3EFAA

Crystal structure of putative n-acetyltransferase from lactobacillus plantarum
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
146
structure length
146
Chain Sequence
NAMKIIFSASPANRAAAYALRQAVFVEERGISADVEFDVKDTDQCEYAVLYLQPDLPITTLRLEPQADHVMRFGRVCTRKAYRGHGWGRQLLTAAEEWATQRGFTHGEIHGELTAQRFYELCGYRVTAGPYDEDGAPVVIMHKQLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Acetyltransferase
publication title Crystal structure of putative N-acetyltransferase from Lactobacillus plantarum
rcsb
source organism Lactobacillus plantarum wcfs1
molecule tags Transferase
total genus 42
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3efaA00
2EVNA 4QBJA 1S7LA 4JLYA 4NSQA 5JPHA 1SQHA 2BEIA 2DXQA 3FXTA 4OLLA 4KVME 1KUYA 2PR1A 1I1DA 2ZW7A 3SHPA 3DDDA 4CAWA 4E8OA 5H86A 4KLWA 3QB8A 2ZW5A 2PR8A 1S60A 2R98A 2HQYA 2Z11A 2VXKA 1XEBA 1V0CA 4LX9A 5DWMA 3TO9A 3R9EA 1XE4A 4H6UA 3TFYA 4UBRA 1YR0A 1XMTA 3DR6A 4XPDB 4CRZB 4PSWA 1B6BA 3TTHA 1M1DA 2P6GA 4KOSA 4XNHB 2FE7A 4CRYB 1P4NA 1WK4A 1I12A 3G3SA 3S6FA 2EUIA 2J8NA 2GE3A 5E96A 5C82A 1NMTA 3I3GA 3EC4A 1YK3A 4QVTA 5F46A 2Q44A 3D3SA 4XNHC 5I0CA 4KUAA 3RYOA 4PSXA 4JXRA 3SXOA 5HMNA 3CXQA 4B5PA 2Q04A 1PUAA 2Q4YA 4KOWA 2VZZA 3FB3A 1LRZA 4J3GA 4FD6A 2ZW6A 4IUSA 4DNCA 2ATRA 1M44A 2D4PA 1M4GA 3FIXA 4B5OA 3GYAA 4H6ZA 4M85A 3JUWA 1Q2YA 3GY9A 2D4OA 1Y9WA 2Q0YA 1RO5A 5KTDA 2REEA 5F49A 4F0YA 3R9GA 4KORA 1Q2CA 1MJAA 2CY2A 2O28A 3W6XA 2QIRA 1QSRA 3I9SA 4U9YA 2FL4A 3KKWA 2JDDA 2A4NA 3TOAA 4ORFA 4AG7A 2CNMA 1GHEA 2FS5A 2PRBA 4U5YA 3F5BA 1IIDA 4FD7A 1YLEA 3PP9A 1Z9UA 5KTAA 4AB7A 2VZYA 2B5GB 1MK4A 4AVAA 3S6HA 5J8CA 3F0AA 2HV2A 2J8MA 3QAHA 3SXNA 1Z4EA 2VEZA 5F48A 5IX3A 4KVOE 2PDOA 4FD5A 3P2HA 5IB0A 4QC6A 4JWPA 3K9UA 4XPLA 1OZPA 4CAVA 2QECA 2KCWA 4R3KA 3D2PA 4KOXA 1YVKA 2B4DB 2AJ6A 2P6EA 4QB9A 1QSTA 3S6GA 4Y49B 4KOTA 4OADA 5J8FA 5IV0A 3W91A 1MJ9A 2PSWA 4X5KA 1QSNA 3MGDA 2G3TA 4GS4A 3H4QA 1RXTA 1Y7RA 3V8IA 2CNSA 3F8KA 1I21A 2FSRA 2F5IA 2G0BA 4XPDC 4L8AA 1NSLA 1ON0A 3TCVA 1QSMA 3D8PA 3R96A 4NEXA 3DSBA 5ISVA 4E0AA 1S7KA 3NE7A 2REFA 2Z10A 2ZW4A 1B87A 1R57A 1K4JA 2OZUA 4MBUA 4ONUA 4R3LA 5DWNA 4YFJA 3EO4A 2J8RA 1KUVA 3DNSA 1VKCA 2WPWA 2WPXA 4FD4A 2GANA 1YGHA 1KZFA 2HUZA 1M4IA 1YREA 4K30A 2VQYA 3JVNA 3EFAA 3W6SA 2Q4VA 4BMHA 3FBUA 2K5TA 1XF8A 1PU9A 2JEVA 2OB0A 2B4BA 2B3UA 2GIVA 4MI4A 4MJ8A 2IL4A 2BSWA 3BLNA 1L0CA 5EC4A 2ARHA 2JLMA 4RS2A 3IGRA 5HH1A 1N71A 2R1IA 3D2MA 1KUXA 2P0WA 1J4JA 1YVOA 1M4DA 3T90A 2FXFA 2FT0A 4HNWB 4JD6A 3C26A 1Z4RA 2G3AA 5FVJA 3CXSA 5F47A 4KOUA 2B58A 4NCZA 1P0HA 2VI7A 4QUSA 4HNYB 3CXPA 3ZZIA 3TOBA 1S3ZA 4PK2A 4MY0A 4YRHA 2ZXVA 3FRMA 3GKRA 3OWCA 1BO4A 3PGPA 3ZJ0A 1IYLA 2R7HA 4AVCA 5H84A 5CNPA 4H89A 2I79A 3PZJA 1TIQA 4YGOA 4HNXB 3TO6A 2B5GA 4MY3A 2AE6A 4L89A 2PQ8A 2ZPAA 4ZBGA 4XPKA 3IWGA 3EY5A 4UA3A 3LODA 4U9ZA 4CAXA 4KUBA 2B3VA 4HKFA 5C88A 4UWJA 4KZTA 3UY5A 3R95A 4LUAA 4R9MA 1Y9KA 2OZHA 3TE4A 2OZGA 5GCNA 2FCKA 4M3SA 3TT2A 3BJ8A 4UWIA 1FY7A 2I00A 4JXQA 4KVXA 4IF5A 3G8WA 2JDCA 2BUEA 3T9YA 5JQ4A 2B4DA 4Y49C 1CJWA 4NF1A 4B5PB 2X7BA 4I49A 3S6KA 2OH1A 3B8GA 4AG9A 5EBVA 2NMTA 2BL1A 1UFHA 1IB1E 4PV6A 1S7FA 2R8VA 3EXNA 4EVYA 4KOYA 4NXYA 1IICA 1XIXA 3E0KA 4KOVA 4JJXA 3LD2A 1CM0A 4F6AA 4R57A 3P2FA 2OU2A 4OAEA 4MHDA 3TO7A 4KLVA 1S7NA 2Y0MA 2Z0ZA 4CS0B 4AVBA 4E2AA 1YX0A 4II9A 2RC4A 2PC1A 1BOBA 2CNTA 3WR7A 3DR8A 1Q2DA 5KTCA 3VWDA 4PK3A 4R87A 3FNCA 2FIAA 2VBQA 2P6FA 1U6MA 3FYNA 3R9FA 2H5MA 2Q7BA 1QSOA 1VHSA 3R1KA 3BJ7A 1MJBA 2QMLA 2FIWA 2C27A 1IYKA 1NE9A 3N7ZA 1S5KA 4RI1A 3VWEA 1WWZA
chains in the Genus database with same CATH superfamily
1XOVA 2EVNA 3KQXA 3RO0A 4RN7A 3FH4A 2YNCC 4QBJA 2QVPA 1S7LA 4JLYA 4NSQA 2QJ8A 2DEAA 3NE8A 5JPHA 3MN8A 4B6ZA 1SQHA 2BEIA 2DXQA 2AFOA 2RB7A 2V8VA 4MXUA 3FXTA 4OLLA 3CPXA 2PJ8A 4KVME 4MFJA 1KUYA 2WYRA 2PR1A 1HEEA 3K9TA 4KSAA 1I1DA 3B3WA 5THWA 2ZW7A 4NGQA 1VIXA 3SHPA 3DDDA 4CAWA 4E8OA 1VGYA 4OC5A 5H86A 4KLWA 3QB8A 2PVWA 3D4UA 2ZW5A 2PR8A 1S60A 4FBEA 2R98A 3GIUA 4R7MA 4R6TA 4C7HA 4F9VA 5AG6A 2PRQA 2HQYA 4MFQA 2Z11A 2EK8A 1XEBA 2VXKA 3SJFA 4Z65A 1V0CA 4A32A 4LX9A 5DWMA 3TO9A 3R9EA 2PJ0A 1XE4A 3NA6A 4H6UA 4UIBA 4A33A 4CYNA 2PJBA 3WC5A 4C7IA 3TFYA 4MCPA 2IJZA 2XEFA 2Z3NA 4UBRA 1ZLIA 1YR0A 1XMTA 3DR6A 1X12A 4XPDB 4PSWA 1B6BA 4CRZB 3TTHA 4F9UA 3CPAA 4Q38A 2NSMA 1M1DA 4ZGYB 4JZ0A 1Q7LA 4MHZA 2P6GA 4KOSA 4XNHB 5G22A 4HPSA 2OR4A 5LYDA 4P45A 5ELYA 2FE7A 4CRYB 4CGLA 1P4NA 4CYOA 1CBXA 1WK4A 1I12A 3G3SA 3CT9A 3S6FA 2EUIA 2J8NA 3FECA 2GE3A 5E96A 5LYIA 5C82A 1NMTA 2ZEHA 3BI0A 4NJRA 1AMPA 1YW6A 3PB9X 3DGVA 3V38A 3ISXA 3I3GA 3EC4A 1YK3A 4QVTA 2Z3KA 3D7HA 3JRUA 5F46A 3B3VA 2Q44A 2ZEFA 3D3SA 3HUVA 4NJQA 4XNHC 5I0CA 4KUAA 3RYOA 4PSXA 3WT4A 4JXRA 1ZG7A 1ZG8A 4X2TA 3CXQA 5AGEA 3SXOA 4B5PA 4C2ZA 5HMNA 2Q04A 1PUAA 2Q4YA 3FX6A 4KOWA 2VZZA 3FB3A 4MFPA 1LRZA 4J3GA 4FD6A 3IU2A 4A2ZA 2ZW6A 4IUSA 2PCUA 3NFZA 1Y0RA 4DNCA 1DTDA 2ZOFA 2D4PA 1M44A 2ATRA 5F09A 2RFHA 3SJGA 1M4GA 3FIXA 2EO8A 4B5OA 1CG2A 3GYAA 5BWAB 4H6ZA 1HDUA 4M85A 4UEFA 2EBJA 2ZELA 3JUWA 1Q2YA 3GY9A 2D4OA 1Y9WA 2Q0YA 1RO5A 5KTDA 2REEA 2PJ2A 3H8FA 4CGNA 1F2OA 1FNOA 4OIDA 5CBMA 4KS9A 5F49A 4F0YA 3R9GA 4A30A 5K8PA 4KORA 4YU9A 1OBRA 1Q2CA 2PJ5A 4ZY0A 1MJAA 1TKFA 2CY2A 2WZNA 4ZX9A 2O28A 3V7ZA 3W6XA 2QIRA 1QSRA 2Q43A 3I9SA 4MMOA 2Z3PA 4U9YA 2FL4A 3KKWA 2JDDA 4B13A 3SJXA 2A4NA 3TOAA 4ORFA 1ARLA 4AG7A 2CNMA 1GHEA 2FS5A 2PRBA 3D68A 1TKJA 4LQGA 4C2XA 2C1CA 2C6PA 1CPSA 2PJ3A 3IWWA 4MFZA 3D7FA 4U5YA 5AG4A 3F5BA 4LQ6A 4P44A 1IIDA 4FD7A 1YLEA 3HLPA 1HDQA 4UIAA 3PP9A 2YNDA 4TNUA 5HXDA 1CP7A 3IU1A 5CPAA 4DUKA 1Z9UA 3T8WA 5KTAA 4UCPA 5G20A 4AB7A 2YNCA 4IK2A 5JH9A 4R76A 5D8NA 2XEIA 2VZYA 2AFZA 3BI1A 2B5GB 2PJ7A 3S9NA 3CDXA 1KWMA 5A27A 1MK4A 4AVAA 3S6HA 5J8CA 3SJEA 2VL1A 4KSIA 3F0AA 1XBUA 2HV2A 2J8MA 3QAHA 1BAVA 5G21A 3SXNA 5A28A 1Z4EA 1Z8WA 2VEZA 5F48A 5LRGA 4A95A 5IX3A 3NH5A 1Z8TA 3NH4A 1EE3P 4NGSA 5K8NA 4KVOE 2PDOA 3SI0A 4FD5A 4ZY2A 5I4MA 4G1PA 3P2HA 3PBEA 1PCAA 5IB0A 2O53A 3WC7A 2C6GA 4QC6A 4JWPA 3TOBA 1ZLHA 3B3TA 1TXRA 3K9UA 1DE4C 3PB8X 4XPLA 5K8MA 1OZPA 1GYTA 4CAVA 2I3CA 4BD9A 4EMEA 1Z8XA 4B10A 2QECA 2KCWA 4NGRA 3H5ZA 2IMOA 4R3KA 4P4EA 3PB4X 3D2PA 4KOXA 1X10A 1YVKA 1BLLE 2B4DB 2AJ6A 2J9AA 2P6EA 2ZEEA 3FEDA 2PJ6A 2JBJA 1ZO0A 4QB9A 1QSTA 1BPNA 3S6GA 3B3SA 4OC0A 4UFVA 3VH9A 6CPAA 3B7IA 4MHPA 4OP4A 4BBHA 4Y49B 5HVFA 4KOTA 3S9MA 4OADA 4M6HA 5IV0A 3W91A 1MJ9A 2PSWA 4X5KA 2PJ9A 5J8FA 1QSNA 4EFDA 2PIYA 3KI9A 3MGDA 2G3TA 4GS4A 4MHYA 2CF4A 4AXVA 3H4QA 1RXTA 2GREA 1IY7A 4NGTA 4A94A 1Y7RA 2YGWA 3V8IA 2CNSA 3F8KA 4ZYQA 1ARMA 1I21A 2FSRA 2F5IA 2G0BA 3ISZA 4XPDC 4L8AA 1NSLA 4M6GA 1ON0A 3TCVA 2CXAA 1QSMA 5HVHA 4OKOA 4FAIA 2Q51A 3D8PA 5AG5A 2GU2A 4UFXA 4NEXA 3R96A 3KZWA 2CTCA 2GLJA 3DSBA 4WWVA 3PRTA 3L2NA 4CAFA 5ISVA 1LFWA 5JGFA 2V77A 4E0AA 3FVLA 1S7KA 3NE7A 3PBBA 2PE3A 2REFA 4OC1A 2Z10A 2ZW4A 3VARA 3D66A 1B87A 1R57A 1K4JA 2OZUA 3LMSA 4MBUA 4P4IA 4ONUA 2Z3LA 4R3LA 4W9YA 3EO4A 3IIBA 5DWNA 4CGPA 4YFJA 1JWQA 2J8RA 1KUVA 3DNSA 4MCSA 4DYOA 1VKCA 2WPWA 2WPXA 4FD4A 2QYVA 2GANA 1YGHA 4M6IA 1KZFA 2HUZA 2ZEDA 1M4IA 1YREA 4MRIA 2DF5A 4K30A 2VQYA 3JVNA 3EFAA 4UCMA 2Q4VA 3W6SA 2Z3MA 4NGMA 3IFEA 3FBUA 4BMHA 2K5TA 3QNVA 2ZEGA 1XF8A 3B3CA 2AFMA 3MRUA 4A39A 1PU9A 2JEVA 1YQEA 2OB0A 2XEJA 5LYLA 2B4BA 1Y7EA 3RAMA 1LCPA 2B3UA 3BHXA 3LWUA 4O23A 1VHEA 5DS0A 2GIVA 4MI4A 1QQ9A 4MJ8A 2O4HA 1R3NA 4NGNA 4UF4A 4B12A 3H8EA 2IL4A 2BSWA 3BLNA 1L0CA 4JYWA 3B35A 2CIJA 1ELLP 5EC4A 4MCQA 1NSAA 2YNEA 2ZENA 3GLJA 4PXDA 1XJOA 1BPMA 2ARHA 2JLMA 5LYFA 1PYTB 3IWEA 4RS2A 2PJ4A 3IGRA 2POKA 2ABZA 2ZEOA 1N71A 3B2YA 4UFWA 2R1IA 5HH1A 3D2MA 1CP6A 3KHZA 3VATA 1KUXA 2P0WA 1TF8A 1J4JA 1YVOA 1M4DA 3N5FA 5EMIA 3T90A 2AFSA 2FXFA 2FT0A 2IQ6A 3A9LA 4HNWB 4JD6A 1UWYA 4FWUA 4UEEA 2Q4ZA 3C26A 4B11A 1Z4RA 2G3AA 5IB9A 5FVJA 4IAVA 4PQAA 3CXSA 5F47A 4KOUA 4Q7AA 2B58A 2ZEMA 4NCZA 1YSJA 1M4LA 1P0HA 2V8GA 2VI7A 1H8LA 2EK9A 4HNYB 4QUSA 4EWTA 3CXPA 3ZZIA 1VHOA 1S3ZA 1F57A 3KHXA 4PK2A 3KR4A 4MY0A 2C6CA 4H2KA 4X8IA 4X3RA 3D67A 4YRHA 2ZXVA 3FRMA 3GKRA 3OWCA 2XEGA 1ZG9A 2GLFA 1IOIA 1XMBA 3FJUA 1BO4A 4OC2A 4Q36A 4CAEA 3PGPA 1QMUA 3ZJ0A 3IEHA 1IYLA 1IU8A 4YWYA 3PB7X 3PEIA 2ODFA 1F2PA 2R7HA 4AVCA 3FEEA 3FF3A 2JBKA 2OOTA 3K2KA 5H84A 5CNPA 4H89A 3I1UA 3IJ3A 8CPAA 4TWEA 2I79A 3NH8A 1LOKA 3SI2A 3PZJA 1TIQA 4P10A 4YGOA 1TF9A 2BOAA 2B5GA 2ANPA 2AE6A 4HNXB 4MY3A 3TO6A 5K8OA 4CGOA 4L89A 2PQ8A 2PJAA 4KSFA 2ZPAA 2HC9A 4XPKA 4ZBGA 3IWGA 1YW4A 4NFRA 4A31A 2PVVA 1Z2LA 2F8HA 4CPAA 3EY5A 4UA3A 3LODA 4B14A 1A2ZA 4OC4A 4U9ZA 4CAXA 4P6YA 2AFWA 4KUBA 2B3VA 4HKFA 1ELMP 5C88A 4UWJA 4KZTA 3UY5A 3R95A 5AG7A 4CYQA 2BO9A 4LUAA 1Y9KA 2OZHA 4R9MA 7CPAA 4R8FA 2OZGA 4UCNA 2Z3OA 5GCNA 1Y0YA 2FCKA 1JQGA 3FMCA 4M3SA 5G1ZA 3TT2A 3BJ8A 4ZI6A 4UWIA 3TX8A 3QAYA 3IC1A 3BXMA 3LACA 3S9LA 1FY7A 1LAMA 4P4JA 4RUHA 2I00A 4JXQA 4KVXA 4IF5A 1IGBA 1XRYA 2V8DA 3CZXA 3G8WA 1CX8A 2JDCA 3DLJA 2BUEA 4MFKA 4MCRA 3T9YA 2FVGA 3TC8A 2B4DA 4ZY1A 5JQ4A 4MHNA 2CTBA 4Y49C 1CJWA 4OC3A 4NF1A 3KASA 2X7BA 4B5PB 3GUXA 4I49A 3KQZA 4CGMA 4PXBA 3KGQA 3S6KA 2PIZA 2OH1A 2PJCA 3B8GA 4AG9A 5EBVA 3TE4A 4F0XA 2NMTA 4CYPA 2BL1A 3D7DA 1UFHA 4MFLA 1IB1E 2WSAA 1AYEA 4PV6A 1S7FA 2AFXA 2R8VA 3RZAA 2DPTA 3EXNA 1YLOA 4EVYA 4KOYA 1Z5RA 4OIWA 2JEWA 4NXYA 2ZOGA 4C2YA 1IICA 1XIXA 3E0KA 4ONWA 4P4BA 3PFOA 5LRJA 5LRKA 2Q7SA 4KOVA 4JJXA 2BCOA 1CM0A 3LD2A 1LAPA 3H8GA 1R43A 4DJLA 4F6AA 4P4DA 1TKHA 4PPZA 4R57A 3P2FA 2OU2A 4OAEA 4MHDA 3TO7A 2G9DA 3D7GA 4IHMA 1S7NA 1LANA 2Y0MA 2Z0ZA 4KLVA 4ZX8A 2HB6A 4FUUA 3PFEA 2AFUA 2ZEPA 4CS0B 4AVBA 4E2AA 1YX0A 3IO1A 4II9A 4F8ZA 2RC4A 2PJ1A 2PC1A 1BOBA 3KL9A 2GFQA 5HVGA 2CNTA 3WR7A 4NGPA 3DR8A 1Q2DA 2F7VA 3SI1A 5KTCA 4GXHA 3VWDA 5JM6A 4C68A 4PXEA 2EWBA 3JTKA 4PK3A 1YMEA 4R87A 2NYQA 3FNCA 2FIAA 4WJBA 2VBQA 2P6FA 1U6MA 4A37A 3RNZA 3FYNA 2WUUA 3R9FA 2H5MA 1FT7A 5J1QA 2Q7BA 3KR5A 1IOFA 1RTQA 1QSOA 2V8HA 4K3NA 1VHSA 4BINA 3PB6X 4PXCA 5D29A 3GB0A 1XFOA 3BJ7A 1AUGA 1MJBA 2QMLA 3R1KA 2FIWA 4P4FA 3WABA 2C27A 1IYKA 1NE9A 1Z8LA 3N7ZA 4UEZA 4GM5A 1CPXA 4OMEA 3RBUA 4A38A 2DPSA 1S5KA 3WC6A 4RI1A 3VWEA 1WWZA
chains in the Genus database with same CATH topology
2EVNA 2YNCC 4QBJA 1S7LA 4JLYA 4NSQA 5JPHA 1SQHA 2BEIA 2DXQA 3FXTA 4OLLA 4KVME 4MFJA 1KUYA 2PR1A 4KSAA 1I1DA 2ZW7A 3SHPA 3DDDA 4CAWA 4E8OA 5H86A 4KLWA 3QB8A 2ZW5A 2PR8A 1S60A 2R98A 4C7HA 5AG6A 2HQYA 4MFQA 2Z11A 2VXKA 1XEBA 1V0CA 4A32A 4LX9A 5DWMA 3TO9A 3R9EA 1XE4A 4H6UA 4A33A 4CYNA 4C7IA 3TFYA 2Z3NA 4UBRA 1YR0A 1XMTA 3DR6A 4XPDB 4CRZB 4PSWA 1B6BA 3TTHA 4Q38A 1M1DA 4ZGYB 2P6GA 4KOSA 4XNHB 5G22A 2FE7A 4CRYB 4CGLA 1P4NA 4CYOA 1WK4A 1I12A 3G3SA 3S6FA 2EUIA 2J8NA 2GE3A 5E96A 5C82A 1NMTA 3I3GA 3EC4A 1YK3A 4QVTA 2Z3KA 5F46A 2Q44A 3D3SA 4XNHC 5I0CA 4KUAA 3RYOA 4PSXA 4JXRA 3SXOA 5AGEA 3CXQA 4C2ZA 4B5PA 5HMNA 2Q04A 1PUAA 2Q4YA 4KOWA 2VZZA 3FB3A 4MFPA 1LRZA 4J3GA 4FD6A 3IU2A 4A2ZA 2ZW6A 4IUSA 4DNCA 2ATRA 1M44A 2D4PA 1M4GA 3FIXA 4B5OA 3GYAA 5BWAB 4H6ZA 4M85A 3JUWA 1Q2YA 3GY9A 2D4OA 1Y9WA 2Q0YA 1RO5A 5KTDA 2REEA 4CGNA 4KS9A 5F49A 4F0YA 3R9GA 4A30A 4KORA 1Q2CA 1MJAA 2CY2A 2O28A 3W6XA 2QIRA 1QSRA 3I9SA 2Z3PA 4U9YA 2FL4A 3KKWA 2JDDA 4B13A 2A4NA 3TOAA 4ORFA 4AG7A 2CNMA 1GHEA 2FS5A 2PRBA 4C2XA 4MFZA 4U5YA 5AG4A 3F5BA 1IIDA 4FD7A 1YLEA 3PP9A 2YNDA 3IU1A 1Z9UA 5KTAA 4UCPA 5G20A 4AB7A 2YNCA 2VZYA 2B5GB 5A27A 1MK4A 4AVAA 3S6HA 5J8CA 3F0AA 2HV2A 2J8MA 3QAHA 5G21A 3SXNA 5A28A 1Z4EA 2VEZA 5F48A 4A95A 5IX3A 4KVOE 2PDOA 4FD5A 3P2HA 5IB0A 4QC6A 4JWPA 3K9UA 4XPLA 1OZPA 4CAVA 4B10A 2QECA 2KCWA 4R3KA 3H5ZA 3D2PA 4KOXA 1YVKA 2B4DB 2AJ6A 2P6EA 1ZO0A 4QB9A 1QSTA 3S6GA 4UFVA 4BBHA 4Y49B 4KOTA 4OADA 5J8FA 5IV0A 3W91A 1MJ9A 2PSWA 4X5KA 1QSNA 3MGDA 2G3TA 4GS4A 3H4QA 1RXTA 2YGWA 1Y7RA 3V8IA 2CNSA 3F8KA 1I21A 2FSRA 2F5IA 2G0BA 4XPDC 4L8AA 1NSLA 1ON0A 3TCVA 2CXAA 1QSMA 5AG5A 3D8PA 4UFXA 4NEXA 3R96A 3DSBA 5ISVA 4CAFA 4E0AA 1S7KA 3NE7A 2REFA 2Z10A 2ZW4A 1B87A 1R57A 1K4JA 2OZUA 4MBUA 4ONUA 2Z3LA 4R3LA 5DWNA 3EO4A 4CGPA 4YFJA 2J8RA 1KUVA 3DNSA 1VKCA 2WPWA 2WPXA 4FD4A 2GANA 1YGHA 1KZFA 2HUZA 1M4IA 1YREA 4K30A 2VQYA 3JVNA 3EFAA 4UCMA 2Q4VA 3W6SA 2Z3MA 4BMHA 3FBUA 2K5TA 1XF8A 1PU9A 2JEVA 2OB0A 2B4BA 2B3UA 2GIVA 4MI4A 4MJ8A 4B12A 2IL4A 2BSWA 3BLNA 1L0CA 5EC4A 2YNEA 2ARHA 2JLMA 3IWEA 4RS2A 3IGRA 4UFWA 1N71A 5HH1A 2R1IA 3D2MA 1KUXA 2P0WA 1J4JA 1YVOA 1M4DA 3T90A 2FXFA 2FT0A 3A9LA 4HNWB 4JD6A 3C26A 4B11A 1Z4RA 2G3AA 5FVJA 3CXSA 5F47A 4KOUA 2B58A 4NCZA 1P0HA 2VI7A 4QUSA 4HNYB 3CXPA 3ZZIA 3TOBA 1S3ZA 4PK2A 4MY0A 4YRHA 2ZXVA 3FRMA 3GKRA 3OWCA 1BO4A 4Q36A 4CAEA 3PGPA 3ZJ0A 1IYLA 2R7HA 4AVCA 5H84A 5CNPA 4H89A 2I79A 3PZJA 1TIQA 4YGOA 4HNXB 3TO6A 2B5GA 4MY3A 2AE6A 4CGOA 4L89A 2PQ8A 4KSFA 2ZPAA 4ZBGA 4XPKA 3IWGA 4A31A 3EY5A 4UA3A 3LODA 4B14A 4U9ZA 4CAXA 4KUBA 2B3VA 4HKFA 5C88A 4UWJA 4KZTA 3UY5A 3R95A 5AG7A 4CYQA 4LUAA 4R9MA 1Y9KA 2OZHA 3TE4A 2OZGA 4UCNA 2Z3OA 5GCNA 2FCKA 4M3SA 5G1ZA 3TT2A 3BJ8A 4UWIA 1FY7A 2I00A 4JXQA 4KVXA 4IF5A 3G8WA 4MFKA 2JDCA 2BUEA 3T9YA 5JQ4A 2B4DA 4Y49C 1CJWA 4NF1A 4B5PB 2X7BA 4I49A 4CGMA 3S6KA 2OH1A 3B8GA 4AG9A 5EBVA 4F0XA 2NMTA 4CYPA 2BL1A 1UFHA 4MFLA 1IB1E 2WSAA 4PV6A 1S7FA 2R8VA 2DPTA 3EXNA 4EVYA 4KOYA 4NXYA 4C2YA 1IICA 1XIXA 3E0KA 4KOVA 4JJXA 3LD2A 1CM0A 4F6AA 4R57A 3P2FA 2OU2A 4OAEA 4MHDA 3TO7A 4KLVA 1S7NA 2Y0MA 2Z0ZA 4CS0B 4AVBA 4E2AA 1YX0A 4II9A 2RC4A 2PC1A 1BOBA 2CNTA 3WR7A 3DR8A 1Q2DA 5KTCA 3VWDA 4C68A 3JTKA 4PK3A 4R87A 3FNCA 2FIAA 2VBQA 2P6FA 1U6MA 3FYNA 2WUUA 3R9FA 2H5MA 2Q7BA 1QSOA 1VHSA 3R1KA 3BJ7A 1MJBA 2QMLA 2FIWA 2C27A 1IYKA 1NE9A 3N7ZA 2DPSA 1S5KA 4RI1A 3VWEA 1WWZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EVN A;  4QBJ A;  1S7L A;  4JLY A;  4NSQ A;  5JPH A;  1SQH A;  2BEI A;  2DXQ A;  3FXT A;  4OLL A;  4KVM E;  1KUY A;  2PR1 A;  1I1D A;  2ZW7 A;  3SHP A;  3DDD A;  4CAW A;  4E8O A;  5H86 A;  4KLW A;  3QB8 A;  2ZW5 A;  2PR8 A;  1S60 A;  2R98 A;  2HQY A;  2Z11 A;  2VXK A;  1XEB A;  1V0C A;  4LX9 A;  5DWM A;  3TO9 A;  3R9E A;  1XE4 A;  4H6U A;  3TFY A;  4UBR A;  1YR0 A;  1XMT A;  3DR6 A;  4XPD B;  4CRZ B;  4PSW A;  1B6B A;  3TTH A;  1M1D A;  2P6G A;  4KOS A;  4XNH B;  2FE7 A;  4CRY B;  1P4N A;  1WK4 A;  1I12 A;  3G3S A;  3S6F A;  2EUI A;  2J8N A;  2GE3 A;  5E96 A;  5C82 A;  1NMT A;  3I3G A;  3EC4 A;  1YK3 A;  4QVT A;  5F46 A;  2Q44 A;  3D3S A;  4XNH C;  5I0C A;  4KUA A;  3RYO A;  4PSX A;  4JXR A;  3SXO A;  5HMN A;  3CXQ A;  4B5P A;  2Q04 A;  1PUA A;  2Q4Y A;  4KOW A;  2VZZ A;  3FB3 A;  1LRZ A;  4J3G A;  4FD6 A;  2ZW6 A;  4IUS A;  4DNC A;  2ATR A;  1M44 A;  2D4P A;  1M4G A;  3FIX A;  4B5O A;  3GYA A;  4H6Z A;  4M85 A;  3JUW A;  1Q2Y A;  3GY9 A;  2D4O A;  1Y9W A;  2Q0Y A;  1RO5 A;  5KTD A;  2REE A;  5F49 A;  4F0Y A;  3R9G A;  4KOR A;  1Q2C A;  1MJA A;  2CY2 A;  2O28 A;  3W6X A;  2QIR A;  1QSR A;  3I9S A;  4U9Y A;  2FL4 A;  3KKW A;  2JDD A;  2A4N A;  3TOA A;  4ORF A;  4AG7 A;  2CNM A;  1GHE A;  2FS5 A;  2PRB A;  4U5Y A;  3F5B A;  1IID A;  4FD7 A;  1YLE A;  3PP9 A;  1Z9U A;  5KTA A;  4AB7 A;  2VZY A;  2B5G B;  1MK4 A;  4AVA A;  3S6H A;  5J8C A;  3F0A A;  2HV2 A;  2J8M A;  3QAH A;  3SXN A;  1Z4E A;  2VEZ A;  5F48 A;  5IX3 A;  4KVO E;  2PDO A;  4FD5 A;  3P2H A;  5IB0 A;  4QC6 A;  4JWP A;  3K9U A;  4XPL A;  1OZP A;  4CAV A;  2QEC A;  2KCW A;  4R3K A;  3D2P A;  4KOX A;  1YVK A;  2B4D B;  2AJ6 A;  2P6E A;  4QB9 A;  1QST A;  3S6G A;  4Y49 B;  4KOT A;  4OAD A;  5J8F A;  5IV0 A;  3W91 A;  1MJ9 A;  2PSW A;  4X5K A;  1QSN A;  3MGD A;  2G3T A;  4GS4 A;  3H4Q A;  1RXT A;  1Y7R A;  3V8I A;  2CNS A;  3F8K A;  1I21 A;  2FSR A;  2F5I A;  2G0B A;  4XPD C;  4L8A A;  1NSL A;  1ON0 A;  3TCV A;  1QSM A;  3D8P A;  3R96 A;  4NEX A;  3DSB A;  5ISV A;  4E0A A;  1S7K A;  3NE7 A;  2REF A;  2Z10 A;  2ZW4 A;  1B87 A;  1R57 A;  1K4J A;  2OZU A;  4MBU A;  4ONU A;  4R3L A;  5DWN A;  4YFJ A;  3EO4 A;  2J8R A;  1KUV A;  3DNS A;  1VKC A;  2WPW A;  2WPX A;  4FD4 A;  2GAN A;  1YGH A;  1KZF A;  2HUZ A;  1M4I A;  1YRE A;  4K30 A;  2VQY A;  3JVN A;  3EFA A;  3W6S A;  2Q4V A;  4BMH A;  3FBU A;  2K5T A;  1XF8 A;  1PU9 A;  2JEV A;  2OB0 A;  2B4B A;  2B3U A;  2GIV A;  4MI4 A;  4MJ8 A;  2IL4 A;  2BSW A;  3BLN A;  1L0C A;  5EC4 A;  2ARH A;  2JLM A;  4RS2 A;  3IGR A;  5HH1 A;  1N71 A;  2R1I A;  3D2M A;  1KUX A;  2P0W A;  1J4J A;  1YVO A;  1M4D A;  3T90 A;  2FXF A;  2FT0 A;  4HNW B;  4JD6 A;  3C26 A;  1Z4R A;  2G3A A;  5FVJ A;  3CXS A;  5F47 A;  4KOU A;  2B58 A;  4NCZ A;  1P0H A;  2VI7 A;  4QUS A;  4HNY B;  3CXP A;  3ZZI A;  3TOB A;  1S3Z A;  4PK2 A;  4MY0 A;  4YRH A;  2ZXV A;  3FRM A;  3GKR A;  3OWC A;  1BO4 A;  3PGP A;  3ZJ0 A;  1IYL A;  2R7H A;  4AVC A;  5H84 A;  5CNP A;  4H89 A;  2I79 A;  3PZJ A;  1TIQ A;  4YGO A;  4HNX B;  3TO6 A;  2B5G A;  4MY3 A;  2AE6 A;  4L89 A;  2PQ8 A;  2ZPA A;  4ZBG A;  4XPK A;  3IWG A;  3EY5 A;  4UA3 A;  3LOD A;  4U9Z A;  4CAX A;  4KUB A;  2B3V A;  4HKF A;  5C88 A;  4UWJ A;  4KZT A;  3UY5 A;  3R95 A;  4LUA A;  4R9M A;  1Y9K A;  2OZH A;  3TE4 A;  2OZG A;  5GCN A;  2FCK A;  4M3S A;  3TT2 A;  3BJ8 A;  4UWI A;  1FY7 A;  2I00 A;  4JXQ A;  4KVX A;  4IF5 A;  3G8W A;  2JDC A;  2BUE A;  3T9Y A;  5JQ4 A;  2B4D A;  4Y49 C;  1CJW A;  4NF1 A;  4B5P B;  2X7B A;  4I49 A;  3S6K A;  2OH1 A;  3B8G A;  4AG9 A;  5EBV A;  2NMT A;  2BL1 A;  1UFH A;  1IB1 E;  4PV6 A;  1S7F A;  2R8V A;  3EXN A;  4EVY A;  4KOY A;  4NXY A;  1IIC A;  1XIX A;  3E0K A;  4KOV A;  4JJX A;  3LD2 A;  1CM0 A;  4F6A A;  4R57 A;  3P2F A;  2OU2 A;  4OAE A;  4MHD A;  3TO7 A;  4KLV A;  1S7N A;  2Y0M A;  2Z0Z A;  4CS0 B;  4AVB A;  4E2A A;  1YX0 A;  4II9 A;  2RC4 A;  2PC1 A;  1BOB A;  2CNT A;  3WR7 A;  3DR8 A;  1Q2D A;  5KTC A;  3VWD A;  4PK3 A;  4R87 A;  3FNC A;  2FIA A;  2VBQ A;  2P6F A;  1U6M A;  3FYN A;  3R9F A;  2H5M A;  2Q7B A;  1QSO A;  1VHS A;  3R1K A;  3BJ7 A;  1MJB A;  2QML A;  2FIW A;  2C27 A;  1IYK A;  1NE9 A;  3N7Z A;  1S5K A;  4RI1 A;  3VWE A;  1WWZ A; 
#chains in the Genus database with same CATH topology
 1XOV A;  2EVN A;  3KQX A;  3RO0 A;  4RN7 A;  3FH4 A;  2YNC C;  4QBJ A;  2QVP A;  1S7L A;  4JLY A;  4NSQ A;  2QJ8 A;  2DEA A;  3NE8 A;  5JPH A;  3MN8 A;  4B6Z A;  1SQH A;  2BEI A;  2DXQ A;  2AFO A;  2RB7 A;  2V8V A;  4MXU A;  3FXT A;  4OLL A;  3CPX A;  2PJ8 A;  4KVM E;  4MFJ A;  1KUY A;  2WYR A;  2PR1 A;  1HEE A;  3K9T A;  4KSA A;  1I1D A;  3B3W A;  5THW A;  2ZW7 A;  4NGQ A;  1VIX A;  3SHP A;  3DDD A;  4CAW A;  4E8O A;  1VGY A;  4OC5 A;  5H86 A;  4KLW A;  3QB8 A;  2PVW A;  3D4U A;  2ZW5 A;  2PR8 A;  1S60 A;  4FBE A;  2R98 A;  3GIU A;  4R7M A;  4R6T A;  4C7H A;  4F9V A;  5AG6 A;  2PRQ A;  2HQY A;  4MFQ A;  2Z11 A;  2EK8 A;  1XEB A;  2VXK A;  3SJF A;  4Z65 A;  1V0C A;  4A32 A;  4LX9 A;  5DWM A;  3TO9 A;  3R9E A;  2PJ0 A;  1XE4 A;  3NA6 A;  4H6U A;  4UIB A;  4A33 A;  4CYN A;  2PJB A;  3WC5 A;  4C7I A;  3TFY A;  4MCP A;  2IJZ A;  2XEF A;  2Z3N A;  4UBR A;  1ZLI A;  1YR0 A;  1XMT A;  3DR6 A;  1X12 A;  4XPD B;  4PSW A;  1B6B A;  4CRZ B;  3TTH A;  4F9U A;  3CPA A;  4Q38 A;  2NSM A;  1M1D A;  4ZGY B;  4JZ0 A;  1Q7L A;  4MHZ A;  2P6G A;  4KOS A;  4XNH B;  5G22 A;  4HPS A;  2OR4 A;  5LYD A;  4P45 A;  5ELY A;  2FE7 A;  4CRY B;  4CGL A;  1P4N A;  4CYO A;  1CBX A;  1WK4 A;  1I12 A;  3G3S A;  3CT9 A;  3S6F A;  2EUI A;  2J8N A;  3FEC A;  2GE3 A;  5E96 A;  5LYI A;  5C82 A;  1NMT A;  2ZEH A;  3BI0 A;  4NJR A;  1AMP A;  1YW6 A;  3PB9 X;  3DGV A;  3V38 A;  3ISX A;  3I3G A;  3EC4 A;  1YK3 A;  4QVT A;  2Z3K A;  3D7H A;  3JRU A;  5F46 A;  3B3V A;  2Q44 A;  2ZEF A;  3D3S A;  3HUV A;  4NJQ A;  4XNH C;  5I0C A;  4KUA A;  3RYO A;  4PSX A;  3WT4 A;  4JXR A;  1ZG7 A;  1ZG8 A;  4X2T A;  3CXQ A;  5AGE A;  3SXO A;  4B5P A;  4C2Z A;  5HMN A;  2Q04 A;  1PUA A;  2Q4Y A;  3FX6 A;  4KOW A;  2VZZ A;  3FB3 A;  4MFP A;  1LRZ A;  4J3G A;  4FD6 A;  3IU2 A;  4A2Z A;  2ZW6 A;  4IUS A;  2PCU A;  3NFZ A;  1Y0R A;  4DNC A;  1DTD A;  2ZOF A;  2D4P A;  1M44 A;  2ATR A;  5F09 A;  2RFH A;  3SJG A;  1M4G A;  3FIX A;  2EO8 A;  4B5O A;  1CG2 A;  3GYA A;  5BWA B;  4H6Z A;  1HDU A;  4M85 A;  4UEF A;  2EBJ A;  2ZEL A;  3JUW A;  1Q2Y A;  3GY9 A;  2D4O A;  1Y9W A;  2Q0Y A;  1RO5 A;  5KTD A;  2REE A;  2PJ2 A;  3H8F A;  4CGN A;  1F2O A;  1FNO A;  4OID A;  5CBM A;  4KS9 A;  5F49 A;  4F0Y A;  3R9G A;  4A30 A;  5K8P A;  4KOR A;  4YU9 A;  1OBR A;  1Q2C A;  2PJ5 A;  4ZY0 A;  1MJA A;  1TKF A;  2CY2 A;  2WZN A;  4ZX9 A;  2O28 A;  3V7Z A;  3W6X A;  2QIR A;  1QSR A;  2Q43 A;  3I9S A;  4MMO A;  2Z3P A;  4U9Y A;  2FL4 A;  3KKW A;  2JDD A;  4B13 A;  3SJX A;  2A4N A;  3TOA A;  4ORF A;  1ARL A;  4AG7 A;  2CNM A;  1GHE A;  2FS5 A;  2PRB A;  3D68 A;  1TKJ A;  4LQG A;  4C2X A;  2C1C A;  2C6P A;  1CPS A;  2PJ3 A;  3IWW A;  4MFZ A;  3D7F A;  4U5Y A;  5AG4 A;  3F5B A;  4LQ6 A;  4P44 A;  1IID A;  4FD7 A;  1YLE A;  3HLP A;  1HDQ A;  4UIA A;  3PP9 A;  2YND A;  4TNU A;  5HXD A;  1CP7 A;  3IU1 A;  5CPA A;  4DUK A;  1Z9U A;  3T8W A;  5KTA A;  4UCP A;  5G20 A;  4AB7 A;  2YNC A;  4IK2 A;  5JH9 A;  4R76 A;  5D8N A;  2XEI A;  2VZY A;  2AFZ A;  3BI1 A;  2B5G B;  2PJ7 A;  3S9N A;  3CDX A;  1KWM A;  5A27 A;  1MK4 A;  4AVA A;  3S6H A;  5J8C A;  3SJE A;  2VL1 A;  4KSI A;  3F0A A;  1XBU A;  2HV2 A;  2J8M A;  3QAH A;  1BAV A;  5G21 A;  3SXN A;  5A28 A;  1Z4E A;  1Z8W A;  2VEZ A;  5F48 A;  5LRG A;  4A95 A;  5IX3 A;  3NH5 A;  1Z8T A;  3NH4 A;  1EE3 P;  4NGS A;  5K8N A;  4KVO E;  2PDO A;  3SI0 A;  4FD5 A;  4ZY2 A;  5I4M A;  4G1P A;  3P2H A;  3PBE A;  1PCA A;  5IB0 A;  2O53 A;  3WC7 A;  2C6G A;  4QC6 A;  4JWP A;  3TOB A;  1ZLH A;  3B3T A;  1TXR A;  3K9U A;  1DE4 C;  3PB8 X;  4XPL A;  5K8M A;  1OZP A;  1GYT A;  4CAV A;  2I3C A;  4BD9 A;  4EME A;  1Z8X A;  4B10 A;  2QEC A;  2KCW A;  4NGR A;  3H5Z A;  2IMO A;  4R3K A;  4P4E A;  3PB4 X;  3D2P A;  4KOX A;  1X10 A;  1YVK A;  1BLL E;  2B4D B;  2AJ6 A;  2J9A A;  2P6E A;  2ZEE A;  3FED A;  2PJ6 A;  2JBJ A;  1ZO0 A;  4QB9 A;  1QST A;  1BPN A;  3S6G A;  3B3S A;  4OC0 A;  4UFV A;  3VH9 A;  6CPA A;  3B7I A;  4MHP A;  4OP4 A;  4BBH A;  4Y49 B;  5HVF A;  4KOT A;  3S9M A;  4OAD A;  4M6H A;  5IV0 A;  3W91 A;  1MJ9 A;  2PSW A;  4X5K A;  2PJ9 A;  5J8F A;  1QSN A;  4EFD A;  2PIY A;  3KI9 A;  3MGD A;  2G3T A;  4GS4 A;  4MHY A;  2CF4 A;  4AXV A;  3H4Q A;  1RXT A;  2GRE A;  1IY7 A;  4NGT A;  4A94 A;  1Y7R A;  2YGW A;  3V8I A;  2CNS A;  3F8K A;  4ZYQ A;  1ARM A;  1I21 A;  2FSR A;  2F5I A;  2G0B A;  3ISZ A;  4XPD C;  4L8A A;  1NSL A;  4M6G A;  1ON0 A;  3TCV A;  2CXA A;  1QSM A;  5HVH A;  4OKO A;  4FAI A;  2Q51 A;  3D8P A;  5AG5 A;  2GU2 A;  4UFX A;  4NEX A;  3R96 A;  3KZW A;  2CTC A;  2GLJ A;  3DSB A;  4WWV A;  3PRT A;  3L2N A;  4CAF A;  5ISV A;  1LFW A;  5JGF A;  2V77 A;  4E0A A;  3FVL A;  1S7K A;  3NE7 A;  3PBB A;  2PE3 A;  2REF A;  4OC1 A;  2Z10 A;  2ZW4 A;  3VAR A;  3D66 A;  1B87 A;  1R57 A;  1K4J A;  2OZU A;  3LMS A;  4MBU A;  4P4I A;  4ONU A;  2Z3L A;  4R3L A;  4W9Y A;  3EO4 A;  3IIB A;  5DWN A;  4CGP A;  4YFJ A;  1JWQ A;  2J8R A;  1KUV A;  3DNS A;  4MCS A;  4DYO A;  1VKC A;  2WPW A;  2WPX A;  4FD4 A;  2QYV A;  2GAN A;  1YGH A;  4M6I A;  1KZF A;  2HUZ A;  2ZED A;  1M4I A;  1YRE A;  4MRI A;  2DF5 A;  4K30 A;  2VQY A;  3JVN A;  3EFA A;  4UCM A;  2Q4V A;  3W6S A;  2Z3M A;  4NGM A;  3IFE A;  3FBU A;  4BMH A;  2K5T A;  3QNV A;  2ZEG A;  1XF8 A;  3B3C A;  2AFM A;  3MRU A;  4A39 A;  1PU9 A;  2JEV A;  1YQE A;  2OB0 A;  2XEJ A;  5LYL A;  2B4B A;  1Y7E A;  3RAM A;  1LCP A;  2B3U A;  3BHX A;  3LWU A;  4O23 A;  1VHE A;  5DS0 A;  2GIV A;  4MI4 A;  1QQ9 A;  4MJ8 A;  2O4H A;  1R3N A;  4NGN A;  4UF4 A;  4B12 A;  3H8E A;  2IL4 A;  2BSW A;  3BLN A;  1L0C A;  4JYW A;  3B35 A;  2CIJ A;  1ELL P;  5EC4 A;  4MCQ A;  1NSA A;  2YNE A;  2ZEN A;  3GLJ A;  4PXD A;  1XJO A;  1BPM A;  2ARH A;  2JLM A;  5LYF A;  1PYT B;  3IWE A;  4RS2 A;  2PJ4 A;  3IGR A;  2POK A;  2ABZ A;  2ZEO A;  1N71 A;  3B2Y A;  4UFW A;  2R1I A;  5HH1 A;  3D2M A;  1CP6 A;  3KHZ A;  3VAT A;  1KUX A;  2P0W A;  1TF8 A;  1J4J A;  1YVO A;  1M4D A;  3N5F A;  5EMI A;  3T90 A;  2AFS A;  2FXF A;  2FT0 A;  2IQ6 A;  3A9L A;  4HNW B;  4JD6 A;  1UWY A;  4FWU A;  4UEE A;  2Q4Z A;  3C26 A;  4B11 A;  1Z4R A;  2G3A A;  5IB9 A;  5FVJ A;  4IAV A;  4PQA A;  3CXS A;  5F47 A;  4KOU A;  4Q7A A;  2B58 A;  2ZEM A;  4NCZ A;  1YSJ A;  1M4L A;  1P0H A;  2V8G A;  2VI7 A;  1H8L A;  2EK9 A;  4HNY B;  4QUS A;  4EWT A;  3CXP A;  3ZZI A;  1VHO A;  1S3Z A;  1F57 A;  3KHX A;  4PK2 A;  3KR4 A;  4MY0 A;  2C6C A;  4H2K A;  4X8I A;  4X3R A;  3D67 A;  4YRH A;  2ZXV A;  3FRM A;  3GKR A;  3OWC A;  2XEG A;  1ZG9 A;  2GLF A;  1IOI A;  1XMB A;  3FJU A;  1BO4 A;  4OC2 A;  4Q36 A;  4CAE A;  3PGP A;  1QMU A;  3ZJ0 A;  3IEH A;  1IYL A;  1IU8 A;  4YWY A;  3PB7 X;  3PEI A;  2ODF A;  1F2P A;  2R7H A;  4AVC A;  3FEE A;  3FF3 A;  2JBK A;  2OOT A;  3K2K A;  5H84 A;  5CNP A;  4H89 A;  3I1U A;  3IJ3 A;  8CPA A;  4TWE A;  2I79 A;  3NH8 A;  1LOK A;  3SI2 A;  3PZJ A;  1TIQ A;  4P10 A;  4YGO A;  1TF9 A;  2BOA A;  2B5G A;  2ANP A;  2AE6 A;  4HNX B;  4MY3 A;  3TO6 A;  5K8O A;  4CGO A;  4L89 A;  2PQ8 A;  2PJA A;  4KSF A;  2ZPA A;  2HC9 A;  4XPK A;  4ZBG A;  3IWG A;  1YW4 A;  4NFR A;  4A31 A;  2PVV A;  1Z2L A;  2F8H A;  4CPA A;  3EY5 A;  4UA3 A;  3LOD A;  4B14 A;  1A2Z A;  4OC4 A;  4U9Z A;  4CAX A;  4P6Y A;  2AFW A;  4KUB A;  2B3V A;  4HKF A;  1ELM P;  5C88 A;  4UWJ A;  4KZT A;  3UY5 A;  3R95 A;  5AG7 A;  4CYQ A;  2BO9 A;  4LUA A;  1Y9K A;  2OZH A;  4R9M A;  7CPA A;  4R8F A;  2OZG A;  4UCN A;  2Z3O A;  5GCN A;  1Y0Y A;  2FCK A;  1JQG A;  3FMC A;  4M3S A;  5G1Z A;  3TT2 A;  3BJ8 A;  4ZI6 A;  4UWI A;  3TX8 A;  3QAY A;  3IC1 A;  3BXM A;  3LAC A;  3S9L A;  1FY7 A;  1LAM A;  4P4J A;  4RUH A;  2I00 A;  4JXQ A;  4KVX A;  4IF5 A;  1IGB A;  1XRY A;  2V8D A;  3CZX A;  3G8W A;  1CX8 A;  2JDC A;  3DLJ A;  2BUE A;  4MFK A;  4MCR A;  3T9Y A;  2FVG A;  3TC8 A;  2B4D A;  4ZY1 A;  5JQ4 A;  4MHN A;  2CTB A;  4Y49 C;  1CJW A;  4OC3 A;  4NF1 A;  3KAS A;  2X7B A;  4B5P B;  3GUX A;  4I49 A;  3KQZ A;  4CGM A;  4PXB A;  3KGQ A;  3S6K A;  2PIZ A;  2OH1 A;  2PJC A;  3B8G A;  4AG9 A;  5EBV A;  3TE4 A;  4F0X A;  2NMT A;  4CYP A;  2BL1 A;  3D7D A;  1UFH A;  4MFL A;  1IB1 E;  2WSA A;  1AYE A;  4PV6 A;  1S7F A;  2AFX A;  2R8V A;  3RZA A;  2DPT A;  3EXN A;  1YLO A;  4EVY A;  4KOY A;  1Z5R A;  4OIW A;  2JEW A;  4NXY A;  2ZOG A;  4C2Y A;  1IIC A;  1XIX A;  3E0K A;  4ONW A;  4P4B A;  3PFO A;  5LRJ A;  5LRK A;  2Q7S A;  4KOV A;  4JJX A;  2BCO A;  1CM0 A;  3LD2 A;  1LAP A;  3H8G A;  1R43 A;  4DJL A;  4F6A A;  4P4D A;  1TKH A;  4PPZ A;  4R57 A;  3P2F A;  2OU2 A;  4OAE A;  4MHD A;  3TO7 A;  2G9D A;  3D7G A;  4IHM A;  1S7N A;  1LAN A;  2Y0M A;  2Z0Z A;  4KLV A;  4ZX8 A;  2HB6 A;  4FUU A;  3PFE A;  2AFU A;  2ZEP A;  4CS0 B;  4AVB A;  4E2A A;  1YX0 A;  3IO1 A;  4II9 A;  4F8Z A;  2RC4 A;  2PJ1 A;  2PC1 A;  1BOB A;  3KL9 A;  2GFQ A;  5HVG A;  2CNT A;  3WR7 A;  4NGP A;  3DR8 A;  1Q2D A;  2F7V A;  3SI1 A;  5KTC A;  4GXH A;  3VWD A;  5JM6 A;  4C68 A;  4PXE A;  2EWB A;  3JTK A;  4PK3 A;  1YME A;  4R87 A;  2NYQ A;  3FNC A;  2FIA A;  4WJB A;  2VBQ A;  2P6F A;  1U6M A;  4A37 A;  3RNZ A;  3FYN A;  2WUU A;  3R9F A;  2H5M A;  1FT7 A;  5J1Q A;  2Q7B A;  3KR5 A;  1IOF A;  1RTQ A;  1QSO A;  2V8H A;  4K3N A;  1VHS A;  4BIN A;  3PB6 X;  4PXC A;  5D29 A;  3GB0 A;  1XFO A;  3BJ7 A;  1AUG A;  1MJB A;  2QML A;  3R1K A;  2FIW A;  4P4F A;  3WAB A;  2C27 A;  1IYK A;  1NE9 A;  1Z8L A;  3N7Z A;  4UEZ A;  4GM5 A;  1CPX A;  4OME A;  3RBU A;  4A38 A;  2DPS A;  1S5K A;  3WC6 A;  4RI1 A;  3VWE A;  1WWZ A; 
#chains in the Genus database with same CATH homology
 2EVN A;  2YNC C;  4QBJ A;  1S7L A;  4JLY A;  4NSQ A;  5JPH A;  1SQH A;  2BEI A;  2DXQ A;  3FXT A;  4OLL A;  4KVM E;  4MFJ A;  1KUY A;  2PR1 A;  4KSA A;  1I1D A;  2ZW7 A;  3SHP A;  3DDD A;  4CAW A;  4E8O A;  5H86 A;  4KLW A;  3QB8 A;  2ZW5 A;  2PR8 A;  1S60 A;  2R98 A;  4C7H A;  5AG6 A;  2HQY A;  4MFQ A;  2Z11 A;  2VXK A;  1XEB A;  1V0C A;  4A32 A;  4LX9 A;  5DWM A;  3TO9 A;  3R9E A;  1XE4 A;  4H6U A;  4A33 A;  4CYN A;  4C7I A;  3TFY A;  2Z3N A;  4UBR A;  1YR0 A;  1XMT A;  3DR6 A;  4XPD B;  4CRZ B;  4PSW A;  1B6B A;  3TTH A;  4Q38 A;  1M1D A;  4ZGY B;  2P6G A;  4KOS A;  4XNH B;  5G22 A;  2FE7 A;  4CRY B;  4CGL A;  1P4N A;  4CYO A;  1WK4 A;  1I12 A;  3G3S A;  3S6F A;  2EUI A;  2J8N A;  2GE3 A;  5E96 A;  5C82 A;  1NMT A;  3I3G A;  3EC4 A;  1YK3 A;  4QVT A;  2Z3K A;  5F46 A;  2Q44 A;  3D3S A;  4XNH C;  5I0C A;  4KUA A;  3RYO A;  4PSX A;  4JXR A;  3SXO A;  5AGE A;  3CXQ A;  4C2Z A;  4B5P A;  5HMN A;  2Q04 A;  1PUA A;  2Q4Y A;  4KOW A;  2VZZ A;  3FB3 A;  4MFP A;  1LRZ A;  4J3G A;  4FD6 A;  3IU2 A;  4A2Z A;  2ZW6 A;  4IUS A;  4DNC A;  2ATR A;  1M44 A;  2D4P A;  1M4G A;  3FIX A;  4B5O A;  3GYA A;  5BWA B;  4H6Z A;  4M85 A;  3JUW A;  1Q2Y A;  3GY9 A;  2D4O A;  1Y9W A;  2Q0Y A;  1RO5 A;  5KTD A;  2REE A;  4CGN A;  4KS9 A;  5F49 A;  4F0Y A;  3R9G A;  4A30 A;  4KOR A;  1Q2C A;  1MJA A;  2CY2 A;  2O28 A;  3W6X A;  2QIR A;  1QSR A;  3I9S A;  2Z3P A;  4U9Y A;  2FL4 A;  3KKW A;  2JDD A;  4B13 A;  2A4N A;  3TOA A;  4ORF A;  4AG7 A;  2CNM A;  1GHE A;  2FS5 A;  2PRB A;  4C2X A;  4MFZ A;  4U5Y A;  5AG4 A;  3F5B A;  1IID A;  4FD7 A;  1YLE A;  3PP9 A;  2YND A;  3IU1 A;  1Z9U A;  5KTA A;  4UCP A;  5G20 A;  4AB7 A;  2YNC A;  2VZY A;  2B5G B;  5A27 A;  1MK4 A;  4AVA A;  3S6H A;  5J8C A;  3F0A A;  2HV2 A;  2J8M A;  3QAH A;  5G21 A;  3SXN A;  5A28 A;  1Z4E A;  2VEZ A;  5F48 A;  4A95 A;  5IX3 A;  4KVO E;  2PDO A;  4FD5 A;  3P2H A;  5IB0 A;  4QC6 A;  4JWP A;  3K9U A;  4XPL A;  1OZP A;  4CAV A;  4B10 A;  2QEC A;  2KCW A;  4R3K A;  3H5Z A;  3D2P A;  4KOX A;  1YVK A;  2B4D B;  2AJ6 A;  2P6E A;  1ZO0 A;  4QB9 A;  1QST A;  3S6G A;  4UFV A;  4BBH A;  4Y49 B;  4KOT A;  4OAD A;  5J8F A;  5IV0 A;  3W91 A;  1MJ9 A;  2PSW A;  4X5K A;  1QSN A;  3MGD A;  2G3T A;  4GS4 A;  3H4Q A;  1RXT A;  2YGW A;  1Y7R A;  3V8I A;  2CNS A;  3F8K A;  1I21 A;  2FSR A;  2F5I A;  2G0B A;  4XPD C;  4L8A A;  1NSL A;  1ON0 A;  3TCV A;  2CXA A;  1QSM A;  5AG5 A;  3D8P A;  4UFX A;  4NEX A;  3R96 A;  3DSB A;  5ISV A;  4CAF A;  4E0A A;  1S7K A;  3NE7 A;  2REF A;  2Z10 A;  2ZW4 A;  1B87 A;  1R57 A;  1K4J A;  2OZU A;  4MBU A;  4ONU A;  2Z3L A;  4R3L A;  5DWN A;  3EO4 A;  4CGP A;  4YFJ A;  2J8R A;  1KUV A;  3DNS A;  1VKC A;  2WPW A;  2WPX A;  4FD4 A;  2GAN A;  1YGH A;  1KZF A;  2HUZ A;  1M4I A;  1YRE A;  4K30 A;  2VQY A;  3JVN A;  3EFA A;  4UCM A;  2Q4V A;  3W6S A;  2Z3M A;  4BMH A;  3FBU A;  2K5T A;  1XF8 A;  1PU9 A;  2JEV A;  2OB0 A;  2B4B A;  2B3U A;  2GIV A;  4MI4 A;  4MJ8 A;  4B12 A;  2IL4 A;  2BSW A;  3BLN A;  1L0C A;  5EC4 A;  2YNE A;  2ARH A;  2JLM A;  3IWE A;  4RS2 A;  3IGR A;  4UFW A;  1N71 A;  5HH1 A;  2R1I A;  3D2M A;  1KUX A;  2P0W A;  1J4J A;  1YVO A;  1M4D A;  3T90 A;  2FXF A;  2FT0 A;  3A9L A;  4HNW B;  4JD6 A;  3C26 A;  4B11 A;  1Z4R A;  2G3A A;  5FVJ A;  3CXS A;  5F47 A;  4KOU A;  2B58 A;  4NCZ A;  1P0H A;  2VI7 A;  4QUS A;  4HNY B;  3CXP A;  3ZZI A;  3TOB A;  1S3Z A;  4PK2 A;  4MY0 A;  4YRH A;  2ZXV A;  3FRM A;  3GKR A;  3OWC A;  1BO4 A;  4Q36 A;  4CAE A;  3PGP A;  3ZJ0 A;  1IYL A;  2R7H A;  4AVC A;  5H84 A;  5CNP A;  4H89 A;  2I79 A;  3PZJ A;  1TIQ A;  4YGO A;  4HNX B;  3TO6 A;  2B5G A;  4MY3 A;  2AE6 A;  4CGO A;  4L89 A;  2PQ8 A;  4KSF A;  2ZPA A;  4ZBG A;  4XPK A;  3IWG A;  4A31 A;  3EY5 A;  4UA3 A;  3LOD A;  4B14 A;  4U9Z A;  4CAX A;  4KUB A;  2B3V A;  4HKF A;  5C88 A;  4UWJ A;  4KZT A;  3UY5 A;  3R95 A;  5AG7 A;  4CYQ A;  4LUA A;  4R9M A;  1Y9K A;  2OZH A;  3TE4 A;  2OZG A;  4UCN A;  2Z3O A;  5GCN A;  2FCK A;  4M3S A;  5G1Z A;  3TT2 A;  3BJ8 A;  4UWI A;  1FY7 A;  2I00 A;  4JXQ A;  4KVX A;  4IF5 A;  3G8W A;  4MFK A;  2JDC A;  2BUE A;  3T9Y A;  5JQ4 A;  2B4D A;  4Y49 C;  1CJW A;  4NF1 A;  4B5P B;  2X7B A;  4I49 A;  4CGM A;  3S6K A;  2OH1 A;  3B8G A;  4AG9 A;  5EBV A;  4F0X A;  2NMT A;  4CYP A;  2BL1 A;  1UFH A;  4MFL A;  1IB1 E;  2WSA A;  4PV6 A;  1S7F A;  2R8V A;  2DPT A;  3EXN A;  4EVY A;  4KOY A;  4NXY A;  4C2Y A;  1IIC A;  1XIX A;  3E0K A;  4KOV A;  4JJX A;  3LD2 A;  1CM0 A;  4F6A A;  4R57 A;  3P2F A;  2OU2 A;  4OAE A;  4MHD A;  3TO7 A;  4KLV A;  1S7N A;  2Y0M A;  2Z0Z A;  4CS0 B;  4AVB A;  4E2A A;  1YX0 A;  4II9 A;  2RC4 A;  2PC1 A;  1BOB A;  2CNT A;  3WR7 A;  3DR8 A;  1Q2D A;  5KTC A;  3VWD A;  4C68 A;  3JTK A;  4PK3 A;  4R87 A;  3FNC A;  2FIA A;  2VBQ A;  2P6F A;  1U6M A;  3FYN A;  2WUU A;  3R9F A;  2H5M A;  2Q7B A;  1QSO A;  1VHS A;  3R1K A;  3BJ7 A;  1MJB A;  2QML A;  2FIW A;  2C27 A;  1IYK A;  1NE9 A;  3N7Z A;  2DPS A;  1S5K A;  4RI1 A;  3VWE A;  1WWZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...