3EFAA

Crystal structure of putative n-acetyltransferase from lactobacillus plantarum
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
146
structure length
146
Chain Sequence
NAMKIIFSASPANRAAAYALRQAVFVEERGISADVEFDVKDTDQCEYAVLYLQPDLPITTLRLEPQADHVMRFGRVCTRKAYRGHGWGRQLLTAAEEWATQRGFTHGEIHGELTAQRFYELCGYRVTAGPYDEDGAPVVIMHKQLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Acetyltransferase
publication title Crystal structure of putative N-acetyltransferase from Lactobacillus plantarum
rcsb
source organism Lactobacillus plantarum wcfs1
molecule tags Transferase
total genus 42
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3efaA00
3FNCA 2IL4A 5HMNA 3N7ZA 1Y9KA 4B5PB 3R9GA 3QB8A 3T9YA 2FSRA 2BEIA 2R8VA 2DXQA 3F0AA 3R96A 3SXOA 4KOXA 1R57A 2WPWA 1S7NA 2CNTA 2BUEA 4Y49B 1XEBA 4RS2A 1SQHA 2Q0YA 1PUAA 4LX9A 2VQYA 4KZTA 5I0CA 4B5PA 1ON0A 2PC1A 3R9EA 1IIDA 2JDDA 1S7KA 4XNHB 3K9UA 3EFAA 2B5GB 3D2PA 3TCVA 2ARHA 5EBVA 2HV2A 1NMTA 1XE4A 4OAEA 2G3AA 2Q44A 3G3SA 4KORA 1Z4RA 3D2MA 4R3LA 4K30A 1V0CA 2CNSA 2PSWA 2ZXVA 2J8MA 4PV6A 4MHDA 4KLWA 1VKCA 4YGOA 3BJ8A 1LRZA 4FD4A 1S3ZA 2F5IA 1BO4A 1UFHA 4XPDC 4GS4A 3P2HA 1Y9WA 4H89A 4CAVA 4KOVA 3FYNA 4JXRA 2KCWA 1P0HA 2B5GA 1IYLA 3OWCA 2EUIA 1NSLA 4R57A 3PP9A 1MJ9A 4KVOE 4JLYA 5IX3A 4MBUA 4AG7A 1MJBA 3TE4A 1L0CA 1IYKA 1RO5A 1Z9UA 3BLNA 3I9SA 5F46A 2ZW6A 3NE7A 5HH1A 1QSMA 4E0AA 2P6GA 4NCZA 2OH1A 2OB0A 4M85A 1MK4A 2OZGA 1S7FA 4DNCA 2PRBA 4CRZB 3VWDA 3PZJA 2P6EA 4XPLA 3W6XA 2FIAA 1RXTA 2H5MA 1FY7A 4AG9A 5J8FA 3R1KA 4KVXA 2C27A 2ZW5A 5CNPA 3DNSA 1NE9A 2NMTA 4JXQA 1QSNA 3EY5A 2Q7BA 2HUZA 4XNHC 1K4JA 3TTHA 4LUAA 4KOWA 1YVOA 3GY9A 3R95A 4L89A 3SXNA 1YX0A 4UWIA 1IB1E 3GKRA 1QSTA 2Q4VA 1B87A 2FIWA 3P2FA 4B5OA 4XPKA 1YREA 4BMHA 4EVYA 5C82A 4ZBGA 5KTCA 2ZW7A 2A4NA 4MY3A 4OADA 5F49A 1Y7RA 3F8KA 4YRHA 5FVJA 1Q2DA 3FIXA 3MGDA 3IWGA 3QAHA 2B4DB 2FT0A 1QSOA 4MJ8A 2VBQA 3EC4A 2D4OA 2GANA 2REFA 5IV0A 5ISVA 4FD5A 4MY0A 2WPXA 4QVTA 4L8AA 3EXNA 2I00A 1S60A 3G8WA 5C88A 2R7HA 4ORFA 4PK2A 3DDDA 2FS5A 3DSBA 2B3UA 2B4DA 4I49A 5F47A 3B8GA 4HKFA 2RC4A 4UWJA 1WK4A 4IF5A 4NSQA 2QMLA 1WWZA 2AJ6A 2JEVA 2B3VA 4KUBA 4R87A 3S6KA 4U9YA 4NF1A 1S7LA 2ZW4A 4AVCA 2QIRA 5DWNA 3S6HA 4E8OA 3CXSA 1XIXA 5GCNA 1VHSA 4F0YA 5KTAA 3LODA 3C26A 3TOAA 5IB0A 1Q2CA 4PK3A 1BOBA 4KOUA 3UY5A 4ONUA 4RI1A 1M4GA 4R9MA 2GE3A 3JVNA 1M4DA 3PGPA 3D8PA 5JPHA 1I1DA 1J4JA 2JDCA 4Y49C 3CXPA 3D3SA 1YR0A 4UA3A 4QBJA 1KUXA 4XPDB 3GYAA 4X5KA 3S6GA 5H86A 2Z11A 3FRMA 1TIQA 2I79A 1I12A 3IGRA 4UBRA 1XF8A 2JLMA 1I21A 4KOYA 2B4BA 1N71A 2REEA 1MJAA 1Z4EA 3TO6A 4AVBA 2FL4A 3F5BA 1M4IA 4YFJA 3TOBA 1YVKA 2PQ8A 4IUSA 1M44A 3LD2A 2Z10A 2VZYA 2B58A 4CS0B 4HNWB 3BJ7A 4E2AA 3KKWA 1PU9A 2Q04A 4PSXA 1XMTA 2BL1A 2VI7A 3RYOA 2OZUA 1YGHA 1QSRA 5KTDA 3ZJ0A 4H6UA 1CJWA 1M1DA 4MI4A 2Q4YA 1Q2YA 4FD6A 3TT2A 4HNYB 1YLEA 1KUYA 4QC6A 3DR6A 1B6BA 3FB3A 4U9ZA 2BSWA 2Z0ZA 4CRYB 3FXTA 5DWMA 4AVAA 2HQYA 2K5TA 3S6FA 2D4PA 3I3GA 4OLLA 4CAXA 2G0BA 4HNXB 4FD7A 4II9A 3WR7A 4QB9A 3W6SA 2P0WA 2QECA 4NXYA 2CY2A 4R3KA 4PSWA 5JQ4A 1OZPA 1YK3A 3E0KA 4H6ZA 2O28A 1U6MA 4CAWA 2P6FA 3H4QA 4KUAA 3FBUA 3T90A 2ATRA 4JWPA 2ZPAA 2J8RA 3DR8A 4KOTA 2EVNA 3W91A 2X7BA 3TO7A 2FE7A 2R98A 4JD6A 4JJXA 2PDOA 4NEXA 2FXFA 4F6AA 3TFYA 2Y0MA 2G3TA 4AB7A 1S5KA 5H84A 2OU2A 4KLVA 2GIVA 4M3SA 3ZZIA 3SHPA 4QUSA 4KVME 4KOSA 2PR8A 2R1IA 3JUWA 3CXQA 1IICA 5E96A 1GHEA 2FCKA 2VXKA 4J3GA 4U5YA 3TO9A 2VZZA 5F48A 3V8IA 5EC4A 3EO4A 1P4NA 1KZFA 5J8CA 1CM0A 2CNMA 2VEZA 2PR1A 2OZHA 1KUVA 2J8NA 3R9FA 3VWEA 2AE6A
chains in the Genus database with same CATH superfamily
2ZEMA 2IL4A 3FNCA 5HMNA 1BLLE 1YSJA 3N7ZA 5CPAA 2V8DA 4UCNA 1Y9KA 4B5PB 4MRIA 3D7DA 4P6YA 2Q4ZA 2C6GA 3R9GA 3QB8A 3FF3A 3T9YA 5AG6A 4MCPA 4OKOA 2FSRA 4MFQA 2BEIA 2R8VA 1FNOA 2DXQA 2PJ2A 3F0AA 3R96A 3SXOA 3QAYA 4KOXA 1R57A 2PJ6A 2WPWA 1S7NA 4OIDA 2ABZA 2CNTA 4R7MA 4EWTA 3TC8A 2AFXA 8CPAA 2BUEA 3PBEA 4Y49B 1XEBA 4WJBA 1CG2A 1SQHA 4RS2A 2XEGA 3LMSA 2Q0YA 1PUAA 4LX9A 2VQYA 4KZTA 5I0CA 4B5PA 4PXEA 1ON0A 2PC1A 3ISZA 1XRYA 1IOFA 3LWUA 4MCQA 3R9EA 2Q43A 3D4UA 3GIUA 4MMOA 2PRQA 1CP6A 1IIDA 2JDDA 1S7KA 4XNHB 5LRJA 3K9UA 4ZI6A 4IHMA 3EFAA 4UFVA 2B5GB 1F2PA 3D2PA 5IB9A 2Z3NA 2Q7SA 3TCVA 4A94A 2O4HA 2V8GA 2ARHA 2PJ1A 4X3RA 5EBVA 2HV2A 3WC5A 1NMTA 1XE4A 4OAEA 2G3AA 2Q44A 3G3SA 2IQ6A 1Z4RA 1OBRA 3D2MA 4KORA 3CT9A 4R3LA 5JH9A 2PJ4A 1V0CA 2CNSA 3PFOA 4K30A 1ARMA 2PSWA 3H8EA 2ZXVA 2J8MA 2POKA 2IJZA 4MHDA 4PV6A 4KLWA 3SJEA 3SJFA 4P4FA 1VKCA 4IK2A 4YGOA 3BJ8A 4A39A 1LRZA 4FD4A 1S3ZA 2F5IA 3H8GA 4C2ZA 1BO4A 1UFHA 4NJQA 4XPDC 4GS4A 3P2HA 1Y9WA 4H89A 4CGPA 4CAVA 4KOVA 1IGBA 4YU9A 3WC6A 3FYNA 3K2KA 4JXRA 2KCWA 1P0HA 4YWYA 2B5GA 1JWQA 1IYLA 2NSMA 2EUIA 2FVGA 2XEIA 3B3WA 3OWCA 1NSLA 4NFRA 2C6CA 2OOTA 3FH4A 1YW4A 4R57A 4DYOA 3PP9A 4A31A 1MJ9A 4KVOE 4JLYA 2PIZA 5IX3A 3H5ZA 4MBUA 4AG7A 1MJBA 1QMUA 3PB9X 4R76A 3TE4A 3PRTA 1M4LA 4CPAA 2ZEHA 1L0CA 5CBMA 1IYKA 1RO5A 1Z9UA 3BLNA 3B3TA 3JRUA 1Z8LA 3I9SA 4NJRA 5F46A 3IU2A 4OMEA 3D66A 5F09A 2ZW6A 3NE7A 5HH1A 1QSMA 3IWEA 4OC2A 3NFZA 5LYIA 4E0AA 5G1ZA 2P6GA 4KSFA 4NCZA 2OH1A 1ZLHA 1TF9A 2OB0A 2GLFA 4M85A 3VATA 4NGNA 4CYOA 4JYWA 1Z8TA 1MK4A 5G21A 4CYPA 2OZGA 3VH9A 1S7FA 2PVVA 2PRBA 4DNCA 4CRZB 5ELYA 4X2TA 4OP4A 2PCUA 3PB8X 3PZJA 3T8WA 3VWDA 1EE3P 2P6EA 4XPLA 3KHZA 3NH5A 3W6XA 4OC5A 2FIAA 4F0XA 4GM5A 3B2YA 1HDUA 4P4DA 4CGNA 4UFWA 2QVPA 1RXTA 3NE8A 3IJ3A 3V38A 3KQZA 2H5MA 3B35A 5A28A 3PBBA 2BOAA 2BO9A 1FY7A 2Z3OA 3CPAA 4KS9A 4AG9A 2J9AA 5J8FA 4Z65A 1JQGA 3R1KA 4KVXA 2C27A 2ZEDA 2ZEOA 2ZW5A 4OC3A 1X10A 2NYQA 4Q7AA 3IO1A 5CNPA 2PJ0A 3DNSA 1NE9A 2NMTA 4JXQA 1QSNA 5HVGA 3IC1A 3B3SA 3EY5A 4A95A 4CGOA 2Q7BA 2HUZA 4XNHC 1K4JA 3A9LA 3TTHA 4LUAA 4KOWA 1AYEA 1YVOA 3GY9A 4NGQA 3R95A 3BI0A 1VIXA 2C1CA 1ARLA 2ZOGA 1Q7LA 4L89A 1AMPA 1CBXA 1YX0A 4UWIA 3SXNA 4B6ZA 4TNUA 3VARA 1BPNA 1IB1E 4UFXA 5K8MA 2PVWA 1QSTA 2Q4VA 3GKRA 4NGTA 3BXMA 4BBHA 1B87A 3S9LA 2ZELA 1ZG8A 2FIWA 3P2FA 3WT4A 4B5OA 5HVHA 4XPKA 1YREA 4Q38A 4BMHA 2EO8A 3CZXA 4MXUA 4EVYA 2PIYA 5C82A 4ZBGA 5KTCA 2ZW7A 2A4NA 4ZY2A 4MY3A 4BINA 4OADA 2Z3MA 5F49A 1Y7RA 5K8OA 2YNEA 3F8KA 4YRHA 4UEFA 5FVJA 4FBEA 1Q2DA 2V8VA 3FIXA 3MGDA 4M6IA 4ZX8A 2Z3PA 3IWGA 1ELMP 2PJCA 4UCMA 3QAHA 2B4DB 2F8HA 3KQXA 3K9TA 2FT0A 3DGVA 1QSOA 4MJ8A 2VBQA 3EC4A 4P44A 4MFKA 2D4OA 2GANA 2REFA 4CAEA 5IV0A 5ISVA 4FD5A 3HLPA 4MY0A 2WPXA 5HXDA 2YGWA 4QVTA 4L8AA 3EXNA 1IOIA 5AGEA 2Z3LA 2I00A 5K8PA 1IU8A 1PYTB 4P45A 3RBUA 4C7IA 1S60A 2G9DA 3G8WA 4ZX9A 5C88A 1Z2LA 2RFHA 2R7HA 4ORFA 1UWYA 1CPXA 3DDDA 1TF8A 3KL9A 4PK2A 1KWMA 1BAVA 2FS5A 3DSBA 3PB4X 2B3UA 3I1UA 5K8NA 2B4DA 4I49A 4LQGA 5J1QA 4ONWA 5F47A 3B8GA 4HKFA 2RC4A 4B11A 4TWEA 1XBUA 3WABA 5LYDA 4UWJA 2PJ5A 1X12A 3FJUA 1WK4A 4IF5A 4NSQA 4OIWA 2QMLA 1WWZA 3S9NA 2PE3A 2ZEGA 2GFQA 5LYLA 4M6GA 3GUXA 1BPMA 2PJ7A 2AJ6A 1QQ9A 2YNCA 2JEVA 5LYFA 1TXRA 3RO0A 2B3VA 4KUBA 1F57A 1CPSA 4R87A 3S6KA 4U9YA 1XMBA 4NF1A 4P4EA 1S7LA 2ZW4A 2CTCA 2HC9A 4KSIA 5EMIA 4AVCA 4F9VA 2QIRA 2ODFA 5DWNA 3S6HA 4E8OA 3CXSA 1XIXA 4B13A 3IU1A 5GCNA 1VHSA 4NGMA 4F0YA 3LODA 5KTAA 3C26A 2ZOFA 1YW6A 3WC7A 4FUUA 2PJBA 4MHZA 2ANPA 3TOAA 3IIBA 1Q2CA 5IB0A 2DPTA 4PK3A 1BOBA 4FWUA 3KASA 1TKHA 2CXAA 2CIJA 2XEJA 4KOUA 3UY5A 4ONUA 4RI1A 3DLJA 4AXVA 1HDQA 1M4GA 4R9MA 1IY7A 2GE3A 3JVNA 5BWAB 1M4DA 3PGPA 2Q51A 3D8PA 5JPHA 4A33A 2CF4A 1I1DA 1J4JA 2JDCA 5AG7A 4Y49C 1TKJA 2JBKA 4LQ6A 3CXPA 3D3SA 4CGMA 4P4BA 4EFDA 1YR0A 4PQAA 4UA3A 1CX8A 1KUXA 3KR5A 4Q36A 4QBJA 3N5FA 4MFLA 1F2OA 4XPDB 3NH4A 3GYAA 2DEAA 3FMCA 4X5KA 5LRGA 3S6GA 4BD9A 2AFSA 5H86A 2HB6A 1YLOA 1TIQA 2I79A 2Z11A 3FRMA 6CPAA 1DE4C 1NSAA 1VHEA 2O53A 1I12A 4F9UA 2YNDA 2F7VA 3IGRA 4UBRA 3FX6A 2WYRA 4K3NA 1XJOA 1XF8A 2JLMA 1I21A 2EK9A 2EBJA 4KOYA 4M6HA 2B4BA 2ZEEA 3KGQA 1N71A 4JZ0A 2REEA 4HPSA 2WZNA 1MJAA 1Z4EA 3TO6A 5G20A 4AVBA 2YNCC 3IFEA 2FL4A 2VL1A 2WSAA 3PB7X 1ZLIA 4R6TA 5DS0A 3F5BA 1M4IA 3BHXA 2BCOA 2GLJA 3TOBA 1YMEA 1YVKA 4CAFA 4DUKA 2PQ8A 4YFJA 4IUSA 1M44A 3LD2A 2Z10A 4P4IA 4CYQA 3V7ZA 2QJ8A 2VZYA 5I4MA 3CPXA 1R3NA 2B58A 4CS0B 4ZYQA 4HNWB 3BJ7A 4F8ZA 2C6PA 4E2AA 1CP7A 3KKWA 3B3VA 3B7IA 1PU9A 2Q04A 4ZGYB 4PSXA 5JGFA 1XMTA 2WUUA 3S9MA 1ELLP 4NGRA 4MFZA 2EWBA 4MFJA 2BL1A 2RB7A 2VI7A 3LACA 4NGSA 3RYOA 2OZUA 1XOVA 3D7GA 1YGHA 4WWVA 1QSRA 4A38A 5KTDA 3ZJ0A 2AFZA 1CJWA 3B3CA 4H6UA 1M1DA 1YQEA 4IAVA 2Q4YA 1Q2YA 1XFOA 4MI4A 4FD6A 3TT2A 4HNYB 4X8IA 4CYNA 1YLEA 1DTDA 1KUYA 2PJAA 4QC6A 3DR6A 1B6BA 3FB3A 4U9ZA 2BSWA 2Z0ZA 4CRYB 3FXTA 3NH8A 1VGYA 2ZENA 5DWMA 1FT7A 4H2KA 4AVAA 2HQYA 2AFWA 2V77A 2K5TA 3D68A 4RUHA 3S6FA 3SJXA 3CDXA 2AFOA 2D4PA 3I3GA 4G1PA 3PEIA 2CTBA 3MN8A 4OLLA 4DJLA 4CAXA 5AG4A 2ZEFA 2G0BA 4HNXB 4FD7A 4B10A 4II9A 1R43A 3WR7A 4ZY0A 4UIBA 4QB9A 3SI0A 3W6SA 2P0WA 2QECA 3IWWA 4NXYA 2CY2A 2PJ8A 4R3KA 2IMOA 4PSWA 5HVFA 5JQ4A 1GYTA 3H8FA 1OZPA 4C2YA 1YK3A 3E0KA 3FVLA 4H6ZA 3D67A 3MRUA 4OC0A 2O28A 1U6MA 2DPSA 2OR4A 4CAWA 1ZG9A 2AFMA 1ZG7A 3RZAA 2P6FA 3H4QA 5THWA 3D7HA 4KUAA 3FBUA 1Z5RA 3T90A 4A32A 4UIAA 4ZY1A 3KZWA 2ATRA 2XEFA 4JWPA 1HEEA 2J8RA 2ZPAA 3DR8A 4KOTA 1Y0RA 5JM6A 3GB0A 2EVNA 3W91A 2X7BA 5D29A 3SI2A 1Y7EA 3TO7A 3JTKA 1Y0YA 2FE7A 2R98A 3FEEA 4JD6A 1PCAA 4JJXA 2PDOA 2V8HA 4KSAA 4NEXA 5A27A 4UEZA 4A30A 4CGLA 3FECA 5D8NA 2FXFA 1LAMA 4F6AA 3TFYA 4MFPA 4OC1A 2AFUA 2Y0MA 5G22A 2G3TA 4C68A 4AB7A 4MHNA 1S5KA 2PJ3A 5H84A 3PFEA 2OU2A 4KLVA 1RTQA 2GIVA 4M3SA 1AUGA 3BI1A 3ZZIA 2I3CA 3FEDA 4PPZA 7CPAA 2GREA 2GU2A 4W9YA 3SHPA 4UCPA 1ZO0A 2QYVA 4QUSA 1A2ZA 3TX8A 4KVME 4OC4A 4KOSA 4A37A 3RAMA 4RN7A 2DF5A 4NGPA 2PJ9A 3KR4A 2PR8A 2R1IA 1VHOA 4MCSA 3JUWA 4UF4A 4UEEA 3CXQA 1IICA 1LFWA 2Z3KA 4MHPA 3IEHA 1H8LA 4B12A 2JBJA 2JEWA 5E96A 3L2NA 4FAIA 1GHEA 1TKFA 2FCKA 2VXKA 3KHXA 3PB6X 4J3GA 4R8FA 4U5YA 3TO9A 5AG5A 4EMEA 2VZZA 5F48A 4P4JA 3SI1A 4C7HA 3V8IA 1Z8XA 5EC4A 3EO4A 1LCPA 1P4NA 3HUVA 3NA6A 1KZFA 1Z8WA 4GXHA 1LANA 4MCRA 4P10A 3SJGA 5J8CA 1LAPA 4PXDA 1CM0A 4B14A 3KI9A 4O23A 3RNZA 2CNMA 4A2ZA 4PXCA 3ISXA 2VEZA 4PXBA 5LRKA 1LOKA 3QNVA 2ZEPA 2PR1A 2OZHA 4MHYA 1KUVA 3D7FA 3GLJA 4C2XA 2J8NA 2EK8A 3R9FA 3VWEA 2AE6A
chains in the Genus database with same CATH topology
3FNCA 2IL4A 5HMNA 3N7ZA 4UCNA 1Y9KA 4B5PB 3R9GA 3QB8A 3T9YA 5AG6A 2FSRA 4MFQA 2BEIA 2R8VA 2DXQA 3F0AA 3R96A 3SXOA 4KOXA 1R57A 2WPWA 1S7NA 2CNTA 2BUEA 4Y49B 1XEBA 4RS2A 1SQHA 2Q0YA 1PUAA 4LX9A 2VQYA 4KZTA 5I0CA 4B5PA 1ON0A 2PC1A 3R9EA 1IIDA 2JDDA 1S7KA 4XNHB 3K9UA 3EFAA 4UFVA 2B5GB 3D2PA 2Z3NA 3TCVA 2ARHA 5EBVA 2HV2A 1NMTA 1XE4A 4OAEA 2G3AA 2Q44A 3G3SA 4KORA 1Z4RA 3D2MA 4R3LA 4K30A 1V0CA 2CNSA 2PSWA 2ZXVA 2J8MA 4PV6A 4MHDA 4KLWA 1VKCA 4YGOA 3BJ8A 1LRZA 4FD4A 1S3ZA 2F5IA 4C2ZA 1BO4A 1UFHA 4XPDC 4GS4A 3P2HA 1Y9WA 4H89A 4CGPA 4CAVA 4KOVA 3FYNA 4JXRA 2KCWA 1P0HA 2B5GA 1IYLA 3OWCA 2EUIA 1NSLA 4R57A 3PP9A 4A31A 1MJ9A 4KVOE 4JLYA 5IX3A 3H5ZA 4MBUA 4AG7A 1MJBA 3TE4A 1L0CA 1IYKA 1RO5A 1Z9UA 3BLNA 3I9SA 5F46A 3IU2A 2ZW6A 3NE7A 5HH1A 1QSMA 3IWEA 4E0AA 5G1ZA 2P6GA 4KSFA 4NCZA 2OH1A 2OB0A 4M85A 4CYOA 1MK4A 5G21A 4CYPA 2OZGA 1S7FA 4DNCA 2PRBA 4CRZB 3VWDA 3PZJA 2P6EA 4XPLA 3W6XA 2FIAA 4F0XA 4CGNA 4UFWA 1RXTA 2H5MA 5A28A 1FY7A 2Z3OA 4KS9A 4AG9A 5J8FA 3R1KA 4KVXA 2C27A 2ZW5A 5CNPA 3DNSA 1NE9A 2NMTA 4JXQA 1QSNA 3EY5A 4A95A 4CGOA 2Q7BA 2HUZA 4XNHC 1K4JA 3A9LA 3TTHA 4LUAA 4KOWA 1YVOA 3GY9A 3R95A 4L89A 3SXNA 1YX0A 4UWIA 1IB1E 4UFXA 3GKRA 1QSTA 2Q4VA 4BBHA 1B87A 2FIWA 3P2FA 4B5OA 4XPKA 1YREA 4Q38A 4BMHA 4EVYA 5C82A 4ZBGA 5KTCA 2ZW7A 2A4NA 4MY3A 4OADA 2Z3MA 5F49A 1Y7RA 2YNEA 3F8KA 4YRHA 5FVJA 1Q2DA 3FIXA 3MGDA 2Z3PA 3IWGA 4UCMA 3QAHA 2B4DB 2FT0A 1QSOA 4MJ8A 2VBQA 3EC4A 4MFKA 2D4OA 2GANA 2REFA 4CAEA 5IV0A 5ISVA 4FD5A 4MY0A 2WPXA 2YGWA 4QVTA 4L8AA 3EXNA 5AGEA 2Z3LA 2I00A 4C7IA 1S60A 3G8WA 5C88A 2R7HA 4ORFA 4PK2A 3DDDA 2FS5A 3DSBA 2B3UA 2B4DA 4I49A 5F47A 4B11A 3B8GA 4HKFA 2RC4A 4UWJA 1WK4A 4IF5A 4NSQA 2QMLA 1WWZA 2AJ6A 2YNCA 2JEVA 2B3VA 4KUBA 4R87A 3S6KA 4U9YA 4NF1A 1S7LA 2ZW4A 4AVCA 2QIRA 5DWNA 3S6HA 4E8OA 3CXSA 1XIXA 4B13A 3IU1A 5GCNA 1VHSA 4F0YA 5KTAA 3LODA 3C26A 3TOAA 5IB0A 1Q2CA 2DPTA 4PK3A 1BOBA 2CXAA 4KOUA 3UY5A 4ONUA 4RI1A 1M4GA 4R9MA 2GE3A 3JVNA 5BWAB 1M4DA 3PGPA 3D8PA 5JPHA 4A33A 1I1DA 1J4JA 2JDCA 5AG7A 4Y49C 3CXPA 3D3SA 4CGMA 1YR0A 4UA3A 4QBJA 1KUXA 4Q36A 4MFLA 4XPDB 3GYAA 4X5KA 3S6GA 5H86A 2Z11A 3FRMA 1TIQA 2I79A 1I12A 2YNDA 3IGRA 4UBRA 1XF8A 2JLMA 1I21A 4KOYA 2B4BA 1N71A 2REEA 1MJAA 1Z4EA 3TO6A 5G20A 4AVBA 2YNCC 2FL4A 2WSAA 3F5BA 1M4IA 4YFJA 3TOBA 1YVKA 4CAFA 2PQ8A 4IUSA 1M44A 3LD2A 2Z10A 4CYQA 2VZYA 2B58A 4CS0B 4HNWB 3BJ7A 4E2AA 3KKWA 1PU9A 2Q04A 4ZGYB 4PSXA 1XMTA 2WUUA 4MFZA 4MFJA 2BL1A 2VI7A 3RYOA 2OZUA 1YGHA 1QSRA 5KTDA 3ZJ0A 4H6UA 1CJWA 1M1DA 4MI4A 2Q4YA 1Q2YA 4FD6A 3TT2A 4HNYB 4CYNA 1YLEA 1KUYA 4QC6A 3DR6A 1B6BA 3FB3A 4U9ZA 2BSWA 2Z0ZA 4CRYB 3FXTA 5DWMA 4AVAA 2HQYA 2K5TA 3S6FA 2D4PA 3I3GA 4OLLA 4CAXA 5AG4A 2G0BA 4HNXB 4FD7A 4B10A 4II9A 3WR7A 4QB9A 3W6SA 2P0WA 2QECA 4NXYA 2CY2A 4R3KA 4PSWA 5JQ4A 1OZPA 4C2YA 1YK3A 3E0KA 4H6ZA 2O28A 1U6MA 2DPSA 4CAWA 2P6FA 3H4QA 4KUAA 3FBUA 3T90A 4A32A 2ATRA 4JWPA 2ZPAA 2J8RA 3DR8A 4KOTA 2EVNA 3W91A 2X7BA 3TO7A 3JTKA 2FE7A 2R98A 4JD6A 4JJXA 2PDOA 4KSAA 4NEXA 5A27A 4A30A 4CGLA 2FXFA 4F6AA 3TFYA 4MFPA 5G22A 2Y0MA 2G3TA 4C68A 4AB7A 1S5KA 5H84A 2OU2A 4KLVA 2GIVA 4M3SA 3ZZIA 3SHPA 4UCPA 1ZO0A 4QUSA 4KVME 4KOSA 2PR8A 2R1IA 3JUWA 3CXQA 1IICA 2Z3KA 4B12A 5E96A 1GHEA 2FCKA 2VXKA 4J3GA 4U5YA 3TO9A 5AG5A 2VZZA 5F48A 4C7HA 3V8IA 5EC4A 3EO4A 1P4NA 1KZFA 5J8CA 1CM0A 4B14A 4A2ZA 2CNMA 2VEZA 2PR1A 2OZHA 1KUVA 4C2XA 2J8NA 3R9FA 3VWEA 2AE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FNC A;  2IL4 A;  5HMN A;  3N7Z A;  1Y9K A;  4B5P B;  3R9G A;  3QB8 A;  3T9Y A;  2FSR A;  2BEI A;  2R8V A;  2DXQ A;  3F0A A;  3R96 A;  3SXO A;  4KOX A;  1R57 A;  2WPW A;  1S7N A;  2CNT A;  2BUE A;  4Y49 B;  1XEB A;  4RS2 A;  1SQH A;  2Q0Y A;  1PUA A;  4LX9 A;  2VQY A;  4KZT A;  5I0C A;  4B5P A;  1ON0 A;  2PC1 A;  3R9E A;  1IID A;  2JDD A;  1S7K A;  4XNH B;  3K9U A;  3EFA A;  2B5G B;  3D2P A;  3TCV A;  2ARH A;  5EBV A;  2HV2 A;  1NMT A;  1XE4 A;  4OAE A;  2G3A A;  2Q44 A;  3G3S A;  4KOR A;  1Z4R A;  3D2M A;  4R3L A;  4K30 A;  1V0C A;  2CNS A;  2PSW A;  2ZXV A;  2J8M A;  4PV6 A;  4MHD A;  4KLW A;  1VKC A;  4YGO A;  3BJ8 A;  1LRZ A;  4FD4 A;  1S3Z A;  2F5I A;  1BO4 A;  1UFH A;  4XPD C;  4GS4 A;  3P2H A;  1Y9W A;  4H89 A;  4CAV A;  4KOV A;  3FYN A;  4JXR A;  2KCW A;  1P0H A;  2B5G A;  1IYL A;  3OWC A;  2EUI A;  1NSL A;  4R57 A;  3PP9 A;  1MJ9 A;  4KVO E;  4JLY A;  5IX3 A;  4MBU A;  4AG7 A;  1MJB A;  3TE4 A;  1L0C A;  1IYK A;  1RO5 A;  1Z9U A;  3BLN A;  3I9S A;  5F46 A;  2ZW6 A;  3NE7 A;  5HH1 A;  1QSM A;  4E0A A;  2P6G A;  4NCZ A;  2OH1 A;  2OB0 A;  4M85 A;  1MK4 A;  2OZG A;  1S7F A;  4DNC A;  2PRB A;  4CRZ B;  3VWD A;  3PZJ A;  2P6E A;  4XPL A;  3W6X A;  2FIA A;  1RXT A;  2H5M A;  1FY7 A;  4AG9 A;  5J8F A;  3R1K A;  4KVX A;  2C27 A;  2ZW5 A;  5CNP A;  3DNS A;  1NE9 A;  2NMT A;  4JXQ A;  1QSN A;  3EY5 A;  2Q7B A;  2HUZ A;  4XNH C;  1K4J A;  3TTH A;  4LUA A;  4KOW A;  1YVO A;  3GY9 A;  3R95 A;  4L89 A;  3SXN A;  1YX0 A;  4UWI A;  1IB1 E;  3GKR A;  1QST A;  2Q4V A;  1B87 A;  2FIW A;  3P2F A;  4B5O A;  4XPK A;  1YRE A;  4BMH A;  4EVY A;  5C82 A;  4ZBG A;  5KTC A;  2ZW7 A;  2A4N A;  4MY3 A;  4OAD A;  5F49 A;  1Y7R A;  3F8K A;  4YRH A;  5FVJ A;  1Q2D A;  3FIX A;  3MGD A;  3IWG A;  3QAH A;  2B4D B;  2FT0 A;  1QSO A;  4MJ8 A;  2VBQ A;  3EC4 A;  2D4O A;  2GAN A;  2REF A;  5IV0 A;  5ISV A;  4FD5 A;  4MY0 A;  2WPX A;  4QVT A;  4L8A A;  3EXN A;  2I00 A;  1S60 A;  3G8W A;  5C88 A;  2R7H A;  4ORF A;  4PK2 A;  3DDD A;  2FS5 A;  3DSB A;  2B3U A;  2B4D A;  4I49 A;  5F47 A;  3B8G A;  4HKF A;  2RC4 A;  4UWJ A;  1WK4 A;  4IF5 A;  4NSQ A;  2QML A;  1WWZ A;  2AJ6 A;  2JEV A;  2B3V A;  4KUB A;  4R87 A;  3S6K A;  4U9Y A;  4NF1 A;  1S7L A;  2ZW4 A;  4AVC A;  2QIR A;  5DWN A;  3S6H A;  4E8O A;  3CXS A;  1XIX A;  5GCN A;  1VHS A;  4F0Y A;  5KTA A;  3LOD A;  3C26 A;  3TOA A;  5IB0 A;  1Q2C A;  4PK3 A;  1BOB A;  4KOU A;  3UY5 A;  4ONU A;  4RI1 A;  1M4G A;  4R9M A;  2GE3 A;  3JVN A;  1M4D A;  3PGP A;  3D8P A;  5JPH A;  1I1D A;  1J4J A;  2JDC A;  4Y49 C;  3CXP A;  3D3S A;  1YR0 A;  4UA3 A;  4QBJ A;  1KUX A;  4XPD B;  3GYA A;  4X5K A;  3S6G A;  5H86 A;  2Z11 A;  3FRM A;  1TIQ A;  2I79 A;  1I12 A;  3IGR A;  4UBR A;  1XF8 A;  2JLM A;  1I21 A;  4KOY A;  2B4B A;  1N71 A;  2REE A;  1MJA A;  1Z4E A;  3TO6 A;  4AVB A;  2FL4 A;  3F5B A;  1M4I A;  4YFJ A;  3TOB A;  1YVK A;  2PQ8 A;  4IUS A;  1M44 A;  3LD2 A;  2Z10 A;  2VZY A;  2B58 A;  4CS0 B;  4HNW B;  3BJ7 A;  4E2A A;  3KKW A;  1PU9 A;  2Q04 A;  4PSX A;  1XMT A;  2BL1 A;  2VI7 A;  3RYO A;  2OZU A;  1YGH A;  1QSR A;  5KTD A;  3ZJ0 A;  4H6U A;  1CJW A;  1M1D A;  4MI4 A;  2Q4Y A;  1Q2Y A;  4FD6 A;  3TT2 A;  4HNY B;  1YLE A;  1KUY A;  4QC6 A;  3DR6 A;  1B6B A;  3FB3 A;  4U9Z A;  2BSW A;  2Z0Z A;  4CRY B;  3FXT A;  5DWM A;  4AVA A;  2HQY A;  2K5T A;  3S6F A;  2D4P A;  3I3G A;  4OLL A;  4CAX A;  2G0B A;  4HNX B;  4FD7 A;  4II9 A;  3WR7 A;  4QB9 A;  3W6S A;  2P0W A;  2QEC A;  4NXY A;  2CY2 A;  4R3K A;  4PSW A;  5JQ4 A;  1OZP A;  1YK3 A;  3E0K A;  4H6Z A;  2O28 A;  1U6M A;  4CAW A;  2P6F A;  3H4Q A;  4KUA A;  3FBU A;  3T90 A;  2ATR A;  4JWP A;  2ZPA A;  2J8R A;  3DR8 A;  4KOT A;  2EVN A;  3W91 A;  2X7B A;  3TO7 A;  2FE7 A;  2R98 A;  4JD6 A;  4JJX A;  2PDO A;  4NEX A;  2FXF A;  4F6A A;  3TFY A;  2Y0M A;  2G3T A;  4AB7 A;  1S5K A;  5H84 A;  2OU2 A;  4KLV A;  2GIV A;  4M3S A;  3ZZI A;  3SHP A;  4QUS A;  4KVM E;  4KOS A;  2PR8 A;  2R1I A;  3JUW A;  3CXQ A;  1IIC A;  5E96 A;  1GHE A;  2FCK A;  2VXK A;  4J3G A;  4U5Y A;  3TO9 A;  2VZZ A;  5F48 A;  3V8I A;  5EC4 A;  3EO4 A;  1P4N A;  1KZF A;  5J8C A;  1CM0 A;  2CNM A;  2VEZ A;  2PR1 A;  2OZH A;  1KUV A;  2J8N A;  3R9F A;  3VWE A;  2AE6 A; 
#chains in the Genus database with same CATH topology
 2ZEM A;  2IL4 A;  3FNC A;  5HMN A;  1BLL E;  1YSJ A;  3N7Z A;  5CPA A;  2V8D A;  4UCN A;  1Y9K A;  4B5P B;  4MRI A;  3D7D A;  4P6Y A;  2Q4Z A;  2C6G A;  3R9G A;  3QB8 A;  3FF3 A;  3T9Y A;  5AG6 A;  4MCP A;  4OKO A;  2FSR A;  4MFQ A;  2BEI A;  2R8V A;  1FNO A;  2DXQ A;  2PJ2 A;  3F0A A;  3R96 A;  3SXO A;  3QAY A;  4KOX A;  1R57 A;  2PJ6 A;  2WPW A;  1S7N A;  4OID A;  2ABZ A;  2CNT A;  4R7M A;  4EWT A;  3TC8 A;  2AFX A;  8CPA A;  2BUE A;  3PBE A;  4Y49 B;  1XEB A;  4WJB A;  1CG2 A;  1SQH A;  4RS2 A;  2XEG A;  3LMS A;  2Q0Y A;  1PUA A;  4LX9 A;  2VQY A;  4KZT A;  5I0C A;  4B5P A;  4PXE A;  1ON0 A;  2PC1 A;  3ISZ A;  1XRY A;  1IOF A;  3LWU A;  4MCQ A;  3R9E A;  2Q43 A;  3D4U A;  3GIU A;  4MMO A;  2PRQ A;  1CP6 A;  1IID A;  2JDD A;  1S7K A;  4XNH B;  5LRJ A;  3K9U A;  4ZI6 A;  4IHM A;  3EFA A;  4UFV A;  2B5G B;  1F2P A;  3D2P A;  5IB9 A;  2Z3N A;  2Q7S A;  3TCV A;  4A94 A;  2O4H A;  2V8G A;  2ARH A;  2PJ1 A;  4X3R A;  5EBV A;  2HV2 A;  3WC5 A;  1NMT A;  1XE4 A;  4OAE A;  2G3A A;  2Q44 A;  3G3S A;  2IQ6 A;  1Z4R A;  1OBR A;  3D2M A;  4KOR A;  3CT9 A;  4R3L A;  5JH9 A;  2PJ4 A;  1V0C A;  2CNS A;  3PFO A;  4K30 A;  1ARM A;  2PSW A;  3H8E A;  2ZXV A;  2J8M A;  2POK A;  2IJZ A;  4MHD A;  4PV6 A;  4KLW A;  3SJE A;  3SJF A;  4P4F A;  1VKC A;  4IK2 A;  4YGO A;  3BJ8 A;  4A39 A;  1LRZ A;  4FD4 A;  1S3Z A;  2F5I A;  3H8G A;  4C2Z A;  1BO4 A;  1UFH A;  4NJQ A;  4XPD C;  4GS4 A;  3P2H A;  1Y9W A;  4H89 A;  4CGP A;  4CAV A;  4KOV A;  1IGB A;  4YU9 A;  3WC6 A;  3FYN A;  3K2K A;  4JXR A;  2KCW A;  1P0H A;  4YWY A;  2B5G A;  1JWQ A;  1IYL A;  2NSM A;  2EUI A;  2FVG A;  2XEI A;  3B3W A;  3OWC A;  1NSL A;  4NFR A;  2C6C A;  2OOT A;  3FH4 A;  1YW4 A;  4R57 A;  4DYO A;  3PP9 A;  4A31 A;  1MJ9 A;  4KVO E;  4JLY A;  2PIZ A;  5IX3 A;  3H5Z A;  4MBU A;  4AG7 A;  1MJB A;  1QMU A;  3PB9 X;  4R76 A;  3TE4 A;  3PRT A;  1M4L A;  4CPA A;  2ZEH A;  1L0C A;  5CBM A;  1IYK A;  1RO5 A;  1Z9U A;  3BLN A;  3B3T A;  3JRU A;  1Z8L A;  3I9S A;  4NJR A;  5F46 A;  3IU2 A;  4OME A;  3D66 A;  5F09 A;  2ZW6 A;  3NE7 A;  5HH1 A;  1QSM A;  3IWE A;  4OC2 A;  3NFZ A;  5LYI A;  4E0A A;  5G1Z A;  2P6G A;  4KSF A;  4NCZ A;  2OH1 A;  1ZLH A;  1TF9 A;  2OB0 A;  2GLF A;  4M85 A;  3VAT A;  4NGN A;  4CYO A;  4JYW A;  1Z8T A;  1MK4 A;  5G21 A;  4CYP A;  2OZG A;  3VH9 A;  1S7F A;  2PVV A;  2PRB A;  4DNC A;  4CRZ B;  5ELY A;  4X2T A;  4OP4 A;  2PCU A;  3PB8 X;  3PZJ A;  3T8W A;  3VWD A;  1EE3 P;  2P6E A;  4XPL A;  3KHZ A;  3NH5 A;  3W6X A;  4OC5 A;  2FIA A;  4F0X A;  4GM5 A;  3B2Y A;  1HDU A;  4P4D A;  4CGN A;  4UFW A;  2QVP A;  1RXT A;  3NE8 A;  3IJ3 A;  3V38 A;  3KQZ A;  2H5M A;  3B35 A;  5A28 A;  3PBB A;  2BOA A;  2BO9 A;  1FY7 A;  2Z3O A;  3CPA A;  4KS9 A;  4AG9 A;  2J9A A;  5J8F A;  4Z65 A;  1JQG A;  3R1K A;  4KVX A;  2C27 A;  2ZED A;  2ZEO A;  2ZW5 A;  4OC3 A;  1X10 A;  2NYQ A;  4Q7A A;  3IO1 A;  5CNP A;  2PJ0 A;  3DNS A;  1NE9 A;  2NMT A;  4JXQ A;  1QSN A;  5HVG A;  3IC1 A;  3B3S A;  3EY5 A;  4A95 A;  4CGO A;  2Q7B A;  2HUZ A;  4XNH C;  1K4J A;  3A9L A;  3TTH A;  4LUA A;  4KOW A;  1AYE A;  1YVO A;  3GY9 A;  4NGQ A;  3R95 A;  3BI0 A;  1VIX A;  2C1C A;  1ARL A;  2ZOG A;  1Q7L A;  4L89 A;  1AMP A;  1CBX A;  1YX0 A;  4UWI A;  3SXN A;  4B6Z A;  4TNU A;  3VAR A;  1BPN A;  1IB1 E;  4UFX A;  5K8M A;  2PVW A;  1QST A;  2Q4V A;  3GKR A;  4NGT A;  3BXM A;  4BBH A;  1B87 A;  3S9L A;  2ZEL A;  1ZG8 A;  2FIW A;  3P2F A;  3WT4 A;  4B5O A;  5HVH A;  4XPK A;  1YRE A;  4Q38 A;  4BMH A;  2EO8 A;  3CZX A;  4MXU A;  4EVY A;  2PIY A;  5C82 A;  4ZBG A;  5KTC A;  2ZW7 A;  2A4N A;  4ZY2 A;  4MY3 A;  4BIN A;  4OAD A;  2Z3M A;  5F49 A;  1Y7R A;  5K8O A;  2YNE A;  3F8K A;  4YRH A;  4UEF A;  5FVJ A;  4FBE A;  1Q2D A;  2V8V A;  3FIX A;  3MGD A;  4M6I A;  4ZX8 A;  2Z3P A;  3IWG A;  1ELM P;  2PJC A;  4UCM A;  3QAH A;  2B4D B;  2F8H A;  3KQX A;  3K9T A;  2FT0 A;  3DGV A;  1QSO A;  4MJ8 A;  2VBQ A;  3EC4 A;  4P44 A;  4MFK A;  2D4O A;  2GAN A;  2REF A;  4CAE A;  5IV0 A;  5ISV A;  4FD5 A;  3HLP A;  4MY0 A;  2WPX A;  5HXD A;  2YGW A;  4QVT A;  4L8A A;  3EXN A;  1IOI A;  5AGE A;  2Z3L A;  2I00 A;  5K8P A;  1IU8 A;  1PYT B;  4P45 A;  3RBU A;  4C7I A;  1S60 A;  2G9D A;  3G8W A;  4ZX9 A;  5C88 A;  1Z2L A;  2RFH A;  2R7H A;  4ORF A;  1UWY A;  1CPX A;  3DDD A;  1TF8 A;  3KL9 A;  4PK2 A;  1KWM A;  1BAV A;  2FS5 A;  3DSB A;  3PB4 X;  2B3U A;  3I1U A;  5K8N A;  2B4D A;  4I49 A;  4LQG A;  5J1Q A;  4ONW A;  5F47 A;  3B8G A;  4HKF A;  2RC4 A;  4B11 A;  4TWE A;  1XBU A;  3WAB A;  5LYD A;  4UWJ A;  2PJ5 A;  1X12 A;  3FJU A;  1WK4 A;  4IF5 A;  4NSQ A;  4OIW A;  2QML A;  1WWZ A;  3S9N A;  2PE3 A;  2ZEG A;  2GFQ A;  5LYL A;  4M6G A;  3GUX A;  1BPM A;  2PJ7 A;  2AJ6 A;  1QQ9 A;  2YNC A;  2JEV A;  5LYF A;  1TXR A;  3RO0 A;  2B3V A;  4KUB A;  1F57 A;  1CPS A;  4R87 A;  3S6K A;  4U9Y A;  1XMB A;  4NF1 A;  4P4E A;  1S7L A;  2ZW4 A;  2CTC A;  2HC9 A;  4KSI A;  5EMI A;  4AVC A;  4F9V A;  2QIR A;  2ODF A;  5DWN A;  3S6H A;  4E8O A;  3CXS A;  1XIX A;  4B13 A;  3IU1 A;  5GCN A;  1VHS A;  4NGM A;  4F0Y A;  3LOD A;  5KTA A;  3C26 A;  2ZOF A;  1YW6 A;  3WC7 A;  4FUU A;  2PJB A;  4MHZ A;  2ANP A;  3TOA A;  3IIB A;  1Q2C A;  5IB0 A;  2DPT A;  4PK3 A;  1BOB A;  4FWU A;  3KAS A;  1TKH A;  2CXA A;  2CIJ A;  2XEJ A;  4KOU A;  3UY5 A;  4ONU A;  4RI1 A;  3DLJ A;  4AXV A;  1HDQ A;  1M4G A;  4R9M A;  1IY7 A;  2GE3 A;  3JVN A;  5BWA B;  1M4D A;  3PGP A;  2Q51 A;  3D8P A;  5JPH A;  4A33 A;  2CF4 A;  1I1D A;  1J4J A;  2JDC A;  5AG7 A;  4Y49 C;  1TKJ A;  2JBK A;  4LQ6 A;  3CXP A;  3D3S A;  4CGM A;  4P4B A;  4EFD A;  1YR0 A;  4PQA A;  4UA3 A;  1CX8 A;  1KUX A;  3KR5 A;  4Q36 A;  4QBJ A;  3N5F A;  4MFL A;  1F2O A;  4XPD B;  3NH4 A;  3GYA A;  2DEA A;  3FMC A;  4X5K A;  5LRG A;  3S6G A;  4BD9 A;  2AFS A;  5H86 A;  2HB6 A;  1YLO A;  1TIQ A;  2I79 A;  2Z11 A;  3FRM A;  6CPA A;  1DE4 C;  1NSA A;  1VHE A;  2O53 A;  1I12 A;  4F9U A;  2YND A;  2F7V A;  3IGR A;  4UBR A;  3FX6 A;  2WYR A;  4K3N A;  1XJO A;  1XF8 A;  2JLM A;  1I21 A;  2EK9 A;  2EBJ A;  4KOY A;  4M6H A;  2B4B A;  2ZEE A;  3KGQ A;  1N71 A;  4JZ0 A;  2REE A;  4HPS A;  2WZN A;  1MJA A;  1Z4E A;  3TO6 A;  5G20 A;  4AVB A;  2YNC C;  3IFE A;  2FL4 A;  2VL1 A;  2WSA A;  3PB7 X;  1ZLI A;  4R6T A;  5DS0 A;  3F5B A;  1M4I A;  3BHX A;  2BCO A;  2GLJ A;  3TOB A;  1YME A;  1YVK A;  4CAF A;  4DUK A;  2PQ8 A;  4YFJ A;  4IUS A;  1M44 A;  3LD2 A;  2Z10 A;  4P4I A;  4CYQ A;  3V7Z A;  2QJ8 A;  2VZY A;  5I4M A;  3CPX A;  1R3N A;  2B58 A;  4CS0 B;  4ZYQ A;  4HNW B;  3BJ7 A;  4F8Z A;  2C6P A;  4E2A A;  1CP7 A;  3KKW A;  3B3V A;  3B7I A;  1PU9 A;  2Q04 A;  4ZGY B;  4PSX A;  5JGF A;  1XMT A;  2WUU A;  3S9M A;  1ELL P;  4NGR A;  4MFZ A;  2EWB A;  4MFJ A;  2BL1 A;  2RB7 A;  2VI7 A;  3LAC A;  4NGS A;  3RYO A;  2OZU A;  1XOV A;  3D7G A;  1YGH A;  4WWV A;  1QSR A;  4A38 A;  5KTD A;  3ZJ0 A;  2AFZ A;  1CJW A;  3B3C A;  4H6U A;  1M1D A;  1YQE A;  4IAV A;  2Q4Y A;  1Q2Y A;  1XFO A;  4MI4 A;  4FD6 A;  3TT2 A;  4HNY B;  4X8I A;  4CYN A;  1YLE A;  1DTD A;  1KUY A;  2PJA A;  4QC6 A;  3DR6 A;  1B6B A;  3FB3 A;  4U9Z A;  2BSW A;  2Z0Z A;  4CRY B;  3FXT A;  3NH8 A;  1VGY A;  2ZEN A;  5DWM A;  1FT7 A;  4H2K A;  4AVA A;  2HQY A;  2AFW A;  2V77 A;  2K5T A;  3D68 A;  4RUH A;  3S6F A;  3SJX A;  3CDX A;  2AFO A;  2D4P A;  3I3G A;  4G1P A;  3PEI A;  2CTB A;  3MN8 A;  4OLL A;  4DJL A;  4CAX A;  5AG4 A;  2ZEF A;  2G0B A;  4HNX B;  4FD7 A;  4B10 A;  4II9 A;  1R43 A;  3WR7 A;  4ZY0 A;  4UIB A;  4QB9 A;  3SI0 A;  3W6S A;  2P0W A;  2QEC A;  3IWW A;  4NXY A;  2CY2 A;  2PJ8 A;  4R3K A;  2IMO A;  4PSW A;  5HVF A;  5JQ4 A;  1GYT A;  3H8F A;  1OZP A;  4C2Y A;  1YK3 A;  3E0K A;  3FVL A;  4H6Z A;  3D67 A;  3MRU A;  4OC0 A;  2O28 A;  1U6M A;  2DPS A;  2OR4 A;  4CAW A;  1ZG9 A;  2AFM A;  1ZG7 A;  3RZA A;  2P6F A;  3H4Q A;  5THW A;  3D7H A;  4KUA A;  3FBU A;  1Z5R A;  3T90 A;  4A32 A;  4UIA A;  4ZY1 A;  3KZW A;  2ATR A;  2XEF A;  4JWP A;  1HEE A;  2J8R A;  2ZPA A;  3DR8 A;  4KOT A;  1Y0R A;  5JM6 A;  3GB0 A;  2EVN A;  3W91 A;  2X7B A;  5D29 A;  3SI2 A;  1Y7E A;  3TO7 A;  3JTK A;  1Y0Y A;  2FE7 A;  2R98 A;  3FEE A;  4JD6 A;  1PCA A;  4JJX A;  2PDO A;  2V8H A;  4KSA A;  4NEX A;  5A27 A;  4UEZ A;  4A30 A;  4CGL A;  3FEC A;  5D8N A;  2FXF A;  1LAM A;  4F6A A;  3TFY A;  4MFP A;  4OC1 A;  2AFU A;  2Y0M A;  5G22 A;  2G3T A;  4C68 A;  4AB7 A;  4MHN A;  1S5K A;  2PJ3 A;  5H84 A;  3PFE A;  2OU2 A;  4KLV A;  1RTQ A;  2GIV A;  4M3S A;  1AUG A;  3BI1 A;  3ZZI A;  2I3C A;  3FED A;  4PPZ A;  7CPA A;  2GRE A;  2GU2 A;  4W9Y A;  3SHP A;  4UCP A;  1ZO0 A;  2QYV A;  4QUS A;  1A2Z A;  3TX8 A;  4KVM E;  4OC4 A;  4KOS A;  4A37 A;  3RAM A;  4RN7 A;  2DF5 A;  4NGP A;  2PJ9 A;  3KR4 A;  2PR8 A;  2R1I A;  1VHO A;  4MCS A;  3JUW A;  4UF4 A;  4UEE A;  3CXQ A;  1IIC A;  1LFW A;  2Z3K A;  4MHP A;  3IEH A;  1H8L A;  4B12 A;  2JBJ A;  2JEW A;  5E96 A;  3L2N A;  4FAI A;  1GHE A;  1TKF A;  2FCK A;  2VXK A;  3KHX A;  3PB6 X;  4J3G A;  4R8F A;  4U5Y A;  3TO9 A;  5AG5 A;  4EME A;  2VZZ A;  5F48 A;  4P4J A;  3SI1 A;  4C7H A;  3V8I A;  1Z8X A;  5EC4 A;  3EO4 A;  1LCP A;  1P4N A;  3HUV A;  3NA6 A;  1KZF A;  1Z8W A;  4GXH A;  1LAN A;  4MCR A;  4P10 A;  3SJG A;  5J8C A;  1LAP A;  4PXD A;  1CM0 A;  4B14 A;  3KI9 A;  4O23 A;  3RNZ A;  2CNM A;  4A2Z A;  4PXC A;  3ISX A;  2VEZ A;  4PXB A;  5LRK A;  1LOK A;  3QNV A;  2ZEP A;  2PR1 A;  2OZH A;  4MHY A;  1KUV A;  3D7F A;  3GLJ A;  4C2X A;  2J8N A;  2EK8 A;  3R9F A;  3VWE A;  2AE6 A; 
#chains in the Genus database with same CATH homology
 3FNC A;  2IL4 A;  5HMN A;  3N7Z A;  4UCN A;  1Y9K A;  4B5P B;  3R9G A;  3QB8 A;  3T9Y A;  5AG6 A;  2FSR A;  4MFQ A;  2BEI A;  2R8V A;  2DXQ A;  3F0A A;  3R96 A;  3SXO A;  4KOX A;  1R57 A;  2WPW A;  1S7N A;  2CNT A;  2BUE A;  4Y49 B;  1XEB A;  4RS2 A;  1SQH A;  2Q0Y A;  1PUA A;  4LX9 A;  2VQY A;  4KZT A;  5I0C A;  4B5P A;  1ON0 A;  2PC1 A;  3R9E A;  1IID A;  2JDD A;  1S7K A;  4XNH B;  3K9U A;  3EFA A;  4UFV A;  2B5G B;  3D2P A;  2Z3N A;  3TCV A;  2ARH A;  5EBV A;  2HV2 A;  1NMT A;  1XE4 A;  4OAE A;  2G3A A;  2Q44 A;  3G3S A;  4KOR A;  1Z4R A;  3D2M A;  4R3L A;  4K30 A;  1V0C A;  2CNS A;  2PSW A;  2ZXV A;  2J8M A;  4PV6 A;  4MHD A;  4KLW A;  1VKC A;  4YGO A;  3BJ8 A;  1LRZ A;  4FD4 A;  1S3Z A;  2F5I A;  4C2Z A;  1BO4 A;  1UFH A;  4XPD C;  4GS4 A;  3P2H A;  1Y9W A;  4H89 A;  4CGP A;  4CAV A;  4KOV A;  3FYN A;  4JXR A;  2KCW A;  1P0H A;  2B5G A;  1IYL A;  3OWC A;  2EUI A;  1NSL A;  4R57 A;  3PP9 A;  4A31 A;  1MJ9 A;  4KVO E;  4JLY A;  5IX3 A;  3H5Z A;  4MBU A;  4AG7 A;  1MJB A;  3TE4 A;  1L0C A;  1IYK A;  1RO5 A;  1Z9U A;  3BLN A;  3I9S A;  5F46 A;  3IU2 A;  2ZW6 A;  3NE7 A;  5HH1 A;  1QSM A;  3IWE A;  4E0A A;  5G1Z A;  2P6G A;  4KSF A;  4NCZ A;  2OH1 A;  2OB0 A;  4M85 A;  4CYO A;  1MK4 A;  5G21 A;  4CYP A;  2OZG A;  1S7F A;  4DNC A;  2PRB A;  4CRZ B;  3VWD A;  3PZJ A;  2P6E A;  4XPL A;  3W6X A;  2FIA A;  4F0X A;  4CGN A;  4UFW A;  1RXT A;  2H5M A;  5A28 A;  1FY7 A;  2Z3O A;  4KS9 A;  4AG9 A;  5J8F A;  3R1K A;  4KVX A;  2C27 A;  2ZW5 A;  5CNP A;  3DNS A;  1NE9 A;  2NMT A;  4JXQ A;  1QSN A;  3EY5 A;  4A95 A;  4CGO A;  2Q7B A;  2HUZ A;  4XNH C;  1K4J A;  3A9L A;  3TTH A;  4LUA A;  4KOW A;  1YVO A;  3GY9 A;  3R95 A;  4L89 A;  3SXN A;  1YX0 A;  4UWI A;  1IB1 E;  4UFX A;  3GKR A;  1QST A;  2Q4V A;  4BBH A;  1B87 A;  2FIW A;  3P2F A;  4B5O A;  4XPK A;  1YRE A;  4Q38 A;  4BMH A;  4EVY A;  5C82 A;  4ZBG A;  5KTC A;  2ZW7 A;  2A4N A;  4MY3 A;  4OAD A;  2Z3M A;  5F49 A;  1Y7R A;  2YNE A;  3F8K A;  4YRH A;  5FVJ A;  1Q2D A;  3FIX A;  3MGD A;  2Z3P A;  3IWG A;  4UCM A;  3QAH A;  2B4D B;  2FT0 A;  1QSO A;  4MJ8 A;  2VBQ A;  3EC4 A;  4MFK A;  2D4O A;  2GAN A;  2REF A;  4CAE A;  5IV0 A;  5ISV A;  4FD5 A;  4MY0 A;  2WPX A;  2YGW A;  4QVT A;  4L8A A;  3EXN A;  5AGE A;  2Z3L A;  2I00 A;  4C7I A;  1S60 A;  3G8W A;  5C88 A;  2R7H A;  4ORF A;  4PK2 A;  3DDD A;  2FS5 A;  3DSB A;  2B3U A;  2B4D A;  4I49 A;  5F47 A;  4B11 A;  3B8G A;  4HKF A;  2RC4 A;  4UWJ A;  1WK4 A;  4IF5 A;  4NSQ A;  2QML A;  1WWZ A;  2AJ6 A;  2YNC A;  2JEV A;  2B3V A;  4KUB A;  4R87 A;  3S6K A;  4U9Y A;  4NF1 A;  1S7L A;  2ZW4 A;  4AVC A;  2QIR A;  5DWN A;  3S6H A;  4E8O A;  3CXS A;  1XIX A;  4B13 A;  3IU1 A;  5GCN A;  1VHS A;  4F0Y A;  5KTA A;  3LOD A;  3C26 A;  3TOA A;  5IB0 A;  1Q2C A;  2DPT A;  4PK3 A;  1BOB A;  2CXA A;  4KOU A;  3UY5 A;  4ONU A;  4RI1 A;  1M4G A;  4R9M A;  2GE3 A;  3JVN A;  5BWA B;  1M4D A;  3PGP A;  3D8P A;  5JPH A;  4A33 A;  1I1D A;  1J4J A;  2JDC A;  5AG7 A;  4Y49 C;  3CXP A;  3D3S A;  4CGM A;  1YR0 A;  4UA3 A;  4QBJ A;  1KUX A;  4Q36 A;  4MFL A;  4XPD B;  3GYA A;  4X5K A;  3S6G A;  5H86 A;  2Z11 A;  3FRM A;  1TIQ A;  2I79 A;  1I12 A;  2YND A;  3IGR A;  4UBR A;  1XF8 A;  2JLM A;  1I21 A;  4KOY A;  2B4B A;  1N71 A;  2REE A;  1MJA A;  1Z4E A;  3TO6 A;  5G20 A;  4AVB A;  2YNC C;  2FL4 A;  2WSA A;  3F5B A;  1M4I A;  4YFJ A;  3TOB A;  1YVK A;  4CAF A;  2PQ8 A;  4IUS A;  1M44 A;  3LD2 A;  2Z10 A;  4CYQ A;  2VZY A;  2B58 A;  4CS0 B;  4HNW B;  3BJ7 A;  4E2A A;  3KKW A;  1PU9 A;  2Q04 A;  4ZGY B;  4PSX A;  1XMT A;  2WUU A;  4MFZ A;  4MFJ A;  2BL1 A;  2VI7 A;  3RYO A;  2OZU A;  1YGH A;  1QSR A;  5KTD A;  3ZJ0 A;  4H6U A;  1CJW A;  1M1D A;  4MI4 A;  2Q4Y A;  1Q2Y A;  4FD6 A;  3TT2 A;  4HNY B;  4CYN A;  1YLE A;  1KUY A;  4QC6 A;  3DR6 A;  1B6B A;  3FB3 A;  4U9Z A;  2BSW A;  2Z0Z A;  4CRY B;  3FXT A;  5DWM A;  4AVA A;  2HQY A;  2K5T A;  3S6F A;  2D4P A;  3I3G A;  4OLL A;  4CAX A;  5AG4 A;  2G0B A;  4HNX B;  4FD7 A;  4B10 A;  4II9 A;  3WR7 A;  4QB9 A;  3W6S A;  2P0W A;  2QEC A;  4NXY A;  2CY2 A;  4R3K A;  4PSW A;  5JQ4 A;  1OZP A;  4C2Y A;  1YK3 A;  3E0K A;  4H6Z A;  2O28 A;  1U6M A;  2DPS A;  4CAW A;  2P6F A;  3H4Q A;  4KUA A;  3FBU A;  3T90 A;  4A32 A;  2ATR A;  4JWP A;  2ZPA A;  2J8R A;  3DR8 A;  4KOT A;  2EVN A;  3W91 A;  2X7B A;  3TO7 A;  3JTK A;  2FE7 A;  2R98 A;  4JD6 A;  4JJX A;  2PDO A;  4KSA A;  4NEX A;  5A27 A;  4A30 A;  4CGL A;  2FXF A;  4F6A A;  3TFY A;  4MFP A;  5G22 A;  2Y0M A;  2G3T A;  4C68 A;  4AB7 A;  1S5K A;  5H84 A;  2OU2 A;  4KLV A;  2GIV A;  4M3S A;  3ZZI A;  3SHP A;  4UCP A;  1ZO0 A;  4QUS A;  4KVM E;  4KOS A;  2PR8 A;  2R1I A;  3JUW A;  3CXQ A;  1IIC A;  2Z3K A;  4B12 A;  5E96 A;  1GHE A;  2FCK A;  2VXK A;  4J3G A;  4U5Y A;  3TO9 A;  5AG5 A;  2VZZ A;  5F48 A;  4C7H A;  3V8I A;  5EC4 A;  3EO4 A;  1P4N A;  1KZF A;  5J8C A;  1CM0 A;  4B14 A;  4A2Z A;  2CNM A;  2VEZ A;  2PR1 A;  2OZH A;  1KUV A;  4C2X A;  2J8N A;  3R9F A;  3VWE A;  2AE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...