1Z4RA

Human gcn5 acetyltransferase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
163
structure length
163
Chain Sequence
b'SGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords General control of amino acid synthesis protein 5-like 2
publication title Crystal structure of a binary complex between human GCN5 histone acetyltransferase domain and acetyl coenzyme A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 43
structure length 163
sequence length 163
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1z4rA00
1YLEA 3T9YA 1J4JA 4KOTA 3R96A 2BL1A 2B4DA 2Z11A 3SHPA 5E96A 2H5MA 2PC1A 3F5BA 3S6KA 4AVCA 2OZGA 5IB0A 2B5GA 2R8VA 2GANA 2EUIA 2Z0ZA 3E0KA 2PR8A 5DWNA 2FIAA 3TE4A 4MY3A 4PSWA 2FT0A 3TO6A 5C88A 2C27A 2Q44A 3R1KA 2G3TA 3FBUA 1BO4A 4Y49C 5F49A 3TTHA 2ATRA 4JWPA 1QSRA 4KLWA 2G3AA 1YVOA 1XEBA 5CNPA 4XPLA 3QAHA 2B58A 2JLMA 5ISVA 2GIVA 1P0HA 4L89A 4KOUA 2VEZA 3JUWA 3CXQA 4QB9A 3JVNA 1S7KA 3BJ7A 5F48A 4AG7A 4AB7A 4M3SA 4R3KA 4AG9A 1TIQA 1QSNA 4PV6A 3TOBA 4HNYB 3W6XA 3TT2A 4CRZB 4KOSA 2F5IA 4KVOE 3D2MA 2OB0A 1I1DA 4X5KA 3DDDA 4CRYB 1Y7RA 4F0YA 3FB3A 4U5YA 3F0AA 3GY9A 4L8AA 4FD5A 4UBRA 4EVYA 2QIRA 4CAVA 3DR8A 3PGPA 2B3VA 2EVNA 2KCWA 2PRBA 3ZZIA 1QSOA 3R9FA 3DR6A 4KLVA 4AVBA 1IYLA 1SQHA 1LRZA 2PR1A 2NMTA 3FYNA 3OWCA 3H4QA 2FS5A 3LD2A 5F47A 3P2FA 3D8PA 1WK4A 2HUZA 4MI4A 2JEVA 2P0WA 3S6HA 4KVXA 1PUAA 5I0CA 1FY7A 1S7FA 3C26A 4R9MA 4FD7A 3EY5A 3FRMA 2JDCA 4U9ZA 4ONUA 3KKWA 2CY2A 2Q4YA 1YK3A 4B5PB 3FXTA 1R57A 2IL4A 2R7HA 3S6FA 3WR7A 1IIDA 4OLLA 3PP9A 4XPKA 3UY5A 1KUXA 4MY0A 2VZYA 4K30A 2AE6A 1KUVA 4NCZA 3S6GA 5FVJA 1Z4EA 5JPHA 4XPDB 2BSWA 4E8OA 2B4BA 1YX0A 4FD6A 2ZW6A 2FL4A 4JXRA 4M85A 4YGOA 5H86A 4JD6A 5HMNA 1Y9WA 4MHDA 1M44A 4I49A 5KTCA 2RC4A 4CS0B 5KTDA 1Z4RA 2FSRA 2HQYA 1RXTA 2WPWA 1IICA 1U6MA 4UA3A 3FIXA 3IGRA 1S5KA 2O28A 2P6FA 2VI7A 3EO4A 1QSTA 1M4GA 1YREA 5EBVA 4HNWB 4ZBGA 4KOXA 4UWIA 1KZFA 4MBUA 1XMTA 4RS2A 2GE3A 3EC4A 3D2PA 1OZPA 4XPDC 2Q04A 2G0BA 5C82A 2VBQA 4NXYA 1CM0A 3RYOA 1K4JA 4F6AA 4MJ8A 2OH1A 1VKCA 2ZW4A 3CXSA 5IV0A 5DWMA 1XF8A 4KVME 2BUEA 5H84A 4LUAA 2ZW5A 1MJAA 2J8NA 4QUSA 2CNSA 4QVTA 2CNMA 4B5OA 1Z9UA 4YRHA 4KOYA 1IB1E 2J8MA 1YVKA 5GCNA 2Y0MA 4OAEA 3GYAA 1UFHA 1Q2DA 2R1IA 4KUBA 1KUYA 4DNCA 4HNXB 3SXOA 3DSBA 5J8CA 3PZJA 3MGDA 2AJ6A 4E0AA 1M4DA 3GKRA 1NSLA 4BMHA 1P4NA 5F46A 1MJ9A 3BJ8A 3P2HA 3V8IA 4KZTA 2B4DB 3QB8A 3R9EA 2OU2A 1Q2CA 2I79A 4H6UA 2P6GA 4B5PA 4HKFA 2B5GB 4RI1A 2B3UA 4U9YA 3IWGA 2CNTA 1RO5A 1I12A 1S7NA 2D4PA 2JDDA 1MJBA 1M4IA 1QSMA 4UWJA 2ZXVA 3CXPA 2FE7A 2ZPAA 1N71A 2Z10A 3TOAA 1NMTA 4ORFA 4XNHB 2VQYA 4IF5A 3R9GA 1YR0A 4GS4A 4NEXA 1XE4A 3ZJ0A 4PK3A 2PDOA 1Q2YA 1XIXA 2J8RA 4QC6A 5HH1A 3N7ZA 2FIWA 4CAWA 4QBJA 1L0CA 2OZHA 4FD4A 2VZZA 2FXFA 3LODA 4KUAA 4PSXA 5IX3A 2ZW7A 4JXQA 3TO7A 1MK4A 4KORA 2Q7BA 4OADA 1WWZA 1NE9A 4H6ZA 2REFA 3G8WA 3T90A 3D3SA 5JQ4A 2ARHA 4J3GA 2X7BA 1I21A 3FNCA 2PQ8A 3EXNA 4XNHC 2FCKA 1ON0A 3NE7A 3F8KA 4II9A 3VWEA 2QECA 4H89A 1PU9A 3TCVA 3TFYA 1S60A 4PK2A 3G3SA 4R57A 3W6SA 1B87A 4NSQA 3B8GA 3TO9A 2WPXA 4CAXA 1VHSA 1BOBA 4LX9A 5J8FA 1YGHA 3DNSA 3R95A 2PSWA 2QMLA 1V0CA 4KOWA 2BEIA 2P6EA 1S3ZA 2Q0YA 3I3GA 3VWDA 4YFJA 2HV2A 2K5TA 4KOVA 4JLYA 2D4OA 2Q4VA 2REEA 5EC4A 3I9SA 5KTAA 1IYKA 4R3LA 4AVAA 3EFAA 4Y49B 2DXQA 3K9UA 1S7LA 1M1DA 4NF1A 2VXKA 1Y9KA 3SXNA 2R98A 1GHEA 2A4NA 1CJWA 4JJXA 2OZUA 4IUSA 2I00A 1B6BA 4R87A 4E2AA 3BLNA 3W91A
chains in the Genus database with same CATH superfamily
1YLEA 3T9YA 1J4JA 4OC0A 4KOTA 1YLOA 4OC3A 4F9VA 3R96A 2ANPA 2B4DA 2BL1A 2Z11A 3SHPA 5E96A 2F7VA 2H5MA 2PC1A 3F5BA 1ELLP 1IY7A 4M6HA 3S6KA 4AVCA 1Q7LA 2OZGA 4GM5A 4CYPA 2JBJA 2B5GA 4F9UA 2R8VA 2YGWA 2ODFA 1TKFA 4MFLA 2I3CA 2BO9A 2EUIA 2GANA 2Z0ZA 3E0KA 2PR8A 1UWYA 4WWVA 4CGLA 3D7FA 2ZEGA 1PYTB 5DWNA 4A31A 5LYFA 2FIAA 3TE4A 4MY3A 4PPZA 4A95A 1JWQA 1YW4A 4PSWA 2FT0A 2VL1A 4UFVA 3TO6A 3PBEA 5C88A 2C27A 3RZAA 2Q44A 2NSMA 2Z3MA 3R1KA 4UEEA 5CBMA 4X3RA 2G3TA 4CYNA 4AXVA 2WZNA 4A33A 1ZLIA 3FBUA 1BO4A 4KSFA 2EBJA 4Y49C 5F49A 3TTHA 2ATRA 4CGOA 4JWPA 5HVHA 1QSRA 5I4MA 1Z8XA 1Z5RA 4KLWA 2G3AA 1YVOA 2Q4ZA 1XEBA 2ZENA 5CNPA 4NGTA 4XPLA 3QAHA 2B58A 3JRUA 2JLMA 5ISVA 2GIVA 4BINA 2CTCA 1P0HA 4M6GA 3D67A 1Z8LA 4L89A 1IOFA 2PIZA 3KQXA 4KOUA 2VEZA 5LYLA 4DJLA 3JUWA 2RB7A 4A32A 3CXQA 2ZEMA 2QVPA 2V8VA 4QB9A 2HC9A 3CPXA 3JVNA 3S9LA 1S7KA 3GIUA 4FBEA 3NA6A 3BJ7A 4Q38A 5F48A 3LWUA 4AG7A 2C6GA 4AB7A 2Q51A 1YQEA 4M3SA 4R3KA 4AG9A 4P4DA 1TIQA 1QSNA 1ARLA 2PJ2A 4PV6A 3B35A 3TOBA 5A27A 2ZEPA 4HNYB 3W6XA 3TT2A 3TC8A 2GU2A 4CRZB 2DEAA 4KOSA 4LQGA 2F5IA 4KVOE 4EWTA 3D2MA 2OB0A 3KR4A 3PEIA 1I1DA 3PB8X 3DDDA 3NH4A 1Y7RA 4X5KA 4CRYB 3FB3A 3KASA 2V8DA 4F0YA 2ZEHA 1HDUA 4KS9A 2OOTA 4U5YA 3F0AA 4F8ZA 1YMEA 2ZEOA 4W9YA 2GLFA 1F57A 3GUXA 3GY9A 4L8AA 4MFZA 4YU9A 5THWA 3PBBA 4FD5A 4OC1A 2JEWA 3L2NA 4O23A 4NGQA 1Z8WA 2QIRA 4UBRA 2Z3PA 3RAMA 4EVYA 4CAVA 2AFZA 3H8EA 1CPSA 1ZG8A 3IWWA 3DR8A 3PGPA 2B3VA 2EVNA 2KCWA 2PRBA 3VARA 1QSOA 4MCRA 3ZZIA 3FEDA 3R9FA 3DR6A 4KLVA 4AVBA 1IYLA 1SQHA 3CT9A 1LRZA 1YW6A 2PR1A 2NMTA 3FYNA 3OWCA 4IHMA 3H4QA 4OP4A 4R6TA 4NJQA 4MXUA 4HPSA 4ZX9A 2FS5A 3LD2A 5F47A 4P6YA 3P2FA 4B14A 2XEFA 2XEJA 1WK4A 3D8PA 2HUZA 4MI4A 4CGMA 2JEVA 2P0WA 3BHXA 3S6HA 4KVXA 1PUAA 4PXBA 3NFZA 4RN7A 2C6CA 1FY7A 5I0CA 4CPAA 1S7FA 3KL9A 3C26A 4R9MA 1ELMP 4FD7A 3EY5A 2C1CA 5JH9A 1Y0YA 2WSAA 3FRMA 4MFKA 1Y0RA 3I1UA 2JDCA 2ZEFA 3FJUA 4U9ZA 4ONUA 2PJ5A 3BXMA 3VH9A 3KKWA 5BWAB 3D4UA 3B3WA 4ONWA 2CY2A 2Q4YA 1YK3A 4GXHA 3WABA 2AFWA 3FXTA 3WC7A 4Q7AA 4B5PB 1R57A 3V38A 2IL4A 3PB9X 1GYTA 4OIWA 2R7HA 1LCPA 3NH8A 1QQ9A 3S6FA 3WR7A 1IIDA 4OLLA 3PP9A 4XPKA 3UY5A 4A39A 5ELYA 5AG5A 1KUXA 3D7GA 4MY0A 2VZYA 4K30A 4CGNA 4EFDA 2AE6A 3PFEA 1KUVA 1H8LA 4ZY0A 4NCZA 3S6GA 4OC2A 5FVJA 1Z4EA 5JPHA 3FX6A 1CP7A 2WUUA 3SJEA 1BLLE 2PJCA 4XPDB 5DS0A 2BSWA 4KSAA 4NGNA 1F2PA 4E8OA 2B4BA 4MCSA 1YX0A 4FD6A 2ZW6A 2PJ6A 3B3TA 2AFUA 3FMCA 2IJZA 2FL4A 4JXRA 3CDXA 4M85A 4YGOA 1BPNA 5H86A 2PJ1A 2EK9A 4C2XA 1DE4C 1TF8A 4JD6A 5HMNA 1Y9WA 4MHDA 5CPAA 1M44A 4I49A 5KTCA 2RC4A 4JZ0A 4DYOA 4P4JA 4FAIA 4CS0B 4MRIA 5HVGA 1ZG9A 4MHNA 5KTDA 2ZOGA 3RO0A 1Z4RA 3SJXA 1LOKA 2DPSA 4KSIA 1TKJA 2FSRA 2HQYA 3H5ZA 3JTKA 3N5FA 2ZOFA 1RXTA 2WPWA 1IICA 1U6MA 3H8FA 2PJ3A 2O4HA 3FIXA 4UA3A 3IGRA 5D29A 1S5KA 2O28A 2P6FA 4RUHA 2EWBA 3LMSA 2VI7A 3EO4A 1QSTA 1M4GA 2BCOA 4G1PA 1Z2LA 8CPAA 2GFQA 4JYWA 1ARMA 2Z3NA 1YREA 4MHZA 5EBVA 4HNWB 3D68A 4ZBGA 4KOXA 4PXDA 5LRKA 3IIBA 4UWIA 1KZFA 1IU8A 4MBUA 1XMTA 2XEIA 1YSJA 3B3VA 4RS2A 1ZLHA 2GE3A 2Z3KA 3EC4A 3D2PA 1OZPA 3KHXA 4MCQA 4XPDC 2YNCC 2Q04A 1XBUA 2G0BA 3H8GA 1QMUA 4PQAA 4ZGYB 1LFWA 4F0XA 3K9TA 5C82A 3RBUA 2VBQA 1VGYA 4NXYA 2CTBA 1CM0A 2EO8A 1NSAA 3A9LA 4MMOA 4DUKA 4ZI6A 3RYOA 4P4IA 4A94A 4ZYQA 4CAEA 1K4JA 4F6AA 4MJ8A 5IB9A 4MFJA 2PJ7A 4OC5A 2OH1A 1VKCA 2CXAA 2O53A 2ZW4A 3CXSA 5IV0A 2QYVA 3NE8A 2Z3LA 5DWMA 2ZEDA 5AGEA 2GLJA 3IU1A 1VHOA 3SI2A 1XF8A 5JM6A 4KVME 4P10A 2V8HA 4EMEA 2BUEA 5H84A 4LUAA 4B12A 2ZW5A 3GB0A 3VATA 1MJAA 2J8NA 4CAFA 4QUSA 3SJFA 4CYOA 2CNSA 4QVTA 2CNMA 4H2KA 5LRGA 4B5OA 1Z9UA 4YRHA 2Z3OA 5LRJA 1VIXA 4A30A 5K8MA 2BOAA 4KOYA 1IB1E 2J8MA 2PJ4A 4OC4A 2AFMA 4MHPA 1YVKA 5GCNA 1HDQA 4A37A 2Y0MA 4OAEA 3GYAA 1UFHA 2V8GA 1Q2DA 1ZO0A 2CF4A 4NJRA 2R1IA 2PE3A 4KUBA 2PVVA 4TNUA 4UEFA 1KUYA 4UF4A 4DNCA 2EK8A 1CP6A 4MHYA 4R76A 2G9DA 4B13A 2PJAA 3B3SA 4HNXB 3SXOA 4NGMA 2OR4A 3DSBA 5J8CA 3PZJA 4IAVA 1R3NA 4MCPA 3MGDA 1LANA 4UCPA 3DLJA 3QAYA 2AJ6A 4M6IA 4CGPA 4MFQA 1VHEA 5D8NA 4E0AA 4P4EA 3IWEA 1M4DA 3GKRA 3KHZA 1NSLA 5G22A 2PRQA 4BMHA 1P4NA 1CX8A 2V77A 5F46A 1MJ9A 3BJ8A 4PXEA 3CZXA 4A38A 3P2HA 3V8IA 4BBHA 4KZTA 2B4DB 3QB8A 3R9EA 2OU2A 1CG2A 1XMBA 1Q2CA 2I79A 4H6UA 4C2YA 5AG6A 2P6GA 4B5PA 4HKFA 4CYQA 2B5GB 4RI1A 2B3UA 4U9YA 1XJOA 2WYRA 3KGQA 2J9AA 3IWGA 2PJBA 3HLPA 2CNTA 3DGVA 1CPXA 1I12A 1RO5A 1S7NA 1X12A 2AFOA 2D4PA 4NFRA 3KI9A 2HB6A 1TKHA 1TXRA 1MJBA 2JDDA 5JGFA 1M4IA 5J1QA 1FT7A 3KR5A 5G1ZA 1IOIA 1QSMA 4UWJA 2ZXVA 3CXPA 2FE7A 2XEGA 2ZPAA 1N71A 2F8HA 2Z10A 4ZX8A 3TOAA 4C7IA 2Q43A 2AFSA 5G20A 1F2OA 4P4FA 1NMTA 4P45A 3V7ZA 1JQGA 2YNCA 3D7HA 3KZWA 4Q36A 4ORFA 1AMPA 1Y7EA 2PIYA 4XNHB 7CPAA 2VQYA 1CBXA 1HEEA 4IF5A 3R9GA 1YR0A 4GS4A 1RTQA 1XE4A 4NEXA 3ZJ0A 4PK3A 2ZELA 2PDOA 2DPTA 1Q2YA 1DTDA 1XIXA 5AG7A 2J8RA 4MFPA 1AYEA 3IU2A 3B7IA 2IQ6A 4QC6A 4UFWA 3FEEA 5HH1A 3N7ZA 2FIWA 4CAWA 1TF9A 2JBKA 4BD9A 4QBJA 1FNOA 4X2TA 3SJGA 1L0CA 2OZHA 3ISZA 4UCMA 5G21A 4FD4A 2VZZA 4A2ZA 5K8PA 2FXFA 2IMOA 4OIDA 3LODA 3WT4A 2GREA 3PRTA 2PJ8A 4ZY1A 4KUAA 4PSXA 1IGBA 4ZY2A 4B6ZA 4NGSA 5IX3A 2ZW7A 4JXQA 3TO7A 3FECA 1MK4A 4KORA 1XOVA 2Q7BA 4OADA 1WWZA 3ISXA 1NE9A 2AFXA 4UIAA 3D66A 3KQZA 4H6ZA 4YWYA 3QNVA 2REFA 2PJ0A 3RNZA 3G8WA 4P4BA 4C68A 3T90A 3PB7X 2YNEA 3D3SA 5JQ4A 2ARHA 4J3GA 4NGPA 3IJ3A 2RFHA 4P44A 1Z8TA 5F09A 3IFEA 3HUVA 4LQ6A 2X7BA 1I21A 3FNCA 3LACA 3MN8A 2PQ8A 3EXNA 4XNHC 2FCKA 1BPMA 5LYDA 1ON0A 4C7HA 3TX8A 3NE7A 3F8KA 4II9A 3FF3A 3VWEA 2QECA 3SI1A 3T8WA 4OMEA 4H89A 1PU9A 3IEHA 3TCVA 3TFYA 4FUUA 6CPAA 4B11A 1S60A 4PK2A 3G3SA 3S9MA 2QJ8A 4R57A 3W6SA 4B10A 4OKOA 5IB0A 1B87A 1PCAA 4TWEA 3WC5A 3IO1A 4NSQA 3B8GA 4WJBA 1M4LA 2ABZA 2YNDA 2WPXA 2Q7SA 3TO9A 3WC6A 4CAXA 1VHSA 1BOBA 1BAVA 2NYQA 3IC1A 2POKA 4LX9A 5J8FA 1YGHA 3DNSA 3R95A 5HXDA 2PSWA 2QMLA 1XFOA 3GLJA 1V0CA 4KOWA 2BEIA 3MRUA 1XRYA 1S3ZA 2P6EA 4PXCA 2ZEEA 2Q0YA 3B2YA 3I3GA 3NH5A 3VWDA 4YFJA 2HV2A 4Z65A 5K8OA 2K5TA 4R7MA 4KOVA 4JLYA 3FVLA 4UIBA 2PVWA 2D4OA 1KWMA 2Q4VA 3BI1A 2REEA 3PB6X 5EC4A 5K8NA 1OBRA 3BI0A 3I9SA 4C2ZA 2PJ9A 2FVGA 5KTAA 1IYKA 3FH4A 4R3LA 3B3CA 4AVAA 2CIJA 3EFAA 4Y49B 2DXQA 3PFOA 4FWUA 4K3NA 1LAMA 2DF5A 4R8FA 3K9UA 1S7LA 2PCUA 1M1DA 4NF1A 3PB4X 5EMIA 1A2ZA 2VXKA 4IK2A 1Y9KA 1AUGA 1LAPA 5LYIA 3SXNA 2R98A 3CPAA 1GHEA 2A4NA 4NGRA 3K2KA 4UEZA 2C6PA 1X10A 1ZG7A 1CJWA 1R43A 4JJXA 3SI0A 3S9NA 1EE3P 2OZUA 2I00A 4IUSA 3D7DA 4UFXA 4X8IA 1B6BA 5A28A 5AG4A 4R87A 4UCNA 4E2AA 3BLNA 5HVFA 3W91A
chains in the Genus database with same CATH topology
1YLEA 3T9YA 1J4JA 4KOTA 3R96A 2BL1A 2B4DA 2Z11A 3SHPA 5E96A 2H5MA 2PC1A 3F5BA 3S6KA 4AVCA 2OZGA 5IB0A 4CYPA 2B5GA 2R8VA 2YGWA 4MFLA 2GANA 2EUIA 2Z0ZA 3E0KA 2PR8A 4CGLA 5DWNA 4A31A 2FIAA 3TE4A 4MY3A 4A95A 4PSWA 2FT0A 4UFVA 3TO6A 5C88A 2C27A 2Q44A 2Z3MA 3R1KA 2G3TA 4CYNA 4A33A 3FBUA 4KSFA 1BO4A 4Y49C 5F49A 3TTHA 2ATRA 4CGOA 4JWPA 1QSRA 4KLWA 2G3AA 1YVOA 1XEBA 5CNPA 4XPLA 3QAHA 2B58A 2JLMA 5ISVA 2GIVA 1P0HA 4L89A 4KOUA 2VEZA 3JUWA 4A32A 3CXQA 4QB9A 3JVNA 1S7KA 3BJ7A 4Q38A 5F48A 4AG7A 4AB7A 4M3SA 4R3KA 4AG9A 1TIQA 1QSNA 4PV6A 5A27A 3TOBA 4HNYB 3W6XA 3TT2A 4CRZB 4KOSA 2F5IA 4KVOE 3D2MA 2OB0A 1I1DA 4X5KA 3DDDA 4CRYB 1Y7RA 4F0YA 3FB3A 4KS9A 4U5YA 3F0AA 3GY9A 4L8AA 4MFZA 4FD5A 4UBRA 4EVYA 2QIRA 2Z3PA 4CAVA 3DR8A 3PGPA 2B3VA 2EVNA 2KCWA 2PRBA 3ZZIA 1QSOA 3R9FA 3DR6A 4KLVA 4AVBA 1IYLA 1SQHA 4A30A 1LRZA 2PR1A 2NMTA 3FYNA 3OWCA 3H4QA 2FS5A 3LD2A 5F47A 3P2FA 4B14A 4CGMA 3D8PA 1WK4A 2HUZA 4MI4A 2JEVA 2P0WA 3S6HA 4KVXA 1PUAA 5I0CA 1FY7A 1S7FA 3C26A 4R9MA 4FD7A 3EY5A 3FRMA 2WSAA 4MFKA 2JDCA 4U9ZA 4ONUA 3KKWA 5BWAB 2CY2A 2Q4YA 1YK3A 4B5PB 3FXTA 1R57A 2IL4A 2R7HA 3S6FA 3WR7A 1IIDA 4OLLA 3PP9A 4XPKA 3UY5A 5AG5A 1KUXA 4MY0A 2VZYA 4K30A 4CGNA 2AE6A 1KUVA 4NCZA 3S6GA 5FVJA 1Z4EA 5JPHA 2WUUA 4XPDB 2BSWA 4KSAA 4E8OA 2B4BA 1YX0A 4FD6A 2ZW6A 2FL4A 4JXRA 4M85A 4YGOA 5H86A 4C2XA 4JD6A 5HMNA 1Y9WA 4MHDA 1M44A 4I49A 5KTCA 2RC4A 4CS0B 5KTDA 1Z4RA 2DPSA 2FSRA 2HQYA 3H5ZA 3JTKA 1RXTA 2WPWA 1IICA 1U6MA 4UA3A 3FIXA 3IGRA 1S5KA 2O28A 2P6FA 2VI7A 3EO4A 1QSTA 1M4GA 2Z3NA 1YREA 5EBVA 4HNWB 4ZBGA 4KOXA 4UWIA 1KZFA 4MBUA 1XMTA 4RS2A 2GE3A 2Z3KA 3EC4A 3D2PA 1OZPA 4XPDC 2YNCC 2Q04A 2G0BA 4ZGYB 4F0XA 5C82A 2VBQA 4NXYA 3A9LA 1CM0A 3RYOA 4CAEA 1K4JA 4F6AA 4MJ8A 4MFJA 2OH1A 1VKCA 2CXAA 2ZW4A 3CXSA 5IV0A 2Z3LA 5DWMA 5AGEA 3IU1A 1XF8A 4KVME 2BUEA 5H84A 4LUAA 4B12A 2ZW5A 1MJAA 2J8NA 4CAFA 4QUSA 4CYOA 2CNSA 4QVTA 2CNMA 4B5OA 1Z9UA 4YRHA 2Z3OA 4KOYA 1IB1E 2J8MA 1YVKA 5GCNA 2Y0MA 4OAEA 3GYAA 1UFHA 1Q2DA 1ZO0A 2R1IA 4KUBA 1KUYA 4DNCA 4B13A 4HNXB 3SXOA 3DSBA 5J8CA 3PZJA 3MGDA 4UCPA 2AJ6A 4CGPA 4MFQA 4E0AA 3IWEA 1M4DA 3GKRA 1NSLA 5G22A 4BMHA 1P4NA 5F46A 1MJ9A 3BJ8A 3P2HA 3V8IA 4BBHA 4KZTA 2B4DB 3QB8A 3R9EA 2OU2A 1Q2CA 2I79A 4H6UA 4C2YA 5AG6A 2P6GA 4B5PA 4HKFA 4CYQA 2B5GB 4RI1A 2B3UA 4U9YA 3IWGA 2CNTA 1RO5A 1I12A 1S7NA 2D4PA 2JDDA 1MJBA 1M4IA 5G1ZA 1QSMA 4UWJA 2ZXVA 3CXPA 2FE7A 2ZPAA 1N71A 2Z10A 3TOAA 4C7IA 5G20A 1NMTA 2YNCA 4Q36A 4ORFA 4XNHB 2VQYA 4IF5A 3R9GA 1YR0A 4GS4A 4NEXA 1XE4A 3ZJ0A 4PK3A 2PDOA 2DPTA 1Q2YA 1XIXA 5AG7A 2J8RA 4MFPA 3IU2A 4QC6A 4UFWA 5HH1A 3N7ZA 2FIWA 4CAWA 4QBJA 1L0CA 2OZHA 4UCMA 5G21A 4FD4A 2VZZA 4A2ZA 2FXFA 3LODA 4KUAA 4PSXA 5IX3A 2ZW7A 4JXQA 3TO7A 1MK4A 4KORA 2Q7BA 4OADA 1WWZA 1NE9A 4H6ZA 2REFA 3G8WA 4C68A 3T90A 2YNEA 3D3SA 5JQ4A 2ARHA 4J3GA 2X7BA 1I21A 3FNCA 4C7HA 2PQ8A 3EXNA 4XNHC 2FCKA 1ON0A 3NE7A 3F8KA 4II9A 3VWEA 2QECA 4H89A 1PU9A 3TCVA 3TFYA 4B11A 1S60A 4PK2A 3G3SA 4R57A 3W6SA 4B10A 1B87A 4NSQA 3B8GA 2YNDA 3TO9A 2WPXA 4CAXA 1VHSA 1BOBA 4LX9A 5J8FA 1YGHA 3DNSA 3R95A 2PSWA 2QMLA 1V0CA 4KOWA 2BEIA 2P6EA 1S3ZA 2Q0YA 3I3GA 3VWDA 4YFJA 2HV2A 2K5TA 4KOVA 4JLYA 2D4OA 2Q4VA 2REEA 5EC4A 3I9SA 4C2ZA 5KTAA 1IYKA 4R3LA 4AVAA 3EFAA 4Y49B 2DXQA 3K9UA 1S7LA 1M1DA 4NF1A 2VXKA 1Y9KA 3SXNA 2R98A 1GHEA 2A4NA 1CJWA 4JJXA 2OZUA 4IUSA 2I00A 4UFXA 5AG4A 5A28A 1B6BA 4R87A 4UCNA 4E2AA 3BLNA 3W91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YLE A;  3T9Y A;  1J4J A;  4KOT A;  3R96 A;  2BL1 A;  2B4D A;  2Z11 A;  3SHP A;  5E96 A;  2H5M A;  2PC1 A;  3F5B A;  3S6K A;  4AVC A;  2OZG A;  5IB0 A;  2B5G A;  2R8V A;  2GAN A;  2EUI A;  2Z0Z A;  3E0K A;  2PR8 A;  5DWN A;  2FIA A;  3TE4 A;  4MY3 A;  4PSW A;  2FT0 A;  3TO6 A;  5C88 A;  2C27 A;  2Q44 A;  3R1K A;  2G3T A;  3FBU A;  1BO4 A;  4Y49 C;  5F49 A;  3TTH A;  2ATR A;  4JWP A;  1QSR A;  4KLW A;  2G3A A;  1YVO A;  1XEB A;  5CNP A;  4XPL A;  3QAH A;  2B58 A;  2JLM A;  5ISV A;  2GIV A;  1P0H A;  4L89 A;  4KOU A;  2VEZ A;  3JUW A;  3CXQ A;  4QB9 A;  3JVN A;  1S7K A;  3BJ7 A;  5F48 A;  4AG7 A;  4AB7 A;  4M3S A;  4R3K A;  4AG9 A;  1TIQ A;  1QSN A;  4PV6 A;  3TOB A;  4HNY B;  3W6X A;  3TT2 A;  4CRZ B;  4KOS A;  2F5I A;  4KVO E;  3D2M A;  2OB0 A;  1I1D A;  4X5K A;  3DDD A;  4CRY B;  1Y7R A;  4F0Y A;  3FB3 A;  4U5Y A;  3F0A A;  3GY9 A;  4L8A A;  4FD5 A;  4UBR A;  4EVY A;  2QIR A;  4CAV A;  3DR8 A;  3PGP A;  2B3V A;  2EVN A;  2KCW A;  2PRB A;  3ZZI A;  1QSO A;  3R9F A;  3DR6 A;  4KLV A;  4AVB A;  1IYL A;  1SQH A;  1LRZ A;  2PR1 A;  2NMT A;  3FYN A;  3OWC A;  3H4Q A;  2FS5 A;  3LD2 A;  5F47 A;  3P2F A;  3D8P A;  1WK4 A;  2HUZ A;  4MI4 A;  2JEV A;  2P0W A;  3S6H A;  4KVX A;  1PUA A;  5I0C A;  1FY7 A;  1S7F A;  3C26 A;  4R9M A;  4FD7 A;  3EY5 A;  3FRM A;  2JDC A;  4U9Z A;  4ONU A;  3KKW A;  2CY2 A;  2Q4Y A;  1YK3 A;  4B5P B;  3FXT A;  1R57 A;  2IL4 A;  2R7H A;  3S6F A;  3WR7 A;  1IID A;  4OLL A;  3PP9 A;  4XPK A;  3UY5 A;  1KUX A;  4MY0 A;  2VZY A;  4K30 A;  2AE6 A;  1KUV A;  4NCZ A;  3S6G A;  5FVJ A;  1Z4E A;  5JPH A;  4XPD B;  2BSW A;  4E8O A;  2B4B A;  1YX0 A;  4FD6 A;  2ZW6 A;  2FL4 A;  4JXR A;  4M85 A;  4YGO A;  5H86 A;  4JD6 A;  5HMN A;  1Y9W A;  4MHD A;  1M44 A;  4I49 A;  5KTC A;  2RC4 A;  4CS0 B;  5KTD A;  1Z4R A;  2FSR A;  2HQY A;  1RXT A;  2WPW A;  1IIC A;  1U6M A;  4UA3 A;  3FIX A;  3IGR A;  1S5K A;  2O28 A;  2P6F A;  2VI7 A;  3EO4 A;  1QST A;  1M4G A;  1YRE A;  5EBV A;  4HNW B;  4ZBG A;  4KOX A;  4UWI A;  1KZF A;  4MBU A;  1XMT A;  4RS2 A;  2GE3 A;  3EC4 A;  3D2P A;  1OZP A;  4XPD C;  2Q04 A;  2G0B A;  5C82 A;  2VBQ A;  4NXY A;  1CM0 A;  3RYO A;  1K4J A;  4F6A A;  4MJ8 A;  2OH1 A;  1VKC A;  2ZW4 A;  3CXS A;  5IV0 A;  5DWM A;  1XF8 A;  4KVM E;  2BUE A;  5H84 A;  4LUA A;  2ZW5 A;  1MJA A;  2J8N A;  4QUS A;  2CNS A;  4QVT A;  2CNM A;  4B5O A;  1Z9U A;  4YRH A;  4KOY A;  1IB1 E;  2J8M A;  1YVK A;  5GCN A;  2Y0M A;  4OAE A;  3GYA A;  1UFH A;  1Q2D A;  2R1I A;  4KUB A;  1KUY A;  4DNC A;  4HNX B;  3SXO A;  3DSB A;  5J8C A;  3PZJ A;  3MGD A;  2AJ6 A;  4E0A A;  1M4D A;  3GKR A;  1NSL A;  4BMH A;  1P4N A;  5F46 A;  1MJ9 A;  3BJ8 A;  3P2H A;  3V8I A;  4KZT A;  2B4D B;  3QB8 A;  3R9E A;  2OU2 A;  1Q2C A;  2I79 A;  4H6U A;  2P6G A;  4B5P A;  4HKF A;  2B5G B;  4RI1 A;  2B3U A;  4U9Y A;  3IWG A;  2CNT A;  1RO5 A;  1I12 A;  1S7N A;  2D4P A;  2JDD A;  1MJB A;  1M4I A;  1QSM A;  4UWJ A;  2ZXV A;  3CXP A;  2FE7 A;  2ZPA A;  1N71 A;  2Z10 A;  3TOA A;  1NMT A;  4ORF A;  4XNH B;  2VQY A;  4IF5 A;  3R9G A;  1YR0 A;  4GS4 A;  4NEX A;  1XE4 A;  3ZJ0 A;  4PK3 A;  2PDO A;  1Q2Y A;  1XIX A;  2J8R A;  4QC6 A;  5HH1 A;  3N7Z A;  2FIW A;  4CAW A;  4QBJ A;  1L0C A;  2OZH A;  4FD4 A;  2VZZ A;  2FXF A;  3LOD A;  4KUA A;  4PSX A;  5IX3 A;  2ZW7 A;  4JXQ A;  3TO7 A;  1MK4 A;  4KOR A;  2Q7B A;  4OAD A;  1WWZ A;  1NE9 A;  4H6Z A;  2REF A;  3G8W A;  3T90 A;  3D3S A;  5JQ4 A;  2ARH A;  4J3G A;  2X7B A;  1I21 A;  3FNC A;  2PQ8 A;  3EXN A;  4XNH C;  2FCK A;  1ON0 A;  3NE7 A;  3F8K A;  4II9 A;  3VWE A;  2QEC A;  4H89 A;  1PU9 A;  3TCV A;  3TFY A;  1S60 A;  4PK2 A;  3G3S A;  4R57 A;  3W6S A;  1B87 A;  4NSQ A;  3B8G A;  3TO9 A;  2WPX A;  4CAX A;  1VHS A;  1BOB A;  4LX9 A;  5J8F A;  1YGH A;  3DNS A;  3R95 A;  2PSW A;  2QML A;  1V0C A;  4KOW A;  2BEI A;  2P6E A;  1S3Z A;  2Q0Y A;  3I3G A;  3VWD A;  4YFJ A;  2HV2 A;  2K5T A;  4KOV A;  4JLY A;  2D4O A;  2Q4V A;  2REE A;  5EC4 A;  3I9S A;  5KTA A;  1IYK A;  4R3L A;  4AVA A;  3EFA A;  4Y49 B;  2DXQ A;  3K9U A;  1S7L A;  1M1D A;  4NF1 A;  2VXK A;  1Y9K A;  3SXN A;  2R98 A;  1GHE A;  2A4N A;  1CJW A;  4JJX A;  2OZU A;  4IUS A;  2I00 A;  1B6B A;  4R87 A;  4E2A A;  3BLN A;  3W91 A; 
#chains in the Genus database with same CATH topology
 1YLE A;  3T9Y A;  1J4J A;  4OC0 A;  4KOT A;  1YLO A;  4OC3 A;  4F9V A;  3R96 A;  2ANP A;  2B4D A;  2BL1 A;  2Z11 A;  3SHP A;  5E96 A;  2F7V A;  2H5M A;  2PC1 A;  3F5B A;  1ELL P;  1IY7 A;  4M6H A;  3S6K A;  4AVC A;  1Q7L A;  2OZG A;  4GM5 A;  4CYP A;  2JBJ A;  2B5G A;  4F9U A;  2R8V A;  2YGW A;  2ODF A;  1TKF A;  4MFL A;  2I3C A;  2BO9 A;  2EUI A;  2GAN A;  2Z0Z A;  3E0K A;  2PR8 A;  1UWY A;  4WWV A;  4CGL A;  3D7F A;  2ZEG A;  1PYT B;  5DWN A;  4A31 A;  5LYF A;  2FIA A;  3TE4 A;  4MY3 A;  4PPZ A;  4A95 A;  1JWQ A;  1YW4 A;  4PSW A;  2FT0 A;  2VL1 A;  4UFV A;  3TO6 A;  3PBE A;  5C88 A;  2C27 A;  3RZA A;  2Q44 A;  2NSM A;  2Z3M A;  3R1K A;  4UEE A;  5CBM A;  4X3R A;  2G3T A;  4CYN A;  4AXV A;  2WZN A;  4A33 A;  1ZLI A;  3FBU A;  1BO4 A;  4KSF A;  2EBJ A;  4Y49 C;  5F49 A;  3TTH A;  2ATR A;  4CGO A;  4JWP A;  5HVH A;  1QSR A;  5I4M A;  1Z8X A;  1Z5R A;  4KLW A;  2G3A A;  1YVO A;  2Q4Z A;  1XEB A;  2ZEN A;  5CNP A;  4NGT A;  4XPL A;  3QAH A;  2B58 A;  3JRU A;  2JLM A;  5ISV A;  2GIV A;  4BIN A;  2CTC A;  1P0H A;  4M6G A;  3D67 A;  1Z8L A;  4L89 A;  1IOF A;  2PIZ A;  3KQX A;  4KOU A;  2VEZ A;  5LYL A;  4DJL A;  3JUW A;  2RB7 A;  4A32 A;  3CXQ A;  2ZEM A;  2QVP A;  2V8V A;  4QB9 A;  2HC9 A;  3CPX A;  3JVN A;  3S9L A;  1S7K A;  3GIU A;  4FBE A;  3NA6 A;  3BJ7 A;  4Q38 A;  5F48 A;  3LWU A;  4AG7 A;  2C6G A;  4AB7 A;  2Q51 A;  1YQE A;  4M3S A;  4R3K A;  4AG9 A;  4P4D A;  1TIQ A;  1QSN A;  1ARL A;  2PJ2 A;  4PV6 A;  3B35 A;  3TOB A;  5A27 A;  2ZEP A;  4HNY B;  3W6X A;  3TT2 A;  3TC8 A;  2GU2 A;  4CRZ B;  2DEA A;  4KOS A;  4LQG A;  2F5I A;  4KVO E;  4EWT A;  3D2M A;  2OB0 A;  3KR4 A;  3PEI A;  1I1D A;  3PB8 X;  3DDD A;  3NH4 A;  1Y7R A;  4X5K A;  4CRY B;  3FB3 A;  3KAS A;  2V8D A;  4F0Y A;  2ZEH A;  1HDU A;  4KS9 A;  2OOT A;  4U5Y A;  3F0A A;  4F8Z A;  1YME A;  2ZEO A;  4W9Y A;  2GLF A;  1F57 A;  3GUX A;  3GY9 A;  4L8A A;  4MFZ A;  4YU9 A;  5THW A;  3PBB A;  4FD5 A;  4OC1 A;  2JEW A;  3L2N A;  4O23 A;  4NGQ A;  1Z8W A;  2QIR A;  4UBR A;  2Z3P A;  3RAM A;  4EVY A;  4CAV A;  2AFZ A;  3H8E A;  1CPS A;  1ZG8 A;  3IWW A;  3DR8 A;  3PGP A;  2B3V A;  2EVN A;  2KCW A;  2PRB A;  3VAR A;  1QSO A;  4MCR A;  3ZZI A;  3FED A;  3R9F A;  3DR6 A;  4KLV A;  4AVB A;  1IYL A;  1SQH A;  3CT9 A;  1LRZ A;  1YW6 A;  2PR1 A;  2NMT A;  3FYN A;  3OWC A;  4IHM A;  3H4Q A;  4OP4 A;  4R6T A;  4NJQ A;  4MXU A;  4HPS A;  4ZX9 A;  2FS5 A;  3LD2 A;  5F47 A;  4P6Y A;  3P2F A;  4B14 A;  2XEF A;  2XEJ A;  1WK4 A;  3D8P A;  2HUZ A;  4MI4 A;  4CGM A;  2JEV A;  2P0W A;  3BHX A;  3S6H A;  4KVX A;  1PUA A;  4PXB A;  3NFZ A;  4RN7 A;  2C6C A;  1FY7 A;  5I0C A;  4CPA A;  1S7F A;  3KL9 A;  3C26 A;  4R9M A;  1ELM P;  4FD7 A;  3EY5 A;  2C1C A;  5JH9 A;  1Y0Y A;  2WSA A;  3FRM A;  4MFK A;  1Y0R A;  3I1U A;  2JDC A;  2ZEF A;  3FJU A;  4U9Z A;  4ONU A;  2PJ5 A;  3BXM A;  3VH9 A;  3KKW A;  5BWA B;  3D4U A;  3B3W A;  4ONW A;  2CY2 A;  2Q4Y A;  1YK3 A;  4GXH A;  3WAB A;  2AFW A;  3FXT A;  3WC7 A;  4Q7A A;  4B5P B;  1R57 A;  3V38 A;  2IL4 A;  3PB9 X;  1GYT A;  4OIW A;  2R7H A;  1LCP A;  3NH8 A;  1QQ9 A;  3S6F A;  3WR7 A;  1IID A;  4OLL A;  3PP9 A;  4XPK A;  3UY5 A;  4A39 A;  5ELY A;  5AG5 A;  1KUX A;  3D7G A;  4MY0 A;  2VZY A;  4K30 A;  4CGN A;  4EFD A;  2AE6 A;  3PFE A;  1KUV A;  1H8L A;  4ZY0 A;  4NCZ A;  3S6G A;  4OC2 A;  5FVJ A;  1Z4E A;  5JPH A;  3FX6 A;  1CP7 A;  2WUU A;  3SJE A;  1BLL E;  2PJC A;  4XPD B;  5DS0 A;  2BSW A;  4KSA A;  4NGN A;  1F2P A;  4E8O A;  2B4B A;  4MCS A;  1YX0 A;  4FD6 A;  2ZW6 A;  2PJ6 A;  3B3T A;  2AFU A;  3FMC A;  2IJZ A;  2FL4 A;  4JXR A;  3CDX A;  4M85 A;  4YGO A;  1BPN A;  5H86 A;  2PJ1 A;  2EK9 A;  4C2X A;  1DE4 C;  1TF8 A;  4JD6 A;  5HMN A;  1Y9W A;  4MHD A;  5CPA A;  1M44 A;  4I49 A;  5KTC A;  2RC4 A;  4JZ0 A;  4DYO A;  4P4J A;  4FAI A;  4CS0 B;  4MRI A;  5HVG A;  1ZG9 A;  4MHN A;  5KTD A;  2ZOG A;  3RO0 A;  1Z4R A;  3SJX A;  1LOK A;  2DPS A;  4KSI A;  1TKJ A;  2FSR A;  2HQY A;  3H5Z A;  3JTK A;  3N5F A;  2ZOF A;  1RXT A;  2WPW A;  1IIC A;  1U6M A;  3H8F A;  2PJ3 A;  2O4H A;  3FIX A;  4UA3 A;  3IGR A;  5D29 A;  1S5K A;  2O28 A;  2P6F A;  4RUH A;  2EWB A;  3LMS A;  2VI7 A;  3EO4 A;  1QST A;  1M4G A;  2BCO A;  4G1P A;  1Z2L A;  8CPA A;  2GFQ A;  4JYW A;  1ARM A;  2Z3N A;  1YRE A;  4MHZ A;  5EBV A;  4HNW B;  3D68 A;  4ZBG A;  4KOX A;  4PXD A;  5LRK A;  3IIB A;  4UWI A;  1KZF A;  1IU8 A;  4MBU A;  1XMT A;  2XEI A;  1YSJ A;  3B3V A;  4RS2 A;  1ZLH A;  2GE3 A;  2Z3K A;  3EC4 A;  3D2P A;  1OZP A;  3KHX A;  4MCQ A;  4XPD C;  2YNC C;  2Q04 A;  1XBU A;  2G0B A;  3H8G A;  1QMU A;  4PQA A;  4ZGY B;  1LFW A;  4F0X A;  3K9T A;  5C82 A;  3RBU A;  2VBQ A;  1VGY A;  4NXY A;  2CTB A;  1CM0 A;  2EO8 A;  1NSA A;  3A9L A;  4MMO A;  4DUK A;  4ZI6 A;  3RYO A;  4P4I A;  4A94 A;  4ZYQ A;  4CAE A;  1K4J A;  4F6A A;  4MJ8 A;  5IB9 A;  4MFJ A;  2PJ7 A;  4OC5 A;  2OH1 A;  1VKC A;  2CXA A;  2O53 A;  2ZW4 A;  3CXS A;  5IV0 A;  2QYV A;  3NE8 A;  2Z3L A;  5DWM A;  2ZED A;  5AGE A;  2GLJ A;  3IU1 A;  1VHO A;  3SI2 A;  1XF8 A;  5JM6 A;  4KVM E;  4P10 A;  2V8H A;  4EME A;  2BUE A;  5H84 A;  4LUA A;  4B12 A;  2ZW5 A;  3GB0 A;  3VAT A;  1MJA A;  2J8N A;  4CAF A;  4QUS A;  3SJF A;  4CYO A;  2CNS A;  4QVT A;  2CNM A;  4H2K A;  5LRG A;  4B5O A;  1Z9U A;  4YRH A;  2Z3O A;  5LRJ A;  1VIX A;  4A30 A;  5K8M A;  2BOA A;  4KOY A;  1IB1 E;  2J8M A;  2PJ4 A;  4OC4 A;  2AFM A;  4MHP A;  1YVK A;  5GCN A;  1HDQ A;  4A37 A;  2Y0M A;  4OAE A;  3GYA A;  1UFH A;  2V8G A;  1Q2D A;  1ZO0 A;  2CF4 A;  4NJR A;  2R1I A;  2PE3 A;  4KUB A;  2PVV A;  4TNU A;  4UEF A;  1KUY A;  4UF4 A;  4DNC A;  2EK8 A;  1CP6 A;  4MHY A;  4R76 A;  2G9D A;  4B13 A;  2PJA A;  3B3S A;  4HNX B;  3SXO A;  4NGM A;  2OR4 A;  3DSB A;  5J8C A;  3PZJ A;  4IAV A;  1R3N A;  4MCP A;  3MGD A;  1LAN A;  4UCP A;  3DLJ A;  3QAY A;  2AJ6 A;  4M6I A;  4CGP A;  4MFQ A;  1VHE A;  5D8N A;  4E0A A;  4P4E A;  3IWE A;  1M4D A;  3GKR A;  3KHZ A;  1NSL A;  5G22 A;  2PRQ A;  4BMH A;  1P4N A;  1CX8 A;  2V77 A;  5F46 A;  1MJ9 A;  3BJ8 A;  4PXE A;  3CZX A;  4A38 A;  3P2H A;  3V8I A;  4BBH A;  4KZT A;  2B4D B;  3QB8 A;  3R9E A;  2OU2 A;  1CG2 A;  1XMB A;  1Q2C A;  2I79 A;  4H6U A;  4C2Y A;  5AG6 A;  2P6G A;  4B5P A;  4HKF A;  4CYQ A;  2B5G B;  4RI1 A;  2B3U A;  4U9Y A;  1XJO A;  2WYR A;  3KGQ A;  2J9A A;  3IWG A;  2PJB A;  3HLP A;  2CNT A;  3DGV A;  1CPX A;  1I12 A;  1RO5 A;  1S7N A;  1X12 A;  2AFO A;  2D4P A;  4NFR A;  3KI9 A;  2HB6 A;  1TKH A;  1TXR A;  1MJB A;  2JDD A;  5JGF A;  1M4I A;  5J1Q A;  1FT7 A;  3KR5 A;  5G1Z A;  1IOI A;  1QSM A;  4UWJ A;  2ZXV A;  3CXP A;  2FE7 A;  2XEG A;  2ZPA A;  1N71 A;  2F8H A;  2Z10 A;  4ZX8 A;  3TOA A;  4C7I A;  2Q43 A;  2AFS A;  5G20 A;  1F2O A;  4P4F A;  1NMT A;  4P45 A;  3V7Z A;  1JQG A;  2YNC A;  3D7H A;  3KZW A;  4Q36 A;  4ORF A;  1AMP A;  1Y7E A;  2PIY A;  4XNH B;  7CPA A;  2VQY A;  1CBX A;  1HEE A;  4IF5 A;  3R9G A;  1YR0 A;  4GS4 A;  1RTQ A;  1XE4 A;  4NEX A;  3ZJ0 A;  4PK3 A;  2ZEL A;  2PDO A;  2DPT A;  1Q2Y A;  1DTD A;  1XIX A;  5AG7 A;  2J8R A;  4MFP A;  1AYE A;  3IU2 A;  3B7I A;  2IQ6 A;  4QC6 A;  4UFW A;  3FEE A;  5HH1 A;  3N7Z A;  2FIW A;  4CAW A;  1TF9 A;  2JBK A;  4BD9 A;  4QBJ A;  1FNO A;  4X2T A;  3SJG A;  1L0C A;  2OZH A;  3ISZ A;  4UCM A;  5G21 A;  4FD4 A;  2VZZ A;  4A2Z A;  5K8P A;  2FXF A;  2IMO A;  4OID A;  3LOD A;  3WT4 A;  2GRE A;  3PRT A;  2PJ8 A;  4ZY1 A;  4KUA A;  4PSX A;  1IGB A;  4ZY2 A;  4B6Z A;  4NGS A;  5IX3 A;  2ZW7 A;  4JXQ A;  3TO7 A;  3FEC A;  1MK4 A;  4KOR A;  1XOV A;  2Q7B A;  4OAD A;  1WWZ A;  3ISX A;  1NE9 A;  2AFX A;  4UIA A;  3D66 A;  3KQZ A;  4H6Z A;  4YWY A;  3QNV A;  2REF A;  2PJ0 A;  3RNZ A;  3G8W A;  4P4B A;  4C68 A;  3T90 A;  3PB7 X;  2YNE A;  3D3S A;  5JQ4 A;  2ARH A;  4J3G A;  4NGP A;  3IJ3 A;  2RFH A;  4P44 A;  1Z8T A;  5F09 A;  3IFE A;  3HUV A;  4LQ6 A;  2X7B A;  1I21 A;  3FNC A;  3LAC A;  3MN8 A;  2PQ8 A;  3EXN A;  4XNH C;  2FCK A;  1BPM A;  5LYD A;  1ON0 A;  4C7H A;  3TX8 A;  3NE7 A;  3F8K A;  4II9 A;  3FF3 A;  3VWE A;  2QEC A;  3SI1 A;  3T8W A;  4OME A;  4H89 A;  1PU9 A;  3IEH A;  3TCV A;  3TFY A;  4FUU A;  6CPA A;  4B11 A;  1S60 A;  4PK2 A;  3G3S A;  3S9M A;  2QJ8 A;  4R57 A;  3W6S A;  4B10 A;  4OKO A;  5IB0 A;  1B87 A;  1PCA A;  4TWE A;  3WC5 A;  3IO1 A;  4NSQ A;  3B8G A;  4WJB A;  1M4L A;  2ABZ A;  2YND A;  2WPX A;  2Q7S A;  3TO9 A;  3WC6 A;  4CAX A;  1VHS A;  1BOB A;  1BAV A;  2NYQ A;  3IC1 A;  2POK A;  4LX9 A;  5J8F A;  1YGH A;  3DNS A;  3R95 A;  5HXD A;  2PSW A;  2QML A;  1XFO A;  3GLJ A;  1V0C A;  4KOW A;  2BEI A;  3MRU A;  1XRY A;  1S3Z A;  2P6E A;  4PXC A;  2ZEE A;  2Q0Y A;  3B2Y A;  3I3G A;  3NH5 A;  3VWD A;  4YFJ A;  2HV2 A;  4Z65 A;  5K8O A;  2K5T A;  4R7M A;  4KOV A;  4JLY A;  3FVL A;  4UIB A;  2PVW A;  2D4O A;  1KWM A;  2Q4V A;  3BI1 A;  2REE A;  3PB6 X;  5EC4 A;  5K8N A;  1OBR A;  3BI0 A;  3I9S A;  4C2Z A;  2PJ9 A;  2FVG A;  5KTA A;  1IYK A;  3FH4 A;  4R3L A;  3B3C A;  4AVA A;  2CIJ A;  3EFA A;  4Y49 B;  2DXQ A;  3PFO A;  4FWU A;  4K3N A;  1LAM A;  2DF5 A;  4R8F A;  3K9U A;  1S7L A;  2PCU A;  1M1D A;  4NF1 A;  3PB4 X;  5EMI A;  1A2Z A;  2VXK A;  4IK2 A;  1Y9K A;  1AUG A;  1LAP A;  5LYI A;  3SXN A;  2R98 A;  3CPA A;  1GHE A;  2A4N A;  4NGR A;  3K2K A;  4UEZ A;  2C6P A;  1X10 A;  1ZG7 A;  1CJW A;  1R43 A;  4JJX A;  3SI0 A;  3S9N A;  1EE3 P;  2OZU A;  2I00 A;  4IUS A;  3D7D A;  4UFX A;  4X8I A;  1B6B A;  5A28 A;  5AG4 A;  4R87 A;  4UCN A;  4E2A A;  3BLN A;  5HVF A;  3W91 A; 
#chains in the Genus database with same CATH homology
 1YLE A;  3T9Y A;  1J4J A;  4KOT A;  3R96 A;  2BL1 A;  2B4D A;  2Z11 A;  3SHP A;  5E96 A;  2H5M A;  2PC1 A;  3F5B A;  3S6K A;  4AVC A;  2OZG A;  5IB0 A;  4CYP A;  2B5G A;  2R8V A;  2YGW A;  4MFL A;  2GAN A;  2EUI A;  2Z0Z A;  3E0K A;  2PR8 A;  4CGL A;  5DWN A;  4A31 A;  2FIA A;  3TE4 A;  4MY3 A;  4A95 A;  4PSW A;  2FT0 A;  4UFV A;  3TO6 A;  5C88 A;  2C27 A;  2Q44 A;  2Z3M A;  3R1K A;  2G3T A;  4CYN A;  4A33 A;  3FBU A;  4KSF A;  1BO4 A;  4Y49 C;  5F49 A;  3TTH A;  2ATR A;  4CGO A;  4JWP A;  1QSR A;  4KLW A;  2G3A A;  1YVO A;  1XEB A;  5CNP A;  4XPL A;  3QAH A;  2B58 A;  2JLM A;  5ISV A;  2GIV A;  1P0H A;  4L89 A;  4KOU A;  2VEZ A;  3JUW A;  4A32 A;  3CXQ A;  4QB9 A;  3JVN A;  1S7K A;  3BJ7 A;  4Q38 A;  5F48 A;  4AG7 A;  4AB7 A;  4M3S A;  4R3K A;  4AG9 A;  1TIQ A;  1QSN A;  4PV6 A;  5A27 A;  3TOB A;  4HNY B;  3W6X A;  3TT2 A;  4CRZ B;  4KOS A;  2F5I A;  4KVO E;  3D2M A;  2OB0 A;  1I1D A;  4X5K A;  3DDD A;  4CRY B;  1Y7R A;  4F0Y A;  3FB3 A;  4KS9 A;  4U5Y A;  3F0A A;  3GY9 A;  4L8A A;  4MFZ A;  4FD5 A;  4UBR A;  4EVY A;  2QIR A;  2Z3P A;  4CAV A;  3DR8 A;  3PGP A;  2B3V A;  2EVN A;  2KCW A;  2PRB A;  3ZZI A;  1QSO A;  3R9F A;  3DR6 A;  4KLV A;  4AVB A;  1IYL A;  1SQH A;  4A30 A;  1LRZ A;  2PR1 A;  2NMT A;  3FYN A;  3OWC A;  3H4Q A;  2FS5 A;  3LD2 A;  5F47 A;  3P2F A;  4B14 A;  4CGM A;  3D8P A;  1WK4 A;  2HUZ A;  4MI4 A;  2JEV A;  2P0W A;  3S6H A;  4KVX A;  1PUA A;  5I0C A;  1FY7 A;  1S7F A;  3C26 A;  4R9M A;  4FD7 A;  3EY5 A;  3FRM A;  2WSA A;  4MFK A;  2JDC A;  4U9Z A;  4ONU A;  3KKW A;  5BWA B;  2CY2 A;  2Q4Y A;  1YK3 A;  4B5P B;  3FXT A;  1R57 A;  2IL4 A;  2R7H A;  3S6F A;  3WR7 A;  1IID A;  4OLL A;  3PP9 A;  4XPK A;  3UY5 A;  5AG5 A;  1KUX A;  4MY0 A;  2VZY A;  4K30 A;  4CGN A;  2AE6 A;  1KUV A;  4NCZ A;  3S6G A;  5FVJ A;  1Z4E A;  5JPH A;  2WUU A;  4XPD B;  2BSW A;  4KSA A;  4E8O A;  2B4B A;  1YX0 A;  4FD6 A;  2ZW6 A;  2FL4 A;  4JXR A;  4M85 A;  4YGO A;  5H86 A;  4C2X A;  4JD6 A;  5HMN A;  1Y9W A;  4MHD A;  1M44 A;  4I49 A;  5KTC A;  2RC4 A;  4CS0 B;  5KTD A;  1Z4R A;  2DPS A;  2FSR A;  2HQY A;  3H5Z A;  3JTK A;  1RXT A;  2WPW A;  1IIC A;  1U6M A;  4UA3 A;  3FIX A;  3IGR A;  1S5K A;  2O28 A;  2P6F A;  2VI7 A;  3EO4 A;  1QST A;  1M4G A;  2Z3N A;  1YRE A;  5EBV A;  4HNW B;  4ZBG A;  4KOX A;  4UWI A;  1KZF A;  4MBU A;  1XMT A;  4RS2 A;  2GE3 A;  2Z3K A;  3EC4 A;  3D2P A;  1OZP A;  4XPD C;  2YNC C;  2Q04 A;  2G0B A;  4ZGY B;  4F0X A;  5C82 A;  2VBQ A;  4NXY A;  3A9L A;  1CM0 A;  3RYO A;  4CAE A;  1K4J A;  4F6A A;  4MJ8 A;  4MFJ A;  2OH1 A;  1VKC A;  2CXA A;  2ZW4 A;  3CXS A;  5IV0 A;  2Z3L A;  5DWM A;  5AGE A;  3IU1 A;  1XF8 A;  4KVM E;  2BUE A;  5H84 A;  4LUA A;  4B12 A;  2ZW5 A;  1MJA A;  2J8N A;  4CAF A;  4QUS A;  4CYO A;  2CNS A;  4QVT A;  2CNM A;  4B5O A;  1Z9U A;  4YRH A;  2Z3O A;  4KOY A;  1IB1 E;  2J8M A;  1YVK A;  5GCN A;  2Y0M A;  4OAE A;  3GYA A;  1UFH A;  1Q2D A;  1ZO0 A;  2R1I A;  4KUB A;  1KUY A;  4DNC A;  4B13 A;  4HNX B;  3SXO A;  3DSB A;  5J8C A;  3PZJ A;  3MGD A;  4UCP A;  2AJ6 A;  4CGP A;  4MFQ A;  4E0A A;  3IWE A;  1M4D A;  3GKR A;  1NSL A;  5G22 A;  4BMH A;  1P4N A;  5F46 A;  1MJ9 A;  3BJ8 A;  3P2H A;  3V8I A;  4BBH A;  4KZT A;  2B4D B;  3QB8 A;  3R9E A;  2OU2 A;  1Q2C A;  2I79 A;  4H6U A;  4C2Y A;  5AG6 A;  2P6G A;  4B5P A;  4HKF A;  4CYQ A;  2B5G B;  4RI1 A;  2B3U A;  4U9Y A;  3IWG A;  2CNT A;  1RO5 A;  1I12 A;  1S7N A;  2D4P A;  2JDD A;  1MJB A;  1M4I A;  5G1Z A;  1QSM A;  4UWJ A;  2ZXV A;  3CXP A;  2FE7 A;  2ZPA A;  1N71 A;  2Z10 A;  3TOA A;  4C7I A;  5G20 A;  1NMT A;  2YNC A;  4Q36 A;  4ORF A;  4XNH B;  2VQY A;  4IF5 A;  3R9G A;  1YR0 A;  4GS4 A;  4NEX A;  1XE4 A;  3ZJ0 A;  4PK3 A;  2PDO A;  2DPT A;  1Q2Y A;  1XIX A;  5AG7 A;  2J8R A;  4MFP A;  3IU2 A;  4QC6 A;  4UFW A;  5HH1 A;  3N7Z A;  2FIW A;  4CAW A;  4QBJ A;  1L0C A;  2OZH A;  4UCM A;  5G21 A;  4FD4 A;  2VZZ A;  4A2Z A;  2FXF A;  3LOD A;  4KUA A;  4PSX A;  5IX3 A;  2ZW7 A;  4JXQ A;  3TO7 A;  1MK4 A;  4KOR A;  2Q7B A;  4OAD A;  1WWZ A;  1NE9 A;  4H6Z A;  2REF A;  3G8W A;  4C68 A;  3T90 A;  2YNE A;  3D3S A;  5JQ4 A;  2ARH A;  4J3G A;  2X7B A;  1I21 A;  3FNC A;  4C7H A;  2PQ8 A;  3EXN A;  4XNH C;  2FCK A;  1ON0 A;  3NE7 A;  3F8K A;  4II9 A;  3VWE A;  2QEC A;  4H89 A;  1PU9 A;  3TCV A;  3TFY A;  4B11 A;  1S60 A;  4PK2 A;  3G3S A;  4R57 A;  3W6S A;  4B10 A;  1B87 A;  4NSQ A;  3B8G A;  2YND A;  3TO9 A;  2WPX A;  4CAX A;  1VHS A;  1BOB A;  4LX9 A;  5J8F A;  1YGH A;  3DNS A;  3R95 A;  2PSW A;  2QML A;  1V0C A;  4KOW A;  2BEI A;  2P6E A;  1S3Z A;  2Q0Y A;  3I3G A;  3VWD A;  4YFJ A;  2HV2 A;  2K5T A;  4KOV A;  4JLY A;  2D4O A;  2Q4V A;  2REE A;  5EC4 A;  3I9S A;  4C2Z A;  5KTA A;  1IYK A;  4R3L A;  4AVA A;  3EFA A;  4Y49 B;  2DXQ A;  3K9U A;  1S7L A;  1M1D A;  4NF1 A;  2VXK A;  1Y9K A;  3SXN A;  2R98 A;  1GHE A;  2A4N A;  1CJW A;  4JJX A;  2OZU A;  4IUS A;  2I00 A;  4UFX A;  5AG4 A;  5A28 A;  1B6B A;  4R87 A;  4UCN A;  4E2A A;  3BLN A;  3W91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...