4UBRA

Crystal structure of pseudomonas aeruginosa n-aetyltransferase pa4534
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
137
structure length
137
Chain Sequence
MQLRSVIAADHPALFALWSRTPGIRLRAEDAYPFFLAYLQRNPGLSLLVETEGEVIACLMAGHDGRRGYLQHLVVDPGYRGLGLARRMLDEVLARLAREGIGKSHVFVLDAAEEAQAFWRAQSDWERRKDIQVFSTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative acetyltransferase
publication title Crystal structure of Pseudomonas aeruginosa N-aetyltransferase PA4534
rcsb
source organism Pseudomonas aeruginosa 18a
molecule tags Transferase
total genus 35
structure length 137
sequence length 137
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2014-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ubrA00
2B4BA 5H86A 2ZXVA 3W91A 2FSRA 4CRYB 5EC4A 4R3KA 5IX3A 3DR6A 2FL4A 3KKWA 2HUZA 4CAXA 2Z10A 4MHDA 2PRBA 1I1DA 4R9MA 4CAWA 2B58A 3TO6A 3TO9A 2B5GB 4QB9A 4XPLA 3SHPA 2Q4YA 1MJAA 5JQ4A 2BL1A 1MJ9A 4R3LA 2FIWA 4HNXB 4U9ZA 5DWNA 2RC4A 2Y0MA 4AVBA 2G3AA 4K30A 3QAHA 3BLNA 3JUWA 4AB7A 5F48A 2Z0ZA 3D8PA 4IUSA 2ATRA 4R87A 3C26A 4KLVA 4MJ8A 4PV6A 1SQHA 2ZW4A 5E96A 2WPXA 4XPDC 2ZPAA 1M4GA 3FYNA 1RXTA 1Y9KA 4FD4A 5DWMA 2HQYA 2ZW7A 2OB0A 4XPKA 4B5OA 2FT0A 4NF1A 4L89A 5J8CA 3FB3A 4JD6A 4U5YA 4MY0A 2REFA 1K4JA 3FXTA 1BO4A 1M4DA 1YGHA 5J8FA 3B8GA 2VI7A 4FD6A 2G3TA 3LD2A 3IWGA 3W6XA 1Y7RA 1Z4RA 2H5MA 3DDDA 1ON0A 2BSWA 3BJ7A 1QSRA 3R9EA 4F6AA 3WR7A 1P4NA 3ZJ0A 4JXRA 4CRZB 1B87A 1KUYA 2K5TA 4AG9A 4B5PA 3W6SA 4LX9A 4Y49C 1S7LA 4RI1A 2JEVA 1WK4A 5GCNA 1Z9UA 2AJ6A 2CNTA 5C82A 2PDOA 4MI4A 2ZW5A 1GHEA 1MJBA 1XIXA 2JLMA 1I21A 3TT2A 2BEIA 2Q4VA 2FIAA 4PK3A 3UY5A 1NE9A 2P6EA 2PR1A 3S6FA 3EY5A 4EVYA 2R98A 1Q2CA 3R96A 2VZYA 4PK2A 4XPDB 4B5PB 3CXPA 2VZZA 3NE7A 2PR8A 1WWZA 3N7ZA 3EC4A 3TTHA 2OZGA 4YFJA 3MGDA 4JXQA 2CNMA 2FS5A 1NSLA 1S7KA 3GY9A 2Q44A 2A4NA 2B4DA 4YGOA 3I3GA 2PQ8A 3CXQA 2ARHA 4NSQA 4L8AA 1Q2YA 5KTDA 2CY2A 4NXYA 1KUVA 4II9A 1UFHA 1YLEA 3F5BA 3ZZIA 3TCVA 2Z11A 2EUIA 4HKFA 3TE4A 4GS4A 3GKRA 1MK4A 2C27A 3DNSA 3G8WA 3FBUA 1N71A 4JLYA 2OH1A 3S6HA 3TO7A 1M1DA 4ORFA 4Y49B 2R7HA 1R57A 1PUAA 3D3SA 4YRHA 3SXNA 3H4QA 2R1IA 3EO4A 2AE6A 1RO5A 1XE4A 1YX0A 1LRZA 3F8KA 2KCWA 1Y9WA 3LODA 1NMTA 1S60A 3DSBA 3V8IA 4DNCA 4HNWB 4F0YA 1S7FA 1BOBA 1I12A 2HV2A 4NCZA 1M4IA 4RS2A 3K9UA 2IL4A 3GYAA 3RYOA 2WPWA 1YVOA 2VXKA 2Q7BA 5HH1A 4X5KA 1Z4EA 2DXQA 4BMHA 3S6GA 1OZPA 3E0KA 3S6KA 2P0WA 2P6GA 2Q04A 5ISVA 4KUBA 3IGRA 4JJXA 2O28A 2P6FA 5IB0A 5KTAA 4PSXA 1QSNA 2J8RA 1KZFA 2G0BA 3EXNA 4ONUA 3SXOA 4QVTA 4KOVA 2Q0YA 4E2AA 2OZHA 1IB1E 2VEZA 4KOUA 1TIQA 1QSTA 3R95A 1IIDA 2EVNA 2X7BA 5CNPA 2BUEA 4HNYB 4LUAA 2J8MA 4KOYA 1VKCA 5FVJA 2B5GA 5F49A 1XF8A 4AVAA 3TOAA 2D4OA 2D4PA 3P2FA 2JDCA 5C88A 4H6ZA 2OU2A 3I9SA 1S7NA 2B3VA 3VWDA 2ZW6A 2REEA 2FXFA 3T9YA 4KOSA 1IICA 4KOXA 1QSMA 4OLLA 4QC6A 1YK3A 4KOTA 5I0CA 4UA3A 4IF5A 1CJWA 1PU9A 4I49A 4M3SA 2VBQA 3TFYA 1CM0A 3JVNA 3PP9A 5JPHA 3PGPA 4H89A 1P0HA 3TOBA 4ZBGA 3FRMA 1Q2DA 3R9GA 4R57A 2CNSA 4FD5A 1YVKA 3R1KA 5EBVA 4XNHC 4J3GA 4KVME 4E0AA 3P2HA 3EFAA 2B4DB 1U6MA 4UWJA 1YR0A 4KOWA 5H84A 2B3UA 1M44A 3F0AA 2R8VA 2I79A 1IYKA 4NEXA 3T90A 2FE7A 1L0CA 1QSOA 3PZJA 4KUAA 4U9YA 1J4JA 3CXSA 4KVXA 4QBJA 2GANA 4KZTA 4MBUA 4E8OA 4MY3A 2GE3A 1XEBA 2OZUA 2PC1A 2JDDA 4UBRA 2QMLA 4UWIA 2J8NA 4AG7A 2F5IA 3R9FA 5F46A 4CS0B 1YREA 5KTCA 4JWPA 2GIVA 3G3SA 1S3ZA 3VWEA 3FIXA 2VQYA 2I00A 5IV0A 4KORA 4KVOE 3D2MA 1KUXA 4M85A 4FD7A 4AVCA 4CAVA 3FNCA 4QUSA 1VHSA 2FCKA 3D2PA 4OAEA 4PSWA 2QIRA 1XMTA 1IYLA 4OADA 3OWCA 5F47A 5HMNA 1S5KA 4H6UA 1FY7A 1B6BA 2NMTA 3QB8A 3DR8A 2PSWA 1V0CA 4XNHB 3BJ8A 4KLWA 2QECA
chains in the Genus database with same CATH superfamily
2B4BA 2EWBA 2V8DA 2ZXVA 5H86A 3W91A 2FSRA 4CRYB 5EC4A 2QVPA 4MFLA 4A95A 4R3KA 2AFSA 4X8IA 5IX3A 3DR6A 2FL4A 1XOVA 4UIBA 3KKWA 5JGFA 3I1UA 3T8WA 3FMCA 1BAVA 2HUZA 1CX8A 4CAXA 2Z10A 4MHDA 4ZX9A 2PRBA 2PJ9A 2V8HA 1I1DA 4R9MA 2Q4ZA 4MFKA 4CAWA 2XEGA 2ZENA 2B58A 3TO6A 3TO9A 2B5GB 4QB9A 4XPLA 4FAIA 3SHPA 2Q4YA 1ARLA 1MJAA 3JRUA 5JQ4A 3B7IA 2BL1A 1JQGA 2XEFA 1MJ9A 5IB9A 4NGSA 4R3LA 5HXDA 2FIWA 2PVWA 1CP6A 2IJZA 1FNOA 4HNXB 3NH5A 4U9ZA 2POKA 1LCPA 2RC4A 2Y0MA 5DWNA 4AVBA 4EMEA 2G3AA 3H8EA 3KZWA 3PB4X 3SJGA 2V8VA 4K30A 4A30A 3QAHA 2PJ7A 3BLNA 3JUWA 4JYWA 3RZAA 2DF5A 3VARA 2ABZA 1H8LA 3SI0A 3S9NA 2ZELA 4IHMA 4AB7A 5F48A 2Z0ZA 3B3CA 4NGQA 4B10A 1BPNA 2PJCA 3D8PA 4IUSA 3PB7X 4A2ZA 3B35A 2O4HA 2ATRA 4R87A 2ZEDA 3PB9X 2GFQA 3C26A 4KLVA 3WABA 4MJ8A 4B13A 5A28A 4PV6A 2IMOA 1SQHA 3FEEA 2ZW4A 2ZEFA 5E96A 1CBXA 4B6ZA 2WPXA 4CYPA 5D29A 4XPDC 4OKOA 4DUKA 1TKJA 2ZPAA 1M4GA 3L2NA 5G1ZA 3FYNA 1Y0YA 1RXTA 4ZYQA 1Y9KA 4FD4A 5DWMA 2HQYA 2ZW7A 1ZLIA 2AFXA 2OB0A 4UEEA 3A9LA 3PFEA 4XPKA 3KI9A 1LAPA 4B5OA 4CGLA 2FT0A 4NF1A 4L89A 4UFXA 5J8CA 3QAYA 1Y7EA 4OC0A 5G22A 2PJAA 4C2YA 3FB3A 3IWWA 4JD6A 4ONWA 4U5YA 4MY0A 1XRYA 2QJ8A 2REFA 4EFDA 1K4JA 3FXTA 1BO4A 1M4DA 1YGHA 2QECA 5J8FA 3B8GA 2BO9A 3D7FA 2F7VA 4A94A 2C1CA 3D7GA 4CYNA 4NFRA 2VI7A 4FD6A 4GXHA 2G3TA 3LD2A 2FVGA 2GU2A 2OR4A 5LRGA 3HLPA 3FEDA 3IWGA 3W6XA 4K3NA 4CGPA 1Y7RA 2ODFA 4A32A 1Z4RA 3MN8A 2H5MA 2AFZA 3DDDA 1ON0A 2BSWA 1ZO0A 3BJ7A 3SJFA 3FJUA 1QSRA 3R9EA 4F0XA 1YW4A 5G21A 4NJRA 4F6AA 3WR7A 4M6GA 4LQGA 1P4NA 2J9AA 3ZJ0A 4JXRA 1R43A 4CYOA 4O23A 3SJXA 4CRZB 1ARMA 1B87A 1KUYA 2K5TA 2PJ3A 4PQAA 4AG9A 4B5PA 3W6SA 4LX9A 1YQEA 4MFPA 1AMPA 3H8FA 4Y49C 1S7LA 2CF4A 3D7DA 3NH4A 4RI1A 2JEVA 3KASA 3VATA 4WWVA 2HC9A 4CGMA 1WK4A 2YGWA 5GCNA 1Z9UA 2AJ6A 2GLFA 2ZEPA 2G9DA 2CNTA 5C82A 2YNCA 2PDOA 4MI4A 4Q38A 3WT4A 1IY7A 2CIJA 4BBHA 2ZW5A 1GHEA 1MJBA 1XIXA 2PE3A 4GM5A 4NGPA 4R76A 2Z3PA 2EBJA 4ZX8A 2JLMA 3WC7A 1I21A 4YWYA 3TT2A 3V7ZA 2Z3NA 2BEIA 1X10A 2Q4VA 2PJ8A 5ELYA 2FIAA 4PK3A 4UFWA 3UY5A 3CDXA 4P6YA 1DE4C 3PB6X 4ZY0A 1NE9A 2P6EA 1LAMA 2PR1A 3S6FA 3EY5A 4EVYA 2R98A 4NGMA 1PCAA 1Z8XA 3CZXA 1Y0RA 3GIUA 3LACA 4RUHA 1Q2CA 3R96A 5LYDA 3K2KA 2GLJA 2VZYA 4B14A 4PPZA 3WC6A 4PK2A 1EE3P 2AFMA 4XPDB 4B5PB 3CXPA 2VZZA 5LRKA 4CPAA 3NE7A 4UCMA 1TF8A 2PR8A 1WWZA 8CPAA 4OIDA 1IU8A 5K8PA 4A39A 3N7ZA 5K8MA 3EC4A 3TTHA 2OZGA 3IO1A 4YFJA 7CPAA 3MGDA 4JXQA 2CNMA 4KSAA 1AUGA 2FS5A 1NSLA 3BI0A 1S7KA 2ZOFA 3GY9A 2EK9A 4OP4A 2Q44A 2A4NA 2B4DA 4RN7A 4YGOA 4BD9A 3DGVA 3I3GA 2PQ8A 3CXQA 4P4BA 3CT9A 4AXVA 1Q7LA 2ARHA 4B12A 3H8GA 4NSQA 3SJEA 5LRJA 4L8AA 1Q2YA 2PIYA 5KTDA 4OC4A 2CY2A 4NXYA 1KUVA 1ZG8A 4FUUA 3KGQA 4II9A 2GREA 1UFHA 1YLEA 3F5BA 4P10A 3GLJA 4NGNA 3TCVA 3ZZIA 2QYVA 3PBBA 2Z11A 1TKHA 1CPSA 2EUIA 4HKFA 3TE4A 4A31A 4GS4A 5AG6A 3GKRA 1MK4A 4G1PA 5DS0A 2JEWA 2C27A 3VH9A 4F0YA 3FVLA 3DNSA 3G8WA 3FBUA 5JM6A 5I4MA 1N71A 2OOTA 4FBEA 3PFOA 2PJBA 1YMEA 2OH1A 4JLYA 3S6HA 3TO7A 1M1DA 4ORFA 2Z3KA 2R7HA 3CPAA 3IEHA 2YNCC 4IK2A 4Y49B 3ISXA 1R57A 1PUAA 2V77A 3D3SA 3D7HA 4YRHA 3SXNA 1M4LA 3H4QA 4OC1A 2R1IA 4CAFA 3EO4A 2AE6A 3TC8A 1RO5A 5J1QA 1XE4A 1YX0A 1LRZA 3F8KA 2CXAA 2KCWA 1Y9WA 3LODA 1NMTA 1S60A 3BHXA 3DSBA 3V8IA 4HNWB 4UF4A 4DNCA 1S7FA 1TF9A 1YSJA 4PXDA 1BOBA 2V8GA 1I12A 5THWA 2HV2A 4NCZA 3IFEA 5BWAB 4YU9A 2RFHA 4Z65A 1M4IA 1VHOA 2ZEGA 4RS2A 4UCPA 4P4JA 4EWTA 3K9UA 2IL4A 3GYAA 4OIWA 3RYOA 3SI1A 1ZLHA 2WPWA 1YVOA 2VXKA 2Q7BA 5HH1A 1TKFA 4PXCA 3MRUA 4X5KA 1Z4EA 2ANPA 2DXQA 4BMHA 2PJ5A 1OZPA 3S6GA 3E0KA 1A2ZA 2ZEEA 4MCQA 2BOAA 4R7MA 3S6KA 1AYEA 4DYOA 1HDUA 2P0WA 2P6GA 2Q04A 4MRIA 5ISVA 4M6HA 4TNUA 2DPTA 4KUBA 3IGRA 1RTQA 4JJXA 5F09A 2O28A 2P6FA 5IB0A 3S9MA 4MHPA 3HUVA 4UFVA 4MHZA 5KTAA 4PSXA 1QSNA 2J8RA 1CP7A 1KZFA 1TXRA 2G0BA 3EXNA 2WSAA 4P45A 2PJ1A 2JBJA 4ONUA 3SXOA 5AG7A 4ZI6A 4QVTA 4KOVA 2Q0YA 4E2AA 3IJ3A 2OZHA 1IB1E 2VEZA 1F2OA 3NH8A 4KOUA 1TIQA 4X2TA 4KSFA 3PEIA 1QSTA 4Q7AA 3R95A 2NYQA 1IIDA 2EVNA 2X7BA 3KL9A 5CNPA 5JH9A 2BUEA 4HNYB 4LUAA 2J8MA 1IOIA 1Z2LA 4ZY2A 3RO0A 4OMEA 3TX8A 2C6GA 2PJ6A 2C6PA 2CTCA 4KOYA 1VKCA 1GYTA 5CPAA 5FVJA 4CGNA 2B5GA 1LANA 3KHZA 5F49A 1XF8A 3GUXA 1CPXA 4AVAA 4C2ZA 3IC1A 3JTKA 3D68A 3TOAA 2D4OA 2D4PA 3P2FA 2JDCA 5C88A 4H6ZA 2OU2A 4MCSA 3I9SA 1S7NA 2B3VA 3VWDA 4P4FA 2ZW6A 4MXUA 2AFUA 2BCOA 2REEA 5K8NA 1LOKA 5AGEA 3KQXA 2FXFA 1JWQA 3LWUA 3T9YA 4KOSA 1F57A 5HVHA 1ZG9A 1IICA 3ISZA 4KOXA 1QSMA 2Q7SA 2PJ0A 4OLLA 3PRTA 4QC6A 2PRQA 1YK3A 4KOTA 5I0CA 2PVVA 4UA3A 5AG4A 4FWUA 5EMIA 3RNZA 4IF5A 1CJWA 1PU9A 3H5ZA 2PCUA 4I49A 4IAVA 4M3SA 4MFJA 2VBQA 3TFYA 1YW6A 1HDQA 2I3CA 5HVFA 5HVGA 4PXBA 1CG2A 4UEFA 3FF3A 2ZEOA 4Q36A 4TWEA 4C2XA 1CM0A 3JVNA 5LYFA 3PP9A 1QMUA 5JPHA 4OC3A 3PGPA 1P0HA 4H89A 3TOBA 4P44A 4ZBGA 3FRMA 2C6CA 5CBMA 2AFOA 1Q2DA 2Q51A 3B3VA 4R57A 4UEZA 3R9GA 1VHEA 2CNSA 3B3SA 4FD5A 1YVKA 3R1KA 4H2KA 3QNVA 2Z3LA 3IU2A 2PIZA 3PB8X 2XEJA 3V38A 4B11A 4NGTA 1ZG7A 1UWYA 4MCRA 5EBVA 4F8ZA 4XNHC 4MHYA 1BPMA 2ZEMA 4J3GA 4A37A 4KVME 4E0AA 3P2HA 1Z8TA 1OBRA 4NGRA 2WZNA 2ZEHA 3EFAA 1ELMP 2B4DB 1U6MA 1VGYA 4UWJA 1YR0A 4KOWA 5H84A 1ELLP 2DPSA 4R6TA 2EK8A 2O53A 4BINA 3KR5A 4P4EA 4WJBA 4CGOA 3FX6A 2B3UA 2Z3OA 3NA6A 4C7IA 3S9LA 1QQ9A 3IWEA 1DTDA 5A27A 1BLLE 1M44A 3F0AA 2R8VA 4OC2A 2I79A 1IYKA 4NEXA 3T90A 2FE7A 3N5FA 1R3NA 1L0CA 1QSOA 1VIXA 1Z5RA 2F8HA 3PZJA 4KUAA 4MHNA 4OC5A 4U9YA 3FH4A 4MCPA 5AG5A 4CAEA 1J4JA 1XMBA 3CXSA 4MMOA 5G20A 4CYQA 5IV0A 1YLOA 4KVXA 3IIBA 1LFWA 4QBJA 1PYTB 3LMSA 4KVOE 4F9VA 4R8FA 2GANA 4KZTA 2Q43A 4MBUA 4E8OA 4MY3A 1IGBA 4P4IA 3B2YA 3RBUA 2AFWA 2GE3A 3KR4A 1XEBA 4UIAA 2OZUA 4ZY1A 5LYIA 4C68A 2ZOGA 4C7HA 1FT7A 4PXEA 3KHXA 2PC1A 3DLJA 2JDDA 3PBEA 4UBRA 4X3RA 4KSIA 3D67A 2QMLA 4UWIA 2J8NA 1IOFA 3B3WA 4DJLA 3BXMA 4AG7A 2Z3MA 2YNDA 1X12A 4A38A 4LQ6A 4W9YA 2F5IA 4MFZA 3R9FA 5F46A 4A33A 4CS0B 1YREA 5KTCA 1Z8WA 3CPXA 4JZ0A 2JBKA 3WC5A 4JWPA 2GIVA 3G3SA 4P4DA 3GB0A 5D8NA 4M6IA 3KQZA 1S3ZA 3K9TA 3IU1A 3VWEA 2CTBA 2YNEA 2PJ2A 3FIXA 2WUUA 2VQYA 2I00A 4KS9A 4NJQA 4UCNA 6CPAA 2NSMA 2WYRA 2EO8A 3D2MA 2DEAA 4HPSA 1KUXA 4KORA 3NE8A 4FD7A 4M85A 3SI2A 4AVCA 4CAVA 4ZGYB 3FNCA 4QUSA 1VHSA 3FECA 2FCKA 3D2PA 5K8OA 2XEIA 4OAEA 4MFQA 4PSWA 1HEEA 3RAMA 2QIRA 1KWMA 5LYLA 1XMTA 1IYLA 2HB6A 2VL1A 3D66A 3OWCA 4OADA 5F47A 5HMNA 1S5KA 4H6UA 1FY7A 1B6BA 2NMTA 1XJOA 3QB8A 1NSAA 3DR8A 1F2PA 2PSWA 1Z8LA 1V0CA 3D4UA 4XNHB 2PJ4A 3B3TA 3BJ8A 4KLWA 3NFZA 1XBUA 2RB7A 1XFOA 3BI1A 2IQ6A 4F9UA
chains in the Genus database with same CATH topology
2B4BA 5H86A 2ZXVA 3W91A 2FSRA 4CRYB 5EC4A 4MFLA 4A95A 4R3KA 5IX3A 3DR6A 2FL4A 3KKWA 2HUZA 4CAXA 2Z10A 4MHDA 2PRBA 1I1DA 4R9MA 4MFKA 4CAWA 2B58A 3TO6A 3TO9A 2B5GB 4QB9A 4XPLA 3SHPA 2Q4YA 1MJAA 5JQ4A 2BL1A 1MJ9A 4R3LA 2FIWA 4HNXB 4U9ZA 5DWNA 2RC4A 2Y0MA 4AVBA 2G3AA 4A30A 4K30A 3QAHA 3BLNA 3JUWA 4AB7A 5F48A 2Z0ZA 4B10A 3D8PA 4IUSA 4A2ZA 2ATRA 4R87A 3C26A 4KLVA 4MJ8A 4B13A 4PV6A 1SQHA 2ZW4A 5E96A 2WPXA 4CYPA 4XPDC 2ZPAA 1M4GA 5G1ZA 3FYNA 1RXTA 1Y9KA 4FD4A 5DWMA 2HQYA 2ZW7A 2OB0A 3A9LA 4XPKA 4CGLA 4B5OA 2FT0A 4NF1A 4L89A 4UFXA 5J8CA 5G22A 4C2YA 3FB3A 4JD6A 4U5YA 4MY0A 2REFA 1K4JA 3FXTA 1BO4A 1M4DA 1YGHA 5J8FA 3B8GA 4CYNA 2VI7A 4FD6A 2G3TA 3LD2A 3IWGA 3W6XA 4CGPA 1Y7RA 4A32A 1Z4RA 2H5MA 3DDDA 1ON0A 2BSWA 1ZO0A 3BJ7A 1QSRA 3R9EA 4F0XA 5G21A 4F6AA 3WR7A 1P4NA 3ZJ0A 4JXRA 4CYOA 4CRZB 1B87A 1KUYA 2K5TA 4AG9A 4B5PA 3W6SA 4LX9A 4MFPA 4Y49C 1S7LA 4RI1A 2JEVA 4CGMA 1WK4A 2YGWA 5GCNA 1Z9UA 2AJ6A 2CNTA 5C82A 2YNCA 2PDOA 4MI4A 4Q38A 4BBHA 2ZW5A 1GHEA 1MJBA 1XIXA 2Z3PA 2JLMA 1I21A 3TT2A 2Z3NA 2BEIA 2Q4VA 2FIAA 4PK3A 4UFWA 3UY5A 1NE9A 2P6EA 2PR1A 3S6FA 3EY5A 4EVYA 2R98A 1Q2CA 3R96A 2VZYA 4B14A 4PK2A 4XPDB 4B5PB 3CXPA 2VZZA 3NE7A 4UCMA 2PR8A 1WWZA 3N7ZA 3EC4A 3TTHA 2OZGA 4YFJA 3MGDA 4JXQA 2CNMA 4KSAA 2FS5A 1NSLA 1S7KA 3GY9A 2Q44A 2A4NA 2B4DA 4YGOA 3I3GA 2PQ8A 3CXQA 2ARHA 4B12A 4NSQA 4L8AA 1Q2YA 5KTDA 2CY2A 4NXYA 1KUVA 4II9A 1UFHA 1YLEA 3F5BA 3ZZIA 3TCVA 2Z11A 2EUIA 4HKFA 3TE4A 4A31A 4GS4A 5AG6A 3GKRA 1MK4A 2C27A 3DNSA 3G8WA 3FBUA 1N71A 4JLYA 2OH1A 3S6HA 3TO7A 1M1DA 4ORFA 2Z3KA 2R7HA 4Y49B 2YNCC 1R57A 1PUAA 3D3SA 4YRHA 3SXNA 3H4QA 2R1IA 4CAFA 3EO4A 2AE6A 1RO5A 1XE4A 1YX0A 1LRZA 3F8KA 2CXAA 2KCWA 1Y9WA 3LODA 1NMTA 1S60A 3DSBA 3V8IA 4DNCA 4HNWB 4F0YA 1S7FA 1BOBA 1I12A 2HV2A 4NCZA 5BWAB 1M4IA 4RS2A 4UCPA 3K9UA 2IL4A 3GYAA 3RYOA 2WPWA 1YVOA 2VXKA 2Q7BA 5HH1A 4X5KA 1Z4EA 2DXQA 4BMHA 3S6GA 1OZPA 3E0KA 3S6KA 2P0WA 2P6GA 2Q04A 5ISVA 2DPTA 4KUBA 3IGRA 4JJXA 2O28A 2P6FA 5IB0A 4UFVA 5KTAA 4PSXA 1QSNA 2J8RA 1KZFA 2G0BA 3EXNA 2WSAA 4ONUA 3SXOA 5AG7A 4QVTA 4KOVA 2Q0YA 4E2AA 2OZHA 1IB1E 2VEZA 4KOUA 1TIQA 4KSFA 1QSTA 3R95A 1IIDA 2EVNA 2X7BA 5CNPA 2BUEA 4HNYB 4LUAA 2J8MA 4KOYA 1VKCA 5FVJA 4CGNA 2B5GA 5F49A 1XF8A 4AVAA 4C2ZA 3JTKA 3TOAA 2D4OA 2D4PA 3P2FA 2JDCA 5C88A 4H6ZA 2OU2A 3I9SA 1S7NA 2B3VA 3VWDA 2ZW6A 2REEA 5AGEA 2FXFA 3T9YA 4KOSA 1IICA 4KOXA 1QSMA 4OLLA 4QC6A 1YK3A 4KOTA 5I0CA 4UA3A 5AG4A 4IF5A 1CJWA 1PU9A 3H5ZA 4I49A 4M3SA 4MFJA 2VBQA 3TFYA 4Q36A 4C2XA 1CM0A 3JVNA 3PP9A 5JPHA 3PGPA 4H89A 1P0HA 3TOBA 4ZBGA 3FRMA 1Q2DA 3R9GA 4R57A 2CNSA 4FD5A 1YVKA 3R1KA 2Z3LA 3IU2A 4B11A 5EBVA 4XNHC 4J3GA 4KVME 4E0AA 3P2HA 3EFAA 2B4DB 1U6MA 4UWJA 1YR0A 4KOWA 5H84A 2DPSA 4CGOA 2B3UA 2Z3OA 4C7IA 3IWEA 5A27A 1M44A 3F0AA 2R8VA 2I79A 1IYKA 4NEXA 3T90A 2FE7A 1L0CA 1QSOA 3PZJA 4KUAA 4CAEA 4U9YA 5AG5A 5A28A 1J4JA 3CXSA 4CYQA 5G20A 4KVXA 4QBJA 2GANA 4KZTA 4MBUA 4E8OA 4MY3A 2GE3A 1XEBA 2OZUA 4C68A 4C7HA 2PC1A 2JDDA 4UBRA 2QMLA 4UWIA 2J8NA 4AG7A 2Z3MA 2YNDA 2F5IA 4MFZA 3R9FA 5F46A 4A33A 4CS0B 1YREA 5KTCA 4JWPA 2GIVA 3G3SA 1S3ZA 3IU1A 3VWEA 2YNEA 3FIXA 2WUUA 2VQYA 2I00A 4KS9A 4UCNA 5IV0A 4KORA 4KVOE 3D2MA 1KUXA 4M85A 4FD7A 4ZGYB 4AVCA 4CAVA 3FNCA 4QUSA 1VHSA 2FCKA 3D2PA 4OAEA 4MFQA 4PSWA 2QIRA 1XMTA 1IYLA 4OADA 3OWCA 5F47A 5HMNA 1S5KA 4H6UA 1FY7A 1B6BA 2NMTA 3QB8A 3DR8A 2PSWA 1V0CA 4XNHB 3BJ8A 4KLWA 2QECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B4B A;  5H86 A;  2ZXV A;  3W91 A;  2FSR A;  4CRY B;  5EC4 A;  4R3K A;  5IX3 A;  3DR6 A;  2FL4 A;  3KKW A;  2HUZ A;  4CAX A;  2Z10 A;  4MHD A;  2PRB A;  1I1D A;  4R9M A;  4CAW A;  2B58 A;  3TO6 A;  3TO9 A;  2B5G B;  4QB9 A;  4XPL A;  3SHP A;  2Q4Y A;  1MJA A;  5JQ4 A;  2BL1 A;  1MJ9 A;  4R3L A;  2FIW A;  4HNX B;  4U9Z A;  5DWN A;  2RC4 A;  2Y0M A;  4AVB A;  2G3A A;  4K30 A;  3QAH A;  3BLN A;  3JUW A;  4AB7 A;  5F48 A;  2Z0Z A;  3D8P A;  4IUS A;  2ATR A;  4R87 A;  3C26 A;  4KLV A;  4MJ8 A;  4PV6 A;  1SQH A;  2ZW4 A;  5E96 A;  2WPX A;  4XPD C;  2ZPA A;  1M4G A;  3FYN A;  1RXT A;  1Y9K A;  4FD4 A;  5DWM A;  2HQY A;  2ZW7 A;  2OB0 A;  4XPK A;  4B5O A;  2FT0 A;  4NF1 A;  4L89 A;  5J8C A;  3FB3 A;  4JD6 A;  4U5Y A;  4MY0 A;  2REF A;  1K4J A;  3FXT A;  1BO4 A;  1M4D A;  1YGH A;  5J8F A;  3B8G A;  2VI7 A;  4FD6 A;  2G3T A;  3LD2 A;  3IWG A;  3W6X A;  1Y7R A;  1Z4R A;  2H5M A;  3DDD A;  1ON0 A;  2BSW A;  3BJ7 A;  1QSR A;  3R9E A;  4F6A A;  3WR7 A;  1P4N A;  3ZJ0 A;  4JXR A;  4CRZ B;  1B87 A;  1KUY A;  2K5T A;  4AG9 A;  4B5P A;  3W6S A;  4LX9 A;  4Y49 C;  1S7L A;  4RI1 A;  2JEV A;  1WK4 A;  5GCN A;  1Z9U A;  2AJ6 A;  2CNT A;  5C82 A;  2PDO A;  4MI4 A;  2ZW5 A;  1GHE A;  1MJB A;  1XIX A;  2JLM A;  1I21 A;  3TT2 A;  2BEI A;  2Q4V A;  2FIA A;  4PK3 A;  3UY5 A;  1NE9 A;  2P6E A;  2PR1 A;  3S6F A;  3EY5 A;  4EVY A;  2R98 A;  1Q2C A;  3R96 A;  2VZY A;  4PK2 A;  4XPD B;  4B5P B;  3CXP A;  2VZZ A;  3NE7 A;  2PR8 A;  1WWZ A;  3N7Z A;  3EC4 A;  3TTH A;  2OZG A;  4YFJ A;  3MGD A;  4JXQ A;  2CNM A;  2FS5 A;  1NSL A;  1S7K A;  3GY9 A;  2Q44 A;  2A4N A;  2B4D A;  4YGO A;  3I3G A;  2PQ8 A;  3CXQ A;  2ARH A;  4NSQ A;  4L8A A;  1Q2Y A;  5KTD A;  2CY2 A;  4NXY A;  1KUV A;  4II9 A;  1UFH A;  1YLE A;  3F5B A;  3ZZI A;  3TCV A;  2Z11 A;  2EUI A;  4HKF A;  3TE4 A;  4GS4 A;  3GKR A;  1MK4 A;  2C27 A;  3DNS A;  3G8W A;  3FBU A;  1N71 A;  4JLY A;  2OH1 A;  3S6H A;  3TO7 A;  1M1D A;  4ORF A;  4Y49 B;  2R7H A;  1R57 A;  1PUA A;  3D3S A;  4YRH A;  3SXN A;  3H4Q A;  2R1I A;  3EO4 A;  2AE6 A;  1RO5 A;  1XE4 A;  1YX0 A;  1LRZ A;  3F8K A;  2KCW A;  1Y9W A;  3LOD A;  1NMT A;  1S60 A;  3DSB A;  3V8I A;  4DNC A;  4HNW B;  4F0Y A;  1S7F A;  1BOB A;  1I12 A;  2HV2 A;  4NCZ A;  1M4I A;  4RS2 A;  3K9U A;  2IL4 A;  3GYA A;  3RYO A;  2WPW A;  1YVO A;  2VXK A;  2Q7B A;  5HH1 A;  4X5K A;  1Z4E A;  2DXQ A;  4BMH A;  3S6G A;  1OZP A;  3E0K A;  3S6K A;  2P0W A;  2P6G A;  2Q04 A;  5ISV A;  4KUB A;  3IGR A;  4JJX A;  2O28 A;  2P6F A;  5IB0 A;  5KTA A;  4PSX A;  1QSN A;  2J8R A;  1KZF A;  2G0B A;  3EXN A;  4ONU A;  3SXO A;  4QVT A;  4KOV A;  2Q0Y A;  4E2A A;  2OZH A;  1IB1 E;  2VEZ A;  4KOU A;  1TIQ A;  1QST A;  3R95 A;  1IID A;  2EVN A;  2X7B A;  5CNP A;  2BUE A;  4HNY B;  4LUA A;  2J8M A;  4KOY A;  1VKC A;  5FVJ A;  2B5G A;  5F49 A;  1XF8 A;  4AVA A;  3TOA A;  2D4O A;  2D4P A;  3P2F A;  2JDC A;  5C88 A;  4H6Z A;  2OU2 A;  3I9S A;  1S7N A;  2B3V A;  3VWD A;  2ZW6 A;  2REE A;  2FXF A;  3T9Y A;  4KOS A;  1IIC A;  4KOX A;  1QSM A;  4OLL A;  4QC6 A;  1YK3 A;  4KOT A;  5I0C A;  4UA3 A;  4IF5 A;  1CJW A;  1PU9 A;  4I49 A;  4M3S A;  2VBQ A;  3TFY A;  1CM0 A;  3JVN A;  3PP9 A;  5JPH A;  3PGP A;  4H89 A;  1P0H A;  3TOB A;  4ZBG A;  3FRM A;  1Q2D A;  3R9G A;  4R57 A;  2CNS A;  4FD5 A;  1YVK A;  3R1K A;  5EBV A;  4XNH C;  4J3G A;  4KVM E;  4E0A A;  3P2H A;  3EFA A;  2B4D B;  1U6M A;  4UWJ A;  1YR0 A;  4KOW A;  5H84 A;  2B3U A;  1M44 A;  3F0A A;  2R8V A;  2I79 A;  1IYK A;  4NEX A;  3T90 A;  2FE7 A;  1L0C A;  1QSO A;  3PZJ A;  4KUA A;  4U9Y A;  1J4J A;  3CXS A;  4KVX A;  4QBJ A;  2GAN A;  4KZT A;  4MBU A;  4E8O A;  4MY3 A;  2GE3 A;  1XEB A;  2OZU A;  2PC1 A;  2JDD A;  4UBR A;  2QML A;  4UWI A;  2J8N A;  4AG7 A;  2F5I A;  3R9F A;  5F46 A;  4CS0 B;  1YRE A;  5KTC A;  4JWP A;  2GIV A;  3G3S A;  1S3Z A;  3VWE A;  3FIX A;  2VQY A;  2I00 A;  5IV0 A;  4KOR A;  4KVO E;  3D2M A;  1KUX A;  4M85 A;  4FD7 A;  4AVC A;  4CAV A;  3FNC A;  4QUS A;  1VHS A;  2FCK A;  3D2P A;  4OAE A;  4PSW A;  2QIR A;  1XMT A;  1IYL A;  4OAD A;  3OWC A;  5F47 A;  5HMN A;  1S5K A;  4H6U A;  1FY7 A;  1B6B A;  2NMT A;  3QB8 A;  3DR8 A;  2PSW A;  1V0C A;  4XNH B;  3BJ8 A;  4KLW A;  2QEC A; 
#chains in the Genus database with same CATH topology
 2B4B A;  2EWB A;  2V8D A;  2ZXV A;  5H86 A;  3W91 A;  2FSR A;  4CRY B;  5EC4 A;  2QVP A;  4MFL A;  4A95 A;  4R3K A;  2AFS A;  4X8I A;  5IX3 A;  3DR6 A;  2FL4 A;  1XOV A;  4UIB A;  3KKW A;  5JGF A;  3I1U A;  3T8W A;  3FMC A;  1BAV A;  2HUZ A;  1CX8 A;  4CAX A;  2Z10 A;  4MHD A;  4ZX9 A;  2PRB A;  2PJ9 A;  2V8H A;  1I1D A;  4R9M A;  2Q4Z A;  4MFK A;  4CAW A;  2XEG A;  2ZEN A;  2B58 A;  3TO6 A;  3TO9 A;  2B5G B;  4QB9 A;  4XPL A;  4FAI A;  3SHP A;  2Q4Y A;  1ARL A;  1MJA A;  3JRU A;  5JQ4 A;  3B7I A;  2BL1 A;  1JQG A;  2XEF A;  1MJ9 A;  5IB9 A;  4NGS A;  4R3L A;  5HXD A;  2FIW A;  2PVW A;  1CP6 A;  2IJZ A;  1FNO A;  4HNX B;  3NH5 A;  4U9Z A;  2POK A;  1LCP A;  2RC4 A;  2Y0M A;  5DWN A;  4AVB A;  4EME A;  2G3A A;  3H8E A;  3KZW A;  3PB4 X;  3SJG A;  2V8V A;  4K30 A;  4A30 A;  3QAH A;  2PJ7 A;  3BLN A;  3JUW A;  4JYW A;  3RZA A;  2DF5 A;  3VAR A;  2ABZ A;  1H8L A;  3SI0 A;  3S9N A;  2ZEL A;  4IHM A;  4AB7 A;  5F48 A;  2Z0Z A;  3B3C A;  4NGQ A;  4B10 A;  1BPN A;  2PJC A;  3D8P A;  4IUS A;  3PB7 X;  4A2Z A;  3B35 A;  2O4H A;  2ATR A;  4R87 A;  2ZED A;  3PB9 X;  2GFQ A;  3C26 A;  4KLV A;  3WAB A;  4MJ8 A;  4B13 A;  5A28 A;  4PV6 A;  2IMO A;  1SQH A;  3FEE A;  2ZW4 A;  2ZEF A;  5E96 A;  1CBX A;  4B6Z A;  2WPX A;  4CYP A;  5D29 A;  4XPD C;  4OKO A;  4DUK A;  1TKJ A;  2ZPA A;  1M4G A;  3L2N A;  5G1Z A;  3FYN A;  1Y0Y A;  1RXT A;  4ZYQ A;  1Y9K A;  4FD4 A;  5DWM A;  2HQY A;  2ZW7 A;  1ZLI A;  2AFX A;  2OB0 A;  4UEE A;  3A9L A;  3PFE A;  4XPK A;  3KI9 A;  1LAP A;  4B5O A;  4CGL A;  2FT0 A;  4NF1 A;  4L89 A;  4UFX A;  5J8C A;  3QAY A;  1Y7E A;  4OC0 A;  5G22 A;  2PJA A;  4C2Y A;  3FB3 A;  3IWW A;  4JD6 A;  4ONW A;  4U5Y A;  4MY0 A;  1XRY A;  2QJ8 A;  2REF A;  4EFD A;  1K4J A;  3FXT A;  1BO4 A;  1M4D A;  1YGH A;  2QEC A;  5J8F A;  3B8G A;  2BO9 A;  3D7F A;  2F7V A;  4A94 A;  2C1C A;  3D7G A;  4CYN A;  4NFR A;  2VI7 A;  4FD6 A;  4GXH A;  2G3T A;  3LD2 A;  2FVG A;  2GU2 A;  2OR4 A;  5LRG A;  3HLP A;  3FED A;  3IWG A;  3W6X A;  4K3N A;  4CGP A;  1Y7R A;  2ODF A;  4A32 A;  1Z4R A;  3MN8 A;  2H5M A;  2AFZ A;  3DDD A;  1ON0 A;  2BSW A;  1ZO0 A;  3BJ7 A;  3SJF A;  3FJU A;  1QSR A;  3R9E A;  4F0X A;  1YW4 A;  5G21 A;  4NJR A;  4F6A A;  3WR7 A;  4M6G A;  4LQG A;  1P4N A;  2J9A A;  3ZJ0 A;  4JXR A;  1R43 A;  4CYO A;  4O23 A;  3SJX A;  4CRZ B;  1ARM A;  1B87 A;  1KUY A;  2K5T A;  2PJ3 A;  4PQA A;  4AG9 A;  4B5P A;  3W6S A;  4LX9 A;  1YQE A;  4MFP A;  1AMP A;  3H8F A;  4Y49 C;  1S7L A;  2CF4 A;  3D7D A;  3NH4 A;  4RI1 A;  2JEV A;  3KAS A;  3VAT A;  4WWV A;  2HC9 A;  4CGM A;  1WK4 A;  2YGW A;  5GCN A;  1Z9U A;  2AJ6 A;  2GLF A;  2ZEP A;  2G9D A;  2CNT A;  5C82 A;  2YNC A;  2PDO A;  4MI4 A;  4Q38 A;  3WT4 A;  1IY7 A;  2CIJ A;  4BBH A;  2ZW5 A;  1GHE A;  1MJB A;  1XIX A;  2PE3 A;  4GM5 A;  4NGP A;  4R76 A;  2Z3P A;  2EBJ A;  4ZX8 A;  2JLM A;  3WC7 A;  1I21 A;  4YWY A;  3TT2 A;  3V7Z A;  2Z3N A;  2BEI A;  1X10 A;  2Q4V A;  2PJ8 A;  5ELY A;  2FIA A;  4PK3 A;  4UFW A;  3UY5 A;  3CDX A;  4P6Y A;  1DE4 C;  3PB6 X;  4ZY0 A;  1NE9 A;  2P6E A;  1LAM A;  2PR1 A;  3S6F A;  3EY5 A;  4EVY A;  2R98 A;  4NGM A;  1PCA A;  1Z8X A;  3CZX A;  1Y0R A;  3GIU A;  3LAC A;  4RUH A;  1Q2C A;  3R96 A;  5LYD A;  3K2K A;  2GLJ A;  2VZY A;  4B14 A;  4PPZ A;  3WC6 A;  4PK2 A;  1EE3 P;  2AFM A;  4XPD B;  4B5P B;  3CXP A;  2VZZ A;  5LRK A;  4CPA A;  3NE7 A;  4UCM A;  1TF8 A;  2PR8 A;  1WWZ A;  8CPA A;  4OID A;  1IU8 A;  5K8P A;  4A39 A;  3N7Z A;  5K8M A;  3EC4 A;  3TTH A;  2OZG A;  3IO1 A;  4YFJ A;  7CPA A;  3MGD A;  4JXQ A;  2CNM A;  4KSA A;  1AUG A;  2FS5 A;  1NSL A;  3BI0 A;  1S7K A;  2ZOF A;  3GY9 A;  2EK9 A;  4OP4 A;  2Q44 A;  2A4N A;  2B4D A;  4RN7 A;  4YGO A;  4BD9 A;  3DGV A;  3I3G A;  2PQ8 A;  3CXQ A;  4P4B A;  3CT9 A;  4AXV A;  1Q7L A;  2ARH A;  4B12 A;  3H8G A;  4NSQ A;  3SJE A;  5LRJ A;  4L8A A;  1Q2Y A;  2PIY A;  5KTD A;  4OC4 A;  2CY2 A;  4NXY A;  1KUV A;  1ZG8 A;  4FUU A;  3KGQ A;  4II9 A;  2GRE A;  1UFH A;  1YLE A;  3F5B A;  4P10 A;  3GLJ A;  4NGN A;  3TCV A;  3ZZI A;  2QYV A;  3PBB A;  2Z11 A;  1TKH A;  1CPS A;  2EUI A;  4HKF A;  3TE4 A;  4A31 A;  4GS4 A;  5AG6 A;  3GKR A;  1MK4 A;  4G1P A;  5DS0 A;  2JEW A;  2C27 A;  3VH9 A;  4F0Y A;  3FVL A;  3DNS A;  3G8W A;  3FBU A;  5JM6 A;  5I4M A;  1N71 A;  2OOT A;  4FBE A;  3PFO A;  2PJB A;  1YME A;  2OH1 A;  4JLY A;  3S6H A;  3TO7 A;  1M1D A;  4ORF A;  2Z3K A;  2R7H A;  3CPA A;  3IEH A;  2YNC C;  4IK2 A;  4Y49 B;  3ISX A;  1R57 A;  1PUA A;  2V77 A;  3D3S A;  3D7H A;  4YRH A;  3SXN A;  1M4L A;  3H4Q A;  4OC1 A;  2R1I A;  4CAF A;  3EO4 A;  2AE6 A;  3TC8 A;  1RO5 A;  5J1Q A;  1XE4 A;  1YX0 A;  1LRZ A;  3F8K A;  2CXA A;  2KCW A;  1Y9W A;  3LOD A;  1NMT A;  1S60 A;  3BHX A;  3DSB A;  3V8I A;  4HNW B;  4UF4 A;  4DNC A;  1S7F A;  1TF9 A;  1YSJ A;  4PXD A;  1BOB A;  2V8G A;  1I12 A;  5THW A;  2HV2 A;  4NCZ A;  3IFE A;  5BWA B;  4YU9 A;  2RFH A;  4Z65 A;  1M4I A;  1VHO A;  2ZEG A;  4RS2 A;  4UCP A;  4P4J A;  4EWT A;  3K9U A;  2IL4 A;  3GYA A;  4OIW A;  3RYO A;  3SI1 A;  1ZLH A;  2WPW A;  1YVO A;  2VXK A;  2Q7B A;  5HH1 A;  1TKF A;  4PXC A;  3MRU A;  4X5K A;  1Z4E A;  2ANP A;  2DXQ A;  4BMH A;  2PJ5 A;  1OZP A;  3S6G A;  3E0K A;  1A2Z A;  2ZEE A;  4MCQ A;  2BOA A;  4R7M A;  3S6K A;  1AYE A;  4DYO A;  1HDU A;  2P0W A;  2P6G A;  2Q04 A;  4MRI A;  5ISV A;  4M6H A;  4TNU A;  2DPT A;  4KUB A;  3IGR A;  1RTQ A;  4JJX A;  5F09 A;  2O28 A;  2P6F A;  5IB0 A;  3S9M A;  4MHP A;  3HUV A;  4UFV A;  4MHZ A;  5KTA A;  4PSX A;  1QSN A;  2J8R A;  1CP7 A;  1KZF A;  1TXR A;  2G0B A;  3EXN A;  2WSA A;  4P45 A;  2PJ1 A;  2JBJ A;  4ONU A;  3SXO A;  5AG7 A;  4ZI6 A;  4QVT A;  4KOV A;  2Q0Y A;  4E2A A;  3IJ3 A;  2OZH A;  1IB1 E;  2VEZ A;  1F2O A;  3NH8 A;  4KOU A;  1TIQ A;  4X2T A;  4KSF A;  3PEI A;  1QST A;  4Q7A A;  3R95 A;  2NYQ A;  1IID A;  2EVN A;  2X7B A;  3KL9 A;  5CNP A;  5JH9 A;  2BUE A;  4HNY B;  4LUA A;  2J8M A;  1IOI A;  1Z2L A;  4ZY2 A;  3RO0 A;  4OME A;  3TX8 A;  2C6G A;  2PJ6 A;  2C6P A;  2CTC A;  4KOY A;  1VKC A;  1GYT A;  5CPA A;  5FVJ A;  4CGN A;  2B5G A;  1LAN A;  3KHZ A;  5F49 A;  1XF8 A;  3GUX A;  1CPX A;  4AVA A;  4C2Z A;  3IC1 A;  3JTK A;  3D68 A;  3TOA A;  2D4O A;  2D4P A;  3P2F A;  2JDC A;  5C88 A;  4H6Z A;  2OU2 A;  4MCS A;  3I9S A;  1S7N A;  2B3V A;  3VWD A;  4P4F A;  2ZW6 A;  4MXU A;  2AFU A;  2BCO A;  2REE A;  5K8N A;  1LOK A;  5AGE A;  3KQX A;  2FXF A;  1JWQ A;  3LWU A;  3T9Y A;  4KOS A;  1F57 A;  5HVH A;  1ZG9 A;  1IIC A;  3ISZ A;  4KOX A;  1QSM A;  2Q7S A;  2PJ0 A;  4OLL A;  3PRT A;  4QC6 A;  2PRQ A;  1YK3 A;  4KOT A;  5I0C A;  2PVV A;  4UA3 A;  5AG4 A;  4FWU A;  5EMI A;  3RNZ A;  4IF5 A;  1CJW A;  1PU9 A;  3H5Z A;  2PCU A;  4I49 A;  4IAV A;  4M3S A;  4MFJ A;  2VBQ A;  3TFY A;  1YW6 A;  1HDQ A;  2I3C A;  5HVF A;  5HVG A;  4PXB A;  1CG2 A;  4UEF A;  3FF3 A;  2ZEO A;  4Q36 A;  4TWE A;  4C2X A;  1CM0 A;  3JVN A;  5LYF A;  3PP9 A;  1QMU A;  5JPH A;  4OC3 A;  3PGP A;  1P0H A;  4H89 A;  3TOB A;  4P44 A;  4ZBG A;  3FRM A;  2C6C A;  5CBM A;  2AFO A;  1Q2D A;  2Q51 A;  3B3V A;  4R57 A;  4UEZ A;  3R9G A;  1VHE A;  2CNS A;  3B3S A;  4FD5 A;  1YVK A;  3R1K A;  4H2K A;  3QNV A;  2Z3L A;  3IU2 A;  2PIZ A;  3PB8 X;  2XEJ A;  3V38 A;  4B11 A;  4NGT A;  1ZG7 A;  1UWY A;  4MCR A;  5EBV A;  4F8Z A;  4XNH C;  4MHY A;  1BPM A;  2ZEM A;  4J3G A;  4A37 A;  4KVM E;  4E0A A;  3P2H A;  1Z8T A;  1OBR A;  4NGR A;  2WZN A;  2ZEH A;  3EFA A;  1ELM P;  2B4D B;  1U6M A;  1VGY A;  4UWJ A;  1YR0 A;  4KOW A;  5H84 A;  1ELL P;  2DPS A;  4R6T A;  2EK8 A;  2O53 A;  4BIN A;  3KR5 A;  4P4E A;  4WJB A;  4CGO A;  3FX6 A;  2B3U A;  2Z3O A;  3NA6 A;  4C7I A;  3S9L A;  1QQ9 A;  3IWE A;  1DTD A;  5A27 A;  1BLL E;  1M44 A;  3F0A A;  2R8V A;  4OC2 A;  2I79 A;  1IYK A;  4NEX A;  3T90 A;  2FE7 A;  3N5F A;  1R3N A;  1L0C A;  1QSO A;  1VIX A;  1Z5R A;  2F8H A;  3PZJ A;  4KUA A;  4MHN A;  4OC5 A;  4U9Y A;  3FH4 A;  4MCP A;  5AG5 A;  4CAE A;  1J4J A;  1XMB A;  3CXS A;  4MMO A;  5G20 A;  4CYQ A;  5IV0 A;  1YLO A;  4KVX A;  3IIB A;  1LFW A;  4QBJ A;  1PYT B;  3LMS A;  4KVO E;  4F9V A;  4R8F A;  2GAN A;  4KZT A;  2Q43 A;  4MBU A;  4E8O A;  4MY3 A;  1IGB A;  4P4I A;  3B2Y A;  3RBU A;  2AFW A;  2GE3 A;  3KR4 A;  1XEB A;  4UIA A;  2OZU A;  4ZY1 A;  5LYI A;  4C68 A;  2ZOG A;  4C7H A;  1FT7 A;  4PXE A;  3KHX A;  2PC1 A;  3DLJ A;  2JDD A;  3PBE A;  4UBR A;  4X3R A;  4KSI A;  3D67 A;  2QML A;  4UWI A;  2J8N A;  1IOF A;  3B3W A;  4DJL A;  3BXM A;  4AG7 A;  2Z3M A;  2YND A;  1X12 A;  4A38 A;  4LQ6 A;  4W9Y A;  2F5I A;  4MFZ A;  3R9F A;  5F46 A;  4A33 A;  4CS0 B;  1YRE A;  5KTC A;  1Z8W A;  3CPX A;  4JZ0 A;  2JBK A;  3WC5 A;  4JWP A;  2GIV A;  3G3S A;  4P4D A;  3GB0 A;  5D8N A;  4M6I A;  3KQZ A;  1S3Z A;  3K9T A;  3IU1 A;  3VWE A;  2CTB A;  2YNE A;  2PJ2 A;  3FIX A;  2WUU A;  2VQY A;  2I00 A;  4KS9 A;  4NJQ A;  4UCN A;  6CPA A;  2NSM A;  2WYR A;  2EO8 A;  3D2M A;  2DEA A;  4HPS A;  1KUX A;  4KOR A;  3NE8 A;  4FD7 A;  4M85 A;  3SI2 A;  4AVC A;  4CAV A;  4ZGY B;  3FNC A;  4QUS A;  1VHS A;  3FEC A;  2FCK A;  3D2P A;  5K8O A;  2XEI A;  4OAE A;  4MFQ A;  4PSW A;  1HEE A;  3RAM A;  2QIR A;  1KWM A;  5LYL A;  1XMT A;  1IYL A;  2HB6 A;  2VL1 A;  3D66 A;  3OWC A;  4OAD A;  5F47 A;  5HMN A;  1S5K A;  4H6U A;  1FY7 A;  1B6B A;  2NMT A;  1XJO A;  3QB8 A;  1NSA A;  3DR8 A;  1F2P A;  2PSW A;  1Z8L A;  1V0C A;  3D4U A;  4XNH B;  2PJ4 A;  3B3T A;  3BJ8 A;  4KLW A;  3NFZ A;  1XBU A;  2RB7 A;  1XFO A;  3BI1 A;  2IQ6 A;  4F9U A; 
#chains in the Genus database with same CATH homology
 2B4B A;  5H86 A;  2ZXV A;  3W91 A;  2FSR A;  4CRY B;  5EC4 A;  4MFL A;  4A95 A;  4R3K A;  5IX3 A;  3DR6 A;  2FL4 A;  3KKW A;  2HUZ A;  4CAX A;  2Z10 A;  4MHD A;  2PRB A;  1I1D A;  4R9M A;  4MFK A;  4CAW A;  2B58 A;  3TO6 A;  3TO9 A;  2B5G B;  4QB9 A;  4XPL A;  3SHP A;  2Q4Y A;  1MJA A;  5JQ4 A;  2BL1 A;  1MJ9 A;  4R3L A;  2FIW A;  4HNX B;  4U9Z A;  5DWN A;  2RC4 A;  2Y0M A;  4AVB A;  2G3A A;  4A30 A;  4K30 A;  3QAH A;  3BLN A;  3JUW A;  4AB7 A;  5F48 A;  2Z0Z A;  4B10 A;  3D8P A;  4IUS A;  4A2Z A;  2ATR A;  4R87 A;  3C26 A;  4KLV A;  4MJ8 A;  4B13 A;  4PV6 A;  1SQH A;  2ZW4 A;  5E96 A;  2WPX A;  4CYP A;  4XPD C;  2ZPA A;  1M4G A;  5G1Z A;  3FYN A;  1RXT A;  1Y9K A;  4FD4 A;  5DWM A;  2HQY A;  2ZW7 A;  2OB0 A;  3A9L A;  4XPK A;  4CGL A;  4B5O A;  2FT0 A;  4NF1 A;  4L89 A;  4UFX A;  5J8C A;  5G22 A;  4C2Y A;  3FB3 A;  4JD6 A;  4U5Y A;  4MY0 A;  2REF A;  1K4J A;  3FXT A;  1BO4 A;  1M4D A;  1YGH A;  5J8F A;  3B8G A;  4CYN A;  2VI7 A;  4FD6 A;  2G3T A;  3LD2 A;  3IWG A;  3W6X A;  4CGP A;  1Y7R A;  4A32 A;  1Z4R A;  2H5M A;  3DDD A;  1ON0 A;  2BSW A;  1ZO0 A;  3BJ7 A;  1QSR A;  3R9E A;  4F0X A;  5G21 A;  4F6A A;  3WR7 A;  1P4N A;  3ZJ0 A;  4JXR A;  4CYO A;  4CRZ B;  1B87 A;  1KUY A;  2K5T A;  4AG9 A;  4B5P A;  3W6S A;  4LX9 A;  4MFP A;  4Y49 C;  1S7L A;  4RI1 A;  2JEV A;  4CGM A;  1WK4 A;  2YGW A;  5GCN A;  1Z9U A;  2AJ6 A;  2CNT A;  5C82 A;  2YNC A;  2PDO A;  4MI4 A;  4Q38 A;  4BBH A;  2ZW5 A;  1GHE A;  1MJB A;  1XIX A;  2Z3P A;  2JLM A;  1I21 A;  3TT2 A;  2Z3N A;  2BEI A;  2Q4V A;  2FIA A;  4PK3 A;  4UFW A;  3UY5 A;  1NE9 A;  2P6E A;  2PR1 A;  3S6F A;  3EY5 A;  4EVY A;  2R98 A;  1Q2C A;  3R96 A;  2VZY A;  4B14 A;  4PK2 A;  4XPD B;  4B5P B;  3CXP A;  2VZZ A;  3NE7 A;  4UCM A;  2PR8 A;  1WWZ A;  3N7Z A;  3EC4 A;  3TTH A;  2OZG A;  4YFJ A;  3MGD A;  4JXQ A;  2CNM A;  4KSA A;  2FS5 A;  1NSL A;  1S7K A;  3GY9 A;  2Q44 A;  2A4N A;  2B4D A;  4YGO A;  3I3G A;  2PQ8 A;  3CXQ A;  2ARH A;  4B12 A;  4NSQ A;  4L8A A;  1Q2Y A;  5KTD A;  2CY2 A;  4NXY A;  1KUV A;  4II9 A;  1UFH A;  1YLE A;  3F5B A;  3ZZI A;  3TCV A;  2Z11 A;  2EUI A;  4HKF A;  3TE4 A;  4A31 A;  4GS4 A;  5AG6 A;  3GKR A;  1MK4 A;  2C27 A;  3DNS A;  3G8W A;  3FBU A;  1N71 A;  4JLY A;  2OH1 A;  3S6H A;  3TO7 A;  1M1D A;  4ORF A;  2Z3K A;  2R7H A;  4Y49 B;  2YNC C;  1R57 A;  1PUA A;  3D3S A;  4YRH A;  3SXN A;  3H4Q A;  2R1I A;  4CAF A;  3EO4 A;  2AE6 A;  1RO5 A;  1XE4 A;  1YX0 A;  1LRZ A;  3F8K A;  2CXA A;  2KCW A;  1Y9W A;  3LOD A;  1NMT A;  1S60 A;  3DSB A;  3V8I A;  4DNC A;  4HNW B;  4F0Y A;  1S7F A;  1BOB A;  1I12 A;  2HV2 A;  4NCZ A;  5BWA B;  1M4I A;  4RS2 A;  4UCP A;  3K9U A;  2IL4 A;  3GYA A;  3RYO A;  2WPW A;  1YVO A;  2VXK A;  2Q7B A;  5HH1 A;  4X5K A;  1Z4E A;  2DXQ A;  4BMH A;  3S6G A;  1OZP A;  3E0K A;  3S6K A;  2P0W A;  2P6G A;  2Q04 A;  5ISV A;  2DPT A;  4KUB A;  3IGR A;  4JJX A;  2O28 A;  2P6F A;  5IB0 A;  4UFV A;  5KTA A;  4PSX A;  1QSN A;  2J8R A;  1KZF A;  2G0B A;  3EXN A;  2WSA A;  4ONU A;  3SXO A;  5AG7 A;  4QVT A;  4KOV A;  2Q0Y A;  4E2A A;  2OZH A;  1IB1 E;  2VEZ A;  4KOU A;  1TIQ A;  4KSF A;  1QST A;  3R95 A;  1IID A;  2EVN A;  2X7B A;  5CNP A;  2BUE A;  4HNY B;  4LUA A;  2J8M A;  4KOY A;  1VKC A;  5FVJ A;  4CGN A;  2B5G A;  5F49 A;  1XF8 A;  4AVA A;  4C2Z A;  3JTK A;  3TOA A;  2D4O A;  2D4P A;  3P2F A;  2JDC A;  5C88 A;  4H6Z A;  2OU2 A;  3I9S A;  1S7N A;  2B3V A;  3VWD A;  2ZW6 A;  2REE A;  5AGE A;  2FXF A;  3T9Y A;  4KOS A;  1IIC A;  4KOX A;  1QSM A;  4OLL A;  4QC6 A;  1YK3 A;  4KOT A;  5I0C A;  4UA3 A;  5AG4 A;  4IF5 A;  1CJW A;  1PU9 A;  3H5Z A;  4I49 A;  4M3S A;  4MFJ A;  2VBQ A;  3TFY A;  4Q36 A;  4C2X A;  1CM0 A;  3JVN A;  3PP9 A;  5JPH A;  3PGP A;  4H89 A;  1P0H A;  3TOB A;  4ZBG A;  3FRM A;  1Q2D A;  3R9G A;  4R57 A;  2CNS A;  4FD5 A;  1YVK A;  3R1K A;  2Z3L A;  3IU2 A;  4B11 A;  5EBV A;  4XNH C;  4J3G A;  4KVM E;  4E0A A;  3P2H A;  3EFA A;  2B4D B;  1U6M A;  4UWJ A;  1YR0 A;  4KOW A;  5H84 A;  2DPS A;  4CGO A;  2B3U A;  2Z3O A;  4C7I A;  3IWE A;  5A27 A;  1M44 A;  3F0A A;  2R8V A;  2I79 A;  1IYK A;  4NEX A;  3T90 A;  2FE7 A;  1L0C A;  1QSO A;  3PZJ A;  4KUA A;  4CAE A;  4U9Y A;  5AG5 A;  5A28 A;  1J4J A;  3CXS A;  4CYQ A;  5G20 A;  4KVX A;  4QBJ A;  2GAN A;  4KZT A;  4MBU A;  4E8O A;  4MY3 A;  2GE3 A;  1XEB A;  2OZU A;  4C68 A;  4C7H A;  2PC1 A;  2JDD A;  4UBR A;  2QML A;  4UWI A;  2J8N A;  4AG7 A;  2Z3M A;  2YND A;  2F5I A;  4MFZ A;  3R9F A;  5F46 A;  4A33 A;  4CS0 B;  1YRE A;  5KTC A;  4JWP A;  2GIV A;  3G3S A;  1S3Z A;  3IU1 A;  3VWE A;  2YNE A;  3FIX A;  2WUU A;  2VQY A;  2I00 A;  4KS9 A;  4UCN A;  5IV0 A;  4KOR A;  4KVO E;  3D2M A;  1KUX A;  4M85 A;  4FD7 A;  4ZGY B;  4AVC A;  4CAV A;  3FNC A;  4QUS A;  1VHS A;  2FCK A;  3D2P A;  4OAE A;  4MFQ A;  4PSW A;  2QIR A;  1XMT A;  1IYL A;  4OAD A;  3OWC A;  5F47 A;  5HMN A;  1S5K A;  4H6U A;  1FY7 A;  1B6B A;  2NMT A;  3QB8 A;  3DR8 A;  2PSW A;  1V0C A;  4XNH B;  3BJ8 A;  4KLW A;  2QEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...