4UBRA

Crystal structure of pseudomonas aeruginosa n-aetyltransferase pa4534
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
137
structure length
137
Chain Sequence
MQLRSVIAADHPALFALWSRTPGIRLRAEDAYPFFLAYLQRNPGLSLLVETEGEVIACLMAGHDGRRGYLQHLVVDPGYRGLGLARRMLDEVLARLAREGIGKSHVFVLDAAEEAQAFWRAQSDWERRKDIQVFSTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative acetyltransferase
publication title Crystal structure of Pseudomonas aeruginosa N-aetyltransferase PA4534
rcsb
source organism Pseudomonas aeruginosa 18a
total genus 35
structure length 137
sequence length 137
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2014-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ubrA00
3JVNA 2IL4A 2VBQA 3R95A 1PUAA 1GHEA 2BEIA 3DR6A 2X7BA 1KZFA 1M1DA 3FRMA 4B5PB 5KTCA 3DNSA 2P6EA 1XEBA 2FL4A 4II9A 1YK3A 4PK2A 2FT0A 4IUSA 1M44A 3D3SA 1I12A 4PSWA 2F5IA 3TO6A 2B4BA 2J8NA 3S6KA 2JEVA 4U5YA 3R9EA 1S7NA 1IICA 1IYLA 4OAEA 4AVBA 1XF8A 2RC4A 1NMTA 5KTDA 3QAHA 3RYOA 3TOBA 5F49A 3UY5A 2CNMA 2FS5A 1KUYA 3G3SA 4KOTA 2PR8A 3S6FA 1UFHA 3DSBA 1Y9KA 4H6UA 3P2HA 2Q44A 4XPKA 2OB0A 2BUEA 2VEZA 1K4JA 3TTHA 4PV6A 2Z11A 2REFA 4CAXA 2B4DA 4KOWA 1B6BA 1QSRA 4L8AA 4MHDA 4FD6A 4UBRA 5DWMA 5DWNA 4AVCA 2C27A 2WPXA 1Z9UA 3ZJ0A 1MJBA 4UWIA 4R3LA 3TT2A 1QSOA 1S7FA 3TCVA 3GKRA 4YFJA 5JQ4A 1WK4A 4CRZB 2FXFA 4MI4A 2J8MA 5FVJA 4Y49B 4KVOE 1I1DA 3F8KA 1J4JA 1FY7A 3TE4A 4H89A 2KCWA 3BJ8A 2GIVA 4ONUA 1MJAA 1Z4RA 5H84A 4UA3A 2GANA 2CNSA 5EBVA 2Z0ZA 1XIXA 1NSLA 4ZBGA 1B87A 2R1IA 1P4NA 1Q2YA 1S60A 3W6XA 1Q2DA 2JDCA 2DXQA 4FD5A 2ZXVA 4KORA 1S5KA 5IV0A 1P0HA 4CS0B 2OH1A 3K9UA 4XNHC 2HQYA 4AG7A 4IF5A 2P6FA 3G8WA 4J3GA 4R3KA 2CY2A 4KVXA 1Z4EA 2P0WA 4LUAA 4KOUA 2ATRA 2FIAA 1IYKA 4AG9A 1SQHA 2ZW7A 2EUIA 1CM0A 1QSMA 2VZZA 4X5KA 1QSTA 2R7HA 5F46A 2PR1A 3TO7A 2VQYA 5KTAA 3R9FA 1MK4A 3IWGA 3P2FA 1YGHA 2ZW4A 2JLMA 4M85A 3TFYA 3CXQA 3S6GA 2K5TA 3N7ZA 4CRYB 2D4PA 4QBJA 4KUBA 2Q04A 3W91A 4MBUA 3EY5A 3W6SA 3IGRA 5E96A 1R57A 4QVTA 4NXYA 3BJ7A 1KUVA 1VKCA 2B58A 4RS2A 4NSQA 2A4NA 1S7LA 2Y0MA 4U9YA 2R98A 1LRZA 1YX0A 4XPDB 1Q2CA 3S6HA 2G3TA 1IB1E 4KLVA 2FE7A 3D2MA 2HUZA 4OADA 4JWPA 1RXTA 1S3ZA 4HNYB 5I0CA 2ZPAA 4CAVA 2EVNA 2VZYA 4EVYA 4KUAA 2PDOA 2P6GA 1PU9A 3JUWA 4I49A 4RI1A 3R96A 2NMTA 4R57A 2VXKA 4XPLA 3DDDA 2G0BA 3D2PA 4R87A 1YREA 4GS4A 2J8RA 3BLNA 4BMHA 5C82A 4JXQA 2PC1A 1OZPA 1N71A 2PSWA 3CXPA 5F48A 2B4DB 3FYNA 3T9YA 2REEA 2QMLA 3EXNA 2ARHA 3LODA 5ISVA 3EFAA 3SHPA 5H86A 3PGPA 3FNCA 5GCNA 3F0AA 4B5PA 4HKFA 1ON0A 1CJWA 2WPWA 1BOBA 2QECA 2FSRA 3TOAA 4AB7A 4E8OA 3SXOA 5J8FA 4NF1A 3B8GA 1RO5A 4JD6A 1IIDA 1VHSA 4LX9A 4FD4A 2HV2A 4B5OA 1S7KA 2B3UA 3FB3A 1WWZA 2AE6A 3R1KA 5IX3A 3WR7A 2QIRA 4MY0A 4NCZA 5C88A 3GY9A 2ZW5A 3KKWA 3TO9A 4JJXA 2FIWA 4DNCA 4YRHA 4HNXB 2B5GA 5IB0A 1YVKA 2Q7BA 4KOXA 3H4QA 5HMNA 5J8CA 3SXNA 4HNWB 4KZTA 3I3GA 2D4OA 1M4IA 1BO4A 1NE9A 4AVAA 2Q0YA 3NE7A 3EO4A 2BL1A 4MJ8A 4F0YA 3C26A 2Q4YA 4Y49C 3CXSA 4L89A 3GYAA 4KVME 3D8PA 3FXTA 3VWEA 4E2AA 1I21A 5EC4A 4NEXA 2BSWA 1Y7RA 1XE4A 1XMTA 2JDDA 4KLWA 1TIQA 3PZJA 1MJ9A 1YLEA 4JLYA 2B5GB 4OLLA 4XNHB 4M3SA 2OZGA 3F5BA 4KOSA 1M4DA 4H6ZA 5HH1A 2VI7A 4UWJA 5CNPA 2FCKA 5F47A 2OZHA 2I79A 2PQ8A 4R9MA 4F6AA 4PSXA 3I9SA 2GE3A 2OU2A 2G3AA 3R9GA 1Y9WA 3E0KA 3MGDA 4U9ZA 4MY3A 3FIXA 2PRBA 2H5MA 4K30A 3VWDA 4JXRA 4FD7A 3V8IA 2ZW6A 1L0CA 1U6MA 4QB9A 3QB8A 4ORFA 3LD2A 2R8VA 4QUSA 4YGOA 1YVOA 1QSNA 5JPHA 1M4GA 3OWCA 4E0AA 3EC4A 3ZZIA 2Q4VA 1YR0A 2I00A 2O28A 2CNTA 3DR8A 4PK3A 2Z10A 1KUXA 4KOVA 4CAWA 4KOYA 2AJ6A 4XPDC 2OZUA 3FBUA 1V0CA 3T90A 2B3VA 4QC6A 3PP9A
chains in the Genus database with same CATH superfamily
3NFZA 3JVNA 2FVGA 2IL4A 2VBQA 1X12A 3FEDA 3SI1A 3R95A 1PUAA 1CX8A 1GHEA 2BEIA 4C2XA 1YW6A 2GU2A 1ZG7A 3DR6A 4R7MA 4CGMA 2X7BA 4FBEA 1KZFA 1M1DA 3FRMA 3PBBA 2POKA 4UCNA 4B5PB 5KTCA 3NE8A 4OC1A 2IJZA 3DNSA 2P6EA 3NH8A 1XEBA 2FL4A 1CPSA 4II9A 1YK3A 2EK8A 3DLJA 3IEHA 4PK2A 2FT0A 4IUSA 1M44A 3D3SA 1I12A 4PSWA 6CPAA 1KWMA 2F5IA 3TO6A 2B4BA 2XEGA 4B13A 4NGSA 2AFWA 2V8DA 1XMBA 4TNUA 2J8NA 3S6KA 4P4EA 2JEVA 3H8GA 4U5YA 3PFEA 2Z3OA 2Q7SA 3R9EA 4CYNA 4OC0A 1S7NA 1IICA 1DTDA 5HVHA 5I4MA 1BAVA 4A30A 2PJ8A 1IYLA 2C1CA 4A39A 3A9LA 4OAEA 4OC5A 2WZNA 2PRQA 1UWYA 3CT9A 3I1UA 2JBJA 1XF8A 4UFWA 2RC4A 4AVBA 5K8OA 1NMTA 2Q4ZA 4CGNA 3KZWA 3QAHA 5HVFA 3RYOA 5KTDA 3S9NA 4MHZA 3SJGA 3TOBA 5F49A 3UY5A 2CNMA 3H8EA 2FS5A 4DJLA 4A33A 4Q38A 1KUYA 3G3SA 1ZLHA 4KOTA 1Z5RA 2PR8A 2ZEOA 3PRTA 3S6FA 1UFHA 4OIDA 3DSBA 4Q36A 4CGOA 1FT7A 1Y9KA 4H6UA 2C6GA 2ABZA 3P2HA 2Q44A 3ISZA 4XPKA 2OB0A 2BUEA 2VEZA 1K4JA 3IC1A 3IU1A 4PXDA 3TTHA 4F9UA 4PV6A 4A2ZA 2CTBA 1ELMP 2REFA 2Z11A 4GM5A 4CAXA 4WJBA 2B4DA 1ELLP 1B6BA 4KOWA 1QSRA 4L8AA 4LQ6A 4MHDA 2PE3A 4FD6A 1CG2A 4UBRA 5AG4A 3WC5A 4P6YA 2RFHA 4CYPA 5D29A 1ZG8A 5DWMA 5DWNA 4ZI6A 1EE3P 4AVCA 2C27A 3B2YA 3FH4A 4OP4A 2WPXA 4YWYA 2AFOA 4X8IA 1NSAA 1Z9UA 2PJ0A 2XEFA 2YNDA 3CPAA 4MFZA 3ZJ0A 4UEEA 1QMUA 2V77A 2BCOA 1BPNA 2PVWA 2HC9A 1MJBA 4UWIA 2QYVA 3B35A 5LRKA 2IQ6A 2O4HA 1BLLE 4A31A 2CXAA 4MFQA 3D67A 4R3LA 3TT2A 4C7IA 4BINA 1XJOA 5J1QA 1QSOA 3GIUA 1S7FA 3TCVA 1TF8A 3GKRA 4YFJA 5JQ4A 1WK4A 4CRZB 4ZX9A 2GFQA 4MCQA 3SI0A 2FXFA 4MI4A 4A37A 4E8OA 2J8MA 3RNZA 5FVJA 1LAPA 4Y49B 3PBEA 2ZEGA 4KVOE 1I1DA 2V8GA 2ZEEA 4KSAA 3F8KA 1J4JA 1FY7A 4NGMA 2ZELA 4HPSA 3TE4A 3K2KA 4GXHA 3KGQA 2KCWA 4H89A 4KS9A 3BJ8A 5LRJA 4BD9A 2GIVA 2YNEA 4G1PA 4ONUA 1MJAA 1Z4RA 5H84A 4UA3A 4DUKA 3PB8X 2EBJA 2GANA 2CNSA 5EBVA 4ZX8A 3VARA 2Z0ZA 1XIXA 3IO1A 1NSLA 3GB0A 3QAYA 3FMCA 4ZBGA 4F8ZA 1B87A 5A27A 3D4UA 4Z65A 5K8NA 7CPAA 1H8LA 2R1IA 1P4NA 4RUHA 1Q2YA 3SJFA 3D7FA 3FVLA 1S60A 1Y0RA 3W6XA 4Q7AA 1Y7EA 1Z8LA 3RO0A 1Q2DA 1TKHA 2JDCA 2WSAA 3MRUA 2DXQA 4ZY2A 4FD5A 1AUGA 4A94A 2ZXVA 4KORA 2YNCC 1S5KA 5G22A 1P0HA 2Q43A 5IV0A 4CS0B 2OH1A 3K9UA 4CAEA 3KHZA 4MFKA 3IU2A 4NGQA 3FECA 4XNHC 2HQYA 4AG7A 4IF5A 2P6FA 1F2OA 2AFXA 3G8WA 1TXRA 3RAMA 4J3GA 4R3KA 2PJ6A 2CY2A 4KVXA 3CZXA 1Z4EA 2P0WA 5G21A 3V7ZA 2ANPA 4W9YA 4LUAA 5ELYA 4FAIA 4KOUA 2ATRA 2FIAA 1IYKA 2YNCA 4AG9A 1SQHA 1CP6A 2ZW7A 1PCAA 2EUIA 1CM0A 4B11A 3QNVA 1QSMA 2VZZA 4MHYA 4X5KA 3SJEA 1F57A 1QSTA 2R7HA 2PJ2A 2PJBA 3LWUA 5F46A 2PR1A 4OMEA 3TO7A 2VQYA 5KTAA 3R9FA 1Z8XA 1YQEA 1MK4A 3IWGA 3P2FA 4MHNA 3WT4A 2PVVA 1YGHA 2ZW4A 2JLMA 3IIBA 4M85A 3TFYA 3CXQA 3S6GA 1JQGA 4EMEA 2K5TA 5LYLA 3N7ZA 4CRYB 2D4PA 4QBJA 4KUBA 4ZY0A 2Q04A 3H5ZA 3W91A 1ZO0A 4MBUA 3EY5A 3W6SA 2AFSA 3D7DA 3IGRA 3HLPA 1R57A 5E96A 2PJ9A 4QVTA 4NXYA 4UF4A 5D8NA 3BJ7A 1KUVA 1HDUA 1VKCA 3JTKA 2B58A 1DE4C 3KR5A 4RS2A 4B10A 4EWTA 1YSJA 2Z3LA 4NSQA 4O23A 4K3NA 1OBRA 2XEIA 2A4NA 1S7LA 3KI9A 3PB9X 2Y0MA 4U9YA 2R98A 5LRGA 1LRZA 1YX0A 4NFRA 4A32A 3D66A 5JM6A 4XPDB 1Q2CA 4JYWA 3VATA 3S6HA 2G3TA 1IB1E 5K8PA 4KLVA 2FE7A 4MCSA 5THWA 3D2MA 2EWBA 1LAMA 2HUZA 4X3RA 4OADA 2C6CA 4A95A 4JWPA 5BWAB 4P4JA 4P4FA 5CBMA 3FJUA 1IGBA 3GLJA 4MFJA 1VIXA 4PQAA 1RXTA 1X10A 4NGTA 2PJ7A 3IFEA 4JZ0A 3KHXA 1S3ZA 4HNYB 3BHXA 1CP7A 2ZPAA 5I0CA 5CPAA 4CAVA 2EVNA 2VZYA 4EVYA 4KUAA 2PDOA 4P45A 5JGFA 2P6GA 3BI0A 1PU9A 3JUWA 1IOFA 2PJ3A 4I49A 1FNOA 2WUUA 3JRUA 4RI1A 3R96A 3T8WA 2NMTA 4R57A 2VXKA 4PXBA 4XPLA 3DDDA 1XBUA 1A2ZA 2DPSA 2V8HA 2G0BA 3D2PA 3LACA 4R87A 5K8MA 4C2YA 3RZAA 1TF9A 1YREA 4GS4A 2J8RA 3BLNA 4BMHA 5C82A 4R6TA 4JXQA 2PC1A 1OZPA 1N71A 1ARMA 2Z3NA 2PSWA 3BI1A 2GLFA 2G9DA 3CXPA 3N5FA 5F48A 2B4DB 2PJCA 2Z3MA 3FYNA 3T9YA 4AXVA 2REEA 2QMLA 3EXNA 1Z2LA 4WWVA 4NJRA 2ARHA 3LODA 5ISVA 5AG6A 3V38A 3EFAA 4P4IA 3CPXA 3SHPA 3SJXA 1Z8TA 5H86A 3PGPA 3B7IA 3FNCA 1TKFA 5GCNA 2XEJA 2Z3KA 1VHEA 3FF3A 3IWWA 4CGLA 3F0AA 4B5PA 4HKFA 1ON0A 4P44A 1CJWA 2WPWA 1BOBA 2QECA 2FSRA 2Q51A 3FX6A 4R8FA 3TOAA 4AB7A 1RTQA 2CIJA 3SXOA 5J8FA 3TX8A 4NF1A 2BO9A 1ARLA 2C6PA 1RO5A 3B8GA 4PXCA 4JD6A 4NJQA 1IIDA 3VH9A 1VHSA 3PFOA 2BOAA 2Z3PA 4LX9A 4FD4A 2GLJA 4CAFA 4OC4A 3KR4A 2HV2A 4ZYQA 3L2NA 4IHMA 1YW4A 2JEWA 4B14A 3PB6X 4B5OA 1S7KA 2B3UA 3FB3A 3NH4A 4UEFA 2GREA 1WWZA 1BPMA 5AG5A 2AE6A 4MCPA 1R3NA 3K9TA 3KQXA 2QJ8A 4UCMA 2NSMA 3R1KA 2ODFA 4X2TA 3WR7A 5IX3A 3KQZA 2QIRA 4MY0A 4NCZA 5C88A 3GY9A 2ZW5A 3KKWA 4P10A 3TO9A 4JJXA 5IB9A 2OR4A 2FIWA 4DNCA 4YRHA 4HNXB 2B5GA 2ZEFA 2ZENA 5IB0A 1YVKA 5HXDA 2Q7BA 4B6ZA 4KOXA 3H4QA 5HMNA 1F2PA 5J8CA 2CTCA 3SXNA 3FEEA 4HNWB 3NA6A 2V8VA 3ISXA 4KZTA 1TKJA 4FUUA 3I3GA 4R76A 5AG7A 5LYIA 2D4OA 4CPAA 1LCPA 1M4IA 4ONWA 1BO4A 3PB7X 3D7HA 1NE9A 4AVAA 3HUVA 2AFMA 2Q0YA 3NE7A 4NGPA 3B3CA 3KASA 3EO4A 2BL1A 4C7HA 4MJ8A 4UIAA 2WYRA 4TWEA 4LQGA 3WABA 4F0YA 5AGEA 3C26A 1LOKA 2Q4YA 2AFZA 2YGWA 4Y49C 1Q7LA 4CYQA 3CXSA 4L89A 3GYAA 1VHOA 4KVME 1IOIA 3D8PA 4F9VA 3KL9A 2PIYA 1XRYA 3FXTA 2ZEPA 3VWEA 1I21A 4E2AA 4P4BA 3D68A 3S9LA 4C68A 1GYTA 5JH9A 5EC4A 4MHPA 4NEXA 2BSWA 1XOVA 1Y7RA 4ZGYB 3BXMA 1XE4A 1XMTA 2JDDA 3IJ3A 4FWUA 4KLWA 4M6HA 1TIQA 3B3WA 3PZJA 5A28A 1MJ9A 1YLEA 1YLOA 3B3VA 4JLYA 2IMOA 2B5GB 1CBXA 4MXUA 4OLLA 2OOTA 4XNHB 2F7VA 3SI2A 4M3SA 2OZGA 2PJ1A 1CPXA 3F5BA 4KOSA 2O53A 2ZEDA 4YU9A 2ZOGA 1QQ9A 2J9AA 3PB4X 4M6IA 1M4DA 2QVPA 2DEAA 4H6ZA 5G1ZA 1IY7A 2PJAA 5HH1A 2PIZA 2VI7A 4OC2A 4UWJA 5CNPA 3RBUA 2CF4A 2EO8A 2FCKA 4PPZA 5EMIA 4M6GA 1HEEA 2VL1A 5F47A 5F09A 4IAVA 2OZHA 2I79A 4RN7A 4PXEA 4DYOA 2PQ8A 2ZEMA 4R9MA 4F6AA 4CGPA 4MFLA 4PSXA 3I9SA 8CPAA 2HB6A 5LYFA 2GE3A 2OU2A 2G3AA 3R9GA 1Y9WA 1ZLIA 3E0KA 3NH5A 4KSFA 3MGDA 4CYOA 3CDXA 4ZY1A 4EFDA 4U9ZA 4MY3A 4B12A 2NYQA 1ZG9A 4C2ZA 1AYEA 2F8HA 1AMPA 4UFXA 3FIXA 2PRBA 3LMSA 2H5MA 3WC7A 1IU8A 2DF5A 4K30A 2JBKA 2ZOFA 3VWDA 4NGRA 3TC8A 5LYDA 3S9MA 4JXRA 4OC3A 1PYTB 4FD7A 3GUXA 3V8IA 2ZW6A 1L0CA 1U6MA 4QB9A 4KSIA 4UEZA 3QB8A 3IWEA 4H2KA 4ORFA 4UIBA 5HVGA 3LD2A 3DGVA 3MN8A 4MRIA 2R8VA 1VGYA 4QUSA 4UFVA 4YGOA 4UCPA 4P4DA 1YVOA 3B3SA 1XFOA 1QSNA 1YMEA 1Z8WA 3D7GA 3WC6A 5JPHA 4MCRA 1R43A 4MFPA 1M4GA 1LFWA 3OWCA 3EC4A 3ZZIA 4E0AA 2Q4VA 1YR0A 2I00A 2O28A 4OKOA 4F0XA 2CNTA 2PCUA 3DR8A 5DS0A 5G20A 4IK2A 4PK3A 1LANA 4NGNA 2PJ4A 3B3TA 2Z10A 1KUXA 2AFUA 2I3CA 3PEIA 4KOVA 2RB7A 4OIWA 4KOYA 4CAWA 2DPTA 3H8FA 2AJ6A 4XPDC 4BBHA 1HDQA 2OZUA 1Y0YA 3FBUA 4A38A 1V0CA 1JWQA 3T90A 1M4LA 2ZEHA 2B3VA 4MMOA 4QC6A 2PJ5A 2EK9A 3PP9A
chains in the Genus database with same CATH topology
3JVNA 2IL4A 2VBQA 3R95A 1PUAA 1GHEA 2BEIA 4C2XA 3DR6A 4CGMA 2X7BA 1KZFA 1M1DA 3FRMA 4B5PB 5KTCA 4UCNA 3DNSA 2P6EA 1XEBA 2FL4A 4II9A 1YK3A 4PK2A 2FT0A 4IUSA 1M44A 3D3SA 1I12A 4PSWA 2F5IA 3TO6A 2B4BA 4B13A 2J8NA 3S6KA 2JEVA 4U5YA 2Z3OA 3R9EA 4CYNA 1S7NA 1IICA 4A30A 1IYLA 3A9LA 4OAEA 4AVBA 4UFWA 1XF8A 2RC4A 1NMTA 4CGNA 5KTDA 3QAHA 3RYOA 3TOBA 5F49A 3UY5A 2CNMA 2FS5A 4A33A 4Q38A 1KUYA 3G3SA 4KOTA 2PR8A 3S6FA 1UFHA 3DSBA 4Q36A 4CGOA 1Y9KA 4H6UA 3P2HA 2Q44A 4XPKA 2OB0A 2BUEA 2VEZA 1K4JA 3IU1A 3TTHA 4PV6A 4A2ZA 2Z11A 2REFA 4CAXA 2B4DA 4KOWA 1B6BA 1QSRA 4L8AA 4MHDA 4FD6A 4UBRA 5AG4A 4CYPA 5DWMA 5DWNA 4AVCA 2C27A 2WPXA 2YNDA 1Z9UA 4MFZA 3ZJ0A 1MJBA 4UWIA 4A31A 2CXAA 4MFQA 4R3LA 3TT2A 4C7IA 1QSOA 1S7FA 3TCVA 3GKRA 4YFJA 5JQ4A 1WK4A 4CRZB 2FXFA 4MI4A 2J8MA 5FVJA 4Y49B 4KVOE 1I1DA 4KSAA 3F8KA 1J4JA 1FY7A 3TE4A 4H89A 2KCWA 4KS9A 3BJ8A 2GIVA 2YNEA 4ONUA 1MJAA 1Z4RA 5H84A 4UA3A 2GANA 2CNSA 5EBVA 2Z0ZA 1XIXA 1NSLA 4ZBGA 5A27A 1B87A 2R1IA 1P4NA 1Q2YA 1S60A 3W6XA 1Q2DA 2WSAA 2JDCA 2DXQA 4FD5A 2ZXVA 4KORA 2YNCC 1S5KA 5G22A 1P0HA 5IV0A 4CS0B 2OH1A 3K9UA 4CAEA 4MFKA 3IU2A 4XNHC 2HQYA 4AG7A 4IF5A 2P6FA 3G8WA 4J3GA 4R3KA 2CY2A 4KVXA 1Z4EA 2P0WA 5G21A 4LUAA 4KOUA 2ATRA 2FIAA 1IYKA 2YNCA 4AG9A 1SQHA 2ZW7A 2EUIA 1CM0A 4B11A 1QSMA 2VZZA 4X5KA 1QSTA 2R7HA 5F46A 2PR1A 3TO7A 2VQYA 5KTAA 3R9FA 1MK4A 3IWGA 3P2FA 1YGHA 2ZW4A 2JLMA 4M85A 3TFYA 3CXQA 3S6GA 2K5TA 3N7ZA 4CRYB 2D4PA 4QBJA 4KUBA 2Q04A 3H5ZA 3W91A 1ZO0A 4MBUA 3EY5A 3W6SA 3IGRA 5E96A 1R57A 4QVTA 4NXYA 3BJ7A 1KUVA 1VKCA 3JTKA 2B58A 4RS2A 4B10A 2Z3LA 4NSQA 2A4NA 1S7LA 2Y0MA 4U9YA 2R98A 4A32A 1LRZA 1YX0A 4XPDB 1Q2CA 3S6HA 2G3TA 1IB1E 4KLVA 2FE7A 3D2MA 2HUZA 4OADA 4A95A 4JWPA 5BWAB 4MFJA 1RXTA 1S3ZA 4HNYB 5I0CA 2ZPAA 4CAVA 2EVNA 2VZYA 4EVYA 4KUAA 2PDOA 2P6GA 1PU9A 3JUWA 4I49A 4RI1A 2WUUA 3R96A 2NMTA 4R57A 2VXKA 4XPLA 3DDDA 2DPSA 2G0BA 3D2PA 4R87A 4C2YA 1YREA 4GS4A 2J8RA 3BLNA 4BMHA 5C82A 4JXQA 2PC1A 1OZPA 1N71A 2Z3NA 2PSWA 3CXPA 5F48A 2B4DB 2Z3MA 3FYNA 3T9YA 2REEA 2QMLA 3EXNA 2ARHA 3LODA 5ISVA 5AG6A 3EFAA 3SHPA 5H86A 3PGPA 3FNCA 5GCNA 2Z3KA 4CGLA 3F0AA 4B5PA 4HKFA 1ON0A 1CJWA 2WPWA 1BOBA 2QECA 2FSRA 3TOAA 4AB7A 4E8OA 3SXOA 5J8FA 4NF1A 3B8GA 1RO5A 4JD6A 1IIDA 1VHSA 2Z3PA 4LX9A 4FD4A 4CAFA 2HV2A 4B14A 4B5OA 1S7KA 2B3UA 3FB3A 1WWZA 5AG5A 2AE6A 4UCMA 3R1KA 5IX3A 3WR7A 2QIRA 4MY0A 4NCZA 5C88A 3GY9A 2ZW5A 3KKWA 3TO9A 4JJXA 2FIWA 4DNCA 4YRHA 4HNXB 2B5GA 5IB0A 1YVKA 2Q7BA 4KOXA 3H4QA 5HMNA 5J8CA 3SXNA 4HNWB 4KZTA 3I3GA 5AG7A 2D4OA 1M4IA 1BO4A 1NE9A 4AVAA 2Q0YA 3NE7A 3EO4A 2BL1A 4C7HA 4MJ8A 4F0YA 5AGEA 3C26A 2Q4YA 2YGWA 4Y49C 4CYQA 3CXSA 4L89A 3GYAA 4KVME 3D8PA 3FXTA 3VWEA 4E2AA 1I21A 4C68A 5EC4A 4NEXA 2BSWA 4ZGYB 1Y7RA 1XE4A 1XMTA 2JDDA 4KLWA 1TIQA 3PZJA 5A28A 1MJ9A 1YLEA 4JLYA 2B5GB 4OLLA 4XNHB 4M3SA 2OZGA 3F5BA 4KOSA 5G1ZA 1M4DA 4H6ZA 5HH1A 4F0XA 2VI7A 4UWJA 5CNPA 2FCKA 5F47A 2OZHA 2I79A 2PQ8A 4R9MA 4F6AA 4CGPA 4MFLA 4PSXA 3I9SA 2GE3A 2OU2A 2G3AA 3R9GA 1Y9WA 3E0KA 4CYOA 4KSFA 3MGDA 4U9ZA 4MY3A 4B12A 4C2ZA 4UFXA 3FIXA 2PRBA 2H5MA 4K30A 3VWDA 4JXRA 4FD7A 3V8IA 2ZW6A 1L0CA 1U6MA 4QB9A 3QB8A 3IWEA 4ORFA 3LD2A 2R8VA 4QUSA 4UFVA 4YGOA 4UCPA 1YVOA 1QSNA 5JPHA 4MFPA 1M4GA 3OWCA 4E0AA 3EC4A 3ZZIA 2Q4VA 1YR0A 2I00A 2O28A 2CNTA 3DR8A 5G20A 4PK3A 2Z10A 1KUXA 4KOVA 4CAWA 4KOYA 2DPTA 2AJ6A 4XPDC 4BBHA 2OZUA 3FBUA 1V0CA 3T90A 2B3VA 4QC6A 3PP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JVN A;  2IL4 A;  2VBQ A;  3R95 A;  1PUA A;  1GHE A;  2BEI A;  3DR6 A;  2X7B A;  1KZF A;  1M1D A;  3FRM A;  4B5P B;  5KTC A;  3DNS A;  2P6E A;  1XEB A;  2FL4 A;  4II9 A;  1YK3 A;  4PK2 A;  2FT0 A;  4IUS A;  1M44 A;  3D3S A;  1I12 A;  4PSW A;  2F5I A;  3TO6 A;  2B4B A;  2J8N A;  3S6K A;  2JEV A;  4U5Y A;  3R9E A;  1S7N A;  1IIC A;  1IYL A;  4OAE A;  4AVB A;  1XF8 A;  2RC4 A;  1NMT A;  5KTD A;  3QAH A;  3RYO A;  3TOB A;  5F49 A;  3UY5 A;  2CNM A;  2FS5 A;  1KUY A;  3G3S A;  4KOT A;  2PR8 A;  3S6F A;  1UFH A;  3DSB A;  1Y9K A;  4H6U A;  3P2H A;  2Q44 A;  4XPK A;  2OB0 A;  2BUE A;  2VEZ A;  1K4J A;  3TTH A;  4PV6 A;  2Z11 A;  2REF A;  4CAX A;  2B4D A;  4KOW A;  1B6B A;  1QSR A;  4L8A A;  4MHD A;  4FD6 A;  4UBR A;  5DWM A;  5DWN A;  4AVC A;  2C27 A;  2WPX A;  1Z9U A;  3ZJ0 A;  1MJB A;  4UWI A;  4R3L A;  3TT2 A;  1QSO A;  1S7F A;  3TCV A;  3GKR A;  4YFJ A;  5JQ4 A;  1WK4 A;  4CRZ B;  2FXF A;  4MI4 A;  2J8M A;  5FVJ A;  4Y49 B;  4KVO E;  1I1D A;  3F8K A;  1J4J A;  1FY7 A;  3TE4 A;  4H89 A;  2KCW A;  3BJ8 A;  2GIV A;  4ONU A;  1MJA A;  1Z4R A;  5H84 A;  4UA3 A;  2GAN A;  2CNS A;  5EBV A;  2Z0Z A;  1XIX A;  1NSL A;  4ZBG A;  1B87 A;  2R1I A;  1P4N A;  1Q2Y A;  1S60 A;  3W6X A;  1Q2D A;  2JDC A;  2DXQ A;  4FD5 A;  2ZXV A;  4KOR A;  1S5K A;  5IV0 A;  1P0H A;  4CS0 B;  2OH1 A;  3K9U A;  4XNH C;  2HQY A;  4AG7 A;  4IF5 A;  2P6F A;  3G8W A;  4J3G A;  4R3K A;  2CY2 A;  4KVX A;  1Z4E A;  2P0W A;  4LUA A;  4KOU A;  2ATR A;  2FIA A;  1IYK A;  4AG9 A;  1SQH A;  2ZW7 A;  2EUI A;  1CM0 A;  1QSM A;  2VZZ A;  4X5K A;  1QST A;  2R7H A;  5F46 A;  2PR1 A;  3TO7 A;  2VQY A;  5KTA A;  3R9F A;  1MK4 A;  3IWG A;  3P2F A;  1YGH A;  2ZW4 A;  2JLM A;  4M85 A;  3TFY A;  3CXQ A;  3S6G A;  2K5T A;  3N7Z A;  4CRY B;  2D4P A;  4QBJ A;  4KUB A;  2Q04 A;  3W91 A;  4MBU A;  3EY5 A;  3W6S A;  3IGR A;  5E96 A;  1R57 A;  4QVT A;  4NXY A;  3BJ7 A;  1KUV A;  1VKC A;  2B58 A;  4RS2 A;  4NSQ A;  2A4N A;  1S7L A;  2Y0M A;  4U9Y A;  2R98 A;  1LRZ A;  1YX0 A;  4XPD B;  1Q2C A;  3S6H A;  2G3T A;  1IB1 E;  4KLV A;  2FE7 A;  3D2M A;  2HUZ A;  4OAD A;  4JWP A;  1RXT A;  1S3Z A;  4HNY B;  5I0C A;  2ZPA A;  4CAV A;  2EVN A;  2VZY A;  4EVY A;  4KUA A;  2PDO A;  2P6G A;  1PU9 A;  3JUW A;  4I49 A;  4RI1 A;  3R96 A;  2NMT A;  4R57 A;  2VXK A;  4XPL A;  3DDD A;  2G0B A;  3D2P A;  4R87 A;  1YRE A;  4GS4 A;  2J8R A;  3BLN A;  4BMH A;  5C82 A;  4JXQ A;  2PC1 A;  1OZP A;  1N71 A;  2PSW A;  3CXP A;  5F48 A;  2B4D B;  3FYN A;  3T9Y A;  2REE A;  2QML A;  3EXN A;  2ARH A;  3LOD A;  5ISV A;  3EFA A;  3SHP A;  5H86 A;  3PGP A;  3FNC A;  5GCN A;  3F0A A;  4B5P A;  4HKF A;  1ON0 A;  1CJW A;  2WPW A;  1BOB A;  2QEC A;  2FSR A;  3TOA A;  4AB7 A;  4E8O A;  3SXO A;  5J8F A;  4NF1 A;  3B8G A;  1RO5 A;  4JD6 A;  1IID A;  1VHS A;  4LX9 A;  4FD4 A;  2HV2 A;  4B5O A;  1S7K A;  2B3U A;  3FB3 A;  1WWZ A;  2AE6 A;  3R1K A;  5IX3 A;  3WR7 A;  2QIR A;  4MY0 A;  4NCZ A;  5C88 A;  3GY9 A;  2ZW5 A;  3KKW A;  3TO9 A;  4JJX A;  2FIW A;  4DNC A;  4YRH A;  4HNX B;  2B5G A;  5IB0 A;  1YVK A;  2Q7B A;  4KOX A;  3H4Q A;  5HMN A;  5J8C A;  3SXN A;  4HNW B;  4KZT A;  3I3G A;  2D4O A;  1M4I A;  1BO4 A;  1NE9 A;  4AVA A;  2Q0Y A;  3NE7 A;  3EO4 A;  2BL1 A;  4MJ8 A;  4F0Y A;  3C26 A;  2Q4Y A;  4Y49 C;  3CXS A;  4L89 A;  3GYA A;  4KVM E;  3D8P A;  3FXT A;  3VWE A;  4E2A A;  1I21 A;  5EC4 A;  4NEX A;  2BSW A;  1Y7R A;  1XE4 A;  1XMT A;  2JDD A;  4KLW A;  1TIQ A;  3PZJ A;  1MJ9 A;  1YLE A;  4JLY A;  2B5G B;  4OLL A;  4XNH B;  4M3S A;  2OZG A;  3F5B A;  4KOS A;  1M4D A;  4H6Z A;  5HH1 A;  2VI7 A;  4UWJ A;  5CNP A;  2FCK A;  5F47 A;  2OZH A;  2I79 A;  2PQ8 A;  4R9M A;  4F6A A;  4PSX A;  3I9S A;  2GE3 A;  2OU2 A;  2G3A A;  3R9G A;  1Y9W A;  3E0K A;  3MGD A;  4U9Z A;  4MY3 A;  3FIX A;  2PRB A;  2H5M A;  4K30 A;  3VWD A;  4JXR A;  4FD7 A;  3V8I A;  2ZW6 A;  1L0C A;  1U6M A;  4QB9 A;  3QB8 A;  4ORF A;  3LD2 A;  2R8V A;  4QUS A;  4YGO A;  1YVO A;  1QSN A;  5JPH A;  1M4G A;  3OWC A;  4E0A A;  3EC4 A;  3ZZI A;  2Q4V A;  1YR0 A;  2I00 A;  2O28 A;  2CNT A;  3DR8 A;  4PK3 A;  2Z10 A;  1KUX A;  4KOV A;  4CAW A;  4KOY A;  2AJ6 A;  4XPD C;  2OZU A;  3FBU A;  1V0C A;  3T90 A;  2B3V A;  4QC6 A;  3PP9 A; 
#chains in the Genus database with same CATH topology
 3NFZ A;  3JVN A;  2FVG A;  2IL4 A;  2VBQ A;  1X12 A;  3FED A;  3SI1 A;  3R95 A;  1PUA A;  1CX8 A;  1GHE A;  2BEI A;  4C2X A;  1YW6 A;  2GU2 A;  1ZG7 A;  3DR6 A;  4R7M A;  4CGM A;  2X7B A;  4FBE A;  1KZF A;  1M1D A;  3FRM A;  3PBB A;  2POK A;  4UCN A;  4B5P B;  5KTC A;  3NE8 A;  4OC1 A;  2IJZ A;  3DNS A;  2P6E A;  3NH8 A;  1XEB A;  2FL4 A;  1CPS A;  4II9 A;  1YK3 A;  2EK8 A;  3DLJ A;  3IEH A;  4PK2 A;  2FT0 A;  4IUS A;  1M44 A;  3D3S A;  1I12 A;  4PSW A;  6CPA A;  1KWM A;  2F5I A;  3TO6 A;  2B4B A;  2XEG A;  4B13 A;  4NGS A;  2AFW A;  2V8D A;  1XMB A;  4TNU A;  2J8N A;  3S6K A;  4P4E A;  2JEV A;  3H8G A;  4U5Y A;  3PFE A;  2Z3O A;  2Q7S A;  3R9E A;  4CYN A;  4OC0 A;  1S7N A;  1IIC A;  1DTD A;  5HVH A;  5I4M A;  1BAV A;  4A30 A;  2PJ8 A;  1IYL A;  2C1C A;  4A39 A;  3A9L A;  4OAE A;  4OC5 A;  2WZN A;  2PRQ A;  1UWY A;  3CT9 A;  3I1U A;  2JBJ A;  1XF8 A;  4UFW A;  2RC4 A;  4AVB A;  5K8O A;  1NMT A;  2Q4Z A;  4CGN A;  3KZW A;  3QAH A;  5HVF A;  3RYO A;  5KTD A;  3S9N A;  4MHZ A;  3SJG A;  3TOB A;  5F49 A;  3UY5 A;  2CNM A;  3H8E A;  2FS5 A;  4DJL A;  4A33 A;  4Q38 A;  1KUY A;  3G3S A;  1ZLH A;  4KOT A;  1Z5R A;  2PR8 A;  2ZEO A;  3PRT A;  3S6F A;  1UFH A;  4OID A;  3DSB A;  4Q36 A;  4CGO A;  1FT7 A;  1Y9K A;  4H6U A;  2C6G A;  2ABZ A;  3P2H A;  2Q44 A;  3ISZ A;  4XPK A;  2OB0 A;  2BUE A;  2VEZ A;  1K4J A;  3IC1 A;  3IU1 A;  4PXD A;  3TTH A;  4F9U A;  4PV6 A;  4A2Z A;  2CTB A;  1ELM P;  2REF A;  2Z11 A;  4GM5 A;  4CAX A;  4WJB A;  2B4D A;  1ELL P;  1B6B A;  4KOW A;  1QSR A;  4L8A A;  4LQ6 A;  4MHD A;  2PE3 A;  4FD6 A;  1CG2 A;  4UBR A;  5AG4 A;  3WC5 A;  4P6Y A;  2RFH A;  4CYP A;  5D29 A;  1ZG8 A;  5DWM A;  5DWN A;  4ZI6 A;  1EE3 P;  4AVC A;  2C27 A;  3B2Y A;  3FH4 A;  4OP4 A;  2WPX A;  4YWY A;  2AFO A;  4X8I A;  1NSA A;  1Z9U A;  2PJ0 A;  2XEF A;  2YND A;  3CPA A;  4MFZ A;  3ZJ0 A;  4UEE A;  1QMU A;  2V77 A;  2BCO A;  1BPN A;  2PVW A;  2HC9 A;  1MJB A;  4UWI A;  2QYV A;  3B35 A;  5LRK A;  2IQ6 A;  2O4H A;  1BLL E;  4A31 A;  2CXA A;  4MFQ A;  3D67 A;  4R3L A;  3TT2 A;  4C7I A;  4BIN A;  1XJO A;  5J1Q A;  1QSO A;  3GIU A;  1S7F A;  3TCV A;  1TF8 A;  3GKR A;  4YFJ A;  5JQ4 A;  1WK4 A;  4CRZ B;  4ZX9 A;  2GFQ A;  4MCQ A;  3SI0 A;  2FXF A;  4MI4 A;  4A37 A;  4E8O A;  2J8M A;  3RNZ A;  5FVJ A;  1LAP A;  4Y49 B;  3PBE A;  2ZEG A;  4KVO E;  1I1D A;  2V8G A;  2ZEE A;  4KSA A;  3F8K A;  1J4J A;  1FY7 A;  4NGM A;  2ZEL A;  4HPS A;  3TE4 A;  3K2K A;  4GXH A;  3KGQ A;  2KCW A;  4H89 A;  4KS9 A;  3BJ8 A;  5LRJ A;  4BD9 A;  2GIV A;  2YNE A;  4G1P A;  4ONU A;  1MJA A;  1Z4R A;  5H84 A;  4UA3 A;  4DUK A;  3PB8 X;  2EBJ A;  2GAN A;  2CNS A;  5EBV A;  4ZX8 A;  3VAR A;  2Z0Z A;  1XIX A;  3IO1 A;  1NSL A;  3GB0 A;  3QAY A;  3FMC A;  4ZBG A;  4F8Z A;  1B87 A;  5A27 A;  3D4U A;  4Z65 A;  5K8N A;  7CPA A;  1H8L A;  2R1I A;  1P4N A;  4RUH A;  1Q2Y A;  3SJF A;  3D7F A;  3FVL A;  1S60 A;  1Y0R A;  3W6X A;  4Q7A A;  1Y7E A;  1Z8L A;  3RO0 A;  1Q2D A;  1TKH A;  2JDC A;  2WSA A;  3MRU A;  2DXQ A;  4ZY2 A;  4FD5 A;  1AUG A;  4A94 A;  2ZXV A;  4KOR A;  2YNC C;  1S5K A;  5G22 A;  1P0H A;  2Q43 A;  5IV0 A;  4CS0 B;  2OH1 A;  3K9U A;  4CAE A;  3KHZ A;  4MFK A;  3IU2 A;  4NGQ A;  3FEC A;  4XNH C;  2HQY A;  4AG7 A;  4IF5 A;  2P6F A;  1F2O A;  2AFX A;  3G8W A;  1TXR A;  3RAM A;  4J3G A;  4R3K A;  2PJ6 A;  2CY2 A;  4KVX A;  3CZX A;  1Z4E A;  2P0W A;  5G21 A;  3V7Z A;  2ANP A;  4W9Y A;  4LUA A;  5ELY A;  4FAI A;  4KOU A;  2ATR A;  2FIA A;  1IYK A;  2YNC A;  4AG9 A;  1SQH A;  1CP6 A;  2ZW7 A;  1PCA A;  2EUI A;  1CM0 A;  4B11 A;  3QNV A;  1QSM A;  2VZZ A;  4MHY A;  4X5K A;  3SJE A;  1F57 A;  1QST A;  2R7H A;  2PJ2 A;  2PJB A;  3LWU A;  5F46 A;  2PR1 A;  4OME A;  3TO7 A;  2VQY A;  5KTA A;  3R9F A;  1Z8X A;  1YQE A;  1MK4 A;  3IWG A;  3P2F A;  4MHN A;  3WT4 A;  2PVV A;  1YGH A;  2ZW4 A;  2JLM A;  3IIB A;  4M85 A;  3TFY A;  3CXQ A;  3S6G A;  1JQG A;  4EME A;  2K5T A;  5LYL A;  3N7Z A;  4CRY B;  2D4P A;  4QBJ A;  4KUB A;  4ZY0 A;  2Q04 A;  3H5Z A;  3W91 A;  1ZO0 A;  4MBU A;  3EY5 A;  3W6S A;  2AFS A;  3D7D A;  3IGR A;  3HLP A;  1R57 A;  5E96 A;  2PJ9 A;  4QVT A;  4NXY A;  4UF4 A;  5D8N A;  3BJ7 A;  1KUV A;  1HDU A;  1VKC A;  3JTK A;  2B58 A;  1DE4 C;  3KR5 A;  4RS2 A;  4B10 A;  4EWT A;  1YSJ A;  2Z3L A;  4NSQ A;  4O23 A;  4K3N A;  1OBR A;  2XEI A;  2A4N A;  1S7L A;  3KI9 A;  3PB9 X;  2Y0M A;  4U9Y A;  2R98 A;  5LRG A;  1LRZ A;  1YX0 A;  4NFR A;  4A32 A;  3D66 A;  5JM6 A;  4XPD B;  1Q2C A;  4JYW A;  3VAT A;  3S6H A;  2G3T A;  1IB1 E;  5K8P A;  4KLV A;  2FE7 A;  4MCS A;  5THW A;  3D2M A;  2EWB A;  1LAM A;  2HUZ A;  4X3R A;  4OAD A;  2C6C A;  4A95 A;  4JWP A;  5BWA B;  4P4J A;  4P4F A;  5CBM A;  3FJU A;  1IGB A;  3GLJ A;  4MFJ A;  1VIX A;  4PQA A;  1RXT A;  1X10 A;  4NGT A;  2PJ7 A;  3IFE A;  4JZ0 A;  3KHX A;  1S3Z A;  4HNY B;  3BHX A;  1CP7 A;  2ZPA A;  5I0C A;  5CPA A;  4CAV A;  2EVN A;  2VZY A;  4EVY A;  4KUA A;  2PDO A;  4P45 A;  5JGF A;  2P6G A;  3BI0 A;  1PU9 A;  3JUW A;  1IOF A;  2PJ3 A;  4I49 A;  1FNO A;  2WUU A;  3JRU A;  4RI1 A;  3R96 A;  3T8W A;  2NMT A;  4R57 A;  2VXK A;  4PXB A;  4XPL A;  3DDD A;  1XBU A;  1A2Z A;  2DPS A;  2V8H A;  2G0B A;  3D2P A;  3LAC A;  4R87 A;  5K8M A;  4C2Y A;  3RZA A;  1TF9 A;  1YRE A;  4GS4 A;  2J8R A;  3BLN A;  4BMH A;  5C82 A;  4R6T A;  4JXQ A;  2PC1 A;  1OZP A;  1N71 A;  1ARM A;  2Z3N A;  2PSW A;  3BI1 A;  2GLF A;  2G9D A;  3CXP A;  3N5F A;  5F48 A;  2B4D B;  2PJC A;  2Z3M A;  3FYN A;  3T9Y A;  4AXV A;  2REE A;  2QML A;  3EXN A;  1Z2L A;  4WWV A;  4NJR A;  2ARH A;  3LOD A;  5ISV A;  5AG6 A;  3V38 A;  3EFA A;  4P4I A;  3CPX A;  3SHP A;  3SJX A;  1Z8T A;  5H86 A;  3PGP A;  3B7I A;  3FNC A;  1TKF A;  5GCN A;  2XEJ A;  2Z3K A;  1VHE A;  3FF3 A;  3IWW A;  4CGL A;  3F0A A;  4B5P A;  4HKF A;  1ON0 A;  4P44 A;  1CJW A;  2WPW A;  1BOB A;  2QEC A;  2FSR A;  2Q51 A;  3FX6 A;  4R8F A;  3TOA A;  4AB7 A;  1RTQ A;  2CIJ A;  3SXO A;  5J8F A;  3TX8 A;  4NF1 A;  2BO9 A;  1ARL A;  2C6P A;  1RO5 A;  3B8G A;  4PXC A;  4JD6 A;  4NJQ A;  1IID A;  3VH9 A;  1VHS A;  3PFO A;  2BOA A;  2Z3P A;  4LX9 A;  4FD4 A;  2GLJ A;  4CAF A;  4OC4 A;  3KR4 A;  2HV2 A;  4ZYQ A;  3L2N A;  4IHM A;  1YW4 A;  2JEW A;  4B14 A;  3PB6 X;  4B5O A;  1S7K A;  2B3U A;  3FB3 A;  3NH4 A;  4UEF A;  2GRE A;  1WWZ A;  1BPM A;  5AG5 A;  2AE6 A;  4MCP A;  1R3N A;  3K9T A;  3KQX A;  2QJ8 A;  4UCM A;  2NSM A;  3R1K A;  2ODF A;  4X2T A;  3WR7 A;  5IX3 A;  3KQZ A;  2QIR A;  4MY0 A;  4NCZ A;  5C88 A;  3GY9 A;  2ZW5 A;  3KKW A;  4P10 A;  3TO9 A;  4JJX A;  5IB9 A;  2OR4 A;  2FIW A;  4DNC A;  4YRH A;  4HNX B;  2B5G A;  2ZEF A;  2ZEN A;  5IB0 A;  1YVK A;  5HXD A;  2Q7B A;  4B6Z A;  4KOX A;  3H4Q A;  5HMN A;  1F2P A;  5J8C A;  2CTC A;  3SXN A;  3FEE A;  4HNW B;  3NA6 A;  2V8V A;  3ISX A;  4KZT A;  1TKJ A;  4FUU A;  3I3G A;  4R76 A;  5AG7 A;  5LYI A;  2D4O A;  4CPA A;  1LCP A;  1M4I A;  4ONW A;  1BO4 A;  3PB7 X;  3D7H A;  1NE9 A;  4AVA A;  3HUV A;  2AFM A;  2Q0Y A;  3NE7 A;  4NGP A;  3B3C A;  3KAS A;  3EO4 A;  2BL1 A;  4C7H A;  4MJ8 A;  4UIA A;  2WYR A;  4TWE A;  4LQG A;  3WAB A;  4F0Y A;  5AGE A;  3C26 A;  1LOK A;  2Q4Y A;  2AFZ A;  2YGW A;  4Y49 C;  1Q7L A;  4CYQ A;  3CXS A;  4L89 A;  3GYA A;  1VHO A;  4KVM E;  1IOI A;  3D8P A;  4F9V A;  3KL9 A;  2PIY A;  1XRY A;  3FXT A;  2ZEP A;  3VWE A;  1I21 A;  4E2A A;  4P4B A;  3D68 A;  3S9L A;  4C68 A;  1GYT A;  5JH9 A;  5EC4 A;  4MHP A;  4NEX A;  2BSW A;  1XOV A;  1Y7R A;  4ZGY B;  3BXM A;  1XE4 A;  1XMT A;  2JDD A;  3IJ3 A;  4FWU A;  4KLW A;  4M6H A;  1TIQ A;  3B3W A;  3PZJ A;  5A28 A;  1MJ9 A;  1YLE A;  1YLO A;  3B3V A;  4JLY A;  2IMO A;  2B5G B;  1CBX A;  4MXU A;  4OLL A;  2OOT A;  4XNH B;  2F7V A;  3SI2 A;  4M3S A;  2OZG A;  2PJ1 A;  1CPX A;  3F5B A;  4KOS A;  2O53 A;  2ZED A;  4YU9 A;  2ZOG A;  1QQ9 A;  2J9A A;  3PB4 X;  4M6I A;  1M4D A;  2QVP A;  2DEA A;  4H6Z A;  5G1Z A;  1IY7 A;  2PJA A;  5HH1 A;  2PIZ A;  2VI7 A;  4OC2 A;  4UWJ A;  5CNP A;  3RBU A;  2CF4 A;  2EO8 A;  2FCK A;  4PPZ A;  5EMI A;  4M6G A;  1HEE A;  2VL1 A;  5F47 A;  5F09 A;  4IAV A;  2OZH A;  2I79 A;  4RN7 A;  4PXE A;  4DYO A;  2PQ8 A;  2ZEM A;  4R9M A;  4F6A A;  4CGP A;  4MFL A;  4PSX A;  3I9S A;  8CPA A;  2HB6 A;  5LYF A;  2GE3 A;  2OU2 A;  2G3A A;  3R9G A;  1Y9W A;  1ZLI A;  3E0K A;  3NH5 A;  4KSF A;  3MGD A;  4CYO A;  3CDX A;  4ZY1 A;  4EFD A;  4U9Z A;  4MY3 A;  4B12 A;  2NYQ A;  1ZG9 A;  4C2Z A;  1AYE A;  2F8H A;  1AMP A;  4UFX A;  3FIX A;  2PRB A;  3LMS A;  2H5M A;  3WC7 A;  1IU8 A;  2DF5 A;  4K30 A;  2JBK A;  2ZOF A;  3VWD A;  4NGR A;  3TC8 A;  5LYD A;  3S9M A;  4JXR A;  4OC3 A;  1PYT B;  4FD7 A;  3GUX A;  3V8I A;  2ZW6 A;  1L0C A;  1U6M A;  4QB9 A;  4KSI A;  4UEZ A;  3QB8 A;  3IWE A;  4H2K A;  4ORF A;  4UIB A;  5HVG A;  3LD2 A;  3DGV A;  3MN8 A;  4MRI A;  2R8V A;  1VGY A;  4QUS A;  4UFV A;  4YGO A;  4UCP A;  4P4D A;  1YVO A;  3B3S A;  1XFO A;  1QSN A;  1YME A;  1Z8W A;  3D7G A;  3WC6 A;  5JPH A;  4MCR A;  1R43 A;  4MFP A;  1M4G A;  1LFW A;  3OWC A;  3EC4 A;  3ZZI A;  4E0A A;  2Q4V A;  1YR0 A;  2I00 A;  2O28 A;  4OKO A;  4F0X A;  2CNT A;  2PCU A;  3DR8 A;  5DS0 A;  5G20 A;  4IK2 A;  4PK3 A;  1LAN A;  4NGN A;  2PJ4 A;  3B3T A;  2Z10 A;  1KUX A;  2AFU A;  2I3C A;  3PEI A;  4KOV A;  2RB7 A;  4OIW A;  4KOY A;  4CAW A;  2DPT A;  3H8F A;  2AJ6 A;  4XPD C;  4BBH A;  1HDQ A;  2OZU A;  1Y0Y A;  3FBU A;  4A38 A;  1V0C A;  1JWQ A;  3T90 A;  1M4L A;  2ZEH A;  2B3V A;  4MMO A;  4QC6 A;  2PJ5 A;  2EK9 A;  3PP9 A; 
#chains in the Genus database with same CATH homology
 3JVN A;  2IL4 A;  2VBQ A;  3R95 A;  1PUA A;  1GHE A;  2BEI A;  4C2X A;  3DR6 A;  4CGM A;  2X7B A;  1KZF A;  1M1D A;  3FRM A;  4B5P B;  5KTC A;  4UCN A;  3DNS A;  2P6E A;  1XEB A;  2FL4 A;  4II9 A;  1YK3 A;  4PK2 A;  2FT0 A;  4IUS A;  1M44 A;  3D3S A;  1I12 A;  4PSW A;  2F5I A;  3TO6 A;  2B4B A;  4B13 A;  2J8N A;  3S6K A;  2JEV A;  4U5Y A;  2Z3O A;  3R9E A;  4CYN A;  1S7N A;  1IIC A;  4A30 A;  1IYL A;  3A9L A;  4OAE A;  4AVB A;  4UFW A;  1XF8 A;  2RC4 A;  1NMT A;  4CGN A;  5KTD A;  3QAH A;  3RYO A;  3TOB A;  5F49 A;  3UY5 A;  2CNM A;  2FS5 A;  4A33 A;  4Q38 A;  1KUY A;  3G3S A;  4KOT A;  2PR8 A;  3S6F A;  1UFH A;  3DSB A;  4Q36 A;  4CGO A;  1Y9K A;  4H6U A;  3P2H A;  2Q44 A;  4XPK A;  2OB0 A;  2BUE A;  2VEZ A;  1K4J A;  3IU1 A;  3TTH A;  4PV6 A;  4A2Z A;  2Z11 A;  2REF A;  4CAX A;  2B4D A;  4KOW A;  1B6B A;  1QSR A;  4L8A A;  4MHD A;  4FD6 A;  4UBR A;  5AG4 A;  4CYP A;  5DWM A;  5DWN A;  4AVC A;  2C27 A;  2WPX A;  2YND A;  1Z9U A;  4MFZ A;  3ZJ0 A;  1MJB A;  4UWI A;  4A31 A;  2CXA A;  4MFQ A;  4R3L A;  3TT2 A;  4C7I A;  1QSO A;  1S7F A;  3TCV A;  3GKR A;  4YFJ A;  5JQ4 A;  1WK4 A;  4CRZ B;  2FXF A;  4MI4 A;  2J8M A;  5FVJ A;  4Y49 B;  4KVO E;  1I1D A;  4KSA A;  3F8K A;  1J4J A;  1FY7 A;  3TE4 A;  4H89 A;  2KCW A;  4KS9 A;  3BJ8 A;  2GIV A;  2YNE A;  4ONU A;  1MJA A;  1Z4R A;  5H84 A;  4UA3 A;  2GAN A;  2CNS A;  5EBV A;  2Z0Z A;  1XIX A;  1NSL A;  4ZBG A;  5A27 A;  1B87 A;  2R1I A;  1P4N A;  1Q2Y A;  1S60 A;  3W6X A;  1Q2D A;  2WSA A;  2JDC A;  2DXQ A;  4FD5 A;  2ZXV A;  4KOR A;  2YNC C;  1S5K A;  5G22 A;  1P0H A;  5IV0 A;  4CS0 B;  2OH1 A;  3K9U A;  4CAE A;  4MFK A;  3IU2 A;  4XNH C;  2HQY A;  4AG7 A;  4IF5 A;  2P6F A;  3G8W A;  4J3G A;  4R3K A;  2CY2 A;  4KVX A;  1Z4E A;  2P0W A;  5G21 A;  4LUA A;  4KOU A;  2ATR A;  2FIA A;  1IYK A;  2YNC A;  4AG9 A;  1SQH A;  2ZW7 A;  2EUI A;  1CM0 A;  4B11 A;  1QSM A;  2VZZ A;  4X5K A;  1QST A;  2R7H A;  5F46 A;  2PR1 A;  3TO7 A;  2VQY A;  5KTA A;  3R9F A;  1MK4 A;  3IWG A;  3P2F A;  1YGH A;  2ZW4 A;  2JLM A;  4M85 A;  3TFY A;  3CXQ A;  3S6G A;  2K5T A;  3N7Z A;  4CRY B;  2D4P A;  4QBJ A;  4KUB A;  2Q04 A;  3H5Z A;  3W91 A;  1ZO0 A;  4MBU A;  3EY5 A;  3W6S A;  3IGR A;  5E96 A;  1R57 A;  4QVT A;  4NXY A;  3BJ7 A;  1KUV A;  1VKC A;  3JTK A;  2B58 A;  4RS2 A;  4B10 A;  2Z3L A;  4NSQ A;  2A4N A;  1S7L A;  2Y0M A;  4U9Y A;  2R98 A;  4A32 A;  1LRZ A;  1YX0 A;  4XPD B;  1Q2C A;  3S6H A;  2G3T A;  1IB1 E;  4KLV A;  2FE7 A;  3D2M A;  2HUZ A;  4OAD A;  4A95 A;  4JWP A;  5BWA B;  4MFJ A;  1RXT A;  1S3Z A;  4HNY B;  5I0C A;  2ZPA A;  4CAV A;  2EVN A;  2VZY A;  4EVY A;  4KUA A;  2PDO A;  2P6G A;  1PU9 A;  3JUW A;  4I49 A;  4RI1 A;  2WUU A;  3R96 A;  2NMT A;  4R57 A;  2VXK A;  4XPL A;  3DDD A;  2DPS A;  2G0B A;  3D2P A;  4R87 A;  4C2Y A;  1YRE A;  4GS4 A;  2J8R A;  3BLN A;  4BMH A;  5C82 A;  4JXQ A;  2PC1 A;  1OZP A;  1N71 A;  2Z3N A;  2PSW A;  3CXP A;  5F48 A;  2B4D B;  2Z3M A;  3FYN A;  3T9Y A;  2REE A;  2QML A;  3EXN A;  2ARH A;  3LOD A;  5ISV A;  5AG6 A;  3EFA A;  3SHP A;  5H86 A;  3PGP A;  3FNC A;  5GCN A;  2Z3K A;  4CGL A;  3F0A A;  4B5P A;  4HKF A;  1ON0 A;  1CJW A;  2WPW A;  1BOB A;  2QEC A;  2FSR A;  3TOA A;  4AB7 A;  4E8O A;  3SXO A;  5J8F A;  4NF1 A;  3B8G A;  1RO5 A;  4JD6 A;  1IID A;  1VHS A;  2Z3P A;  4LX9 A;  4FD4 A;  4CAF A;  2HV2 A;  4B14 A;  4B5O A;  1S7K A;  2B3U A;  3FB3 A;  1WWZ A;  5AG5 A;  2AE6 A;  4UCM A;  3R1K A;  5IX3 A;  3WR7 A;  2QIR A;  4MY0 A;  4NCZ A;  5C88 A;  3GY9 A;  2ZW5 A;  3KKW A;  3TO9 A;  4JJX A;  2FIW A;  4DNC A;  4YRH A;  4HNX B;  2B5G A;  5IB0 A;  1YVK A;  2Q7B A;  4KOX A;  3H4Q A;  5HMN A;  5J8C A;  3SXN A;  4HNW B;  4KZT A;  3I3G A;  5AG7 A;  2D4O A;  1M4I A;  1BO4 A;  1NE9 A;  4AVA A;  2Q0Y A;  3NE7 A;  3EO4 A;  2BL1 A;  4C7H A;  4MJ8 A;  4F0Y A;  5AGE A;  3C26 A;  2Q4Y A;  2YGW A;  4Y49 C;  4CYQ A;  3CXS A;  4L89 A;  3GYA A;  4KVM E;  3D8P A;  3FXT A;  3VWE A;  4E2A A;  1I21 A;  4C68 A;  5EC4 A;  4NEX A;  2BSW A;  4ZGY B;  1Y7R A;  1XE4 A;  1XMT A;  2JDD A;  4KLW A;  1TIQ A;  3PZJ A;  5A28 A;  1MJ9 A;  1YLE A;  4JLY A;  2B5G B;  4OLL A;  4XNH B;  4M3S A;  2OZG A;  3F5B A;  4KOS A;  5G1Z A;  1M4D A;  4H6Z A;  5HH1 A;  4F0X A;  2VI7 A;  4UWJ A;  5CNP A;  2FCK A;  5F47 A;  2OZH A;  2I79 A;  2PQ8 A;  4R9M A;  4F6A A;  4CGP A;  4MFL A;  4PSX A;  3I9S A;  2GE3 A;  2OU2 A;  2G3A A;  3R9G A;  1Y9W A;  3E0K A;  4CYO A;  4KSF A;  3MGD A;  4U9Z A;  4MY3 A;  4B12 A;  4C2Z A;  4UFX A;  3FIX A;  2PRB A;  2H5M A;  4K30 A;  3VWD A;  4JXR A;  4FD7 A;  3V8I A;  2ZW6 A;  1L0C A;  1U6M A;  4QB9 A;  3QB8 A;  3IWE A;  4ORF A;  3LD2 A;  2R8V A;  4QUS A;  4UFV A;  4YGO A;  4UCP A;  1YVO A;  1QSN A;  5JPH A;  4MFP A;  1M4G A;  3OWC A;  4E0A A;  3EC4 A;  3ZZI A;  2Q4V A;  1YR0 A;  2I00 A;  2O28 A;  2CNT A;  3DR8 A;  5G20 A;  4PK3 A;  2Z10 A;  1KUX A;  4KOV A;  4CAW A;  4KOY A;  2DPT A;  2AJ6 A;  4XPD C;  4BBH A;  2OZU A;  3FBU A;  1V0C A;  3T90 A;  2B3V A;  4QC6 A;  3PP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...