1Z4RA

Human gcn5 acetyltransferase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
163
structure length
163
Chain Sequence
SGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a binary complex between human GCN5 histone acetyltransferase domain and acetyl coenzyme A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords General control of amino acid synthesis protein 5-like 2
total genus 43
structure length 163
sequence length 163
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1z4rA00
2VQYA 1Z4EA 4DNCA 1KUVA 4PSWA 2ZW4A 1LRZA 3DSBA 4NEXA 4B5PA 1K4JA 1ON0A 4ONUA 2QIRA 4HKFA 4KOYA 4F6AA 2PDOA 2ATRA 4KLWA 5F47A 2A4NA 2X7BA 4JLYA 1KZFA 4KOUA 4MY3A 2RC4A 1TIQA 1PU9A 2Q44A 3E0KA 3QAHA 1YK3A 3P2FA 3FRMA 2B3UA 1YR0A 2P0WA 1M4GA 2J8MA 3CXSA 4RI1A 1YGHA 3ZJ0A 4AB7A 4L89A 2CNTA 4AVBA 1M4DA 5EC4A 1Q2YA 3TO7A 1KUYA 4KOSA 4AG7A 4GS4A 1IICA 2P6FA 2FT0A 4JWPA 3R95A 4H6ZA 2R7HA 1YVKA 3D2MA 3TOAA 4QB9A 3F5BA 3SXNA 3I9SA 4B5PB 3UY5A 4JD6A 3FBUA 5J8CA 3IWGA 2Y0MA 4BMHA 3GKRA 3BLNA 2FCKA 4HNWB 4M3SA 2AJ6A 3VWDA 4XNHB 5CNPA 2GANA 4AVAA 2KCWA 1YX0A 2F5IA 3EFAA 3I3GA 3CXPA 5IV0A 3TO6A 2OZUA 5H84A 3VWEA 5KTDA 2FL4A 3R9FA 2Q0YA 2G3AA 3QB8A 4XPDB 5F48A 3WR7A 3D8PA 4IUSA 3IGRA 1S7FA 2HQYA 2B5GA 2Z0ZA 2Z11A 1P0HA 4KVME 5HMNA 2OZGA 1VHSA 3TFYA 3W6XA 2ZW5A 3DR6A 2JDCA 4HNXB 1S7KA 4IF5A 2CNMA 1R57A 4KOWA 1BOBA 4XPLA 4Y49B 2NMTA 4FD5A 4KOVA 1OZPA 5GCNA 4YRHA 1QSOA 1M1DA 4KVOE 1S60A 4QC6A 4UA3A 3S6FA 4XPDC 3S6GA 4M85A 2EVNA 1U6MA 2B58A 3BJ8A 3R1KA 1QSTA 2OH1A 4CAVA 5C82A 1FY7A 4NCZA 3DNSA 5ISVA 2FXFA 3FXTA 3R9GA 1CM0A 2BUEA 2VBQA 2Q04A 1Z9UA 2R98A 5IX3A 3LODA 1IB1E 2PRBA 1SQHA 2JDDA 4FD7A 4U9ZA 1CJWA 2CNSA 2PR1A 4R3LA 2G3TA 5F46A 1MJBA 4R9MA 3H4QA 4QVTA 1I12A 3P2HA 2B4BA 1WK4A 4Y49C 4MJ8A 3B8GA 1XIXA 2PSWA 3S6KA 3K9UA 1M44A 4CS0B 1PUAA 1S5KA 4B5OA 1S7LA 2WPXA 4QUSA 3V8IA 5DWMA 5DWNA 4AVCA 4KOXA 3TT2A 2ARHA 1WWZA 3D3SA 4FD6A 5F49A 4PV6A 4I49A 1XMTA 2IL4A 3T9YA 3R9EA 4KZTA 2VXKA 2REEA 1YLEA 1NMTA 4ORFA 2BSWA 1MK4A 3BJ7A 4CAWA 3ZZIA 2B4DA 2K5TA 1XF8A 2Q4YA 1I21A 2J8NA 3TCVA 2ZPAA 4OAEA 2PC1A 4HNYB 4PK3A 1V0CA 3TTHA 3PGPA 3RYOA 1P4NA 1S3ZA 2R8VA 2Q7BA 4E2AA 3PZJA 4UWIA 4CAXA 3MGDA 2VI7A 2B3VA 3G3SA 1B6BA 4E0AA 2FIAA 4MI4A 2DXQA 2VZYA 4KOTA 4AG9A 1YVOA 3R96A 2VZZA 4U5YA 4JXRA 5KTAA 2REFA 2ZXVA 2G0BA 2GE3A 1MJ9A 3EY5A 4MY0A 3T90A 2CY2A 3W91A 2B4DB 1Q2CA 5HH1A 3JUWA 2B5GB 2O28A 3F8KA 4KUAA 2D4PA 2R1IA 4NXYA 1Y9WA 4YGOA 2OB0A 1MJAA 4CRYB 2Q4VA 1VKCA 3EO4A 3W6SA 4EVYA 2BEIA 1QSMA 2FS5A 2FSRA 1QSRA 3N7ZA 1Q2DA 3TOBA 2ZW6A 2H5MA 1Z4RA 1IIDA 2I79A 1IYKA 1J4JA 1Y7RA 4K30A 3FB3A 3F0AA 1M4IA 2WPWA 4FD4A 1NE9A 2P6GA 2OZHA 2PR8A 3GY9A 4ZBGA 2OU2A 4YFJA 2P6EA 3S6HA 2PQ8A 4NF1A 1GHEA 2VEZA 3KKWA 4OADA 1NSLA 3CXQA 4JJXA 3DDDA 2I00A 4H6UA 5I0CA 5JQ4A 3OWCA 5KTCA 4X5KA 2EUIA 4II9A 3LD2A 1BO4A 2BL1A 4R3KA 3FIXA 3TO9A 4H89A 2QECA 4OLLA 1Y9KA 4F0YA 4PSXA 3PP9A 1KUXA 5JPHA 3SXOA 4LUAA 2J8RA 1IYLA 4PK2A 4XNHC 4E8OA 2D4OA 2FIWA 3G8WA 5IB0A 1N71A 1QSNA 2Z10A 1RXTA 2FE7A 5EBVA 1I1DA 1L0CA 1UFHA 5FVJA 3SHPA 2HUZA 5H86A 4MHDA 2GIVA 4KLVA 5J8FA 3GYAA 3TE4A 2C27A 4L8AA 4MBUA 4UBRA 4J3GA 3D2PA 4KUBA 2ZW7A 4LX9A 4NSQA 4KVXA 3DR8A 3NE7A 4UWJA 3FYNA 2QMLA 2JEVA 5E96A 4R87A 3FNCA 2AE6A 4CRZB 4R57A 2HV2A 2JLMA 1XEBA 3C26A 4JXQA 1YREA 1B87A 3JVNA 4KORA 4XPKA 4QBJA 3EC4A 4RS2A 5C88A 1RO5A 1XE4A 3EXNA 1S7NA 4U9YA
chains in the Genus database with same CATH superfamily
4A2ZA 5HVHA 4PXEA 2VQYA 1Z4EA 4DNCA 2Q51A 1KUVA 3KZWA 4PSWA 1NSAA 2ZEGA 2ZW4A 1LRZA 3DSBA 4NEXA 4B5PA 1K4JA 2ZENA 3KR5A 1ON0A 4PXCA 4ONUA 3KI9A 2QIRA 4F8ZA 4HKFA 2CF4A 4KOYA 4F6AA 2PDOA 3DGVA 2V77A 2ATRA 4KLWA 5F47A 3V7ZA 2A4NA 2X7BA 4KSFA 4JLYA 2GLJA 3B35A 3PB6X 1KZFA 4KOUA 1HEEA 4CYNA 4MY3A 2RC4A 4UIAA 4C7IA 1TIQA 2PCUA 2V8GA 1PU9A 2Q44A 3PRTA 3E0KA 3SJEA 2ZEDA 3QAYA 4ZY2A 3QAHA 2AFOA 1YK3A 5LYIA 4A95A 3P2FA 4B10A 1ARLA 3FRMA 3B3VA 2HC9A 4ONWA 2B3UA 2YGWA 3IU2A 1IGBA 3RAMA 2P0WA 1YR0A 1M4GA 2J8MA 1XMBA 3CXSA 4OMEA 4RUHA 4RI1A 4C68A 1YGHA 3ZJ0A 4AB7A 3IO1A 1DE4C 1LAPA 1TKHA 2CNTA 3JTKA 4L89A 4AVBA 1M4DA 5EC4A 1Q2YA 3TO7A 1F2PA 5K8OA 3NH8A 2BCOA 1KUYA 4KOSA 3QNVA 4P45A 4GS4A 4AG7A 1IICA 2P6FA 4UFXA 4CGPA 4FUUA 4P4JA 1YLOA 2FT0A 4JWPA 4CGOA 1AYEA 2PJ0A 2OR4A 3R95A 4O23A 3K9TA 3GB0A 4H6ZA 3RNZA 2PE3A 2R7HA 2DEAA 4P44A 1YVKA 3D2MA 3SI1A 2DPTA 4A32A 4OIDA 3TOAA 4QB9A 2ZEFA 2C6CA 3F5BA 3IIBA 1BLLE 4MFKA 4NGRA 5G1ZA 3I9SA 3SXNA 1BAVA 4UCNA 3UY5A 4B5PB 5JQ4A 4MMOA 4P4DA 1R3NA 2PJAA 4JD6A 3FBUA 4OC5A 3VATA 3HUVA 5J8CA 4R6TA 3IWGA 2WSAA 2Y0MA 4BMHA 3GKRA 3NA6A 4B13A 3BLNA 8CPAA 4M6HA 3FF3A 5CBMA 2FCKA 3KHXA 1AUGA 4HNWB 3ISZA 2AJ6A 4M3SA 3TX8A 2EWBA 3VWDA 3B3CA 5AG7A 4NGQA 1ARMA 1YSJA 4XNHB 5CNPA 4A31A 4OP4A 1ZG8A 5LYDA 2YNCC 3IEHA 2IJZA 2GANA 4AVAA 2KCWA 1YX0A 1IY7A 2F5IA 3CPXA 3B7IA 3EFAA 3I3GA 3KR4A 2GLFA 1Z8LA 4GM5A 2G9DA 3CXPA 4P6YA 4P4EA 5IV0A 3TO6A 2OZUA 5H84A 3VWEA 4MCSA 3IJ3A 5KTDA 2FL4A 2PVVA 3R9FA 5LRKA 2Q0YA 3IWWA 4KSAA 4B11A 4Q36A 2G3AA 3CDXA 3QB8A 4XPDB 4PXBA 3KQXA 2YNEA 4W9YA 3D8PA 5F48A 4IUSA 4ZX9A 2PJ5A 3IGRA 1S7FA 2HQYA 2B5GA 4MXUA 4P4IA 2Z0ZA 2Z11A 4A30A 5HVGA 1P0HA 3D68A 4KVME 3SJFA 4AXVA 3LMSA 4MHZA 4A94A 4BD9A 5HMNA 2OZGA 2ANPA 1VHSA 3IC1A 4M6GA 5JM6A 3TFYA 2F8HA 4PPZA 3W6XA 2ZW5A 2Z3LA 1JWQA 3DR6A 2JDCA 4HNXB 4OC1A 6CPAA 4NJQA 1S7KA 4IF5A 3H5ZA 4Q38A 2CNMA 1R57A 4KOWA 4EFDA 4MHNA 1BOBA 4XPLA 4Y49B 2JBJA 2NMTA 4FD5A 4KOVA 5HVFA 1OZPA 5GCNA 4YRHA 1Y0RA 1QSOA 4MFZA 4UCMA 1XJOA 4CGNA 3D7DA 5AG5A 5D8NA 3PEIA 3PBEA 2PJ4A 1YW6A 1M1DA 2GFQA 1S60A 1VHOA 4KVOE 4QC6A 2AFSA 4UA3A 2PJ2A 5LYFA 3S6FA 3KL9A 4XPDC 2HB6A 3S6GA 4M85A 2EVNA 1U6MA 2B58A 3BJ8A 2PJ6A 3R1KA 1QSTA 1Z8WA 3B3TA 2OH1A 4U9YA 3NE8A 4B12A 4CAVA 4NGSA 5C82A 1FY7A 4DUKA 4NCZA 3DNSA 5ISVA 1KWMA 1UWYA 2FXFA 2XEFA 4CPAA 4ZY1A 1ZLHA 3FXTA 3R9GA 1CM0A 1CPXA 2BUEA 2VBQA 4A37A 5JH9A 4CGMA 2Q04A 2QVPA 2BOAA 1XBUA 4MFPA 1YW4A 1Z9UA 3PFOA 2R98A 3CPAA 3KGQA 5IX3A 3LODA 4NGTA 1YQEA 4MFLA 2Z3OA 2Z3NA 1IB1E 1H8LA 2EO8A 2PRBA 4MRIA 1X12A 4MFJA 2GREA 1SQHA 1Y7EA 2JDDA 3PFEA 4FD7A 4U9ZA 5G20A 4BINA 1CJWA 2CNSA 3T8WA 2NYQA 2YNDA 2PR1A 2FVGA 4R3LA 2G3TA 2ZELA 3LACA 5F46A 2JEWA 4X8IA 1Q7LA 3H8FA 7CPAA 1MJBA 4R9MA 3WC5A 3H4QA 2GU2A 1I12A 3P2HA 4QVTA 2B4BA 1WK4A 4Y49C 1ZG9A 4MJ8A 3B8GA 1XIXA 1LOKA 5A27A 2PSWA 3S6KA 3K9UA 1M44A 4CS0B 2CXAA 4H2KA 4MCQA 4CYPA 1PUAA 2ZEHA 1JQGA 4CYOA 4C2YA 5I4MA 1S5KA 3SI0A 4B5OA 2C1CA 1A2ZA 5LRJA 1S7LA 5J1QA 2PJ9A 2WPXA 4QUSA 3S9MA 2IQ6A 3WC6A 3MN8A 3V8IA 1QMUA 1M4LA 2PJ7A 5DWMA 4MCPA 5DWNA 2Q43A 4AVCA 2Z3MA 2AFWA 4KOXA 3TT2A 3VH9A 2ARHA 1WWZA 4C2XA 4P10A 3D3SA 4Z65A 4FD6A 1GYTA 5F49A 4PV6A 3D67A 4I49A 1XMTA 2IL4A 4CGLA 2O4HA 3T9YA 4GXHA 2ZEOA 3R9EA 4KZTA 4FAIA 1ZLIA 2VXKA 1RTQA 2PIYA 2REEA 3CT9A 3IWEA 1YLEA 1NMTA 3PB4X 2PVWA 4ORFA 4ZY0A 2BSWA 1MK4A 3FVLA 3FEDA 3BJ7A 1FT7A 2IMOA 4CAWA 3ZZIA 2B4DA 4G1PA 4PXDA 3GUXA 1ELLP 3IU1A 2K5TA 1R43A 1XF8A 2Q4YA 4WWVA 1I21A 2J8NA 5BWAB 3TCVA 4FWUA 2ZPAA 1F57A 4OAEA 4X3RA 2EK9A 5THWA 1LANA 1TKJA 2PC1A 3LWUA 4HNYB 4PK3A 1V0CA 4YU9A 4CYQA 5LYLA 3TTHA 4B6ZA 4ZYQA 1Z8XA 3PGPA 1XRYA 4OC3A 3RYOA 1P4NA 2O53A 2ZOGA 4P4FA 4BBHA 1S3ZA 2R8VA 1HDQA 4M6IA 4ZX8A 4OKOA 2Q7BA 3PZJA 4E2AA 4ZI6A 5A28A 4UWIA 4CAXA 3BI0A 2CTBA 3MGDA 3I1UA 2VI7A 2B3VA 3G3SA 4NJRA 1B6BA 1XOVA 2DPSA 4E0AA 3V38A 4MCRA 2FIAA 4FBEA 3S9NA 3JRUA 4MI4A 2DXQA 2VZYA 3KQZA 4KOTA 5DS0A 4AG9A 2POKA 1YVOA 1ELMP 3R96A 2VZZA 4U5YA 4JXRA 5KTAA 2PJ8A 4K3NA 2REFA 2ZXVA 1EE3P 3WT4A 2JBKA 5HXDA 1DTDA 3B2YA 2G0BA 1AMPA 2GE3A 3D7HA 1MJ9A 3IFEA 3RO0A 3EY5A 5IB9A 2XEGA 3GIUA 4C2ZA 4MY0A 3B3SA 2XEJA 3T90A 2CY2A 1VHEA 2I3CA 2B4DB 3W91A 1Q2CA 3RZAA 5HH1A 2BO9A 2CTCA 2B5GB 2O28A 3F8KA 3JUWA 4KUAA 2D4PA 1BPNA 4R7MA 5K8PA 2R1IA 3FEEA 4NXYA 1Y9WA 3RBUA 2EBJA 2ZEPA 4WJBA 4YGOA 1ZG7A 2OB0A 4JYWA 1PCAA 4UEZA 4YWYA 1MJAA 4CRYB 4R76A 2PJBA 1VKCA 2Q4VA 3EO4A 3VARA 3W6SA 4EVYA 1QQ9A 2BEIA 1QSMA 2FS5A 3FJUA 2FSRA 1QSRA 3HLPA 3N7ZA 1Q2DA 4Q7AA 3TOBA 4DYOA 4NGPA 4KS9A 2ZW6A 4PQAA 1LCPA 1LFWA 2H5MA 2WZNA 2QJ8A 1Z4RA 4MHYA 1IIDA 5K8MA 2ABZA 1IYKA 2I79A 1J4JA 1Y7RA 4K30A 4B14A 1CG2A 2C6GA 1CPSA 3FECA 2WYRA 4UEEA 2PJ1A 4A39A 3FB3A 3F0AA 1M4IA 3SJXA 2WPWA 4FD4A 5JGFA 1HDUA 1NE9A 2P6GA 3H8EA 4TWEA 2OZHA 2PR8A 3GY9A 4ZBGA 2OU2A 2J9AA 4YFJA 1TXRA 2P6EA 4UIBA 1Z8TA 4RN7A 4F9VA 4CAEA 3S6HA 5I0CA 2PQ8A 4NF1A 4EWTA 1GHEA 1IOIA 2VEZA 3KKWA 4OADA 3NH4A 4MFQA 1NSLA 3CXQA 3S9LA 4IAVA 4JJXA 3N5FA 5G21A 2ZEEA 2Z3PA 3DDDA 1XFOA 2I00A 2EK8A 3DLJA 2F7VA 3GLJA 3OWCA 4H6UA 1Z2LA 2EUIA 4LQGA 4X5KA 5AGEA 5KTCA 4II9A 4DJLA 1OBRA 3LD2A 3FH4A 4P4BA 1BO4A 2BL1A 1IOFA 1VGYA 4R3KA 2Q4ZA 3BHXA 3FIXA 3TO9A 3WC7A 4H89A 2QECA 2Z3KA 1Y9KA 4KSIA 4OLLA 2V8DA 4F0YA 1IU8A 4IK2A 4PSXA 2ODFA 3PP9A 1KUXA 5JPHA 3SXOA 4LUAA 3FX6A 5D29A 4A33A 2J8RA 4EMEA 1IYLA 4PK2A 4UEFA 4OC2A 3B3WA 4XNHC 2AFMA 2D4OA 4E8OA 2FIWA 3G8WA 5IB0A 2YNCA 1N71A 1QSNA 2RFHA 1PYTB 1YMEA 2Z10A 3PB7X 1ZO0A 3PB8X 1RXTA 2FE7A 3H8GA 5EBVA 1TF9A 1TF8A 1CP6A 1I1DA 1L0CA 1UFHA 5AG6A 5FVJA 3KASA 4OC0A 4LQ6A 1CP7A 1X10A 4UF4A 2ZEMA 3SI2A 2PJ3A 2C6PA 3CZXA 2Q7SA 4IHMA 5EMIA 3SHPA 3D7FA 2HUZA 5H86A 4MHDA 3A9LA 1Y0YA 3D4UA 2PRQA 4NFRA 4F9UA 2GIVA 4KLVA 3PBBA 4A38A 4UFVA 2DF5A 5J8FA 3GYAA 4JZ0A 3TE4A 3MRUA 2C27A 4L8AA 4MBUA 4MHPA 4UBRA 3WABA 4UCPA 4J3GA 1FNOA 3D2PA 4KUBA 2ZW7A 3K2KA 2OOTA 4LX9A 4NSQA 4KVXA 5ELYA 1CBXA 5G22A 2V8VA 4HPSA 3DR8A 4NGNA 4R8FA 4OC4A 3NE7A 4UWJA 5LRGA 1LAMA 1Z5RA 2QMLA 3D7GA 3FYNA 2JEVA 2V8HA 2CIJA 3D66A 5E96A 4ZGYB 2QYVA 5K8NA 4R87A 3WR7A 3FNCA 4F0XA 2AE6A 2WUUA 4CRZB 4NGMA 3BI1A 1VIXA 1TKFA 4R57A 2RB7A 4X2TA 3TC8A 3KHZA 2JLMA 2HV2A 1XEBA 4C7HA 3SJGA 1CX8A 2AFZA 3C26A 3L2NA 4JXQA 1YREA 1B87A 2ZOFA 4OIWA 3BXMA 3JVNA 5CPAA 2AFXA 4CAFA 2VL1A 3ISXA 1F2OA 2PIZA 4KORA 3NH5A 4UFWA 4XPKA 4QBJA 3EC4A 4RS2A 4TNUA 5F09A 5C88A 1RO5A 3NFZA 1XE4A 3EXNA 3FMCA 1BPMA 2PJCA 2XEIA 2AFUA 5AG4A 2NSMA 1S7NA 3PB9X
chains in the Genus database with same CATH topology
4A2ZA 2VQYA 1Z4EA 4DNCA 1KUVA 4PSWA 2ZW4A 1LRZA 3DSBA 4NEXA 4B5PA 1K4JA 1ON0A 4ONUA 2QIRA 4HKFA 4KOYA 4F6AA 2PDOA 2ATRA 4KLWA 5F47A 2A4NA 2X7BA 4KSFA 4JLYA 1KZFA 4KOUA 4CYNA 4MY3A 2RC4A 4C7IA 1TIQA 1PU9A 2Q44A 3E0KA 3QAHA 4B10A 1YK3A 4A95A 3P2FA 3FRMA 2B3UA 2YGWA 3IU2A 1YR0A 2P0WA 1M4GA 2J8MA 3CXSA 4RI1A 4C68A 1YGHA 3ZJ0A 4AB7A 4L89A 2CNTA 3JTKA 4AVBA 1M4DA 5EC4A 1Q2YA 3TO7A 1KUYA 4KOSA 4AG7A 4GS4A 1IICA 2P6FA 4UFXA 4CGPA 2FT0A 4JWPA 4CGOA 3R95A 4H6ZA 2R7HA 1YVKA 3D2MA 2DPTA 4A32A 3TOAA 4QB9A 3F5BA 4MFKA 5G1ZA 3SXNA 3I9SA 4B5PB 4UCNA 3UY5A 4JD6A 3FBUA 5J8CA 3IWGA 2WSAA 2Y0MA 4BMHA 3GKRA 4B13A 3BLNA 2FCKA 4HNWB 4M3SA 2AJ6A 3VWDA 5AG7A 4XNHB 5CNPA 4A31A 2YNCC 2GANA 4AVAA 2KCWA 1YX0A 2F5IA 3EFAA 3I3GA 3CXPA 5IV0A 3TO6A 2OZUA 5H84A 3VWEA 5KTDA 2FL4A 3R9FA 2Q0YA 4KSAA 4B11A 4Q36A 2G3AA 3QB8A 4XPDB 5F48A 3WR7A 2YNEA 3D8PA 4IUSA 3IGRA 1S7FA 2HQYA 2B5GA 2Z0ZA 2Z11A 4A30A 1P0HA 4KVME 5HMNA 2OZGA 1VHSA 3TFYA 3W6XA 2ZW5A 2Z3LA 3DR6A 2JDCA 4HNXB 1S7KA 4IF5A 3H5ZA 4Q38A 2CNMA 1R57A 4KOWA 1BOBA 4XPLA 4Y49B 2NMTA 4FD5A 4KOVA 1OZPA 5GCNA 4YRHA 1QSOA 4MFZA 4UCMA 4CGNA 5AG5A 1M1DA 4KVOE 1S60A 4QC6A 4UA3A 3S6FA 4XPDC 3S6GA 4M85A 2EVNA 1U6MA 2B58A 3BJ8A 3R1KA 1QSTA 2OH1A 4B12A 4CAVA 5C82A 1FY7A 4NCZA 3DNSA 5ISVA 2FXFA 3FXTA 3R9GA 1CM0A 2BUEA 2VBQA 4CGMA 2Q04A 4MFPA 1Z9UA 2R98A 5IX3A 3LODA 4MFLA 2Z3OA 2Z3NA 1IB1E 2PRBA 4MFJA 1SQHA 2JDDA 4FD7A 4U9ZA 5G20A 1CJWA 2CNSA 2YNDA 2PR1A 4R3LA 2G3TA 5F46A 1MJBA 4R9MA 3H4QA 1I12A 3P2HA 4QVTA 2B4BA 1WK4A 4Y49C 4MJ8A 3B8GA 1XIXA 5A27A 2PSWA 3S6KA 3K9UA 1M44A 4CS0B 2CXAA 4CYPA 1PUAA 4CYOA 4C2YA 1S5KA 4B5OA 1S7LA 2WPXA 4QUSA 3V8IA 5DWMA 5DWNA 4AVCA 2Z3MA 4KOXA 3TT2A 2ARHA 1WWZA 4C2XA 3D3SA 4FD6A 5F49A 4PV6A 4I49A 1XMTA 2IL4A 4CGLA 3T9YA 3R9EA 4KZTA 2VXKA 2REEA 3IWEA 1YLEA 1NMTA 4ORFA 2BSWA 1MK4A 3BJ7A 4CAWA 3ZZIA 2B4DA 3IU1A 2K5TA 1XF8A 2Q4YA 1I21A 2J8NA 5BWAB 3TCVA 2ZPAA 4OAEA 2PC1A 4HNYB 4PK3A 1V0CA 4CYQA 3TTHA 3PGPA 3RYOA 1P4NA 4BBHA 1S3ZA 2R8VA 2Q7BA 4E2AA 3PZJA 5A28A 4UWIA 4CAXA 3MGDA 2VI7A 2B3VA 3G3SA 1B6BA 2DPSA 4E0AA 2FIAA 4MI4A 2DXQA 2VZYA 4KOTA 4AG9A 1YVOA 3R96A 2VZZA 4U5YA 4JXRA 5KTAA 2REFA 2ZXVA 2G0BA 2GE3A 1MJ9A 3EY5A 4C2ZA 4MY0A 3T90A 2CY2A 3W91A 2B4DB 1Q2CA 5HH1A 3JUWA 2B5GB 2O28A 3F8KA 4KUAA 2D4PA 2R1IA 4NXYA 1Y9WA 4YGOA 2OB0A 1MJAA 4CRYB 2Q4VA 1VKCA 3EO4A 3W6SA 4EVYA 2BEIA 1QSMA 2FS5A 2FSRA 1QSRA 3N7ZA 1Q2DA 3TOBA 4KS9A 2ZW6A 2H5MA 1Z4RA 1IIDA 2I79A 1IYKA 1J4JA 1Y7RA 4K30A 4B14A 3FB3A 3F0AA 1M4IA 2WPWA 4FD4A 1NE9A 2P6GA 2OZHA 2PR8A 3GY9A 4ZBGA 2OU2A 4YFJA 2P6EA 4CAEA 3S6HA 2PQ8A 4NF1A 1GHEA 2VEZA 3KKWA 4OADA 4MFQA 1NSLA 3CXQA 4JJXA 5G21A 2Z3PA 3DDDA 2I00A 4H6UA 5I0CA 5JQ4A 3OWCA 5AGEA 5KTCA 4X5KA 2EUIA 4II9A 3LD2A 1BO4A 2BL1A 4R3KA 3FIXA 3TO9A 4H89A 2QECA 2Z3KA 1Y9KA 4OLLA 4F0YA 4PSXA 3PP9A 1KUXA 5JPHA 3SXOA 4LUAA 4A33A 2J8RA 1IYLA 4PK2A 4XNHC 4E8OA 2D4OA 2FIWA 3G8WA 5IB0A 2YNCA 1N71A 1QSNA 2Z10A 1ZO0A 1RXTA 2FE7A 5EBVA 1I1DA 1L0CA 1UFHA 5AG6A 5FVJA 3SHPA 2HUZA 5H86A 4MHDA 3A9LA 2GIVA 4KLVA 4UFVA 5J8FA 3GYAA 3TE4A 2C27A 4L8AA 4MBUA 4UBRA 4UCPA 4J3GA 3D2PA 4KUBA 2ZW7A 4LX9A 4NSQA 4KVXA 5G22A 3DR8A 3NE7A 4UWJA 3FYNA 2QMLA 2JEVA 5E96A 4ZGYB 4R87A 3FNCA 4F0XA 2AE6A 2WUUA 4CRZB 4R57A 2HV2A 2JLMA 1XEBA 4C7HA 3C26A 4JXQA 1YREA 1B87A 4CAFA 3JVNA 4KORA 4UFWA 4XPKA 4QBJA 3EC4A 4RS2A 5C88A 1RO5A 1XE4A 3EXNA 5AG4A 1S7NA 4U9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQY A;  1Z4E A;  4DNC A;  1KUV A;  4PSW A;  2ZW4 A;  1LRZ A;  3DSB A;  4NEX A;  4B5P A;  1K4J A;  1ON0 A;  4ONU A;  2QIR A;  4HKF A;  4KOY A;  4F6A A;  2PDO A;  2ATR A;  4KLW A;  5F47 A;  2A4N A;  2X7B A;  4JLY A;  1KZF A;  4KOU A;  4MY3 A;  2RC4 A;  1TIQ A;  1PU9 A;  2Q44 A;  3E0K A;  3QAH A;  1YK3 A;  3P2F A;  3FRM A;  2B3U A;  1YR0 A;  2P0W A;  1M4G A;  2J8M A;  3CXS A;  4RI1 A;  1YGH A;  3ZJ0 A;  4AB7 A;  4L89 A;  2CNT A;  4AVB A;  1M4D A;  5EC4 A;  1Q2Y A;  3TO7 A;  1KUY A;  4KOS A;  4AG7 A;  4GS4 A;  1IIC A;  2P6F A;  2FT0 A;  4JWP A;  3R95 A;  4H6Z A;  2R7H A;  1YVK A;  3D2M A;  3TOA A;  4QB9 A;  3F5B A;  3SXN A;  3I9S A;  4B5P B;  3UY5 A;  4JD6 A;  3FBU A;  5J8C A;  3IWG A;  2Y0M A;  4BMH A;  3GKR A;  3BLN A;  2FCK A;  4HNW B;  4M3S A;  2AJ6 A;  3VWD A;  4XNH B;  5CNP A;  2GAN A;  4AVA A;  2KCW A;  1YX0 A;  2F5I A;  3EFA A;  3I3G A;  3CXP A;  5IV0 A;  3TO6 A;  2OZU A;  5H84 A;  3VWE A;  5KTD A;  2FL4 A;  3R9F A;  2Q0Y A;  2G3A A;  3QB8 A;  4XPD B;  5F48 A;  3WR7 A;  3D8P A;  4IUS A;  3IGR A;  1S7F A;  2HQY A;  2B5G A;  2Z0Z A;  2Z11 A;  1P0H A;  4KVM E;  5HMN A;  2OZG A;  1VHS A;  3TFY A;  3W6X A;  2ZW5 A;  3DR6 A;  2JDC A;  4HNX B;  1S7K A;  4IF5 A;  2CNM A;  1R57 A;  4KOW A;  1BOB A;  4XPL A;  4Y49 B;  2NMT A;  4FD5 A;  4KOV A;  1OZP A;  5GCN A;  4YRH A;  1QSO A;  1M1D A;  4KVO E;  1S60 A;  4QC6 A;  4UA3 A;  3S6F A;  4XPD C;  3S6G A;  4M85 A;  2EVN A;  1U6M A;  2B58 A;  3BJ8 A;  3R1K A;  1QST A;  2OH1 A;  4CAV A;  5C82 A;  1FY7 A;  4NCZ A;  3DNS A;  5ISV A;  2FXF A;  3FXT A;  3R9G A;  1CM0 A;  2BUE A;  2VBQ A;  2Q04 A;  1Z9U A;  2R98 A;  5IX3 A;  3LOD A;  1IB1 E;  2PRB A;  1SQH A;  2JDD A;  4FD7 A;  4U9Z A;  1CJW A;  2CNS A;  2PR1 A;  4R3L A;  2G3T A;  5F46 A;  1MJB A;  4R9M A;  3H4Q A;  4QVT A;  1I12 A;  3P2H A;  2B4B A;  1WK4 A;  4Y49 C;  4MJ8 A;  3B8G A;  1XIX A;  2PSW A;  3S6K A;  3K9U A;  1M44 A;  4CS0 B;  1PUA A;  1S5K A;  4B5O A;  1S7L A;  2WPX A;  4QUS A;  3V8I A;  5DWM A;  5DWN A;  4AVC A;  4KOX A;  3TT2 A;  2ARH A;  1WWZ A;  3D3S A;  4FD6 A;  5F49 A;  4PV6 A;  4I49 A;  1XMT A;  2IL4 A;  3T9Y A;  3R9E A;  4KZT A;  2VXK A;  2REE A;  1YLE A;  1NMT A;  4ORF A;  2BSW A;  1MK4 A;  3BJ7 A;  4CAW A;  3ZZI A;  2B4D A;  2K5T A;  1XF8 A;  2Q4Y A;  1I21 A;  2J8N A;  3TCV A;  2ZPA A;  4OAE A;  2PC1 A;  4HNY B;  4PK3 A;  1V0C A;  3TTH A;  3PGP A;  3RYO A;  1P4N A;  1S3Z A;  2R8V A;  2Q7B A;  4E2A A;  3PZJ A;  4UWI A;  4CAX A;  3MGD A;  2VI7 A;  2B3V A;  3G3S A;  1B6B A;  4E0A A;  2FIA A;  4MI4 A;  2DXQ A;  2VZY A;  4KOT A;  4AG9 A;  1YVO A;  3R96 A;  2VZZ A;  4U5Y A;  4JXR A;  5KTA A;  2REF A;  2ZXV A;  2G0B A;  2GE3 A;  1MJ9 A;  3EY5 A;  4MY0 A;  3T90 A;  2CY2 A;  3W91 A;  2B4D B;  1Q2C A;  5HH1 A;  3JUW A;  2B5G B;  2O28 A;  3F8K A;  4KUA A;  2D4P A;  2R1I A;  4NXY A;  1Y9W A;  4YGO A;  2OB0 A;  1MJA A;  4CRY B;  2Q4V A;  1VKC A;  3EO4 A;  3W6S A;  4EVY A;  2BEI A;  1QSM A;  2FS5 A;  2FSR A;  1QSR A;  3N7Z A;  1Q2D A;  3TOB A;  2ZW6 A;  2H5M A;  1Z4R A;  1IID A;  2I79 A;  1IYK A;  1J4J A;  1Y7R A;  4K30 A;  3FB3 A;  3F0A A;  1M4I A;  2WPW A;  4FD4 A;  1NE9 A;  2P6G A;  2OZH A;  2PR8 A;  3GY9 A;  4ZBG A;  2OU2 A;  4YFJ A;  2P6E A;  3S6H A;  2PQ8 A;  4NF1 A;  1GHE A;  2VEZ A;  3KKW A;  4OAD A;  1NSL A;  3CXQ A;  4JJX A;  3DDD A;  2I00 A;  4H6U A;  5I0C A;  5JQ4 A;  3OWC A;  5KTC A;  4X5K A;  2EUI A;  4II9 A;  3LD2 A;  1BO4 A;  2BL1 A;  4R3K A;  3FIX A;  3TO9 A;  4H89 A;  2QEC A;  4OLL A;  1Y9K A;  4F0Y A;  4PSX A;  3PP9 A;  1KUX A;  5JPH A;  3SXO A;  4LUA A;  2J8R A;  1IYL A;  4PK2 A;  4XNH C;  4E8O A;  2D4O A;  2FIW A;  3G8W A;  5IB0 A;  1N71 A;  1QSN A;  2Z10 A;  1RXT A;  2FE7 A;  5EBV A;  1I1D A;  1L0C A;  1UFH A;  5FVJ A;  3SHP A;  2HUZ A;  5H86 A;  4MHD A;  2GIV A;  4KLV A;  5J8F A;  3GYA A;  3TE4 A;  2C27 A;  4L8A A;  4MBU A;  4UBR A;  4J3G A;  3D2P A;  4KUB A;  2ZW7 A;  4LX9 A;  4NSQ A;  4KVX A;  3DR8 A;  3NE7 A;  4UWJ A;  3FYN A;  2QML A;  2JEV A;  5E96 A;  4R87 A;  3FNC A;  2AE6 A;  4CRZ B;  4R57 A;  2HV2 A;  2JLM A;  1XEB A;  3C26 A;  4JXQ A;  1YRE A;  1B87 A;  3JVN A;  4KOR A;  4XPK A;  4QBJ A;  3EC4 A;  4RS2 A;  5C88 A;  1RO5 A;  1XE4 A;  3EXN A;  1S7N A;  4U9Y A; 
#chains in the Genus database with same CATH topology
 4A2Z A;  5HVH A;  4PXE A;  2VQY A;  1Z4E A;  4DNC A;  2Q51 A;  1KUV A;  3KZW A;  4PSW A;  1NSA A;  2ZEG A;  2ZW4 A;  1LRZ A;  3DSB A;  4NEX A;  4B5P A;  1K4J A;  2ZEN A;  3KR5 A;  1ON0 A;  4PXC A;  4ONU A;  3KI9 A;  2QIR A;  4F8Z A;  4HKF A;  2CF4 A;  4KOY A;  4F6A A;  2PDO A;  3DGV A;  2V77 A;  2ATR A;  4KLW A;  5F47 A;  3V7Z A;  2A4N A;  2X7B A;  4KSF A;  4JLY A;  2GLJ A;  3B35 A;  3PB6 X;  1KZF A;  4KOU A;  1HEE A;  4CYN A;  4MY3 A;  2RC4 A;  4UIA A;  4C7I A;  1TIQ A;  2PCU A;  2V8G A;  1PU9 A;  2Q44 A;  3PRT A;  3E0K A;  3SJE A;  2ZED A;  3QAY A;  4ZY2 A;  3QAH A;  2AFO A;  1YK3 A;  5LYI A;  4A95 A;  3P2F A;  4B10 A;  1ARL A;  3FRM A;  3B3V A;  2HC9 A;  4ONW A;  2B3U A;  2YGW A;  3IU2 A;  1IGB A;  3RAM A;  2P0W A;  1YR0 A;  1M4G A;  2J8M A;  1XMB A;  3CXS A;  4OME A;  4RUH A;  4RI1 A;  4C68 A;  1YGH A;  3ZJ0 A;  4AB7 A;  3IO1 A;  1DE4 C;  1LAP A;  1TKH A;  2CNT A;  3JTK A;  4L89 A;  4AVB A;  1M4D A;  5EC4 A;  1Q2Y A;  3TO7 A;  1F2P A;  5K8O A;  3NH8 A;  2BCO A;  1KUY A;  4KOS A;  3QNV A;  4P45 A;  4GS4 A;  4AG7 A;  1IIC A;  2P6F A;  4UFX A;  4CGP A;  4FUU A;  4P4J A;  1YLO A;  2FT0 A;  4JWP A;  4CGO A;  1AYE A;  2PJ0 A;  2OR4 A;  3R95 A;  4O23 A;  3K9T A;  3GB0 A;  4H6Z A;  3RNZ A;  2PE3 A;  2R7H A;  2DEA A;  4P44 A;  1YVK A;  3D2M A;  3SI1 A;  2DPT A;  4A32 A;  4OID A;  3TOA A;  4QB9 A;  2ZEF A;  2C6C A;  3F5B A;  3IIB A;  1BLL E;  4MFK A;  4NGR A;  5G1Z A;  3I9S A;  3SXN A;  1BAV A;  4UCN A;  3UY5 A;  4B5P B;  5JQ4 A;  4MMO A;  4P4D A;  1R3N A;  2PJA A;  4JD6 A;  3FBU A;  4OC5 A;  3VAT A;  3HUV A;  5J8C A;  4R6T A;  3IWG A;  2WSA A;  2Y0M A;  4BMH A;  3GKR A;  3NA6 A;  4B13 A;  3BLN A;  8CPA A;  4M6H A;  3FF3 A;  5CBM A;  2FCK A;  3KHX A;  1AUG A;  4HNW B;  3ISZ A;  2AJ6 A;  4M3S A;  3TX8 A;  2EWB A;  3VWD A;  3B3C A;  5AG7 A;  4NGQ A;  1ARM A;  1YSJ A;  4XNH B;  5CNP A;  4A31 A;  4OP4 A;  1ZG8 A;  5LYD A;  2YNC C;  3IEH A;  2IJZ A;  2GAN A;  4AVA A;  2KCW A;  1YX0 A;  1IY7 A;  2F5I A;  3CPX A;  3B7I A;  3EFA A;  3I3G A;  3KR4 A;  2GLF A;  1Z8L A;  4GM5 A;  2G9D A;  3CXP A;  4P6Y A;  4P4E A;  5IV0 A;  3TO6 A;  2OZU A;  5H84 A;  3VWE A;  4MCS A;  3IJ3 A;  5KTD A;  2FL4 A;  2PVV A;  3R9F A;  5LRK A;  2Q0Y A;  3IWW A;  4KSA A;  4B11 A;  4Q36 A;  2G3A A;  3CDX A;  3QB8 A;  4XPD B;  4PXB A;  3KQX A;  2YNE A;  4W9Y A;  3D8P A;  5F48 A;  4IUS A;  4ZX9 A;  2PJ5 A;  3IGR A;  1S7F A;  2HQY A;  2B5G A;  4MXU A;  4P4I A;  2Z0Z A;  2Z11 A;  4A30 A;  5HVG A;  1P0H A;  3D68 A;  4KVM E;  3SJF A;  4AXV A;  3LMS A;  4MHZ A;  4A94 A;  4BD9 A;  5HMN A;  2OZG A;  2ANP A;  1VHS A;  3IC1 A;  4M6G A;  5JM6 A;  3TFY A;  2F8H A;  4PPZ A;  3W6X A;  2ZW5 A;  2Z3L A;  1JWQ A;  3DR6 A;  2JDC A;  4HNX B;  4OC1 A;  6CPA A;  4NJQ A;  1S7K A;  4IF5 A;  3H5Z A;  4Q38 A;  2CNM A;  1R57 A;  4KOW A;  4EFD A;  4MHN A;  1BOB A;  4XPL A;  4Y49 B;  2JBJ A;  2NMT A;  4FD5 A;  4KOV A;  5HVF A;  1OZP A;  5GCN A;  4YRH A;  1Y0R A;  1QSO A;  4MFZ A;  4UCM A;  1XJO A;  4CGN A;  3D7D A;  5AG5 A;  5D8N A;  3PEI A;  3PBE A;  2PJ4 A;  1YW6 A;  1M1D A;  2GFQ A;  1S60 A;  1VHO A;  4KVO E;  4QC6 A;  2AFS A;  4UA3 A;  2PJ2 A;  5LYF A;  3S6F A;  3KL9 A;  4XPD C;  2HB6 A;  3S6G A;  4M85 A;  2EVN A;  1U6M A;  2B58 A;  3BJ8 A;  2PJ6 A;  3R1K A;  1QST A;  1Z8W A;  3B3T A;  2OH1 A;  4U9Y A;  3NE8 A;  4B12 A;  4CAV A;  4NGS A;  5C82 A;  1FY7 A;  4DUK A;  4NCZ A;  3DNS A;  5ISV A;  1KWM A;  1UWY A;  2FXF A;  2XEF A;  4CPA A;  4ZY1 A;  1ZLH A;  3FXT A;  3R9G A;  1CM0 A;  1CPX A;  2BUE A;  2VBQ A;  4A37 A;  5JH9 A;  4CGM A;  2Q04 A;  2QVP A;  2BOA A;  1XBU A;  4MFP A;  1YW4 A;  1Z9U A;  3PFO A;  2R98 A;  3CPA A;  3KGQ A;  5IX3 A;  3LOD A;  4NGT A;  1YQE A;  4MFL A;  2Z3O A;  2Z3N A;  1IB1 E;  1H8L A;  2EO8 A;  2PRB A;  4MRI A;  1X12 A;  4MFJ A;  2GRE A;  1SQH A;  1Y7E A;  2JDD A;  3PFE A;  4FD7 A;  4U9Z A;  5G20 A;  4BIN A;  1CJW A;  2CNS A;  3T8W A;  2NYQ A;  2YND A;  2PR1 A;  2FVG A;  4R3L A;  2G3T A;  2ZEL A;  3LAC A;  5F46 A;  2JEW A;  4X8I A;  1Q7L A;  3H8F A;  7CPA A;  1MJB A;  4R9M A;  3WC5 A;  3H4Q A;  2GU2 A;  1I12 A;  3P2H A;  4QVT A;  2B4B A;  1WK4 A;  4Y49 C;  1ZG9 A;  4MJ8 A;  3B8G A;  1XIX A;  1LOK A;  5A27 A;  2PSW A;  3S6K A;  3K9U A;  1M44 A;  4CS0 B;  2CXA A;  4H2K A;  4MCQ A;  4CYP A;  1PUA A;  2ZEH A;  1JQG A;  4CYO A;  4C2Y A;  5I4M A;  1S5K A;  3SI0 A;  4B5O A;  2C1C A;  1A2Z A;  5LRJ A;  1S7L A;  5J1Q A;  2PJ9 A;  2WPX A;  4QUS A;  3S9M A;  2IQ6 A;  3WC6 A;  3MN8 A;  3V8I A;  1QMU A;  1M4L A;  2PJ7 A;  5DWM A;  4MCP A;  5DWN A;  2Q43 A;  4AVC A;  2Z3M A;  2AFW A;  4KOX A;  3TT2 A;  3VH9 A;  2ARH A;  1WWZ A;  4C2X A;  4P10 A;  3D3S A;  4Z65 A;  4FD6 A;  1GYT A;  5F49 A;  4PV6 A;  3D67 A;  4I49 A;  1XMT A;  2IL4 A;  4CGL A;  2O4H A;  3T9Y A;  4GXH A;  2ZEO A;  3R9E A;  4KZT A;  4FAI A;  1ZLI A;  2VXK A;  1RTQ A;  2PIY A;  2REE A;  3CT9 A;  3IWE A;  1YLE A;  1NMT A;  3PB4 X;  2PVW A;  4ORF A;  4ZY0 A;  2BSW A;  1MK4 A;  3FVL A;  3FED A;  3BJ7 A;  1FT7 A;  2IMO A;  4CAW A;  3ZZI A;  2B4D A;  4G1P A;  4PXD A;  3GUX A;  1ELL P;  3IU1 A;  2K5T A;  1R43 A;  1XF8 A;  2Q4Y A;  4WWV A;  1I21 A;  2J8N A;  5BWA B;  3TCV A;  4FWU A;  2ZPA A;  1F57 A;  4OAE A;  4X3R A;  2EK9 A;  5THW A;  1LAN A;  1TKJ A;  2PC1 A;  3LWU A;  4HNY B;  4PK3 A;  1V0C A;  4YU9 A;  4CYQ A;  5LYL A;  3TTH A;  4B6Z A;  4ZYQ A;  1Z8X A;  3PGP A;  1XRY A;  4OC3 A;  3RYO A;  1P4N A;  2O53 A;  2ZOG A;  4P4F A;  4BBH A;  1S3Z A;  2R8V A;  1HDQ A;  4M6I A;  4ZX8 A;  4OKO A;  2Q7B A;  3PZJ A;  4E2A A;  4ZI6 A;  5A28 A;  4UWI A;  4CAX A;  3BI0 A;  2CTB A;  3MGD A;  3I1U A;  2VI7 A;  2B3V A;  3G3S A;  4NJR A;  1B6B A;  1XOV A;  2DPS A;  4E0A A;  3V38 A;  4MCR A;  2FIA A;  4FBE A;  3S9N A;  3JRU A;  4MI4 A;  2DXQ A;  2VZY A;  3KQZ A;  4KOT A;  5DS0 A;  4AG9 A;  2POK A;  1YVO A;  1ELM P;  3R96 A;  2VZZ A;  4U5Y A;  4JXR A;  5KTA A;  2PJ8 A;  4K3N A;  2REF A;  2ZXV A;  1EE3 P;  3WT4 A;  2JBK A;  5HXD A;  1DTD A;  3B2Y A;  2G0B A;  1AMP A;  2GE3 A;  3D7H A;  1MJ9 A;  3IFE A;  3RO0 A;  3EY5 A;  5IB9 A;  2XEG A;  3GIU A;  4C2Z A;  4MY0 A;  3B3S A;  2XEJ A;  3T90 A;  2CY2 A;  1VHE A;  2I3C A;  2B4D B;  3W91 A;  1Q2C A;  3RZA A;  5HH1 A;  2BO9 A;  2CTC A;  2B5G B;  2O28 A;  3F8K A;  3JUW A;  4KUA A;  2D4P A;  1BPN A;  4R7M A;  5K8P A;  2R1I A;  3FEE A;  4NXY A;  1Y9W A;  3RBU A;  2EBJ A;  2ZEP A;  4WJB A;  4YGO A;  1ZG7 A;  2OB0 A;  4JYW A;  1PCA A;  4UEZ A;  4YWY A;  1MJA A;  4CRY B;  4R76 A;  2PJB A;  1VKC A;  2Q4V A;  3EO4 A;  3VAR A;  3W6S A;  4EVY A;  1QQ9 A;  2BEI A;  1QSM A;  2FS5 A;  3FJU A;  2FSR A;  1QSR A;  3HLP A;  3N7Z A;  1Q2D A;  4Q7A A;  3TOB A;  4DYO A;  4NGP A;  4KS9 A;  2ZW6 A;  4PQA A;  1LCP A;  1LFW A;  2H5M A;  2WZN A;  2QJ8 A;  1Z4R A;  4MHY A;  1IID A;  5K8M A;  2ABZ A;  1IYK A;  2I79 A;  1J4J A;  1Y7R A;  4K30 A;  4B14 A;  1CG2 A;  2C6G A;  1CPS A;  3FEC A;  2WYR A;  4UEE A;  2PJ1 A;  4A39 A;  3FB3 A;  3F0A A;  1M4I A;  3SJX A;  2WPW A;  4FD4 A;  5JGF A;  1HDU A;  1NE9 A;  2P6G A;  3H8E A;  4TWE A;  2OZH A;  2PR8 A;  3GY9 A;  4ZBG A;  2OU2 A;  2J9A A;  4YFJ A;  1TXR A;  2P6E A;  4UIB A;  1Z8T A;  4RN7 A;  4F9V A;  4CAE A;  3S6H A;  5I0C A;  2PQ8 A;  4NF1 A;  4EWT A;  1GHE A;  1IOI A;  2VEZ A;  3KKW A;  4OAD A;  3NH4 A;  4MFQ A;  1NSL A;  3CXQ A;  3S9L A;  4IAV A;  4JJX A;  3N5F A;  5G21 A;  2ZEE A;  2Z3P A;  3DDD A;  1XFO A;  2I00 A;  2EK8 A;  3DLJ A;  2F7V A;  3GLJ A;  3OWC A;  4H6U A;  1Z2L A;  2EUI A;  4LQG A;  4X5K A;  5AGE A;  5KTC A;  4II9 A;  4DJL A;  1OBR A;  3LD2 A;  3FH4 A;  4P4B A;  1BO4 A;  2BL1 A;  1IOF A;  1VGY A;  4R3K A;  2Q4Z A;  3BHX A;  3FIX A;  3TO9 A;  3WC7 A;  4H89 A;  2QEC A;  2Z3K A;  1Y9K A;  4KSI A;  4OLL A;  2V8D A;  4F0Y A;  1IU8 A;  4IK2 A;  4PSX A;  2ODF A;  3PP9 A;  1KUX A;  5JPH A;  3SXO A;  4LUA A;  3FX6 A;  5D29 A;  4A33 A;  2J8R A;  4EME A;  1IYL A;  4PK2 A;  4UEF A;  4OC2 A;  3B3W A;  4XNH C;  2AFM A;  2D4O A;  4E8O A;  2FIW A;  3G8W A;  5IB0 A;  2YNC A;  1N71 A;  1QSN A;  2RFH A;  1PYT B;  1YME A;  2Z10 A;  3PB7 X;  1ZO0 A;  3PB8 X;  1RXT A;  2FE7 A;  3H8G A;  5EBV A;  1TF9 A;  1TF8 A;  1CP6 A;  1I1D A;  1L0C A;  1UFH A;  5AG6 A;  5FVJ A;  3KAS A;  4OC0 A;  4LQ6 A;  1CP7 A;  1X10 A;  4UF4 A;  2ZEM A;  3SI2 A;  2PJ3 A;  2C6P A;  3CZX A;  2Q7S A;  4IHM A;  5EMI A;  3SHP A;  3D7F A;  2HUZ A;  5H86 A;  4MHD A;  3A9L A;  1Y0Y A;  3D4U A;  2PRQ A;  4NFR A;  4F9U A;  2GIV A;  4KLV A;  3PBB A;  4A38 A;  4UFV A;  2DF5 A;  5J8F A;  3GYA A;  4JZ0 A;  3TE4 A;  3MRU A;  2C27 A;  4L8A A;  4MBU A;  4MHP A;  4UBR A;  3WAB A;  4UCP A;  4J3G A;  1FNO A;  3D2P A;  4KUB A;  2ZW7 A;  3K2K A;  2OOT A;  4LX9 A;  4NSQ A;  4KVX A;  5ELY A;  1CBX A;  5G22 A;  2V8V A;  4HPS A;  3DR8 A;  4NGN A;  4R8F A;  4OC4 A;  3NE7 A;  4UWJ A;  5LRG A;  1LAM A;  1Z5R A;  2QML A;  3D7G A;  3FYN A;  2JEV A;  2V8H A;  2CIJ A;  3D66 A;  5E96 A;  4ZGY B;  2QYV A;  5K8N A;  4R87 A;  3WR7 A;  3FNC A;  4F0X A;  2AE6 A;  2WUU A;  4CRZ B;  4NGM A;  3BI1 A;  1VIX A;  1TKF A;  4R57 A;  2RB7 A;  4X2T A;  3TC8 A;  3KHZ A;  2JLM A;  2HV2 A;  1XEB A;  4C7H A;  3SJG A;  1CX8 A;  2AFZ A;  3C26 A;  3L2N A;  4JXQ A;  1YRE A;  1B87 A;  2ZOF A;  4OIW A;  3BXM A;  3JVN A;  5CPA A;  2AFX A;  4CAF A;  2VL1 A;  3ISX A;  1F2O A;  2PIZ A;  4KOR A;  3NH5 A;  4UFW A;  4XPK A;  4QBJ A;  3EC4 A;  4RS2 A;  4TNU A;  5F09 A;  5C88 A;  1RO5 A;  3NFZ A;  1XE4 A;  3EXN A;  3FMC A;  1BPM A;  2PJC A;  2XEI A;  2AFU A;  5AG4 A;  2NSM A;  1S7N A;  3PB9 X; 
#chains in the Genus database with same CATH homology
 4A2Z A;  2VQY A;  1Z4E A;  4DNC A;  1KUV A;  4PSW A;  2ZW4 A;  1LRZ A;  3DSB A;  4NEX A;  4B5P A;  1K4J A;  1ON0 A;  4ONU A;  2QIR A;  4HKF A;  4KOY A;  4F6A A;  2PDO A;  2ATR A;  4KLW A;  5F47 A;  2A4N A;  2X7B A;  4KSF A;  4JLY A;  1KZF A;  4KOU A;  4CYN A;  4MY3 A;  2RC4 A;  4C7I A;  1TIQ A;  1PU9 A;  2Q44 A;  3E0K A;  3QAH A;  4B10 A;  1YK3 A;  4A95 A;  3P2F A;  3FRM A;  2B3U A;  2YGW A;  3IU2 A;  1YR0 A;  2P0W A;  1M4G A;  2J8M A;  3CXS A;  4RI1 A;  4C68 A;  1YGH A;  3ZJ0 A;  4AB7 A;  4L89 A;  2CNT A;  3JTK A;  4AVB A;  1M4D A;  5EC4 A;  1Q2Y A;  3TO7 A;  1KUY A;  4KOS A;  4AG7 A;  4GS4 A;  1IIC A;  2P6F A;  4UFX A;  4CGP A;  2FT0 A;  4JWP A;  4CGO A;  3R95 A;  4H6Z A;  2R7H A;  1YVK A;  3D2M A;  2DPT A;  4A32 A;  3TOA A;  4QB9 A;  3F5B A;  4MFK A;  5G1Z A;  3SXN A;  3I9S A;  4B5P B;  4UCN A;  3UY5 A;  4JD6 A;  3FBU A;  5J8C A;  3IWG A;  2WSA A;  2Y0M A;  4BMH A;  3GKR A;  4B13 A;  3BLN A;  2FCK A;  4HNW B;  4M3S A;  2AJ6 A;  3VWD A;  5AG7 A;  4XNH B;  5CNP A;  4A31 A;  2YNC C;  2GAN A;  4AVA A;  2KCW A;  1YX0 A;  2F5I A;  3EFA A;  3I3G A;  3CXP A;  5IV0 A;  3TO6 A;  2OZU A;  5H84 A;  3VWE A;  5KTD A;  2FL4 A;  3R9F A;  2Q0Y A;  4KSA A;  4B11 A;  4Q36 A;  2G3A A;  3QB8 A;  4XPD B;  5F48 A;  3WR7 A;  2YNE A;  3D8P A;  4IUS A;  3IGR A;  1S7F A;  2HQY A;  2B5G A;  2Z0Z A;  2Z11 A;  4A30 A;  1P0H A;  4KVM E;  5HMN A;  2OZG A;  1VHS A;  3TFY A;  3W6X A;  2ZW5 A;  2Z3L A;  3DR6 A;  2JDC A;  4HNX B;  1S7K A;  4IF5 A;  3H5Z A;  4Q38 A;  2CNM A;  1R57 A;  4KOW A;  1BOB A;  4XPL A;  4Y49 B;  2NMT A;  4FD5 A;  4KOV A;  1OZP A;  5GCN A;  4YRH A;  1QSO A;  4MFZ A;  4UCM A;  4CGN A;  5AG5 A;  1M1D A;  4KVO E;  1S60 A;  4QC6 A;  4UA3 A;  3S6F A;  4XPD C;  3S6G A;  4M85 A;  2EVN A;  1U6M A;  2B58 A;  3BJ8 A;  3R1K A;  1QST A;  2OH1 A;  4B12 A;  4CAV A;  5C82 A;  1FY7 A;  4NCZ A;  3DNS A;  5ISV A;  2FXF A;  3FXT A;  3R9G A;  1CM0 A;  2BUE A;  2VBQ A;  4CGM A;  2Q04 A;  4MFP A;  1Z9U A;  2R98 A;  5IX3 A;  3LOD A;  4MFL A;  2Z3O A;  2Z3N A;  1IB1 E;  2PRB A;  4MFJ A;  1SQH A;  2JDD A;  4FD7 A;  4U9Z A;  5G20 A;  1CJW A;  2CNS A;  2YND A;  2PR1 A;  4R3L A;  2G3T A;  5F46 A;  1MJB A;  4R9M A;  3H4Q A;  1I12 A;  3P2H A;  4QVT A;  2B4B A;  1WK4 A;  4Y49 C;  4MJ8 A;  3B8G A;  1XIX A;  5A27 A;  2PSW A;  3S6K A;  3K9U A;  1M44 A;  4CS0 B;  2CXA A;  4CYP A;  1PUA A;  4CYO A;  4C2Y A;  1S5K A;  4B5O A;  1S7L A;  2WPX A;  4QUS A;  3V8I A;  5DWM A;  5DWN A;  4AVC A;  2Z3M A;  4KOX A;  3TT2 A;  2ARH A;  1WWZ A;  4C2X A;  3D3S A;  4FD6 A;  5F49 A;  4PV6 A;  4I49 A;  1XMT A;  2IL4 A;  4CGL A;  3T9Y A;  3R9E A;  4KZT A;  2VXK A;  2REE A;  3IWE A;  1YLE A;  1NMT A;  4ORF A;  2BSW A;  1MK4 A;  3BJ7 A;  4CAW A;  3ZZI A;  2B4D A;  3IU1 A;  2K5T A;  1XF8 A;  2Q4Y A;  1I21 A;  2J8N A;  5BWA B;  3TCV A;  2ZPA A;  4OAE A;  2PC1 A;  4HNY B;  4PK3 A;  1V0C A;  4CYQ A;  3TTH A;  3PGP A;  3RYO A;  1P4N A;  4BBH A;  1S3Z A;  2R8V A;  2Q7B A;  4E2A A;  3PZJ A;  5A28 A;  4UWI A;  4CAX A;  3MGD A;  2VI7 A;  2B3V A;  3G3S A;  1B6B A;  2DPS A;  4E0A A;  2FIA A;  4MI4 A;  2DXQ A;  2VZY A;  4KOT A;  4AG9 A;  1YVO A;  3R96 A;  2VZZ A;  4U5Y A;  4JXR A;  5KTA A;  2REF A;  2ZXV A;  2G0B A;  2GE3 A;  1MJ9 A;  3EY5 A;  4C2Z A;  4MY0 A;  3T90 A;  2CY2 A;  3W91 A;  2B4D B;  1Q2C A;  5HH1 A;  3JUW A;  2B5G B;  2O28 A;  3F8K A;  4KUA A;  2D4P A;  2R1I A;  4NXY A;  1Y9W A;  4YGO A;  2OB0 A;  1MJA A;  4CRY B;  2Q4V A;  1VKC A;  3EO4 A;  3W6S A;  4EVY A;  2BEI A;  1QSM A;  2FS5 A;  2FSR A;  1QSR A;  3N7Z A;  1Q2D A;  3TOB A;  4KS9 A;  2ZW6 A;  2H5M A;  1Z4R A;  1IID A;  2I79 A;  1IYK A;  1J4J A;  1Y7R A;  4K30 A;  4B14 A;  3FB3 A;  3F0A A;  1M4I A;  2WPW A;  4FD4 A;  1NE9 A;  2P6G A;  2OZH A;  2PR8 A;  3GY9 A;  4ZBG A;  2OU2 A;  4YFJ A;  2P6E A;  4CAE A;  3S6H A;  2PQ8 A;  4NF1 A;  1GHE A;  2VEZ A;  3KKW A;  4OAD A;  4MFQ A;  1NSL A;  3CXQ A;  4JJX A;  5G21 A;  2Z3P A;  3DDD A;  2I00 A;  4H6U A;  5I0C A;  5JQ4 A;  3OWC A;  5AGE A;  5KTC A;  4X5K A;  2EUI A;  4II9 A;  3LD2 A;  1BO4 A;  2BL1 A;  4R3K A;  3FIX A;  3TO9 A;  4H89 A;  2QEC A;  2Z3K A;  1Y9K A;  4OLL A;  4F0Y A;  4PSX A;  3PP9 A;  1KUX A;  5JPH A;  3SXO A;  4LUA A;  4A33 A;  2J8R A;  1IYL A;  4PK2 A;  4XNH C;  4E8O A;  2D4O A;  2FIW A;  3G8W A;  5IB0 A;  2YNC A;  1N71 A;  1QSN A;  2Z10 A;  1ZO0 A;  1RXT A;  2FE7 A;  5EBV A;  1I1D A;  1L0C A;  1UFH A;  5AG6 A;  5FVJ A;  3SHP A;  2HUZ A;  5H86 A;  4MHD A;  3A9L A;  2GIV A;  4KLV A;  4UFV A;  5J8F A;  3GYA A;  3TE4 A;  2C27 A;  4L8A A;  4MBU A;  4UBR A;  4UCP A;  4J3G A;  3D2P A;  4KUB A;  2ZW7 A;  4LX9 A;  4NSQ A;  4KVX A;  5G22 A;  3DR8 A;  3NE7 A;  4UWJ A;  3FYN A;  2QML A;  2JEV A;  5E96 A;  4ZGY B;  4R87 A;  3FNC A;  4F0X A;  2AE6 A;  2WUU A;  4CRZ B;  4R57 A;  2HV2 A;  2JLM A;  1XEB A;  4C7H A;  3C26 A;  4JXQ A;  1YRE A;  1B87 A;  4CAF A;  3JVN A;  4KOR A;  4UFW A;  4XPK A;  4QBJ A;  3EC4 A;  4RS2 A;  5C88 A;  1RO5 A;  1XE4 A;  3EXN A;  5AG4 A;  1S7N A;  4U9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...