1Z4RA

Human gcn5 acetyltransferase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
163
structure length
163
Chain Sequence
SGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a binary complex between human GCN5 histone acetyltransferase domain and acetyl coenzyme A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords General control of amino acid synthesis protein 5-like 2
total genus 43
structure length 163
sequence length 163
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1z4rA00
5EBVA 5E96A 3FNCA 3B8GA 3R9GA 4QBJA 3D3SA 3F5BA 4KOVA 3SXNA 1CJWA 5F47A 3SHPA 2ZW5A 3MGDA 4HKFA 2VBQA 3D2MA 1GHEA 4MI4A 1KZFA 4L8AA 4B5PA 1MJ9A 1Q2CA 2B4BA 3R9FA 4KZTA 1S5KA 2Q44A 5J8FA 1NSLA 4PSXA 2Z0ZA 2GE3A 2B5GB 2VI7A 2ZW4A 4F6AA 3E0KA 1YX0A 1V0CA 2FCKA 3BJ7A 3TOBA 3FB3A 4M3SA 2QECA 3CXSA 1L0CA 5EC4A 4MBUA 1NMTA 4PK2A 5F46A 1MJAA 3SXOA 3EY5A 2OU2A 2CY2A 4KOUA 3IGRA 4IUSA 4YFJA 1Y9WA 4AG9A 4CS0B 3PGPA 1S3ZA 2D4OA 2B3UA 1P4NA 4ORFA 3S6HA 5KTCA 4CRYB 3DNSA 1IIDA 1SQHA 3BLNA 4LUAA 3TE4A 1J4JA 2X7BA 3R96A 2BUEA 3T90A 2NMTA 5H84A 3W91A 4NXYA 1MK4A 3ZZIA 4B5PB 4JWPA 2C27A 2IL4A 3TOAA 4H89A 2P6EA 3GKRA 2JEVA 4KORA 4JD6A 2HV2A 2B5GA 2Z11A 2EVNA 1IYKA 2H5MA 4JLYA 1QSRA 2OH1A 2A4NA 2Y0MA 2D4PA 1YLEA 4GS4A 1S7KA 4E0AA 2J8MA 2GANA 1I12A 2BL1A 1B6BA 3S6FA 3FBUA 1KUYA 2PDOA 3R95A 3G8WA 2F5IA 3IWGA 4JXRA 4FD7A 2VQYA 2VZYA 4CRZB 4CAWA 3GY9A 3UY5A 4H6UA 2JDCA 4UWIA 4OAEA 4E8OA 2Q4VA 5H86A 1IICA 4KOYA 4XPDC 4Y49C 1QSNA 4R57A 4MJ8A 4QUSA 4KLVA 4UA3A 2FIWA 2RC4A 2Q7BA 2ZW7A 3EC4A 2EUIA 1R57A 3DR6A 3OWCA 2P6FA 2B3VA 1XF8A 1M4DA 4PSWA 2KCWA 2REEA 5F49A 1QSMA 4YGOA 1WK4A 4NCZA 4MY3A 4AVBA 3C26A 1S7LA 4U9ZA 1PU9A 2DXQA 2Z10A 4X5KA 2PQ8A 3JUWA 4XPKA 3EXNA 4KVXA 3DSBA 3N7ZA 4U9YA 1BO4A 3QB8A 5FVJA 3D2PA 5JQ4A 3FRMA 3BJ8A 4QVTA 3EFAA 4OADA 4RS2A 3V8IA 3FXTA 3PP9A 2AJ6A 3FIXA 1LRZA 3FYNA 2R98A 2FS5A 2B58A 2ZW6A 1MJBA 2FE7A 5GCNA 3R9EA 3TCVA 4F0YA 4FD6A 4HNXB 2FL4A 3TFYA 1RO5A 4K30A 3JVNA 4DNCA 1OZPA 3LODA 2R1IA 5DWMA 4FD4A 4JJXA 1WWZA 3PZJA 4HNWB 5IB0A 3TO7A 4KOTA 2BSWA 2P0WA 3CXQA 1M4IA 3T9YA 2WPXA 2ZXVA 1VHSA 1Q2YA 4I49A 2Q4YA 3K9UA 5I0CA 3LD2A 4M85A 4RI1A 3VWEA 3GYAA 2OZHA 1UFHA 1B87A 3DDDA 3DR8A 2PC1A 1YK3A 3S6GA 1KUXA 1BOBA 4XPLA 1M44A 2JLMA 1N71A 2J8RA 2PR8A 5C82A 4LX9A 1Y7RA 5DWNA 5JPHA 3W6XA 1FY7A 1IB1E 3S6KA 3TTHA 2OZUA 2CNMA 2FIAA 4ONUA 4PK3A 1ON0A 2VEZA 2B4DB 2CNTA 5CNPA 2I00A 1KUVA 1I21A 2G3AA 1Z9UA 4NSQA 4PV6A 2PR1A 4KLWA 5IX3A 4EVYA 1QSOA 1YVKA 4R87A 4XNHB 1QSTA 2O28A 2VXKA 1XEBA 2OZGA 2Q04A 2JDDA 1IYLA 2CNSA 4AB7A 2P6GA 3F8KA 2G3TA 2PRBA 4OLLA 3TO9A 5KTAA 4U5YA 1VKCA 3P2FA 4NF1A 3G3SA 4KOXA 4L89A 2ZPAA 2PSWA 1NE9A 4UBRA 4QB9A 1TIQA 5ISVA 2ATRA 3TO6A 1S60A 1S7FA 3VWDA 4AVAA 1S7NA 1P0HA 4B5OA 2R7HA 3KKWA 2QMLA 3I3GA 3CXPA 4R9MA 4NEXA 5IV0A 1I1DA 1Z4RA 3D8PA 4R3LA 5C88A 2BEIA 1M1DA 2HUZA 2B4DA 4BMHA 3TT2A 4R3KA 4KOSA 2REFA 4KUAA 3WR7A 4UWJA 1CM0A 1XE4A 1YREA 1PUAA 3I9SA 2FSRA 5KTDA 2ARHA 5HH1A 4H6ZA 2R8VA 4CAVA 5J8CA 3NE7A 1Q2DA 1U6MA 4ZBGA 2AE6A 5HMNA 4KOWA 2QIRA 2I79A 4KUBA 4IF5A 4XNHC 4E2AA 2FXFA 4FD5A 3ZJ0A 4KVME 4CAXA 3F0AA 3EO4A 4XPDB 4Y49B 2Q0YA 4QC6A 2VZZA 2OB0A 4YRHA 3H4QA 4AVCA 2J8NA 1M4GA 3W6SA 1YGHA 1XIXA 4II9A 2GIVA 4MHDA 3QAHA 4J3GA 3RYOA 1YR0A 4AG7A 1YVOA 2G0BA 4JXQA 4MY0A 2K5TA 2FT0A 1RXTA 1Z4EA 2WPWA 2HQYA 1XMTA 1Y9KA 3R1KA 4KVOE 5F48A 3P2HA 4HNYB 1K4JA
chains in the Genus database with same CATH superfamily
5EBVA 5E96A 4P10A 3ISXA 3FNCA 4A30A 3B8GA 4KSAA 4NGRA 3R9GA 4QBJA 2BO9A 3D3SA 3F5BA 1ZG8A 4KOVA 3S9MA 3SXNA 3BXMA 1CJWA 5F47A 4DJLA 3PB4X 3SHPA 5AG5A 2ZW5A 3MGDA 4HKFA 2EK9A 2VBQA 3D2MA 1GHEA 3PEIA 4MI4A 5AG4A 4OIWA 1KZFA 2DEAA 4L8AA 2V8HA 2JBKA 4B5PA 1MJ9A 1Q2CA 2B4BA 1AYEA 4WWVA 3CDXA 3R9FA 4KZTA 1S5KA 2XEJA 5EMIA 2Q44A 4YWYA 3GUXA 3PB6X 2CTCA 4C2YA 5J8FA 5LYLA 4PXBA 4ZI6A 1M4LA 3PFEA 1NSLA 1QMUA 1X10A 4PSXA 2Z0ZA 2GE3A 2B5GB 2VI7A 2ZW4A 4F6AA 3E0KA 3WC7A 1XRYA 2OOTA 4PXDA 4BBHA 1YX0A 1V0CA 4P4IA 2FCKA 2C6CA 3BJ7A 3TOBA 3FB3A 5CBMA 2IQ6A 4M3SA 1DE4C 2QECA 2WUUA 4W9YA 2ABZA 3CXSA 1L0CA 5EC4A 2ZELA 3VH9A 3LWUA 4MBUA 1NMTA 2VL1A 3KR4A 1ARMA 4MMOA 4PK2A 4Q36A 5F46A 5G21A 1MJAA 3SXOA 4TWEA 1ZO0A 3EY5A 4A31A 1Z8LA 2OU2A 3WC5A 3RBUA 3FH4A 3WT4A 1VIXA 2CY2A 4KOUA 4CGLA 4UFWA 4IAVA 1TXRA 3IGRA 4IUSA 1Y7EA 4AXVA 2V77A 1Y9WA 4AG9A 1Q7LA 4CS0B 4YFJA 3PGPA 1RTQA 1S3ZA 2ZEPA 2D4OA 4CYQA 2B3UA 1P4NA 3KHXA 2ZEOA 3PFOA 4ORFA 3S6HA 5KTCA 2PJ8A 4MFKA 4CRYB 3DNSA 1IIDA 1SQHA 2POKA 4NJQA 3BLNA 4UFXA 4LUAA 3IEHA 1TKFA 2OR4A 1J4JA 3TE4A 4IK2A 5LRJA 4ZY0A 2X7BA 4ONWA 3R96A 2BUEA 3T90A 2NMTA 4A95A 2AFUA 3PB7X 1AMPA 4FUUA 1IY7A 3IJ3A 4HPSA 5H84A 3W91A 4NXYA 1MK4A 3ZZIA 5A28A 4MCRA 5AG7A 2GLFA 3NE8A 2FVGA 4B5PB 1LANA 4JWPA 2C27A 4F8ZA 2IL4A 3TOAA 4NGTA 4C68A 5A27A 5DS0A 3GIUA 4H89A 3S9LA 2C6PA 2EO8A 2P6EA 4B12A 3GKRA 4R76A 2JEVA 2ZEGA 4KORA 4JD6A 1Z8XA 2HV2A 5D8NA 2B5GA 1Z8TA 2Z11A 2EVNA 3QNVA 4CGOA 4YU9A 2V8VA 2EBJA 3B3TA 4UF4A 1IYKA 2H5MA 5IB9A 4JLYA 4C7IA 4NGPA 1HEEA 2IMOA 4H2KA 1ZLIA 1QSRA 1ZG7A 3D4UA 3SJXA 4OC5A 2OH1A 4FAIA 1VHEA 3KGQA 2A4NA 4UCPA 4ZYQA 2Y0MA 2D4PA 3D7HA 1YLEA 2HB6A 5BWAB 4GS4A 4MXUA 4DUKA 1S7KA 4E0AA 2GREA 3PBEA 4MFPA 4NGNA 2J8MA 4CAEA 1KWMA 2GANA 1I12A 3NA6A 4RN7A 1ELMP 3NH8A 2BL1A 1B6BA 3S6FA 5CPAA 3B35A 1ZG9A 8CPAA 4UIBA 3FBUA 4CGPA 1KUYA 3DGVA 5AG6A 1UWYA 2PDOA 4GM5A 3R95A 2AFOA 4GXHA 4NGSA 5LYIA 3G8WA 2F5IA 3V7ZA 4OC4A 3IWGA 4JXRA 5LRGA 4FD7A 2VQYA 4FWUA 2VZYA 3HLPA 3RO0A 2JEWA 3BI1A 2PJ7A 4CRZB 1GYTA 4CAWA 3GY9A 3IWEA 4OC1A 3UY5A 4H6UA 2JDCA 4UWIA 2Q43A 4OAEA 4E8OA 2Q4VA 5H86A 3V38A 1IICA 4KOYA 4XPDC 4Y49C 1QSNA 4R57A 4UEFA 2EK8A 4MJ8A 4QUSA 4KLVA 1ARLA 4P4FA 2FIWA 2RC4A 4P4EA 1XJOA 4UA3A 2PJ9A 2Q7BA 4A94A 2ZW7A 1A2ZA 3EC4A 3D7DA 4NGQA 2EUIA 1R57A 1TKHA 4JZ0A 4M6GA 4P6YA 3B3CA 2PJCA 5ISVA 3DR6A 3OWCA 2P6FA 2O4HA 2B3VA 3B3SA 1XF8A 1M4DA 3D7FA 4MCQA 2KCWA 4PSWA 3SI2A 2GFQA 1CP6A 5HVHA 4DYOA 2REEA 3SJFA 5F49A 2CXAA 1QSMA 4YGOA 3SJGA 1WK4A 2WSAA 4NCZA 4MY3A 2PJ4A 3VATA 2EWBA 2XEFA 3C26A 4AVBA 4ZGYB 1S7LA 4U9ZA 1PU9A 2DXQA 4LQGA 2Z10A 2GLJA 5JM6A 4X5KA 2PQ8A 3JUWA 4XPKA 3FVLA 1XMBA 3EXNA 2WZNA 3WABA 2F8HA 4Q38A 2Q7SA 4KVXA 4C7HA 2F7VA 3DSBA 4P44A 4OKOA 3N7ZA 4C2XA 4A38A 4U9YA 2RFHA 5JGFA 2JBJA 5J1QA 1BO4A 3QB8A 5FVJA 3D2PA 3KHZA 3KASA 2QVPA 5JQ4A 3FRMA 3SI0A 2Q4ZA 3KI9A 5LYFA 2Z3PA 4P4JA 4B11A 3BJ8A 1TF9A 4ZY2A 4OC2A 4QVTA 3JTKA 3EFAA 4OADA 4RS2A 4UEZA 1TKJA 3V8IA 3FXTA 2PJAA 3FX6A 3PP9A 4MHYA 3IU1A 4MFQA 2AJ6A 3IO1A 3DLJA 3FIXA 1LRZA 2BOAA 3FYNA 2R98A 2ANPA 4MHPA 2PVVA 5K8PA 3B2YA 2FS5A 1Z5RA 1X12A 2B58A 2XEGA 2ZW6A 5G20A 1MJBA 1NSAA 1VGYA 2FE7A 3KR5A 3PB9X 5GCNA 3R9EA 3TCVA 4F0YA 4FD6A 4IHMA 4OC3A 2PIZA 3BI0A 4HNXB 2Z3MA 1BLLE 1BPNA 3IIBA 2FL4A 3NFZA 5ELYA 1BAVA 4F9UA 2PIYA 2ZEMA 4NFRA 3TFYA 1RO5A 4K30A 3JVNA 2Z3KA 4G1PA 4DNCA 2O53A 3FMCA 2NYQA 2RB7A 5JH9A 1OZPA 3NH5A 3LODA 4B6ZA 1CP7A 1LCPA 4MFJA 1Z8WA 2R1IA 3B3WA 2IJZA 5DWMA 4FD4A 4R6TA 1IU8A 4JJXA 5LRKA 1WWZA 3PZJA 3CPXA 4UCNA 1OBRA 1LAPA 4UIAA 4HNWB 3FEDA 4MFLA 3RNZA 4B14A 5IB0A 5HXDA 2ZENA 3TO7A 1YLOA 4CYNA 1AUGA 3H5ZA 4KOTA 2BSWA 2DPTA 2P0WA 4MHNA 1BPMA 4MRIA 3SI1A 3CXQA 4K3NA 1M4IA 3IFEA 3T8WA 3T9YA 2PCUA 2WPXA 2ZXVA 3CT9A 1CBXA 1VHSA 1CX8A 4F0XA 1Q2YA 4I49A 2Q4YA 3FJUA 3K9UA 3MRUA 5I0CA 2AFZA 4OMEA 3H8EA 3JRUA 3LD2A 4P45A 2V8GA 4M85A 4R8FA 1DTDA 4RI1A 4BINA 2PJ5A 3PB8X 3VWEA 3D7GA 3GYAA 1XFOA 2PJ2A 5G1ZA 2OZHA 1UFHA 4PXEA 1B87A 4EWTA 1XBUA 3DDDA 5D29A 3DR8A 1YW6A 2DF5A 2PC1A 3B3VA 3S9NA 3GLJA 5AGEA 2PJ1A 5K8NA 4WJBA 3IC1A 1YK3A 3S6GA 1KUXA 1BOBA 4XPLA 1HDQA 3D67A 2YGWA 1M44A 3MN8A 2YNCA 4PQAA 2JLMA 4A32A 4A39A 2DPSA 1N71A 3GB0A 2J8RA 4PXCA 2PR8A 1ELLP 2ZOFA 5C82A 5HVGA 4LX9A 2YNDA 3IU2A 1Y7RA 4OC0A 5DWNA 5JPHA 3W6XA 1FY7A 2CF4A 1VHOA 3FF3A 4B13A 1F2PA 1IB1E 2YNCC 3S6KA 3TTHA 2ODFA 2OZUA 2CNMA 3H8GA 4NGMA 2GU2A 5LYDA 4X3RA 4CGMA 2FIAA 1R43A 4KSIA 4ONUA 5THWA 1Y0RA 1ON0A 2VEZA 4PK3A 2B4DB 2CNTA 5CNPA 2I00A 1KUVA 4CYPA 1I21A 1Y0YA 2G3AA 4CYOA 1Z9UA 3PBBA 1XOVA 3CPAA 2PR1A 4NSQA 4KLWA 4PV6A 5IX3A 4KS9A 1LAMA 2Z3NA 4EVYA 2Q51A 2ZEEA 1JWQA 1QSOA 3TX8A 6CPAA 1YVKA 4R87A 2PJ6A 1ZLHA 4XNHB 1QSTA 3RAMA 2O28A 2VXKA 2XEIA 3RZAA 1XEBA 4PPZA 2OZGA 2Q04A 4P4DA 2JDDA 1IYLA 2QYVA 2ZEHA 2CNSA 4AB7A 1FT7A 2P6GA 3N5FA 3F8KA 2G3TA 2PRBA 3L2NA 4OLLA 3TO9A 4EMEA 3FECA 5KTAA 4U5YA 1VKCA 3P2FA 7CPAA 4MHZA 4NF1A 3G3SA 4KOXA 4ZY1A 4L89A 4B10A 4X2TA 2ZPAA 2PSWA 4UEEA 5HVFA 4BD9A 4NJRA 1NE9A 4UBRA 4QB9A 1YW4A 1TIQA 4CAFA 4FBEA 4A2ZA 2ATRA 2I3CA 2QJ8A 2YNEA 2ZEFA 2ZEDA 1YSJA 3D66A 3TO6A 4EFDA 1F2OA 1S60A 2CIJA 1IOIA 2PE3A 1S7FA 3VWDA 4C2ZA 4OIDA 3SJEA 2PRQA 4AVAA 1CPXA 2AFMA 1S7NA 1P0HA 3KZWA 3NH4A 4B5OA 2R7HA 4R7MA 2V8DA 3KKWA 2QMLA 3I3GA 3KL9A 1IOFA 4JYWA 3CXPA 4R9MA 1FNOA 2HC9A 4NEXA 5K8OA 5IV0A 1I1DA 1Z4RA 4KSFA 4A37A 2AFWA 3D8PA 4R3LA 5G22A 3BHXA 1CPSA 2BEIA 5C88A 1M1DA 4P4BA 1YQEA 2HUZA 2B4DA 4BMHA 3TT2A 3QAYA 4R3KA 2AFXA 4KOSA 3ISZA 2C6GA 2REFA 2PJ3A 1R3NA 4KUAA 5K8MA 3WR7A 3KQZA 1CM0A 1LOKA 2CTBA 3A9LA 4M6HA 4UWJA 1XE4A 1YREA 1PUAA 3I9SA 5F09A 2FSRA 5KTDA 3PRTA 4M6IA 1QQ9A 3H8FA 2NSMA 2ARHA 1TF8A 3CZXA 3HUVA 5HH1A 3I1UA 3KQXA 4H6ZA 4MFZA 2R8VA 1HDUA 4CAVA 2G9DA 3NE7A 1Q2DA 1LFWA 4LQ6A 5J8CA 3LMSA 4CPAA 1U6MA 1H8LA 4OP4A 3K2KA 4ZBGA 2AE6A 5HMNA 2BCOA 4KOWA 3IWWA 2Z3LA 2QIRA 4O23A 2J9AA 3FEEA 1JQGA 4CGNA 5I4MA 2I79A 2C1CA 1F57A 2PVWA 4A33A 3LACA 4X8IA 4KUBA 4IF5A 4XNHC 4E2AA 2FXFA 4Q7AA 4FD5A 3ZJ0A 4KVME 2WYRA 4CAXA 3F0AA 4TNUA 4UCMA 3EO4A 3B7IA 1PYTB 4XPDB 4Y49B 2Q0YA 4QC6A 1Z2LA 2VZZA 2OB0A 4YRHA 2AFSA 2ZOGA 3H4QA 4AVCA 2J8NA 2PJBA 1M4GA 3W6SA 1YGHA 1XIXA 4II9A 2GIVA 4MHDA 3QAHA 4J3GA 3RYOA 4ZX8A 4RUHA 1YR0A 4AG7A 1YVOA 1IGBA 2G0BA 1EE3P 4MCPA 4Z65A 2PJ0A 4JXQA 1PCAA 4MCSA 3K9TA 2K5TA 4MY0A 2FT0A 2Z3OA 1RXTA 1Z4EA 2WPWA 3D68A 2HQYA 4F9VA 1XMTA 1Y9KA 4ZX9A 3R1KA 3VARA 4KVOE 5F48A 3P2HA 1CG2A 3TC8A 4UFVA 4HNYB 1YMEA 3WC6A 1K4JA
chains in the Genus database with same CATH topology
5EBVA 5E96A 3FNCA 4A30A 3B8GA 4KSAA 3R9GA 4QBJA 3D3SA 3F5BA 4KOVA 3SXNA 1CJWA 5F47A 3SHPA 5AG5A 2ZW5A 3MGDA 4HKFA 2VBQA 3D2MA 5AG4A 1GHEA 4MI4A 1KZFA 4L8AA 4B5PA 1MJ9A 1Q2CA 2B4BA 3R9FA 4KZTA 1S5KA 2Q44A 4C2YA 5J8FA 1NSLA 4PSXA 2Z0ZA 2GE3A 2B5GB 2VI7A 2ZW4A 4F6AA 3E0KA 4BBHA 1YX0A 1V0CA 2FCKA 3BJ7A 3TOBA 3FB3A 4M3SA 2QECA 2WUUA 3CXSA 1L0CA 5EC4A 4MBUA 1NMTA 4PK2A 4Q36A 5F46A 5G21A 1MJAA 3SXOA 1ZO0A 3EY5A 4A31A 2OU2A 2CY2A 4KOUA 4CGLA 4UFWA 3IGRA 4IUSA 4YFJA 1Y9WA 4AG9A 4CS0B 3PGPA 1S3ZA 2D4OA 4CYQA 2B3UA 1P4NA 4ORFA 3S6HA 5KTCA 4CRYB 4MFKA 3DNSA 1IIDA 1SQHA 3BLNA 4UFXA 4LUAA 3TE4A 1J4JA 2X7BA 3R96A 2BUEA 3T90A 2NMTA 4A95A 5H84A 3W91A 4NXYA 1MK4A 3ZZIA 5A28A 5AG7A 4B5PB 4JWPA 2C27A 2IL4A 3TOAA 4C68A 5A27A 4H89A 2P6EA 4B12A 3GKRA 2JEVA 4KORA 4JD6A 2HV2A 2B5GA 2Z11A 2EVNA 4CGOA 1IYKA 2H5MA 4JLYA 4C7IA 1QSRA 2OH1A 2A4NA 4UCPA 2Y0MA 2D4PA 1YLEA 5BWAB 4GS4A 1S7KA 4E0AA 4MFPA 4CAEA 2J8MA 2GANA 1I12A 2BL1A 1B6BA 3S6FA 3FBUA 4CGPA 1KUYA 5AG6A 2PDOA 3R95A 3G8WA 2F5IA 3IWGA 4JXRA 4FD7A 2VQYA 2VZYA 4CRZB 4CAWA 3GY9A 3IWEA 3UY5A 4H6UA 2JDCA 4UWIA 4OAEA 4E8OA 2Q4VA 5H86A 1IICA 4KOYA 4XPDC 4Y49C 1QSNA 4R57A 4MJ8A 4QUSA 4KLVA 4UA3A 2FIWA 2RC4A 2Q7BA 2ZW7A 3EC4A 2EUIA 1R57A 3DR6A 3OWCA 2P6FA 2B3VA 1XF8A 1M4DA 4PSWA 2KCWA 2REEA 5F49A 2CXAA 1QSMA 4YGOA 1WK4A 2WSAA 4NCZA 4MY3A 4AVBA 3C26A 4ZGYB 1S7LA 4U9ZA 1PU9A 2DXQA 2Z10A 4X5KA 2PQ8A 3JUWA 4XPKA 3EXNA 4Q38A 4KVXA 4C7HA 3DSBA 4C2XA 3N7ZA 4U9YA 1BO4A 3QB8A 5FVJA 3D2PA 5JQ4A 3FRMA 2Z3PA 4B11A 3BJ8A 4QVTA 3JTKA 3EFAA 4OADA 4RS2A 3V8IA 3FXTA 3PP9A 3IU1A 4MFQA 2AJ6A 3FIXA 1LRZA 3FYNA 2R98A 2FS5A 2B58A 2ZW6A 5G20A 1MJBA 2FE7A 5GCNA 3R9EA 3TCVA 4F0YA 4FD6A 4HNXB 2Z3MA 2FL4A 3TFYA 1RO5A 4K30A 3JVNA 2Z3KA 4DNCA 1OZPA 3LODA 4MFJA 2R1IA 5DWMA 4FD4A 4JJXA 1WWZA 3PZJA 4UCNA 4HNWB 4B14A 4MFLA 5IB0A 3TO7A 4CYNA 3H5ZA 4KOTA 2BSWA 2DPTA 2P0WA 3CXQA 1M4IA 3T9YA 2WPXA 2ZXVA 1VHSA 4F0XA 1Q2YA 4I49A 2Q4YA 3K9UA 5I0CA 3LD2A 4M85A 4RI1A 3VWEA 3GYAA 5G1ZA 2OZHA 1UFHA 1B87A 3DDDA 3DR8A 2PC1A 5AGEA 1YK3A 3S6GA 1KUXA 1BOBA 4XPLA 2YGWA 1M44A 2YNCA 2JLMA 4A32A 2DPSA 1N71A 2J8RA 2PR8A 5C82A 4LX9A 2YNDA 3IU2A 1Y7RA 5DWNA 5JPHA 3W6XA 1FY7A 4B13A 1IB1E 2YNCC 3S6KA 3TTHA 2OZUA 2CNMA 4CGMA 2FIAA 4ONUA 1ON0A 2VEZA 4PK3A 2B4DB 2CNTA 5CNPA 2I00A 1KUVA 4CYPA 1I21A 2G3AA 4CYOA 1Z9UA 4NSQA 4PV6A 2PR1A 4KLWA 5IX3A 4KS9A 2Z3NA 4EVYA 1QSOA 1YVKA 4R87A 4XNHB 1QSTA 2O28A 2VXKA 1XEBA 2OZGA 2Q04A 2JDDA 1IYLA 2CNSA 4AB7A 2P6GA 3F8KA 2G3TA 2PRBA 4OLLA 3TO9A 5KTAA 4U5YA 1VKCA 3P2FA 4NF1A 3G3SA 4KOXA 4L89A 4B10A 2ZPAA 2PSWA 1NE9A 4UBRA 4QB9A 1TIQA 4CAFA 4A2ZA 2ATRA 2YNEA 5ISVA 3TO6A 1S60A 1S7FA 3VWDA 4C2ZA 4AVAA 1S7NA 1P0HA 4B5OA 2R7HA 3KKWA 2QMLA 3I3GA 3CXPA 4R9MA 4NEXA 5IV0A 1I1DA 1Z4RA 4KSFA 3D8PA 4R3LA 5G22A 5C88A 2BEIA 1M1DA 2HUZA 2B4DA 4BMHA 3TT2A 4R3KA 4KOSA 2REFA 4KUAA 3WR7A 4UWJA 1CM0A 3A9LA 1XE4A 1YREA 1PUAA 3I9SA 2FSRA 5KTDA 2ARHA 5HH1A 4H6ZA 4MFZA 2R8VA 4CAVA 5J8CA 3NE7A 1Q2DA 1U6MA 4ZBGA 2AE6A 5HMNA 4KOWA 2Z3LA 2QIRA 4CGNA 2I79A 4A33A 4KUBA 4IF5A 4XNHC 4E2AA 2FXFA 4FD5A 3ZJ0A 4KVME 4CAXA 3F0AA 4UCMA 3EO4A 4XPDB 4Y49B 2Q0YA 4QC6A 2VZZA 2OB0A 4YRHA 3H4QA 4AVCA 2J8NA 1M4GA 3W6SA 1YGHA 1XIXA 4II9A 2GIVA 4MHDA 3QAHA 4J3GA 3RYOA 1YR0A 4AG7A 1YVOA 2G0BA 4JXQA 2K5TA 4MY0A 2FT0A 2Z3OA 1RXTA 1Z4EA 2WPWA 2HQYA 1XMTA 1Y9KA 3R1KA 4KVOE 5F48A 3P2HA 4UFVA 4HNYB 1K4JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EBV A;  5E96 A;  3FNC A;  3B8G A;  3R9G A;  4QBJ A;  3D3S A;  3F5B A;  4KOV A;  3SXN A;  1CJW A;  5F47 A;  3SHP A;  2ZW5 A;  3MGD A;  4HKF A;  2VBQ A;  3D2M A;  1GHE A;  4MI4 A;  1KZF A;  4L8A A;  4B5P A;  1MJ9 A;  1Q2C A;  2B4B A;  3R9F A;  4KZT A;  1S5K A;  2Q44 A;  5J8F A;  1NSL A;  4PSX A;  2Z0Z A;  2GE3 A;  2B5G B;  2VI7 A;  2ZW4 A;  4F6A A;  3E0K A;  1YX0 A;  1V0C A;  2FCK A;  3BJ7 A;  3TOB A;  3FB3 A;  4M3S A;  2QEC A;  3CXS A;  1L0C A;  5EC4 A;  4MBU A;  1NMT A;  4PK2 A;  5F46 A;  1MJA A;  3SXO A;  3EY5 A;  2OU2 A;  2CY2 A;  4KOU A;  3IGR A;  4IUS A;  4YFJ A;  1Y9W A;  4AG9 A;  4CS0 B;  3PGP A;  1S3Z A;  2D4O A;  2B3U A;  1P4N A;  4ORF A;  3S6H A;  5KTC A;  4CRY B;  3DNS A;  1IID A;  1SQH A;  3BLN A;  4LUA A;  3TE4 A;  1J4J A;  2X7B A;  3R96 A;  2BUE A;  3T90 A;  2NMT A;  5H84 A;  3W91 A;  4NXY A;  1MK4 A;  3ZZI A;  4B5P B;  4JWP A;  2C27 A;  2IL4 A;  3TOA A;  4H89 A;  2P6E A;  3GKR A;  2JEV A;  4KOR A;  4JD6 A;  2HV2 A;  2B5G A;  2Z11 A;  2EVN A;  1IYK A;  2H5M A;  4JLY A;  1QSR A;  2OH1 A;  2A4N A;  2Y0M A;  2D4P A;  1YLE A;  4GS4 A;  1S7K A;  4E0A A;  2J8M A;  2GAN A;  1I12 A;  2BL1 A;  1B6B A;  3S6F A;  3FBU A;  1KUY A;  2PDO A;  3R95 A;  3G8W A;  2F5I A;  3IWG A;  4JXR A;  4FD7 A;  2VQY A;  2VZY A;  4CRZ B;  4CAW A;  3GY9 A;  3UY5 A;  4H6U A;  2JDC A;  4UWI A;  4OAE A;  4E8O A;  2Q4V A;  5H86 A;  1IIC A;  4KOY A;  4XPD C;  4Y49 C;  1QSN A;  4R57 A;  4MJ8 A;  4QUS A;  4KLV A;  4UA3 A;  2FIW A;  2RC4 A;  2Q7B A;  2ZW7 A;  3EC4 A;  2EUI A;  1R57 A;  3DR6 A;  3OWC A;  2P6F A;  2B3V A;  1XF8 A;  1M4D A;  4PSW A;  2KCW A;  2REE A;  5F49 A;  1QSM A;  4YGO A;  1WK4 A;  4NCZ A;  4MY3 A;  4AVB A;  3C26 A;  1S7L A;  4U9Z A;  1PU9 A;  2DXQ A;  2Z10 A;  4X5K A;  2PQ8 A;  3JUW A;  4XPK A;  3EXN A;  4KVX A;  3DSB A;  3N7Z A;  4U9Y A;  1BO4 A;  3QB8 A;  5FVJ A;  3D2P A;  5JQ4 A;  3FRM A;  3BJ8 A;  4QVT A;  3EFA A;  4OAD A;  4RS2 A;  3V8I A;  3FXT A;  3PP9 A;  2AJ6 A;  3FIX A;  1LRZ A;  3FYN A;  2R98 A;  2FS5 A;  2B58 A;  2ZW6 A;  1MJB A;  2FE7 A;  5GCN A;  3R9E A;  3TCV A;  4F0Y A;  4FD6 A;  4HNX B;  2FL4 A;  3TFY A;  1RO5 A;  4K30 A;  3JVN A;  4DNC A;  1OZP A;  3LOD A;  2R1I A;  5DWM A;  4FD4 A;  4JJX A;  1WWZ A;  3PZJ A;  4HNW B;  5IB0 A;  3TO7 A;  4KOT A;  2BSW A;  2P0W A;  3CXQ A;  1M4I A;  3T9Y A;  2WPX A;  2ZXV A;  1VHS A;  1Q2Y A;  4I49 A;  2Q4Y A;  3K9U A;  5I0C A;  3LD2 A;  4M85 A;  4RI1 A;  3VWE A;  3GYA A;  2OZH A;  1UFH A;  1B87 A;  3DDD A;  3DR8 A;  2PC1 A;  1YK3 A;  3S6G A;  1KUX A;  1BOB A;  4XPL A;  1M44 A;  2JLM A;  1N71 A;  2J8R A;  2PR8 A;  5C82 A;  4LX9 A;  1Y7R A;  5DWN A;  5JPH A;  3W6X A;  1FY7 A;  1IB1 E;  3S6K A;  3TTH A;  2OZU A;  2CNM A;  2FIA A;  4ONU A;  4PK3 A;  1ON0 A;  2VEZ A;  2B4D B;  2CNT A;  5CNP A;  2I00 A;  1KUV A;  1I21 A;  2G3A A;  1Z9U A;  4NSQ A;  4PV6 A;  2PR1 A;  4KLW A;  5IX3 A;  4EVY A;  1QSO A;  1YVK A;  4R87 A;  4XNH B;  1QST A;  2O28 A;  2VXK A;  1XEB A;  2OZG A;  2Q04 A;  2JDD A;  1IYL A;  2CNS A;  4AB7 A;  2P6G A;  3F8K A;  2G3T A;  2PRB A;  4OLL A;  3TO9 A;  5KTA A;  4U5Y A;  1VKC A;  3P2F A;  4NF1 A;  3G3S A;  4KOX A;  4L89 A;  2ZPA A;  2PSW A;  1NE9 A;  4UBR A;  4QB9 A;  1TIQ A;  5ISV A;  2ATR A;  3TO6 A;  1S60 A;  1S7F A;  3VWD A;  4AVA A;  1S7N A;  1P0H A;  4B5O A;  2R7H A;  3KKW A;  2QML A;  3I3G A;  3CXP A;  4R9M A;  4NEX A;  5IV0 A;  1I1D A;  1Z4R A;  3D8P A;  4R3L A;  5C88 A;  2BEI A;  1M1D A;  2HUZ A;  2B4D A;  4BMH A;  3TT2 A;  4R3K A;  4KOS A;  2REF A;  4KUA A;  3WR7 A;  4UWJ A;  1CM0 A;  1XE4 A;  1YRE A;  1PUA A;  3I9S A;  2FSR A;  5KTD A;  2ARH A;  5HH1 A;  4H6Z A;  2R8V A;  4CAV A;  5J8C A;  3NE7 A;  1Q2D A;  1U6M A;  4ZBG A;  2AE6 A;  5HMN A;  4KOW A;  2QIR A;  2I79 A;  4KUB A;  4IF5 A;  4XNH C;  4E2A A;  2FXF A;  4FD5 A;  3ZJ0 A;  4KVM E;  4CAX A;  3F0A A;  3EO4 A;  4XPD B;  4Y49 B;  2Q0Y A;  4QC6 A;  2VZZ A;  2OB0 A;  4YRH A;  3H4Q A;  4AVC A;  2J8N A;  1M4G A;  3W6S A;  1YGH A;  1XIX A;  4II9 A;  2GIV A;  4MHD A;  3QAH A;  4J3G A;  3RYO A;  1YR0 A;  4AG7 A;  1YVO A;  2G0B A;  4JXQ A;  4MY0 A;  2K5T A;  2FT0 A;  1RXT A;  1Z4E A;  2WPW A;  2HQY A;  1XMT A;  1Y9K A;  3R1K A;  4KVO E;  5F48 A;  3P2H A;  4HNY B;  1K4J A; 
#chains in the Genus database with same CATH topology
 5EBV A;  5E96 A;  4P10 A;  3ISX A;  3FNC A;  4A30 A;  3B8G A;  4KSA A;  4NGR A;  3R9G A;  4QBJ A;  2BO9 A;  3D3S A;  3F5B A;  1ZG8 A;  4KOV A;  3S9M A;  3SXN A;  3BXM A;  1CJW A;  5F47 A;  4DJL A;  3PB4 X;  3SHP A;  5AG5 A;  2ZW5 A;  3MGD A;  4HKF A;  2EK9 A;  2VBQ A;  3D2M A;  1GHE A;  3PEI A;  4MI4 A;  5AG4 A;  4OIW A;  1KZF A;  2DEA A;  4L8A A;  2V8H A;  2JBK A;  4B5P A;  1MJ9 A;  1Q2C A;  2B4B A;  1AYE A;  4WWV A;  3CDX A;  3R9F A;  4KZT A;  1S5K A;  2XEJ A;  5EMI A;  2Q44 A;  4YWY A;  3GUX A;  3PB6 X;  2CTC A;  4C2Y A;  5J8F A;  5LYL A;  4PXB A;  4ZI6 A;  1M4L A;  3PFE A;  1NSL A;  1QMU A;  1X10 A;  4PSX A;  2Z0Z A;  2GE3 A;  2B5G B;  2VI7 A;  2ZW4 A;  4F6A A;  3E0K A;  3WC7 A;  1XRY A;  2OOT A;  4PXD A;  4BBH A;  1YX0 A;  1V0C A;  4P4I A;  2FCK A;  2C6C A;  3BJ7 A;  3TOB A;  3FB3 A;  5CBM A;  2IQ6 A;  4M3S A;  1DE4 C;  2QEC A;  2WUU A;  4W9Y A;  2ABZ A;  3CXS A;  1L0C A;  5EC4 A;  2ZEL A;  3VH9 A;  3LWU A;  4MBU A;  1NMT A;  2VL1 A;  3KR4 A;  1ARM A;  4MMO A;  4PK2 A;  4Q36 A;  5F46 A;  5G21 A;  1MJA A;  3SXO A;  4TWE A;  1ZO0 A;  3EY5 A;  4A31 A;  1Z8L A;  2OU2 A;  3WC5 A;  3RBU A;  3FH4 A;  3WT4 A;  1VIX A;  2CY2 A;  4KOU A;  4CGL A;  4UFW A;  4IAV A;  1TXR A;  3IGR A;  4IUS A;  1Y7E A;  4AXV A;  2V77 A;  1Y9W A;  4AG9 A;  1Q7L A;  4CS0 B;  4YFJ A;  3PGP A;  1RTQ A;  1S3Z A;  2ZEP A;  2D4O A;  4CYQ A;  2B3U A;  1P4N A;  3KHX A;  2ZEO A;  3PFO A;  4ORF A;  3S6H A;  5KTC A;  2PJ8 A;  4MFK A;  4CRY B;  3DNS A;  1IID A;  1SQH A;  2POK A;  4NJQ A;  3BLN A;  4UFX A;  4LUA A;  3IEH A;  1TKF A;  2OR4 A;  1J4J A;  3TE4 A;  4IK2 A;  5LRJ A;  4ZY0 A;  2X7B A;  4ONW A;  3R96 A;  2BUE A;  3T90 A;  2NMT A;  4A95 A;  2AFU A;  3PB7 X;  1AMP A;  4FUU A;  1IY7 A;  3IJ3 A;  4HPS A;  5H84 A;  3W91 A;  4NXY A;  1MK4 A;  3ZZI A;  5A28 A;  4MCR A;  5AG7 A;  2GLF A;  3NE8 A;  2FVG A;  4B5P B;  1LAN A;  4JWP A;  2C27 A;  4F8Z A;  2IL4 A;  3TOA A;  4NGT A;  4C68 A;  5A27 A;  5DS0 A;  3GIU A;  4H89 A;  3S9L A;  2C6P A;  2EO8 A;  2P6E A;  4B12 A;  3GKR A;  4R76 A;  2JEV A;  2ZEG A;  4KOR A;  4JD6 A;  1Z8X A;  2HV2 A;  5D8N A;  2B5G A;  1Z8T A;  2Z11 A;  2EVN A;  3QNV A;  4CGO A;  4YU9 A;  2V8V A;  2EBJ A;  3B3T A;  4UF4 A;  1IYK A;  2H5M A;  5IB9 A;  4JLY A;  4C7I A;  4NGP A;  1HEE A;  2IMO A;  4H2K A;  1ZLI A;  1QSR A;  1ZG7 A;  3D4U A;  3SJX A;  4OC5 A;  2OH1 A;  4FAI A;  1VHE A;  3KGQ A;  2A4N A;  4UCP A;  4ZYQ A;  2Y0M A;  2D4P A;  3D7H A;  1YLE A;  2HB6 A;  5BWA B;  4GS4 A;  4MXU A;  4DUK A;  1S7K A;  4E0A A;  2GRE A;  3PBE A;  4MFP A;  4NGN A;  2J8M A;  4CAE A;  1KWM A;  2GAN A;  1I12 A;  3NA6 A;  4RN7 A;  1ELM P;  3NH8 A;  2BL1 A;  1B6B A;  3S6F A;  5CPA A;  3B35 A;  1ZG9 A;  8CPA A;  4UIB A;  3FBU A;  4CGP A;  1KUY A;  3DGV A;  5AG6 A;  1UWY A;  2PDO A;  4GM5 A;  3R95 A;  2AFO A;  4GXH A;  4NGS A;  5LYI A;  3G8W A;  2F5I A;  3V7Z A;  4OC4 A;  3IWG A;  4JXR A;  5LRG A;  4FD7 A;  2VQY A;  4FWU A;  2VZY A;  3HLP A;  3RO0 A;  2JEW A;  3BI1 A;  2PJ7 A;  4CRZ B;  1GYT A;  4CAW A;  3GY9 A;  3IWE A;  4OC1 A;  3UY5 A;  4H6U A;  2JDC A;  4UWI A;  2Q43 A;  4OAE A;  4E8O A;  2Q4V A;  5H86 A;  3V38 A;  1IIC A;  4KOY A;  4XPD C;  4Y49 C;  1QSN A;  4R57 A;  4UEF A;  2EK8 A;  4MJ8 A;  4QUS A;  4KLV A;  1ARL A;  4P4F A;  2FIW A;  2RC4 A;  4P4E A;  1XJO A;  4UA3 A;  2PJ9 A;  2Q7B A;  4A94 A;  2ZW7 A;  1A2Z A;  3EC4 A;  3D7D A;  4NGQ A;  2EUI A;  1R57 A;  1TKH A;  4JZ0 A;  4M6G A;  4P6Y A;  3B3C A;  2PJC A;  5ISV A;  3DR6 A;  3OWC A;  2P6F A;  2O4H A;  2B3V A;  3B3S A;  1XF8 A;  1M4D A;  3D7F A;  4MCQ A;  2KCW A;  4PSW A;  3SI2 A;  2GFQ A;  1CP6 A;  5HVH A;  4DYO A;  2REE A;  3SJF A;  5F49 A;  2CXA A;  1QSM A;  4YGO A;  3SJG A;  1WK4 A;  2WSA A;  4NCZ A;  4MY3 A;  2PJ4 A;  3VAT A;  2EWB A;  2XEF A;  3C26 A;  4AVB A;  4ZGY B;  1S7L A;  4U9Z A;  1PU9 A;  2DXQ A;  4LQG A;  2Z10 A;  2GLJ A;  5JM6 A;  4X5K A;  2PQ8 A;  3JUW A;  4XPK A;  3FVL A;  1XMB A;  3EXN A;  2WZN A;  3WAB A;  2F8H A;  4Q38 A;  2Q7S A;  4KVX A;  4C7H A;  2F7V A;  3DSB A;  4P44 A;  4OKO A;  3N7Z A;  4C2X A;  4A38 A;  4U9Y A;  2RFH A;  5JGF A;  2JBJ A;  5J1Q A;  1BO4 A;  3QB8 A;  5FVJ A;  3D2P A;  3KHZ A;  3KAS A;  2QVP A;  5JQ4 A;  3FRM A;  3SI0 A;  2Q4Z A;  3KI9 A;  5LYF A;  2Z3P A;  4P4J A;  4B11 A;  3BJ8 A;  1TF9 A;  4ZY2 A;  4OC2 A;  4QVT A;  3JTK A;  3EFA A;  4OAD A;  4RS2 A;  4UEZ A;  1TKJ A;  3V8I A;  3FXT A;  2PJA A;  3FX6 A;  3PP9 A;  4MHY A;  3IU1 A;  4MFQ A;  2AJ6 A;  3IO1 A;  3DLJ A;  3FIX A;  1LRZ A;  2BOA A;  3FYN A;  2R98 A;  2ANP A;  4MHP A;  2PVV A;  5K8P A;  3B2Y A;  2FS5 A;  1Z5R A;  1X12 A;  2B58 A;  2XEG A;  2ZW6 A;  5G20 A;  1MJB A;  1NSA A;  1VGY A;  2FE7 A;  3KR5 A;  3PB9 X;  5GCN A;  3R9E A;  3TCV A;  4F0Y A;  4FD6 A;  4IHM A;  4OC3 A;  2PIZ A;  3BI0 A;  4HNX B;  2Z3M A;  1BLL E;  1BPN A;  3IIB A;  2FL4 A;  3NFZ A;  5ELY A;  1BAV A;  4F9U A;  2PIY A;  2ZEM A;  4NFR A;  3TFY A;  1RO5 A;  4K30 A;  3JVN A;  2Z3K A;  4G1P A;  4DNC A;  2O53 A;  3FMC A;  2NYQ A;  2RB7 A;  5JH9 A;  1OZP A;  3NH5 A;  3LOD A;  4B6Z A;  1CP7 A;  1LCP A;  4MFJ A;  1Z8W A;  2R1I A;  3B3W A;  2IJZ A;  5DWM A;  4FD4 A;  4R6T A;  1IU8 A;  4JJX A;  5LRK A;  1WWZ A;  3PZJ A;  3CPX A;  4UCN A;  1OBR A;  1LAP A;  4UIA A;  4HNW B;  3FED A;  4MFL A;  3RNZ A;  4B14 A;  5IB0 A;  5HXD A;  2ZEN A;  3TO7 A;  1YLO A;  4CYN A;  1AUG A;  3H5Z A;  4KOT A;  2BSW A;  2DPT A;  2P0W A;  4MHN A;  1BPM A;  4MRI A;  3SI1 A;  3CXQ A;  4K3N A;  1M4I A;  3IFE A;  3T8W A;  3T9Y A;  2PCU A;  2WPX A;  2ZXV A;  3CT9 A;  1CBX A;  1VHS A;  1CX8 A;  4F0X A;  1Q2Y A;  4I49 A;  2Q4Y A;  3FJU A;  3K9U A;  3MRU A;  5I0C A;  2AFZ A;  4OME A;  3H8E A;  3JRU A;  3LD2 A;  4P45 A;  2V8G A;  4M85 A;  4R8F A;  1DTD A;  4RI1 A;  4BIN A;  2PJ5 A;  3PB8 X;  3VWE A;  3D7G A;  3GYA A;  1XFO A;  2PJ2 A;  5G1Z A;  2OZH A;  1UFH A;  4PXE A;  1B87 A;  4EWT A;  1XBU A;  3DDD A;  5D29 A;  3DR8 A;  1YW6 A;  2DF5 A;  2PC1 A;  3B3V A;  3S9N A;  3GLJ A;  5AGE A;  2PJ1 A;  5K8N A;  4WJB A;  3IC1 A;  1YK3 A;  3S6G A;  1KUX A;  1BOB A;  4XPL A;  1HDQ A;  3D67 A;  2YGW A;  1M44 A;  3MN8 A;  2YNC A;  4PQA A;  2JLM A;  4A32 A;  4A39 A;  2DPS A;  1N71 A;  3GB0 A;  2J8R A;  4PXC A;  2PR8 A;  1ELL P;  2ZOF A;  5C82 A;  5HVG A;  4LX9 A;  2YND A;  3IU2 A;  1Y7R A;  4OC0 A;  5DWN A;  5JPH A;  3W6X A;  1FY7 A;  2CF4 A;  1VHO A;  3FF3 A;  4B13 A;  1F2P A;  1IB1 E;  2YNC C;  3S6K A;  3TTH A;  2ODF A;  2OZU A;  2CNM A;  3H8G A;  4NGM A;  2GU2 A;  5LYD A;  4X3R A;  4CGM A;  2FIA A;  1R43 A;  4KSI A;  4ONU A;  5THW A;  1Y0R A;  1ON0 A;  2VEZ A;  4PK3 A;  2B4D B;  2CNT A;  5CNP A;  2I00 A;  1KUV A;  4CYP A;  1I21 A;  1Y0Y A;  2G3A A;  4CYO A;  1Z9U A;  3PBB A;  1XOV A;  3CPA A;  2PR1 A;  4NSQ A;  4KLW A;  4PV6 A;  5IX3 A;  4KS9 A;  1LAM A;  2Z3N A;  4EVY A;  2Q51 A;  2ZEE A;  1JWQ A;  1QSO A;  3TX8 A;  6CPA A;  1YVK A;  4R87 A;  2PJ6 A;  1ZLH A;  4XNH B;  1QST A;  3RAM A;  2O28 A;  2VXK A;  2XEI A;  3RZA A;  1XEB A;  4PPZ A;  2OZG A;  2Q04 A;  4P4D A;  2JDD A;  1IYL A;  2QYV A;  2ZEH A;  2CNS A;  4AB7 A;  1FT7 A;  2P6G A;  3N5F A;  3F8K A;  2G3T A;  2PRB A;  3L2N A;  4OLL A;  3TO9 A;  4EME A;  3FEC A;  5KTA A;  4U5Y A;  1VKC A;  3P2F A;  7CPA A;  4MHZ A;  4NF1 A;  3G3S A;  4KOX A;  4ZY1 A;  4L89 A;  4B10 A;  4X2T A;  2ZPA A;  2PSW A;  4UEE A;  5HVF A;  4BD9 A;  4NJR A;  1NE9 A;  4UBR A;  4QB9 A;  1YW4 A;  1TIQ A;  4CAF A;  4FBE A;  4A2Z A;  2ATR A;  2I3C A;  2QJ8 A;  2YNE A;  2ZEF A;  2ZED A;  1YSJ A;  3D66 A;  3TO6 A;  4EFD A;  1F2O A;  1S60 A;  2CIJ A;  1IOI A;  2PE3 A;  1S7F A;  3VWD A;  4C2Z A;  4OID A;  3SJE A;  2PRQ A;  4AVA A;  1CPX A;  2AFM A;  1S7N A;  1P0H A;  3KZW A;  3NH4 A;  4B5O A;  2R7H A;  4R7M A;  2V8D A;  3KKW A;  2QML A;  3I3G A;  3KL9 A;  1IOF A;  4JYW A;  3CXP A;  4R9M A;  1FNO A;  2HC9 A;  4NEX A;  5K8O A;  5IV0 A;  1I1D A;  1Z4R A;  4KSF A;  4A37 A;  2AFW A;  3D8P A;  4R3L A;  5G22 A;  3BHX A;  1CPS A;  2BEI A;  5C88 A;  1M1D A;  4P4B A;  1YQE A;  2HUZ A;  2B4D A;  4BMH A;  3TT2 A;  3QAY A;  4R3K A;  2AFX A;  4KOS A;  3ISZ A;  2C6G A;  2REF A;  2PJ3 A;  1R3N A;  4KUA A;  5K8M A;  3WR7 A;  3KQZ A;  1CM0 A;  1LOK A;  2CTB A;  3A9L A;  4M6H A;  4UWJ A;  1XE4 A;  1YRE A;  1PUA A;  3I9S A;  5F09 A;  2FSR A;  5KTD A;  3PRT A;  4M6I A;  1QQ9 A;  3H8F A;  2NSM A;  2ARH A;  1TF8 A;  3CZX A;  3HUV A;  5HH1 A;  3I1U A;  3KQX A;  4H6Z A;  4MFZ A;  2R8V A;  1HDU A;  4CAV A;  2G9D A;  3NE7 A;  1Q2D A;  1LFW A;  4LQ6 A;  5J8C A;  3LMS A;  4CPA A;  1U6M A;  1H8L A;  4OP4 A;  3K2K A;  4ZBG A;  2AE6 A;  5HMN A;  2BCO A;  4KOW A;  3IWW A;  2Z3L A;  2QIR A;  4O23 A;  2J9A A;  3FEE A;  1JQG A;  4CGN A;  5I4M A;  2I79 A;  2C1C A;  1F57 A;  2PVW A;  4A33 A;  3LAC A;  4X8I A;  4KUB A;  4IF5 A;  4XNH C;  4E2A A;  2FXF A;  4Q7A A;  4FD5 A;  3ZJ0 A;  4KVM E;  2WYR A;  4CAX A;  3F0A A;  4TNU A;  4UCM A;  3EO4 A;  3B7I A;  1PYT B;  4XPD B;  4Y49 B;  2Q0Y A;  4QC6 A;  1Z2L A;  2VZZ A;  2OB0 A;  4YRH A;  2AFS A;  2ZOG A;  3H4Q A;  4AVC A;  2J8N A;  2PJB A;  1M4G A;  3W6S A;  1YGH A;  1XIX A;  4II9 A;  2GIV A;  4MHD A;  3QAH A;  4J3G A;  3RYO A;  4ZX8 A;  4RUH A;  1YR0 A;  4AG7 A;  1YVO A;  1IGB A;  2G0B A;  1EE3 P;  4MCP A;  4Z65 A;  2PJ0 A;  4JXQ A;  1PCA A;  4MCS A;  3K9T A;  2K5T A;  4MY0 A;  2FT0 A;  2Z3O A;  1RXT A;  1Z4E A;  2WPW A;  3D68 A;  2HQY A;  4F9V A;  1XMT A;  1Y9K A;  4ZX9 A;  3R1K A;  3VAR A;  4KVO E;  5F48 A;  3P2H A;  1CG2 A;  3TC8 A;  4UFV A;  4HNY B;  1YME A;  3WC6 A;  1K4J A; 
#chains in the Genus database with same CATH homology
 5EBV A;  5E96 A;  3FNC A;  4A30 A;  3B8G A;  4KSA A;  3R9G A;  4QBJ A;  3D3S A;  3F5B A;  4KOV A;  3SXN A;  1CJW A;  5F47 A;  3SHP A;  5AG5 A;  2ZW5 A;  3MGD A;  4HKF A;  2VBQ A;  3D2M A;  5AG4 A;  1GHE A;  4MI4 A;  1KZF A;  4L8A A;  4B5P A;  1MJ9 A;  1Q2C A;  2B4B A;  3R9F A;  4KZT A;  1S5K A;  2Q44 A;  4C2Y A;  5J8F A;  1NSL A;  4PSX A;  2Z0Z A;  2GE3 A;  2B5G B;  2VI7 A;  2ZW4 A;  4F6A A;  3E0K A;  4BBH A;  1YX0 A;  1V0C A;  2FCK A;  3BJ7 A;  3TOB A;  3FB3 A;  4M3S A;  2QEC A;  2WUU A;  3CXS A;  1L0C A;  5EC4 A;  4MBU A;  1NMT A;  4PK2 A;  4Q36 A;  5F46 A;  5G21 A;  1MJA A;  3SXO A;  1ZO0 A;  3EY5 A;  4A31 A;  2OU2 A;  2CY2 A;  4KOU A;  4CGL A;  4UFW A;  3IGR A;  4IUS A;  4YFJ A;  1Y9W A;  4AG9 A;  4CS0 B;  3PGP A;  1S3Z A;  2D4O A;  4CYQ A;  2B3U A;  1P4N A;  4ORF A;  3S6H A;  5KTC A;  4CRY B;  4MFK A;  3DNS A;  1IID A;  1SQH A;  3BLN A;  4UFX A;  4LUA A;  3TE4 A;  1J4J A;  2X7B A;  3R96 A;  2BUE A;  3T90 A;  2NMT A;  4A95 A;  5H84 A;  3W91 A;  4NXY A;  1MK4 A;  3ZZI A;  5A28 A;  5AG7 A;  4B5P B;  4JWP A;  2C27 A;  2IL4 A;  3TOA A;  4C68 A;  5A27 A;  4H89 A;  2P6E A;  4B12 A;  3GKR A;  2JEV A;  4KOR A;  4JD6 A;  2HV2 A;  2B5G A;  2Z11 A;  2EVN A;  4CGO A;  1IYK A;  2H5M A;  4JLY A;  4C7I A;  1QSR A;  2OH1 A;  2A4N A;  4UCP A;  2Y0M A;  2D4P A;  1YLE A;  5BWA B;  4GS4 A;  1S7K A;  4E0A A;  4MFP A;  4CAE A;  2J8M A;  2GAN A;  1I12 A;  2BL1 A;  1B6B A;  3S6F A;  3FBU A;  4CGP A;  1KUY A;  5AG6 A;  2PDO A;  3R95 A;  3G8W A;  2F5I A;  3IWG A;  4JXR A;  4FD7 A;  2VQY A;  2VZY A;  4CRZ B;  4CAW A;  3GY9 A;  3IWE A;  3UY5 A;  4H6U A;  2JDC A;  4UWI A;  4OAE A;  4E8O A;  2Q4V A;  5H86 A;  1IIC A;  4KOY A;  4XPD C;  4Y49 C;  1QSN A;  4R57 A;  4MJ8 A;  4QUS A;  4KLV A;  4UA3 A;  2FIW A;  2RC4 A;  2Q7B A;  2ZW7 A;  3EC4 A;  2EUI A;  1R57 A;  3DR6 A;  3OWC A;  2P6F A;  2B3V A;  1XF8 A;  1M4D A;  4PSW A;  2KCW A;  2REE A;  5F49 A;  2CXA A;  1QSM A;  4YGO A;  1WK4 A;  2WSA A;  4NCZ A;  4MY3 A;  4AVB A;  3C26 A;  4ZGY B;  1S7L A;  4U9Z A;  1PU9 A;  2DXQ A;  2Z10 A;  4X5K A;  2PQ8 A;  3JUW A;  4XPK A;  3EXN A;  4Q38 A;  4KVX A;  4C7H A;  3DSB A;  4C2X A;  3N7Z A;  4U9Y A;  1BO4 A;  3QB8 A;  5FVJ A;  3D2P A;  5JQ4 A;  3FRM A;  2Z3P A;  4B11 A;  3BJ8 A;  4QVT A;  3JTK A;  3EFA A;  4OAD A;  4RS2 A;  3V8I A;  3FXT A;  3PP9 A;  3IU1 A;  4MFQ A;  2AJ6 A;  3FIX A;  1LRZ A;  3FYN A;  2R98 A;  2FS5 A;  2B58 A;  2ZW6 A;  5G20 A;  1MJB A;  2FE7 A;  5GCN A;  3R9E A;  3TCV A;  4F0Y A;  4FD6 A;  4HNX B;  2Z3M A;  2FL4 A;  3TFY A;  1RO5 A;  4K30 A;  3JVN A;  2Z3K A;  4DNC A;  1OZP A;  3LOD A;  4MFJ A;  2R1I A;  5DWM A;  4FD4 A;  4JJX A;  1WWZ A;  3PZJ A;  4UCN A;  4HNW B;  4B14 A;  4MFL A;  5IB0 A;  3TO7 A;  4CYN A;  3H5Z A;  4KOT A;  2BSW A;  2DPT A;  2P0W A;  3CXQ A;  1M4I A;  3T9Y A;  2WPX A;  2ZXV A;  1VHS A;  4F0X A;  1Q2Y A;  4I49 A;  2Q4Y A;  3K9U A;  5I0C A;  3LD2 A;  4M85 A;  4RI1 A;  3VWE A;  3GYA A;  5G1Z A;  2OZH A;  1UFH A;  1B87 A;  3DDD A;  3DR8 A;  2PC1 A;  5AGE A;  1YK3 A;  3S6G A;  1KUX A;  1BOB A;  4XPL A;  2YGW A;  1M44 A;  2YNC A;  2JLM A;  4A32 A;  2DPS A;  1N71 A;  2J8R A;  2PR8 A;  5C82 A;  4LX9 A;  2YND A;  3IU2 A;  1Y7R A;  5DWN A;  5JPH A;  3W6X A;  1FY7 A;  4B13 A;  1IB1 E;  2YNC C;  3S6K A;  3TTH A;  2OZU A;  2CNM A;  4CGM A;  2FIA A;  4ONU A;  1ON0 A;  2VEZ A;  4PK3 A;  2B4D B;  2CNT A;  5CNP A;  2I00 A;  1KUV A;  4CYP A;  1I21 A;  2G3A A;  4CYO A;  1Z9U A;  4NSQ A;  4PV6 A;  2PR1 A;  4KLW A;  5IX3 A;  4KS9 A;  2Z3N A;  4EVY A;  1QSO A;  1YVK A;  4R87 A;  4XNH B;  1QST A;  2O28 A;  2VXK A;  1XEB A;  2OZG A;  2Q04 A;  2JDD A;  1IYL A;  2CNS A;  4AB7 A;  2P6G A;  3F8K A;  2G3T A;  2PRB A;  4OLL A;  3TO9 A;  5KTA A;  4U5Y A;  1VKC A;  3P2F A;  4NF1 A;  3G3S A;  4KOX A;  4L89 A;  4B10 A;  2ZPA A;  2PSW A;  1NE9 A;  4UBR A;  4QB9 A;  1TIQ A;  4CAF A;  4A2Z A;  2ATR A;  2YNE A;  5ISV A;  3TO6 A;  1S60 A;  1S7F A;  3VWD A;  4C2Z A;  4AVA A;  1S7N A;  1P0H A;  4B5O A;  2R7H A;  3KKW A;  2QML A;  3I3G A;  3CXP A;  4R9M A;  4NEX A;  5IV0 A;  1I1D A;  1Z4R A;  4KSF A;  3D8P A;  4R3L A;  5G22 A;  5C88 A;  2BEI A;  1M1D A;  2HUZ A;  2B4D A;  4BMH A;  3TT2 A;  4R3K A;  4KOS A;  2REF A;  4KUA A;  3WR7 A;  4UWJ A;  1CM0 A;  3A9L A;  1XE4 A;  1YRE A;  1PUA A;  3I9S A;  2FSR A;  5KTD A;  2ARH A;  5HH1 A;  4H6Z A;  4MFZ A;  2R8V A;  4CAV A;  5J8C A;  3NE7 A;  1Q2D A;  1U6M A;  4ZBG A;  2AE6 A;  5HMN A;  4KOW A;  2Z3L A;  2QIR A;  4CGN A;  2I79 A;  4A33 A;  4KUB A;  4IF5 A;  4XNH C;  4E2A A;  2FXF A;  4FD5 A;  3ZJ0 A;  4KVM E;  4CAX A;  3F0A A;  4UCM A;  3EO4 A;  4XPD B;  4Y49 B;  2Q0Y A;  4QC6 A;  2VZZ A;  2OB0 A;  4YRH A;  3H4Q A;  4AVC A;  2J8N A;  1M4G A;  3W6S A;  1YGH A;  1XIX A;  4II9 A;  2GIV A;  4MHD A;  3QAH A;  4J3G A;  3RYO A;  1YR0 A;  4AG7 A;  1YVO A;  2G0B A;  4JXQ A;  2K5T A;  4MY0 A;  2FT0 A;  2Z3O A;  1RXT A;  1Z4E A;  2WPW A;  2HQY A;  1XMT A;  1Y9K A;  3R1K A;  4KVO E;  5F48 A;  3P2H A;  4UFV A;  4HNY B;  1K4J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...