1NSLA

Crystal structure of probable acetyltransferase
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
180
structure length
176
Chain Sequence
b'GMFTCKVNEHITIRLLEPKDAERLAELIIQNQQRLGKWLFFSSADTYRETIIPDWRRQYADLNGIEAGLLYDGSLCGMISLHNLDQVNRKAEIGYWIAKEFEGKGIITAACRKLITYAFEELELNRVAICAAVGNEKSRAVPERIGFLEEGKARDGLYVNGMHHDLVYYSLLKREW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable acetyltransferase
publication title Crystal structure of Bacillus subtilis YdaF protein: A putative ribosomal N-acetyltransferase
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 47
structure length 176
sequence length 180
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2003-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1nslA00
5FVJA 4QUSA 1M1DA 4AG9A 2AE6A 1B87A 4KUAA 4QBJA 3T90A 3F5BA 1K4JA 3QB8A 2Z10A 4QB9A 1QSOA 3SXNA 2DXQA 3PZJA 5JQ4A 5GCNA 3TCVA 3S6HA 1XE4A 4IF5A 2FT0A 2B58A 2Q0YA 4KOTA 2OZHA 3D8PA 4CAWA 1N71A 2WPWA 5KTDA 3W91A 3S6FA 2Q04A 2BL1A 1Y9WA 4B5PB 1IICA 3JUWA 5F47A 2K5TA 5HMNA 1KUVA 1P0HA 4Y49C 2QECA 3FYNA 4NCZA 3P2FA 2RC4A 2PC1A 3FXTA 1YLEA 3TT2A 4I49A 2G3AA 2F5IA 5IX3A 5I0CA 4KVME 4AVAA 2NMTA 1M4DA 2ZXVA 3IWGA 4KOXA 1S7KA 1NSLA 2H5MA 2B3VA 2EUIA 3CXQA 4H6ZA 5ISVA 5KTCA 3E0KA 4KVOE 3R9FA 3CXPA 2CNSA 1BOBA 3TOAA 1MJ9A 1WWZA 4CS0B 3I9SA 1MJBA 4KOVA 1RXTA 2FSRA 4KVXA 1QSRA 1YVOA 1PU9A 2OZUA 4XPDC 5IB0A 4PV6A 2D4PA 2GIVA 3LD2A 3VWEA 2ZW4A 3S6KA 1CJWA 3EC4A 2Q7BA 4NF1A 2FCKA 4UA3A 4MHDA 2QMLA 2VEZA 1YK3A 4U9YA 2FXFA 3BJ7A 3SXOA 3TO6A 3G8WA 4GS4A 2PQ8A 3DNSA 4JXQA 3TO7A 2GE3A 2G3TA 4AVBA 3EXNA 1S7NA 2PSWA 4MBUA 3R95A 1YVKA 1R57A 2AJ6A 2B3UA 2FE7A 4MI4A 3RYOA 2ARHA 2PDOA 4R3LA 2HV2A 2JEVA 4FD7A 2GANA 4UWJA 2B4DA 2P6EA 3DR8A 3TTHA 4JWPA 4HKFA 2CNMA 4EVYA 1Q2YA 4CRYB 2JDCA 2WPXA 2KCWA 2B5GA 3KKWA 2Z0ZA 1XF8A 3TE4A 1S3ZA 2ATRA 2I00A 2FS5A 2OZGA 4NEXA 1I12A 4AB7A 3ZZIA 1TIQA 1Q2CA 4LX9A 1UFHA 3BJ8A 1YR0A 1GHEA 3DDDA 4XPLA 4XPKA 5CNPA 2EVNA 5F48A 2Z11A 3I3GA 4CRZB 4MY0A 1U6MA 5DWMA 2OH1A 3FB3A 1VKCA 4KZTA 4PK2A 1XIXA 4KUBA 3VWDA 1B6BA 1I1DA 4QVTA 2C27A 4AVCA 1M44A 4B5OA 4F6AA 5IV0A 3FBUA 3GYAA 5H86A 2P6GA 5DWNA 4KOSA 4X5KA 1ON0A 1MJAA 5E96A 1PUAA 3EO4A 2REFA 4FD6A 2P6FA 4YGOA 3W6XA 3PGPA 1S60A 2BSWA 2QIRA 3K9UA 4UWIA 3GY9A 2VZYA 3TOBA 2JDDA 1OZPA 3R9GA 1KUXA 3NE7A 2X7BA 4NSQA 1S7FA 1Y9KA 4II9A 1S7LA 4HNXB 3D2PA 2PR8A 4OADA 3B8GA 3TFYA 4RS2A 2B4BA 2R7HA 4E0AA 3LODA 5EBVA 2VQYA 2R8VA 1CM0A 4NXYA 4QC6A 1Z4RA 4PSWA 2JLMA 4JLYA 2PRBA 1QSNA 3DSBA 4R3KA 2ZW6A 4ZBGA 1L0CA 2Q4VA 2CNTA 4JJXA 5J8CA 1YX0A 3G3SA 4H89A 4XNHB 1YREA 5KTAA 4MJ8A 1YGHA 1S5KA 2VXKA 4R57A 1Y7RA 4IUSA 1SQHA 1I21A 4KOWA 1KUYA 3CXSA 4U5YA 1WK4A 3EFAA 3F8KA 3R9EA 4RI1A 1NE9A 5F46A 2FIAA 2P0WA 4PSXA 4DNCA 5H84A 4R87A 2B4DB 3WR7A 4AG7A 4KOYA 2VBQA 4JD6A 4YFJA 3FIXA 1XMTA 2B5GB 2FL4A 3DR6A 3S6GA 2J8RA 3BLNA 4KLVA 5J8FA 1IB1E 4HNYB 3OWCA 4HNWB 4K30A 5HH1A 1Z4EA 4B5PA 2OU2A 4M3SA 3R96A 3IGRA 3FRMA 5C82A 4L89A 4KORA 3ZJ0A 2FIWA 1RO5A 4J3GA 4ONUA 2G0BA 4KOUA 4H6UA 4E8OA 3TO9A 3W6SA 1FY7A 3P2HA 2D4OA 4OLLA 1VHSA 1Z9UA 3EY5A 4BMHA 1QSMA 1M4GA 1BO4A 4PK3A 1Q2DA 3C26A 2A4NA 4FD5A 5JPHA 2Y0MA 1KZFA 2J8NA 4JXRA 3FNCA 1QSTA 1IYLA 3JVNA 2ZW5A 3D2MA 5F49A 3F0AA 1LRZA 4XNHC 2Q44A 1IYKA 2R98A 3MGDA 3UY5A 4E2AA 1IIDA 2IL4A 4L8AA 2CY2A 3QAHA 2R1IA 2I79A 3R1KA 2J8MA 2VI7A 4R9MA 3T9YA 2ZPAA 4CAXA 3V8IA 4LUAA 2O28A 2REEA 5C88A 4UBRA 4Y49B 1V0CA 2BUEA 3D3SA 2BEIA 4YRHA 4M85A 1XEBA 2OB0A 4FD4A 3H4QA 1J4JA 3GKRA 2VZZA 4CAVA 5EC4A 1P4NA 1MK4A 1NMTA 2HQYA 4ORFA 4F0YA 2Q4YA 1M4IA 4OAEA 2ZW7A 2HUZA 4U9ZA 3N7ZA 3PP9A 4MY3A 2PR1A 4KLWA 4XPDB 3SHPA
chains in the Genus database with same CATH superfamily
4GM5A 1FT7A 5FVJA 2OOTA 2GREA 4QUSA 4CYOA 4WJBA 1AMPA 2O53A 4MCQA 2Q4ZA 5LRJA 1F2PA 1M1DA 3WC7A 4AG9A 2AE6A 2WUUA 4OIWA 2DPTA 2ABZA 1B87A 4KUAA 4A32A 4QBJA 3T90A 4MHNA 3F5BA 5HVHA 4EMEA 1K4JA 4AXVA 3SI2A 3QB8A 2Z10A 3K2KA 4QB9A 3ISZA 1M4LA 1QSOA 3SXNA 2DXQA 2ZEOA 4A39A 3PZJA 4Z65A 3N5FA 4OKOA 3FEDA 3S9MA 4CGOA 5JQ4A 3A9LA 5GCNA 3TX8A 4C2YA 3TCVA 1TF8A 3S6HA 2Z3PA 3IU2A 4A37A 4P44A 5HVFA 1XE4A 2EWBA 4PQAA 3S9NA 4IF5A 2FT0A 4B12A 2B58A 2Q0YA 4NGRA 1A2ZA 2ZEGA 4KOTA 2OZHA 1IOIA 3D8PA 4MFJA 4CAWA 3FECA 1N71A 2C6CA 2WPWA 4YWYA 5KTDA 3W91A 1CG2A 3S6FA 4A38A 4DUKA 4ZI6A 2Q04A 2BL1A 3RBUA 4R6TA 1Y9WA 2GLJA 3SJFA 4B5PB 3SJGA 1IICA 5G22A 3JUWA 1ZLIA 2PJ4A 3ISXA 5F47A 3KHXA 2K5TA 1IOFA 1ARMA 5HMNA 1KUVA 4BD9A 2BO9A 4MCRA 1P0HA 1YLOA 4Y49C 2Z3MA 4MHZA 4P4DA 4UFVA 2QECA 3FYNA 3NE8A 4B14A 4NCZA 2Z3NA 3P2FA 3B35A 2RC4A 3D67A 2I3CA 2PC1A 1ELMP 2XEFA 3FXTA 4NGPA 4Q7AA 4CAFA 1YLEA 4P4JA 3TT2A 4I49A 1Y7EA 4PXCA 4A2ZA 2ZENA 3JRUA 3MRUA 2G3AA 3B3VA 3CZXA 2F5IA 4P4EA 5IX3A 5I0CA 3S6KA 4KVME 4B13A 3PBEA 2PE3A 4AVAA 1DE4C 4FBEA 3IWWA 2AFSA 2NMTA 1M4DA 2ZXVA 3IWGA 2HB6A 4KOXA 1S7KA 4O23A 1BLLE 1YW6A 1NSLA 2H5MA 2B3VA 2EUIA 3H8GA 4DJLA 3CXQA 2PJCA 4OMEA 4H6ZA 4CGPA 4OC2A 2CTCA 5ISVA 5KTCA 3E0KA 4KVOE 3R9FA 3CXPA 1XJOA 2CNSA 4PXBA 1BOBA 3TOAA 1MJ9A 4UIBA 1XBUA 1WWZA 2YNCA 4CS0B 3I9SA 1MJBA 4KOVA 1RXTA 2FSRA 2PJ1A 1CX8A 4KVXA 1QSRA 3B2YA 1YVOA 1PU9A 2OZUA 4XPDC 5IB0A 4F9UA 4PV6A 2V8HA 2D4PA 2HC9A 2Z3KA 1X12A 4F8ZA 5HXDA 2GIVA 2C1CA 3LD2A 4P10A 4KSIA 3VWEA 4ZX9A 2ZW4A 3HLPA 2C6PA 4P4BA 2J9AA 1CJWA 2IJZA 2V77A 2YNDA 2FCKA 3EC4A 4NF1A 4MHDA 4UA3A 4IK2A 2Q7BA 5I4MA 2QMLA 2JBKA 5JGFA 1NSAA 3CT9A 2VEZA 1YK3A 4U9YA 3B3TA 2EBJA 1ZG9A 1ZG8A 2FXFA 3BJ7A 3SXOA 3G8WA 3TO6A 5A28A 3PB9X 5AG4A 1Z5RA 3V38A 2G9DA 3IWEA 4GS4A 4M6IA 3IIBA 2QVPA 2Z3OA 4UFXA 1PCAA 2PQ8A 3CPAA 4MFZA 4B10A 3DNSA 4JXQA 3TO7A 2GE3A 2G3TA 4AVBA 3EXNA 1R43A 3VATA 1S7NA 2PSWA 4MBUA 5ELYA 4OC4A 5AG6A 5K8MA 3BI0A 3R95A 1YVKA 1R57A 2AFUA 3PFEA 1VHOA 4KSAA 2AJ6A 5THWA 2B3UA 2WZNA 2FE7A 4MI4A 3RYOA 2ARHA 2PDOA 4R3LA 3IEHA 2HV2A 1Z8WA 3KGQA 2JEVA 4FD7A 4OP4A 2GANA 4UWJA 4A31A 4BINA 4M6HA 1TKJA 2B4DA 1QMUA 1ELLP 5LYLA 2ZEMA 2P6EA 3DR8A 3PB7X 4JWPA 3TTHA 4HKFA 1HDUA 2AFMA 4G1PA 2FVGA 2CNMA 2F8HA 4EVYA 1Q2YA 3FH4A 1TKFA 3PFOA 4R8FA 4CRYB 2BOAA 3RO0A 2JDCA 2WPXA 2KCWA 2PJ0A 2B5GA 3KKWA 4LQGA 4B11A 2Z0ZA 1XF8A 4NJRA 3TE4A 1S3ZA 4MMOA 2ATRA 3WABA 2I00A 1FNOA 4C2ZA 1F57A 2FS5A 2OZGA 1H8LA 4NEXA 1I12A 5G21A 4AB7A 3ZZIA 3D7HA 1TIQA 2CXAA 4IAVA 1Q2CA 1HDQA 1XOVA 3RAMA 3SI0A 1Z8LA 3JTKA 4LX9A 2POKA 4GXHA 2PJBA 1AYEA 1UFHA 4TNUA 3BJ8A 1Z8XA 4UIAA 3DGVA 1YR0A 1GHEA 3DDDA 4OIDA 3H8EA 4XPLA 3VH9A 1CBXA 4WWVA 4XPKA 5HVGA 1TF9A 5CNPA 5D29A 5LRKA 2EVNA 4OC5A 5F48A 2Z11A 3I3GA 4CRZB 4MY0A 1U6MA 5DWMA 2OH1A 2BCOA 1VKCA 3FB3A 4KZTA 4PK2A 1XIXA 4KUBA 3BXMA 3VWDA 1F2OA 4CGNA 2PCUA 4MXUA 3NH4A 3TC8A 1PYTB 1B6BA 1CPSA 2DEAA 1I1DA 3PEIA 4QVTA 4A95A 2C27A 4AVCA 4PPZA 4A94A 1M44A 1VGYA 4CYQA 4B5OA 4KSFA 4C2XA 4F6AA 4MCSA 1Q7LA 4ONWA 3FBUA 3PB4X 5IV0A 3GYAA 1Y0YA 2ZEDA 5CPAA 4DYOA 4MHPA 3DLJA 4FUUA 4JZ0A 2GU2A 5LRGA 5LYDA 5H86A 4ZX8A 2ZEHA 2RFHA 2P6GA 2IMOA 3H8FA 5DWNA 4KOSA 3B3CA 4X5KA 4UF4A 4RN7A 4RUHA 1YQEA 1ON0A 1QQ9A 1MJAA 5E96A 2RB7A 1XRYA 1RTQA 1PUAA 2PJ2A 3EO4A 5CBMA 4KS9A 2REFA 2NYQA 4FD6A 5G20A 2P6FA 4FWUA 2ZEPA 1IGBA 4MCPA 2IQ6A 4YGOA 3W6XA 3D7FA 3PGPA 4H2KA 5IB9A 1S60A 2BSWA 1Z8TA 2QIRA 4FAIA 3K9UA 2CF4A 1ZLHA 4UWIA 4MFPA 3GY9A 2VL1A 2AFWA 2VZYA 3LACA 4OC3A 4C7HA 5G1ZA 3TOBA 1CP6A 2JDDA 1OZPA 1LAMA 2ZEEA 3BHXA 4CAEA 2GFQA 1CP7A 1X10A 3D7GA 4PXEA 2O4HA 1LAPA 3PB8X 3R9GA 4NGSA 1KUXA 2AFXA 3NE7A 1JQGA 1IY7A 1LANA 1OBRA 2PJ6A 2V8VA 2X7BA 1IU8A 4NSQA 1S7FA 1Y9KA 4II9A 1S7LA 4HNXB 3CPXA 3D2PA 2PR8A 3KASA 4OADA 3FMCA 3B8GA 4Q38A 3TFYA 2DPSA 3D7DA 4JYWA 4RS2A 4A30A 3HUVA 3NH8A 2B4BA 4A33A 2R7HA 6CPAA 4E0AA 3LODA 5EBVA 2ODFA 2PJ7A 2VQYA 3FJUA 2R8VA 2DF5A 3GUXA 1CM0A 4NXYA 4QC6A 1ZG7A 1Z4RA 4PSWA 5D8NA 2JLMA 4JLYA 2PRBA 1QSNA 3DSBA 4R3KA 2PIZA 2ZW6A 4ZBGA 5JH9A 1L0CA 4BBHA 2Q4VA 2CNTA 1ZO0A 2PVVA 4X3RA 4CPAA 4ZY0A 4JJXA 5J8CA 1YX0A 3G3SA 4H89A 5AG7A 4XNHB 1YREA 1BPNA 1UWYA 3B7IA 1XMBA 4NFRA 5KTAA 4MJ8A 2NSMA 1YGHA 3NA6A 1S5KA 2XEGA 5JM6A 2VXKA 2PJ8A 5AG5A 1VHEA 2ZOGA 5A27A 4R57A 1Y7RA 4IUSA 1SQHA 1I21A 4KOWA 1KUYA 2PJ3A 3CXSA 4NJQA 4CYPA 4U5YA 3H5ZA 1WK4A 3EFAA 3F8KA 3R9EA 1YMEA 4RI1A 1NE9A 4MFLA 3WC6A 4R7MA 4MFQA 2FIAA 3BI1A 2Q7SA 5F46A 2P0WA 4PSXA 4DNCA 4F9VA 1LFWA 2XEJA 4R87A 2B4DB 5H84A 3WR7A 4AG7A 5AGEA 4EFDA 2ANPA 4KOYA 2VBQA 5J1QA 3IU1A 3KQXA 3LWUA 4JD6A 3SI1A 3PRTA 4YFJA 3FIXA 3WT4A 4P4FA 1XMTA 2QJ8A 2B5GB 3IC1A 2FL4A 4X2TA 3DR6A 3S6GA 2J8RA 2EK8A 2YNEA 3BLNA 4KLVA 2PVWA 3NH5A 2V8GA 1IB1E 4NGQA 4YU9A 5J8FA 3IFEA 4HNYB 1HEEA 3D4UA 2ZOFA 3FVLA 3MN8A 1TXRA 3OWCA 3IO1A 4HNWB 3RZAA 2XEIA 4K30A 5HH1A 3GB0A 2ZEFA 4ZY2A 1Z4EA 4B6ZA 3S9LA 4B5PA 4NGNA 4Q36A 2OU2A 4M3SA 3CDXA 1DTDA 2YGWA 4MHYA 3R96A 3IGRA 3FRMA 5C82A 4L89A 5EMIA 3KZWA 4KORA 4CYNA 4CGLA 3ZJ0A 2FIWA 1BAVA 5K8OA 3FX6A 1RO5A 3KR5A 4J3GA 4ONUA 2G0BA 2YNCC 4F0XA 4KOUA 4H6UA 5F09A 4E8OA 3GLJA 4C7IA 3TO9A 4MRIA 1FY7A 3W6SA 3P2HA 2C6GA 2D4OA 4OLLA 1VHSA 1Z9UA 3EY5A 4MFKA 4BMHA 3KHZA 2PJ5A 1QSMA 3FEEA 3GIUA 2QYVA 8CPAA 4ZYQA 2CTBA 1M4GA 4UCNA 3WC5A 3PBBA 1BO4A 3I1UA 4UEEA 4PK3A 1Q2DA 4W9YA 1ARLA 3C26A 2A4NA 4FD5A 5JPHA 4X8IA 2Y0MA 2Q51A 1KZFA 3T8WA 3KL9A 2J8NA 3PB6X 4JXRA 3FNCA 1QSTA 3FF3A 2Q43A 5DS0A 1IYLA 3JVNA 3B3SA 2ZW5A 3D2MA 5F49A 3F0AA 1LCPA 1LRZA 2V8DA 3SJXA 4XNHC 2Q44A 1R3NA 1IYKA 2R98A 1XFOA 3NFZA 4M6GA 3MGDA 3VARA 4OC0A 4EWTA 4LQ6A 2JEWA 3UY5A 4E2AA 4CGMA 3D66A 1IIDA 3SJEA 2EO8A 1TKHA 5BWAB 2IL4A 4HPSA 1GYTA 4OC1A 1KWMA 1VIXA 4L8AA 2CY2A 3QAHA 2R1IA 5K8PA 2I79A 3R1KA 2AFOA 2J8MA 2PRQA 2VI7A 5LYFA 4R9MA 1Y0RA 3T9YA 4P45A 2ZPAA 4NGTA 4CAXA 3RNZA 3V8IA 4LUAA 4IHMA 2O28A 1CPXA 2REEA 2Z3LA 3D68A 5C88A 4UBRA 4Y49B 1V0CA 4UFWA 7CPAA 2BUEA 4UEZA 2AFZA 3D3SA 3IJ3A 1BPMA 1JWQA 4R76A 2PJ9A 2ZELA 2BEIA 2GLFA 4K3NA 4YRHA 2CIJA 2PIYA 3B3WA 3KQZA 3L2NA 4P4IA 1YSJA 4M85A 3QAYA 1XEBA 2OB0A 4FD4A 3H4QA 1AUGA 1J4JA 2VZZA 3GKRA 4CAVA 5EC4A 5LYIA 1P4NA 1MK4A 1NMTA 3V7ZA 2HQYA 4ORFA 1YW4A 3LMSA 4F0YA 4NGMA 4TWEA 2Q4YA 1M4IA 4PXDA 2PJAA 3QNVA 3KI9A 4OAEA 2ZW7A 4P6YA 3K9TA 2HUZA 2EK9A 4ZGYB 4U9ZA 1EE3P 3N7ZA 5K8NA 1LOKA 3KR4A 4UCPA 2OR4A 2F7VA 3PP9A 4MY3A 2PR1A 2JBJA 1Z2LA 4KLWA 4XPDB 4C68A 4ZY1A 2WSAA 3SHPA 4UEFA 4UCMA 2WYRA
chains in the Genus database with same CATH topology
5FVJA 4QUSA 4CYOA 1M1DA 4AG9A 2AE6A 2WUUA 2DPTA 1B87A 4KUAA 4A32A 4QBJA 3T90A 3F5BA 1K4JA 3QB8A 2Z10A 4QB9A 1QSOA 3SXNA 2DXQA 3PZJA 5JQ4A 3A9LA 5GCNA 4C2YA 3TCVA 3S6HA 2Z3PA 3IU2A 1XE4A 4IF5A 2FT0A 4B12A 2B58A 2Q0YA 4KOTA 2OZHA 3D8PA 4MFJA 4CAWA 1N71A 2WPWA 5KTDA 3W91A 3S6FA 2Q04A 2BL1A 1Y9WA 4B5PB 1IICA 5G22A 3JUWA 5F47A 2K5TA 5HMNA 1KUVA 1P0HA 4Y49C 2Z3MA 4B14A 4UFVA 2QECA 3FYNA 4NCZA 2Z3NA 3P2FA 2RC4A 2PC1A 3FXTA 4CAFA 1YLEA 3TT2A 4I49A 4A2ZA 4CGOA 2G3AA 2F5IA 5IX3A 5I0CA 4KVME 4B13A 4AVAA 2NMTA 1M4DA 2ZXVA 3IWGA 4KOXA 1S7KA 1NSLA 2H5MA 2B3VA 2EUIA 3CXQA 4H6ZA 4CGPA 5ISVA 5KTCA 3E0KA 4KVOE 3R9FA 3CXPA 2CNSA 1BOBA 3TOAA 1MJ9A 1WWZA 2YNCA 4CS0B 3I9SA 1MJBA 4KOVA 1RXTA 2FSRA 4KVXA 1QSRA 1YVOA 1PU9A 2OZUA 4XPDC 5IB0A 4PV6A 2D4PA 2Z3KA 2GIVA 3LD2A 3VWEA 2ZW4A 3S6KA 1CJWA 2YNDA 3EC4A 4NF1A 2FCKA 4UA3A 2Q7BA 4MHDA 2QMLA 2VEZA 1YK3A 4U9YA 2FXFA 3BJ7A 3SXOA 3TO6A 3G8WA 5A28A 5AG4A 3IWEA 4GS4A 2Z3OA 4UFXA 2PQ8A 4MFZA 4B10A 3DNSA 4JXQA 3TO7A 2GE3A 2G3TA 4AVBA 3EXNA 1S7NA 2PSWA 4MBUA 5AG6A 3R95A 1YVKA 1R57A 4KSAA 2AJ6A 2B3UA 2FE7A 4MI4A 3RYOA 2ARHA 2PDOA 4R3LA 2HV2A 2JEVA 4FD7A 2GANA 4UWJA 4A31A 2B4DA 2P6EA 3DR8A 3TTHA 4JWPA 4HKFA 2CNMA 4EVYA 1Q2YA 4CRYB 2JDCA 2WPXA 2KCWA 2B5GA 3KKWA 4B11A 2Z0ZA 1XF8A 3TE4A 1S3ZA 2ATRA 2I00A 4C2ZA 2FS5A 2OZGA 4NEXA 1I12A 5G21A 4AB7A 3ZZIA 1TIQA 2CXAA 1Q2CA 3JTKA 4LX9A 1UFHA 3BJ8A 1YR0A 1GHEA 3DDDA 4XPLA 4XPKA 5CNPA 2EVNA 5F48A 2Z11A 3I3GA 4CRZB 4MY0A 1U6MA 5DWMA 2OH1A 3FB3A 1VKCA 4KZTA 4PK2A 1XIXA 4KUBA 3VWDA 4CGNA 1B6BA 1I1DA 4QVTA 4A95A 2C27A 4AVCA 1M44A 4CYQA 4B5OA 4KSFA 4C2XA 4F6AA 5IV0A 3FBUA 3GYAA 5H86A 2P6GA 5DWNA 4KOSA 4X5KA 1ON0A 1MJAA 5E96A 1PUAA 3EO4A 4KS9A 2REFA 4FD6A 5G20A 2P6FA 4YGOA 3W6XA 3PGPA 1S60A 2BSWA 2QIRA 3K9UA 4UWIA 4MFPA 3GY9A 2VZYA 4C7HA 5G1ZA 3TOBA 2JDDA 1OZPA 4CAEA 3R9GA 1KUXA 3NE7A 2X7BA 4NSQA 1S7FA 1Y9KA 4II9A 4HNXB 1S7LA 3D2PA 2PR8A 4OADA 3B8GA 4Q38A 3TFYA 2DPSA 4RS2A 4A30A 2B4BA 4A33A 2R7HA 4E0AA 3LODA 5EBVA 2VQYA 2R8VA 1CM0A 4NXYA 4QC6A 1Z4RA 4PSWA 2JLMA 4JLYA 2PRBA 1QSNA 3DSBA 4R3KA 2ZW6A 4ZBGA 1L0CA 4BBHA 2Q4VA 2CNTA 1ZO0A 4JJXA 5J8CA 1YX0A 3G3SA 4H89A 5AG7A 4XNHB 1YREA 5KTAA 4MJ8A 1YGHA 1S5KA 2VXKA 5AG5A 5A27A 4R57A 1Y7RA 4IUSA 1SQHA 1I21A 4KOWA 1KUYA 3CXSA 4CYPA 4U5YA 3H5ZA 1WK4A 3EFAA 3F8KA 3R9EA 4RI1A 1NE9A 4MFLA 4MFQA 2FIAA 5F46A 2P0WA 4PSXA 4DNCA 5H84A 4R87A 2B4DB 3WR7A 4AG7A 5AGEA 4KOYA 2VBQA 3IU1A 4JD6A 4YFJA 3FIXA 1XMTA 2B5GB 2FL4A 3DR6A 3S6GA 2J8RA 2YNEA 3BLNA 4KLVA 5J8FA 1IB1E 4HNYB 3OWCA 4HNWB 4K30A 5HH1A 1Z4EA 4B5PA 4Q36A 2OU2A 4M3SA 2YGWA 3R96A 3IGRA 3FRMA 5C82A 4L89A 4CYNA 4KORA 4CGLA 3ZJ0A 2FIWA 1RO5A 4J3GA 4ONUA 2G0BA 2YNCC 4F0XA 4KOUA 4H6UA 4E8OA 4C7IA 3TO9A 3W6SA 1FY7A 3P2HA 2D4OA 4OLLA 1VHSA 1Z9UA 3EY5A 4MFKA 4BMHA 1QSMA 1M4GA 4UCNA 1BO4A 4PK3A 1Q2DA 3C26A 2A4NA 4FD5A 5JPHA 2Y0MA 1KZFA 2J8NA 4JXRA 3FNCA 1QSTA 1IYLA 3JVNA 2ZW5A 3D2MA 5F49A 3F0AA 1LRZA 4XNHC 2Q44A 1IYKA 2R98A 3MGDA 3UY5A 4E2AA 4CGMA 1IIDA 5BWAB 2IL4A 4L8AA 2CY2A 3QAHA 2R1IA 2I79A 3R1KA 2J8MA 2VI7A 4R9MA 3T9YA 2ZPAA 4CAXA 3V8IA 4LUAA 2O28A 2REEA 5C88A 2Z3LA 4UBRA 4Y49B 1V0CA 4UFWA 2BUEA 3D3SA 2BEIA 4YRHA 4M85A 1XEBA 2OB0A 4FD4A 3H4QA 1J4JA 3GKRA 2VZZA 4CAVA 5EC4A 1P4NA 1MK4A 1NMTA 2HQYA 4ORFA 4F0YA 2Q4YA 1M4IA 4OAEA 2ZW7A 2HUZA 4ZGYB 4U9ZA 3N7ZA 4UCPA 3PP9A 4MY3A 2PR1A 4KLWA 4XPDB 4C68A 2WSAA 3SHPA 4UCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FVJ A;  4QUS A;  1M1D A;  4AG9 A;  2AE6 A;  1B87 A;  4KUA A;  4QBJ A;  3T90 A;  3F5B A;  1K4J A;  3QB8 A;  2Z10 A;  4QB9 A;  1QSO A;  3SXN A;  2DXQ A;  3PZJ A;  5JQ4 A;  5GCN A;  3TCV A;  3S6H A;  1XE4 A;  4IF5 A;  2FT0 A;  2B58 A;  2Q0Y A;  4KOT A;  2OZH A;  3D8P A;  4CAW A;  1N71 A;  2WPW A;  5KTD A;  3W91 A;  3S6F A;  2Q04 A;  2BL1 A;  1Y9W A;  4B5P B;  1IIC A;  3JUW A;  5F47 A;  2K5T A;  5HMN A;  1KUV A;  1P0H A;  4Y49 C;  2QEC A;  3FYN A;  4NCZ A;  3P2F A;  2RC4 A;  2PC1 A;  3FXT A;  1YLE A;  3TT2 A;  4I49 A;  2G3A A;  2F5I A;  5IX3 A;  5I0C A;  4KVM E;  4AVA A;  2NMT A;  1M4D A;  2ZXV A;  3IWG A;  4KOX A;  1S7K A;  1NSL A;  2H5M A;  2B3V A;  2EUI A;  3CXQ A;  4H6Z A;  5ISV A;  5KTC A;  3E0K A;  4KVO E;  3R9F A;  3CXP A;  2CNS A;  1BOB A;  3TOA A;  1MJ9 A;  1WWZ A;  4CS0 B;  3I9S A;  1MJB A;  4KOV A;  1RXT A;  2FSR A;  4KVX A;  1QSR A;  1YVO A;  1PU9 A;  2OZU A;  4XPD C;  5IB0 A;  4PV6 A;  2D4P A;  2GIV A;  3LD2 A;  3VWE A;  2ZW4 A;  3S6K A;  1CJW A;  3EC4 A;  2Q7B A;  4NF1 A;  2FCK A;  4UA3 A;  4MHD A;  2QML A;  2VEZ A;  1YK3 A;  4U9Y A;  2FXF A;  3BJ7 A;  3SXO A;  3TO6 A;  3G8W A;  4GS4 A;  2PQ8 A;  3DNS A;  4JXQ A;  3TO7 A;  2GE3 A;  2G3T A;  4AVB A;  3EXN A;  1S7N A;  2PSW A;  4MBU A;  3R95 A;  1YVK A;  1R57 A;  2AJ6 A;  2B3U A;  2FE7 A;  4MI4 A;  3RYO A;  2ARH A;  2PDO A;  4R3L A;  2HV2 A;  2JEV A;  4FD7 A;  2GAN A;  4UWJ A;  2B4D A;  2P6E A;  3DR8 A;  3TTH A;  4JWP A;  4HKF A;  2CNM A;  4EVY A;  1Q2Y A;  4CRY B;  2JDC A;  2WPX A;  2KCW A;  2B5G A;  3KKW A;  2Z0Z A;  1XF8 A;  3TE4 A;  1S3Z A;  2ATR A;  2I00 A;  2FS5 A;  2OZG A;  4NEX A;  1I12 A;  4AB7 A;  3ZZI A;  1TIQ A;  1Q2C A;  4LX9 A;  1UFH A;  3BJ8 A;  1YR0 A;  1GHE A;  3DDD A;  4XPL A;  4XPK A;  5CNP A;  2EVN A;  5F48 A;  2Z11 A;  3I3G A;  4CRZ B;  4MY0 A;  1U6M A;  5DWM A;  2OH1 A;  3FB3 A;  1VKC A;  4KZT A;  4PK2 A;  1XIX A;  4KUB A;  3VWD A;  1B6B A;  1I1D A;  4QVT A;  2C27 A;  4AVC A;  1M44 A;  4B5O A;  4F6A A;  5IV0 A;  3FBU A;  3GYA A;  5H86 A;  2P6G A;  5DWN A;  4KOS A;  4X5K A;  1ON0 A;  1MJA A;  5E96 A;  1PUA A;  3EO4 A;  2REF A;  4FD6 A;  2P6F A;  4YGO A;  3W6X A;  3PGP A;  1S60 A;  2BSW A;  2QIR A;  3K9U A;  4UWI A;  3GY9 A;  2VZY A;  3TOB A;  2JDD A;  1OZP A;  3R9G A;  1KUX A;  3NE7 A;  2X7B A;  4NSQ A;  1S7F A;  1Y9K A;  4II9 A;  1S7L A;  4HNX B;  3D2P A;  2PR8 A;  4OAD A;  3B8G A;  3TFY A;  4RS2 A;  2B4B A;  2R7H A;  4E0A A;  3LOD A;  5EBV A;  2VQY A;  2R8V A;  1CM0 A;  4NXY A;  4QC6 A;  1Z4R A;  4PSW A;  2JLM A;  4JLY A;  2PRB A;  1QSN A;  3DSB A;  4R3K A;  2ZW6 A;  4ZBG A;  1L0C A;  2Q4V A;  2CNT A;  4JJX A;  5J8C A;  1YX0 A;  3G3S A;  4H89 A;  4XNH B;  1YRE A;  5KTA A;  4MJ8 A;  1YGH A;  1S5K A;  2VXK A;  4R57 A;  1Y7R A;  4IUS A;  1SQH A;  1I21 A;  4KOW A;  1KUY A;  3CXS A;  4U5Y A;  1WK4 A;  3EFA A;  3F8K A;  3R9E A;  4RI1 A;  1NE9 A;  5F46 A;  2FIA A;  2P0W A;  4PSX A;  4DNC A;  5H84 A;  4R87 A;  2B4D B;  3WR7 A;  4AG7 A;  4KOY A;  2VBQ A;  4JD6 A;  4YFJ A;  3FIX A;  1XMT A;  2B5G B;  2FL4 A;  3DR6 A;  3S6G A;  2J8R A;  3BLN A;  4KLV A;  5J8F A;  1IB1 E;  4HNY B;  3OWC A;  4HNW B;  4K30 A;  5HH1 A;  1Z4E A;  4B5P A;  2OU2 A;  4M3S A;  3R96 A;  3IGR A;  3FRM A;  5C82 A;  4L89 A;  4KOR A;  3ZJ0 A;  2FIW A;  1RO5 A;  4J3G A;  4ONU A;  2G0B A;  4KOU A;  4H6U A;  4E8O A;  3TO9 A;  3W6S A;  1FY7 A;  3P2H A;  2D4O A;  4OLL A;  1VHS A;  1Z9U A;  3EY5 A;  4BMH A;  1QSM A;  1M4G A;  1BO4 A;  4PK3 A;  1Q2D A;  3C26 A;  2A4N A;  4FD5 A;  5JPH A;  2Y0M A;  1KZF A;  2J8N A;  4JXR A;  3FNC A;  1QST A;  1IYL A;  3JVN A;  2ZW5 A;  3D2M A;  5F49 A;  3F0A A;  1LRZ A;  4XNH C;  2Q44 A;  1IYK A;  2R98 A;  3MGD A;  3UY5 A;  4E2A A;  1IID A;  2IL4 A;  4L8A A;  2CY2 A;  3QAH A;  2R1I A;  2I79 A;  3R1K A;  2J8M A;  2VI7 A;  4R9M A;  3T9Y A;  2ZPA A;  4CAX A;  3V8I A;  4LUA A;  2O28 A;  2REE A;  5C88 A;  4UBR A;  4Y49 B;  1V0C A;  2BUE A;  3D3S A;  2BEI A;  4YRH A;  4M85 A;  1XEB A;  2OB0 A;  4FD4 A;  3H4Q A;  1J4J A;  3GKR A;  2VZZ A;  4CAV A;  5EC4 A;  1P4N A;  1MK4 A;  1NMT A;  2HQY A;  4ORF A;  4F0Y A;  2Q4Y A;  1M4I A;  4OAE A;  2ZW7 A;  2HUZ A;  4U9Z A;  3N7Z A;  3PP9 A;  4MY3 A;  2PR1 A;  4KLW A;  4XPD B;  3SHP A; 
#chains in the Genus database with same CATH topology
 4GM5 A;  1FT7 A;  5FVJ A;  2OOT A;  2GRE A;  4QUS A;  4CYO A;  4WJB A;  1AMP A;  2O53 A;  4MCQ A;  2Q4Z A;  5LRJ A;  1F2P A;  1M1D A;  3WC7 A;  4AG9 A;  2AE6 A;  2WUU A;  4OIW A;  2DPT A;  2ABZ A;  1B87 A;  4KUA A;  4A32 A;  4QBJ A;  3T90 A;  4MHN A;  3F5B A;  5HVH A;  4EME A;  1K4J A;  4AXV A;  3SI2 A;  3QB8 A;  2Z10 A;  3K2K A;  4QB9 A;  3ISZ A;  1M4L A;  1QSO A;  3SXN A;  2DXQ A;  2ZEO A;  4A39 A;  3PZJ A;  4Z65 A;  3N5F A;  4OKO A;  3FED A;  3S9M A;  4CGO A;  5JQ4 A;  3A9L A;  5GCN A;  3TX8 A;  4C2Y A;  3TCV A;  1TF8 A;  3S6H A;  2Z3P A;  3IU2 A;  4A37 A;  4P44 A;  5HVF A;  1XE4 A;  2EWB A;  4PQA A;  3S9N A;  4IF5 A;  2FT0 A;  4B12 A;  2B58 A;  2Q0Y A;  4NGR A;  1A2Z A;  2ZEG A;  4KOT A;  2OZH A;  1IOI A;  3D8P A;  4MFJ A;  4CAW A;  3FEC A;  1N71 A;  2C6C A;  2WPW A;  4YWY A;  5KTD A;  3W91 A;  1CG2 A;  3S6F A;  4A38 A;  4DUK A;  4ZI6 A;  2Q04 A;  2BL1 A;  3RBU A;  4R6T A;  1Y9W A;  2GLJ A;  3SJF A;  4B5P B;  3SJG A;  1IIC A;  5G22 A;  3JUW A;  1ZLI A;  2PJ4 A;  3ISX A;  5F47 A;  3KHX A;  2K5T A;  1IOF A;  1ARM A;  5HMN A;  1KUV A;  4BD9 A;  2BO9 A;  4MCR A;  1P0H A;  1YLO A;  4Y49 C;  2Z3M A;  4MHZ A;  4P4D A;  4UFV A;  2QEC A;  3FYN A;  3NE8 A;  4B14 A;  4NCZ A;  2Z3N A;  3P2F A;  3B35 A;  2RC4 A;  3D67 A;  2I3C A;  2PC1 A;  1ELM P;  2XEF A;  3FXT A;  4NGP A;  4Q7A A;  4CAF A;  1YLE A;  4P4J A;  3TT2 A;  4I49 A;  1Y7E A;  4PXC A;  4A2Z A;  2ZEN A;  3JRU A;  3MRU A;  2G3A A;  3B3V A;  3CZX A;  2F5I A;  4P4E A;  5IX3 A;  5I0C A;  3S6K A;  4KVM E;  4B13 A;  3PBE A;  2PE3 A;  4AVA A;  1DE4 C;  4FBE A;  3IWW A;  2AFS A;  2NMT A;  1M4D A;  2ZXV A;  3IWG A;  2HB6 A;  4KOX A;  1S7K A;  4O23 A;  1BLL E;  1YW6 A;  1NSL A;  2H5M A;  2B3V A;  2EUI A;  3H8G A;  4DJL A;  3CXQ A;  2PJC A;  4OME A;  4H6Z A;  4CGP A;  4OC2 A;  2CTC A;  5ISV A;  5KTC A;  3E0K A;  4KVO E;  3R9F A;  3CXP A;  1XJO A;  2CNS A;  4PXB A;  1BOB A;  3TOA A;  1MJ9 A;  4UIB A;  1XBU A;  1WWZ A;  2YNC A;  4CS0 B;  3I9S A;  1MJB A;  4KOV A;  1RXT A;  2FSR A;  2PJ1 A;  1CX8 A;  4KVX A;  1QSR A;  3B2Y A;  1YVO A;  1PU9 A;  2OZU A;  4XPD C;  5IB0 A;  4F9U A;  4PV6 A;  2V8H A;  2D4P A;  2HC9 A;  2Z3K A;  1X12 A;  4F8Z A;  5HXD A;  2GIV A;  2C1C A;  3LD2 A;  4P10 A;  4KSI A;  3VWE A;  4ZX9 A;  2ZW4 A;  3HLP A;  2C6P A;  4P4B A;  2J9A A;  1CJW A;  2IJZ A;  2V77 A;  2YND A;  2FCK A;  3EC4 A;  4NF1 A;  4MHD A;  4UA3 A;  4IK2 A;  2Q7B A;  5I4M A;  2QML A;  2JBK A;  5JGF A;  1NSA A;  3CT9 A;  2VEZ A;  1YK3 A;  4U9Y A;  3B3T A;  2EBJ A;  1ZG9 A;  1ZG8 A;  2FXF A;  3BJ7 A;  3SXO A;  3G8W A;  3TO6 A;  5A28 A;  3PB9 X;  5AG4 A;  1Z5R A;  3V38 A;  2G9D A;  3IWE A;  4GS4 A;  4M6I A;  3IIB A;  2QVP A;  2Z3O A;  4UFX A;  1PCA A;  2PQ8 A;  3CPA A;  4MFZ A;  4B10 A;  3DNS A;  4JXQ A;  3TO7 A;  2GE3 A;  2G3T A;  4AVB A;  3EXN A;  1R43 A;  3VAT A;  1S7N A;  2PSW A;  4MBU A;  5ELY A;  4OC4 A;  5AG6 A;  5K8M A;  3BI0 A;  3R95 A;  1YVK A;  1R57 A;  2AFU A;  3PFE A;  1VHO A;  4KSA A;  2AJ6 A;  5THW A;  2B3U A;  2WZN A;  2FE7 A;  4MI4 A;  3RYO A;  2ARH A;  2PDO A;  4R3L A;  3IEH A;  2HV2 A;  1Z8W A;  3KGQ A;  2JEV A;  4FD7 A;  4OP4 A;  2GAN A;  4UWJ A;  4A31 A;  4BIN A;  4M6H A;  1TKJ A;  2B4D A;  1QMU A;  1ELL P;  5LYL A;  2ZEM A;  2P6E A;  3DR8 A;  3PB7 X;  4JWP A;  3TTH A;  4HKF A;  1HDU A;  2AFM A;  4G1P A;  2FVG A;  2CNM A;  2F8H A;  4EVY A;  1Q2Y A;  3FH4 A;  1TKF A;  3PFO A;  4R8F A;  4CRY B;  2BOA A;  3RO0 A;  2JDC A;  2WPX A;  2KCW A;  2PJ0 A;  2B5G A;  3KKW A;  4LQG A;  4B11 A;  2Z0Z A;  1XF8 A;  4NJR A;  3TE4 A;  1S3Z A;  4MMO A;  2ATR A;  3WAB A;  2I00 A;  1FNO A;  4C2Z A;  1F57 A;  2FS5 A;  2OZG A;  1H8L A;  4NEX A;  1I12 A;  5G21 A;  4AB7 A;  3ZZI A;  3D7H A;  1TIQ A;  2CXA A;  4IAV A;  1Q2C A;  1HDQ A;  1XOV A;  3RAM A;  3SI0 A;  1Z8L A;  3JTK A;  4LX9 A;  2POK A;  4GXH A;  2PJB A;  1AYE A;  1UFH A;  4TNU A;  3BJ8 A;  1Z8X A;  4UIA A;  3DGV A;  1YR0 A;  1GHE A;  3DDD A;  4OID A;  3H8E A;  4XPL A;  3VH9 A;  1CBX A;  4WWV A;  4XPK A;  5HVG A;  1TF9 A;  5CNP A;  5D29 A;  5LRK A;  2EVN A;  4OC5 A;  5F48 A;  2Z11 A;  3I3G A;  4CRZ B;  4MY0 A;  1U6M A;  5DWM A;  2OH1 A;  2BCO A;  1VKC A;  3FB3 A;  4KZT A;  4PK2 A;  1XIX A;  4KUB A;  3BXM A;  3VWD A;  1F2O A;  4CGN A;  2PCU A;  4MXU A;  3NH4 A;  3TC8 A;  1PYT B;  1B6B A;  1CPS A;  2DEA A;  1I1D A;  3PEI A;  4QVT A;  4A95 A;  2C27 A;  4AVC A;  4PPZ A;  4A94 A;  1M44 A;  1VGY A;  4CYQ A;  4B5O A;  4KSF A;  4C2X A;  4F6A A;  4MCS A;  1Q7L A;  4ONW A;  3FBU A;  3PB4 X;  5IV0 A;  3GYA A;  1Y0Y A;  2ZED A;  5CPA A;  4DYO A;  4MHP A;  3DLJ A;  4FUU A;  4JZ0 A;  2GU2 A;  5LRG A;  5LYD A;  5H86 A;  4ZX8 A;  2ZEH A;  2RFH A;  2P6G A;  2IMO A;  3H8F A;  5DWN A;  4KOS A;  3B3C A;  4X5K A;  4UF4 A;  4RN7 A;  4RUH A;  1YQE A;  1ON0 A;  1QQ9 A;  1MJA A;  5E96 A;  2RB7 A;  1XRY A;  1RTQ A;  1PUA A;  2PJ2 A;  3EO4 A;  5CBM A;  4KS9 A;  2REF A;  2NYQ A;  4FD6 A;  5G20 A;  2P6F A;  4FWU A;  2ZEP A;  1IGB A;  4MCP A;  2IQ6 A;  4YGO A;  3W6X A;  3D7F A;  3PGP A;  4H2K A;  5IB9 A;  1S60 A;  2BSW A;  1Z8T A;  2QIR A;  4FAI A;  3K9U A;  2CF4 A;  1ZLH A;  4UWI A;  4MFP A;  3GY9 A;  2VL1 A;  2AFW A;  2VZY A;  3LAC A;  4OC3 A;  4C7H A;  5G1Z A;  3TOB A;  1CP6 A;  2JDD A;  1OZP A;  1LAM A;  2ZEE A;  3BHX A;  4CAE A;  2GFQ A;  1CP7 A;  1X10 A;  3D7G A;  4PXE A;  2O4H A;  1LAP A;  3PB8 X;  3R9G A;  4NGS A;  1KUX A;  2AFX A;  3NE7 A;  1JQG A;  1IY7 A;  1LAN A;  1OBR A;  2PJ6 A;  2V8V A;  2X7B A;  1IU8 A;  4NSQ A;  1S7F A;  1Y9K A;  4II9 A;  1S7L A;  4HNX B;  3CPX A;  3D2P A;  2PR8 A;  3KAS A;  4OAD A;  3FMC A;  3B8G A;  4Q38 A;  3TFY A;  2DPS A;  3D7D A;  4JYW A;  4RS2 A;  4A30 A;  3HUV A;  3NH8 A;  2B4B A;  4A33 A;  2R7H A;  6CPA A;  4E0A A;  3LOD A;  5EBV A;  2ODF A;  2PJ7 A;  2VQY A;  3FJU A;  2R8V A;  2DF5 A;  3GUX A;  1CM0 A;  4NXY A;  4QC6 A;  1ZG7 A;  1Z4R A;  4PSW A;  5D8N A;  2JLM A;  4JLY A;  2PRB A;  1QSN A;  3DSB A;  4R3K A;  2PIZ A;  2ZW6 A;  4ZBG A;  5JH9 A;  1L0C A;  4BBH A;  2Q4V A;  2CNT A;  1ZO0 A;  2PVV A;  4X3R A;  4CPA A;  4ZY0 A;  4JJX A;  5J8C A;  1YX0 A;  3G3S A;  4H89 A;  5AG7 A;  4XNH B;  1YRE A;  1BPN A;  1UWY A;  3B7I A;  1XMB A;  4NFR A;  5KTA A;  4MJ8 A;  2NSM A;  1YGH A;  3NA6 A;  1S5K A;  2XEG A;  5JM6 A;  2VXK A;  2PJ8 A;  5AG5 A;  1VHE A;  2ZOG A;  5A27 A;  4R57 A;  1Y7R A;  4IUS A;  1SQH A;  1I21 A;  4KOW A;  1KUY A;  2PJ3 A;  3CXS A;  4NJQ A;  4CYP A;  4U5Y A;  3H5Z A;  1WK4 A;  3EFA A;  3F8K A;  3R9E A;  1YME A;  4RI1 A;  1NE9 A;  4MFL A;  3WC6 A;  4R7M A;  4MFQ A;  2FIA A;  3BI1 A;  2Q7S A;  5F46 A;  2P0W A;  4PSX A;  4DNC A;  4F9V A;  1LFW A;  2XEJ A;  4R87 A;  2B4D B;  5H84 A;  3WR7 A;  4AG7 A;  5AGE A;  4EFD A;  2ANP A;  4KOY A;  2VBQ A;  5J1Q A;  3IU1 A;  3KQX A;  3LWU A;  4JD6 A;  3SI1 A;  3PRT A;  4YFJ A;  3FIX A;  3WT4 A;  4P4F A;  1XMT A;  2QJ8 A;  2B5G B;  3IC1 A;  2FL4 A;  4X2T A;  3DR6 A;  3S6G A;  2J8R A;  2EK8 A;  2YNE A;  3BLN A;  4KLV A;  2PVW A;  3NH5 A;  2V8G A;  1IB1 E;  4NGQ A;  4YU9 A;  5J8F A;  3IFE A;  4HNY B;  1HEE A;  3D4U A;  2ZOF A;  3FVL A;  3MN8 A;  1TXR A;  3OWC A;  3IO1 A;  4HNW B;  3RZA A;  2XEI A;  4K30 A;  5HH1 A;  3GB0 A;  2ZEF A;  4ZY2 A;  1Z4E A;  4B6Z A;  3S9L A;  4B5P A;  4NGN A;  4Q36 A;  2OU2 A;  4M3S A;  3CDX A;  1DTD A;  2YGW A;  4MHY A;  3R96 A;  3IGR A;  3FRM A;  5C82 A;  4L89 A;  5EMI A;  3KZW A;  4KOR A;  4CYN A;  4CGL A;  3ZJ0 A;  2FIW A;  1BAV A;  5K8O A;  3FX6 A;  1RO5 A;  3KR5 A;  4J3G A;  4ONU A;  2G0B A;  2YNC C;  4F0X A;  4KOU A;  4H6U A;  5F09 A;  4E8O A;  3GLJ A;  4C7I A;  3TO9 A;  4MRI A;  1FY7 A;  3W6S A;  3P2H A;  2C6G A;  2D4O A;  4OLL A;  1VHS A;  1Z9U A;  3EY5 A;  4MFK A;  4BMH A;  3KHZ A;  2PJ5 A;  1QSM A;  3FEE A;  3GIU A;  2QYV A;  8CPA A;  4ZYQ A;  2CTB A;  1M4G A;  4UCN A;  3WC5 A;  3PBB A;  1BO4 A;  3I1U A;  4UEE A;  4PK3 A;  1Q2D A;  4W9Y A;  1ARL A;  3C26 A;  2A4N A;  4FD5 A;  5JPH A;  4X8I A;  2Y0M A;  2Q51 A;  1KZF A;  3T8W A;  3KL9 A;  2J8N A;  3PB6 X;  4JXR A;  3FNC A;  1QST A;  3FF3 A;  2Q43 A;  5DS0 A;  1IYL A;  3JVN A;  3B3S A;  2ZW5 A;  3D2M A;  5F49 A;  3F0A A;  1LCP A;  1LRZ A;  2V8D A;  3SJX A;  4XNH C;  2Q44 A;  1R3N A;  1IYK A;  2R98 A;  1XFO A;  3NFZ A;  4M6G A;  3MGD A;  3VAR A;  4OC0 A;  4EWT A;  4LQ6 A;  2JEW A;  3UY5 A;  4E2A A;  4CGM A;  3D66 A;  1IID A;  3SJE A;  2EO8 A;  1TKH A;  5BWA B;  2IL4 A;  4HPS A;  1GYT A;  4OC1 A;  1KWM A;  1VIX A;  4L8A A;  2CY2 A;  3QAH A;  2R1I A;  5K8P A;  2I79 A;  3R1K A;  2AFO A;  2J8M A;  2PRQ A;  2VI7 A;  5LYF A;  4R9M A;  1Y0R A;  3T9Y A;  4P45 A;  2ZPA A;  4NGT A;  4CAX A;  3RNZ A;  3V8I A;  4LUA A;  4IHM A;  2O28 A;  1CPX A;  2REE A;  2Z3L A;  3D68 A;  5C88 A;  4UBR A;  4Y49 B;  1V0C A;  4UFW A;  7CPA A;  2BUE A;  4UEZ A;  2AFZ A;  3D3S A;  3IJ3 A;  1BPM A;  1JWQ A;  4R76 A;  2PJ9 A;  2ZEL A;  2BEI A;  2GLF A;  4K3N A;  4YRH A;  2CIJ A;  2PIY A;  3B3W A;  3KQZ A;  3L2N A;  4P4I A;  1YSJ A;  4M85 A;  3QAY A;  1XEB A;  2OB0 A;  4FD4 A;  3H4Q A;  1AUG A;  1J4J A;  2VZZ A;  3GKR A;  4CAV A;  5EC4 A;  5LYI A;  1P4N A;  1MK4 A;  1NMT A;  3V7Z A;  2HQY A;  4ORF A;  1YW4 A;  3LMS A;  4F0Y A;  4NGM A;  4TWE A;  2Q4Y A;  1M4I A;  4PXD A;  2PJA A;  3QNV A;  3KI9 A;  4OAE A;  2ZW7 A;  4P6Y A;  3K9T A;  2HUZ A;  2EK9 A;  4ZGY B;  4U9Z A;  1EE3 P;  3N7Z A;  5K8N A;  1LOK A;  3KR4 A;  4UCP A;  2OR4 A;  2F7V A;  3PP9 A;  4MY3 A;  2PR1 A;  2JBJ A;  1Z2L A;  4KLW A;  4XPD B;  4C68 A;  4ZY1 A;  2WSA A;  3SHP A;  4UEF A;  4UCM A;  2WYR A; 
#chains in the Genus database with same CATH homology
 5FVJ A;  4QUS A;  4CYO A;  1M1D A;  4AG9 A;  2AE6 A;  2WUU A;  2DPT A;  1B87 A;  4KUA A;  4A32 A;  4QBJ A;  3T90 A;  3F5B A;  1K4J A;  3QB8 A;  2Z10 A;  4QB9 A;  1QSO A;  3SXN A;  2DXQ A;  3PZJ A;  5JQ4 A;  3A9L A;  5GCN A;  4C2Y A;  3TCV A;  3S6H A;  2Z3P A;  3IU2 A;  1XE4 A;  4IF5 A;  2FT0 A;  4B12 A;  2B58 A;  2Q0Y A;  4KOT A;  2OZH A;  3D8P A;  4MFJ A;  4CAW A;  1N71 A;  2WPW A;  5KTD A;  3W91 A;  3S6F A;  2Q04 A;  2BL1 A;  1Y9W A;  4B5P B;  1IIC A;  5G22 A;  3JUW A;  5F47 A;  2K5T A;  5HMN A;  1KUV A;  1P0H A;  4Y49 C;  2Z3M A;  4B14 A;  4UFV A;  2QEC A;  3FYN A;  4NCZ A;  2Z3N A;  3P2F A;  2RC4 A;  2PC1 A;  3FXT A;  4CAF A;  1YLE A;  3TT2 A;  4I49 A;  4A2Z A;  4CGO A;  2G3A A;  2F5I A;  5IX3 A;  5I0C A;  4KVM E;  4B13 A;  4AVA A;  2NMT A;  1M4D A;  2ZXV A;  3IWG A;  4KOX A;  1S7K A;  1NSL A;  2H5M A;  2B3V A;  2EUI A;  3CXQ A;  4H6Z A;  4CGP A;  5ISV A;  5KTC A;  3E0K A;  4KVO E;  3R9F A;  3CXP A;  2CNS A;  1BOB A;  3TOA A;  1MJ9 A;  1WWZ A;  2YNC A;  4CS0 B;  3I9S A;  1MJB A;  4KOV A;  1RXT A;  2FSR A;  4KVX A;  1QSR A;  1YVO A;  1PU9 A;  2OZU A;  4XPD C;  5IB0 A;  4PV6 A;  2D4P A;  2Z3K A;  2GIV A;  3LD2 A;  3VWE A;  2ZW4 A;  3S6K A;  1CJW A;  2YND A;  3EC4 A;  4NF1 A;  2FCK A;  4UA3 A;  2Q7B A;  4MHD A;  2QML A;  2VEZ A;  1YK3 A;  4U9Y A;  2FXF A;  3BJ7 A;  3SXO A;  3TO6 A;  3G8W A;  5A28 A;  5AG4 A;  3IWE A;  4GS4 A;  2Z3O A;  4UFX A;  2PQ8 A;  4MFZ A;  4B10 A;  3DNS A;  4JXQ A;  3TO7 A;  2GE3 A;  2G3T A;  4AVB A;  3EXN A;  1S7N A;  2PSW A;  4MBU A;  5AG6 A;  3R95 A;  1YVK A;  1R57 A;  4KSA A;  2AJ6 A;  2B3U A;  2FE7 A;  4MI4 A;  3RYO A;  2ARH A;  2PDO A;  4R3L A;  2HV2 A;  2JEV A;  4FD7 A;  2GAN A;  4UWJ A;  4A31 A;  2B4D A;  2P6E A;  3DR8 A;  3TTH A;  4JWP A;  4HKF A;  2CNM A;  4EVY A;  1Q2Y A;  4CRY B;  2JDC A;  2WPX A;  2KCW A;  2B5G A;  3KKW A;  4B11 A;  2Z0Z A;  1XF8 A;  3TE4 A;  1S3Z A;  2ATR A;  2I00 A;  4C2Z A;  2FS5 A;  2OZG A;  4NEX A;  1I12 A;  5G21 A;  4AB7 A;  3ZZI A;  1TIQ A;  2CXA A;  1Q2C A;  3JTK A;  4LX9 A;  1UFH A;  3BJ8 A;  1YR0 A;  1GHE A;  3DDD A;  4XPL A;  4XPK A;  5CNP A;  2EVN A;  5F48 A;  2Z11 A;  3I3G A;  4CRZ B;  4MY0 A;  1U6M A;  5DWM A;  2OH1 A;  3FB3 A;  1VKC A;  4KZT A;  4PK2 A;  1XIX A;  4KUB A;  3VWD A;  4CGN A;  1B6B A;  1I1D A;  4QVT A;  4A95 A;  2C27 A;  4AVC A;  1M44 A;  4CYQ A;  4B5O A;  4KSF A;  4C2X A;  4F6A A;  5IV0 A;  3FBU A;  3GYA A;  5H86 A;  2P6G A;  5DWN A;  4KOS A;  4X5K A;  1ON0 A;  1MJA A;  5E96 A;  1PUA A;  3EO4 A;  4KS9 A;  2REF A;  4FD6 A;  5G20 A;  2P6F A;  4YGO A;  3W6X A;  3PGP A;  1S60 A;  2BSW A;  2QIR A;  3K9U A;  4UWI A;  4MFP A;  3GY9 A;  2VZY A;  4C7H A;  5G1Z A;  3TOB A;  2JDD A;  1OZP A;  4CAE A;  3R9G A;  1KUX A;  3NE7 A;  2X7B A;  4NSQ A;  1S7F A;  1Y9K A;  4II9 A;  4HNX B;  1S7L A;  3D2P A;  2PR8 A;  4OAD A;  3B8G A;  4Q38 A;  3TFY A;  2DPS A;  4RS2 A;  4A30 A;  2B4B A;  4A33 A;  2R7H A;  4E0A A;  3LOD A;  5EBV A;  2VQY A;  2R8V A;  1CM0 A;  4NXY A;  4QC6 A;  1Z4R A;  4PSW A;  2JLM A;  4JLY A;  2PRB A;  1QSN A;  3DSB A;  4R3K A;  2ZW6 A;  4ZBG A;  1L0C A;  4BBH A;  2Q4V A;  2CNT A;  1ZO0 A;  4JJX A;  5J8C A;  1YX0 A;  3G3S A;  4H89 A;  5AG7 A;  4XNH B;  1YRE A;  5KTA A;  4MJ8 A;  1YGH A;  1S5K A;  2VXK A;  5AG5 A;  5A27 A;  4R57 A;  1Y7R A;  4IUS A;  1SQH A;  1I21 A;  4KOW A;  1KUY A;  3CXS A;  4CYP A;  4U5Y A;  3H5Z A;  1WK4 A;  3EFA A;  3F8K A;  3R9E A;  4RI1 A;  1NE9 A;  4MFL A;  4MFQ A;  2FIA A;  5F46 A;  2P0W A;  4PSX A;  4DNC A;  5H84 A;  4R87 A;  2B4D B;  3WR7 A;  4AG7 A;  5AGE A;  4KOY A;  2VBQ A;  3IU1 A;  4JD6 A;  4YFJ A;  3FIX A;  1XMT A;  2B5G B;  2FL4 A;  3DR6 A;  3S6G A;  2J8R A;  2YNE A;  3BLN A;  4KLV A;  5J8F A;  1IB1 E;  4HNY B;  3OWC A;  4HNW B;  4K30 A;  5HH1 A;  1Z4E A;  4B5P A;  4Q36 A;  2OU2 A;  4M3S A;  2YGW A;  3R96 A;  3IGR A;  3FRM A;  5C82 A;  4L89 A;  4CYN A;  4KOR A;  4CGL A;  3ZJ0 A;  2FIW A;  1RO5 A;  4J3G A;  4ONU A;  2G0B A;  2YNC C;  4F0X A;  4KOU A;  4H6U A;  4E8O A;  4C7I A;  3TO9 A;  3W6S A;  1FY7 A;  3P2H A;  2D4O A;  4OLL A;  1VHS A;  1Z9U A;  3EY5 A;  4MFK A;  4BMH A;  1QSM A;  1M4G A;  4UCN A;  1BO4 A;  4PK3 A;  1Q2D A;  3C26 A;  2A4N A;  4FD5 A;  5JPH A;  2Y0M A;  1KZF A;  2J8N A;  4JXR A;  3FNC A;  1QST A;  1IYL A;  3JVN A;  2ZW5 A;  3D2M A;  5F49 A;  3F0A A;  1LRZ A;  4XNH C;  2Q44 A;  1IYK A;  2R98 A;  3MGD A;  3UY5 A;  4E2A A;  4CGM A;  1IID A;  5BWA B;  2IL4 A;  4L8A A;  2CY2 A;  3QAH A;  2R1I A;  2I79 A;  3R1K A;  2J8M A;  2VI7 A;  4R9M A;  3T9Y A;  2ZPA A;  4CAX A;  3V8I A;  4LUA A;  2O28 A;  2REE A;  5C88 A;  2Z3L A;  4UBR A;  4Y49 B;  1V0C A;  4UFW A;  2BUE A;  3D3S A;  2BEI A;  4YRH A;  4M85 A;  1XEB A;  2OB0 A;  4FD4 A;  3H4Q A;  1J4J A;  3GKR A;  2VZZ A;  4CAV A;  5EC4 A;  1P4N A;  1MK4 A;  1NMT A;  2HQY A;  4ORF A;  4F0Y A;  2Q4Y A;  1M4I A;  4OAE A;  2ZW7 A;  2HUZ A;  4ZGY B;  4U9Z A;  3N7Z A;  4UCP A;  3PP9 A;  4MY3 A;  2PR1 A;  4KLW A;  4XPD B;  4C68 A;  2WSA A;  3SHP A;  4UCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...