5BWAB

Crystal structure of odc-plp-az1 ternary complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
127
structure length
121
Chain Sequence
NLFYSDDRLNVTEEDKTRILNVQSRLTDAKRINWRTVLSGGSLYIEIPGGALPEGSKDSFAVLLEFAEEQLRADHVFICFHKNREDRAALLRTFSFLGFEIVRPGHPLVRPDACFMAYTFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/lyase inhibitor
molecule keywords Ornithine decarboxylase
publication title Structural basis of Ornithine Decarboxylase inactivation and accelerated degradation by polyamine sensor Antizyme1
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 121
sequence length 127
ec nomenclature
pdb deposition date 2015-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02100 ODC_AZ Ornithine decarboxylase antizyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.60 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5bwaB00
1ZO0A 4ZGYB 5BWAB
chains in the Genus database with same CATH superfamily
5AG6A 2IMOA 2QVPA 4LQGA 4UWIA 2J9AA 2PJ0A 3KGQA 4UFVA 3LD2A 3P2HA 4YU9A 4BBHA 1IIDA 2ABZA 2CNSA 3DGVA 3KQXA 2POKA 2I3CA 3FRMA 2NSMA 1X12A 1S5KA 2PC1A 1HEEA 1Y7RA 2JDDA 4R9MA 1Z8XA 3BJ8A 4L8AA 4Q36A 3D7GA 4MFPA 1FY7A 2ZEMA 5IB9A 2OZHA 4OC0A 1MJBA 1TKFA 1S7LA 4UIBA 1IYLA 3TO9A 3VH9A 4KSIA 1ZG9A 4UA3A 4H6UA 2PJ5A 4NEXA 3MN8A 2P6FA 4F0YA 1I1DA 3CXSA 4IAVA 1CPXA 4R7MA 3D7DA 4I49A 4PPZA 4TWEA 4NCZA 1IICA 4EMEA 4P4FA 3FYNA 4JXRA 5JM6A 1M1DA 1PU9A 3LACA 2ZOFA 2J8NA 4A38A 3KZWA 1BLLE 2GANA 4Z65A 3KASA 3PZJA 2F5IA 4QUSA 3W6SA 3NH5A 4UCMA 4UF4A 2NMTA 4CGPA 4OADA 4ZI6A 5AG4A 3B3SA 4ZYQA 1M4GA 2ATRA 3GYAA 1VKCA 5H84A 2Q51A 4NJRA 2I00A 1IB1E 2XEGA 3GUXA 4JYWA 2ZEFA 4NXYA 4MMOA 2CY2A 4CAFA 4E2AA 5ISVA 3QB8A 2B5GB 2VXKA 1YGHA 2WZNA 3E0KA 4K30A 5AGEA 5HVGA 2Z10A 3I9SA 4JXQA 1LANA 1CP7A 1P4NA 1UWYA 4P4EA 3FH4A 4BD9A 1XIXA 1BAVA 2FIWA 3D68A 4LUAA 4OIDA 3H8GA 3K2KA 2QECA 3KR5A 4QVTA 5I0CA 2YNEA 3C26A 3D3SA 3R9GA 2HUZA 4KUAA 1CBXA 3PBBA 2WUUA 2BUEA 2ZEOA 4OIWA 4C2YA 3B8GA 2OU2A 2CXAA 1QQ9A 1Z5RA 2GE3A 4R8FA 1YX0A 4R76A 3DSBA 4XPDB 3WC6A 3IWWA 1VIXA 4X5KA 1NSLA 2PVWA 3SI1A 5JQ4A 3FBUA 5F09A 5EC4A 4P4JA 1IGBA 3IC1A 2OH1A 4J3GA 4KS9A 4XNHC 1WWZA 4LX9A 3VARA 4OC5A 4MFJA 5BWAB 3PB6X 3N5FA 4PXCA 1XMTA 2ZOGA 3SXOA 4R57A 1CX8A 4MHPA 4IF5A 3BI0A 5G21A 4QB9A 3ISZA 2AE6A 4QC6A 2BEIA 2RFHA 1CP6A 4NJQA 4M6IA 4X3RA 2C1CA 2VQYA 4HNYB 2B4DA 5K8PA 4AVCA 4BINA 2ZW7A 3SI2A 1NE9A 4ORFA 3PRTA 4CAEA 4B10A 1TXRA 2B58A 2GREA 3EFAA 3NE7A 1QMUA 4FAIA 2Z3NA 1GHEA 3B2YA 4X8IA 2J8MA 1M44A 3D2MA 1ARMA 2BSWA 3FVLA 4NFRA 1KUVA 2VBQA 1ARLA 1IOIA 4B11A 1Z8WA 2IJZA 1Q2CA 3GB0A 2WPXA 1YSJA 2R1IA 1MK4A 1XBUA 3IIBA 3WC5A 3BXMA 4AVAA 4C2ZA 1IOFA 3EXNA 3VWDA 3F0AA 3V7ZA 5HMNA 2J8RA 2O53A 3CXPA 1Q2YA 2K5TA 3TT2A 1M4IA 4NGPA 1TF8A 1NMTA 4FD6A 4MJ8A 4MCSA 1B87A 3NFZA 1YLEA 4OKOA 3W6XA 2ZEEA 3UY5A 1YREA 3WR7A 2GLJA 3SI0A 1AYEA 1S60A 4NSQA 4MFLA 2PJ9A 3VWEA 4YRHA 1XF8A 3R95A 4UEZA 2PCUA 1UFHA 4Q7AA 3R96A 3DR6A 1Z8TA 3PEIA 1YW4A 2WPWA 3D66A 4MI4A 2G3AA 2ZEPA 4KVOE 3T8WA 4C2XA 2YNDA 4A95A 4PSWA 1VHSA 2O28A 4IUSA 3H8EA 2EVNA 2PR1A 4U9ZA 2PSWA 5C88A 4NGMA 4AB7A 1PCAA 6CPAA 3EC4A 2HC9A 1YW6A 4F9UA 3FEEA 5KTCA 4CS0B 1HDUA 1KUYA 1R43A 4QBJA 3GIUA 3D8PA 1QSTA 2CNTA 4NF1A 5GCNA 4HKFA 4OC1A 4ZGYB 2AFUA 3CDXA 3PB4X 2B4DB 4F8ZA 4YFJA 1FT7A 4OAEA 1XE4A 2REFA 2JLMA 4F0XA 5DS0A 2PIZA 4UWJA 5J8CA 5J1QA 3HUVA 3G3SA 4FUUA 5LYFA 1TKJA 3ISXA 1YVOA 4CRZB 1KUXA 1ELMP 4XNHB 3CT9A 4II9A 4B14A 4C7HA 5CPAA 4K3NA 2C6PA 4P4IA 1KWMA 4UCNA 3IU1A 1J4JA 3PB7X 2JBKA 4UEFA 5IX3A 5F48A 2A4NA 2JEVA 4YWYA 3RZAA 3IO1A 3D67A 1LAMA 1K4JA 2KCWA 2FXFA 4E0AA 3FNCA 4PV6A 4ZY1A 4W9YA 1XOVA 4FD5A 3H5ZA 3JVNA 3MRUA 4CAVA 1TIQA 1RTQA 5G22A 4OLLA 5D8NA 4FBEA 3FF3A 4A37A 3SJGA 1LCPA 4AXVA 3OWCA 2PIYA 3T9YA 5KTDA 4CGOA 3I3GA 3TOBA 4AG7A 5LYLA 4R3KA 4MCPA 5JGFA 2D4PA 3R9FA 2AFOA 1ZO0A 5AG5A 4CGNA 4MHDA 2EBJA 3JUWA 4KZTA 5AG7A 5LRJA 2AFXA 3TFYA 4UFXA 4ZY2A 3LODA 4RUHA 1LRZA 2PJ3A 5F47A 1QSRA 2Z3PA 2ZW4A 2CTCA 2PDOA 5DWMA 3VATA 3FMCA 1Q2DA 4UIAA 1S7KA 4MBUA 2Z3KA 3FJUA 4KSFA 4MRIA 5K8MA 5HXDA 3S9LA 1R3NA 2RB7A 4M3SA 5DWNA 1YQEA 2AFZA 3RBUA 4GS4A 3TOAA 3H8FA 4B13A 2FT0A 3R1KA 3G8WA 5C82A 4RI1A 2QYVA 4ZY0A 2BCOA 1HDQA 3GY9A 5ELYA 3JRUA 1Z4RA 4OC2A 4XPKA 5JH9A 1MJ9A 4WJBA 4JD6A 4CYOA 4E8OA 1F57A 3DLJA 5D29A 1Y9WA 2FIAA 1IU8A 5KTAA 2R7HA 2FCKA 2ARHA 2PJ1A 4Y49C 3TCVA 4KORA 4NGRA 4PK3A 1JQGA 4HPSA 5H86A 1CPSA 3B7IA 3HLPA 1ON0A 4UFWA 1YMEA 4MFZA 1I12A 2YNCC 3NE8A 2Q4YA 3IWEA 5EMIA 4KUBA 1TF9A 3B3TA 2ZPAA 2H5MA 5CBMA 2PR8A 4KVXA 3KI9A 3TTHA 4A39A 4PSXA 4B5PA 1QSOA 4F9VA 4JWPA 4CRYB 2PJ7A 5THWA 1F2OA 2Q44A 3KL9A 1Y9KA 1AUGA 1XJOA 1Z8LA 2F7VA 2PJ4A 4KSAA 5HH1A 4CYPA 2ZEGA 3NH8A 2VZYA 4O23A 2P6EA 1Z2LA 2ZEDA 1U6MA 2B3UA 2CIJA 4MHZA 4MCQA 2Z11A 4ONWA 3TX8A 1X10A 3CZXA 2PVVA 3TO7A 1LFWA 4ZX9A 2BO9A 2HB6A 2G0BA 2P6GA 4P45A 2Q7BA 3LWUA 4FD7A 3WABA 3S6FA 4GM5A 2XEFA 1M4DA 1BOBA 2PJCA 1VHEA 3EO4A 2Q4ZA 4MXUA 4OC3A 5K8OA 4CGLA 4PK2A 2DEAA 1F2PA 2YNCA 2PJBA 2NYQA 1NSAA 2R98A 3F8KA 3FB3A 3FX6A 1AMPA 4KVME 4L89A 3NH4A 4M6HA 2G9DA 4C7IA 4YGOA 2BOAA 4MHNA 3D4UA 1ZG7A 5G20A 4B12A 4AG9A 4KOTA 2ZXVA 2QIRA 1V0CA 4B5OA 3SJEA 3IJ3A 4A32A 2BL1A 4KOVA 1Y7EA 1YK3A 2QMLA 3FXTA 3D2PA 4OC4A 4MHYA 2FL4A 2CF4A 3RAMA 1ZG8A 4PXBA 2DPTA 3MGDA 4KOUA 1R57A 1XMBA 3IWGA 4NGSA 2Z3OA 4ONUA 3TE4A 3PBEA 2FSRA 2IL4A 4Q38A 1A2ZA 4WWVA 4A30A 2FE7A 2Q0YA 4F6AA 4P44A 4UCPA 1ELLP 1Q7LA 1Y0RA 1CG2A 4CYQA 1Y0YA 3QAHA 4DNCA 2F8HA 3PGPA 3SHPA 5LYDA 3SXNA 2EUIA 2Y0MA 2B5GA 4MY3A 1IY7A 2ODFA 1ZLHA 4MFKA 4NGNA 4G1PA 1BPMA 2DXQA 4DYOA 3D7HA 7CPAA 2B4BA 1Z4EA 3PB9X 4M6GA 2C6CA 2JDCA 3S9MA 5J8FA 3V38A 2B3VA 1YLOA 2XEIA 5G1ZA 1KZFA 3KQZA 4IK2A 4A33A 3CPAA 4MFQA 3LMSA 1OZPA 4MY0A 4OMEA 4Y49B 2DPSA 2V8VA 5CNPA 2IQ6A 2GLFA 3WC7A 4TNUA 3KHZA 4R6TA 4A31A 4UBRA 4IHMA 2PQ8A 5F46A 3PB8X 2AFMA 2ZW6A 1VGYA 2EK8A 1CJWA 2EO8A 2DF5A 4KOSA 4JZ0A 2V8GA 1BO4A 1B6BA 3NA6A 4U5YA 2Z3MA 3I1UA 4P4BA 5LRKA 4EWTA 1YVKA 2JEWA 5E96A 2GU2A 4JLYA 3N7ZA 4H89A 2OB0A 2ZEHA 3H4QA 2Q4VA 4LQ6A 2Z0ZA 5HVFA 4UEEA 2GIVA 4ZX8A 2VEZA 4PXEA 2YGWA 2Q7SA 4C68A 3GLJA 2Q43A 5K8NA 1YR0A 2PRQA 2CTBA 4RS2A 1MJAA 2AFSA 3B3VA 3ZZIA 5A28A 2ZENA 4M85A 3V8IA 4DUKA 3IU2A 5IV0A 4KLVA 2V8HA 4P10A 3B3CA 1VHOA 3ZJ0A 3IEHA 8CPAA 3EY5A 4H6ZA 2FS5A 1M4LA 3T90A 3S6KA 1WK4A 2C6GA 4H2KA 4KOXA 3JTKA 3BJ7A 3FEDA 2G3TA 2HV2A 1EE3P 2OZUA 3RNZA 3TC8A 4KOYA 2PJ2A 4BMHA 2PE3A 1I21A 2AJ6A 2PJ6A 3S6GA 5LRGA 1LOKA 1S3ZA 2OZGA 4U9YA 4A94A 5FVJA 4CGMA 4KLWA 4FWUA 5I4MA 2AFWA 4P6YA 1XFOA 4JJXA 2HQYA 1S7NA 1Z9UA 3DNSA 3L2NA 3BHXA 4OP4A 2REEA 4P4DA 3S6HA 3R9EA 2WSAA 2V8DA 3D7FA 2Q04A 3PFEA 2ZW5A 1GYTA 5JPHA 2EK9A 3CPXA 1SQHA 2R8VA 3F5BA 1S7FA 4GXHA 5IB0A 3K9UA 2ZELA 3BLNA 4ZBGA 2PRBA 3KR4A 2QJ8A 1FNOA 3SJXA 1IYKA 1DE4C 4KOWA 3PP9A 4EFDA 1XEBA 1L0CA 2D4OA 1LAPA 2V77A 4HNXB 5HVHA 3IFEA 1RXTA 5F49A 2VI7A 2PJ8A 3K9TA 1H8LA 5LYIA 2PJAA 1QSNA 4NGTA 1RO5A 2GFQA 2P0WA 2RC4A 1PUAA 4NGQA 4EVYA 3DR8A 5EBVA 3RO0A 1N71A 1QSMA 4A2ZA 3W91A 2X7BA 2WYRA 4R87A 3KHXA 4AVBA 2ANPA 2Z3LA 3B3WA 3P2FA 2EWBA 2VZZA 3PFOA 4R3LA 4CYNA 4DJLA 4RN7A 2OR4A 3FECA 4CPAA 2VL1A 2JBJA 1OBRA 4X2TA 3QAYA 3SJFA 3TO6A 4CAXA 2C27A 1CM0A 3CXQA 3DDDA 4XPDC 2FVGA 1TKHA 3BI1A 4PXDA 3KKWA 1JWQA 3QNVA 1ZLIA 2O4HA 3B35A 1BPNA 1XRYA 4PQAA 3RYOA 3GKRA 2CNMA 4XPLA 3IGRA 4CAWA 1DTDA 1PYTB 4HNWB 3WT4A 4B5PB 2OOTA 3A9LA 3FIXA 4MCRA 1P0HA 4FD4A 4B6ZA 5A27A 2XEJA 3S9NA 2I79A
chains in the Genus database with same CATH topology
5AG6A 4UWIA 4UFVA 3LD2A 3P2HA 4BBHA 1IIDA 2CNSA 3FRMA 1S5KA 2PC1A 1Y7RA 2JDDA 4R9MA 3BJ8A 4Q36A 4L8AA 4MFPA 1FY7A 2OZHA 1MJBA 1S7LA 1IYLA 3TO9A 4UA3A 4H6UA 4NEXA 2P6FA 4F0YA 1I1DA 3CXSA 4I49A 4NCZA 1IICA 3FYNA 4JXRA 1M1DA 1PU9A 2J8NA 2GANA 3PZJA 2F5IA 4QUSA 3W6SA 4UCMA 2NMTA 4CGPA 4OADA 5AG4A 1M4GA 2ATRA 3GYAA 1VKCA 5H84A 2I00A 1IB1E 4NXYA 4CAFA 4E2AA 5ISVA 2CY2A 3QB8A 2B5GB 2VXKA 1YGHA 3E0KA 4K30A 5AGEA 2Z10A 3I9SA 4JXQA 1P4NA 1XIXA 2FIWA 4LUAA 2QECA 4QVTA 5I0CA 2YNEA 3C26A 3D3SA 3R9GA 2HUZA 4KUAA 2WUUA 2BUEA 4C2YA 3B8GA 2OU2A 2CXAA 2GE3A 1YX0A 3DSBA 4XPDB 1NSLA 4X5KA 5JQ4A 3FBUA 5EC4A 2OH1A 4J3GA 4KS9A 4XNHC 1WWZA 4LX9A 4MFJA 5BWAB 1XMTA 3SXOA 4R57A 4IF5A 5G21A 4QB9A 2AE6A 4QC6A 2BEIA 2VQYA 4HNYB 2B4DA 4AVCA 2ZW7A 1NE9A 4ORFA 4CAEA 4B10A 2B58A 3EFAA 3NE7A 2Z3NA 1GHEA 2J8MA 1M44A 3D2MA 2BSWA 1KUVA 2VBQA 4B11A 1Q2CA 2WPXA 2R1IA 1MK4A 4AVAA 4C2ZA 3EXNA 3VWDA 5HMNA 3F0AA 2J8RA 3CXPA 1Q2YA 2K5TA 3TT2A 1M4IA 4FD6A 1NMTA 4MJ8A 1B87A 1YLEA 3W6XA 3WR7A 3UY5A 1YREA 1S60A 4NSQA 4MFLA 3VWEA 4YRHA 1XF8A 3R95A 1UFHA 3R96A 3DR6A 2WPWA 4MI4A 2G3AA 4KVOE 4C2XA 2YNDA 4A95A 4PSWA 1VHSA 2O28A 4IUSA 2EVNA 2PR1A 4U9ZA 2PSWA 5C88A 4AB7A 3EC4A 5KTCA 4CS0B 1KUYA 4QBJA 5GCNA 3D8PA 1QSTA 2CNTA 4NF1A 4HKFA 4ZGYB 2B4DB 4YFJA 4OAEA 1XE4A 2REFA 2JLMA 4F0XA 4UWJA 5J8CA 3G3SA 1YVOA 4CRZB 1KUXA 4XNHB 4II9A 4B14A 4C7HA 4UCNA 3IU1A 1J4JA 5IX3A 5F48A 2A4NA 2JEVA 2KCWA 1K4JA 4E0AA 2FXFA 3FNCA 4PV6A 4FD5A 3H5ZA 3JVNA 4CAVA 1TIQA 5G22A 4OLLA 3OWCA 3T9YA 5KTDA 4CGOA 3I3GA 3TOBA 4AG7A 4R3KA 2D4PA 3R9FA 1ZO0A 5AG5A 4CGNA 4MHDA 3JUWA 4KZTA 5AG7A 3TFYA 4UFXA 3LODA 1LRZA 5F47A 1QSRA 2Z3PA 2ZW4A 2PDOA 5DWMA 1Q2DA 1S7KA 4MBUA 2Z3KA 4KSFA 4M3SA 5DWNA 4GS4A 3TOAA 4B13A 2FT0A 3R1KA 3G8WA 5C82A 4RI1A 3GY9A 1Z4RA 4XPKA 1MJ9A 4E8OA 4JD6A 4CYOA 1Y9WA 2FIAA 5KTAA 2R7HA 2FCKA 2ARHA 4Y49C 3TCVA 4KORA 4PK3A 5H86A 1ON0A 4UFWA 4MFZA 1I12A 2YNCC 2Q4YA 3IWEA 4KUBA 2ZPAA 2H5MA 2PR8A 4KVXA 3TTHA 4PSXA 4B5PA 1QSOA 4JWPA 4CRYB 2Q44A 1Y9KA 4KSAA 5HH1A 4CYPA 2VZYA 2P6EA 3R9EA 1U6MA 2B3UA 2Z11A 3TO7A 2G0BA 2P6GA 2Q7BA 4FD7A 3S6FA 1M4DA 1BOBA 3EO4A 4CGLA 4PK2A 2YNCA 3F8KA 2R98A 3FB3A 4L89A 4C7IA 4KVME 4YGOA 5G20A 4B12A 4AG9A 4KOTA 2ZXVA 2QIRA 1V0CA 4B5OA 4A32A 2BL1A 4KOVA 3FXTA 1YK3A 2QMLA 3D2PA 2FL4A 2DPTA 3MGDA 4KOUA 1R57A 3IWGA 4ONUA 3TE4A 2Z3OA 4F6AA 2FSRA 2IL4A 4Q38A 4A30A 2FE7A 2Q0YA 4UCPA 4CYQA 3QAHA 4DNCA 3PGPA 3SHPA 3SXNA 2EUIA 2Y0MA 2B5GA 4MY3A 4MFKA 2DXQA 2B4BA 1Z4EA 2JDCA 5J8FA 2B3VA 5G1ZA 1KZFA 4A33A 4MFQA 4Y49B 1OZPA 4MY0A 2DPSA 5CNPA 4A31A 4UBRA 2PQ8A 5F46A 2ZW6A 1CJWA 4KOSA 1BO4A 1B6BA 4U5YA 2Z3MA 1YVKA 5E96A 4JLYA 3N7ZA 4H89A 2OB0A 3H4QA 2Q4VA 2Z0ZA 2GIVA 2VEZA 2YGWA 4C68A 1YR0A 4RS2A 1MJAA 3ZZIA 5A28A 4M85A 3V8IA 5IV0A 3IU2A 4KLVA 3ZJ0A 3EY5A 4H6ZA 2FS5A 3T90A 3S6KA 1WK4A 4KOXA 3JTKA 3BJ7A 2G3TA 2HV2A 2OZUA 4KOYA 4BMHA 1I21A 2AJ6A 3S6GA 1S3ZA 2OZGA 4U9YA 5FVJA 4CGMA 4KLWA 4JJXA 2HQYA 1S7NA 1Z9UA 3DNSA 2REEA 3S6HA 2WSAA 2Q04A 2ZW5A 5JPHA 1SQHA 2R8VA 3F5BA 1S7FA 5IB0A 3K9UA 4ZBGA 3BLNA 2PRBA 1IYKA 4KOWA 3PP9A 1XEBA 1L0CA 2D4OA 4HNXB 1RXTA 5F49A 2VI7A 1QSNA 1RO5A 2P0WA 2RC4A 1PUAA 4EVYA 3DR8A 5EBVA 1QSMA 1N71A 4A2ZA 3W91A 2X7BA 4R87A 4AVBA 2Z3LA 3P2FA 2VZZA 4CYNA 4R3LA 3TO6A 4CAXA 2C27A 1CM0A 3CXQA 3DDDA 4XPDC 3KKWA 3RYOA 3GKRA 2CNMA 4CAWA 3IGRA 4HNWB 4B5PB 3A9LA 3FIXA 1P0HA 4FD4A 5A27A 4XPLA 2I79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZO0 A;  4ZGY B;  5BWA B; 
#chains in the Genus database with same CATH topology
 5AG6 A;  2IMO A;  2QVP A;  4LQG A;  4UWI A;  2J9A A;  2PJ0 A;  3KGQ A;  4UFV A;  3LD2 A;  3P2H A;  4YU9 A;  4BBH A;  1IID A;  2ABZ A;  2CNS A;  3DGV A;  3KQX A;  2POK A;  2I3C A;  3FRM A;  2NSM A;  1X12 A;  1S5K A;  2PC1 A;  1HEE A;  1Y7R A;  2JDD A;  4R9M A;  1Z8X A;  3BJ8 A;  4L8A A;  4Q36 A;  3D7G A;  4MFP A;  1FY7 A;  2ZEM A;  5IB9 A;  2OZH A;  4OC0 A;  1MJB A;  1TKF A;  1S7L A;  4UIB A;  1IYL A;  3TO9 A;  3VH9 A;  4KSI A;  1ZG9 A;  4UA3 A;  4H6U A;  2PJ5 A;  4NEX A;  3MN8 A;  2P6F A;  4F0Y A;  1I1D A;  3CXS A;  4IAV A;  1CPX A;  4R7M A;  3D7D A;  4I49 A;  4PPZ A;  4TWE A;  4NCZ A;  1IIC A;  4EME A;  4P4F A;  3FYN A;  4JXR A;  5JM6 A;  1M1D A;  1PU9 A;  3LAC A;  2ZOF A;  2J8N A;  4A38 A;  3KZW A;  1BLL E;  2GAN A;  4Z65 A;  3KAS A;  3PZJ A;  2F5I A;  4QUS A;  3W6S A;  3NH5 A;  4UCM A;  4UF4 A;  2NMT A;  4CGP A;  4OAD A;  4ZI6 A;  5AG4 A;  3B3S A;  4ZYQ A;  1M4G A;  2ATR A;  3GYA A;  1VKC A;  5H84 A;  2Q51 A;  4NJR A;  2I00 A;  1IB1 E;  2XEG A;  3GUX A;  4JYW A;  2ZEF A;  4NXY A;  4MMO A;  2CY2 A;  4CAF A;  4E2A A;  5ISV A;  3QB8 A;  2B5G B;  2VXK A;  1YGH A;  2WZN A;  3E0K A;  4K30 A;  5AGE A;  5HVG A;  2Z10 A;  3I9S A;  4JXQ A;  1LAN A;  1CP7 A;  1P4N A;  1UWY A;  4P4E A;  3FH4 A;  4BD9 A;  1XIX A;  1BAV A;  2FIW A;  3D68 A;  4LUA A;  4OID A;  3H8G A;  3K2K A;  2QEC A;  3KR5 A;  4QVT A;  5I0C A;  2YNE A;  3C26 A;  3D3S A;  3R9G A;  2HUZ A;  4KUA A;  1CBX A;  3PBB A;  2WUU A;  2BUE A;  2ZEO A;  4OIW A;  4C2Y A;  3B8G A;  2OU2 A;  2CXA A;  1QQ9 A;  1Z5R A;  2GE3 A;  4R8F A;  1YX0 A;  4R76 A;  3DSB A;  4XPD B;  3WC6 A;  3IWW A;  1VIX A;  4X5K A;  1NSL A;  2PVW A;  3SI1 A;  5JQ4 A;  3FBU A;  5F09 A;  5EC4 A;  4P4J A;  1IGB A;  3IC1 A;  2OH1 A;  4J3G A;  4KS9 A;  4XNH C;  1WWZ A;  4LX9 A;  3VAR A;  4OC5 A;  4MFJ A;  5BWA B;  3PB6 X;  3N5F A;  4PXC A;  1XMT A;  2ZOG A;  3SXO A;  4R57 A;  1CX8 A;  4MHP A;  4IF5 A;  3BI0 A;  5G21 A;  4QB9 A;  3ISZ A;  2AE6 A;  4QC6 A;  2BEI A;  2RFH A;  1CP6 A;  4NJQ A;  4M6I A;  4X3R A;  2C1C A;  2VQY A;  4HNY B;  2B4D A;  5K8P A;  4AVC A;  4BIN A;  2ZW7 A;  3SI2 A;  1NE9 A;  4ORF A;  3PRT A;  4CAE A;  4B10 A;  1TXR A;  2B58 A;  2GRE A;  3EFA A;  3NE7 A;  1QMU A;  4FAI A;  2Z3N A;  1GHE A;  3B2Y A;  4X8I A;  2J8M A;  1M44 A;  3D2M A;  1ARM A;  2BSW A;  3FVL A;  4NFR A;  1KUV A;  2VBQ A;  1ARL A;  1IOI A;  4B11 A;  1Z8W A;  2IJZ A;  1Q2C A;  3GB0 A;  2WPX A;  1YSJ A;  2R1I A;  1MK4 A;  1XBU A;  3IIB A;  3WC5 A;  3BXM A;  4AVA A;  4C2Z A;  1IOF A;  3EXN A;  3VWD A;  3F0A A;  3V7Z A;  5HMN A;  2J8R A;  2O53 A;  3CXP A;  1Q2Y A;  2K5T A;  3TT2 A;  1M4I A;  4NGP A;  1TF8 A;  1NMT A;  4FD6 A;  4MJ8 A;  4MCS A;  1B87 A;  3NFZ A;  1YLE A;  4OKO A;  3W6X A;  2ZEE A;  3UY5 A;  1YRE A;  3WR7 A;  2GLJ A;  3SI0 A;  1AYE A;  1S60 A;  4NSQ A;  4MFL A;  2PJ9 A;  3VWE A;  4YRH A;  1XF8 A;  3R95 A;  4UEZ A;  2PCU A;  1UFH A;  4Q7A A;  3R96 A;  3DR6 A;  1Z8T A;  3PEI A;  1YW4 A;  2WPW A;  3D66 A;  4MI4 A;  2G3A A;  2ZEP A;  4KVO E;  3T8W A;  4C2X A;  2YND A;  4A95 A;  4PSW A;  1VHS A;  2O28 A;  4IUS A;  3H8E A;  2EVN A;  2PR1 A;  4U9Z A;  2PSW A;  5C88 A;  4NGM A;  4AB7 A;  1PCA A;  6CPA A;  3EC4 A;  2HC9 A;  1YW6 A;  4F9U A;  3FEE A;  5KTC A;  4CS0 B;  1HDU A;  1KUY A;  1R43 A;  4QBJ A;  3GIU A;  3D8P A;  1QST A;  2CNT A;  4NF1 A;  5GCN A;  4HKF A;  4OC1 A;  4ZGY B;  2AFU A;  3CDX A;  3PB4 X;  2B4D B;  4F8Z A;  4YFJ A;  1FT7 A;  4OAE A;  1XE4 A;  2REF A;  2JLM A;  4F0X A;  5DS0 A;  2PIZ A;  4UWJ A;  5J8C A;  5J1Q A;  3HUV A;  3G3S A;  4FUU A;  5LYF A;  1TKJ A;  3ISX A;  1YVO A;  4CRZ B;  1KUX A;  1ELM P;  4XNH B;  3CT9 A;  4II9 A;  4B14 A;  4C7H A;  5CPA A;  4K3N A;  2C6P A;  4P4I A;  1KWM A;  4UCN A;  3IU1 A;  1J4J A;  3PB7 X;  2JBK A;  4UEF A;  5IX3 A;  5F48 A;  2A4N A;  2JEV A;  4YWY A;  3RZA A;  3IO1 A;  3D67 A;  1LAM A;  1K4J A;  2KCW A;  2FXF A;  4E0A A;  3FNC A;  4PV6 A;  4ZY1 A;  4W9Y A;  1XOV A;  4FD5 A;  3H5Z A;  3JVN A;  3MRU A;  4CAV A;  1TIQ A;  1RTQ A;  5G22 A;  4OLL A;  5D8N A;  4FBE A;  3FF3 A;  4A37 A;  3SJG A;  1LCP A;  4AXV A;  3OWC A;  2PIY A;  3T9Y A;  5KTD A;  4CGO A;  3I3G A;  3TOB A;  4AG7 A;  5LYL A;  4R3K A;  4MCP A;  5JGF A;  2D4P A;  3R9F A;  2AFO A;  1ZO0 A;  5AG5 A;  4CGN A;  4MHD A;  2EBJ A;  3JUW A;  4KZT A;  5AG7 A;  5LRJ A;  2AFX A;  3TFY A;  4UFX A;  4ZY2 A;  3LOD A;  4RUH A;  1LRZ A;  2PJ3 A;  5F47 A;  1QSR A;  2Z3P A;  2ZW4 A;  2CTC A;  2PDO A;  5DWM A;  3VAT A;  3FMC A;  1Q2D A;  4UIA A;  1S7K A;  4MBU A;  2Z3K A;  3FJU A;  4KSF A;  4MRI A;  5K8M A;  5HXD A;  3S9L A;  1R3N A;  2RB7 A;  4M3S A;  5DWN A;  1YQE A;  2AFZ A;  3RBU A;  4GS4 A;  3TOA A;  3H8F A;  4B13 A;  2FT0 A;  3R1K A;  3G8W A;  5C82 A;  4RI1 A;  2QYV A;  4ZY0 A;  2BCO A;  1HDQ A;  3GY9 A;  5ELY A;  3JRU A;  1Z4R A;  4OC2 A;  4XPK A;  5JH9 A;  1MJ9 A;  4WJB A;  4JD6 A;  4CYO A;  4E8O A;  1F57 A;  3DLJ A;  5D29 A;  1Y9W A;  2FIA A;  1IU8 A;  5KTA A;  2R7H A;  2FCK A;  2ARH A;  2PJ1 A;  4Y49 C;  3TCV A;  4KOR A;  4NGR A;  4PK3 A;  1JQG A;  4HPS A;  5H86 A;  1CPS A;  3B7I A;  3HLP A;  1ON0 A;  4UFW A;  1YME A;  4MFZ A;  1I12 A;  2YNC C;  3NE8 A;  2Q4Y A;  3IWE A;  5EMI A;  4KUB A;  1TF9 A;  3B3T A;  2ZPA A;  2H5M A;  5CBM A;  2PR8 A;  4KVX A;  3KI9 A;  3TTH A;  4A39 A;  4PSX A;  4B5P A;  1QSO A;  4F9V A;  4JWP A;  4CRY B;  2PJ7 A;  5THW A;  1F2O A;  2Q44 A;  3KL9 A;  1Y9K A;  1AUG A;  1XJO A;  1Z8L A;  2F7V A;  2PJ4 A;  4KSA A;  5HH1 A;  4CYP A;  2ZEG A;  3NH8 A;  2VZY A;  4O23 A;  2P6E A;  1Z2L A;  2ZED A;  1U6M A;  2B3U A;  2CIJ A;  4MHZ A;  4MCQ A;  2Z11 A;  4ONW A;  3TX8 A;  1X10 A;  3CZX A;  2PVV A;  3TO7 A;  1LFW A;  4ZX9 A;  2BO9 A;  2HB6 A;  2G0B A;  2P6G A;  4P45 A;  2Q7B A;  3LWU A;  4FD7 A;  3WAB A;  3S6F A;  4GM5 A;  2XEF A;  1M4D A;  1BOB A;  2PJC A;  1VHE A;  3EO4 A;  2Q4Z A;  4MXU A;  4OC3 A;  5K8O A;  4CGL A;  4PK2 A;  2DEA A;  1F2P A;  2YNC A;  2PJB A;  2NYQ A;  1NSA A;  2R98 A;  3F8K A;  3FB3 A;  3FX6 A;  1AMP A;  4KVM E;  4L89 A;  3NH4 A;  4M6H A;  2G9D A;  4C7I A;  4YGO A;  2BOA A;  4MHN A;  3D4U A;  1ZG7 A;  5G20 A;  4B12 A;  4AG9 A;  4KOT A;  2ZXV A;  2QIR A;  1V0C A;  4B5O A;  3SJE A;  3IJ3 A;  4A32 A;  2BL1 A;  4KOV A;  1Y7E A;  1YK3 A;  2QML A;  3FXT A;  3D2P A;  4OC4 A;  4MHY A;  2FL4 A;  2CF4 A;  3RAM A;  1ZG8 A;  4PXB A;  2DPT A;  3MGD A;  4KOU A;  1R57 A;  1XMB A;  3IWG A;  4NGS A;  2Z3O A;  4ONU A;  3TE4 A;  3PBE A;  2FSR A;  2IL4 A;  4Q38 A;  1A2Z A;  4WWV A;  4A30 A;  2FE7 A;  2Q0Y A;  4F6A A;  4P44 A;  4UCP A;  1ELL P;  1Q7L A;  1Y0R A;  1CG2 A;  4CYQ A;  1Y0Y A;  3QAH A;  4DNC A;  2F8H A;  3PGP A;  3SHP A;  5LYD A;  3SXN A;  2EUI A;  2Y0M A;  2B5G A;  4MY3 A;  1IY7 A;  2ODF A;  1ZLH A;  4MFK A;  4NGN A;  4G1P A;  1BPM A;  2DXQ A;  4DYO A;  3D7H A;  7CPA A;  2B4B A;  1Z4E A;  3PB9 X;  4M6G A;  2C6C A;  2JDC A;  3S9M A;  5J8F A;  3V38 A;  2B3V A;  1YLO A;  2XEI A;  5G1Z A;  1KZF A;  3KQZ A;  4IK2 A;  4A33 A;  3CPA A;  4MFQ A;  3LMS A;  1OZP A;  4MY0 A;  4OME A;  4Y49 B;  2DPS A;  2V8V A;  5CNP A;  2IQ6 A;  2GLF A;  3WC7 A;  4TNU A;  3KHZ A;  4R6T A;  4A31 A;  4UBR A;  4IHM A;  2PQ8 A;  5F46 A;  3PB8 X;  2AFM A;  2ZW6 A;  1VGY A;  2EK8 A;  1CJW A;  2EO8 A;  2DF5 A;  4KOS A;  4JZ0 A;  2V8G A;  1BO4 A;  1B6B A;  3NA6 A;  4U5Y A;  2Z3M A;  3I1U A;  4P4B A;  5LRK A;  4EWT A;  1YVK A;  2JEW A;  5E96 A;  2GU2 A;  4JLY A;  3N7Z A;  4H89 A;  2OB0 A;  2ZEH A;  3H4Q A;  2Q4V A;  4LQ6 A;  2Z0Z A;  5HVF A;  4UEE A;  2GIV A;  4ZX8 A;  2VEZ A;  4PXE A;  2YGW A;  2Q7S A;  4C68 A;  3GLJ A;  2Q43 A;  5K8N A;  1YR0 A;  2PRQ A;  2CTB A;  4RS2 A;  1MJA A;  2AFS A;  3B3V A;  3ZZI A;  5A28 A;  2ZEN A;  4M85 A;  3V8I A;  4DUK A;  3IU2 A;  5IV0 A;  4KLV A;  2V8H A;  4P10 A;  3B3C A;  1VHO A;  3ZJ0 A;  3IEH A;  8CPA A;  3EY5 A;  4H6Z A;  2FS5 A;  1M4L A;  3T90 A;  3S6K A;  1WK4 A;  2C6G A;  4H2K A;  4KOX A;  3JTK A;  3BJ7 A;  3FED A;  2G3T A;  2HV2 A;  1EE3 P;  2OZU A;  3RNZ A;  3TC8 A;  4KOY A;  2PJ2 A;  4BMH A;  2PE3 A;  1I21 A;  2AJ6 A;  2PJ6 A;  3S6G A;  5LRG A;  1LOK A;  1S3Z A;  2OZG A;  4U9Y A;  4A94 A;  5FVJ A;  4CGM A;  4KLW A;  4FWU A;  5I4M A;  2AFW A;  4P6Y A;  1XFO A;  4JJX A;  2HQY A;  1S7N A;  1Z9U A;  3DNS A;  3L2N A;  3BHX A;  4OP4 A;  2REE A;  4P4D A;  3S6H A;  3R9E A;  2WSA A;  2V8D A;  3D7F A;  2Q04 A;  3PFE A;  2ZW5 A;  1GYT A;  5JPH A;  2EK9 A;  3CPX A;  1SQH A;  2R8V A;  3F5B A;  1S7F A;  4GXH A;  5IB0 A;  3K9U A;  2ZEL A;  3BLN A;  4ZBG A;  2PRB A;  3KR4 A;  2QJ8 A;  1FNO A;  3SJX A;  1IYK A;  1DE4 C;  4KOW A;  3PP9 A;  4EFD A;  1XEB A;  1L0C A;  2D4O A;  1LAP A;  2V77 A;  4HNX B;  5HVH A;  3IFE A;  1RXT A;  5F49 A;  2VI7 A;  2PJ8 A;  3K9T A;  1H8L A;  5LYI A;  2PJA A;  1QSN A;  4NGT A;  1RO5 A;  2GFQ A;  2P0W A;  2RC4 A;  1PUA A;  4NGQ A;  4EVY A;  3DR8 A;  5EBV A;  3RO0 A;  1N71 A;  1QSM A;  4A2Z A;  3W91 A;  2X7B A;  2WYR A;  4R87 A;  3KHX A;  4AVB A;  2ANP A;  2Z3L A;  3B3W A;  3P2F A;  2EWB A;  2VZZ A;  3PFO A;  4R3L A;  4CYN A;  4DJL A;  4RN7 A;  2OR4 A;  3FEC A;  4CPA A;  2VL1 A;  2JBJ A;  1OBR A;  4X2T A;  3QAY A;  3SJF A;  3TO6 A;  4CAX A;  2C27 A;  1CM0 A;  3CXQ A;  3DDD A;  4XPD C;  2FVG A;  1TKH A;  3BI1 A;  4PXD A;  3KKW A;  1JWQ A;  3QNV A;  1ZLI A;  2O4H A;  3B35 A;  1BPN A;  1XRY A;  4PQA A;  3RYO A;  3GKR A;  2CNM A;  4XPL A;  3IGR A;  4CAW A;  1DTD A;  1PYT B;  4HNW B;  3WT4 A;  4B5P B;  2OOT A;  3A9L A;  3FIX A;  4MCR A;  1P0H A;  4FD4 A;  4B6Z A;  5A27 A;  2XEJ A;  3S9N A;  2I79 A; 
#chains in the Genus database with same CATH homology
 5AG6 A;  4UWI A;  4UFV A;  3LD2 A;  3P2H A;  4BBH A;  1IID A;  2CNS A;  3FRM A;  1S5K A;  2PC1 A;  1Y7R A;  2JDD A;  4R9M A;  3BJ8 A;  4Q36 A;  4L8A A;  4MFP A;  1FY7 A;  2OZH A;  1MJB A;  1S7L A;  1IYL A;  3TO9 A;  4UA3 A;  4H6U A;  4NEX A;  2P6F A;  4F0Y A;  1I1D A;  3CXS A;  4I49 A;  4NCZ A;  1IIC A;  3FYN A;  4JXR A;  1M1D A;  1PU9 A;  2J8N A;  2GAN A;  3PZJ A;  2F5I A;  4QUS A;  3W6S A;  4UCM A;  2NMT A;  4CGP A;  4OAD A;  5AG4 A;  1M4G A;  2ATR A;  3GYA A;  1VKC A;  5H84 A;  2I00 A;  1IB1 E;  4NXY A;  4CAF A;  4E2A A;  5ISV A;  2CY2 A;  3QB8 A;  2B5G B;  2VXK A;  1YGH A;  3E0K A;  4K30 A;  5AGE A;  2Z10 A;  3I9S A;  4JXQ A;  1P4N A;  1XIX A;  2FIW A;  4LUA A;  2QEC A;  4QVT A;  5I0C A;  2YNE A;  3C26 A;  3D3S A;  3R9G A;  2HUZ A;  4KUA A;  2WUU A;  2BUE A;  4C2Y A;  3B8G A;  2OU2 A;  2CXA A;  2GE3 A;  1YX0 A;  3DSB A;  4XPD B;  1NSL A;  4X5K A;  5JQ4 A;  3FBU A;  5EC4 A;  2OH1 A;  4J3G A;  4KS9 A;  4XNH C;  1WWZ A;  4LX9 A;  4MFJ A;  5BWA B;  1XMT A;  3SXO A;  4R57 A;  4IF5 A;  5G21 A;  4QB9 A;  2AE6 A;  4QC6 A;  2BEI A;  2VQY A;  4HNY B;  2B4D A;  4AVC A;  2ZW7 A;  1NE9 A;  4ORF A;  4CAE A;  4B10 A;  2B58 A;  3EFA A;  3NE7 A;  2Z3N A;  1GHE A;  2J8M A;  1M44 A;  3D2M A;  2BSW A;  1KUV A;  2VBQ A;  4B11 A;  1Q2C A;  2WPX A;  2R1I A;  1MK4 A;  4AVA A;  4C2Z A;  3EXN A;  3VWD A;  5HMN A;  3F0A A;  2J8R A;  3CXP A;  1Q2Y A;  2K5T A;  3TT2 A;  1M4I A;  4FD6 A;  1NMT A;  4MJ8 A;  1B87 A;  1YLE A;  3W6X A;  3WR7 A;  3UY5 A;  1YRE A;  1S60 A;  4NSQ A;  4MFL A;  3VWE A;  4YRH A;  1XF8 A;  3R95 A;  1UFH A;  3R96 A;  3DR6 A;  2WPW A;  4MI4 A;  2G3A A;  4KVO E;  4C2X A;  2YND A;  4A95 A;  4PSW A;  1VHS A;  2O28 A;  4IUS A;  2EVN A;  2PR1 A;  4U9Z A;  2PSW A;  5C88 A;  4AB7 A;  3EC4 A;  5KTC A;  4CS0 B;  1KUY A;  4QBJ A;  5GCN A;  3D8P A;  1QST A;  2CNT A;  4NF1 A;  4HKF A;  4ZGY B;  2B4D B;  4YFJ A;  4OAE A;  1XE4 A;  2REF A;  2JLM A;  4F0X A;  4UWJ A;  5J8C A;  3G3S A;  1YVO A;  4CRZ B;  1KUX A;  4XNH B;  4II9 A;  4B14 A;  4C7H A;  4UCN A;  3IU1 A;  1J4J A;  5IX3 A;  5F48 A;  2A4N A;  2JEV A;  2KCW A;  1K4J A;  4E0A A;  2FXF A;  3FNC A;  4PV6 A;  4FD5 A;  3H5Z A;  3JVN A;  4CAV A;  1TIQ A;  5G22 A;  4OLL A;  3OWC A;  3T9Y A;  5KTD A;  4CGO A;  3I3G A;  3TOB A;  4AG7 A;  4R3K A;  2D4P A;  3R9F A;  1ZO0 A;  5AG5 A;  4CGN A;  4MHD A;  3JUW A;  4KZT A;  5AG7 A;  3TFY A;  4UFX A;  3LOD A;  1LRZ A;  5F47 A;  1QSR A;  2Z3P A;  2ZW4 A;  2PDO A;  5DWM A;  1Q2D A;  1S7K A;  4MBU A;  2Z3K A;  4KSF A;  4M3S A;  5DWN A;  4GS4 A;  3TOA A;  4B13 A;  2FT0 A;  3R1K A;  3G8W A;  5C82 A;  4RI1 A;  3GY9 A;  1Z4R A;  4XPK A;  1MJ9 A;  4E8O A;  4JD6 A;  4CYO A;  1Y9W A;  2FIA A;  5KTA A;  2R7H A;  2FCK A;  2ARH A;  4Y49 C;  3TCV A;  4KOR A;  4PK3 A;  5H86 A;  1ON0 A;  4UFW A;  4MFZ A;  1I12 A;  2YNC C;  2Q4Y A;  3IWE A;  4KUB A;  2ZPA A;  2H5M A;  2PR8 A;  4KVX A;  3TTH A;  4PSX A;  4B5P A;  1QSO A;  4JWP A;  4CRY B;  2Q44 A;  1Y9K A;  4KSA A;  5HH1 A;  4CYP A;  2VZY A;  2P6E A;  3R9E A;  1U6M A;  2B3U A;  2Z11 A;  3TO7 A;  2G0B A;  2P6G A;  2Q7B A;  4FD7 A;  3S6F A;  1M4D A;  1BOB A;  3EO4 A;  4CGL A;  4PK2 A;  2YNC A;  3F8K A;  2R98 A;  3FB3 A;  4L89 A;  4C7I A;  4KVM E;  4YGO A;  5G20 A;  4B12 A;  4AG9 A;  4KOT A;  2ZXV A;  2QIR A;  1V0C A;  4B5O A;  4A32 A;  2BL1 A;  4KOV A;  3FXT A;  1YK3 A;  2QML A;  3D2P A;  2FL4 A;  2DPT A;  3MGD A;  4KOU A;  1R57 A;  3IWG A;  4ONU A;  3TE4 A;  2Z3O A;  4F6A A;  2FSR A;  2IL4 A;  4Q38 A;  4A30 A;  2FE7 A;  2Q0Y A;  4UCP A;  4CYQ A;  3QAH A;  4DNC A;  3PGP A;  3SHP A;  3SXN A;  2EUI A;  2Y0M A;  2B5G A;  4MY3 A;  4MFK A;  2DXQ A;  2B4B A;  1Z4E A;  2JDC A;  5J8F A;  2B3V A;  5G1Z A;  1KZF A;  4A33 A;  4MFQ A;  4Y49 B;  1OZP A;  4MY0 A;  2DPS A;  5CNP A;  4A31 A;  4UBR A;  2PQ8 A;  5F46 A;  2ZW6 A;  1CJW A;  4KOS A;  1BO4 A;  1B6B A;  4U5Y A;  2Z3M A;  1YVK A;  5E96 A;  4JLY A;  3N7Z A;  4H89 A;  2OB0 A;  3H4Q A;  2Q4V A;  2Z0Z A;  2GIV A;  2VEZ A;  2YGW A;  4C68 A;  1YR0 A;  4RS2 A;  1MJA A;  3ZZI A;  5A28 A;  4M85 A;  3V8I A;  5IV0 A;  3IU2 A;  4KLV A;  3ZJ0 A;  3EY5 A;  4H6Z A;  2FS5 A;  3T90 A;  3S6K A;  1WK4 A;  4KOX A;  3JTK A;  3BJ7 A;  2G3T A;  2HV2 A;  2OZU A;  4KOY A;  4BMH A;  1I21 A;  2AJ6 A;  3S6G A;  1S3Z A;  2OZG A;  4U9Y A;  5FVJ A;  4CGM A;  4KLW A;  4JJX A;  2HQY A;  1S7N A;  1Z9U A;  3DNS A;  2REE A;  3S6H A;  2WSA A;  2Q04 A;  2ZW5 A;  5JPH A;  1SQH A;  2R8V A;  3F5B A;  1S7F A;  5IB0 A;  3K9U A;  4ZBG A;  3BLN A;  2PRB A;  1IYK A;  4KOW A;  3PP9 A;  1XEB A;  1L0C A;  2D4O A;  4HNX B;  1RXT A;  5F49 A;  2VI7 A;  1QSN A;  1RO5 A;  2P0W A;  2RC4 A;  1PUA A;  4EVY A;  3DR8 A;  5EBV A;  1QSM A;  1N71 A;  4A2Z A;  3W91 A;  2X7B A;  4R87 A;  4AVB A;  2Z3L A;  3P2F A;  2VZZ A;  4CYN A;  4R3L A;  3TO6 A;  4CAX A;  2C27 A;  1CM0 A;  3CXQ A;  3DDD A;  4XPD C;  3KKW A;  3RYO A;  3GKR A;  2CNM A;  4CAW A;  3IGR A;  4HNW B;  4B5P B;  3A9L A;  3FIX A;  1P0H A;  4FD4 A;  5A27 A;  4XPL A;  2I79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...