4EVY A;  4MFQ A;  5ELY A;  2PJ3 A;  2Q44 A;  3S9N A;  3ISX A;  3FJU A;  2WYR A;  2WZN A;  3K9T A;  4OAE A;  1XFO A;  2GIV A;  2WUU A;  1ZG8 A;  3HLP A;  2V8H A;  3PEI A;  4UCM A;  3T90 A;  3PFE A;  3RBU A;  2ANP A;  2F7V A;  4MFK A;  3I3G A;  4B13 A;  3GLJ A;  4L8A A;  2PIZ A;  2JDC A;  2VZY A;  4YRH A;  2Q4Z A;  2PR1 A;  1YX0 A;  3H5Z A;  3FIX A;  4B6Z A;  3D67 A;  2Z3O A;  3V8I A;  1I21 A;  4FD4 A;  3TX8 A;  4CAX A;  2JEV A;  4LUA A;  4H6U A;  3BI0 A;  4GM5 A;  5F09 A;  1IYL A;  4JJX A;  3PB9 X;  2O53 A;  2PVW A;  3TFY A;  2ZOG A;  3MGD A;  2CIJ A;  2PJ7 A;  1ZG9 A;  2G3A A;  3CXQ A;  3H8E A;  5JPH A;  5J1Q A;  5EMI A;  1LFW A;  3FRM A;  4KLW A;  2FIA A;  4CYP A;  3FNC A;  4CGN A;  2Z3M A;  1UWY A;  4P4I A;  4XNH C;  1S5K A;  2PJ2 A;  5A28 A;  4A2Z A;  1QSM A;  5JGF A;  3TTH A;  3IFE A;  3N5F A;  4KUA A;  3TOA A;  3F5B A;  2Q4Y A;  4MCP A;  1XMT A;  1QSR A;  5IB0 A;  2P6F A;  2PCU A;  1LAP A;  1R3N A;  3D66 A;  3FYN A;  1Z5R A;  2ZW4 A;  4OC4 A;  3S9M A;  4IK2 A;  4MCS A;  2V8D A;  4CYQ A;  2AFO A;  4JWP A;  8CPA A;  2YNE A;  2PJ1 A;  2D4P A;  2PE3 A;  3CDX A;  4ZX8 A;  4ONW A;  5KTA A;  3BJ7 A;  4UCP A;  4FAI A;  2ZEO A;  3SI1 A;  2PJ9 A;  4CAE A;  1RXT A;  4CGM A;  3B3V A;  2QEC A;  4LQG A;  3TE4 A;  3LWU A;  4G1P A;  5A27 A;  4FD5 A;  2C6C A;  1VIX A;  3KI9 A;  1LRZ A;  1ZLI A;  4A38 A;  4MFJ A;  1YME A;  5G1Z A;  4NGQ A;  3FX6 A;  3CXP A;  1DE4 C;  4NEX A;  1Z8L A;  2PRB A;  3D2P A;  1Y0R A;  3SI2 A;  4MHZ A;  4A32 A;  1JWQ A;  4B11 A;  4EFD A;  4J3G A;  5EC4 A;  2K5T A;  4ZX9 A;  4ZYQ A;  4YGO A;  4C7H A;  2ZEM A;  4B14 A;  1S7K A;  2POK A;  4JLY A;  4TWE A;  5DS0 A;  2RC4 A;  1FT7 A;  5LYI A;  5K8M A;  2JBK A;  1CJW A;  2Z3P A;  1PUA A;  4PXC A;  5AG4 A;  1Z4R A;  3JRU A;  4KZT A;  3D7H A;  2FT0 A;  1ELM P;  2NSM A;  4W9Y A;  5HH1 A;  3IU2 A;  1PYT B;  2Q7S A;  4WWV A;  3F0A A;  3EXN A;  1ON0 A;  4ONU A;  3IC1 A;  2WSA A;  4KVX A;  3KHX A;  3DGV A;  4QBJ A;  3V38 A;  4JD6 A;  2QIR A;  3B8G A;  2VBQ A;  2XEJ A;  3K9U A;  4X5K A;  3V7Z A;  3HUV A;  4QVT A;  2PDO A;  3D3S A;  1CM0 A;  1S7N A;  4X8I A;  4JXR A;  4YFJ A;  1ZG7 A;  4KUB A;  4AVB A;  1ZO0 A;  4KOR A;  1Q2D A;  2PJ6 A;  4RI1 A;  5D29 A;  4B5P A;  1OZP A;  1VGY A;  2ZOF A;  1LCP A;  2B3U A;  2B3V A;  5BWA B;  5C82 A;  2P6E A;  2Z10 A;  2ZEF A;  2DPT A;  3PB7 X;  4FBE A;  4R57 A;  4NGP A;  4OC2 A;  3DR6 A;  2O28 A;  3PBE A;  2I3C A;  4OKO A;  3ZJ0 A;  4Q38 A;  1EE3 P;  2C1C A;  3FMC A;  2R8V A;  3IU1 A;  1BAV A;  4R7M A;  1Q7L A;  3T8W A;  5I0C A;  2ODF A;  1X10 A;  3R1K A;  1AUG A;  2PR8 A;  1BOB A;  1F2P A;  2CNT A;  4K30 A;  1UFH A;  3IWE A;  1V0C A;  3SJE A;  2VXK A;  1S60 A;  4H89 A;  1N71 A;  1TF8 A;  3S6K A;  3SXN A;  2PIY A;  4RUH A;  5LRG A;  2YNC A;  4MHP A;  1ELL P;  4NJR A;  3RO0 A;  4C2Z A;  4A33 A;  5HMN A;  2G3T A;  2ZEH A;  2R1I A;  4KVO E;  4NF1 A;  4UEZ A;  1M44 A;  3B3S A;  4HNW B;  3GKR A;  4HPS A;  3RYO A;  1IID A;  4M6H A;  3VAT A;  2Q0Y A;  1CX8 A;  3QAH A;  4PK3 A;  3N7Z A;  4OC3 A;  4M6I A;  1YSJ A;  2DXQ A;  4C2Y A;  4Q36 A;  1IYK A;  2PJA A;  4KOX A;  1U6M A;  1GHE A;  2CTB A;  1Y7E A;  2Y0M A;  1XRY A;  4AXV A;  4H2K A;  5THW A;  2ZEP A;  2A4N A;  2ZW5 A;  4NFR A;  1Y0Y A;  3LOD A;  4PK2 A;  1XJO A;  3DDD A;  4MFL A;  3SJX A;  1CP7 A;  2J9A A;  1SQH A;  3MRU A;  3NFZ A;  4MXU A;  1H8L A;  3FXT A;  5AG7 A;  4AVA A;  2B5G A;  4MMO A;  4Y49 C;  3GIU A;  2GLF A;  2J8R A;  4DYO A;  3B7I A;  1LAN A;  2ZPA A;  4MJ8 A;  3S6G A;  1QMU A;  3WAB A;  4DNC A;  3JUW A;  5KTC A;  3B3T A;  3L2N A;  4PPZ A;  4CAV A;  1NMT A;  4R76 A;  2OR4 A;  4PXD A;  4E0A A;  1F2O A;  3H8G A;  4KOY A;  3C26 A;  1GYT A;  5GCN A;  4B5O A;  4F0Y A;  4M3S A;  5FVJ A;  1CG2 A;  5HVG A;  5LRJ A;  2QVP A;  4GXH A;  2QML A;  4XNH B;  2VEZ A;  2HV2 A;  3FB3 A;  4C2X A;  4NGN A;  2EBJ A;  2YND A;  1XE4 A;  7CPA A;  2CTC A;  2VZZ A;  4QUS A;  2BO9 A;  5J8F A;  5AGE A;  2IQ6 A;  3DSB A;  3PB4 X;  5DWM A;  3TC8 A;  5F47 A;  4CYO A;  4BBH A;  1P0H A;  1MJA A;  3EFA A;  4K3N A;  3TT2 A;  4OAD A;  3P2H A;  1KUV A;  3B35 A;  3GYA A;  1F57 A;  2FE7 A;  3UY5 A;  3FBU A;  1VHO A;  2IJZ A;  4UEE A;  4IAV A;  5IV0 A;  2PJ4 A;  3IWG A;  1AMP A;  1J4J A;  1LAM A;  4MHN A;  5CPA A;  2ATR A;  4UBR A;  1NSA A;  2R98 A;  4UEF A;  4QC6 A;  4U5Y A;  2OU2 A;  4MCR A;  4OME A;  3S6F A;  3KAS A;  5CBM A;  1TKJ A;  1YK3 A;  2QYV A;  2VQY A;  2PJB A;  3LAC A;  4NGT A;  2PJ5 A;  3H4Q A;  4PSX A;  4X2T A;  5JM6 A;  4QB9 A;  2HQY A;  3EC4 A;  1NSL A;  4MY0 A;  2PVV A;  4JXQ A;  2EK8 A;  4UFV A;  2CY2 A;  3W91 A;  3PP9 A;  4UIB A;  2RB7 A;  4F9U A;  3IWW A;  3P2F A;  4KSF A;  4M85 A;  2Q4V A;  4KLV A;  4MI4 A;  2DEA A;  1R57 A;  2Z3N A;  4AVC A;  5JH9 A;  4MFP A;  4A95 A;  1IGB A;  4TNU A;  4XPL A;  1KWM A;  3VH9 A;  4ZGY B;  5EBV A;  1L0C A;  3LMS A;  4P45 A;  1CBX A;  5C88 A;  5H84 A;  4ZY0 A;  3NE7 A;  1IY7 A;  1PCA A;  4P4J A;  2C6G A;  2I79 A;  1BPN A;  1HDQ A;  2AFZ A;  3I9S A;  2Z0Z A;  4UWJ A;  5K8P A;  1VHS A;  3TOB A;  2BEI A;  2B4D B;  3R9F A;  5K8N A;  1S3Z A;  1S7L A;  4XPD C;  2WPX A;  4XPD B;  4ORF A;  3JVN A;  3PB8 X;  2PQ8 A;  3WC5 A;  4BD9 A;  4PSW A;  1ARL A;  2ARH A;  1R43 A;  1Q2Y A;  1XIX A;  2BOA A;  2ZEG A;  4OID A;  4P4B A;  2EK9 A;  2Z3L A;  2J8N A;  2AE6 A;  1B6B A;  2GFQ A;  4FUU A;  3KR4 A;  4MBU A;  3RZA A;  4WJB A;  3NH8 A;  3D68 A;  2GU2 A;  2I00 A;  2REF A;  2ZW6 A;  4R3L A;  4UIA A;  3FF3 A;  1RTQ A;  2AFM A;  3CT9 A;  3FED A;  4MY3 A;  3ZZI A;  3BXM A;  1YGH A;  4CYN A;  4NGS A;  3FH4 A;  2YNC C;  3DNS A;  4KOS A;  5D8N A;  2OZU A;  1FY7 A;  3IIB A;  3EY5 A;  2PJ8 A;  4F0X A;  4HNX B;  1RO5 A;  2JDD A;  3KHZ A;  2ZXV A;  2AFX A;  3S6H A;  2PRQ A;  4F8Z A;  2EO8 A;  2PC1 A;  2J8M A;  4UCN A;  5AG5 A;  4IF5 A;  5J8C A;  3K2K A;  3R9G A;  2PSW A;  1WK4 A;  3BI1 A;  4E8O A;  4RS2 A;  1AYE A;  3B3W A;  5HXD A;  5JQ4 A;  1Z8X A;  2AFW A;  3BHX A;  3NH4 A;  5IB9 A;  3JTK A;  4IUS A;  4UFW A;  4F9V A;  4AB7 A;  3GB0 A;  2IMO A;  4P10 A;  4OC5 A;  3FVL A;  4BIN A;  5IX3 A;  4B12 A;  3IGR A;  1I12 A;  3W6S A;  3DLJ A;  4M6G A;  5E96 A;  3G8W A;  4CAW A;  2YGW A;  2HC9 A;  2JBJ A;  2Q51 A;  1XEB A;  1TF9 A;  3CZX A;  3I1U A;  3NH5 A;  4FD6 A;  4LQ6 A;  2REE A;  3CPX A;  4U9Y A;  1WWZ A;  3LD2 A;  2ZEE A;  3PBB A;  3IJ3 A;  4PQA A;  4Y49 B;  5G22 A;  4MHY A;  4KSA A;  4NGR A;  2WPW A;  4R6T A;  3KL9 A;  2HUZ A;  2G9D A;  1Y7R A;  2XEG A;  4H6Z A;  4HKF A;  2CNS A;  4CRZ B;  3BLN A;  2PJ0 A;  3D8P A;  3PGP A;  2FVG A;  3SJF A;  1X12 A;  1YQE A;  2BUE A;  3VWE A;  2JEW A;  5LYD A;  2CNM A;  3SHP A;  4U9Z A;  3W6X A;  2JLM A;  1YW4 A;  3IEH A;  4PXE A;  4P4F A;  3WR7 A;  4FD7 A;  3TO9 A;  3KGQ A;  1M4G A;  4HNY B;  3B2Y A;  1Z9U A;  3TCV A;  1PU9 A;  1IOI A;  5K8O A;  1KUX A;  3D2M A;  4X3R A;  3SXO A;  5CNP A;  1I1D A;  3OWC A;  1M4L A;  4OC0 A;  3WC6 A;  3SJG A;  1MK4 A;  4OIW A;  1IB1 E;  2FSR A;  2DF5 A;  5G21 A;  2V8V A;  5G20 A;  1QST A;  2BCO A;  2F8H A;  3CPA A;  4Z65 A;  3IO1 A;  4LX9 A;  1YVK A;  3KR5 A;  4CGO A;  4GS4 A;  4KSI A;  1JQG A;  3B3C A;  1Z4E A;  4CS0 B;  4ZY2 A;  4KOT A;  1KZF A;  5F48 A;  1TIQ A;  1ZLH A;  3TO7 A;  1QSO A;  3D7G A;  2IL4 A;  4C7I A;  2CXA A;  2BL1 A;  3PZJ A;  1ARM A;  2OB0 A;  3KZW A;  4I49 A;  4KVM E;  1CP6 A;  1M4D A;  4F6A A;  3S9L A;  1M1D A;  2ABZ A;  4CPA A;  3WC7 A;  1XOV A;  3RNZ A;  4A30 A; 
#chains in the Genus database with same CATH homology
 1YRE A;  1MJB A;  1YVO A;  4XPK A;  2ZW7 A;  4UWI A;  4KS9 A;  1Y9K A;  3CXS A;  2BSW A;  4NSQ A;  4UA3 A;  4AG9 A;  2OZG A;  2DPS A;  4CRY B;  4OLL A;  1BO4 A;  3R9E A;  3T9Y A;  2P0W A;  2EUI A;  2FS5 A;  2Z3K A;  2H5M A;  4R9M A;  2Q04 A;  1P4N A;  3EO4 A;  5DWN A;  1M4I A;  3R96 A;  2Z11 A;  5ISV A;  2OH1 A;  2Q7B A;  2AJ6 A;  4A31 A;  4B5P B;  5KTD A;  3A9L A;  5H86 A;  3R95 A;  2FCK A;  4R3K A;  4AG7 A;  2X7B A;  4E2A A;  4MHD A;  4NXY A;  2OZH A;  1Q2C A;  3F8K A;  4KOW A;  2C27 A;  1IIC A;  2EVN A;  2F5I A;  1XF8 A;  3QB8 A;  2G0B A;  1YR0 A;  1KUY A;  4PV6 A;  2B4D A;  1MJ9 A;  1VKC A;  3DR8 A;  3TO6 A;  4II9 A;  4ZBG A;  2R7H A;  1S7F A;  2FL4 A;  5AG6 A;  1K4J A;  2NMT A;  2VI7 A;  3GY9 A;  4MFZ A;  2D4O A;  3G3S A;  3E0K A;  1QSN A;  1NE9 A;  2FXF A;  4R87 A;  4KOU A;  1YLE A;  2B4B A;  4UFX A;  4BMH A;  1B87 A;  5F46 A;  2GAN A;  2B58 A;  2FIW A;  5F49 A;  3VWD A;  4L89 A;  4NCZ A;  4CGP A;  2GE3 A;  2B5G B;  4B10 A;  3KKW A;  2P6G A;  1Y9W A;  4KOV A;  4C68 A;  4EVY A;  3BJ8 A;  4CAF A;  2KCW A;  4MFQ A;  2Q44 A;  4OAE A;  2WUU A;  2GIV A;  4UCM A;  3T90 A;  4MFK A;  3I3G A;  4B13 A;  4L8A A;  2JDC A;  2VZY A;  4YRH A;  2PR1 A;  1YX0 A;  3H5Z A;  3FIX A;  2Z3O A;  3V8I A;  1I21 A;  4FD4 A;  4CAX A;  2JEV A;  4LUA A;  4H6U A;  1IYL A;  4JJX A;  3TFY A;  3MGD A;  5JPH A;  2G3A A;  3CXQ A;  3FRM A;  4KLW A;  2FIA A;  4CYP A;  3FNC A;  4CGN A;  2Z3M A;  4XNH C;  1S5K A;  5A28 A;  4A2Z A;  1QSM A;  3TTH A;  4KUA A;  3TOA A;  3F5B A;  2Q4Y A;  1XMT A;  1QSR A;  5IB0 A;  2P6F A;  3FYN A;  2ZW4 A;  4CYQ A;  4JWP A;  2YNE A;  2D4P A;  5KTA A;  3BJ7 A;  4UCP A;  4CGM A;  4CAE A;  1RXT A;  2QEC A;  3TE4 A;  5A27 A;  4FD5 A;  1LRZ A;  4MFJ A;  5G1Z A;  3CXP A;  4NEX A;  2PRB A;  3D2P A;  4A32 A;  4B11 A;  4J3G A;  5EC4 A;  2K5T A;  4YGO A;  4C7H A;  4B14 A;  1S7K A;  4JLY A;  2RC4 A;  1CJW A;  2Z3P A;  1PUA A;  5AG4 A;  1Z4R A;  4KZT A;  2FT0 A;  5HH1 A;  3IU2 A;  3F0A A;  3EXN A;  1ON0 A;  4ONU A;  2WSA A;  4KVX A;  4QBJ A;  4JD6 A;  2QIR A;  3B8G A;  2VBQ A;  3K9U A;  4X5K A;  4QVT A;  2PDO A;  3D3S A;  1CM0 A;  1S7N A;  4JXR A;  4YFJ A;  4KUB A;  4AVB A;  1ZO0 A;  4KOR A;  1Q2D A;  4B5P A;  4RI1 A;  1OZP A;  2B3U A;  2B3V A;  5BWA B;  5C82 A;  2P6E A;  2Z10 A;  2DPT A;  4R57 A;  3DR6 A;  2O28 A;  3ZJ0 A;  4Q38 A;  2R8V A;  3IU1 A;  5I0C A;  3R1K A;  2PR8 A;  1BOB A;  2CNT A;  4K30 A;  1UFH A;  3IWE A;  1V0C A;  2VXK A;  1S60 A;  4H89 A;  1N71 A;  3S6K A;  3SXN A;  2YNC A;  4C2Z A;  4A33 A;  5HMN A;  2G3T A;  4KVO E;  2R1I A;  4NF1 A;  4CGL A;  1M44 A;  4HNW B;  3GKR A;  3RYO A;  1IID A;  2Q0Y A;  3QAH A;  4PK3 A;  3N7Z A;  2DXQ A;  4C2Y A;  4Q36 A;  1IYK A;  4KOX A;  1U6M A;  1GHE A;  2Y0M A;  2A4N A;  2ZW5 A;  3LOD A;  4PK2 A;  3DDD A;  4MFL A;  1SQH A;  4AVA A;  3FXT A;  5AG7 A;  2B5G A;  4Y49 C;  2J8R A;  4DNC A;  2ZPA A;  4MJ8 A;  3S6G A;  5KTC A;  3JUW A;  4CAV A;  1NMT A;  4E0A A;  4KOY A;  3C26 A;  5GCN A;  4B5O A;  4F0Y A;  4M3S A;  5FVJ A;  4XNH B;  2QML A;  2VEZ A;  2HV2 A;  3FB3 A;  4C2X A;  2YND A;  1XE4 A;  2VZZ A;  4QUS A;  5J8F A;  5AGE A;  3DSB A;  5DWM A;  5F47 A;  4CYO A;  4BBH A;  1P0H A;  1MJA A;  3EFA A;  3TT2 A;  4OAD A;  3P2H A;  1KUV A;  3GYA A;  2FE7 A;  3UY5 A;  3FBU A;  5IV0 A;  3IWG A;  1J4J A;  2ATR A;  4UBR A;  2R98 A;  4QC6 A;  4U5Y A;  2OU2 A;  3S6F A;  1YK3 A;  2VQY A;  4PSX A;  3H4Q A;  4QB9 A;  2HQY A;  3EC4 A;  1NSL A;  4MY0 A;  4JXQ A;  3W91 A;  4UFV A;  2CY2 A;  3PP9 A;  3P2F A;  4KSF A;  4M85 A;  2Q4V A;  4KLV A;  4MI4 A;  1R57 A;  2Z3N A;  4AVC A;  4MFP A;  4A95 A;  4XPL A;  4ZGY B;  5EBV A;  1L0C A;  5C88 A;  5H84 A;  3NE7 A;  2I79 A;  3I9S A;  2Z0Z A;  4UWJ A;  1VHS A;  3TOB A;  2BEI A;  2B4D B;  3R9F A;  1S3Z A;  1S7L A;  4XPD C;  2WPX A;  4XPD B;  4ORF A;  3JVN A;  2PQ8 A;  4PSW A;  2ARH A;  1Q2Y A;  1XIX A;  2Z3L A;  2J8N A;  2AE6 A;  1B6B A;  4MBU A;  2I00 A;  2REF A;  2ZW6 A;  4R3L A;  4MY3 A;  3ZZI A;  1YGH A;  4CYN A;  2YNC C;  3DNS A;  4KOS A;  2OZU A;  1FY7 A;  3EY5 A;  4F0X A;  4HNX B;  1RO5 A;  2JDD A;  2ZXV A;  3S6H A;  2PC1 A;  2J8M A;  4UCN A;  5AG5 A;  4IF5 A;  5J8C A;  3R9G A;  2PSW A;  1WK4 A;  4E8O A;  4RS2 A;  5JQ4 A;  3JTK A;  4IUS A;  4UFW A;  4AB7 A;  5IX3 A;  4B12 A;  3IGR A;  1I12 A;  3W6S A;  5E96 A;  3G8W A;  4CAW A;  2YGW A;  1XEB A;  4FD6 A;  2REE A;  4U9Y A;  1WWZ A;  3LD2 A;  4Y49 B;  5G22 A;  4KSA A;  2WPW A;  2HUZ A;  4H6Z A;  4HKF A;  1Y7R A;  2CNS A;  4CRZ B;  3BLN A;  3D8P A;  3PGP A;  3VWE A;  2BUE A;  2CNM A;  3SHP A;  4U9Z A;  3W6X A;  2JLM A;  3WR7 A;  4FD7 A;  3TO9 A;  1M4G A;  4HNY B;  3TCV A;  1Z9U A;  1PU9 A;  1KUX A;  3D2M A;  3SXO A;  5CNP A;  1I1D A;  3OWC A;  1MK4 A;  1IB1 E;  2FSR A;  5G21 A;  5G20 A;  1QST A;  4LX9 A;  1YVK A;  4CGO A;  4GS4 A;  4CS0 B;  1Z4E A;  4KOT A;  1KZF A;  5F48 A;  1TIQ A;  3TO7 A;  1QSO A;  2IL4 A;  4C7I A;  2CXA A;  2BL1 A;  3PZJ A;  2OB0 A;  4I49 A;  4KVM E;  1M4D A;  4F6A A;  1M1D A;  4A30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...