1Z4RA

Human gcn5 acetyltransferase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
163
structure length
163
Chain Sequence
SGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords General control of amino acid synthesis protein 5-like 2
publication title Crystal structure of a binary complex between human GCN5 histone acetyltransferase domain and acetyl coenzyme A
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 163
sequence length 163
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1z4rA00
3T90A 3TFYA 2PSWA 4OAEA 3PGPA 4QBJA 2R98A 2REEA 3GKRA 4AG9A 4CRYB 4U9ZA 2VEZA 3IGRA 3DR6A 4AG7A 2FSRA 1IB1E 2B4DA 3EFAA 1NMTA 1N71A 3FNCA 2JEVA 5HH1A 2P0WA 4KVME 5HMNA 4I49A 1U6MA 1IICA 2OU2A 2KCWA 1M1DA 5KTAA 2G3AA 3P2HA 2OH1A 3FRMA 2JLMA 2PRBA 1PUAA 2Q04A 4XNHC 4NCZA 1CM0A 2OZHA 1MJBA 2Z0ZA 1YR0A 5E96A 2Q44A 4CAXA 4FD4A 1S7FA 4R3KA 4B5PB 3VWEA 1IYLA 1RO5A 1XE4A 4E2AA 3TE4A 4YFJA 3TO9A 1Q2CA 4KLWA 4CAVA 1Q2DA 3BJ7A 3IWGA 4K30A 4R87A 2VI7A 2D4PA 2R8VA 3EO4A 1V0CA 3ZJ0A 1K4JA 1XEBA 2GIVA 2JDDA 3T9YA 4B5OA 1QSMA 4RS2A 2D4OA 4FD5A 1QSRA 2VZZA 4R57A 2WPXA 3R95A 3G3SA 3TCVA 3V8IA 1GHEA 4PV6A 3F0AA 2G0BA 3K9UA 2Q4YA 1P0HA 3UY5A 3BJ8A 1YLEA 4ONUA 2IL4A 2B5GA 2I00A 4PK2A 4F0YA 4KOSA 4NF1A 5C88A 4PSWA 4HNXB 3FBUA 3R9FA 2HUZA 1XMTA 1YK3A 4GS4A 3D3SA 3EC4A 2VXKA 4KOYA 2BEIA 4XPKA 1YGHA 2FT0A 3F5BA 4M3SA 3CXSA 5EC4A 4QC6A 4M85A 1XF8A 5KTCA 4KUBA 4F6AA 3SXOA 3TTHA 5EBVA 1J4JA 4XNHB 5IV0A 3FB3A 4J3GA 5GCNA 1Y9WA 4JXRA 5J8CA 2FE7A 4OLLA 1B6BA 3D2MA 1Y9KA 4XPDB 1Y7RA 1I21A 1KUVA 3JUWA 2O28A 4LUAA 3W6XA 2P6FA 3TO6A 2B4DB 4KOVA 1VHSA 2ARHA 3QAHA 2DXQA 1Z4EA 1MJAA 4DNCA 5H86A 3F8KA 3TT2A 1YX0A 2K5TA 4R9MA 4LX9A 3DR8A 1QSTA 2J8NA 2Q4VA 4XPDC 3LODA 3GYAA 3SXNA 3DDDA 2GE3A 2ATRA 4MHDA 3I3GA 2FS5A 2Z11A 3R96A 4FD7A 3QB8A 5DWMA 2F5IA 2PQ8A 1LRZA 2NMTA 1FY7A 1MJ9A 1Z4RA 2BSWA 2BUEA 4HNYB 1S7LA 1KUXA 4EVYA 3P2FA 5F46A 3RYOA 2HQYA 5FVJA 4AB7A 2H5MA 3D8PA 4JD6A 3C26A 4UA3A 3CXQA 4E8OA 5ISVA 1KZFA 2J8MA 4QUSA 5CNPA 4CRZB 2PC1A 1IYKA 5J8FA 1BOBA 5C82A 4JWPA 3PP9A 1WK4A 4NSQA 1QSOA 3R9GA 3S6GA 3B8GA 4JJXA 4KZTA 1M4DA 1ON0A 3S6KA 4IUSA 4RI1A 2Q7BA 1S7NA 3DNSA 4MJ8A 1YREA 2B5GB 4U9YA 3FXTA 4KOTA 2A4NA 2R7HA 3VWDA 4NEXA 1S7KA 2B4BA 3EXNA 1PU9A 2Z10A 1NSLA 2P6GA 3FIXA 1MK4A 4QB9A 1XIXA 2PDOA 4FD6A 4KOUA 1NE9A 4H89A 4AVCA 5JPHA 2ZW6A 4Y49B 3KKWA 2FIAA 3D2PA 4U5YA 4QVTA 1IIDA 3OWCA 5F47A 3NE7A 1M4IA 3LD2A 1SQHA 4NXYA 1B87A 3FYNA 1P4NA 4AVAA 5I0CA 2B58A 1QSNA 4KVXA 5H84A 3CXPA 2OZUA 2Y0MA 5KTDA 3R1KA 2CNTA 2RC4A 1M4GA 4OADA 2AE6A 4L89A 2CNMA 4L8AA 3S6HA 3SHPA 2I79A 2JDCA 2FCKA 2WPWA 2QMLA 4Y49C 2ZW5A 4YRHA 2AJ6A 4UWIA 2OZGA 2FXFA 4PSXA 2ZPAA 3MGDA 2OB0A 4YGOA 4E0AA 3TOAA 1OZPA 5DWNA 4MY3A 4X5KA 4MY0A 4B5PA 4HKFA 2BL1A 3I9SA 5IX3A 3N7ZA 3ZZIA 1I12A 2CNSA 2VQYA 4CAWA 4II9A 3W6SA 1YVOA 1S5KA 1KUYA 1TIQA 4MI4A 4KUAA 3S6FA 4BMHA 1Q2YA 3JVNA 2C27A 4H6UA 3R9EA 3EY5A 5IB0A 2X7BA 4KORA 1YVKA 4IF5A 4R3LA 1WWZA 2FL4A 2PR1A 2VBQA 2REFA 2VZYA 1RXTA 2HV2A 1L0CA 4JLYA 2FIWA 1VKCA 1I1DA 3E0KA 2CY2A 1S3ZA 2EVNA 3DSBA 1CJWA 3G8WA 1BO4A 2EUIA 4XPLA 4ZBGA 4AVBA 2J8RA 4HNWB 4UWJA 2Q0YA 2QIRA 2ZW4A 3H4QA 5JQ4A 1S60A 2ZW7A 2R1IA 2G3TA 3WR7A 1Z9UA 5F48A 2ZXVA 2QECA 3TOBA 4JXQA 2GANA 3GY9A 5F49A 4UBRA 2PR8A 3PZJA 1R57A 4ORFA 3BLNA 4KOXA 4CS0B 1UFHA 1M44A 4H6ZA 3W91A 2B3VA 3TO7A 2P6EA 4KOWA 4PK3A 4KVOE 4MBUA 4KLVA 2B3UA
chains in the Genus database with same CATH superfamily
3T90A 2WYRA 3TFYA 2PSWA 4OAEA 4OC1A 5JH9A 3PGPA 1BPNA 2PJ3A 4QBJA 1Z8LA 2R98A 2REEA 2WUUA 3GKRA 4AG9A 4CRYB 5I4MA 5D29A 4U9ZA 2RFHA 4HPSA 5HVFA 4ZY0A 2VEZA 1M4LA 3IGRA 3DR6A 2ODFA 4AG7A 2FSRA 1IB1E 1Y7EA 2B4DA 5AG4A 3D4UA 4MHPA 4OIDA 3IWWA 4JZ0A 3EFAA 5AGEA 1NMTA 5LRJA 1N71A 3FNCA 4JYWA 2JEVA 3B3TA 3MRUA 5HH1A 2P0WA 1AYEA 4KVME 2C6PA 2ZOGA 3PB9X 3KR5A 1DTDA 1PCAA 4I49A 1U6MA 4NGTA 4FBEA 5HMNA 4CGLA 4F9UA 1IICA 4CGNA 4A30A 3IO1A 4UF4A 2OU2A 2KCWA 3BI0A 3CZXA 1M1DA 2DF5A 4MCPA 3D68A 2CTBA 4ZX8A 5KTAA 2G3AA 1DE4C 3P2HA 2DPTA 2PJ9A 2OH1A 3FRMA 2JLMA 2PRBA 1PUAA 2Q04A 4XNHC 4NCZA 1IOFA 1CM0A 2OZHA 4MMOA 4B11A 3BHXA 1MJBA 2Z0ZA 1YR0A 4F9VA 4A31A 1LAPA 2YNCA 4NGRA 1H8LA 4FWUA 5E96A 5K8PA 7CPAA 1AUGA 4B14A 3IIBA 1XRYA 3QNVA 2Q44A 4CAXA 2CTCA 4FD4A 3D7HA 3KL9A 1S7FA 1ARMA 2ZEEA 4R3KA 2C1CA 3VWEA 4B5PB 1IYLA 4A33A 3RBUA 1EE3P 4Q36A 1Q7LA 1RO5A 1XE4A 4ZI6A 2CF4A 2CIJA 2RB7A 4RN7A 4E2AA 2Z3OA 3TO9A 4YFJA 3KQZA 1Q2CA 4KLWA 3TE4A 1TKFA 4FUUA 4EWTA 4MHYA 4C2ZA 4CAVA 1Q2DA 2ZOFA 3BJ7A 3IWGA 4K30A 3T8WA 4R87A 2VI7A 1BPMA 2D4PA 2IQ6A 2C6CA 2R8VA 1YQEA 3SJEA 3FX6A 3EO4A 1V0CA 3ZJ0A 1K4JA 4M6GA 1XEBA 2GIVA 2JDDA 2YNEA 3JTKA 3PRTA 3T9YA 1F2PA 4B5OA 1QSMA 4CGMA 4P4BA 4RS2A 2D4OA 5BWAB 4FD5A 1Z8XA 4MHNA 1QSRA 4A2ZA 3LACA 2VZZA 4R57A 2WPXA 3R95A 2QVPA 3G3SA 3QAYA 4NGNA 2F7VA 3LWUA 4UCMA 4C68A 3TCVA 3V8IA 5F09A 2EWBA 3PBEA 1GHEA 4PV6A 3F0AA 4NGSA 2G0BA 3K9UA 4PQAA 2Q4YA 1P0HA 3UY5A 1IOIA 3BJ8A 1YLEA 4ONUA 4PPZA 4UFXA 2IL4A 3WC5A 2B5GA 1Z8WA 2I00A 3FH4A 4K3NA 4PK2A 4F0YA 5IB9A 4OC0A 4KOSA 4NF1A 5C88A 2GLJA 2DEAA 3PB7X 3HUVA 1Y0YA 4PSWA 3K2KA 4C7IA 4CYQA 1CPSA 2XEGA 4NGPA 1FNOA 3H8EA 3IU1A 4OC3A 4CYOA 5JM6A 2JEWA 2IJZA 5D8NA 4HNXB 3FBUA 2Z3PA 4UEFA 3R9FA 4X3RA 1Z5RA 2HUZA 1XMTA 2POKA 4NGQA 2Q51A 1YK3A 3S9LA 1BLLE 3D3SA 4GS4A 3EC4A 5EMIA 5LYDA 4IAVA 1HEEA 2VXKA 2ZEOA 2IMOA 4KOYA 2BEIA 4P4EA 4XPKA 2ZEGA 2EK8A 1YGHA 2FT0A 4P44A 3F5BA 3S9NA 4M3SA 2Z3KA 3CXSA 5EC4A 4UIBA 4QC6A 1GYTA 4M85A 1XF8A 4BINA 5KTCA 1HDUA 4KUBA 4OC4A 3GB0A 5CBMA 4F6AA 3SXOA 5A28A 3TTHA 5HVHA 4IHMA 5EBVA 1J4JA 4XNHB 5IV0A 3FB3A 2AFOA 4GM5A 4J3GA 5GCNA 1Y9WA 3B7IA 3KQXA 1Z2LA 4JXRA 4MCQA 5J8CA 1YW6A 2FE7A 4OLLA 2J9AA 6CPAA 1B6BA 3PB4X 3CDXA 1FT7A 3D2MA 1Y9KA 4XPDB 4B10A 3I1UA 3SI2A 1Y7RA 2PJ1A 1UWYA 4P4IA 4OC2A 1I21A 1KUVA 3JUWA 2O28A 4LUAA 3CPXA 1XBUA 3V38A 3W6XA 4EFDA 4W9YA 3IJ3A 3H5ZA 2Q43A 4CAEA 1LAMA 2P6FA 3TO6A 1ZG7A 2B4DB 4KOVA 1AMPA 1VHSA 2ARHA 3QAHA 4UCPA 4UEZA 4ZGYB 1BAVA 2DXQA 1IU8A 1Z4EA 1MJAA 1YSJA 2AFXA 3NE8A 4PXBA 4DNCA 3KHZA 5H86A 4C2XA 3FVLA 3F8KA 3TT2A 3GIUA 1YX0A 2BO9A 2K5TA 2PCUA 3K9TA 1TF8A 4PXCA 2PJ2A 4R9MA 2DPSA 4LX9A 4DYOA 3PEIA 4RUHA 3B35A 2GLFA 2G9DA 3DR8A 3D66A 1OBRA 1QSTA 2J8NA 2Q4VA 4XPDC 3PB8X 4AXVA 4MCRA 4YU9A 4CPAA 2V8VA 4O23A 3LODA 1Z8TA 3GYAA 3DDDA 3SXNA 2GE3A 4BBHA 2ATRA 4MHDA 4UEEA 3I3GA 2OR4A 2FS5A 3B3SA 4MFKA 2Z11A 2Z3MA 3R96A 4FD7A 3QB8A 5DWMA 3IEHA 2F5IA 1ARLA 1LRZA 2PQ8A 3A9LA 2O4HA 2NMTA 5HXDA 1FY7A 4NFRA 4C7HA 1MJ9A 1Z4RA 2FVGA 3SJGA 3VARA 2BSWA 4MFZA 2ZEDA 2BUEA 1TKHA 4HNYB 3FJUA 5CPAA 1S7LA 1X10A 3KHXA 1KUXA 2Q7SA 4EVYA 3P2FA 3L2NA 3RYOA 5F46A 1F57A 2HQYA 1TKJA 5FVJA 4AB7A 1CBXA 4OKOA 2H5MA 3D8PA 4JD6A 4CGOA 5G1ZA 3C26A 1R43A 3NA6A 3CXQA 4UA3A 4X2TA 4E8OA 5ISVA 1KZFA 2O53A 2J8MA 2V8GA 3NH4A 2Z3LA 3ISZA 4PXDA 4QUSA 5CNPA 4CRZB 2PC1A 1KWMA 1IYKA 2YNDA 5LRKA 3WC7A 5J8FA 1BOBA 4FAIA 5C82A 4JWPA 2YNCC 1XOVA 3FEDA 3BI1A 2HB6A 5K8MA 3PP9A 4ZY1A 2QJ8A 8CPAA 1WK4A 3IWEA 2CXAA 4NSQA 1QSOA 4P10A 3R9GA 3NH8A 4UIAA 3S6GA 3B8GA 4JJXA 4DUKA 3JRUA 2PJ8A 3PFOA 4KZTA 1M4DA 1ZLIA 2AFMA 5LYIA 3KZWA 4WJBA 4B6ZA 4ONWA 1ON0A 3S6KA 4IUSA 4RI1A 2XEIA 2Q7BA 2JBKA 1S7NA 3DNSA 4MJ8A 1YREA 3H8GA 2BOAA 3FF3A 3WT4A 4MFQA 2B5GB 5J1QA 4U9YA 3B2YA 3FXTA 4KOTA 4Z65A 3B3WA 2ABZA 1LOKA 2A4NA 3D7DA 2PJ5A 2JBJA 4WWVA 3SI1A 5K8OA 1TXRA 3KASA 3TC8A 2GU2A 2V8HA 2R7HA 2ANPA 3VWDA 2PJBA 2PJCA 1S7KA 4NEXA 4PXEA 1LFWA 4LQ6A 1VHEA 2XEFA 2B4BA 4B13A 3EXNA 4CGPA 1PU9A 2Z10A 1NSLA 2P6GA 1IY7A 3IU2A 1QMUA 2PJAA 3FIXA 1MK4A 4QB9A 3LMSA 1XIXA 2PDOA 4FD6A 4KOUA 4A32A 5K8NA 1YW4A 1IGBA 1NE9A 4H89A 3RZAA 4AVCA 3NFZA 5JPHA 2ZW6A 1XFOA 2WZNA 4Y49B 3VH9A 2PVWA 4UFVA 4R8FA 3KKWA 3WABA 3V7ZA 2BCOA 2GREA 1ELMP 4ZY2A 2FIAA 3D2PA 4U5YA 1ZLHA 4KS9A 4QVTA 2GFQA 1IIDA 2PRQA 2EK9A 1CX8A 3OWCA 5F47A 3NE7A 1M4IA 1JWQA 1SQHA 3LD2A 4MFJA 4NXYA 2PJ6A 1B87A 3FYNA 2EO8A 1P4NA 5HVGA 2AFSA 4AVAA 2PJ0A 1CP7A 3DLJA 3B3CA 5I0CA 2NYQA 4IK2A 2B58A 1QSNA 4KVXA 5H84A 2PVVA 1YMEA 3CXPA 2OZUA 2Y0MA 4CYPA 4F8ZA 5KTDA 3R1KA 4CAFA 2CNTA 2RC4A 1M4GA 4OADA 4P6YA 4F0XA 2AE6A 4L89A 2CNMA 4MHZA 4NGMA 4P4FA 4L8AA 3S6HA 3SHPA 4MXUA 2I79A 2JDCA 2FCKA 4NJQA 2V8DA 2WPWA 2QMLA 4Y49C 3RO0A 2ZW5A 4YRHA 2AJ6A 4UWIA 2OZGA 2FXFA 2ZEPA 4GXHA 3ISXA 4PSXA 2ZPAA 5LRGA 1VGYA 3MGDA 1A2ZA 2OB0A 3N5FA 4YGOA 2AFWA 3IFEA 4E0AA 3TOAA 1OZPA 1TF9A 1RTQA 1LANA 2PJ4A 3PFEA 4Q7AA 3NH5A 5DWNA 1X12A 4R6TA 5AG7A 4MY3A 4X5KA 4MY0A 1ZG8A 4HKFA 4B5PA 3DGVA 2BL1A 3I9SA 5IX3A 3N7ZA 3RNZA 3VATA 3ZZIA 2WSAA 2AFUA 5A27A 3D67A 1I12A 2CNSA 4KSIA 2VQYA 4CAWA 4A39A 4YWYA 4II9A 3W6SA 4R76A 2Q4ZA 1YVOA 2PIZA 3KGQA 1S5KA 1KUYA 1TIQA 2XEJA 3BXMA 3KI9A 4KUAA 4MI4A 3S6FA 4BMHA 1HDQA 1JQGA 1ZG9A 4TNUA 2F8HA 3CT9A 2QYVA 4NJRA 1Q2YA 2ZEHA 3PBBA 5G22A 3FECA 3JVNA 5THWA 1LCPA 4P45A 1Y0RA 1VHOA 2C27A 4H6UA 3R9EA 3EY5A 5IB0A 1CG2A 1ELLP 1QQ9A 2X7BA 3FMCA 1YVKA 1F2OA 4KORA 1XJOA 4IF5A 4Q38A 5ELYA 3D7FA 1R3NA 4R3LA 1WWZA 2FL4A 4G1PA 2PR1A 3S9MA 1CP6A 2VBQA 4KSFA 2OOTA 2REFA 2VZYA 5LYFA 2VL1A 2PIYA 2PJ7A 4LQGA 5LYLA 3FEEA 1ZO0A 2B3UA 1RXTA 2HV2A 3RAMA 1L0CA 4C2YA 3KR4A 4UCNA 4JLYA 2FIWA 1VKCA 4KSAA 1I1DA 2C6GA 2I3CA 4H2KA 3E0KA 4MCSA 4ZYQA 2CY2A 2YGWA 1S3ZA 2EVNA 3DSBA 4A94A 2AFZA 3HLPA 3GUXA 3MN8A 4UFWA 2ZELA 1PYTB 4CYNA 1CJWA 2NSMA 3G8WA 1BO4A 4OC5A 5JGFA 4ZX9A 2EUIA 1YLOA 2PE3A 4XPLA 4ZBGA 4TWEA 4AVBA 2J8RA 4HNWB 4B12A 2V77A 4UWJA 4X8IA 4MFLA 3D7GA 3H8FA 3GLJA 3SJFA 4OIWA 2Q0YA 2ZEFA 5G20A 4M6IA 2QIRA 2ZENA 4A95A 2ZW4A 3H4QA 5JQ4A 1S60A 3PB6X 2ZW7A 2R1IA 4OP4A 2G3TA 3WR7A 1Z9UA 5F48A 2ZXVA 2QECA 3CPAA 3TOBA 4A38A 2EBJA 4DJLA 4JXQA 3B3VA 4MFPA 1CPXA 1XMBA 4M6HA 3SI0A 2GANA 3GY9A 5F49A 1VIXA 5AG6A 4MRIA 4UBRA 1NSAA 2PR8A 2ZEMA 5DS0A 5G21A 3SJXA 3PZJA 4A37A 4EMEA 1R57A 4ORFA 3BLNA 4R7MA 4P4DA 4KOXA 4CS0B 1UFHA 3IC1A 4P4JA 2Z3NA 1M44A 4H6ZA 3W91A 2B3VA 5AG5A 3TO7A 2P6EA 4KOWA 4PK3A 4BD9A 3WC6A 4OMEA 3TX8A 4KVOE 4MBUA 4KLVA 2HC9A
chains in the Genus database with same CATH topology
3T90A 3TFYA 2PSWA 4OAEA 3PGPA 4QBJA 2R98A 2REEA 2WUUA 3GKRA 4AG9A 4CRYB 4U9ZA 2VEZA 3IGRA 3DR6A 4AG7A 2FSRA 1IB1E 2B4DA 5AG4A 5AGEA 3EFAA 1NMTA 1N71A 3FNCA 2JEVA 5HH1A 2P0WA 4KVME 5HMNA 4I49A 1U6MA 4CGLA 1IICA 4CGNA 4A30A 2OU2A 2KCWA 1M1DA 5KTAA 2G3AA 3P2HA 2DPTA 2OH1A 3FRMA 2JLMA 2PRBA 1PUAA 2Q04A 4XNHC 4NCZA 1CM0A 2OZHA 4B11A 1MJBA 2Z0ZA 1YR0A 4A31A 2YNCA 5E96A 4B14A 2Q44A 4CAXA 4FD4A 1S7FA 4R3KA 4B5PB 3VWEA 1IYLA 4A33A 4Q36A 1RO5A 1XE4A 4E2AA 3TE4A 2Z3OA 3TO9A 4YFJA 1Q2CA 4KLWA 4C2ZA 4CAVA 1Q2DA 3BJ7A 3IWGA 4K30A 4R87A 2VI7A 2D4PA 2R8VA 3EO4A 1V0CA 3ZJ0A 1K4JA 1XEBA 2GIVA 2JDDA 2YNEA 3JTKA 3T9YA 4B5OA 4CGMA 1QSMA 4RS2A 2D4OA 5BWAB 4FD5A 4A2ZA 1QSRA 2VZZA 4R57A 2WPXA 3R95A 3G3SA 4C68A 4UCMA 3TCVA 3V8IA 1GHEA 4PV6A 3F0AA 2G0BA 3K9UA 2Q4YA 1P0HA 3UY5A 3BJ8A 1YLEA 4ONUA 4UFXA 2IL4A 2B5GA 2I00A 4PK2A 4F0YA 4KOSA 4NF1A 5C88A 4PSWA 4C7IA 4CYQA 4CYOA 3IU1A 4HNXB 3FBUA 2Z3PA 3R9FA 2HUZA 1XMTA 1YK3A 4GS4A 3D3SA 3EC4A 2VXKA 4KOYA 2BEIA 4XPKA 1YGHA 2FT0A 3F5BA 4M3SA 2Z3KA 3CXSA 5EC4A 4QC6A 4M85A 1XF8A 5KTCA 4KUBA 4F6AA 3SXOA 5A28A 3TTHA 5EBVA 1J4JA 4XNHB 5IV0A 3FB3A 4J3GA 5GCNA 1Y9WA 4JXRA 5J8CA 2FE7A 4OLLA 1B6BA 3D2MA 1Y9KA 4XPDB 4B10A 1Y7RA 1I21A 1KUVA 3JUWA 2O28A 4LUAA 3W6XA 3H5ZA 4CAEA 2P6FA 3TO6A 2B4DB 4KOVA 1VHSA 2ARHA 3QAHA 4UCPA 4ZGYB 2DXQA 1Z4EA 1MJAA 4DNCA 5H86A 4C2XA 3F8KA 3TT2A 1YX0A 2K5TA 4R9MA 2DPSA 4LX9A 3DR8A 1QSTA 2J8NA 2Q4VA 4XPDC 3LODA 3GYAA 3SXNA 3DDDA 2GE3A 4BBHA 2ATRA 4MHDA 3I3GA 2FS5A 4MFKA 2Z11A 2Z3MA 3R96A 4FD7A 3QB8A 5DWMA 2F5IA 2PQ8A 1LRZA 3A9LA 2NMTA 1FY7A 4C7HA 1MJ9A 1Z4RA 2BSWA 4MFZA 2BUEA 4HNYB 1S7LA 1KUXA 4EVYA 3P2FA 5F46A 3RYOA 2HQYA 5FVJA 4AB7A 2H5MA 3D8PA 4JD6A 4CGOA 5G1ZA 3C26A 4UA3A 3CXQA 4E8OA 5ISVA 1KZFA 2J8MA 2Z3LA 4QUSA 5CNPA 4CRZB 2PC1A 1IYKA 2YNDA 5J8FA 1BOBA 5C82A 4JWPA 2YNCC 3PP9A 1WK4A 3IWEA 2CXAA 4NSQA 1QSOA 3R9GA 3S6GA 3B8GA 4JJXA 4KZTA 1M4DA 1ON0A 3S6KA 4IUSA 4RI1A 2Q7BA 1S7NA 3DNSA 4MJ8A 1YREA 4MFQA 2B5GB 4U9YA 3FXTA 4KOTA 2A4NA 2R7HA 3VWDA 4NEXA 1S7KA 2B4BA 4B13A 3EXNA 4CGPA 1PU9A 2Z10A 1NSLA 2P6GA 3IU2A 3FIXA 1MK4A 4QB9A 1XIXA 2PDOA 4FD6A 4KOUA 4A32A 1NE9A 4H89A 4AVCA 5JPHA 2ZW6A 4Y49B 4UFVA 3KKWA 2FIAA 3D2PA 4U5YA 4KS9A 4QVTA 1IIDA 3OWCA 5F47A 3NE7A 1M4IA 3LD2A 1SQHA 4MFJA 4NXYA 1B87A 3FYNA 1P4NA 4AVAA 5I0CA 2B58A 1QSNA 4KVXA 5H84A 3CXPA 2OZUA 2Y0MA 4CYPA 5KTDA 3R1KA 4CAFA 2CNTA 2RC4A 1M4GA 4OADA 4F0XA 2AE6A 4L89A 2CNMA 4L8AA 3S6HA 3SHPA 2I79A 2JDCA 2FCKA 2WPWA 2QMLA 4Y49C 2ZW5A 4YRHA 2AJ6A 4UWIA 2OZGA 2FXFA 4PSXA 2ZPAA 3MGDA 2OB0A 4YGOA 4E0AA 3TOAA 1OZPA 5DWNA 5AG7A 4MY3A 4X5KA 4MY0A 4B5PA 4HKFA 2BL1A 3I9SA 5IX3A 3N7ZA 3ZZIA 2WSAA 5A27A 1I12A 2CNSA 2VQYA 4CAWA 4II9A 3W6SA 1YVOA 1S5KA 1KUYA 1TIQA 4MI4A 4KUAA 3S6FA 4BMHA 5G22A 1Q2YA 3JVNA 2C27A 4H6UA 3R9EA 3EY5A 5IB0A 2X7BA 4KORA 4Q38A 1YVKA 4IF5A 4R3LA 1WWZA 2FL4A 2PR1A 2VBQA 4KSFA 2REFA 2VZYA 1ZO0A 1RXTA 2HV2A 1L0CA 4C2YA 4UCNA 4JLYA 2FIWA 1VKCA 4KSAA 1I1DA 3E0KA 2CY2A 2YGWA 1S3ZA 2EVNA 3DSBA 4UFWA 4CYNA 1CJWA 3G8WA 1BO4A 2EUIA 4XPLA 4ZBGA 4AVBA 2J8RA 4HNWB 4B12A 4UWJA 4MFLA 2Q0YA 5G20A 2QIRA 4A95A 2ZW4A 3H4QA 5JQ4A 1S60A 2ZW7A 2R1IA 2G3TA 3WR7A 1Z9UA 5F48A 2ZXVA 2QECA 3TOBA 4JXQA 4MFPA 2GANA 3GY9A 5F49A 5AG6A 5G21A 4UBRA 2PR8A 3PZJA 1R57A 4ORFA 3BLNA 4KOXA 4CS0B 1UFHA 2Z3NA 1M44A 4H6ZA 3W91A 2B3VA 5AG5A 3TO7A 2P6EA 4KOWA 4PK3A 4KVOE 4MBUA 4KLVA 2B3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T90 A;  3TFY A;  2PSW A;  4OAE A;  3PGP A;  4QBJ A;  2R98 A;  2REE A;  3GKR A;  4AG9 A;  4CRY B;  4U9Z A;  2VEZ A;  3IGR A;  3DR6 A;  4AG7 A;  2FSR A;  1IB1 E;  2B4D A;  3EFA A;  1NMT A;  1N71 A;  3FNC A;  2JEV A;  5HH1 A;  2P0W A;  4KVM E;  5HMN A;  4I49 A;  1U6M A;  1IIC A;  2OU2 A;  2KCW A;  1M1D A;  5KTA A;  2G3A A;  3P2H A;  2OH1 A;  3FRM A;  2JLM A;  2PRB A;  1PUA A;  2Q04 A;  4XNH C;  4NCZ A;  1CM0 A;  2OZH A;  1MJB A;  2Z0Z A;  1YR0 A;  5E96 A;  2Q44 A;  4CAX A;  4FD4 A;  1S7F A;  4R3K A;  4B5P B;  3VWE A;  1IYL A;  1RO5 A;  1XE4 A;  4E2A A;  3TE4 A;  4YFJ A;  3TO9 A;  1Q2C A;  4KLW A;  4CAV A;  1Q2D A;  3BJ7 A;  3IWG A;  4K30 A;  4R87 A;  2VI7 A;  2D4P A;  2R8V A;  3EO4 A;  1V0C A;  3ZJ0 A;  1K4J A;  1XEB A;  2GIV A;  2JDD A;  3T9Y A;  4B5O A;  1QSM A;  4RS2 A;  2D4O A;  4FD5 A;  1QSR A;  2VZZ A;  4R57 A;  2WPX A;  3R95 A;  3G3S A;  3TCV A;  3V8I A;  1GHE A;  4PV6 A;  3F0A A;  2G0B A;  3K9U A;  2Q4Y A;  1P0H A;  3UY5 A;  3BJ8 A;  1YLE A;  4ONU A;  2IL4 A;  2B5G A;  2I00 A;  4PK2 A;  4F0Y A;  4KOS A;  4NF1 A;  5C88 A;  4PSW A;  4HNX B;  3FBU A;  3R9F A;  2HUZ A;  1XMT A;  1YK3 A;  4GS4 A;  3D3S A;  3EC4 A;  2VXK A;  4KOY A;  2BEI A;  4XPK A;  1YGH A;  2FT0 A;  3F5B A;  4M3S A;  3CXS A;  5EC4 A;  4QC6 A;  4M85 A;  1XF8 A;  5KTC A;  4KUB A;  4F6A A;  3SXO A;  3TTH A;  5EBV A;  1J4J A;  4XNH B;  5IV0 A;  3FB3 A;  4J3G A;  5GCN A;  1Y9W A;  4JXR A;  5J8C A;  2FE7 A;  4OLL A;  1B6B A;  3D2M A;  1Y9K A;  4XPD B;  1Y7R A;  1I21 A;  1KUV A;  3JUW A;  2O28 A;  4LUA A;  3W6X A;  2P6F A;  3TO6 A;  2B4D B;  4KOV A;  1VHS A;  2ARH A;  3QAH A;  2DXQ A;  1Z4E A;  1MJA A;  4DNC A;  5H86 A;  3F8K A;  3TT2 A;  1YX0 A;  2K5T A;  4R9M A;  4LX9 A;  3DR8 A;  1QST A;  2J8N A;  2Q4V A;  4XPD C;  3LOD A;  3GYA A;  3SXN A;  3DDD A;  2GE3 A;  2ATR A;  4MHD A;  3I3G A;  2FS5 A;  2Z11 A;  3R96 A;  4FD7 A;  3QB8 A;  5DWM A;  2F5I A;  2PQ8 A;  1LRZ A;  2NMT A;  1FY7 A;  1MJ9 A;  1Z4R A;  2BSW A;  2BUE A;  4HNY B;  1S7L A;  1KUX A;  4EVY A;  3P2F A;  5F46 A;  3RYO A;  2HQY A;  5FVJ A;  4AB7 A;  2H5M A;  3D8P A;  4JD6 A;  3C26 A;  4UA3 A;  3CXQ A;  4E8O A;  5ISV A;  1KZF A;  2J8M A;  4QUS A;  5CNP A;  4CRZ B;  2PC1 A;  1IYK A;  5J8F A;  1BOB A;  5C82 A;  4JWP A;  3PP9 A;  1WK4 A;  4NSQ A;  1QSO A;  3R9G A;  3S6G A;  3B8G A;  4JJX A;  4KZT A;  1M4D A;  1ON0 A;  3S6K A;  4IUS A;  4RI1 A;  2Q7B A;  1S7N A;  3DNS A;  4MJ8 A;  1YRE A;  2B5G B;  4U9Y A;  3FXT A;  4KOT A;  2A4N A;  2R7H A;  3VWD A;  4NEX A;  1S7K A;  2B4B A;  3EXN A;  1PU9 A;  2Z10 A;  1NSL A;  2P6G A;  3FIX A;  1MK4 A;  4QB9 A;  1XIX A;  2PDO A;  4FD6 A;  4KOU A;  1NE9 A;  4H89 A;  4AVC A;  5JPH A;  2ZW6 A;  4Y49 B;  3KKW A;  2FIA A;  3D2P A;  4U5Y A;  4QVT A;  1IID A;  3OWC A;  5F47 A;  3NE7 A;  1M4I A;  3LD2 A;  1SQH A;  4NXY A;  1B87 A;  3FYN A;  1P4N A;  4AVA A;  5I0C A;  2B58 A;  1QSN A;  4KVX A;  5H84 A;  3CXP A;  2OZU A;  2Y0M A;  5KTD A;  3R1K A;  2CNT A;  2RC4 A;  1M4G A;  4OAD A;  2AE6 A;  4L89 A;  2CNM A;  4L8A A;  3S6H A;  3SHP A;  2I79 A;  2JDC A;  2FCK A;  2WPW A;  2QML A;  4Y49 C;  2ZW5 A;  4YRH A;  2AJ6 A;  4UWI A;  2OZG A;  2FXF A;  4PSX A;  2ZPA A;  3MGD A;  2OB0 A;  4YGO A;  4E0A A;  3TOA A;  1OZP A;  5DWN A;  4MY3 A;  4X5K A;  4MY0 A;  4B5P A;  4HKF A;  2BL1 A;  3I9S A;  5IX3 A;  3N7Z A;  3ZZI A;  1I12 A;  2CNS A;  2VQY A;  4CAW A;  4II9 A;  3W6S A;  1YVO A;  1S5K A;  1KUY A;  1TIQ A;  4MI4 A;  4KUA A;  3S6F A;  4BMH A;  1Q2Y A;  3JVN A;  2C27 A;  4H6U A;  3R9E A;  3EY5 A;  5IB0 A;  2X7B A;  4KOR A;  1YVK A;  4IF5 A;  4R3L A;  1WWZ A;  2FL4 A;  2PR1 A;  2VBQ A;  2REF A;  2VZY A;  1RXT A;  2HV2 A;  1L0C A;  4JLY A;  2FIW A;  1VKC A;  1I1D A;  3E0K A;  2CY2 A;  1S3Z A;  2EVN A;  3DSB A;  1CJW A;  3G8W A;  1BO4 A;  2EUI A;  4XPL A;  4ZBG A;  4AVB A;  2J8R A;  4HNW B;  4UWJ A;  2Q0Y A;  2QIR A;  2ZW4 A;  3H4Q A;  5JQ4 A;  1S60 A;  2ZW7 A;  2R1I A;  2G3T A;  3WR7 A;  1Z9U A;  5F48 A;  2ZXV A;  2QEC A;  3TOB A;  4JXQ A;  2GAN A;  3GY9 A;  5F49 A;  4UBR A;  2PR8 A;  3PZJ A;  1R57 A;  4ORF A;  3BLN A;  4KOX A;  4CS0 B;  1UFH A;  1M44 A;  4H6Z A;  3W91 A;  2B3V A;  3TO7 A;  2P6E A;  4KOW A;  4PK3 A;  4KVO E;  4MBU A;  4KLV A;  2B3U A; 
#chains in the Genus database with same CATH topology
 3T90 A;  2WYR A;  3TFY A;  2PSW A;  4OAE A;  4OC1 A;  5JH9 A;  3PGP A;  1BPN A;  2PJ3 A;  4QBJ A;  1Z8L A;  2R98 A;  2REE A;  2WUU A;  3GKR A;  4AG9 A;  4CRY B;  5I4M A;  5D29 A;  4U9Z A;  2RFH A;  4HPS A;  5HVF A;  4ZY0 A;  2VEZ A;  1M4L A;  3IGR A;  3DR6 A;  2ODF A;  4AG7 A;  2FSR A;  1IB1 E;  1Y7E A;  2B4D A;  5AG4 A;  3D4U A;  4MHP A;  4OID A;  3IWW A;  4JZ0 A;  3EFA A;  5AGE A;  1NMT A;  5LRJ A;  1N71 A;  3FNC A;  4JYW A;  2JEV A;  3B3T A;  3MRU A;  5HH1 A;  2P0W A;  1AYE A;  4KVM E;  2C6P A;  2ZOG A;  3PB9 X;  3KR5 A;  1DTD A;  1PCA A;  4I49 A;  1U6M A;  4NGT A;  4FBE A;  5HMN A;  4CGL A;  4F9U A;  1IIC A;  4CGN A;  4A30 A;  3IO1 A;  4UF4 A;  2OU2 A;  2KCW A;  3BI0 A;  3CZX A;  1M1D A;  2DF5 A;  4MCP A;  3D68 A;  2CTB A;  4ZX8 A;  5KTA A;  2G3A A;  1DE4 C;  3P2H A;  2DPT A;  2PJ9 A;  2OH1 A;  3FRM A;  2JLM A;  2PRB A;  1PUA A;  2Q04 A;  4XNH C;  4NCZ A;  1IOF A;  1CM0 A;  2OZH A;  4MMO A;  4B11 A;  3BHX A;  1MJB A;  2Z0Z A;  1YR0 A;  4F9V A;  4A31 A;  1LAP A;  2YNC A;  4NGR A;  1H8L A;  4FWU A;  5E96 A;  5K8P A;  7CPA A;  1AUG A;  4B14 A;  3IIB A;  1XRY A;  3QNV A;  2Q44 A;  4CAX A;  2CTC A;  4FD4 A;  3D7H A;  3KL9 A;  1S7F A;  1ARM A;  2ZEE A;  4R3K A;  2C1C A;  3VWE A;  4B5P B;  1IYL A;  4A33 A;  3RBU A;  1EE3 P;  4Q36 A;  1Q7L A;  1RO5 A;  1XE4 A;  4ZI6 A;  2CF4 A;  2CIJ A;  2RB7 A;  4RN7 A;  4E2A A;  2Z3O A;  3TO9 A;  4YFJ A;  3KQZ A;  1Q2C A;  4KLW A;  3TE4 A;  1TKF A;  4FUU A;  4EWT A;  4MHY A;  4C2Z A;  4CAV A;  1Q2D A;  2ZOF A;  3BJ7 A;  3IWG A;  4K30 A;  3T8W A;  4R87 A;  2VI7 A;  1BPM A;  2D4P A;  2IQ6 A;  2C6C A;  2R8V A;  1YQE A;  3SJE A;  3FX6 A;  3EO4 A;  1V0C A;  3ZJ0 A;  1K4J A;  4M6G A;  1XEB A;  2GIV A;  2JDD A;  2YNE A;  3JTK A;  3PRT A;  3T9Y A;  1F2P A;  4B5O A;  1QSM A;  4CGM A;  4P4B A;  4RS2 A;  2D4O A;  5BWA B;  4FD5 A;  1Z8X A;  4MHN A;  1QSR A;  4A2Z A;  3LAC A;  2VZZ A;  4R57 A;  2WPX A;  3R95 A;  2QVP A;  3G3S A;  3QAY A;  4NGN A;  2F7V A;  3LWU A;  4UCM A;  4C68 A;  3TCV A;  3V8I A;  5F09 A;  2EWB A;  3PBE A;  1GHE A;  4PV6 A;  3F0A A;  4NGS A;  2G0B A;  3K9U A;  4PQA A;  2Q4Y A;  1P0H A;  3UY5 A;  1IOI A;  3BJ8 A;  1YLE A;  4ONU A;  4PPZ A;  4UFX A;  2IL4 A;  3WC5 A;  2B5G A;  1Z8W A;  2I00 A;  3FH4 A;  4K3N A;  4PK2 A;  4F0Y A;  5IB9 A;  4OC0 A;  4KOS A;  4NF1 A;  5C88 A;  2GLJ A;  2DEA A;  3PB7 X;  3HUV A;  1Y0Y A;  4PSW A;  3K2K A;  4C7I A;  4CYQ A;  1CPS A;  2XEG A;  4NGP A;  1FNO A;  3H8E A;  3IU1 A;  4OC3 A;  4CYO A;  5JM6 A;  2JEW A;  2IJZ A;  5D8N A;  4HNX B;  3FBU A;  2Z3P A;  4UEF A;  3R9F A;  4X3R A;  1Z5R A;  2HUZ A;  1XMT A;  2POK A;  4NGQ A;  2Q51 A;  1YK3 A;  3S9L A;  1BLL E;  3D3S A;  4GS4 A;  3EC4 A;  5EMI A;  5LYD A;  4IAV A;  1HEE A;  2VXK A;  2ZEO A;  2IMO A;  4KOY A;  2BEI A;  4P4E A;  4XPK A;  2ZEG A;  2EK8 A;  1YGH A;  2FT0 A;  4P44 A;  3F5B A;  3S9N A;  4M3S A;  2Z3K A;  3CXS A;  5EC4 A;  4UIB A;  4QC6 A;  1GYT A;  4M85 A;  1XF8 A;  4BIN A;  5KTC A;  1HDU A;  4KUB A;  4OC4 A;  3GB0 A;  5CBM A;  4F6A A;  3SXO A;  5A28 A;  3TTH A;  5HVH A;  4IHM A;  5EBV A;  1J4J A;  4XNH B;  5IV0 A;  3FB3 A;  2AFO A;  4GM5 A;  4J3G A;  5GCN A;  1Y9W A;  3B7I A;  3KQX A;  1Z2L A;  4JXR A;  4MCQ A;  5J8C A;  1YW6 A;  2FE7 A;  4OLL A;  2J9A A;  6CPA A;  1B6B A;  3PB4 X;  3CDX A;  1FT7 A;  3D2M A;  1Y9K A;  4XPD B;  4B10 A;  3I1U A;  3SI2 A;  1Y7R A;  2PJ1 A;  1UWY A;  4P4I A;  4OC2 A;  1I21 A;  1KUV A;  3JUW A;  2O28 A;  4LUA A;  3CPX A;  1XBU A;  3V38 A;  3W6X A;  4EFD A;  4W9Y A;  3IJ3 A;  3H5Z A;  2Q43 A;  4CAE A;  1LAM A;  2P6F A;  3TO6 A;  1ZG7 A;  2B4D B;  4KOV A;  1AMP A;  1VHS A;  2ARH A;  3QAH A;  4UCP A;  4UEZ A;  4ZGY B;  1BAV A;  2DXQ A;  1IU8 A;  1Z4E A;  1MJA A;  1YSJ A;  2AFX A;  3NE8 A;  4PXB A;  4DNC A;  3KHZ A;  5H86 A;  4C2X A;  3FVL A;  3F8K A;  3TT2 A;  3GIU A;  1YX0 A;  2BO9 A;  2K5T A;  2PCU A;  3K9T A;  1TF8 A;  4PXC A;  2PJ2 A;  4R9M A;  2DPS A;  4LX9 A;  4DYO A;  3PEI A;  4RUH A;  3B35 A;  2GLF A;  2G9D A;  3DR8 A;  3D66 A;  1OBR A;  1QST A;  2J8N A;  2Q4V A;  4XPD C;  3PB8 X;  4AXV A;  4MCR A;  4YU9 A;  4CPA A;  2V8V A;  4O23 A;  3LOD A;  1Z8T A;  3GYA A;  3DDD A;  3SXN A;  2GE3 A;  4BBH A;  2ATR A;  4MHD A;  4UEE A;  3I3G A;  2OR4 A;  2FS5 A;  3B3S A;  4MFK A;  2Z11 A;  2Z3M A;  3R96 A;  4FD7 A;  3QB8 A;  5DWM A;  3IEH A;  2F5I A;  1ARL A;  1LRZ A;  2PQ8 A;  3A9L A;  2O4H A;  2NMT A;  5HXD A;  1FY7 A;  4NFR A;  4C7H A;  1MJ9 A;  1Z4R A;  2FVG A;  3SJG A;  3VAR A;  2BSW A;  4MFZ A;  2ZED A;  2BUE A;  1TKH A;  4HNY B;  3FJU A;  5CPA A;  1S7L A;  1X10 A;  3KHX A;  1KUX A;  2Q7S A;  4EVY A;  3P2F A;  3L2N A;  3RYO A;  5F46 A;  1F57 A;  2HQY A;  1TKJ A;  5FVJ A;  4AB7 A;  1CBX A;  4OKO A;  2H5M A;  3D8P A;  4JD6 A;  4CGO A;  5G1Z A;  3C26 A;  1R43 A;  3NA6 A;  3CXQ A;  4UA3 A;  4X2T A;  4E8O A;  5ISV A;  1KZF A;  2O53 A;  2J8M A;  2V8G A;  3NH4 A;  2Z3L A;  3ISZ A;  4PXD A;  4QUS A;  5CNP A;  4CRZ B;  2PC1 A;  1KWM A;  1IYK A;  2YND A;  5LRK A;  3WC7 A;  5J8F A;  1BOB A;  4FAI A;  5C82 A;  4JWP A;  2YNC C;  1XOV A;  3FED A;  3BI1 A;  2HB6 A;  5K8M A;  3PP9 A;  4ZY1 A;  2QJ8 A;  8CPA A;  1WK4 A;  3IWE A;  2CXA A;  4NSQ A;  1QSO A;  4P10 A;  3R9G A;  3NH8 A;  4UIA A;  3S6G A;  3B8G A;  4JJX A;  4DUK A;  3JRU A;  2PJ8 A;  3PFO A;  4KZT A;  1M4D A;  1ZLI A;  2AFM A;  5LYI A;  3KZW A;  4WJB A;  4B6Z A;  4ONW A;  1ON0 A;  3S6K A;  4IUS A;  4RI1 A;  2XEI A;  2Q7B A;  2JBK A;  1S7N A;  3DNS A;  4MJ8 A;  1YRE A;  3H8G A;  2BOA A;  3FF3 A;  3WT4 A;  4MFQ A;  2B5G B;  5J1Q A;  4U9Y A;  3B2Y A;  3FXT A;  4KOT A;  4Z65 A;  3B3W A;  2ABZ A;  1LOK A;  2A4N A;  3D7D A;  2PJ5 A;  2JBJ A;  4WWV A;  3SI1 A;  5K8O A;  1TXR A;  3KAS A;  3TC8 A;  2GU2 A;  2V8H A;  2R7H A;  2ANP A;  3VWD A;  2PJB A;  2PJC A;  1S7K A;  4NEX A;  4PXE A;  1LFW A;  4LQ6 A;  1VHE A;  2XEF A;  2B4B A;  4B13 A;  3EXN A;  4CGP A;  1PU9 A;  2Z10 A;  1NSL A;  2P6G A;  1IY7 A;  3IU2 A;  1QMU A;  2PJA A;  3FIX A;  1MK4 A;  4QB9 A;  3LMS A;  1XIX A;  2PDO A;  4FD6 A;  4KOU A;  4A32 A;  5K8N A;  1YW4 A;  1IGB A;  1NE9 A;  4H89 A;  3RZA A;  4AVC A;  3NFZ A;  5JPH A;  2ZW6 A;  1XFO A;  2WZN A;  4Y49 B;  3VH9 A;  2PVW A;  4UFV A;  4R8F A;  3KKW A;  3WAB A;  3V7Z A;  2BCO A;  2GRE A;  1ELM P;  4ZY2 A;  2FIA A;  3D2P A;  4U5Y A;  1ZLH A;  4KS9 A;  4QVT A;  2GFQ A;  1IID A;  2PRQ A;  2EK9 A;  1CX8 A;  3OWC A;  5F47 A;  3NE7 A;  1M4I A;  1JWQ A;  1SQH A;  3LD2 A;  4MFJ A;  4NXY A;  2PJ6 A;  1B87 A;  3FYN A;  2EO8 A;  1P4N A;  5HVG A;  2AFS A;  4AVA A;  2PJ0 A;  1CP7 A;  3DLJ A;  3B3C A;  5I0C A;  2NYQ A;  4IK2 A;  2B58 A;  1QSN A;  4KVX A;  5H84 A;  2PVV A;  1YME A;  3CXP A;  2OZU A;  2Y0M A;  4CYP A;  4F8Z A;  5KTD A;  3R1K A;  4CAF A;  2CNT A;  2RC4 A;  1M4G A;  4OAD A;  4P6Y A;  4F0X A;  2AE6 A;  4L89 A;  2CNM A;  4MHZ A;  4NGM A;  4P4F A;  4L8A A;  3S6H A;  3SHP A;  4MXU A;  2I79 A;  2JDC A;  2FCK A;  4NJQ A;  2V8D A;  2WPW A;  2QML A;  4Y49 C;  3RO0 A;  2ZW5 A;  4YRH A;  2AJ6 A;  4UWI A;  2OZG A;  2FXF A;  2ZEP A;  4GXH A;  3ISX A;  4PSX A;  2ZPA A;  5LRG A;  1VGY A;  3MGD A;  1A2Z A;  2OB0 A;  3N5F A;  4YGO A;  2AFW A;  3IFE A;  4E0A A;  3TOA A;  1OZP A;  1TF9 A;  1RTQ A;  1LAN A;  2PJ4 A;  3PFE A;  4Q7A A;  3NH5 A;  5DWN A;  1X12 A;  4R6T A;  5AG7 A;  4MY3 A;  4X5K A;  4MY0 A;  1ZG8 A;  4HKF A;  4B5P A;  3DGV A;  2BL1 A;  3I9S A;  5IX3 A;  3N7Z A;  3RNZ A;  3VAT A;  3ZZI A;  2WSA A;  2AFU A;  5A27 A;  3D67 A;  1I12 A;  2CNS A;  4KSI A;  2VQY A;  4CAW A;  4A39 A;  4YWY A;  4II9 A;  3W6S A;  4R76 A;  2Q4Z A;  1YVO A;  2PIZ A;  3KGQ A;  1S5K A;  1KUY A;  1TIQ A;  2XEJ A;  3BXM A;  3KI9 A;  4KUA A;  4MI4 A;  3S6F A;  4BMH A;  1HDQ A;  1JQG A;  1ZG9 A;  4TNU A;  2F8H A;  3CT9 A;  2QYV A;  4NJR A;  1Q2Y A;  2ZEH A;  3PBB A;  5G22 A;  3FEC A;  3JVN A;  5THW A;  1LCP A;  4P45 A;  1Y0R A;  1VHO A;  2C27 A;  4H6U A;  3R9E A;  3EY5 A;  5IB0 A;  1CG2 A;  1ELL P;  1QQ9 A;  2X7B A;  3FMC A;  1YVK A;  1F2O A;  4KOR A;  1XJO A;  4IF5 A;  4Q38 A;  5ELY A;  3D7F A;  1R3N A;  4R3L A;  1WWZ A;  2FL4 A;  4G1P A;  2PR1 A;  3S9M A;  1CP6 A;  2VBQ A;  4KSF A;  2OOT A;  2REF A;  2VZY A;  5LYF A;  2VL1 A;  2PIY A;  2PJ7 A;  4LQG A;  5LYL A;  3FEE A;  1ZO0 A;  2B3U A;  1RXT A;  2HV2 A;  3RAM A;  1L0C A;  4C2Y A;  3KR4 A;  4UCN A;  4JLY A;  2FIW A;  1VKC A;  4KSA A;  1I1D A;  2C6G A;  2I3C A;  4H2K A;  3E0K A;  4MCS A;  4ZYQ A;  2CY2 A;  2YGW A;  1S3Z A;  2EVN A;  3DSB A;  4A94 A;  2AFZ A;  3HLP A;  3GUX A;  3MN8 A;  4UFW A;  2ZEL A;  1PYT B;  4CYN A;  1CJW A;  2NSM A;  3G8W A;  1BO4 A;  4OC5 A;  5JGF A;  4ZX9 A;  2EUI A;  1YLO A;  2PE3 A;  4XPL A;  4ZBG A;  4TWE A;  4AVB A;  2J8R A;  4HNW B;  4B12 A;  2V77 A;  4UWJ A;  4X8I A;  4MFL A;  3D7G A;  3H8F A;  3GLJ A;  3SJF A;  4OIW A;  2Q0Y A;  2ZEF A;  5G20 A;  4M6I A;  2QIR A;  2ZEN A;  4A95 A;  2ZW4 A;  3H4Q A;  5JQ4 A;  1S60 A;  3PB6 X;  2ZW7 A;  2R1I A;  4OP4 A;  2G3T A;  3WR7 A;  1Z9U A;  5F48 A;  2ZXV A;  2QEC A;  3CPA A;  3TOB A;  4A38 A;  2EBJ A;  4DJL A;  4JXQ A;  3B3V A;  4MFP A;  1CPX A;  1XMB A;  4M6H A;  3SI0 A;  2GAN A;  3GY9 A;  5F49 A;  1VIX A;  5AG6 A;  4MRI A;  4UBR A;  1NSA A;  2PR8 A;  2ZEM A;  5DS0 A;  5G21 A;  3SJX A;  3PZJ A;  4A37 A;  4EME A;  1R57 A;  4ORF A;  3BLN A;  4R7M A;  4P4D A;  4KOX A;  4CS0 B;  1UFH A;  3IC1 A;  4P4J A;  2Z3N A;  1M44 A;  4H6Z A;  3W91 A;  2B3V A;  5AG5 A;  3TO7 A;  2P6E A;  4KOW A;  4PK3 A;  4BD9 A;  3WC6 A;  4OME A;  3TX8 A;  4KVO E;  4MBU A;  4KLV A;  2HC9 A; 
#chains in the Genus database with same CATH homology
 3T90 A;  3TFY A;  2PSW A;  4OAE A;  3PGP A;  4QBJ A;  2R98 A;  2REE A;  2WUU A;  3GKR A;  4AG9 A;  4CRY B;  4U9Z A;  2VEZ A;  3IGR A;  3DR6 A;  4AG7 A;  2FSR A;  1IB1 E;  2B4D A;  5AG4 A;  5AGE A;  3EFA A;  1NMT A;  1N71 A;  3FNC A;  2JEV A;  5HH1 A;  2P0W A;  4KVM E;  5HMN A;  4I49 A;  1U6M A;  4CGL A;  1IIC A;  4CGN A;  4A30 A;  2OU2 A;  2KCW A;  1M1D A;  5KTA A;  2G3A A;  3P2H A;  2DPT A;  2OH1 A;  3FRM A;  2JLM A;  2PRB A;  1PUA A;  2Q04 A;  4XNH C;  4NCZ A;  1CM0 A;  2OZH A;  4B11 A;  1MJB A;  2Z0Z A;  1YR0 A;  4A31 A;  2YNC A;  5E96 A;  4B14 A;  2Q44 A;  4CAX A;  4FD4 A;  1S7F A;  4R3K A;  4B5P B;  3VWE A;  1IYL A;  4A33 A;  4Q36 A;  1RO5 A;  1XE4 A;  4E2A A;  3TE4 A;  2Z3O A;  3TO9 A;  4YFJ A;  1Q2C A;  4KLW A;  4C2Z A;  4CAV A;  1Q2D A;  3BJ7 A;  3IWG A;  4K30 A;  4R87 A;  2VI7 A;  2D4P A;  2R8V A;  3EO4 A;  1V0C A;  3ZJ0 A;  1K4J A;  1XEB A;  2GIV A;  2JDD A;  2YNE A;  3JTK A;  3T9Y A;  4B5O A;  4CGM A;  1QSM A;  4RS2 A;  2D4O A;  5BWA B;  4FD5 A;  4A2Z A;  1QSR A;  2VZZ A;  4R57 A;  2WPX A;  3R95 A;  3G3S A;  4C68 A;  4UCM A;  3TCV A;  3V8I A;  1GHE A;  4PV6 A;  3F0A A;  2G0B A;  3K9U A;  2Q4Y A;  1P0H A;  3UY5 A;  3BJ8 A;  1YLE A;  4ONU A;  4UFX A;  2IL4 A;  2B5G A;  2I00 A;  4PK2 A;  4F0Y A;  4KOS A;  4NF1 A;  5C88 A;  4PSW A;  4C7I A;  4CYQ A;  4CYO A;  3IU1 A;  4HNX B;  3FBU A;  2Z3P A;  3R9F A;  2HUZ A;  1XMT A;  1YK3 A;  4GS4 A;  3D3S A;  3EC4 A;  2VXK A;  4KOY A;  2BEI A;  4XPK A;  1YGH A;  2FT0 A;  3F5B A;  4M3S A;  2Z3K A;  3CXS A;  5EC4 A;  4QC6 A;  4M85 A;  1XF8 A;  5KTC A;  4KUB A;  4F6A A;  3SXO A;  5A28 A;  3TTH A;  5EBV A;  1J4J A;  4XNH B;  5IV0 A;  3FB3 A;  4J3G A;  5GCN A;  1Y9W A;  4JXR A;  5J8C A;  2FE7 A;  4OLL A;  1B6B A;  3D2M A;  1Y9K A;  4XPD B;  4B10 A;  1Y7R A;  1I21 A;  1KUV A;  3JUW A;  2O28 A;  4LUA A;  3W6X A;  3H5Z A;  4CAE A;  2P6F A;  3TO6 A;  2B4D B;  4KOV A;  1VHS A;  2ARH A;  3QAH A;  4UCP A;  4ZGY B;  2DXQ A;  1Z4E A;  1MJA A;  4DNC A;  5H86 A;  4C2X A;  3F8K A;  3TT2 A;  1YX0 A;  2K5T A;  4R9M A;  2DPS A;  4LX9 A;  3DR8 A;  1QST A;  2J8N A;  2Q4V A;  4XPD C;  3LOD A;  3GYA A;  3SXN A;  3DDD A;  2GE3 A;  4BBH A;  2ATR A;  4MHD A;  3I3G A;  2FS5 A;  4MFK A;  2Z11 A;  2Z3M A;  3R96 A;  4FD7 A;  3QB8 A;  5DWM A;  2F5I A;  2PQ8 A;  1LRZ A;  3A9L A;  2NMT A;  1FY7 A;  4C7H A;  1MJ9 A;  1Z4R A;  2BSW A;  4MFZ A;  2BUE A;  4HNY B;  1S7L A;  1KUX A;  4EVY A;  3P2F A;  5F46 A;  3RYO A;  2HQY A;  5FVJ A;  4AB7 A;  2H5M A;  3D8P A;  4JD6 A;  4CGO A;  5G1Z A;  3C26 A;  4UA3 A;  3CXQ A;  4E8O A;  5ISV A;  1KZF A;  2J8M A;  2Z3L A;  4QUS A;  5CNP A;  4CRZ B;  2PC1 A;  1IYK A;  2YND A;  5J8F A;  1BOB A;  5C82 A;  4JWP A;  2YNC C;  3PP9 A;  1WK4 A;  3IWE A;  2CXA A;  4NSQ A;  1QSO A;  3R9G A;  3S6G A;  3B8G A;  4JJX A;  4KZT A;  1M4D A;  1ON0 A;  3S6K A;  4IUS A;  4RI1 A;  2Q7B A;  1S7N A;  3DNS A;  4MJ8 A;  1YRE A;  4MFQ A;  2B5G B;  4U9Y A;  3FXT A;  4KOT A;  2A4N A;  2R7H A;  3VWD A;  4NEX A;  1S7K A;  2B4B A;  4B13 A;  3EXN A;  4CGP A;  1PU9 A;  2Z10 A;  1NSL A;  2P6G A;  3IU2 A;  3FIX A;  1MK4 A;  4QB9 A;  1XIX A;  2PDO A;  4FD6 A;  4KOU A;  4A32 A;  1NE9 A;  4H89 A;  4AVC A;  5JPH A;  2ZW6 A;  4Y49 B;  4UFV A;  3KKW A;  2FIA A;  3D2P A;  4U5Y A;  4KS9 A;  4QVT A;  1IID A;  3OWC A;  5F47 A;  3NE7 A;  1M4I A;  3LD2 A;  1SQH A;  4MFJ A;  4NXY A;  1B87 A;  3FYN A;  1P4N A;  4AVA A;  5I0C A;  2B58 A;  1QSN A;  4KVX A;  5H84 A;  3CXP A;  2OZU A;  2Y0M A;  4CYP A;  5KTD A;  3R1K A;  4CAF A;  2CNT A;  2RC4 A;  1M4G A;  4OAD A;  4F0X A;  2AE6 A;  4L89 A;  2CNM A;  4L8A A;  3S6H A;  3SHP A;  2I79 A;  2JDC A;  2FCK A;  2WPW A;  2QML A;  4Y49 C;  2ZW5 A;  4YRH A;  2AJ6 A;  4UWI A;  2OZG A;  2FXF A;  4PSX A;  2ZPA A;  3MGD A;  2OB0 A;  4YGO A;  4E0A A;  3TOA A;  1OZP A;  5DWN A;  5AG7 A;  4MY3 A;  4X5K A;  4MY0 A;  4B5P A;  4HKF A;  2BL1 A;  3I9S A;  5IX3 A;  3N7Z A;  3ZZI A;  2WSA A;  5A27 A;  1I12 A;  2CNS A;  2VQY A;  4CAW A;  4II9 A;  3W6S A;  1YVO A;  1S5K A;  1KUY A;  1TIQ A;  4MI4 A;  4KUA A;  3S6F A;  4BMH A;  5G22 A;  1Q2Y A;  3JVN A;  2C27 A;  4H6U A;  3R9E A;  3EY5 A;  5IB0 A;  2X7B A;  4KOR A;  4Q38 A;  1YVK A;  4IF5 A;  4R3L A;  1WWZ A;  2FL4 A;  2PR1 A;  2VBQ A;  4KSF A;  2REF A;  2VZY A;  1ZO0 A;  1RXT A;  2HV2 A;  1L0C A;  4C2Y A;  4UCN A;  4JLY A;  2FIW A;  1VKC A;  4KSA A;  1I1D A;  3E0K A;  2CY2 A;  2YGW A;  1S3Z A;  2EVN A;  3DSB A;  4UFW A;  4CYN A;  1CJW A;  3G8W A;  1BO4 A;  2EUI A;  4XPL A;  4ZBG A;  4AVB A;  2J8R A;  4HNW B;  4B12 A;  4UWJ A;  4MFL A;  2Q0Y A;  5G20 A;  2QIR A;  4A95 A;  2ZW4 A;  3H4Q A;  5JQ4 A;  1S60 A;  2ZW7 A;  2R1I A;  2G3T A;  3WR7 A;  1Z9U A;  5F48 A;  2ZXV A;  2QEC A;  3TOB A;  4JXQ A;  4MFP A;  2GAN A;  3GY9 A;  5F49 A;  5AG6 A;  5G21 A;  4UBR A;  2PR8 A;  3PZJ A;  1R57 A;  4ORF A;  3BLN A;  4KOX A;  4CS0 B;  1UFH A;  2Z3N A;  1M44 A;  4H6Z A;  3W91 A;  2B3V A;  5AG5 A;  3TO7 A;  2P6E A;  4KOW A;  4PK3 A;  4KVO E;  4MBU A;  4KLV A;  2B3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...