3EFAA

Crystal structure of putative n-acetyltransferase from lactobacillus plantarum
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
146
structure length
146
Chain Sequence
NAMKIIFSASPANRAAAYALRQAVFVEERGISADVEFDVKDTDQCEYAVLYLQPDLPITTLRLEPQADHVMRFGRVCTRKAYRGHGWGRQLLTAAEEWATQRGFTHGEIHGELTAQRFYELCGYRVTAGPYDEDGAPVVIMHKQLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative Acetyltransferase
publication title Crystal structure of putative N-acetyltransferase from Lactobacillus plantarum
rcsb
source organism Lactobacillus plantarum wcfs1
total genus 42
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3efaA00
1BOBA 3TO7A 4LX9A 4FD7A 2EVNA 2QMLA 2JDDA 4FD4A 3TT2A 4LUAA 2OZHA 1B87A 2ARHA 4PK3A 3PZJA 1QSTA 3DNSA 2FIAA 2B58A 3TO6A 2ZXVA 4XNHC 1LRZA 2Q4YA 1Z4EA 4X5KA 2ZW4A 2ATRA 3FNCA 4HNWB 4KOUA 2Q0YA 4XPDC 4H6UA 1KUYA 2R98A 4JJXA 1ON0A 2J8NA 4NF1A 1NSLA 4JXRA 4KOYA 3P2HA 1IYLA 3QAHA 2HUZA 4PK2A 4KOSA 4CRYB 4H6ZA 2OB0A 1TIQA 4U9ZA 3VWEA 2GE3A 1NMTA 2B5GA 4MHDA 5HH1A 1Q2YA 1I12A 4KOXA 2BSWA 4KVOE 4U5YA 3FXTA 1XEBA 1QSRA 5EC4A 2D4OA 3EXNA 3FBUA 3TE4A 4KOTA 3S6FA 4OADA 4IUSA 2B4DA 5EBVA 5F46A 1VKCA 1Y9KA 2HQYA 2X7BA 3P2FA 3V8IA 2J8MA 2PRBA 3F8KA 3EFAA 3DDDA 3T9YA 3CXSA 1KZFA 3W6SA 2Z11A 4YFJA 2B5GB 3R96A 4MBUA 1R57A 3D2PA 4OAEA 4PV6A 4R3LA 2OU2A 2R8VA 3DSBA 4AVAA 2FSRA 2P6EA 5F48A 2P6GA 4MY0A 2VBQA 3TTHA 2VI7A 3PP9A 1S7NA 4KOWA 1NE9A 2Q7BA 5IB0A 4KUBA 4CAVA 3NE7A 3W91A 5F47A 1Y7RA 3EO4A 4HKFA 4H89A 2Y0MA 2P0WA 2VZYA 3S6KA 4PSWA 5E96A 1YLEA 1IB1E 4ORFA 1S7FA 3H4QA 4AVBA 5IV0A 3FYNA 4KVME 4NXYA 3R9FA 1XF8A 4I49A 2JEVA 1M4GA 1V0CA 4E2AA 2QECA 4KORA 4XPKA 3T90A 2OZGA 3B8GA 2REFA 1M4DA 2Q44A 5KTDA 3I3GA 1MJ9A 1OZPA 4E0AA 3TO9A 2CY2A 3GYAA 4QBJA 3S6GA 1P4NA 4NCZA 2PR1A 2VEZA 1S3ZA 3IGRA 5GCNA 4DNCA 3JVNA 4UA3A 1MJAA 4Y49B 1S5KA 1UFHA 2WPWA 4JD6A 3I9SA 4CAWA 3SHPA 1QSMA 2RC4A 1IYKA 2F5IA 2BL1A 2G3TA 2FXFA 1Z9UA 1K4JA 2B3UA 4MI4A 4AG7A 1Q2DA 4F0YA 2ZW7A 4FD6A 4II9A 1P0HA 4OLLA 5KTCA 4L8AA 1KUVA 3D3SA 2FIWA 3FIXA 3D2MA 4PSXA 3ZZIA 2PR8A 5HMNA 2P6FA 1BO4A 4YGOA 2Z0ZA 2OH1A 1S60A 2A4NA 2PDOA 3BJ7A 2FE7A 3R9GA 5FVJA 4MJ8A 4U9YA 3QB8A 4JXQA 2PQ8A 4IF5A 3CXPA 3E0KA 1I21A 3F0AA 1YREA 4KVXA 1YGHA 4QC6A 2ZPAA 3D8PA 2FS5A 2KCWA 4AVCA 2C27A 1N71A 2FCKA 3UY5A 4RS2A 4R57A 1CJWA 1PUAA 4UWIA 2WPXA 3S6HA 2ZW6A 2R7HA 4GS4A 1GHEA 2REEA 3RYOA 2Q04A 3TOBA 1B6BA 1IICA 3TFYA 3LODA 2GANA 1PU9A 1XE4A 4XPLA 4B5OA 4QVTA 4M85A 2J8RA 2IL4A 2B4DB 2CNTA 4KZTA 3EY5A 4UWJA 4AB7A 3N7ZA 1RO5A 3K9UA 1S7KA 2VQYA 4CRZB 2FT0A 1Z4RA 1I1DA 4R87A 1S7LA 2G3AA 2VXKA 1M1DA 1YK3A 4JLYA 1J4JA 4L89A 1IIDA 3SXOA 5J8CA 5H84A 4CAXA 4UBRA 4HNYB 3MGDA 1QSNA 2BUEA 5JPHA 5H86A 2PC1A 2FL4A 4Y49C 3VWDA 3GY9A 4K30A 2OZUA 4KLVA 4ZBGA 4F6AA 4CS0B 3R95A 3G3SA 1XMTA 3DR8A 5I0CA 3LD2A 1CM0A 1YR0A 3JUWA 4QUSA 1Y9WA 4R9MA 4ONUA 5ISVA 1FY7A 2B4BA 4XNHB 1M4IA 2K5TA 2G0BA 3BLNA 4KOVA 1YX0A 2GIVA 2VZZA 3G8WA 4QB9A 2R1IA 3R9EA 4JWPA 4XPDB 1RXTA 5F49A 1YVKA 3KKWA 1L0CA 4R3KA 2PSWA 5JQ4A 1U6MA 4M3SA 5KTAA 5C82A 5DWNA 4YRHA 2I00A 4B5PA 1M44A 3EC4A 4MY3A 2DXQA 1SQHA 3W6XA 3ZJ0A 2EUIA 2H5MA 4E8OA 5IX3A 1MK4A 3IWGA 2JLMA 3FRMA 2O28A 4BMHA 2NMTA 3TCVA 5DWMA 2AJ6A 2I79A 2CNMA 2D4PA 1KUXA 3C26A 5C88A 3GKRA 1XIXA 2BEIA 4NEXA 3SXNA 3TOAA 4EVYA 3F5BA 4J3GA 3PGPA 4NSQA 3CXQA 1WWZA 2AE6A 3BJ8A 2B3VA 2JDCA 4RI1A 4KLWA 1Q2CA 4AG9A 5CNPA 4B5PB 5J8FA 3OWCA 3WR7A 2HV2A 2Q4VA 2Z10A 1MJBA 4FD5A 4HNXB 4KUAA 3R1KA 2QIRA 1WK4A 1QSOA 1YVOA 3FB3A 2ZW5A 1VHSA 2CNSA 3DR6A
chains in the Genus database with same CATH superfamily
4B14A 1BOBA 4A37A 3TO7A 4LX9A 4FD7A 2I3CA 2EVNA 2QMLA 2JDDA 2Z3LA 3D7GA 4FD4A 1Z5RA 3TT2A 1AMPA 1HEEA 4LUAA 2OZHA 2ZEMA 1B87A 2AFWA 2ARHA 5D29A 4B6ZA 1JWQA 4PK3A 3PZJA 1QSTA 3A9LA 3DNSA 2CIJA 1Z8LA 2V8VA 2FIAA 4OKOA 2B58A 3TO6A 4P10A 4ZYQA 2ZXVA 3KASA 4XNHC 1ZLIA 3NH8A 1IGBA 4CGOA 1LRZA 2AFMA 2Q4YA 2Q4ZA 5G21A 3WABA 4OC3A 4CYOA 1Z4EA 3FEDA 2YNCA 2PVWA 4X5KA 2ZW4A 2ATRA 1EE3P 3FNCA 4HNWB 4KOUA 4YWYA 2XEGA 3SJXA 2Z3OA 2Q43A 2Q0YA 3FJUA 1BAVA 4XPDC 5I4MA 3SI1A 4H6UA 1KUYA 3FH4A 4MHYA 3D7DA 2Z3KA 2R98A 4JJXA 1ON0A 2J8NA 4NF1A 3L2NA 4JXRA 2JBJA 2G9DA 1NSLA 2JEWA 5EMIA 4KOYA 3P2HA 4MFJA 1A2ZA 1IYLA 1PCAA 1XRYA 5G1ZA 2ZEPA 3QAHA 2HUZA 4PK2A 4P4IA 4KOSA 3K2KA 2PE3A 3KR5A 4CRYB 4MFKA 5D8NA 4H6ZA 4JZ0A 2OB0A 1ELLP 1TIQA 4U9ZA 2PJ2A 4WJBA 5AG5A 3T8WA 3GB0A 2EK9A 3VWEA 5BWAB 1IOIA 2AFSA 2GE3A 3B3VA 1NMTA 2B5GA 4MHDA 3FECA 3FVLA 5ELYA 5AGEA 4MXUA 1VGYA 2IMOA 5HH1A 2IQ6A 4R6TA 1Q2YA 1I12A 4KOXA 4P4EA 4ZX8A 2BSWA 3FX6A 3QNVA 5LYIA 2WUUA 4M6IA 4DYOA 6CPAA 3VARA 2VL1A 4KVOE 4AXVA 4OC2A 4U5YA 3IEHA 4NFRA 4O23A 3FXTA 1XEBA 3B3SA 3KL9A 1QSRA 4MFQA 1XOVA 2D4OA 5EC4A 4FAIA 2C6PA 3EXNA 4P6YA 3FBUA 4FWUA 3PFOA 4TNUA 4C7HA 3TE4A 4KOTA 3K9TA 3S6FA 4OADA 4PXBA 4IUSA 4MRIA 2B4DA 5EBVA 5F46A 1VKCA 1TXRA 1Y9KA 2QJ8A 2XEJA 2HQYA 1Q7LA 4UCNA 2X7BA 3P2FA 4UEEA 2PCUA 4C2YA 2ODFA 2CTBA 2PJ4A 2RFHA 3V8IA 2J8MA 2PRBA 3PB6X 4FUUA 3F8KA 3EFAA 4ZY1A 1Z8TA 2EWBA 4UEFA 3BI1A 3D4UA 3DDDA 4M6HA 3SJEA 4P45A 4KSIA 3T9YA 1CG2A 3CXSA 1KZFA 3W6SA 2PJ5A 2Z11A 4H2KA 3PBBA 4ONWA 4YFJA 2B5GB 2AFXA 1F2OA 3NH5A 4MCQA 3R96A 4MBUA 5CBMA 1R57A 3D2PA 4MCSA 2V8DA 2ZEGA 5IB9A 4OAEA 4PV6A 4R3LA 2ZEDA 2OU2A 3IJ3A 3TC8A 1ZLHA 3CPAA 2R8VA 3DSBA 2ANPA 4AVAA 2FSRA 2P6EA 4CYQA 5F48A 3CPXA 2P6GA 4MY0A 1YMEA 1CPSA 3VH9A 2VBQA 3TTHA 2PIYA 2VI7A 3PP9A 4OMEA 1S7NA 3GLJA 1NE9A 4KOWA 4NGPA 4F9VA 1LCPA 2BCOA 3NE8A 2Q7BA 2PJ1A 3B3CA 3WC6A 5IB0A 3KHXA 4KUBA 4A39A 2ZEOA 4CAVA 3NE7A 3W91A 3B35A 3IWEA 3FMCA 5F47A 1Y7RA 3EO4A 4P4BA 3H8FA 4HKFA 4H89A 2Y0MA 2P0WA 1TKJA 2VZYA 1CBXA 4PQAA 3S6KA 4BINA 2ZEHA 4ZI6A 3PEIA 4A95A 3B2YA 2QVPA 4K3NA 1ARMA 4PSWA 5JGFA 2V8HA 4LQ6A 5E96A 1YLEA 4EWTA 1IB1E 4ORFA 1S7FA 3H4QA 4MFLA 1KWMA 4AVBA 3H8EA 1F2PA 4OIDA 3S9NA 3KR4A 5IV0A 2EBJA 1VHOA 3FYNA 4KVME 4F9UA 2NYQA 3WC7A 4NXYA 1X12A 2POKA 3R9FA 1LAMA 1XF8A 3IC1A 4I49A 2JEVA 1M4GA 3IO1A 1V0CA 4Q38A 1DE4C 2O53A 4UIAA 2QECA 4KORA 4XPKA 4E2AA 1YQEA 3T90A 1GYTA 2OZGA 3B8GA 2F7VA 4W9YA 2REFA 1M4DA 2Q44A 5THWA 3I3GA 5KTDA 1MJ9A 1OZPA 2GREA 4G1PA 4C2XA 4E0AA 3CDXA 4P44A 3TO9A 2V77A 1PYTB 4UFWA 2CY2A 3GYAA 4YU9A 4QBJA 1QMUA 5K8NA 3S6GA 1P4NA 4NCZA 2EO8A 2PR1A 2PRQA 3PFEA 2VEZA 3GIUA 1S3ZA 2GFQA 1CP7A 4CYPA 3RO0A 4X2TA 5DS0A 2DF5A 3IGRA 2DEAA 5GCNA 4DNCA 1Y0YA 3JVNA 4PXDA 1JQGA 2Q7SA 4UA3A 2ZOFA 1F57A 5G20A 4F0XA 4NGRA 3PBEA 2O4HA 1MJAA 2GLJA 3QAYA 3LACA 4Y49B 1S5KA 3RAMA 1UFHA 2YNCC 5LYLA 2WPWA 5JH9A 4JD6A 3I9SA 4CAWA 3KGQA 4NGMA 1ZG7A 3MN8A 3SHPA 1QSMA 2RC4A 1IYKA 2F5IA 2BL1A 4CYNA 4B13A 2G3TA 1Y7EA 4CAFA 2FXFA 1Z9UA 1K4JA 2B3UA 4MI4A 4AG7A 4KS9A 3N5FA 4GM5A 1Q2DA 4PPZA 1HDUA 2ZW7A 1FNOA 4FD6A 1P0HA 2PJ0A 4F0YA 4II9A 4OLLA 5KTCA 1ARLA 4L8AA 1LAPA 1KUVA 3D3SA 1ZO0A 2FIWA 3FIXA 2PJ9A 3D2MA 4NGTA 4PSXA 4ZY2A 4C7IA 3S9MA 3ZZIA 2PR8A 1RTQA 5HMNA 2P6FA 3HLPA 3SJFA 1HDQA 1BO4A 4Z65A 4YGOA 2YNDA 2Z0ZA 4KSAA 2OH1A 1S60A 2PJ3A 3PB9X 3SI0A 4DUKA 4UF4A 5J1QA 2A4NA 2PDOA 2J9AA 3BJ7A 2FE7A 4X8IA 2Z3MA 3KI9A 5FVJA 3R9GA 4MJ8A 3SI2A 1CX8A 4MMOA 4U9YA 2WSAA 3QB8A 4WWVA 4P4FA 4UIBA 2AFZA 4JXQA 2PQ8A 8CPAA 4IF5A 1BLLE 3CXPA 3E0KA 2BOAA 3ISXA 1I21A 3NH4A 3F0AA 1TKFA 4ZX9A 4OC5A 1YREA 1VHEA 3D7HA 4KVXA 1YGHA 4QC6A 3NFZA 2ZPAA 1R3NA 3D8PA 2FS5A 1XFOA 2KCWA 4MFZA 2XEIA 2C27A 4AVCA 1N71A 2FCKA 3UY5A 3BI0A 1YW6A 4ZGYB 2ABZA 4RS2A 3IWWA 1BPMA 4R8FA 4A2ZA 1CP6A 3PB4X 5A28A 1QQ9A 1CJWA 2FVGA 4R57A 1PUAA 4UWIA 2WPXA 3PB8X 5CPAA 2ZW6A 3S6HA 4EFDA 3V7ZA 2R7HA 4GS4A 2OOTA 4HPSA 1GHEA 2REEA 4UFXA 3RYOA 2Q04A 1M4LA 3D68A 3TOBA 4LQGA 1B6BA 1IICA 3TFYA 3LODA 2GANA 1PU9A 1XE4A 4XPLA 4B5OA 4QVTA 4P4JA 1IU8A 2PJ6A 2ZOGA 4NGNA 4PXEA 4M85A 2J8RA 2IL4A 2CTCA 2B4DB 4MHZA 1XBUA 4OIWA 2CNTA 4KZTA 3EY5A 4UFVA 5LYDA 2PJCA 5AG6A 1LOKA 4UWJA 3IFEA 2PIZA 4MHPA 3N7ZA 5AG7A 4AB7A 4RUHA 4BBHA 1RO5A 2YNEA 3S9LA 1X10A 1LANA 3K9UA 4A38A 1S7KA 2VQYA 2PJ8A 3FEEA 4CRZB 4NGQA 2FT0A 1Z4RA 1I1DA 3B3TA 3BHXA 4R87A 1S7LA 4Q36A 4A33A 2G3AA 3BXMA 4CGLA 2VXKA 4EMEA 1M1DA 1YK3A 2WZNA 4JLYA 4Q7AA 1FT7A 2GU2A 1AYEA 4IK2A 1J4JA 4NJRA 4B12A 4CGMA 4L89A 1BPNA 3MRUA 2BO9A 3JTKA 1IIDA 3SXOA 5J8CA 1DTDA 5H84A 3LWUA 2WYRA 3PRTA 2ZELA 5HXDA 4CAXA 3H8GA 4HNYB 4UBRA 3MGDA 4ZY0A 1OBRA 1QSNA 2BUEA 1XMBA 2IJZA 4B10A 5G22A 5H86A 5JPHA 2PC1A 2FL4A 3IU1A 4A30A 2ZEEA 4Y49C 1XJOA 3GY9A 3VWDA 3VATA 4K30A 2OZUA 3WT4A 1IY7A 4KLVA 4ZBGA 1AUGA 4F6AA 3V38A 4RN7A 4CS0B 2AFUA 3R95A 5HVHA 3G3SA 1XMTA 3D7FA 3DR8A 4OP4A 5I0CA 3LD2A 1CM0A 1YR0A 3DLJA 4UCMA 1NSAA 5LYFA 5F09A 3JUWA 4P4DA 4QUSA 4NJQA 1Y9WA 4PXCA 4R9MA 4ONUA 5ISVA 1CPXA 2PJAA 4CPAA 3B7IA 1FY7A 4MCPA 3LMSA 2B4BA 3WC5A 4XNHB 1M4IA 2K5TA 3FF3A 2C6GA 3IIBA 2G0BA 2JBKA 3B3WA 4R76A 1Y0RA 3BLNA 4KOVA 4F8ZA 1YX0A 2NSMA 2PJ7A 2F8HA 2GIVA 2VZZA 5K8OA 1Z8WA 3G8WA 1ZG8A 4QB9A 5LRJA 2R1IA 4M6GA 2CF4A 2HC9A 3R9EA 5JM6A 3DGVA 4JWPA 1RXTA 4XPDB 5F49A 1YVKA 2CXAA 3KZWA 3KKWA 1TKHA 1L0CA 4NGSA 4R3KA 2PSWA 1ZG9A 5JQ4A 3KQXA 2V8GA 1U6MA 1IOFA 2QYVA 3ISZA 4M3SA 3RZAA 5KTAA 5C82A 3D66A 2C6CA 5DWNA 4YRHA 2RB7A 2I00A 4B5PA 4UEZA 1M44A 3EC4A 5C88A 4MY3A 3GUXA 3RNZA 5A27A 4MHNA 4MFPA 4A31A 2DXQA 1SQHA 2Z3PA 3PB7X 3W6XA 3ZJ0A 2EUIA 2H5MA 4OC1A 4UCPA 4E8OA 4CGNA 5IX3A 1MK4A 4IAVA 2GLFA 3RBUA 2EK8A 1TF8A 3IWGA 2JLMA 4CGPA 3FRMA 2O28A 2PVVA 2YGWA 4BMHA 2NMTA 3TX8A 3KQZA 3TCVA 5DWMA 4DJLA 2AJ6A 2I79A 2CNMA 2D4PA 1VIXA 4TWEA 4KSFA 4B11A 1KUXA 3C26A 3CZXA 3GKRA 1XIXA 2BEIA 4NEXA 3SXNA 2PJBA 3I1UA 1ELMP 3TOAA 4EVYA 1YW4A 1LFWA 3F5BA 4J3GA 3PGPA 4NSQA 3CXQA 1WWZA 4IHMA 5K8MA 2AE6A 4R7MA 3BJ8A 3CT9A 2B3VA 1Z8XA 3KHZA 4X3RA 4C2ZA 4C68A 2JDCA 4A94A 4MCRA 4OC0A 5HVFA 4JYWA 4RI1A 3JRUA 4KLWA 4OC4A 5AG4A 1Q2CA 4AG9A 5HVGA 1UWYA 2XEFA 2ZENA 1R43A 5LRGA 5CNPA 7CPAA 2C1CA 4B5PB 2HB6A 5J8FA 3OWCA 3WR7A 3NA6A 5LRKA 2HV2A 2Q4VA 2Z10A 2Q51A 3H5ZA 5K8PA 3HUVA 1MJBA 1YSJA 3D67A 4CAEA 3SJGA 3IU2A 2OR4A 4FD5A 4HNXB 4BD9A 4KUAA 3R1KA 1YLOA 1H8LA 2QIRA 1WK4A 2Z3NA 2DPSA 4A32A 1QSOA 1YVOA 3FB3A 2ZW5A 4FBEA 1TF9A 1Z2LA 1VHSA 2CNSA 3DR6A 2AFOA 2DPTA 4GXHA 2ZEFA
chains in the Genus database with same CATH topology
4B14A 1BOBA 3TO7A 4LX9A 4FD7A 2EVNA 2QMLA 2JDDA 2Z3LA 4FD4A 3TT2A 4LUAA 2OZHA 1B87A 2ARHA 4PK3A 3PZJA 1QSTA 3A9LA 3DNSA 2FIAA 2B58A 3TO6A 2ZXVA 4XNHC 4CGOA 1LRZA 2Q4YA 5G21A 4CYOA 1Z4EA 2YNCA 4X5KA 2ZW4A 2ATRA 3FNCA 4HNWB 4KOUA 2Z3OA 2Q0YA 4XPDC 4H6UA 1KUYA 2Z3KA 2R98A 4JJXA 1ON0A 2J8NA 4NF1A 1NSLA 4JXRA 4KOYA 3P2HA 4MFJA 1IYLA 5G1ZA 3QAHA 2HUZA 4PK2A 4KOSA 4CRYB 4MFKA 4H6ZA 2OB0A 5AG5A 1TIQA 4U9ZA 3VWEA 5BWAB 2GE3A 1NMTA 2B5GA 4MHDA 5AGEA 5HH1A 1Q2YA 1I12A 4KOXA 2BSWA 2WUUA 4KVOE 4U5YA 3FXTA 1XEBA 1QSRA 4MFQA 5EC4A 2D4OA 3EXNA 3FBUA 4C7HA 3TE4A 4KOTA 3S6FA 4OADA 4IUSA 2B4DA 5EBVA 5F46A 1VKCA 1Y9KA 2HQYA 4UCNA 2X7BA 3P2FA 4C2YA 3V8IA 2J8MA 2PRBA 3F8KA 3EFAA 3DDDA 3T9YA 3CXSA 1KZFA 3W6SA 2Z11A 4YFJA 2B5GB 3R96A 4MBUA 1R57A 3D2PA 4OAEA 4PV6A 4R3LA 2OU2A 2R8VA 3DSBA 4AVAA 2FSRA 2P6EA 4CYQA 5F48A 2P6GA 4MY0A 2VBQA 3TTHA 2VI7A 3PP9A 1S7NA 4KOWA 1NE9A 2Q7BA 5IB0A 4KUBA 4CAVA 3NE7A 3W91A 3IWEA 5F47A 1Y7RA 3EO4A 4HKFA 4H89A 2Y0MA 2P0WA 2VZYA 3S6KA 4A95A 4PSWA 5E96A 1YLEA 1IB1E 4ORFA 1S7FA 3H4QA 4MFLA 4AVBA 5IV0A 3FYNA 4KVME 4NXYA 3R9FA 1XF8A 4I49A 2JEVA 1M4GA 4Q38A 1V0CA 4E2AA 2QECA 4KORA 4XPKA 3T90A 2OZGA 3B8GA 2REFA 1M4DA 2Q44A 5KTDA 3I3GA 1MJ9A 1OZPA 4C2XA 4E0AA 3TO9A 4UFWA 2CY2A 3GYAA 4QBJA 3S6GA 1P4NA 4NCZA 2PR1A 2VEZA 1S3ZA 4CYPA 3IGRA 5GCNA 4DNCA 3JVNA 4UA3A 5G20A 4F0XA 1MJAA 4Y49B 1S5KA 1UFHA 2YNCC 2WPWA 4JD6A 3I9SA 4CAWA 3SHPA 1QSMA 2RC4A 1IYKA 2F5IA 2BL1A 4CYNA 4B13A 2G3TA 4CAFA 2FXFA 1Z9UA 1K4JA 2B3UA 4MI4A 4AG7A 4KS9A 1Q2DA 4F0YA 2ZW7A 4FD6A 4II9A 1P0HA 4OLLA 5KTCA 4L8AA 1KUVA 3D3SA 1ZO0A 2FIWA 3FIXA 3D2MA 4C7IA 4PSXA 3ZZIA 2PR8A 5HMNA 2P6FA 1BO4A 4YGOA 2YNDA 2Z0ZA 4KSAA 2OH1A 1S60A 2A4NA 2PDOA 3BJ7A 2FE7A 2Z3MA 3R9GA 5FVJA 4MJ8A 4U9YA 2WSAA 3QB8A 4JXQA 2PQ8A 4IF5A 3CXPA 3E0KA 1I21A 3F0AA 1YREA 4KVXA 1YGHA 4QC6A 2ZPAA 3D8PA 2FS5A 2KCWA 4MFZA 4AVCA 2C27A 1N71A 2FCKA 3UY5A 4ZGYB 4RS2A 4A2ZA 5A28A 4R57A 1CJWA 1PUAA 4UWIA 2WPXA 3S6HA 2ZW6A 2R7HA 4GS4A 1GHEA 2REEA 4UFXA 3RYOA 2Q04A 3TOBA 1B6BA 1IICA 3TFYA 3LODA 2GANA 1PU9A 1XE4A 4XPLA 4B5OA 4QVTA 4M85A 2J8RA 2IL4A 2B4DB 2CNTA 4KZTA 3EY5A 4UFVA 5AG6A 4UWJA 4AB7A 5AG7A 3N7ZA 4BBHA 1RO5A 2YNEA 3K9UA 1S7KA 2VQYA 4CRZB 2FT0A 1Z4RA 1I1DA 4R87A 1S7LA 4Q36A 4A33A 2G3AA 4CGLA 2VXKA 1M1DA 1YK3A 4JLYA 1J4JA 4B12A 4CGMA 4L89A 3JTKA 1IIDA 3SXOA 5J8CA 5H84A 4CAXA 4UBRA 4HNYB 3MGDA 1QSNA 2BUEA 4B10A 5G22A 5H86A 5JPHA 2PC1A 2FL4A 3IU1A 4A30A 4Y49C 3VWDA 3GY9A 4K30A 2OZUA 4KLVA 4ZBGA 4F6AA 4CS0B 3R95A 3G3SA 1XMTA 3DR8A 5I0CA 3LD2A 1CM0A 1YR0A 4UCMA 3JUWA 4QUSA 1Y9WA 4R9MA 4ONUA 5ISVA 1FY7A 2B4BA 4XNHB 1M4IA 2K5TA 2G0BA 3BLNA 4KOVA 1YX0A 2GIVA 2VZZA 3G8WA 4QB9A 2R1IA 3R9EA 4JWPA 4XPDB 1RXTA 5F49A 1YVKA 2CXAA 3KKWA 1L0CA 4R3KA 2PSWA 5JQ4A 1U6MA 4M3SA 5KTAA 5C82A 5DWNA 4YRHA 2I00A 4B5PA 1M44A 3EC4A 4MY3A 5A27A 4A31A 4MFPA 2DXQA 1SQHA 2Z3PA 3W6XA 3ZJ0A 2EUIA 2H5MA 4UCPA 4E8OA 5IX3A 4CGNA 1MK4A 3IWGA 2JLMA 4CGPA 3FRMA 2O28A 2YGWA 4BMHA 2NMTA 3TCVA 5DWMA 2AJ6A 2I79A 2CNMA 2D4PA 4KSFA 4B11A 1KUXA 3C26A 5C88A 3GKRA 1XIXA 2BEIA 4NEXA 3SXNA 3TOAA 4EVYA 3F5BA 4J3GA 3PGPA 4NSQA 3CXQA 1WWZA 2AE6A 3BJ8A 2B3VA 4C68A 4C2ZA 2JDCA 4RI1A 4KLWA 5AG4A 1Q2CA 4AG9A 5CNPA 4B5PB 5J8FA 3OWCA 3WR7A 2HV2A 2Q4VA 2Z10A 3H5ZA 1MJBA 4CAEA 3IU2A 4FD5A 4HNXB 4KUAA 3R1KA 2QIRA 2Z3NA 1WK4A 4A32A 2DPSA 1QSOA 1YVOA 3FB3A 2ZW5A 1VHSA 2CNSA 3DR6A 2DPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BOB A;  3TO7 A;  4LX9 A;  4FD7 A;  2EVN A;  2QML A;  2JDD A;  4FD4 A;  3TT2 A;  4LUA A;  2OZH A;  1B87 A;  2ARH A;  4PK3 A;  3PZJ A;  1QST A;  3DNS A;  2FIA A;  2B58 A;  3TO6 A;  2ZXV A;  4XNH C;  1LRZ A;  2Q4Y A;  1Z4E A;  4X5K A;  2ZW4 A;  2ATR A;  3FNC A;  4HNW B;  4KOU A;  2Q0Y A;  4XPD C;  4H6U A;  1KUY A;  2R98 A;  4JJX A;  1ON0 A;  2J8N A;  4NF1 A;  1NSL A;  4JXR A;  4KOY A;  3P2H A;  1IYL A;  3QAH A;  2HUZ A;  4PK2 A;  4KOS A;  4CRY B;  4H6Z A;  2OB0 A;  1TIQ A;  4U9Z A;  3VWE A;  2GE3 A;  1NMT A;  2B5G A;  4MHD A;  5HH1 A;  1Q2Y A;  1I12 A;  4KOX A;  2BSW A;  4KVO E;  4U5Y A;  3FXT A;  1XEB A;  1QSR A;  5EC4 A;  2D4O A;  3EXN A;  3FBU A;  3TE4 A;  4KOT A;  3S6F A;  4OAD A;  4IUS A;  2B4D A;  5EBV A;  5F46 A;  1VKC A;  1Y9K A;  2HQY A;  2X7B A;  3P2F A;  3V8I A;  2J8M A;  2PRB A;  3F8K A;  3EFA A;  3DDD A;  3T9Y A;  3CXS A;  1KZF A;  3W6S A;  2Z11 A;  4YFJ A;  2B5G B;  3R96 A;  4MBU A;  1R57 A;  3D2P A;  4OAE A;  4PV6 A;  4R3L A;  2OU2 A;  2R8V A;  3DSB A;  4AVA A;  2FSR A;  2P6E A;  5F48 A;  2P6G A;  4MY0 A;  2VBQ A;  3TTH A;  2VI7 A;  3PP9 A;  1S7N A;  4KOW A;  1NE9 A;  2Q7B A;  5IB0 A;  4KUB A;  4CAV A;  3NE7 A;  3W91 A;  5F47 A;  1Y7R A;  3EO4 A;  4HKF A;  4H89 A;  2Y0M A;  2P0W A;  2VZY A;  3S6K A;  4PSW A;  5E96 A;  1YLE A;  1IB1 E;  4ORF A;  1S7F A;  3H4Q A;  4AVB A;  5IV0 A;  3FYN A;  4KVM E;  4NXY A;  3R9F A;  1XF8 A;  4I49 A;  2JEV A;  1M4G A;  1V0C A;  4E2A A;  2QEC A;  4KOR A;  4XPK A;  3T90 A;  2OZG A;  3B8G A;  2REF A;  1M4D A;  2Q44 A;  5KTD A;  3I3G A;  1MJ9 A;  1OZP A;  4E0A A;  3TO9 A;  2CY2 A;  3GYA A;  4QBJ A;  3S6G A;  1P4N A;  4NCZ A;  2PR1 A;  2VEZ A;  1S3Z A;  3IGR A;  5GCN A;  4DNC A;  3JVN A;  4UA3 A;  1MJA A;  4Y49 B;  1S5K A;  1UFH A;  2WPW A;  4JD6 A;  3I9S A;  4CAW A;  3SHP A;  1QSM A;  2RC4 A;  1IYK A;  2F5I A;  2BL1 A;  2G3T A;  2FXF A;  1Z9U A;  1K4J A;  2B3U A;  4MI4 A;  4AG7 A;  1Q2D A;  4F0Y A;  2ZW7 A;  4FD6 A;  4II9 A;  1P0H A;  4OLL A;  5KTC A;  4L8A A;  1KUV A;  3D3S A;  2FIW A;  3FIX A;  3D2M A;  4PSX A;  3ZZI A;  2PR8 A;  5HMN A;  2P6F A;  1BO4 A;  4YGO A;  2Z0Z A;  2OH1 A;  1S60 A;  2A4N A;  2PDO A;  3BJ7 A;  2FE7 A;  3R9G A;  5FVJ A;  4MJ8 A;  4U9Y A;  3QB8 A;  4JXQ A;  2PQ8 A;  4IF5 A;  3CXP A;  3E0K A;  1I21 A;  3F0A A;  1YRE A;  4KVX A;  1YGH A;  4QC6 A;  2ZPA A;  3D8P A;  2FS5 A;  2KCW A;  4AVC A;  2C27 A;  1N71 A;  2FCK A;  3UY5 A;  4RS2 A;  4R57 A;  1CJW A;  1PUA A;  4UWI A;  2WPX A;  3S6H A;  2ZW6 A;  2R7H A;  4GS4 A;  1GHE A;  2REE A;  3RYO A;  2Q04 A;  3TOB A;  1B6B A;  1IIC A;  3TFY A;  3LOD A;  2GAN A;  1PU9 A;  1XE4 A;  4XPL A;  4B5O A;  4QVT A;  4M85 A;  2J8R A;  2IL4 A;  2B4D B;  2CNT A;  4KZT A;  3EY5 A;  4UWJ A;  4AB7 A;  3N7Z A;  1RO5 A;  3K9U A;  1S7K A;  2VQY A;  4CRZ B;  2FT0 A;  1Z4R A;  1I1D A;  4R87 A;  1S7L A;  2G3A A;  2VXK A;  1M1D A;  1YK3 A;  4JLY A;  1J4J A;  4L89 A;  1IID A;  3SXO A;  5J8C A;  5H84 A;  4CAX A;  4UBR A;  4HNY B;  3MGD A;  1QSN A;  2BUE A;  5JPH A;  5H86 A;  2PC1 A;  2FL4 A;  4Y49 C;  3VWD A;  3GY9 A;  4K30 A;  2OZU A;  4KLV A;  4ZBG A;  4F6A A;  4CS0 B;  3R95 A;  3G3S A;  1XMT A;  3DR8 A;  5I0C A;  3LD2 A;  1CM0 A;  1YR0 A;  3JUW A;  4QUS A;  1Y9W A;  4R9M A;  4ONU A;  5ISV A;  1FY7 A;  2B4B A;  4XNH B;  1M4I A;  2K5T A;  2G0B A;  3BLN A;  4KOV A;  1YX0 A;  2GIV A;  2VZZ A;  3G8W A;  4QB9 A;  2R1I A;  3R9E A;  4JWP A;  4XPD B;  1RXT A;  5F49 A;  1YVK A;  3KKW A;  1L0C A;  4R3K A;  2PSW A;  5JQ4 A;  1U6M A;  4M3S A;  5KTA A;  5C82 A;  5DWN A;  4YRH A;  2I00 A;  4B5P A;  1M44 A;  3EC4 A;  4MY3 A;  2DXQ A;  1SQH A;  3W6X A;  3ZJ0 A;  2EUI A;  2H5M A;  4E8O A;  5IX3 A;  1MK4 A;  3IWG A;  2JLM A;  3FRM A;  2O28 A;  4BMH A;  2NMT A;  3TCV A;  5DWM A;  2AJ6 A;  2I79 A;  2CNM A;  2D4P A;  1KUX A;  3C26 A;  5C88 A;  3GKR A;  1XIX A;  2BEI A;  4NEX A;  3SXN A;  3TOA A;  4EVY A;  3F5B A;  4J3G A;  3PGP A;  4NSQ A;  3CXQ A;  1WWZ A;  2AE6 A;  3BJ8 A;  2B3V A;  2JDC A;  4RI1 A;  4KLW A;  1Q2C A;  4AG9 A;  5CNP A;  4B5P B;  5J8F A;  3OWC A;  3WR7 A;  2HV2 A;  2Q4V A;  2Z10 A;  1MJB A;  4FD5 A;  4HNX B;  4KUA A;  3R1K A;  2QIR A;  1WK4 A;  1QSO A;  1YVO A;  3FB3 A;  2ZW5 A;  1VHS A;  2CNS A;  3DR6 A; 
#chains in the Genus database with same CATH topology
 4B14 A;  1BOB A;  4A37 A;  3TO7 A;  4LX9 A;  4FD7 A;  2I3C A;  2EVN A;  2QML A;  2JDD A;  2Z3L A;  3D7G A;  4FD4 A;  1Z5R A;  3TT2 A;  1AMP A;  1HEE A;  4LUA A;  2OZH A;  2ZEM A;  1B87 A;  2AFW A;  2ARH A;  5D29 A;  4B6Z A;  1JWQ A;  4PK3 A;  3PZJ A;  1QST A;  3A9L A;  3DNS A;  2CIJ A;  1Z8L A;  2V8V A;  2FIA A;  4OKO A;  2B58 A;  3TO6 A;  4P10 A;  4ZYQ A;  2ZXV A;  3KAS A;  4XNH C;  1ZLI A;  3NH8 A;  1IGB A;  4CGO A;  1LRZ A;  2AFM A;  2Q4Y A;  2Q4Z A;  5G21 A;  3WAB A;  4OC3 A;  4CYO A;  1Z4E A;  3FED A;  2YNC A;  2PVW A;  4X5K A;  2ZW4 A;  2ATR A;  1EE3 P;  3FNC A;  4HNW B;  4KOU A;  4YWY A;  2XEG A;  3SJX A;  2Z3O A;  2Q43 A;  2Q0Y A;  3FJU A;  1BAV A;  4XPD C;  5I4M A;  3SI1 A;  4H6U A;  1KUY A;  3FH4 A;  4MHY A;  3D7D A;  2Z3K A;  2R98 A;  4JJX A;  1ON0 A;  2J8N A;  4NF1 A;  3L2N A;  4JXR A;  2JBJ A;  2G9D A;  1NSL A;  2JEW A;  5EMI A;  4KOY A;  3P2H A;  4MFJ A;  1A2Z A;  1IYL A;  1PCA A;  1XRY A;  5G1Z A;  2ZEP A;  3QAH A;  2HUZ A;  4PK2 A;  4P4I A;  4KOS A;  3K2K A;  2PE3 A;  3KR5 A;  4CRY B;  4MFK A;  5D8N A;  4H6Z A;  4JZ0 A;  2OB0 A;  1ELL P;  1TIQ A;  4U9Z A;  2PJ2 A;  4WJB A;  5AG5 A;  3T8W A;  3GB0 A;  2EK9 A;  3VWE A;  5BWA B;  1IOI A;  2AFS A;  2GE3 A;  3B3V A;  1NMT A;  2B5G A;  4MHD A;  3FEC A;  3FVL A;  5ELY A;  5AGE A;  4MXU A;  1VGY A;  2IMO A;  5HH1 A;  2IQ6 A;  4R6T A;  1Q2Y A;  1I12 A;  4KOX A;  4P4E A;  4ZX8 A;  2BSW A;  3FX6 A;  3QNV A;  5LYI A;  2WUU A;  4M6I A;  4DYO A;  6CPA A;  3VAR A;  2VL1 A;  4KVO E;  4AXV A;  4OC2 A;  4U5Y A;  3IEH A;  4NFR A;  4O23 A;  3FXT A;  1XEB A;  3B3S A;  3KL9 A;  1QSR A;  4MFQ A;  1XOV A;  2D4O A;  5EC4 A;  4FAI A;  2C6P A;  3EXN A;  4P6Y A;  3FBU A;  4FWU A;  3PFO A;  4TNU A;  4C7H A;  3TE4 A;  4KOT A;  3K9T A;  3S6F A;  4OAD A;  4PXB A;  4IUS A;  4MRI A;  2B4D A;  5EBV A;  5F46 A;  1VKC A;  1TXR A;  1Y9K A;  2QJ8 A;  2XEJ A;  2HQY A;  1Q7L A;  4UCN A;  2X7B A;  3P2F A;  4UEE A;  2PCU A;  4C2Y A;  2ODF A;  2CTB A;  2PJ4 A;  2RFH A;  3V8I A;  2J8M A;  2PRB A;  3PB6 X;  4FUU A;  3F8K A;  3EFA A;  4ZY1 A;  1Z8T A;  2EWB A;  4UEF A;  3BI1 A;  3D4U A;  3DDD A;  4M6H A;  3SJE A;  4P45 A;  4KSI A;  3T9Y A;  1CG2 A;  3CXS A;  1KZF A;  3W6S A;  2PJ5 A;  2Z11 A;  4H2K A;  3PBB A;  4ONW A;  4YFJ A;  2B5G B;  2AFX A;  1F2O A;  3NH5 A;  4MCQ A;  3R96 A;  4MBU A;  5CBM A;  1R57 A;  3D2P A;  4MCS A;  2V8D A;  2ZEG A;  5IB9 A;  4OAE A;  4PV6 A;  4R3L A;  2ZED A;  2OU2 A;  3IJ3 A;  3TC8 A;  1ZLH A;  3CPA A;  2R8V A;  3DSB A;  2ANP A;  4AVA A;  2FSR A;  2P6E A;  4CYQ A;  5F48 A;  3CPX A;  2P6G A;  4MY0 A;  1YME A;  1CPS A;  3VH9 A;  2VBQ A;  3TTH A;  2PIY A;  2VI7 A;  3PP9 A;  4OME A;  1S7N A;  3GLJ A;  1NE9 A;  4KOW A;  4NGP A;  4F9V A;  1LCP A;  2BCO A;  3NE8 A;  2Q7B A;  2PJ1 A;  3B3C A;  3WC6 A;  5IB0 A;  3KHX A;  4KUB A;  4A39 A;  2ZEO A;  4CAV A;  3NE7 A;  3W91 A;  3B35 A;  3IWE A;  3FMC A;  5F47 A;  1Y7R A;  3EO4 A;  4P4B A;  3H8F A;  4HKF A;  4H89 A;  2Y0M A;  2P0W A;  1TKJ A;  2VZY A;  1CBX A;  4PQA A;  3S6K A;  4BIN A;  2ZEH A;  4ZI6 A;  3PEI A;  4A95 A;  3B2Y A;  2QVP A;  4K3N A;  1ARM A;  4PSW A;  5JGF A;  2V8H A;  4LQ6 A;  5E96 A;  1YLE A;  4EWT A;  1IB1 E;  4ORF A;  1S7F A;  3H4Q A;  4MFL A;  1KWM A;  4AVB A;  3H8E A;  1F2P A;  4OID A;  3S9N A;  3KR4 A;  5IV0 A;  2EBJ A;  1VHO A;  3FYN A;  4KVM E;  4F9U A;  2NYQ A;  3WC7 A;  4NXY A;  1X12 A;  2POK A;  3R9F A;  1LAM A;  1XF8 A;  3IC1 A;  4I49 A;  2JEV A;  1M4G A;  3IO1 A;  1V0C A;  4Q38 A;  1DE4 C;  2O53 A;  4UIA A;  2QEC A;  4KOR A;  4XPK A;  4E2A A;  1YQE A;  3T90 A;  1GYT A;  2OZG A;  3B8G A;  2F7V A;  4W9Y A;  2REF A;  1M4D A;  2Q44 A;  5THW A;  3I3G A;  5KTD A;  1MJ9 A;  1OZP A;  2GRE A;  4G1P A;  4C2X A;  4E0A A;  3CDX A;  4P44 A;  3TO9 A;  2V77 A;  1PYT B;  4UFW A;  2CY2 A;  3GYA A;  4YU9 A;  4QBJ A;  1QMU A;  5K8N A;  3S6G A;  1P4N A;  4NCZ A;  2EO8 A;  2PR1 A;  2PRQ A;  3PFE A;  2VEZ A;  3GIU A;  1S3Z A;  2GFQ A;  1CP7 A;  4CYP A;  3RO0 A;  4X2T A;  5DS0 A;  2DF5 A;  3IGR A;  2DEA A;  5GCN A;  4DNC A;  1Y0Y A;  3JVN A;  4PXD A;  1JQG A;  2Q7S A;  4UA3 A;  2ZOF A;  1F57 A;  5G20 A;  4F0X A;  4NGR A;  3PBE A;  2O4H A;  1MJA A;  2GLJ A;  3QAY A;  3LAC A;  4Y49 B;  1S5K A;  3RAM A;  1UFH A;  2YNC C;  5LYL A;  2WPW A;  5JH9 A;  4JD6 A;  3I9S A;  4CAW A;  3KGQ A;  4NGM A;  1ZG7 A;  3MN8 A;  3SHP A;  1QSM A;  2RC4 A;  1IYK A;  2F5I A;  2BL1 A;  4CYN A;  4B13 A;  2G3T A;  1Y7E A;  4CAF A;  2FXF A;  1Z9U A;  1K4J A;  2B3U A;  4MI4 A;  4AG7 A;  4KS9 A;  3N5F A;  4GM5 A;  1Q2D A;  4PPZ A;  1HDU A;  2ZW7 A;  1FNO A;  4FD6 A;  1P0H A;  2PJ0 A;  4F0Y A;  4II9 A;  4OLL A;  5KTC A;  1ARL A;  4L8A A;  1LAP A;  1KUV A;  3D3S A;  1ZO0 A;  2FIW A;  3FIX A;  2PJ9 A;  3D2M A;  4NGT A;  4PSX A;  4ZY2 A;  4C7I A;  3S9M A;  3ZZI A;  2PR8 A;  1RTQ A;  5HMN A;  2P6F A;  3HLP A;  3SJF A;  1HDQ A;  1BO4 A;  4Z65 A;  4YGO A;  2YND A;  2Z0Z A;  4KSA A;  2OH1 A;  1S60 A;  2PJ3 A;  3PB9 X;  3SI0 A;  4DUK A;  4UF4 A;  5J1Q A;  2A4N A;  2PDO A;  2J9A A;  3BJ7 A;  2FE7 A;  4X8I A;  2Z3M A;  3KI9 A;  5FVJ A;  3R9G A;  4MJ8 A;  3SI2 A;  1CX8 A;  4MMO A;  4U9Y A;  2WSA A;  3QB8 A;  4WWV A;  4P4F A;  4UIB A;  2AFZ A;  4JXQ A;  2PQ8 A;  8CPA A;  4IF5 A;  1BLL E;  3CXP A;  3E0K A;  2BOA A;  3ISX A;  1I21 A;  3NH4 A;  3F0A A;  1TKF A;  4ZX9 A;  4OC5 A;  1YRE A;  1VHE A;  3D7H A;  4KVX A;  1YGH A;  4QC6 A;  3NFZ A;  2ZPA A;  1R3N A;  3D8P A;  2FS5 A;  1XFO A;  2KCW A;  4MFZ A;  2XEI A;  2C27 A;  4AVC A;  1N71 A;  2FCK A;  3UY5 A;  3BI0 A;  1YW6 A;  4ZGY B;  2ABZ A;  4RS2 A;  3IWW A;  1BPM A;  4R8F A;  4A2Z A;  1CP6 A;  3PB4 X;  5A28 A;  1QQ9 A;  1CJW A;  2FVG A;  4R57 A;  1PUA A;  4UWI A;  2WPX A;  3PB8 X;  5CPA A;  2ZW6 A;  3S6H A;  4EFD A;  3V7Z A;  2R7H A;  4GS4 A;  2OOT A;  4HPS A;  1GHE A;  2REE A;  4UFX A;  3RYO A;  2Q04 A;  1M4L A;  3D68 A;  3TOB A;  4LQG A;  1B6B A;  1IIC A;  3TFY A;  3LOD A;  2GAN A;  1PU9 A;  1XE4 A;  4XPL A;  4B5O A;  4QVT A;  4P4J A;  1IU8 A;  2PJ6 A;  2ZOG A;  4NGN A;  4PXE A;  4M85 A;  2J8R A;  2IL4 A;  2CTC A;  2B4D B;  4MHZ A;  1XBU A;  4OIW A;  2CNT A;  4KZT A;  3EY5 A;  4UFV A;  5LYD A;  2PJC A;  5AG6 A;  1LOK A;  4UWJ A;  3IFE A;  2PIZ A;  4MHP A;  3N7Z A;  5AG7 A;  4AB7 A;  4RUH A;  4BBH A;  1RO5 A;  2YNE A;  3S9L A;  1X10 A;  1LAN A;  3K9U A;  4A38 A;  1S7K A;  2VQY A;  2PJ8 A;  3FEE A;  4CRZ B;  4NGQ A;  2FT0 A;  1Z4R A;  1I1D A;  3B3T A;  3BHX A;  4R87 A;  1S7L A;  4Q36 A;  4A33 A;  2G3A A;  3BXM A;  4CGL A;  2VXK A;  4EME A;  1M1D A;  1YK3 A;  2WZN A;  4JLY A;  4Q7A A;  1FT7 A;  2GU2 A;  1AYE A;  4IK2 A;  1J4J A;  4NJR A;  4B12 A;  4CGM A;  4L89 A;  1BPN A;  3MRU A;  2BO9 A;  3JTK A;  1IID A;  3SXO A;  5J8C A;  1DTD A;  5H84 A;  3LWU A;  2WYR A;  3PRT A;  2ZEL A;  5HXD A;  4CAX A;  3H8G A;  4HNY B;  4UBR A;  3MGD A;  4ZY0 A;  1OBR A;  1QSN A;  2BUE A;  1XMB A;  2IJZ A;  4B10 A;  5G22 A;  5H86 A;  5JPH A;  2PC1 A;  2FL4 A;  3IU1 A;  4A30 A;  2ZEE A;  4Y49 C;  1XJO A;  3GY9 A;  3VWD A;  3VAT A;  4K30 A;  2OZU A;  3WT4 A;  1IY7 A;  4KLV A;  4ZBG A;  1AUG A;  4F6A A;  3V38 A;  4RN7 A;  4CS0 B;  2AFU A;  3R95 A;  5HVH A;  3G3S A;  1XMT A;  3D7F A;  3DR8 A;  4OP4 A;  5I0C A;  3LD2 A;  1CM0 A;  1YR0 A;  3DLJ A;  4UCM A;  1NSA A;  5LYF A;  5F09 A;  3JUW A;  4P4D A;  4QUS A;  4NJQ A;  1Y9W A;  4PXC A;  4R9M A;  4ONU A;  5ISV A;  1CPX A;  2PJA A;  4CPA A;  3B7I A;  1FY7 A;  4MCP A;  3LMS A;  2B4B A;  3WC5 A;  4XNH B;  1M4I A;  2K5T A;  3FF3 A;  2C6G A;  3IIB A;  2G0B A;  2JBK A;  3B3W A;  4R76 A;  1Y0R A;  3BLN A;  4KOV A;  4F8Z A;  1YX0 A;  2NSM A;  2PJ7 A;  2F8H A;  2GIV A;  2VZZ A;  5K8O A;  1Z8W A;  3G8W A;  1ZG8 A;  4QB9 A;  5LRJ A;  2R1I A;  4M6G A;  2CF4 A;  2HC9 A;  3R9E A;  5JM6 A;  3DGV A;  4JWP A;  1RXT A;  4XPD B;  5F49 A;  1YVK A;  2CXA A;  3KZW A;  3KKW A;  1TKH A;  1L0C A;  4NGS A;  4R3K A;  2PSW A;  1ZG9 A;  5JQ4 A;  3KQX A;  2V8G A;  1U6M A;  1IOF A;  2QYV A;  3ISZ A;  4M3S A;  3RZA A;  5KTA A;  5C82 A;  3D66 A;  2C6C A;  5DWN A;  4YRH A;  2RB7 A;  2I00 A;  4B5P A;  4UEZ A;  1M44 A;  3EC4 A;  5C88 A;  4MY3 A;  3GUX A;  3RNZ A;  5A27 A;  4MHN A;  4MFP A;  4A31 A;  2DXQ A;  1SQH A;  2Z3P A;  3PB7 X;  3W6X A;  3ZJ0 A;  2EUI A;  2H5M A;  4OC1 A;  4UCP A;  4E8O A;  4CGN A;  5IX3 A;  1MK4 A;  4IAV A;  2GLF A;  3RBU A;  2EK8 A;  1TF8 A;  3IWG A;  2JLM A;  4CGP A;  3FRM A;  2O28 A;  2PVV A;  2YGW A;  4BMH A;  2NMT A;  3TX8 A;  3KQZ A;  3TCV A;  5DWM A;  4DJL A;  2AJ6 A;  2I79 A;  2CNM A;  2D4P A;  1VIX A;  4TWE A;  4KSF A;  4B11 A;  1KUX A;  3C26 A;  3CZX A;  3GKR A;  1XIX A;  2BEI A;  4NEX A;  3SXN A;  2PJB A;  3I1U A;  1ELM P;  3TOA A;  4EVY A;  1YW4 A;  1LFW A;  3F5B A;  4J3G A;  3PGP A;  4NSQ A;  3CXQ A;  1WWZ A;  4IHM A;  5K8M A;  2AE6 A;  4R7M A;  3BJ8 A;  3CT9 A;  2B3V A;  1Z8X A;  3KHZ A;  4X3R A;  4C2Z A;  4C68 A;  2JDC A;  4A94 A;  4MCR A;  4OC0 A;  5HVF A;  4JYW A;  4RI1 A;  3JRU A;  4KLW A;  4OC4 A;  5AG4 A;  1Q2C A;  4AG9 A;  5HVG A;  1UWY A;  2XEF A;  2ZEN A;  1R43 A;  5LRG A;  5CNP A;  7CPA A;  2C1C A;  4B5P B;  2HB6 A;  5J8F A;  3OWC A;  3WR7 A;  3NA6 A;  5LRK A;  2HV2 A;  2Q4V A;  2Z10 A;  2Q51 A;  3H5Z A;  5K8P A;  3HUV A;  1MJB A;  1YSJ A;  3D67 A;  4CAE A;  3SJG A;  3IU2 A;  2OR4 A;  4FD5 A;  4HNX B;  4BD9 A;  4KUA A;  3R1K A;  1YLO A;  1H8L A;  2QIR A;  1WK4 A;  2Z3N A;  2DPS A;  4A32 A;  1QSO A;  1YVO A;  3FB3 A;  2ZW5 A;  4FBE A;  1TF9 A;  1Z2L A;  1VHS A;  2CNS A;  3DR6 A;  2AFO A;  2DPT A;  4GXH A;  2ZEF A; 
#chains in the Genus database with same CATH homology
 4B14 A;  1BOB A;  3TO7 A;  4LX9 A;  4FD7 A;  2EVN A;  2QML A;  2JDD A;  2Z3L A;  4FD4 A;  3TT2 A;  4LUA A;  2OZH A;  1B87 A;  2ARH A;  4PK3 A;  3PZJ A;  1QST A;  3A9L A;  3DNS A;  2FIA A;  2B58 A;  3TO6 A;  2ZXV A;  4XNH C;  4CGO A;  1LRZ A;  2Q4Y A;  5G21 A;  4CYO A;  1Z4E A;  2YNC A;  4X5K A;  2ZW4 A;  2ATR A;  3FNC A;  4HNW B;  4KOU A;  2Z3O A;  2Q0Y A;  4XPD C;  4H6U A;  1KUY A;  2Z3K A;  2R98 A;  4JJX A;  1ON0 A;  2J8N A;  4NF1 A;  1NSL A;  4JXR A;  4KOY A;  3P2H A;  4MFJ A;  1IYL A;  5G1Z A;  3QAH A;  2HUZ A;  4PK2 A;  4KOS A;  4CRY B;  4MFK A;  4H6Z A;  2OB0 A;  5AG5 A;  1TIQ A;  4U9Z A;  3VWE A;  5BWA B;  2GE3 A;  1NMT A;  2B5G A;  4MHD A;  5AGE A;  5HH1 A;  1Q2Y A;  1I12 A;  4KOX A;  2BSW A;  2WUU A;  4KVO E;  4U5Y A;  3FXT A;  1XEB A;  1QSR A;  4MFQ A;  5EC4 A;  2D4O A;  3EXN A;  3FBU A;  4C7H A;  3TE4 A;  4KOT A;  3S6F A;  4OAD A;  4IUS A;  2B4D A;  5EBV A;  5F46 A;  1VKC A;  1Y9K A;  2HQY A;  4UCN A;  2X7B A;  3P2F A;  4C2Y A;  3V8I A;  2J8M A;  2PRB A;  3F8K A;  3EFA A;  3DDD A;  3T9Y A;  3CXS A;  1KZF A;  3W6S A;  2Z11 A;  4YFJ A;  2B5G B;  3R96 A;  4MBU A;  1R57 A;  3D2P A;  4OAE A;  4PV6 A;  4R3L A;  2OU2 A;  2R8V A;  3DSB A;  4AVA A;  2FSR A;  2P6E A;  4CYQ A;  5F48 A;  2P6G A;  4MY0 A;  2VBQ A;  3TTH A;  2VI7 A;  3PP9 A;  1S7N A;  4KOW A;  1NE9 A;  2Q7B A;  5IB0 A;  4KUB A;  4CAV A;  3NE7 A;  3W91 A;  3IWE A;  5F47 A;  1Y7R A;  3EO4 A;  4HKF A;  4H89 A;  2Y0M A;  2P0W A;  2VZY A;  3S6K A;  4A95 A;  4PSW A;  5E96 A;  1YLE A;  1IB1 E;  4ORF A;  1S7F A;  3H4Q A;  4MFL A;  4AVB A;  5IV0 A;  3FYN A;  4KVM E;  4NXY A;  3R9F A;  1XF8 A;  4I49 A;  2JEV A;  1M4G A;  4Q38 A;  1V0C A;  4E2A A;  2QEC A;  4KOR A;  4XPK A;  3T90 A;  2OZG A;  3B8G A;  2REF A;  1M4D A;  2Q44 A;  5KTD A;  3I3G A;  1MJ9 A;  1OZP A;  4C2X A;  4E0A A;  3TO9 A;  4UFW A;  2CY2 A;  3GYA A;  4QBJ A;  3S6G A;  1P4N A;  4NCZ A;  2PR1 A;  2VEZ A;  1S3Z A;  4CYP A;  3IGR A;  5GCN A;  4DNC A;  3JVN A;  4UA3 A;  5G20 A;  4F0X A;  1MJA A;  4Y49 B;  1S5K A;  1UFH A;  2YNC C;  2WPW A;  4JD6 A;  3I9S A;  4CAW A;  3SHP A;  1QSM A;  2RC4 A;  1IYK A;  2F5I A;  2BL1 A;  4CYN A;  4B13 A;  2G3T A;  4CAF A;  2FXF A;  1Z9U A;  1K4J A;  2B3U A;  4MI4 A;  4AG7 A;  4KS9 A;  1Q2D A;  4F0Y A;  2ZW7 A;  4FD6 A;  4II9 A;  1P0H A;  4OLL A;  5KTC A;  4L8A A;  1KUV A;  3D3S A;  1ZO0 A;  2FIW A;  3FIX A;  3D2M A;  4C7I A;  4PSX A;  3ZZI A;  2PR8 A;  5HMN A;  2P6F A;  1BO4 A;  4YGO A;  2YND A;  2Z0Z A;  4KSA A;  2OH1 A;  1S60 A;  2A4N A;  2PDO A;  3BJ7 A;  2FE7 A;  2Z3M A;  3R9G A;  5FVJ A;  4MJ8 A;  4U9Y A;  2WSA A;  3QB8 A;  4JXQ A;  2PQ8 A;  4IF5 A;  3CXP A;  3E0K A;  1I21 A;  3F0A A;  1YRE A;  4KVX A;  1YGH A;  4QC6 A;  2ZPA A;  3D8P A;  2FS5 A;  2KCW A;  4MFZ A;  4AVC A;  2C27 A;  1N71 A;  2FCK A;  3UY5 A;  4ZGY B;  4RS2 A;  4A2Z A;  5A28 A;  4R57 A;  1CJW A;  1PUA A;  4UWI A;  2WPX A;  3S6H A;  2ZW6 A;  2R7H A;  4GS4 A;  1GHE A;  2REE A;  4UFX A;  3RYO A;  2Q04 A;  3TOB A;  1B6B A;  1IIC A;  3TFY A;  3LOD A;  2GAN A;  1PU9 A;  1XE4 A;  4XPL A;  4B5O A;  4QVT A;  4M85 A;  2J8R A;  2IL4 A;  2B4D B;  2CNT A;  4KZT A;  3EY5 A;  4UFV A;  5AG6 A;  4UWJ A;  4AB7 A;  5AG7 A;  3N7Z A;  4BBH A;  1RO5 A;  2YNE A;  3K9U A;  1S7K A;  2VQY A;  4CRZ B;  2FT0 A;  1Z4R A;  1I1D A;  4R87 A;  1S7L A;  4Q36 A;  4A33 A;  2G3A A;  4CGL A;  2VXK A;  1M1D A;  1YK3 A;  4JLY A;  1J4J A;  4B12 A;  4CGM A;  4L89 A;  3JTK A;  1IID A;  3SXO A;  5J8C A;  5H84 A;  4CAX A;  4UBR A;  4HNY B;  3MGD A;  1QSN A;  2BUE A;  4B10 A;  5G22 A;  5H86 A;  5JPH A;  2PC1 A;  2FL4 A;  3IU1 A;  4A30 A;  4Y49 C;  3VWD A;  3GY9 A;  4K30 A;  2OZU A;  4KLV A;  4ZBG A;  4F6A A;  4CS0 B;  3R95 A;  3G3S A;  1XMT A;  3DR8 A;  5I0C A;  3LD2 A;  1CM0 A;  1YR0 A;  4UCM A;  3JUW A;  4QUS A;  1Y9W A;  4R9M A;  4ONU A;  5ISV A;  1FY7 A;  2B4B A;  4XNH B;  1M4I A;  2K5T A;  2G0B A;  3BLN A;  4KOV A;  1YX0 A;  2GIV A;  2VZZ A;  3G8W A;  4QB9 A;  2R1I A;  3R9E A;  4JWP A;  4XPD B;  1RXT A;  5F49 A;  1YVK A;  2CXA A;  3KKW A;  1L0C A;  4R3K A;  2PSW A;  5JQ4 A;  1U6M A;  4M3S A;  5KTA A;  5C82 A;  5DWN A;  4YRH A;  2I00 A;  4B5P A;  1M44 A;  3EC4 A;  4MY3 A;  5A27 A;  4A31 A;  4MFP A;  2DXQ A;  1SQH A;  2Z3P A;  3W6X A;  3ZJ0 A;  2EUI A;  2H5M A;  4UCP A;  4E8O A;  5IX3 A;  4CGN A;  1MK4 A;  3IWG A;  2JLM A;  4CGP A;  3FRM A;  2O28 A;  2YGW A;  4BMH A;  2NMT A;  3TCV A;  5DWM A;  2AJ6 A;  2I79 A;  2CNM A;  2D4P A;  4KSF A;  4B11 A;  1KUX A;  3C26 A;  5C88 A;  3GKR A;  1XIX A;  2BEI A;  4NEX A;  3SXN A;  3TOA A;  4EVY A;  3F5B A;  4J3G A;  3PGP A;  4NSQ A;  3CXQ A;  1WWZ A;  2AE6 A;  3BJ8 A;  2B3V A;  4C68 A;  4C2Z A;  2JDC A;  4RI1 A;  4KLW A;  5AG4 A;  1Q2C A;  4AG9 A;  5CNP A;  4B5P B;  5J8F A;  3OWC A;  3WR7 A;  2HV2 A;  2Q4V A;  2Z10 A;  3H5Z A;  1MJB A;  4CAE A;  3IU2 A;  4FD5 A;  4HNX B;  4KUA A;  3R1K A;  2QIR A;  2Z3N A;  1WK4 A;  4A32 A;  2DPS A;  1QSO A;  1YVO A;  3FB3 A;  2ZW5 A;  1VHS A;  2CNS A;  3DR6 A;  2DPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...