1Z4RA

Human gcn5 acetyltransferase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
163
structure length
163
Chain Sequence
SGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords General control of amino acid synthesis protein 5-like 2
publication title Crystal structure of a binary complex between human GCN5 histone acetyltransferase domain and acetyl coenzyme A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 43
structure length 163
sequence length 163
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1z4rA00
4AG7A 2C27A 2BUEA 2PC1A 4EVYA 3R96A 4MHDA 4H6ZA 4XPKA 1KZFA 5F48A 1S7FA 1RXTA 3T90A 2B3UA 1MK4A 3P2HA 2D4OA 2G3TA 1KUYA 2OZHA 4B5PB 2B4DB 2ZW7A 1R57A 4M3SA 4H89A 3FRMA 2R8VA 2REEA 4HNYB 1YR0A 1YX0A 5F46A 2PDOA 1N71A 3E0KA 3EY5A 2FCKA 3K9UA 1MJAA 4JXRA 3V8IA 3OWCA 4Y49B 1S5KA 2RC4A 1XIXA 4AG9A 4AVBA 2OZUA 2HV2A 4KZTA 3D2MA 1J4JA 2VXKA 4DNCA 2EUIA 3NE7A 2JLMA 3R9EA 5J8CA 2O28A 2P6GA 3TOBA 2JEVA 3H4QA 1SQHA 4AVCA 1KUVA 1M4IA 5KTCA 3GY9A 3PP9A 1B87A 4U9YA 2NMTA 2QIRA 1IYKA 4KORA 3IWGA 5JPHA 3TT2A 5C88A 4KOXA 1Z4EA 3MGDA 4RI1A 4CRZB 4PK2A 2D4PA 4KVME 3S6HA 2P6FA 3I3GA 1YREA 2BEIA 4NCZA 2BSWA 4JWPA 3W6SA 3S6FA 1CJWA 4LX9A 4KOTA 4CAVA 1Y9WA 4CRYB 1KUXA 4MBUA 1YVKA 1QSMA 2CNTA 3PZJA 2EVNA 4XPDC 1QSOA 1BOBA 1YVOA 1YGHA 2Y0MA 3DDDA 5DWNA 2FT0A 2AE6A 1CM0A 1Z9UA 2CNSA 4QBJA 1P0HA 4XPDB 4ORFA 4QUSA 3R9FA 4L8AA 2B5GB 2OZGA 1P4NA 1NSLA 1YLEA 3SXNA 4PSWA 4KVXA 4R57A 4UBRA 1M4GA 3FNCA 2P6EA 4ZBGA 1LRZA 3D8PA 4R87A 3TO7A 3C26A 4X5KA 1IYLA 1Q2DA 2GE3A 5IV0A 1QSTA 3EXNA 4JLYA 2QMLA 2FIWA 3W91A 4PV6A 3QAHA 3ZZIA 4HKFA 2I79A 2VEZA 3FYNA 3VWDA 3TOAA 4FD7A 3LD2A 3GKRA 2ZPAA 4KOWA 1K4JA 4QVTA 4HNWB 5JQ4A 2JDDA 4R9MA 1U6MA 2REFA 3JUWA 5ISVA 2VI7A 1XEBA 3P2FA 4K30A 3D3SA 2B58A 2F5IA 4JJXA 4JXQA 3F8KA 1ON0A 5IB0A 2BL1A 3F0AA 2VZYA 2GANA 5KTDA 3ZJ0A 5KTAA 2OU2A 3BJ8A 1M44A 1XF8A 3N7ZA 1XE4A 1IIDA 1M4DA 2B4BA 3CXPA 3QB8A 1I21A 4I49A 3TO9A 2Q04A 2ZW5A 3R1KA 2ARHA 3KKWA 4XPLA 3RYOA 4B5OA 5F47A 2CNMA 4B5PA 2B4DA 5I0CA 4L89A 4KUAA 2PRBA 2FXFA 3DSBA 2KCWA 5H86A 4F0YA 5EC4A 3EO4A 4M85A 1M1DA 2Q0YA 2WPWA 4QC6A 1RO5A 4U9ZA 3TTHA 2DXQA 2WPXA 2OH1A 4KUBA 2HQYA 3TCVA 1TIQA 2Q4YA 1S7NA 1VHSA 5HMNA 2Q44A 3IGRA 3DR8A 1Y7RA 2Q4VA 3GYAA 4F6AA 1I12A 3G3SA 2B3VA 1Q2CA 4AB7A 4KOVA 4FD5A 4E2AA 1V0CA 4OLLA 1VKCA 3W6XA 4KOSA 2FE7A 2R7HA 1QSNA 2Z11A 2X7BA 2I00A 4HNXB 1UFHA 2FS5A 2PR8A 2Q7BA 1S3ZA 4RS2A 3EFAA 3TFYA 1I1DA 2FSRA 3F5BA 3FXTA 3VWEA 4IUSA 1Q2YA 3R9GA 1Y9KA 1NE9A 4J3GA 3SXOA 5EBVA 1FY7A 1B6BA 2CY2A 4JD6A 2GIVA 1MJ9A 2J8MA 1QSRA 4PSXA 2ATRA 2J8RA 2VQYA 2ZW6A 2A4NA 3DNSA 5IX3A 1BO4A 4OAEA 2ZXVA 4FD4A 2PQ8A 3FB3A 1S60A 4NEXA 2PR1A 5FVJA 2VBQA 3EC4A 4Y49C 3SHPA 3S6KA 2JDCA 4NXYA 3PGPA 4MI4A 4LUAA 3R95A 4CS0B 3BJ7A 2B5GA 5F49A 2R1IA 2PSWA 2Z0ZA 1Z4RA 4U5YA 2OB0A 2J8NA 4PK3A 2FL4A 4FD6A 3D2PA 4II9A 4GS4A 4UWIA 2Z10A 1WK4A 4CAWA 3BLNA 4IF5A 2VZZA 2H5MA 4OADA 4NSQA 1YK3A 5DWMA 3CXSA 2AJ6A 4AVAA 1IB1E 4E0AA 3G8WA 1S7KA 2QECA 3JVNA 4MY0A 5H84A 5J8FA 2R98A 4KOUA 4YRHA 3UY5A 1MJBA 4KLVA 4KOYA 3CXQA 3FIXA 4E8OA 1OZPA 4KLWA 5E96A 4H6UA 4UWJA 5GCNA 1L0CA 4CAXA 2HUZA 5C82A 1IICA 4XNHC 4ONUA 4MJ8A 3WR7A 4YFJA 2FIAA 4MY3A 3B8GA 4NF1A 4R3KA 4QB9A 3DR6A 5CNPA 5HH1A 3T9YA 2P0WA 4KVOE 3TO6A 4BMHA 3FBUA 4XNHB 4YGOA 2K5TA 3TE4A 1XMTA 3LODA 4R3LA 1PU9A 1PUAA 1S7LA 2ZW4A 2IL4A 1GHEA 2G0BA 4UA3A 2G3AA 3I9SA 1NMTA 1WWZA 3S6GA
chains in the Genus database with same CATH superfamily
2ZEHA 1ZG9A 4UF4A 1CX8A 4AG7A 4R7MA 2C27A 3NA6A 3QNVA 1XBUA 2BUEA 2PC1A 3KHZA 3R96A 3D7GA 4EVYA 1IGBA 4MHDA 4H6ZA 1X12A 4XPKA 1KZFA 3K9TA 4B14A 4ONWA 5F48A 3IWWA 4MMOA 4UFVA 1S7FA 1RXTA 3T90A 2B3UA 1MK4A 2Z3NA 3P2HA 3D67A 3KI9A 5LYIA 2D4OA 4ZY2A 2G3TA 2C6GA 3GUXA 1KUYA 2OZHA 4B5PB 2B4DB 2XEIA 2ZW7A 1R57A 3LMSA 4M3SA 4M6HA 4C68A 4H89A 3LACA 3FRMA 3BI0A 4BBHA 3KZWA 2R8VA 3WT4A 5LYFA 2REEA 4YWYA 2PJ6A 2AFUA 1X10A 1YR0A 4HNYB 4P4BA 4PXBA 4LQ6A 1YX0A 1LOKA 1RTQA 5F46A 4HPSA 2PDOA 3D66A 4GXHA 4A30A 1N71A 3E0KA 4PXEA 3EY5A 2FCKA 3IU2A 2ODFA 1MJAA 3K9UA 4RN7A 4UFWA 3KL9A 4JXRA 3V8IA 2Q43A 3OWCA 4OIDA 4X2TA 4CPAA 1HDQA 4Y49B 1AMPA 4FAIA 7CPAA 2AFOA 2J9AA 1S5KA 2PJ8A 2RC4A 1XIXA 1BAVA 5F09A 4AG9A 4AVBA 2OZUA 4MCSA 2HV2A 1NSAA 3CDXA 5J1QA 4P10A 4KZTA 2QVPA 2PCUA 1CP7A 2V8DA 2Z3PA 3D2MA 1M4LA 1J4JA 2VXKA 4DNCA 2YNEA 2EUIA 3NE7A 5JM6A 3N5FA 2JLMA 3R9EA 4A2ZA 4AXVA 5K8PA 5J8CA 2O28A 2P6GA 3KQZA 3TOBA 2JEVA 2YNCA 3B3SA 3H4QA 2XEGA 1SQHA 2CF4A 3IU1A 1VGYA 4AVCA 5G1ZA 1KUVA 3D68A 3QAYA 4ZY0A 1F2PA 1M4IA 1TF8A 2ZEPA 5KTCA 3GY9A 3IIBA 1LCPA 3PP9A 1B87A 4U9YA 3IC1A 2NMTA 1YLOA 4KSIA 4OIWA 4UCPA 5AG5A 2Q7SA 2DPSA 4M6IA 3PBEA 3RO0A 5G22A 5THWA 2QIRA 4UCNA 3NFZA 1IYKA 5G20A 2QJ8A 3IWGA 4KORA 3KHXA 5JPHA 4MFJA 5AGEA 3SI1A 3TT2A 5C88A 4KOXA 1Z4EA 2RB7A 4C2ZA 4CYOA 3MGDA 4RI1A 4CRZB 4PK2A 1ZG8A 2D4PA 4KVME 3S6HA 4A37A 2P6FA 3FX6A 3I3GA 4CAFA 3B2YA 4NGTA 1HDUA 3LWUA 4WWVA 1ARMA 1YREA 1H8LA 2BEIA 4NCZA 3FVLA 2BSWA 4JWPA 3W6SA 4RUHA 2OR4A 3S6FA 1CJWA 5BWAB 2GFQA 4P4FA 4LX9A 4OMEA 3VATA 4KOTA 4CAVA 1Y9WA 4NJQA 1VHEA 4CGPA 4CRYB 2G9DA 4UEEA 3D7DA 1CPSA 1KUXA 4MBUA 1YVKA 3B3VA 4MFQA 3D7FA 2OOTA 1QSMA 2CNTA 3PZJA 3I1UA 1FNOA 2EVNA 1XJOA 1JQGA 1QSOA 1BOBA 3H8FA 4XPDC 3IWEA 1YVOA 1CBXA 1YGHA 2AFSA 2Y0MA 5CBMA 1Y0YA 3V38A 1Z8LA 2ZEGA 2Z3MA 3FH4A 2PJ9A 3T8WA 5JGFA 4C7IA 3IEHA 3DDDA 5DWNA 2FT0A 2AE6A 2EWBA 1CM0A 2PJ3A 1Z9UA 2CNSA 2BOAA 2GREA 1P0HA 4H2KA 4QBJA 1R3NA 4XPDB 1XMBA 1BLLE 4MCPA 4ORFA 1Z8TA 4L8AA 4QUSA 3R9FA 2PRQA 1LFWA 4KSAA 4ZYQA 4P6YA 5EMIA 1Q7LA 3FMCA 2B5GB 2OZGA 4IK2A 1P4NA 1NSLA 2AFWA 1YLEA 4B6ZA 4JZ0A 4P44A 1R43A 3SXNA 2GLFA 2ZENA 4PSWA 2ZOFA 4KVXA 4R57A 4UBRA 3TX8A 1M4GA 3FNCA 2P6EA 4OC5A 4ZBGA 1LRZA 3D8PA 2Z3OA 4R87A 4Z65A 3H8GA 1QMUA 3TO7A 2PJ4A 3RAMA 3C26A 4NGPA 4X5KA 4ZX8A 1IYLA 3D7HA 1Q2DA 5HVFA 3CPXA 2GE3A 2V8VA 2YNCC 5IV0A 4K3NA 1QSTA 3EXNA 2JBJA 4JLYA 4R8FA 5LRGA 2QMLA 2FIWA 3W91A 4MHYA 3QAHA 3KGQA 4PV6A 2GU2A 3ZZIA 4C2YA 4HKFA 2I79A 2PJ1A 2F8HA 2VEZA 2JEWA 3FYNA 3VWDA 4C7HA 3TOAA 5A27A 4FD7A 1LANA 3LD2A 2ZOGA 3GKRA 2ZPAA 4KOWA 4NFRA 1TXRA 1K4JA 4QVTA 4HNWB 3MN8A 5JQ4A 2JDDA 4R9MA 1U6MA 2PJ5A 4B12A 2REFA 3JUWA 5ISVA 1Z2LA 1Y0RA 1ZO0A 2IMOA 1XEBA 2VI7A 3PB9X 2V8GA 3P2FA 4G1PA 4K30A 3D3SA 4ZGYB 2B58A 2F5IA 4JJXA 4JXQA 3F8KA 1ON0A 2CXAA 2RFHA 1DTDA 2BL1A 5IB0A 3F0AA 4ZX9A 2VZYA 2GANA 5KTDA 2PJAA 2EK9A 5AG7A 1A2ZA 3ZJ0A 5KTAA 5K8OA 2OU2A 3BJ8A 4PXDA 1M44A 1XF8A 3N7ZA 1XE4A 1IIDA 1M4DA 2B4BA 3CXPA 3QB8A 4OC2A 4ZI6A 2Q4ZA 1I21A 3CZXA 4I49A 3TO9A 3S9NA 5K8NA 2Q04A 2ZW5A 1JWQA 3R1KA 8CPAA 2ARHA 1GYTA 3KKWA 5D8NA 5DS0A 4R6TA 4Q38A 2PVWA 3PB7X 4XPLA 3RYOA 4P4IA 3PB8X 5JH9A 4GM5A 4B5OA 5HXDA 1ZLIA 5F47A 1YW4A 2CNMA 4B5PA 2B4DA 5I0CA 4L89A 4KUAA 2PRBA 2FXFA 1CG2A 3DSBA 2KCWA 4P4DA 5H86A 2WSAA 4CAEA 2WUUA 4CYQA 5A28A 4EFDA 2PE3A 2ZEMA 1YW6A 3KQXA 5EC4A 4F0YA 3IJ3A 2C1CA 3EO4A 2PIZA 4M85A 3PEIA 2WYRA 4FBEA 3FEDA 2JBKA 1M1DA 4MHZA 4LQGA 3GB0A 2Q0YA 2WPWA 4QC6A 4A39A 4MRIA 1RO5A 4U9ZA 2V77A 3PRTA 3TTHA 1DE4C 2DXQA 2EK8A 2WPXA 2OH1A 3FEEA 3H8EA 4KUBA 2HQYA 4A33A 4A38A 3TCVA 3PBBA 1UWYA 4A31A 5LYDA 1TIQA 4NGSA 4IHMA 4CGOA 2Q4YA 1BPMA 2HB6A 1S7NA 3RBUA 1VHSA 2DF5A 3WC6A 5HMNA 2Q44A 3IGRA 4Q7AA 1Z5RA 4CYNA 4P4EA 3DR8A 2YNDA 1Y7RA 2Q4VA 1CP6A 4OKOA 1XFOA 2PJBA 3KR4A 3GYAA 2GLJA 4F6AA 4UIBA 1I12A 3G3SA 2B3VA 1Q2CA 2NSMA 3NH4A 2AFXA 4AB7A 3FECA 4KOVA 4FD5A 1Y7EA 3CPAA 2XEJA 3PFOA 3SJEA 4YU9A 3B3WA 1FT7A 4E2AA 2ZEOA 1V0CA 4OLLA 1VKCA 3W6XA 4KOSA 3SJFA 5K8MA 2FE7A 4DYOA 2R7HA 1QSNA 4UEZA 2Z11A 3DGVA 2ZELA 3DLJA 3FJUA 2ZEEA 4PQAA 4X3RA 1IOFA 2ZEFA 2X7BA 2I00A 3VH9A 4HNXB 3BXMA 1UFHA 4JYWA 2FS5A 4PXCA 2PR8A 1IY7A 3ISZA 2Z3KA 2Q7BA 1S3ZA 3H5ZA 4RS2A 3EFAA 4B10A 1I1DA 3TFYA 4MFKA 3JRUA 1F57A 2EBJA 3PFEA 3RNZA 2FSRA 1F2OA 4OC0A 2PIYA 3F5BA 2XEFA 3FXTA 3VWEA 4IUSA 1Q2YA 4DJLA 2IJZA 3R9GA 1Y9KA 4DUKA 1NE9A 1ELLP 3K2KA 4J3GA 5CPAA 2ANPA 2IQ6A 4WJBA 3SXOA 2BCOA 1FY7A 1KWMA 1TKJA 5EBVA 4MFLA 1B6BA 3PB4X 1YSJA 2CY2A 4CYPA 4JD6A 2GIVA 2NYQA 1Z8WA 1VHOA 2CTCA 4OC4A 1MJ9A 2J8MA 4P4JA 1QSRA 4A94A 4KSFA 4PSXA 2QYVA 3HUVA 4W9YA 3B35A 1PCAA 4P45A 2O4HA 2ATRA 2J8RA 2VQYA 3HLPA 2CTBA 2ZW6A 2A4NA 3IFEA 3DNSA 5IX3A 4MFPA 1BO4A 4OAEA 2ZXVA 2WZNA 4FD4A 4OC1A 1IU8A 2PQ8A 1S60A 3FB3A 2HC9A 4NEXA 2PR1A 5AG6A 4UIAA 5FVJA 1BPNA 3BI1A 2VBQA 3EC4A 4Y49C 4MFZA 3SHPA 3WC7A 3S6KA 2JDCA 2FVGA 4NXYA 2VL1A 3PGPA 4LUAA 4MI4A 2PJ7A 3R95A 4CS0B 2I3CA 3BJ7A 2B5GA 5F49A 2R1IA 2PSWA 2Z0ZA 3A9LA 3NH8A 3D4UA 1EE3P 3JTKA 1Z4RA 4U5YA 1IOIA 2C6PA 2OB0A 1Z8XA 4R76A 2ZEDA 1PYTB 2J8NA 2DEAA 4PK3A 4UCMA 2PJ2A 2FL4A 2BO9A 2CIJA 4FD6A 1LAPA 4MCQA 3D2PA 3B3CA 4II9A 4GS4A 4UWIA 4F8ZA 2Z10A 5AG4A 1WK4A 4CAWA 1ZLHA 4OP4A 3BLNA 1CPXA 4IF5A 4Q36A 2VZZA 4NGQA 2H5MA 4OADA 3WABA 4OC3A 2PJ0A 4NGRA 4F0XA 1ELMP 4NSQA 1YK3A 3GIUA 3SJGA 3FF3A 4TWEA 3S9MA 5DWMA 1AYEA 3CXSA 2V8HA 2Z3LA 1TKFA 2AJ6A 1ARLA 4AVAA 1IB1E 4F9VA 4E0AA 2ABZA 3B7IA 4B13A 4B11A 4KS9A 4BINA 3G8WA 4MHNA 3BHXA 5G21A 1S7KA 2QECA 3NE8A 5IB9A 3JVNA 4MY0A 5H84A 5J8FA 4M6GA 1XOVA 2R98A 1TF9A 4X8IA 5D29A 5ELYA 4BD9A 4KOUA 5I4MA 4YRHA 3UY5A 2F7VA 4MXUA 4NGMA 1MJBA 4KLVA 4KOYA 3CXQA 1TKHA 3FIXA 4FWUA 3WC5A 4CGLA 4E8OA 1OZPA 1LAMA 3NH5A 2Q51A 4KLWA 5E96A 4H6UA 4UWJA 5HVHA 5GCNA 3L2NA 1L0CA 2PJCA 4CAXA 2HUZA 5C82A 1IICA 4XNHC 1QQ9A 4MJ8A 4ONUA 4UEFA 3PB6X 3SI2A 1HEEA 3WR7A 4A95A 4YFJA 2POKA 5HVGA 4MCRA 3CT9A 2FIAA 3VARA 1ZG7A 2DPTA 3SI0A 4MY3A 4EWTA 1YQEA 4F9UA 5LYLA 3B8GA 4NF1A 4R3KA 4QB9A 3DR6A 4O23A 5CNPA 5HH1A 3T9YA 2P0WA 3V7ZA 5LRKA 3KR5A 3S9LA 4KVOE 6CPAA 4MHPA 4NJRA 3TO6A 3MRUA 2PVVA 4BMHA 4CGNA 3FBUA 4XNHB 1VIXA 4ZY1A 4C2XA 4YGOA 3SJXA 3TC8A 4CGMA 2K5TA 3TE4A 4EMEA 2YGWA 3IO1A 1XMTA 3LODA 4IAVA 4R3LA 1PU9A 4TNUA 3ISXA 1PUAA 1S7LA 2ZW4A 2AFZA 3GLJA 4NGNA 2IL4A 4PPZA 1OBRA 3RZAA 4A32A 2EO8A 4UFXA 1AUGA 2C6CA 1GHEA 5LRJA 2G0BA 3KASA 4UA3A 2G3AA 2AFMA 1YMEA 3I9SA 3B3TA 4FUUA 1NMTA 1WWZA 3S6GA 2O53A 1XRYA
chains in the Genus database with same CATH topology
4AG7A 2C27A 2BUEA 2PC1A 4EVYA 3R96A 4MHDA 4H6ZA 4XPKA 1KZFA 4B14A 5F48A 4UFVA 1S7FA 1RXTA 3T90A 2B3UA 1MK4A 2Z3NA 3P2HA 2D4OA 2G3TA 1KUYA 2OZHA 4B5PB 2B4DB 2ZW7A 1R57A 4M3SA 4C68A 4H89A 3FRMA 4BBHA 2R8VA 2REEA 4HNYB 1YR0A 1YX0A 5F46A 2PDOA 4A30A 1N71A 3E0KA 3EY5A 2FCKA 3IU2A 3K9UA 1MJAA 4UFWA 4JXRA 3V8IA 3OWCA 4Y49B 1S5KA 2RC4A 1XIXA 4AG9A 4AVBA 2OZUA 2HV2A 4KZTA 2Z3PA 3D2MA 1J4JA 2VXKA 4DNCA 2YNEA 2EUIA 3NE7A 2JLMA 3R9EA 4A2ZA 5J8CA 2O28A 2P6GA 3TOBA 2JEVA 2YNCA 3H4QA 1SQHA 3IU1A 4AVCA 5G1ZA 1KUVA 1M4IA 5KTCA 3GY9A 3PP9A 1B87A 4U9YA 2NMTA 4UCPA 5AG5A 2DPSA 5G22A 2QIRA 4UCNA 1IYKA 5G20A 3IWGA 4KORA 5JPHA 4MFJA 5AGEA 3TT2A 5C88A 4KOXA 1Z4EA 4C2ZA 4CYOA 3MGDA 4RI1A 4CRZB 4PK2A 2D4PA 4KVME 3S6HA 2P6FA 3I3GA 4CAFA 1YREA 2BEIA 4NCZA 2BSWA 4JWPA 3W6SA 3S6FA 1CJWA 5BWAB 4LX9A 4KOTA 4CAVA 1Y9WA 4CGPA 4CRYB 1KUXA 4MBUA 1YVKA 4MFQA 1QSMA 2CNTA 3PZJA 2EVNA 4XPDC 1QSOA 1BOBA 3IWEA 1YVOA 1YGHA 2Y0MA 2Z3MA 4C7IA 3DDDA 5DWNA 2FT0A 2AE6A 1CM0A 1Z9UA 2CNSA 4QBJA 1P0HA 4XPDB 4ORFA 4QUSA 3R9FA 4L8AA 4KSAA 2B5GB 2OZGA 1P4NA 1NSLA 1YLEA 3SXNA 4PSWA 4KVXA 4R57A 4UBRA 1M4GA 3FNCA 2P6EA 4ZBGA 1LRZA 3D8PA 2Z3OA 4R87A 3TO7A 3C26A 4X5KA 1IYLA 1Q2DA 2GE3A 5IV0A 2YNCC 1QSTA 3EXNA 4JLYA 2QMLA 2FIWA 3W91A 4PV6A 3QAHA 3ZZIA 4C2YA 4HKFA 2I79A 2VEZA 3FYNA 3VWDA 4C7HA 3TOAA 5A27A 4FD7A 3LD2A 3GKRA 2ZPAA 4KOWA 1K4JA 4QVTA 4HNWB 5JQ4A 2JDDA 4R9MA 1U6MA 4B12A 2REFA 3JUWA 5ISVA 2VI7A 1ZO0A 1XEBA 3P2FA 4K30A 3D3SA 4ZGYB 2B58A 2F5IA 4JJXA 4JXQA 3F8KA 1ON0A 2CXAA 5IB0A 2BL1A 3F0AA 2VZYA 2GANA 5KTDA 5AG7A 3ZJ0A 5KTAA 2OU2A 3BJ8A 1M44A 1XF8A 3N7ZA 1XE4A 1IIDA 1M4DA 2B4BA 3CXPA 3QB8A 1I21A 4I49A 3TO9A 2Q04A 2ZW5A 3R1KA 2ARHA 3KKWA 4Q38A 4XPLA 3RYOA 4B5OA 5F47A 2CNMA 4B5PA 2B4DA 5I0CA 4L89A 4KUAA 2PRBA 2FXFA 3DSBA 2KCWA 5H86A 2WSAA 4CAEA 2WUUA 4CYQA 5A28A 4F0YA 5EC4A 3EO4A 4M85A 1M1DA 2Q0YA 2WPWA 4QC6A 1RO5A 4U9ZA 3TTHA 2DXQA 2WPXA 4A33A 2OH1A 4KUBA 2HQYA 3TCVA 4A31A 1TIQA 4CGOA 2Q4YA 1S7NA 1VHSA 5HMNA 2Q44A 3IGRA 4CYNA 3DR8A 2YNDA 1Y7RA 2Q4VA 3GYAA 4F6AA 1I12A 3G3SA 2B3VA 1Q2CA 4AB7A 4KOVA 4FD5A 4E2AA 1V0CA 4OLLA 1VKCA 3W6XA 4KOSA 2FE7A 2R7HA 1QSNA 2Z11A 2X7BA 2I00A 4HNXB 1UFHA 2FS5A 2PR8A 2Z3KA 2Q7BA 1S3ZA 3H5ZA 4RS2A 3EFAA 4B10A 1I1DA 3TFYA 4MFKA 2FSRA 3F5BA 3FXTA 3VWEA 4IUSA 1Q2YA 3R9GA 1Y9KA 1NE9A 4J3GA 3SXOA 5EBVA 1FY7A 4MFLA 1B6BA 2CY2A 4CYPA 4JD6A 2GIVA 1MJ9A 2J8MA 1QSRA 4KSFA 4PSXA 2ATRA 2J8RA 2VQYA 2ZW6A 2A4NA 3DNSA 5IX3A 4MFPA 1BO4A 4OAEA 2ZXVA 4FD4A 2PQ8A 3FB3A 1S60A 4NEXA 2PR1A 5AG6A 5FVJA 2VBQA 3EC4A 4Y49C 4MFZA 3SHPA 3S6KA 2JDCA 4NXYA 3PGPA 4MI4A 4LUAA 3R95A 4CS0B 3BJ7A 2B5GA 5F49A 2R1IA 2PSWA 2Z0ZA 3A9LA 3JTKA 1Z4RA 4U5YA 2OB0A 2J8NA 4PK3A 4UCMA 2FL4A 4FD6A 3D2PA 4II9A 4GS4A 4UWIA 5AG4A 2Z10A 1WK4A 4CAWA 3BLNA 4IF5A 4Q36A 2VZZA 2H5MA 4OADA 4F0XA 4NSQA 1YK3A 5DWMA 3CXSA 2Z3LA 2AJ6A 4AVAA 1IB1E 4E0AA 4B13A 4B11A 4KS9A 3G8WA 5G21A 1S7KA 2QECA 3JVNA 4MY0A 5H84A 5J8FA 2R98A 4KOUA 4YRHA 3UY5A 1MJBA 4KLVA 4KOYA 3CXQA 3FIXA 4E8OA 4CGLA 1OZPA 4KLWA 5E96A 4H6UA 4UWJA 5GCNA 1L0CA 4CAXA 2HUZA 5C82A 1IICA 4XNHC 4ONUA 4MJ8A 3WR7A 4YFJA 4A95A 2FIAA 2DPTA 4MY3A 3B8GA 4NF1A 4R3KA 4QB9A 3DR6A 5CNPA 5HH1A 3T9YA 2P0WA 4KVOE 3TO6A 4CGNA 4BMHA 3FBUA 4XNHB 4C2XA 4YGOA 4CGMA 2K5TA 3TE4A 2YGWA 1XMTA 3LODA 4R3LA 1PU9A 1PUAA 1S7LA 2ZW4A 4A32A 2IL4A 4UFXA 1GHEA 2G0BA 4UA3A 2G3AA 3I9SA 1NMTA 1WWZA 3S6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AG7 A;  2C27 A;  2BUE A;  2PC1 A;  4EVY A;  3R96 A;  4MHD A;  4H6Z A;  4XPK A;  1KZF A;  5F48 A;  1S7F A;  1RXT A;  3T90 A;  2B3U A;  1MK4 A;  3P2H A;  2D4O A;  2G3T A;  1KUY A;  2OZH A;  4B5P B;  2B4D B;  2ZW7 A;  1R57 A;  4M3S A;  4H89 A;  3FRM A;  2R8V A;  2REE A;  4HNY B;  1YR0 A;  1YX0 A;  5F46 A;  2PDO A;  1N71 A;  3E0K A;  3EY5 A;  2FCK A;  3K9U A;  1MJA A;  4JXR A;  3V8I A;  3OWC A;  4Y49 B;  1S5K A;  2RC4 A;  1XIX A;  4AG9 A;  4AVB A;  2OZU A;  2HV2 A;  4KZT A;  3D2M A;  1J4J A;  2VXK A;  4DNC A;  2EUI A;  3NE7 A;  2JLM A;  3R9E A;  5J8C A;  2O28 A;  2P6G A;  3TOB A;  2JEV A;  3H4Q A;  1SQH A;  4AVC A;  1KUV A;  1M4I A;  5KTC A;  3GY9 A;  3PP9 A;  1B87 A;  4U9Y A;  2NMT A;  2QIR A;  1IYK A;  4KOR A;  3IWG A;  5JPH A;  3TT2 A;  5C88 A;  4KOX A;  1Z4E A;  3MGD A;  4RI1 A;  4CRZ B;  4PK2 A;  2D4P A;  4KVM E;  3S6H A;  2P6F A;  3I3G A;  1YRE A;  2BEI A;  4NCZ A;  2BSW A;  4JWP A;  3W6S A;  3S6F A;  1CJW A;  4LX9 A;  4KOT A;  4CAV A;  1Y9W A;  4CRY B;  1KUX A;  4MBU A;  1YVK A;  1QSM A;  2CNT A;  3PZJ A;  2EVN A;  4XPD C;  1QSO A;  1BOB A;  1YVO A;  1YGH A;  2Y0M A;  3DDD A;  5DWN A;  2FT0 A;  2AE6 A;  1CM0 A;  1Z9U A;  2CNS A;  4QBJ A;  1P0H A;  4XPD B;  4ORF A;  4QUS A;  3R9F A;  4L8A A;  2B5G B;  2OZG A;  1P4N A;  1NSL A;  1YLE A;  3SXN A;  4PSW A;  4KVX A;  4R57 A;  4UBR A;  1M4G A;  3FNC A;  2P6E A;  4ZBG A;  1LRZ A;  3D8P A;  4R87 A;  3TO7 A;  3C26 A;  4X5K A;  1IYL A;  1Q2D A;  2GE3 A;  5IV0 A;  1QST A;  3EXN A;  4JLY A;  2QML A;  2FIW A;  3W91 A;  4PV6 A;  3QAH A;  3ZZI A;  4HKF A;  2I79 A;  2VEZ A;  3FYN A;  3VWD A;  3TOA A;  4FD7 A;  3LD2 A;  3GKR A;  2ZPA A;  4KOW A;  1K4J A;  4QVT A;  4HNW B;  5JQ4 A;  2JDD A;  4R9M A;  1U6M A;  2REF A;  3JUW A;  5ISV A;  2VI7 A;  1XEB A;  3P2F A;  4K30 A;  3D3S A;  2B58 A;  2F5I A;  4JJX A;  4JXQ A;  3F8K A;  1ON0 A;  5IB0 A;  2BL1 A;  3F0A A;  2VZY A;  2GAN A;  5KTD A;  3ZJ0 A;  5KTA A;  2OU2 A;  3BJ8 A;  1M44 A;  1XF8 A;  3N7Z A;  1XE4 A;  1IID A;  1M4D A;  2B4B A;  3CXP A;  3QB8 A;  1I21 A;  4I49 A;  3TO9 A;  2Q04 A;  2ZW5 A;  3R1K A;  2ARH A;  3KKW A;  4XPL A;  3RYO A;  4B5O A;  5F47 A;  2CNM A;  4B5P A;  2B4D A;  5I0C A;  4L89 A;  4KUA A;  2PRB A;  2FXF A;  3DSB A;  2KCW A;  5H86 A;  4F0Y A;  5EC4 A;  3EO4 A;  4M85 A;  1M1D A;  2Q0Y A;  2WPW A;  4QC6 A;  1RO5 A;  4U9Z A;  3TTH A;  2DXQ A;  2WPX A;  2OH1 A;  4KUB A;  2HQY A;  3TCV A;  1TIQ A;  2Q4Y A;  1S7N A;  1VHS A;  5HMN A;  2Q44 A;  3IGR A;  3DR8 A;  1Y7R A;  2Q4V A;  3GYA A;  4F6A A;  1I12 A;  3G3S A;  2B3V A;  1Q2C A;  4AB7 A;  4KOV A;  4FD5 A;  4E2A A;  1V0C A;  4OLL A;  1VKC A;  3W6X A;  4KOS A;  2FE7 A;  2R7H A;  1QSN A;  2Z11 A;  2X7B A;  2I00 A;  4HNX B;  1UFH A;  2FS5 A;  2PR8 A;  2Q7B A;  1S3Z A;  4RS2 A;  3EFA A;  3TFY A;  1I1D A;  2FSR A;  3F5B A;  3FXT A;  3VWE A;  4IUS A;  1Q2Y A;  3R9G A;  1Y9K A;  1NE9 A;  4J3G A;  3SXO A;  5EBV A;  1FY7 A;  1B6B A;  2CY2 A;  4JD6 A;  2GIV A;  1MJ9 A;  2J8M A;  1QSR A;  4PSX A;  2ATR A;  2J8R A;  2VQY A;  2ZW6 A;  2A4N A;  3DNS A;  5IX3 A;  1BO4 A;  4OAE A;  2ZXV A;  4FD4 A;  2PQ8 A;  3FB3 A;  1S60 A;  4NEX A;  2PR1 A;  5FVJ A;  2VBQ A;  3EC4 A;  4Y49 C;  3SHP A;  3S6K A;  2JDC A;  4NXY A;  3PGP A;  4MI4 A;  4LUA A;  3R95 A;  4CS0 B;  3BJ7 A;  2B5G A;  5F49 A;  2R1I A;  2PSW A;  2Z0Z A;  1Z4R A;  4U5Y A;  2OB0 A;  2J8N A;  4PK3 A;  2FL4 A;  4FD6 A;  3D2P A;  4II9 A;  4GS4 A;  4UWI A;  2Z10 A;  1WK4 A;  4CAW A;  3BLN A;  4IF5 A;  2VZZ A;  2H5M A;  4OAD A;  4NSQ A;  1YK3 A;  5DWM A;  3CXS A;  2AJ6 A;  4AVA A;  1IB1 E;  4E0A A;  3G8W A;  1S7K A;  2QEC A;  3JVN A;  4MY0 A;  5H84 A;  5J8F A;  2R98 A;  4KOU A;  4YRH A;  3UY5 A;  1MJB A;  4KLV A;  4KOY A;  3CXQ A;  3FIX A;  4E8O A;  1OZP A;  4KLW A;  5E96 A;  4H6U A;  4UWJ A;  5GCN A;  1L0C A;  4CAX A;  2HUZ A;  5C82 A;  1IIC A;  4XNH C;  4ONU A;  4MJ8 A;  3WR7 A;  4YFJ A;  2FIA A;  4MY3 A;  3B8G A;  4NF1 A;  4R3K A;  4QB9 A;  3DR6 A;  5CNP A;  5HH1 A;  3T9Y A;  2P0W A;  4KVO E;  3TO6 A;  4BMH A;  3FBU A;  4XNH B;  4YGO A;  2K5T A;  3TE4 A;  1XMT A;  3LOD A;  4R3L A;  1PU9 A;  1PUA A;  1S7L A;  2ZW4 A;  2IL4 A;  1GHE A;  2G0B A;  4UA3 A;  2G3A A;  3I9S A;  1NMT A;  1WWZ A;  3S6G A; 
#chains in the Genus database with same CATH topology
 2ZEH A;  1ZG9 A;  4UF4 A;  1CX8 A;  4AG7 A;  4R7M A;  2C27 A;  3NA6 A;  3QNV A;  1XBU A;  2BUE A;  2PC1 A;  3KHZ A;  3R96 A;  3D7G A;  4EVY A;  1IGB A;  4MHD A;  4H6Z A;  1X12 A;  4XPK A;  1KZF A;  3K9T A;  4B14 A;  4ONW A;  5F48 A;  3IWW A;  4MMO A;  4UFV A;  1S7F A;  1RXT A;  3T90 A;  2B3U A;  1MK4 A;  2Z3N A;  3P2H A;  3D67 A;  3KI9 A;  5LYI A;  2D4O A;  4ZY2 A;  2G3T A;  2C6G A;  3GUX A;  1KUY A;  2OZH A;  4B5P B;  2B4D B;  2XEI A;  2ZW7 A;  1R57 A;  3LMS A;  4M3S A;  4M6H A;  4C68 A;  4H89 A;  3LAC A;  3FRM A;  3BI0 A;  4BBH A;  3KZW A;  2R8V A;  3WT4 A;  5LYF A;  2REE A;  4YWY A;  2PJ6 A;  2AFU A;  1X10 A;  1YR0 A;  4HNY B;  4P4B A;  4PXB A;  4LQ6 A;  1YX0 A;  1LOK A;  1RTQ A;  5F46 A;  4HPS A;  2PDO A;  3D66 A;  4GXH A;  4A30 A;  1N71 A;  3E0K A;  4PXE A;  3EY5 A;  2FCK A;  3IU2 A;  2ODF A;  1MJA A;  3K9U A;  4RN7 A;  4UFW A;  3KL9 A;  4JXR A;  3V8I A;  2Q43 A;  3OWC A;  4OID A;  4X2T A;  4CPA A;  1HDQ A;  4Y49 B;  1AMP A;  4FAI A;  7CPA A;  2AFO A;  2J9A A;  1S5K A;  2PJ8 A;  2RC4 A;  1XIX A;  1BAV A;  5F09 A;  4AG9 A;  4AVB A;  2OZU A;  4MCS A;  2HV2 A;  1NSA A;  3CDX A;  5J1Q A;  4P10 A;  4KZT A;  2QVP A;  2PCU A;  1CP7 A;  2V8D A;  2Z3P A;  3D2M A;  1M4L A;  1J4J A;  2VXK A;  4DNC A;  2YNE A;  2EUI A;  3NE7 A;  5JM6 A;  3N5F A;  2JLM A;  3R9E A;  4A2Z A;  4AXV A;  5K8P A;  5J8C A;  2O28 A;  2P6G A;  3KQZ A;  3TOB A;  2JEV A;  2YNC A;  3B3S A;  3H4Q A;  2XEG A;  1SQH A;  2CF4 A;  3IU1 A;  1VGY A;  4AVC A;  5G1Z A;  1KUV A;  3D68 A;  3QAY A;  4ZY0 A;  1F2P A;  1M4I A;  1TF8 A;  2ZEP A;  5KTC A;  3GY9 A;  3IIB A;  1LCP A;  3PP9 A;  1B87 A;  4U9Y A;  3IC1 A;  2NMT A;  1YLO A;  4KSI A;  4OIW A;  4UCP A;  5AG5 A;  2Q7S A;  2DPS A;  4M6I A;  3PBE A;  3RO0 A;  5G22 A;  5THW A;  2QIR A;  4UCN A;  3NFZ A;  1IYK A;  5G20 A;  2QJ8 A;  3IWG A;  4KOR A;  3KHX A;  5JPH A;  4MFJ A;  5AGE A;  3SI1 A;  3TT2 A;  5C88 A;  4KOX A;  1Z4E A;  2RB7 A;  4C2Z A;  4CYO A;  3MGD A;  4RI1 A;  4CRZ B;  4PK2 A;  1ZG8 A;  2D4P A;  4KVM E;  3S6H A;  4A37 A;  2P6F A;  3FX6 A;  3I3G A;  4CAF A;  3B2Y A;  4NGT A;  1HDU A;  3LWU A;  4WWV A;  1ARM A;  1YRE A;  1H8L A;  2BEI A;  4NCZ A;  3FVL A;  2BSW A;  4JWP A;  3W6S A;  4RUH A;  2OR4 A;  3S6F A;  1CJW A;  5BWA B;  2GFQ A;  4P4F A;  4LX9 A;  4OME A;  3VAT A;  4KOT A;  4CAV A;  1Y9W A;  4NJQ A;  1VHE A;  4CGP A;  4CRY B;  2G9D A;  4UEE A;  3D7D A;  1CPS A;  1KUX A;  4MBU A;  1YVK A;  3B3V A;  4MFQ A;  3D7F A;  2OOT A;  1QSM A;  2CNT A;  3PZJ A;  3I1U A;  1FNO A;  2EVN A;  1XJO A;  1JQG A;  1QSO A;  1BOB A;  3H8F A;  4XPD C;  3IWE A;  1YVO A;  1CBX A;  1YGH A;  2AFS A;  2Y0M A;  5CBM A;  1Y0Y A;  3V38 A;  1Z8L A;  2ZEG A;  2Z3M A;  3FH4 A;  2PJ9 A;  3T8W A;  5JGF A;  4C7I A;  3IEH A;  3DDD A;  5DWN A;  2FT0 A;  2AE6 A;  2EWB A;  1CM0 A;  2PJ3 A;  1Z9U A;  2CNS A;  2BOA A;  2GRE A;  1P0H A;  4H2K A;  4QBJ A;  1R3N A;  4XPD B;  1XMB A;  1BLL E;  4MCP A;  4ORF A;  1Z8T A;  4L8A A;  4QUS A;  3R9F A;  2PRQ A;  1LFW A;  4KSA A;  4ZYQ A;  4P6Y A;  5EMI A;  1Q7L A;  3FMC A;  2B5G B;  2OZG A;  4IK2 A;  1P4N A;  1NSL A;  2AFW A;  1YLE A;  4B6Z A;  4JZ0 A;  4P44 A;  1R43 A;  3SXN A;  2GLF A;  2ZEN A;  4PSW A;  2ZOF A;  4KVX A;  4R57 A;  4UBR A;  3TX8 A;  1M4G A;  3FNC A;  2P6E A;  4OC5 A;  4ZBG A;  1LRZ A;  3D8P A;  2Z3O A;  4R87 A;  4Z65 A;  3H8G A;  1QMU A;  3TO7 A;  2PJ4 A;  3RAM A;  3C26 A;  4NGP A;  4X5K A;  4ZX8 A;  1IYL A;  3D7H A;  1Q2D A;  5HVF A;  3CPX A;  2GE3 A;  2V8V A;  2YNC C;  5IV0 A;  4K3N A;  1QST A;  3EXN A;  2JBJ A;  4JLY A;  4R8F A;  5LRG A;  2QML A;  2FIW A;  3W91 A;  4MHY A;  3QAH A;  3KGQ A;  4PV6 A;  2GU2 A;  3ZZI A;  4C2Y A;  4HKF A;  2I79 A;  2PJ1 A;  2F8H A;  2VEZ A;  2JEW A;  3FYN A;  3VWD A;  4C7H A;  3TOA A;  5A27 A;  4FD7 A;  1LAN A;  3LD2 A;  2ZOG A;  3GKR A;  2ZPA A;  4KOW A;  4NFR A;  1TXR A;  1K4J A;  4QVT A;  4HNW B;  3MN8 A;  5JQ4 A;  2JDD A;  4R9M A;  1U6M A;  2PJ5 A;  4B12 A;  2REF A;  3JUW A;  5ISV A;  1Z2L A;  1Y0R A;  1ZO0 A;  2IMO A;  1XEB A;  2VI7 A;  3PB9 X;  2V8G A;  3P2F A;  4G1P A;  4K30 A;  3D3S A;  4ZGY B;  2B58 A;  2F5I A;  4JJX A;  4JXQ A;  3F8K A;  1ON0 A;  2CXA A;  2RFH A;  1DTD A;  2BL1 A;  5IB0 A;  3F0A A;  4ZX9 A;  2VZY A;  2GAN A;  5KTD A;  2PJA A;  2EK9 A;  5AG7 A;  1A2Z A;  3ZJ0 A;  5KTA A;  5K8O A;  2OU2 A;  3BJ8 A;  4PXD A;  1M44 A;  1XF8 A;  3N7Z A;  1XE4 A;  1IID A;  1M4D A;  2B4B A;  3CXP A;  3QB8 A;  4OC2 A;  4ZI6 A;  2Q4Z A;  1I21 A;  3CZX A;  4I49 A;  3TO9 A;  3S9N A;  5K8N A;  2Q04 A;  2ZW5 A;  1JWQ A;  3R1K A;  8CPA A;  2ARH A;  1GYT A;  3KKW A;  5D8N A;  5DS0 A;  4R6T A;  4Q38 A;  2PVW A;  3PB7 X;  4XPL A;  3RYO A;  4P4I A;  3PB8 X;  5JH9 A;  4GM5 A;  4B5O A;  5HXD A;  1ZLI A;  5F47 A;  1YW4 A;  2CNM A;  4B5P A;  2B4D A;  5I0C A;  4L89 A;  4KUA A;  2PRB A;  2FXF A;  1CG2 A;  3DSB A;  2KCW A;  4P4D A;  5H86 A;  2WSA A;  4CAE A;  2WUU A;  4CYQ A;  5A28 A;  4EFD A;  2PE3 A;  2ZEM A;  1YW6 A;  3KQX A;  5EC4 A;  4F0Y A;  3IJ3 A;  2C1C A;  3EO4 A;  2PIZ A;  4M85 A;  3PEI A;  2WYR A;  4FBE A;  3FED A;  2JBK A;  1M1D A;  4MHZ A;  4LQG A;  3GB0 A;  2Q0Y A;  2WPW A;  4QC6 A;  4A39 A;  4MRI A;  1RO5 A;  4U9Z A;  2V77 A;  3PRT A;  3TTH A;  1DE4 C;  2DXQ A;  2EK8 A;  2WPX A;  2OH1 A;  3FEE A;  3H8E A;  4KUB A;  2HQY A;  4A33 A;  4A38 A;  3TCV A;  3PBB A;  1UWY A;  4A31 A;  5LYD A;  1TIQ A;  4NGS A;  4IHM A;  4CGO A;  2Q4Y A;  1BPM A;  2HB6 A;  1S7N A;  3RBU A;  1VHS A;  2DF5 A;  3WC6 A;  5HMN A;  2Q44 A;  3IGR A;  4Q7A A;  1Z5R A;  4CYN A;  4P4E A;  3DR8 A;  2YND A;  1Y7R A;  2Q4V A;  1CP6 A;  4OKO A;  1XFO A;  2PJB A;  3KR4 A;  3GYA A;  2GLJ A;  4F6A A;  4UIB A;  1I12 A;  3G3S A;  2B3V A;  1Q2C A;  2NSM A;  3NH4 A;  2AFX A;  4AB7 A;  3FEC A;  4KOV A;  4FD5 A;  1Y7E A;  3CPA A;  2XEJ A;  3PFO A;  3SJE A;  4YU9 A;  3B3W A;  1FT7 A;  4E2A A;  2ZEO A;  1V0C A;  4OLL A;  1VKC A;  3W6X A;  4KOS A;  3SJF A;  5K8M A;  2FE7 A;  4DYO A;  2R7H A;  1QSN A;  4UEZ A;  2Z11 A;  3DGV A;  2ZEL A;  3DLJ A;  3FJU A;  2ZEE A;  4PQA A;  4X3R A;  1IOF A;  2ZEF A;  2X7B A;  2I00 A;  3VH9 A;  4HNX B;  3BXM A;  1UFH A;  4JYW A;  2FS5 A;  4PXC A;  2PR8 A;  1IY7 A;  3ISZ A;  2Z3K A;  2Q7B A;  1S3Z A;  3H5Z A;  4RS2 A;  3EFA A;  4B10 A;  1I1D A;  3TFY A;  4MFK A;  3JRU A;  1F57 A;  2EBJ A;  3PFE A;  3RNZ A;  2FSR A;  1F2O A;  4OC0 A;  2PIY A;  3F5B A;  2XEF A;  3FXT A;  3VWE A;  4IUS A;  1Q2Y A;  4DJL A;  2IJZ A;  3R9G A;  1Y9K A;  4DUK A;  1NE9 A;  1ELL P;  3K2K A;  4J3G A;  5CPA A;  2ANP A;  2IQ6 A;  4WJB A;  3SXO A;  2BCO A;  1FY7 A;  1KWM A;  1TKJ A;  5EBV A;  4MFL A;  1B6B A;  3PB4 X;  1YSJ A;  2CY2 A;  4CYP A;  4JD6 A;  2GIV A;  2NYQ A;  1Z8W A;  1VHO A;  2CTC A;  4OC4 A;  1MJ9 A;  2J8M A;  4P4J A;  1QSR A;  4A94 A;  4KSF A;  4PSX A;  2QYV A;  3HUV A;  4W9Y A;  3B35 A;  1PCA A;  4P45 A;  2O4H A;  2ATR A;  2J8R A;  2VQY A;  3HLP A;  2CTB A;  2ZW6 A;  2A4N A;  3IFE A;  3DNS A;  5IX3 A;  4MFP A;  1BO4 A;  4OAE A;  2ZXV A;  2WZN A;  4FD4 A;  4OC1 A;  1IU8 A;  2PQ8 A;  1S60 A;  3FB3 A;  2HC9 A;  4NEX A;  2PR1 A;  5AG6 A;  4UIA A;  5FVJ A;  1BPN A;  3BI1 A;  2VBQ A;  3EC4 A;  4Y49 C;  4MFZ A;  3SHP A;  3WC7 A;  3S6K A;  2JDC A;  2FVG A;  4NXY A;  2VL1 A;  3PGP A;  4LUA A;  4MI4 A;  2PJ7 A;  3R95 A;  4CS0 B;  2I3C A;  3BJ7 A;  2B5G A;  5F49 A;  2R1I A;  2PSW A;  2Z0Z A;  3A9L A;  3NH8 A;  3D4U A;  1EE3 P;  3JTK A;  1Z4R A;  4U5Y A;  1IOI A;  2C6P A;  2OB0 A;  1Z8X A;  4R76 A;  2ZED A;  1PYT B;  2J8N A;  2DEA A;  4PK3 A;  4UCM A;  2PJ2 A;  2FL4 A;  2BO9 A;  2CIJ A;  4FD6 A;  1LAP A;  4MCQ A;  3D2P A;  3B3C A;  4II9 A;  4GS4 A;  4UWI A;  4F8Z A;  2Z10 A;  5AG4 A;  1WK4 A;  4CAW A;  1ZLH A;  4OP4 A;  3BLN A;  1CPX A;  4IF5 A;  4Q36 A;  2VZZ A;  4NGQ A;  2H5M A;  4OAD A;  3WAB A;  4OC3 A;  2PJ0 A;  4NGR A;  4F0X A;  1ELM P;  4NSQ A;  1YK3 A;  3GIU A;  3SJG A;  3FF3 A;  4TWE A;  3S9M A;  5DWM A;  1AYE A;  3CXS A;  2V8H A;  2Z3L A;  1TKF A;  2AJ6 A;  1ARL A;  4AVA A;  1IB1 E;  4F9V A;  4E0A A;  2ABZ A;  3B7I A;  4B13 A;  4B11 A;  4KS9 A;  4BIN A;  3G8W A;  4MHN A;  3BHX A;  5G21 A;  1S7K A;  2QEC A;  3NE8 A;  5IB9 A;  3JVN A;  4MY0 A;  5H84 A;  5J8F A;  4M6G A;  1XOV A;  2R98 A;  1TF9 A;  4X8I A;  5D29 A;  5ELY A;  4BD9 A;  4KOU A;  5I4M A;  4YRH A;  3UY5 A;  2F7V A;  4MXU A;  4NGM A;  1MJB A;  4KLV A;  4KOY A;  3CXQ A;  1TKH A;  3FIX A;  4FWU A;  3WC5 A;  4CGL A;  4E8O A;  1OZP A;  1LAM A;  3NH5 A;  2Q51 A;  4KLW A;  5E96 A;  4H6U A;  4UWJ A;  5HVH A;  5GCN A;  3L2N A;  1L0C A;  2PJC A;  4CAX A;  2HUZ A;  5C82 A;  1IIC A;  4XNH C;  1QQ9 A;  4MJ8 A;  4ONU A;  4UEF A;  3PB6 X;  3SI2 A;  1HEE A;  3WR7 A;  4A95 A;  4YFJ A;  2POK A;  5HVG A;  4MCR A;  3CT9 A;  2FIA A;  3VAR A;  1ZG7 A;  2DPT A;  3SI0 A;  4MY3 A;  4EWT A;  1YQE A;  4F9U A;  5LYL A;  3B8G A;  4NF1 A;  4R3K A;  4QB9 A;  3DR6 A;  4O23 A;  5CNP A;  5HH1 A;  3T9Y A;  2P0W A;  3V7Z A;  5LRK A;  3KR5 A;  3S9L A;  4KVO E;  6CPA A;  4MHP A;  4NJR A;  3TO6 A;  3MRU A;  2PVV A;  4BMH A;  4CGN A;  3FBU A;  4XNH B;  1VIX A;  4ZY1 A;  4C2X A;  4YGO A;  3SJX A;  3TC8 A;  4CGM A;  2K5T A;  3TE4 A;  4EME A;  2YGW A;  3IO1 A;  1XMT A;  3LOD A;  4IAV A;  4R3L A;  1PU9 A;  4TNU A;  3ISX A;  1PUA A;  1S7L A;  2ZW4 A;  2AFZ A;  3GLJ A;  4NGN A;  2IL4 A;  4PPZ A;  1OBR A;  3RZA A;  4A32 A;  2EO8 A;  4UFX A;  1AUG A;  2C6C A;  1GHE A;  5LRJ A;  2G0B A;  3KAS A;  4UA3 A;  2G3A A;  2AFM A;  1YME A;  3I9S A;  3B3T A;  4FUU A;  1NMT A;  1WWZ A;  3S6G A;  2O53 A;  1XRY A; 
#chains in the Genus database with same CATH homology
 4AG7 A;  2C27 A;  2BUE A;  2PC1 A;  4EVY A;  3R96 A;  4MHD A;  4H6Z A;  4XPK A;  1KZF A;  4B14 A;  5F48 A;  4UFV A;  1S7F A;  1RXT A;  3T90 A;  2B3U A;  1MK4 A;  2Z3N A;  3P2H A;  2D4O A;  2G3T A;  1KUY A;  2OZH A;  4B5P B;  2B4D B;  2ZW7 A;  1R57 A;  4M3S A;  4C68 A;  4H89 A;  3FRM A;  4BBH A;  2R8V A;  2REE A;  4HNY B;  1YR0 A;  1YX0 A;  5F46 A;  2PDO A;  4A30 A;  1N71 A;  3E0K A;  3EY5 A;  2FCK A;  3IU2 A;  3K9U A;  1MJA A;  4UFW A;  4JXR A;  3V8I A;  3OWC A;  4Y49 B;  1S5K A;  2RC4 A;  1XIX A;  4AG9 A;  4AVB A;  2OZU A;  2HV2 A;  4KZT A;  2Z3P A;  3D2M A;  1J4J A;  2VXK A;  4DNC A;  2YNE A;  2EUI A;  3NE7 A;  2JLM A;  3R9E A;  4A2Z A;  5J8C A;  2O28 A;  2P6G A;  3TOB A;  2JEV A;  2YNC A;  3H4Q A;  1SQH A;  3IU1 A;  4AVC A;  5G1Z A;  1KUV A;  1M4I A;  5KTC A;  3GY9 A;  3PP9 A;  1B87 A;  4U9Y A;  2NMT A;  4UCP A;  5AG5 A;  2DPS A;  5G22 A;  2QIR A;  4UCN A;  1IYK A;  5G20 A;  3IWG A;  4KOR A;  5JPH A;  4MFJ A;  5AGE A;  3TT2 A;  5C88 A;  4KOX A;  1Z4E A;  4C2Z A;  4CYO A;  3MGD A;  4RI1 A;  4CRZ B;  4PK2 A;  2D4P A;  4KVM E;  3S6H A;  2P6F A;  3I3G A;  4CAF A;  1YRE A;  2BEI A;  4NCZ A;  2BSW A;  4JWP A;  3W6S A;  3S6F A;  1CJW A;  5BWA B;  4LX9 A;  4KOT A;  4CAV A;  1Y9W A;  4CGP A;  4CRY B;  1KUX A;  4MBU A;  1YVK A;  4MFQ A;  1QSM A;  2CNT A;  3PZJ A;  2EVN A;  4XPD C;  1QSO A;  1BOB A;  3IWE A;  1YVO A;  1YGH A;  2Y0M A;  2Z3M A;  4C7I A;  3DDD A;  5DWN A;  2FT0 A;  2AE6 A;  1CM0 A;  1Z9U A;  2CNS A;  4QBJ A;  1P0H A;  4XPD B;  4ORF A;  4QUS A;  3R9F A;  4L8A A;  4KSA A;  2B5G B;  2OZG A;  1P4N A;  1NSL A;  1YLE A;  3SXN A;  4PSW A;  4KVX A;  4R57 A;  4UBR A;  1M4G A;  3FNC A;  2P6E A;  4ZBG A;  1LRZ A;  3D8P A;  2Z3O A;  4R87 A;  3TO7 A;  3C26 A;  4X5K A;  1IYL A;  1Q2D A;  2GE3 A;  5IV0 A;  2YNC C;  1QST A;  3EXN A;  4JLY A;  2QML A;  2FIW A;  3W91 A;  4PV6 A;  3QAH A;  3ZZI A;  4C2Y A;  4HKF A;  2I79 A;  2VEZ A;  3FYN A;  3VWD A;  4C7H A;  3TOA A;  5A27 A;  4FD7 A;  3LD2 A;  3GKR A;  2ZPA A;  4KOW A;  1K4J A;  4QVT A;  4HNW B;  5JQ4 A;  2JDD A;  4R9M A;  1U6M A;  4B12 A;  2REF A;  3JUW A;  5ISV A;  2VI7 A;  1ZO0 A;  1XEB A;  3P2F A;  4K30 A;  3D3S A;  4ZGY B;  2B58 A;  2F5I A;  4JJX A;  4JXQ A;  3F8K A;  1ON0 A;  2CXA A;  5IB0 A;  2BL1 A;  3F0A A;  2VZY A;  2GAN A;  5KTD A;  5AG7 A;  3ZJ0 A;  5KTA A;  2OU2 A;  3BJ8 A;  1M44 A;  1XF8 A;  3N7Z A;  1XE4 A;  1IID A;  1M4D A;  2B4B A;  3CXP A;  3QB8 A;  1I21 A;  4I49 A;  3TO9 A;  2Q04 A;  2ZW5 A;  3R1K A;  2ARH A;  3KKW A;  4Q38 A;  4XPL A;  3RYO A;  4B5O A;  5F47 A;  2CNM A;  4B5P A;  2B4D A;  5I0C A;  4L89 A;  4KUA A;  2PRB A;  2FXF A;  3DSB A;  2KCW A;  5H86 A;  2WSA A;  4CAE A;  2WUU A;  4CYQ A;  5A28 A;  4F0Y A;  5EC4 A;  3EO4 A;  4M85 A;  1M1D A;  2Q0Y A;  2WPW A;  4QC6 A;  1RO5 A;  4U9Z A;  3TTH A;  2DXQ A;  2WPX A;  4A33 A;  2OH1 A;  4KUB A;  2HQY A;  3TCV A;  4A31 A;  1TIQ A;  4CGO A;  2Q4Y A;  1S7N A;  1VHS A;  5HMN A;  2Q44 A;  3IGR A;  4CYN A;  3DR8 A;  2YND A;  1Y7R A;  2Q4V A;  3GYA A;  4F6A A;  1I12 A;  3G3S A;  2B3V A;  1Q2C A;  4AB7 A;  4KOV A;  4FD5 A;  4E2A A;  1V0C A;  4OLL A;  1VKC A;  3W6X A;  4KOS A;  2FE7 A;  2R7H A;  1QSN A;  2Z11 A;  2X7B A;  2I00 A;  4HNX B;  1UFH A;  2FS5 A;  2PR8 A;  2Z3K A;  2Q7B A;  1S3Z A;  3H5Z A;  4RS2 A;  3EFA A;  4B10 A;  1I1D A;  3TFY A;  4MFK A;  2FSR A;  3F5B A;  3FXT A;  3VWE A;  4IUS A;  1Q2Y A;  3R9G A;  1Y9K A;  1NE9 A;  4J3G A;  3SXO A;  5EBV A;  1FY7 A;  4MFL A;  1B6B A;  2CY2 A;  4CYP A;  4JD6 A;  2GIV A;  1MJ9 A;  2J8M A;  1QSR A;  4KSF A;  4PSX A;  2ATR A;  2J8R A;  2VQY A;  2ZW6 A;  2A4N A;  3DNS A;  5IX3 A;  4MFP A;  1BO4 A;  4OAE A;  2ZXV A;  4FD4 A;  2PQ8 A;  3FB3 A;  1S60 A;  4NEX A;  2PR1 A;  5AG6 A;  5FVJ A;  2VBQ A;  3EC4 A;  4Y49 C;  4MFZ A;  3SHP A;  3S6K A;  2JDC A;  4NXY A;  3PGP A;  4MI4 A;  4LUA A;  3R95 A;  4CS0 B;  3BJ7 A;  2B5G A;  5F49 A;  2R1I A;  2PSW A;  2Z0Z A;  3A9L A;  3JTK A;  1Z4R A;  4U5Y A;  2OB0 A;  2J8N A;  4PK3 A;  4UCM A;  2FL4 A;  4FD6 A;  3D2P A;  4II9 A;  4GS4 A;  4UWI A;  5AG4 A;  2Z10 A;  1WK4 A;  4CAW A;  3BLN A;  4IF5 A;  4Q36 A;  2VZZ A;  2H5M A;  4OAD A;  4F0X A;  4NSQ A;  1YK3 A;  5DWM A;  3CXS A;  2Z3L A;  2AJ6 A;  4AVA A;  1IB1 E;  4E0A A;  4B13 A;  4B11 A;  4KS9 A;  3G8W A;  5G21 A;  1S7K A;  2QEC A;  3JVN A;  4MY0 A;  5H84 A;  5J8F A;  2R98 A;  4KOU A;  4YRH A;  3UY5 A;  1MJB A;  4KLV A;  4KOY A;  3CXQ A;  3FIX A;  4E8O A;  4CGL A;  1OZP A;  4KLW A;  5E96 A;  4H6U A;  4UWJ A;  5GCN A;  1L0C A;  4CAX A;  2HUZ A;  5C82 A;  1IIC A;  4XNH C;  4ONU A;  4MJ8 A;  3WR7 A;  4YFJ A;  4A95 A;  2FIA A;  2DPT A;  4MY3 A;  3B8G A;  4NF1 A;  4R3K A;  4QB9 A;  3DR6 A;  5CNP A;  5HH1 A;  3T9Y A;  2P0W A;  4KVO E;  3TO6 A;  4CGN A;  4BMH A;  3FBU A;  4XNH B;  4C2X A;  4YGO A;  4CGM A;  2K5T A;  3TE4 A;  2YGW A;  1XMT A;  3LOD A;  4R3L A;  1PU9 A;  1PUA A;  1S7L A;  2ZW4 A;  4A32 A;  2IL4 A;  4UFX A;  1GHE A;  2G0B A;  4UA3 A;  2G3A A;  3I9S A;  1NMT A;  1WWZ A;  3S6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...