5BWAB

Crystal structure of odc-plp-az1 ternary complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
127
structure length
121
Chain Sequence
NLFYSDDRLNVTEEDKTRILNVQSRLTDAKRINWRTVLSGGSLYIEIPGGALPEGSKDSFAVLLEFAEEQLRADHVFICFHKNREDRAALLRTFSFLGFEIVRPGHPLVRPDACFMAYTFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ornithine decarboxylase
publication title Structural basis of Ornithine Decarboxylase inactivation and accelerated degradation by polyamine sensor Antizyme1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase/lyase inhibitor
total genus 22
structure length 121
sequence length 127
ec nomenclature
pdb deposition date 2015-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02100 ODC_AZ Ornithine decarboxylase antizyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.60 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5bwaB00
5BWAB 4ZGYB 1ZO0A
chains in the Genus database with same CATH superfamily
4WJBA 3IJ3A 1BPNA 2CTCA 2ZOGA 4OC3A 3SJFA 2JDCA 3H8GA 4XPDB 3K9UA 1HDQA 4H2KA 2Z10A 4A2ZA 2Z3OA 2D4PA 2Z0ZA 3FECA 2PR1A 2Z3KA 2P6GA 4NGPA 2Q44A 5I4MA 4EFDA 1S7KA 3SHPA 4FD4A 3BI0A 1Z4EA 4X2TA 3SI2A 1Y7EA 2IL4A 3CXPA 4K30A 2B5GA 4MRIA 4OC0A 1IGBA 4P4IA 6CPAA 1P0HA 4OAEA 1VKCA 2J8MA 4KS9A 5K8OA 2EWBA 2PJ7A 2ZEEA 2PC1A 2PJAA 2XEGA 4UEZA 2R1IA 4KSAA 1QQ9A 4HNXB 5THWA 2BEIA 4U9ZA 5G22A 1F2OA 3T9YA 1Y0YA 3FMCA 4FD7A 2HV2A 4YU9A 5BWAB 4C7HA 4U9YA 3KI9A 2J9AA 3VWEA 2REFA 3RAMA 4CGOA 4JXRA 4L89A 5F48A 2V8DA 3QAHA 3SXOA 1GYTA 1YW6A 1Z9UA 2C6GA 1UWYA 2ZXVA 4QC6A 3DR8A 3D66A 3P2FA 1YGHA 3D7HA 2QJ8A 2OZHA 2AFOA 2YNCA 4PSWA 2RC4A 4A94A 3IWEA 4NJQA 3L2NA 3PRTA 3WC6A 4KOSA 4IF5A 2B3VA 4QVTA 3D7FA 4ZY2A 2GREA 1FNOA 5HVFA 1Q7LA 4AG7A 4ZYQA 2Q7SA 4JXQA 1Q2YA 4UCPA 5E96A 4XPLA 3SJEA 2Q4YA 1KZFA 3S9MA 1AYEA 4RN7A 1Q2DA 1WWZA 2R98A 3N5FA 4YGOA 4NGQA 1AUGA 3IEHA 4ORFA 2HUZA 4RS2A 2X7BA 1S7NA 3WC7A 3PP9A 1X12A 2B4DA 3W6SA 4DJLA 2P6FA 5DWMA 2CY2A 4CAFA 3H8EA 1P4NA 2PJ5A 5GCNA 2GLFA 3BJ7A 4CPAA 4ZI6A 1LAMA 4WWVA 2I79A 3TT2A 1QMUA 4EMEA 3GYAA 3RZAA 4MFZA 3D7DA 4TWEA 5IB0A 1DE4C 1PYTB 2C6CA 4MXUA 3TE4A 4R6TA 2F8HA 4CAVA 1Q2CA 3PB9X 3IC1A 2WPXA 4IAVA 4UEEA 3S9NA 3FX6A 4TNUA 5IB9A 1IB1E 1WK4A 3EO4A 1XMTA 4Q38A 3GLJA 4P10A 1BPMA 2ARHA 2RFHA 3CXSA 7CPAA 2XEJA 2OZUA 4KOYA 2CF4A 4H89A 1MJAA 2CNTA 3VWDA 3TOBA 5G21A 4P45A 5KTDA 4W9YA 2JDDA 4MFLA 4ZX8A 4KVME 3B2YA 2PJ6A 1M4IA 1AMPA 3PGPA 2JEVA 1L0CA 1S7LA 5DS0A 1ELMP 2GANA 4JD6A 4RI1A 4KOTA 4BBHA 1PUAA 4NEXA 5KTCA 1RTQA 4ZGYB 1IOFA 1IU8A 3F0AA 4IUSA 3D4UA 4PPZA 1BOBA 2PRBA 2PJ1A 1I21A 2WUUA 4O23A 4UWJA 4G1PA 4A30A 5AG4A 2VL1A 2JLMA 2FE7A 1IIDA 4B5PB 3BXMA 4NGMA 2PIZA 1XMBA 3A9LA 3B3WA 4AVCA 2H5MA 5C88A 2BOAA 3RNZA 2PRQA 1S7FA 8CPAA 3FF3A 4NJRA 2EK9A 4A39A 5JH9A 4PV6A 1PCAA 5K8PA 3TC8A 4AVAA 4I49A 4J3GA 4UWIA 4XNHC 4CGMA 2HQYA 1YSJA 1CG2A 3QAYA 5K8MA 3R95A 2C27A 5G20A 3RO0A 3TX8A 4YWYA 5A27A 2QIRA 4Y49C 3FEDA 3D2MA 3FEEA 3CPAA 4NF1A 2Q51A 2PVVA 5G1ZA 2NSMA 4OC5A 5ISVA 2CTBA 1ZLIA 4BMHA 2PE3A 4CGPA 4XPKA 1XRYA 2CIJA 4BINA 2VQYA 1YMEA 1YLEA 1JWQA 1YVKA 2FS5A 2Z3NA 4KSFA 4MBUA 5D8NA 4F0YA 3S9LA 1CM0A 3VARA 3G3SA 3D2PA 3RBUA 4L8AA 5CNPA 2PIYA 2ZOFA 3C26A 4PK3A 5KTAA 3PFEA 3T90A 3BLNA 1QSOA 4H6UA 3W91A 1TXRA 3KASA 4FAIA 4A38A 5F09A 3LWUA 4U5YA 3WABA 1M4GA 2P6EA 5AG5A 4BD9A 2PR8A 3I9SA 3S6FA 1XEBA 4LQ6A 4XNHB 1I1DA 1TF9A 2AFUA 4OC2A 2NMTA 4NFRA 3FH4A 2GE3A 3CXQA 2Z11A 1HDUA 1Z8TA 2OB0A 2V8VA 4PXDA 2OOTA 3PB8X 5HXDA 4ONWA 2Z3PA 3MRUA 2O53A 1R43A 1QSTA 3SJGA 2FCKA 2FXFA 3TCVA 4QBJA 5IV0A 4P6YA 1XOVA 1M4LA 1MK4A 2DPTA 2HC9A 1YK3A 2OU2A 4OADA 4OP4A 1I12A 1Y7RA 1Y9WA 4M6HA 4KVXA 5LRGA 4UCMA 3FNCA 3NA6A 3W6XA 2ZEPA 4P4JA 5EMIA 2FL4A 3KHZA 3GIUA 3ISXA 3B35A 4KOWA 1ZG9A 2AJ6A 2YNCC 3DGVA 3KQXA 2XEFA 3ZZIA 4AVBA 4A33A 1N71A 2CXAA 2ODFA 1YREA 3UY5A 4RUHA 1M44A 4IHMA 2R7HA 4C2YA 3IFEA 1VHEA 3WC5A 4K3NA 3F8KA 2I3CA 3R9EA 2F5IA 3WT4A 1TKHA 3BHXA 4MJ8A 1CPSA 2IJZA 2PJ2A 4DNCA 2G9DA 4A32A 5LYLA 1M4DA 1S5KA 1LOKA 4FD6A 1ZG7A 4B11A 4B5PA 1ON0A 2J8RA 2ZEHA 2VZYA 2BCOA 2PJ8A 3IU1A 3KHXA 1ELLP 3H4QA 4NCZA 5JQ4A 5LYDA 3V8IA 3EXNA 1IOIA 3K9TA 4UFVA 4UIBA 2XEIA 3KQZA 2ZEOA 3PB6X 3B8GA 2C6PA 1ARLA 3HLPA 4DUKA 2G3TA 1KUYA 1Z2LA 3IIBA 4QB9A 4UEFA 5F49A 2ZELA 2FIWA 4CYQA 4MFKA 5H86A 1XBUA 4KOXA 5F47A 1JQGA 4NGTA 3DLJA 2QYVA 3FYNA 2GLJA 2YNEA 3IWGA 4IK2A 4M6IA 3PBEA 4CAXA 1CP7A 2VZZA 2ZENA 4A31A 2PDOA 5HH1A 3R9GA 1VGYA 4OIDA 4F9UA 4CGNA 1XFOA 3KR4A 4A95A 3NH5A 3S6KA 1LFWA 4R7MA 3FXTA 3PB4X 2PQ8A 3G8WA 3VATA 5J1QA 5F46A 3TOAA 1IY7A 3H5ZA 2EUIA 4X5KA 2FT0A 4P4FA 3TFYA 4ONUA 4PQAA 4PXEA 3TO6A 2Z3LA 2BO9A 3KKWA 4PXCA 4B6ZA 1TKJA 4F0XA 4CS0B 4AG9A 3D8PA 4XPDC 2Q04A 4OKOA 4CRZB 2V8HA 1IYKA 2VBQA 1YR0A 4KSIA 2Z3MA 4NXYA 4CAEA 3NH4A 2AFWA 4C2ZA 5C82A 3IGRA 2PJCA 5HVGA 2BUEA 2JBJA 5HMNA 5JPHA 4YFJA 3B7IA 4NGSA 2OR4A 3SI0A 4PXBA 2PCUA 4X8IA 1KWMA 5EC4A 4A37A 3TO9A 4E0AA 3SI1A 4F9VA 3MGDA 2ZW6A 2Y0MA 4MFQA 4F6AA 4MFPA 1Y0RA 2ZW4A 5LYFA 2G0BA 3NE8A 2EK8A 4R76A 4YRHA 5AGEA 3S6HA 2IMOA 4UF4A 2A4NA 5ELYA 1QSMA 4HNYB 2O28A 3S6GA 2ZEDA 1BLLE 2WZNA 4MY0A 4OC1A 2O4HA 4II9A 1R57A 4QUSA 3WR7A 3ISZA 4KUBA 4M85A 1J4JA 5JGFA 2AFMA 2DXQA 1B6BA 2BSWA 2EVNA 4MFJA 4KUAA 4FD5A 5AG7A 5JM6A 3D3SA 2ATRA 1VHOA 2BL1A 2R8VA 1HEEA 3NE7A 2ZW5A 3B3SA 2B4BA 3SXNA 5J8FA 3ZJ0A 2PJ4A 4HNWB 1NMTA 3BJ8A 4R9MA 1YLOA 4LUAA 1R3NA 3FBUA 4E8OA 1IYLA 2NYQA 4UBRA 1XIXA 1PU9A 3EC4A 1V0CA 2FSRA 5CBMA 1LAPA 3EY5A 4R57A 1YQEA 4X3RA 1Z4RA 2OZGA 4Y49B 1OZPA 1Z5RA 4KORA 2PSWA 2B3UA 2FVGA 3I1UA 1NSLA 4EVYA 4HKFA 4OC4A 4ZY1A 1S3ZA 2AFXA 2JEWA 4JJXA 4P4DA 4JLYA 1XF8A 2DEAA 4JWPA 1FY7A 4CYPA 3QNVA 2QMLA 2ZPAA 1F57A 4KOVA 4M3SA 2CNMA 4UIAA 1NE9A 5AG6A 2J8NA 3LMSA 2PJBA 1K4JA 3GKRA 1KUVA 1QSRA 4C68A 4MY3A 1LANA 1ARMA 2AFZA 3KGQA 3NH8A 2C1CA 4P4BA 3FB3A 1H8LA 3LACA 1CX8A 4AXVA 5LRJA 1LCPA 2KCWA 2IQ6A 2OH1A 4AB7A 3PB7X 3BI1A 4LX9A 2WPWA 2PVWA 3CT9A 1GHEA 2VI7A 3PZJA 3NFZA 1A2ZA 1MJBA 1FT7A 2D4OA 4Z65A 3D68A 3QB8A 3DSBA 5DWNA 1RXTA 2FIAA 3V38A 2GU2A 2EBJA 2P0WA 2Q4ZA 3EFAA 2Q4VA 2B5GB 4H6ZA 3KZWA 2ZEFA 3H8FA 1Z8LA 4B12A 1Z8XA 2AFSA 2WSAA 3HUVA 1B87A 1CBXA 3PBBA 4JYWA 3PFOA 4M6GA 4KOUA 5CPAA 3TO7A 1TIQA 3E0KA 4MCQA 1U6MA 2VXKA 4KZTA 1CP6A 3LODA 2RB7A 4MCRA 1MJ9A 4NSQA 4R87A 1ZO0A 2REEA 4P4EA 1QSNA 5LRKA 2PJ9A 3VH9A 2VEZA 2PJ3A 4R3LA 4CRYB 3R9FA 4OMEA 2DF5A 2QVPA 3SJXA 1XJOA 2G3AA 4Q36A 4KLWA 2K5TA 4LQGA 2YGWA 1OBRA 2JBKA 2WYRA 2ZEMA 3IO1A 4MHPA 3B3TA 4NGRA 3DNSA 1LRZA 3CZXA 1Y9KA 1YW4A 4MHDA 1ZG8A 4Q7AA 4UFWA 5EBVA 4OLLA 4EWTA 5I0CA 4FBEA 3GB0A 4C7IA 2V77A 3F5BA 1VIXA 1Z8WA 3N7ZA 3B3CA 3GUXA 4FUUA 1S60A 4GXHA 3K2KA 4MCSA 2GIVA 5IX3A 4CGLA 1TF8A 2CNSA 3JTKA 1UFHA 1CPXA 4ZY0A 4MCPA 4UFXA 2B58A 4UA3A 4NGNA 1EE3P 4KVOE 2HB6A 1VHSA 3JVNA 4PSXA 1M1DA 4P44A 2F7VA 1DTDA 2ZW7A 1ZLHA 3KL9A 4FWUA 4KLVA 4MHNA 2B4DB 4R8FA 5D29A 2Q7BA 4B5OA 1IICA 3DDDA 5FVJA 4JZ0A 4F8ZA 3OWCA 5LYIA 3TTHA 4DYOA 3GY9A 1CJWA 2DPSA 4GS4A 5J8CA 4MHYA 4MI4A 4PK2A 4UCNA 1BO4A 2ABZA 1TKFA 3FIXA 1X10A 2PJ0A 5H84A 4R3KA 4C2XA 2Q43A 3T8WA 5HVHA 4ZX9A 1NSAA 2I00A 4B10A 4OIWA 2POKA 2ZEGA 4B14A 4HPSA 5A28A 3D7GA 3LD2A 3R96A 2Q0YA 3RYOA 1XE4A 2GFQA 3FJUA 3PEIA 5K8NA 3CDXA 3JUWA 3FVLA 3IWWA 3R1KA 2EO8A 3B3VA 1F2PA 4MHZA 3JRUA 3KR5A 1YX0A 3DR6A 1BAVA 4GM5A 4B13A 4CAWA 4E2AA 4MMOA 3V7ZA 2V8GA 3IU2A 1RO5A 3P2HA 4ZBGA 2QECA 3D67A 2YNDA 3I3GA 4CYNA 2AE6A 1SQHA 4CYOA 2ANPA 3CPXA 3FRMA 3MN8A 1YVOA 1KUXA
chains in the Genus database with same CATH topology
2JDCA 4XPDB 3K9UA 2Z10A 4A2ZA 2Z3OA 2D4PA 2Z0ZA 2PR1A 2Z3KA 2P6GA 2Q44A 1S7KA 3SHPA 4FD4A 1Z4EA 2IL4A 3CXPA 4K30A 2B5GA 1P0HA 4OAEA 1VKCA 2J8MA 4KS9A 2PC1A 2R1IA 4KSAA 4HNXB 2BEIA 4U9ZA 5G22A 3T9YA 4FD7A 5BWAB 2HV2A 4C7HA 4U9YA 3VWEA 2REFA 4CGOA 4JXRA 4L89A 5F48A 3QAHA 3SXOA 1Z9UA 2ZXVA 4QC6A 3DR8A 3P2FA 1YGHA 2OZHA 2YNCA 4PSWA 2RC4A 3IWEA 4KOSA 4IF5A 2B3VA 4QVTA 4AG7A 4JXQA 1Q2YA 4UCPA 5E96A 4XPLA 2Q4YA 1KZFA 1Q2DA 1WWZA 2R98A 4YGOA 4ORFA 2HUZA 4RS2A 2X7BA 1S7NA 3PP9A 3W6SA 2B4DA 2P6FA 5DWMA 2CY2A 4CAFA 1P4NA 5GCNA 3BJ7A 2I79A 3TT2A 3GYAA 4MFZA 5IB0A 3TE4A 4CAVA 1Q2CA 2WPXA 1IB1E 1WK4A 3EO4A 1XMTA 4Q38A 2ARHA 3CXSA 2OZUA 4KOYA 4H89A 1MJAA 2CNTA 3VWDA 3TOBA 5G21A 5KTDA 2JDDA 4MFLA 4KVME 1M4IA 3PGPA 1L0CA 2JEVA 1S7LA 2GANA 4JD6A 4RI1A 4KOTA 4BBHA 1PUAA 4NEXA 5KTCA 4ZGYB 3F0AA 4IUSA 1BOBA 2PRBA 2WUUA 1I21A 4UWJA 4A30A 5AG4A 2JLMA 2FE7A 1IIDA 4B5PB 4AVCA 3A9LA 2H5MA 5C88A 1S7FA 4PV6A 4AVAA 4I49A 4J3GA 4UWIA 4XNHC 4CGMA 2HQYA 3R95A 2C27A 5G20A 5A27A 2QIRA 4Y49C 3D2MA 4NF1A 5G1ZA 5ISVA 4BMHA 4CGPA 4XPKA 2VQYA 1YVKA 1YLEA 2Z3NA 2FS5A 4KSFA 4MBUA 4F0YA 1CM0A 3G3SA 3D2PA 4L8AA 5CNPA 3C26A 4PK3A 5KTAA 3T90A 3BLNA 1QSOA 4H6UA 3W91A 4U5YA 1M4GA 2P6EA 5AG5A 2PR8A 3I9SA 3S6FA 1XEBA 4XNHB 1I1DA 2NMTA 2GE3A 3CXQA 2Z11A 2OB0A 2Z3PA 1QSTA 2FCKA 2FXFA 3TCVA 4QBJA 5IV0A 1MK4A 2DPTA 4OADA 1YK3A 2OU2A 1I12A 1Y7RA 1Y9WA 4KVXA 4UCMA 3FNCA 3W6XA 2FL4A 4KOWA 2YNCC 2AJ6A 3ZZIA 4AVBA 4A33A 1N71A 2CXAA 3UY5A 1YREA 1M44A 2R7HA 4C2YA 3F8KA 3R9EA 2F5IA 4MJ8A 4DNCA 4A32A 1M4DA 1S5KA 4FD6A 4B11A 4B5PA 1ON0A 2J8RA 3IU1A 2VZYA 4NCZA 3H4QA 5JQ4A 3V8IA 3EXNA 4UFVA 3B8GA 2G3TA 1KUYA 4QB9A 5F49A 2FIWA 4CYQA 4MFKA 5H86A 4KOXA 5F47A 3FYNA 2YNEA 3IWGA 4CAXA 2VZZA 4A31A 2PDOA 5HH1A 3R9GA 4CGNA 4A95A 3S6KA 3FXTA 2PQ8A 3G8WA 5F46A 3TOAA 3H5ZA 2EUIA 4X5KA 2FT0A 3TFYA 4ONUA 3TO6A 2Z3LA 3KKWA 4F0XA 4CS0B 4AG9A 3D8PA 4XPDC 2Q04A 4CRZB 1IYKA 2VBQA 1YR0A 4NXYA 2Z3MA 4CAEA 5C82A 4C2ZA 3IGRA 2BUEA 5HMNA 5JPHA 4YFJA 5EC4A 4E0AA 3TO9A 3MGDA 2ZW6A 2Y0MA 4MFQA 4F6AA 4MFPA 2ZW4A 2G0BA 4YRHA 5AGEA 3S6HA 2A4NA 1QSMA 4HNYB 2O28A 3S6GA 4MY0A 4II9A 1R57A 4QUSA 3WR7A 4KUBA 4M85A 1J4JA 2DXQA 2EVNA 1B6BA 2BSWA 4MFJA 5AG7A 4KUAA 4FD5A 3D3SA 2ATRA 2BL1A 2R8VA 3NE7A 2ZW5A 5J8FA 2B4BA 3SXNA 3ZJ0A 4HNWB 1NMTA 3BJ8A 4R9MA 4LUAA 3FBUA 4E8OA 1IYLA 4UBRA 1XIXA 1PU9A 3EC4A 1V0CA 2FSRA 3EY5A 4R57A 1Z4RA 2OZGA 4Y49B 1OZPA 4KORA 2PSWA 2B3UA 1NSLA 4EVYA 4HKFA 1S3ZA 4JJXA 4JLYA 1XF8A 4JWPA 1FY7A 4CYPA 2QMLA 2ZPAA 4KOVA 4M3SA 2CNMA 1NE9A 5AG6A 2J8NA 1K4JA 3GKRA 1KUVA 1QSRA 4C68A 4MY3A 3FB3A 2KCWA 2OH1A 4AB7A 4LX9A 2WPWA 3PZJA 1GHEA 2VI7A 1MJBA 2D4OA 3QB8A 3DSBA 5DWNA 1RXTA 2FIAA 2P0WA 3EFAA 2Q4VA 2B5GB 4H6ZA 4B12A 2WSAA 1B87A 3TO7A 4KOUA 1TIQA 3E0KA 1U6MA 2VXKA 4KZTA 3LODA 4NSQA 4R87A 1MJ9A 1ZO0A 2REEA 1QSNA 2VEZA 4R3LA 4CRYB 3R9FA 2G3AA 4Q36A 4KLWA 2K5TA 2YGWA 3DNSA 1LRZA 1Y9KA 5EBVA 4MHDA 4UFWA 5I0CA 4OLLA 4C7IA 3F5BA 3N7ZA 1S60A 2GIVA 5IX3A 4CGLA 2CNSA 3JTKA 1UFHA 4UFXA 2B58A 4UA3A 4KVOE 1VHSA 3JVNA 4PSXA 1M1DA 2ZW7A 4KLVA 2B4DB 2Q7BA 4B5OA 1IICA 3DDDA 5FVJA 3OWCA 3TTHA 3GY9A 1CJWA 2DPSA 4GS4A 5J8CA 4PK2A 4MI4A 4UCNA 1BO4A 3FIXA 5H84A 4R3KA 4C2XA 4B10A 2I00A 4B14A 5A28A 3LD2A 3R96A 2Q0YA 3RYOA 1XE4A 3JUWA 3R1KA 1YX0A 3DR6A 4CAWA 4B13A 4E2AA 3IU2A 1RO5A 3P2HA 4ZBGA 2QECA 2YNDA 3I3GA 4CYNA 2AE6A 1SQHA 4CYOA 3FRMA 1YVOA 1KUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BWA B;  4ZGY B;  1ZO0 A; 
#chains in the Genus database with same CATH topology
 4WJB A;  3IJ3 A;  1BPN A;  2CTC A;  2ZOG A;  4OC3 A;  3SJF A;  2JDC A;  3H8G A;  4XPD B;  3K9U A;  1HDQ A;  4H2K A;  2Z10 A;  4A2Z A;  2Z3O A;  2D4P A;  2Z0Z A;  3FEC A;  2PR1 A;  2Z3K A;  2P6G A;  4NGP A;  2Q44 A;  5I4M A;  4EFD A;  1S7K A;  3SHP A;  4FD4 A;  3BI0 A;  1Z4E A;  4X2T A;  3SI2 A;  1Y7E A;  2IL4 A;  3CXP A;  4K30 A;  2B5G A;  4MRI A;  4OC0 A;  1IGB A;  4P4I A;  6CPA A;  1P0H A;  4OAE A;  1VKC A;  2J8M A;  4KS9 A;  5K8O A;  2EWB A;  2PJ7 A;  2ZEE A;  2PC1 A;  2PJA A;  2XEG A;  4UEZ A;  2R1I A;  4KSA A;  1QQ9 A;  4HNX B;  5THW A;  2BEI A;  4U9Z A;  5G22 A;  1F2O A;  3T9Y A;  1Y0Y A;  3FMC A;  4FD7 A;  2HV2 A;  4YU9 A;  5BWA B;  4C7H A;  4U9Y A;  3KI9 A;  2J9A A;  3VWE A;  2REF A;  3RAM A;  4CGO A;  4JXR A;  4L89 A;  5F48 A;  2V8D A;  3QAH A;  3SXO A;  1GYT A;  1YW6 A;  1Z9U A;  2C6G A;  1UWY A;  2ZXV A;  4QC6 A;  3DR8 A;  3D66 A;  3P2F A;  1YGH A;  3D7H A;  2QJ8 A;  2OZH A;  2AFO A;  2YNC A;  4PSW A;  2RC4 A;  4A94 A;  3IWE A;  4NJQ A;  3L2N A;  3PRT A;  3WC6 A;  4KOS A;  4IF5 A;  2B3V A;  4QVT A;  3D7F A;  4ZY2 A;  2GRE A;  1FNO A;  5HVF A;  1Q7L A;  4AG7 A;  4ZYQ A;  2Q7S A;  4JXQ A;  1Q2Y A;  4UCP A;  5E96 A;  4XPL A;  3SJE A;  2Q4Y A;  1KZF A;  3S9M A;  1AYE A;  4RN7 A;  1Q2D A;  1WWZ A;  2R98 A;  3N5F A;  4YGO A;  4NGQ A;  1AUG A;  3IEH A;  4ORF A;  2HUZ A;  4RS2 A;  2X7B A;  1S7N A;  3WC7 A;  3PP9 A;  1X12 A;  2B4D A;  3W6S A;  4DJL A;  2P6F A;  5DWM A;  2CY2 A;  4CAF A;  3H8E A;  1P4N A;  2PJ5 A;  5GCN A;  2GLF A;  3BJ7 A;  4CPA A;  4ZI6 A;  1LAM A;  4WWV A;  2I79 A;  3TT2 A;  1QMU A;  4EME A;  3GYA A;  3RZA A;  4MFZ A;  3D7D A;  4TWE A;  5IB0 A;  1DE4 C;  1PYT B;  2C6C A;  4MXU A;  3TE4 A;  4R6T A;  2F8H A;  4CAV A;  1Q2C A;  3PB9 X;  3IC1 A;  2WPX A;  4IAV A;  4UEE A;  3S9N A;  3FX6 A;  4TNU A;  5IB9 A;  1IB1 E;  1WK4 A;  3EO4 A;  1XMT A;  4Q38 A;  3GLJ A;  4P10 A;  1BPM A;  2ARH A;  2RFH A;  3CXS A;  7CPA A;  2XEJ A;  2OZU A;  4KOY A;  2CF4 A;  4H89 A;  1MJA A;  2CNT A;  3VWD A;  3TOB A;  5G21 A;  4P45 A;  5KTD A;  4W9Y A;  2JDD A;  4MFL A;  4ZX8 A;  4KVM E;  3B2Y A;  2PJ6 A;  1M4I A;  1AMP A;  3PGP A;  2JEV A;  1L0C A;  1S7L A;  5DS0 A;  1ELM P;  2GAN A;  4JD6 A;  4RI1 A;  4KOT A;  4BBH A;  1PUA A;  4NEX A;  5KTC A;  1RTQ A;  4ZGY B;  1IOF A;  1IU8 A;  3F0A A;  4IUS A;  3D4U A;  4PPZ A;  1BOB A;  2PRB A;  2PJ1 A;  1I21 A;  2WUU A;  4O23 A;  4UWJ A;  4G1P A;  4A30 A;  5AG4 A;  2VL1 A;  2JLM A;  2FE7 A;  1IID A;  4B5P B;  3BXM A;  4NGM A;  2PIZ A;  1XMB A;  3A9L A;  3B3W A;  4AVC A;  2H5M A;  5C88 A;  2BOA A;  3RNZ A;  2PRQ A;  1S7F A;  8CPA A;  3FF3 A;  4NJR A;  2EK9 A;  4A39 A;  5JH9 A;  4PV6 A;  1PCA A;  5K8P A;  3TC8 A;  4AVA A;  4I49 A;  4J3G A;  4UWI A;  4XNH C;  4CGM A;  2HQY A;  1YSJ A;  1CG2 A;  3QAY A;  5K8M A;  3R95 A;  2C27 A;  5G20 A;  3RO0 A;  3TX8 A;  4YWY A;  5A27 A;  2QIR A;  4Y49 C;  3FED A;  3D2M A;  3FEE A;  3CPA A;  4NF1 A;  2Q51 A;  2PVV A;  5G1Z A;  2NSM A;  4OC5 A;  5ISV A;  2CTB A;  1ZLI A;  4BMH A;  2PE3 A;  4CGP A;  4XPK A;  1XRY A;  2CIJ A;  4BIN A;  2VQY A;  1YME A;  1YLE A;  1JWQ A;  1YVK A;  2FS5 A;  2Z3N A;  4KSF A;  4MBU A;  5D8N A;  4F0Y A;  3S9L A;  1CM0 A;  3VAR A;  3G3S A;  3D2P A;  3RBU A;  4L8A A;  5CNP A;  2PIY A;  2ZOF A;  3C26 A;  4PK3 A;  5KTA A;  3PFE A;  3T90 A;  3BLN A;  1QSO A;  4H6U A;  3W91 A;  1TXR A;  3KAS A;  4FAI A;  4A38 A;  5F09 A;  3LWU A;  4U5Y A;  3WAB A;  1M4G A;  2P6E A;  5AG5 A;  4BD9 A;  2PR8 A;  3I9S A;  3S6F A;  1XEB A;  4LQ6 A;  4XNH B;  1I1D A;  1TF9 A;  2AFU A;  4OC2 A;  2NMT A;  4NFR A;  3FH4 A;  2GE3 A;  3CXQ A;  2Z11 A;  1HDU A;  1Z8T A;  2OB0 A;  2V8V A;  4PXD A;  2OOT A;  3PB8 X;  5HXD A;  4ONW A;  2Z3P A;  3MRU A;  2O53 A;  1R43 A;  1QST A;  3SJG A;  2FCK A;  2FXF A;  3TCV A;  4QBJ A;  5IV0 A;  4P6Y A;  1XOV A;  1M4L A;  1MK4 A;  2DPT A;  2HC9 A;  1YK3 A;  2OU2 A;  4OAD A;  4OP4 A;  1I12 A;  1Y7R A;  1Y9W A;  4M6H A;  4KVX A;  5LRG A;  4UCM A;  3FNC A;  3NA6 A;  3W6X A;  2ZEP A;  4P4J A;  5EMI A;  2FL4 A;  3KHZ A;  3GIU A;  3ISX A;  3B35 A;  4KOW A;  1ZG9 A;  2AJ6 A;  2YNC C;  3DGV A;  3KQX A;  2XEF A;  3ZZI A;  4AVB A;  4A33 A;  1N71 A;  2CXA A;  2ODF A;  1YRE A;  3UY5 A;  4RUH A;  1M44 A;  4IHM A;  2R7H A;  4C2Y A;  3IFE A;  1VHE A;  3WC5 A;  4K3N A;  3F8K A;  2I3C A;  3R9E A;  2F5I A;  3WT4 A;  1TKH A;  3BHX A;  4MJ8 A;  1CPS A;  2IJZ A;  2PJ2 A;  4DNC A;  2G9D A;  4A32 A;  5LYL A;  1M4D A;  1S5K A;  1LOK A;  4FD6 A;  1ZG7 A;  4B11 A;  4B5P A;  1ON0 A;  2J8R A;  2ZEH A;  2VZY A;  2BCO A;  2PJ8 A;  3IU1 A;  3KHX A;  1ELL P;  3H4Q A;  4NCZ A;  5JQ4 A;  5LYD A;  3V8I A;  3EXN A;  1IOI A;  3K9T A;  4UFV A;  4UIB A;  2XEI A;  3KQZ A;  2ZEO A;  3PB6 X;  3B8G A;  2C6P A;  1ARL A;  3HLP A;  4DUK A;  2G3T A;  1KUY A;  1Z2L A;  3IIB A;  4QB9 A;  4UEF A;  5F49 A;  2ZEL A;  2FIW A;  4CYQ A;  4MFK A;  5H86 A;  1XBU A;  4KOX A;  5F47 A;  1JQG A;  4NGT A;  3DLJ A;  2QYV A;  3FYN A;  2GLJ A;  2YNE A;  3IWG A;  4IK2 A;  4M6I A;  3PBE A;  4CAX A;  1CP7 A;  2VZZ A;  2ZEN A;  4A31 A;  2PDO A;  5HH1 A;  3R9G A;  1VGY A;  4OID A;  4F9U A;  4CGN A;  1XFO A;  3KR4 A;  4A95 A;  3NH5 A;  3S6K A;  1LFW A;  4R7M A;  3FXT A;  3PB4 X;  2PQ8 A;  3G8W A;  3VAT A;  5J1Q A;  5F46 A;  3TOA A;  1IY7 A;  3H5Z A;  2EUI A;  4X5K A;  2FT0 A;  4P4F A;  3TFY A;  4ONU A;  4PQA A;  4PXE A;  3TO6 A;  2Z3L A;  2BO9 A;  3KKW A;  4PXC A;  4B6Z A;  1TKJ A;  4F0X A;  4CS0 B;  4AG9 A;  3D8P A;  4XPD C;  2Q04 A;  4OKO A;  4CRZ B;  2V8H A;  1IYK A;  2VBQ A;  1YR0 A;  4KSI A;  2Z3M A;  4NXY A;  4CAE A;  3NH4 A;  2AFW A;  4C2Z A;  5C82 A;  3IGR A;  2PJC A;  5HVG A;  2BUE A;  2JBJ A;  5HMN A;  5JPH A;  4YFJ A;  3B7I A;  4NGS A;  2OR4 A;  3SI0 A;  4PXB A;  2PCU A;  4X8I A;  1KWM A;  5EC4 A;  4A37 A;  3TO9 A;  4E0A A;  3SI1 A;  4F9V A;  3MGD A;  2ZW6 A;  2Y0M A;  4MFQ A;  4F6A A;  4MFP A;  1Y0R A;  2ZW4 A;  5LYF A;  2G0B A;  3NE8 A;  2EK8 A;  4R76 A;  4YRH A;  5AGE A;  3S6H A;  2IMO A;  4UF4 A;  2A4N A;  5ELY A;  1QSM A;  4HNY B;  2O28 A;  3S6G A;  2ZED A;  1BLL E;  2WZN A;  4MY0 A;  4OC1 A;  2O4H A;  4II9 A;  1R57 A;  4QUS A;  3WR7 A;  3ISZ A;  4KUB A;  4M85 A;  1J4J A;  5JGF A;  2AFM A;  2DXQ A;  1B6B A;  2BSW A;  2EVN A;  4MFJ A;  4KUA A;  4FD5 A;  5AG7 A;  5JM6 A;  3D3S A;  2ATR A;  1VHO A;  2BL1 A;  2R8V A;  1HEE A;  3NE7 A;  2ZW5 A;  3B3S A;  2B4B A;  3SXN A;  5J8F A;  3ZJ0 A;  2PJ4 A;  4HNW B;  1NMT A;  3BJ8 A;  4R9M A;  1YLO A;  4LUA A;  1R3N A;  3FBU A;  4E8O A;  1IYL A;  2NYQ A;  4UBR A;  1XIX A;  1PU9 A;  3EC4 A;  1V0C A;  2FSR A;  5CBM A;  1LAP A;  3EY5 A;  4R57 A;  1YQE A;  4X3R A;  1Z4R A;  2OZG A;  4Y49 B;  1OZP A;  1Z5R A;  4KOR A;  2PSW A;  2B3U A;  2FVG A;  3I1U A;  1NSL A;  4EVY A;  4HKF A;  4OC4 A;  4ZY1 A;  1S3Z A;  2AFX A;  2JEW A;  4JJX A;  4P4D A;  4JLY A;  1XF8 A;  2DEA A;  4JWP A;  1FY7 A;  4CYP A;  3QNV A;  2QML A;  2ZPA A;  1F57 A;  4KOV A;  4M3S A;  2CNM A;  4UIA A;  1NE9 A;  5AG6 A;  2J8N A;  3LMS A;  2PJB A;  1K4J A;  3GKR A;  1KUV A;  1QSR A;  4C68 A;  4MY3 A;  1LAN A;  1ARM A;  2AFZ A;  3KGQ A;  3NH8 A;  2C1C A;  4P4B A;  3FB3 A;  1H8L A;  3LAC A;  1CX8 A;  4AXV A;  5LRJ A;  1LCP A;  2KCW A;  2IQ6 A;  2OH1 A;  4AB7 A;  3PB7 X;  3BI1 A;  4LX9 A;  2WPW A;  2PVW A;  3CT9 A;  1GHE A;  2VI7 A;  3PZJ A;  3NFZ A;  1A2Z A;  1MJB A;  1FT7 A;  2D4O A;  4Z65 A;  3D68 A;  3QB8 A;  3DSB A;  5DWN A;  1RXT A;  2FIA A;  3V38 A;  2GU2 A;  2EBJ A;  2P0W A;  2Q4Z A;  3EFA A;  2Q4V A;  2B5G B;  4H6Z A;  3KZW A;  2ZEF A;  3H8F A;  1Z8L A;  4B12 A;  1Z8X A;  2AFS A;  2WSA A;  3HUV A;  1B87 A;  1CBX A;  3PBB A;  4JYW A;  3PFO A;  4M6G A;  4KOU A;  5CPA A;  3TO7 A;  1TIQ A;  3E0K A;  4MCQ A;  1U6M A;  2VXK A;  4KZT A;  1CP6 A;  3LOD A;  2RB7 A;  4MCR A;  1MJ9 A;  4NSQ A;  4R87 A;  1ZO0 A;  2REE A;  4P4E A;  1QSN A;  5LRK A;  2PJ9 A;  3VH9 A;  2VEZ A;  2PJ3 A;  4R3L A;  4CRY B;  3R9F A;  4OME A;  2DF5 A;  2QVP A;  3SJX A;  1XJO A;  2G3A A;  4Q36 A;  4KLW A;  2K5T A;  4LQG A;  2YGW A;  1OBR A;  2JBK A;  2WYR A;  2ZEM A;  3IO1 A;  4MHP A;  3B3T A;  4NGR A;  3DNS A;  1LRZ A;  3CZX A;  1Y9K A;  1YW4 A;  4MHD A;  1ZG8 A;  4Q7A A;  4UFW A;  5EBV A;  4OLL A;  4EWT A;  5I0C A;  4FBE A;  3GB0 A;  4C7I A;  2V77 A;  3F5B A;  1VIX A;  1Z8W A;  3N7Z A;  3B3C A;  3GUX A;  4FUU A;  1S60 A;  4GXH A;  3K2K A;  4MCS A;  2GIV A;  5IX3 A;  4CGL A;  1TF8 A;  2CNS A;  3JTK A;  1UFH A;  1CPX A;  4ZY0 A;  4MCP A;  4UFX A;  2B58 A;  4UA3 A;  4NGN A;  1EE3 P;  4KVO E;  2HB6 A;  1VHS A;  3JVN A;  4PSX A;  1M1D A;  4P44 A;  2F7V A;  1DTD A;  2ZW7 A;  1ZLH A;  3KL9 A;  4FWU A;  4KLV A;  4MHN A;  2B4D B;  4R8F A;  5D29 A;  2Q7B A;  4B5O A;  1IIC A;  3DDD A;  5FVJ A;  4JZ0 A;  4F8Z A;  3OWC A;  5LYI A;  3TTH A;  4DYO A;  3GY9 A;  1CJW A;  2DPS A;  4GS4 A;  5J8C A;  4MHY A;  4MI4 A;  4PK2 A;  4UCN A;  1BO4 A;  2ABZ A;  1TKF A;  3FIX A;  1X10 A;  2PJ0 A;  5H84 A;  4R3K A;  4C2X A;  2Q43 A;  3T8W A;  5HVH A;  4ZX9 A;  1NSA A;  2I00 A;  4B10 A;  4OIW A;  2POK A;  2ZEG A;  4B14 A;  4HPS A;  5A28 A;  3D7G A;  3LD2 A;  3R96 A;  2Q0Y A;  3RYO A;  1XE4 A;  2GFQ A;  3FJU A;  3PEI A;  5K8N A;  3CDX A;  3JUW A;  3FVL A;  3IWW A;  3R1K A;  2EO8 A;  3B3V A;  1F2P A;  4MHZ A;  3JRU A;  3KR5 A;  1YX0 A;  3DR6 A;  1BAV A;  4GM5 A;  4B13 A;  4CAW A;  4E2A A;  4MMO A;  3V7Z A;  2V8G A;  3IU2 A;  1RO5 A;  3P2H A;  4ZBG A;  2QEC A;  3D67 A;  2YND A;  3I3G A;  4CYN A;  2AE6 A;  1SQH A;  4CYO A;  2ANP A;  3CPX A;  3FRM A;  3MN8 A;  1YVO A;  1KUX A; 
#chains in the Genus database with same CATH homology
 2JDC A;  4XPD B;  3K9U A;  2Z10 A;  4A2Z A;  2Z3O A;  2D4P A;  2Z0Z A;  2PR1 A;  2Z3K A;  2P6G A;  2Q44 A;  1S7K A;  3SHP A;  4FD4 A;  1Z4E A;  2IL4 A;  3CXP A;  4K30 A;  2B5G A;  1P0H A;  4OAE A;  1VKC A;  2J8M A;  4KS9 A;  2PC1 A;  2R1I A;  4KSA A;  4HNX B;  2BEI A;  4U9Z A;  5G22 A;  3T9Y A;  4FD7 A;  5BWA B;  2HV2 A;  4C7H A;  4U9Y A;  3VWE A;  2REF A;  4CGO A;  4JXR A;  4L89 A;  5F48 A;  3QAH A;  3SXO A;  1Z9U A;  2ZXV A;  4QC6 A;  3DR8 A;  3P2F A;  1YGH A;  2OZH A;  2YNC A;  4PSW A;  2RC4 A;  3IWE A;  4KOS A;  4IF5 A;  2B3V A;  4QVT A;  4AG7 A;  4JXQ A;  1Q2Y A;  4UCP A;  5E96 A;  4XPL A;  2Q4Y A;  1KZF A;  1Q2D A;  1WWZ A;  2R98 A;  4YGO A;  4ORF A;  2HUZ A;  4RS2 A;  2X7B A;  1S7N A;  3PP9 A;  3W6S A;  2B4D A;  2P6F A;  5DWM A;  2CY2 A;  4CAF A;  1P4N A;  5GCN A;  3BJ7 A;  2I79 A;  3TT2 A;  3GYA A;  4MFZ A;  5IB0 A;  3TE4 A;  4CAV A;  1Q2C A;  2WPX A;  1IB1 E;  1WK4 A;  3EO4 A;  1XMT A;  4Q38 A;  2ARH A;  3CXS A;  2OZU A;  4KOY A;  4H89 A;  1MJA A;  2CNT A;  3VWD A;  3TOB A;  5G21 A;  5KTD A;  2JDD A;  4MFL A;  4KVM E;  1M4I A;  3PGP A;  1L0C A;  2JEV A;  1S7L A;  2GAN A;  4JD6 A;  4RI1 A;  4KOT A;  4BBH A;  1PUA A;  4NEX A;  5KTC A;  4ZGY B;  3F0A A;  4IUS A;  1BOB A;  2PRB A;  2WUU A;  1I21 A;  4UWJ A;  4A30 A;  5AG4 A;  2JLM A;  2FE7 A;  1IID A;  4B5P B;  4AVC A;  3A9L A;  2H5M A;  5C88 A;  1S7F A;  4PV6 A;  4AVA A;  4I49 A;  4J3G A;  4UWI A;  4XNH C;  4CGM A;  2HQY A;  3R95 A;  2C27 A;  5G20 A;  5A27 A;  2QIR A;  4Y49 C;  3D2M A;  4NF1 A;  5G1Z A;  5ISV A;  4BMH A;  4CGP A;  4XPK A;  2VQY A;  1YVK A;  1YLE A;  2Z3N A;  2FS5 A;  4KSF A;  4MBU A;  4F0Y A;  1CM0 A;  3G3S A;  3D2P A;  4L8A A;  5CNP A;  3C26 A;  4PK3 A;  5KTA A;  3T90 A;  3BLN A;  1QSO A;  4H6U A;  3W91 A;  4U5Y A;  1M4G A;  2P6E A;  5AG5 A;  2PR8 A;  3I9S A;  3S6F A;  1XEB A;  4XNH B;  1I1D A;  2NMT A;  2GE3 A;  3CXQ A;  2Z11 A;  2OB0 A;  2Z3P A;  1QST A;  2FCK A;  2FXF A;  3TCV A;  4QBJ A;  5IV0 A;  1MK4 A;  2DPT A;  4OAD A;  1YK3 A;  2OU2 A;  1I12 A;  1Y7R A;  1Y9W A;  4KVX A;  4UCM A;  3FNC A;  3W6X A;  2FL4 A;  4KOW A;  2YNC C;  2AJ6 A;  3ZZI A;  4AVB A;  4A33 A;  1N71 A;  2CXA A;  3UY5 A;  1YRE A;  1M44 A;  2R7H A;  4C2Y A;  3F8K A;  3R9E A;  2F5I A;  4MJ8 A;  4DNC A;  4A32 A;  1M4D A;  1S5K A;  4FD6 A;  4B11 A;  4B5P A;  1ON0 A;  2J8R A;  3IU1 A;  2VZY A;  4NCZ A;  3H4Q A;  5JQ4 A;  3V8I A;  3EXN A;  4UFV A;  3B8G A;  2G3T A;  1KUY A;  4QB9 A;  5F49 A;  2FIW A;  4CYQ A;  4MFK A;  5H86 A;  4KOX A;  5F47 A;  3FYN A;  2YNE A;  3IWG A;  4CAX A;  2VZZ A;  4A31 A;  2PDO A;  5HH1 A;  3R9G A;  4CGN A;  4A95 A;  3S6K A;  3FXT A;  2PQ8 A;  3G8W A;  5F46 A;  3TOA A;  3H5Z A;  2EUI A;  4X5K A;  2FT0 A;  3TFY A;  4ONU A;  3TO6 A;  2Z3L A;  3KKW A;  4F0X A;  4CS0 B;  4AG9 A;  3D8P A;  4XPD C;  2Q04 A;  4CRZ B;  1IYK A;  2VBQ A;  1YR0 A;  4NXY A;  2Z3M A;  4CAE A;  5C82 A;  4C2Z A;  3IGR A;  2BUE A;  5HMN A;  5JPH A;  4YFJ A;  5EC4 A;  4E0A A;  3TO9 A;  3MGD A;  2ZW6 A;  2Y0M A;  4MFQ A;  4F6A A;  4MFP A;  2ZW4 A;  2G0B A;  4YRH A;  5AGE A;  3S6H A;  2A4N A;  1QSM A;  4HNY B;  2O28 A;  3S6G A;  4MY0 A;  4II9 A;  1R57 A;  4QUS A;  3WR7 A;  4KUB A;  4M85 A;  1J4J A;  2DXQ A;  2EVN A;  1B6B A;  2BSW A;  4MFJ A;  5AG7 A;  4KUA A;  4FD5 A;  3D3S A;  2ATR A;  2BL1 A;  2R8V A;  3NE7 A;  2ZW5 A;  5J8F A;  2B4B A;  3SXN A;  3ZJ0 A;  4HNW B;  1NMT A;  3BJ8 A;  4R9M A;  4LUA A;  3FBU A;  4E8O A;  1IYL A;  4UBR A;  1XIX A;  1PU9 A;  3EC4 A;  1V0C A;  2FSR A;  3EY5 A;  4R57 A;  1Z4R A;  2OZG A;  4Y49 B;  1OZP A;  4KOR A;  2PSW A;  2B3U A;  1NSL A;  4EVY A;  4HKF A;  1S3Z A;  4JJX A;  4JLY A;  1XF8 A;  4JWP A;  1FY7 A;  4CYP A;  2QML A;  2ZPA A;  4KOV A;  4M3S A;  2CNM A;  1NE9 A;  5AG6 A;  2J8N A;  1K4J A;  3GKR A;  1KUV A;  1QSR A;  4C68 A;  4MY3 A;  3FB3 A;  2KCW A;  2OH1 A;  4AB7 A;  4LX9 A;  2WPW A;  3PZJ A;  1GHE A;  2VI7 A;  1MJB A;  2D4O A;  3QB8 A;  3DSB A;  5DWN A;  1RXT A;  2FIA A;  2P0W A;  3EFA A;  2Q4V A;  2B5G B;  4H6Z A;  4B12 A;  2WSA A;  1B87 A;  3TO7 A;  4KOU A;  1TIQ A;  3E0K A;  1U6M A;  2VXK A;  4KZT A;  3LOD A;  4NSQ A;  4R87 A;  1MJ9 A;  1ZO0 A;  2REE A;  1QSN A;  2VEZ A;  4R3L A;  4CRY B;  3R9F A;  2G3A A;  4Q36 A;  4KLW A;  2K5T A;  2YGW A;  3DNS A;  1LRZ A;  1Y9K A;  5EBV A;  4MHD A;  4UFW A;  5I0C A;  4OLL A;  4C7I A;  3F5B A;  3N7Z A;  1S60 A;  2GIV A;  5IX3 A;  4CGL A;  2CNS A;  3JTK A;  1UFH A;  4UFX A;  2B58 A;  4UA3 A;  4KVO E;  1VHS A;  3JVN A;  4PSX A;  1M1D A;  2ZW7 A;  4KLV A;  2B4D B;  2Q7B A;  4B5O A;  1IIC A;  3DDD A;  5FVJ A;  3OWC A;  3TTH A;  3GY9 A;  1CJW A;  2DPS A;  4GS4 A;  5J8C A;  4PK2 A;  4MI4 A;  4UCN A;  1BO4 A;  3FIX A;  5H84 A;  4R3K A;  4C2X A;  4B10 A;  2I00 A;  4B14 A;  5A28 A;  3LD2 A;  3R96 A;  2Q0Y A;  3RYO A;  1XE4 A;  3JUW A;  3R1K A;  1YX0 A;  3DR6 A;  4CAW A;  4B13 A;  4E2A A;  3IU2 A;  1RO5 A;  3P2H A;  4ZBG A;  2QEC A;  2YND A;  3I3G A;  4CYN A;  2AE6 A;  1SQH A;  4CYO A;  3FRM A;  1YVO A;  1KUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...