1NSLA

Crystal structure of probable acetyltransferase
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
180
structure length
176
Chain Sequence
GMFTCKVNEHITIRLLEPKDAERLAELIIQNQQRLGKWLFFSSADTYRETIIPDWRRQYADLNGIEAGLLYDGSLCGMISLHNLDQVNRKAEIGYWIAKEFEGKGIITAACRKLITYAFEELELNRVAICAAVGNEKSRAVPERIGFLEEGKARDGLYVNGMHHDLVYYSLLKREW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Probable acetyltransferase
publication title Crystal structure of Bacillus subtilis YdaF protein: A putative ribosomal N-acetyltransferase
pubmed doi rcsb
source organism Bacillus subtilis
total genus 47
structure length 176
sequence length 180
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2003-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1nslA00
1KUXA 1WWZA 4KLVA 5FVJA 3DDDA 1SQHA 1FY7A 3P2FA 4LX9A 5C88A 3R9EA 3PP9A 1M4DA 4J3GA 4JXQA 4B5OA 3TOBA 5IB0A 4II9A 1RXTA 2I79A 4L8AA 1L0CA 1S7KA 1UFHA 5KTAA 3S6GA 4NXYA 1I21A 4PSWA 4KORA 1YK3A 1ON0A 5EBVA 1LRZA 3TCVA 2ZW4A 2A4NA 2Z0ZA 1U6MA 2B3UA 2Q04A 2VZZA 4UWJA 1QSOA 1P0HA 2FIAA 3GKRA 3NE7A 3TT2A 5J8FA 1S7LA 4IF5A 4MJ8A 1CJWA 4KOTA 4H89A 2G3TA 4DNCA 1PU9A 3GYAA 2OZUA 2K5TA 2IL4A 4NEXA 5JPHA 2ZW5A 1Q2DA 1IB1E 1S3ZA 3I9SA 5DWNA 2G0BA 1IYLA 4XPDB 2H5MA 4JWPA 2PR1A 4U9ZA 1N71A 4JLYA 2KCWA 2ZPAA 1PUAA 3G8WA 4KOUA 2B3VA 1B6BA 2PRBA 5JQ4A 4F0YA 4AVCA 2FIWA 1YLEA 3R9FA 2JLMA 4HKFA 1Z9UA 4CS0B 3BJ7A 3I3GA 2JEVA 3GY9A 4E2AA 1M4GA 2OU2A 2HUZA 2FCKA 2FS5A 4IUSA 1Z4RA 3BJ8A 3WR7A 1KUVA 2Q44A 1Y9WA 4M3SA 3G3SA 3H4QA 3DNSA 3LODA 1QSNA 5C82A 3FIXA 1K4JA 4XNHB 2VI7A 2HQYA 4RI1A 1XIXA 2J8NA 1Y9KA 3P2HA 2VBQA 5IX3A 3RYOA 4B5PA 2AE6A 3D2PA 4PSXA 2FL4A 2D4PA 1Q2CA 4MY0A 2GE3A 4HNYB 2I00A 1QSTA 3S6HA 2RC4A 2CNTA 2Q0YA 4H6ZA 2Z11A 4MHDA 4CAXA 2P6GA 3DSBA 1M44A 4MBUA 5EC4A 3VWDA 1S7FA 3W6XA 1S5KA 2B5GA 2B4DB 5F49A 1CM0A 4M85A 1B87A 3TO7A 1RO5A 4UWIA 2JDDA 4ZBGA 2VEZA 3SHPA 1BO4A 2OH1A 3TTHA 4JD6A 3F0AA 1QSRA 4B5PB 5H84A 4CRYB 3JUWA 2FE7A 4AB7A 4JJXA 4QVTA 1IIDA 3T90A 4E8OA 5ISVA 4JXRA 2FSRA 4QBJA 4FD4A 5F46A 3ZZIA 1NSLA 3TE4A 5HH1A 1I1DA 4R3LA 2Q7BA 4I49A 1J4JA 1YVKA 2CY2A 4OAEA 2J8RA 4K30A 2B5GB 4GS4A 4F6AA 1IICA 1MJBA 2ARHA 4FD7A 4QC6A 3CXPA 1S7NA 3F8KA 3T9YA 4KOVA 2CNMA 4XPLA 2PDOA 1KUYA 4FD6A 3ZJ0A 3FBUA 1YVOA 4XPDC 1YGHA 1QSMA 2FT0A 4KVOE 4UBRA 3FB3A 2EVNA 4Y49B 5I0CA 3R96A 2WPXA 2FXFA 2VXKA 2PSWA 2R8VA 2OZGA 1R57A 2AJ6A 1XEBA 2Q4YA 1YREA 3PZJA 4R3KA 3IWGA 4KVME 3K9UA 4R9MA 1XF8A 3QAHA 4OLLA 1XE4A 3TO6A 2B4DA 4R57A 2BL1A 2B58A 3QB8A 4KLWA 2CNSA 5KTCA 2ATRA 4NSQA 4XNHC 3R9GA 4L89A 2BSWA 2NMTA 3BLNA 1OZPA 4LUAA 5CNPA 3FXTA 3EO4A 2GIVA 3D8PA 2R1IA 4YGOA 1YX0A 3OWCA 2EUIA 3TO9A 4EVYA 4U9YA 2OB0A 4CRZB 4HNXB 2VQYA 3JVNA 3CXSA 4KOSA 1BOBA 4PV6A 1YR0A 3SXOA 4AG9A 2R98A 2O28A 3DR6A 1Z4EA 3FNCA 4CAWA 3FYNA 1IYKA 4QUSA 2OZHA 2QMLA 2X7BA 3D3SA 5H86A 2R7HA 3DR8A 3S6KA 1MJAA 1NMTA 5J8CA 3EY5A 2REFA 4UA3A 3E0KA 3CXQA 4BMHA 5IV0A 1S60A 1P4NA 4KOXA 3V8IA 4MI4A 2Z10A 4PK2A 2ZXVA 4OADA 4E0AA 3W91A 1Y7RA 3EC4A 4KOYA 2GANA 1TIQA 4MY3A 4XPKA 1VHSA 2QECA 5DWMA 3IGRA 1Q2YA 4RS2A 5GCNA 3KKWA 4AVBA 4HNWB 1GHEA 2Q4VA 4H6UA 4KZTA 4U5YA 2PR8A 2PC1A 3R95A 3D2MA 2HV2A 1WK4A 4PK3A 1I12A 3TOAA 3FRMA 4KUBA 3UY5A 5F48A 3LD2A 3PGPA 1XMTA 2WPWA 4Y49C 2C27A 4KOWA 2B4BA 4ONUA 1VKCA 4FD5A 5F47A 1MJ9A 4YRHA 2P6EA 2F5IA 3N7ZA 2ZW7A 2P0WA 4YFJA 2DXQA 3S6FA 3SXNA 2JDCA 3W6SA 2D4OA 4AVAA 3VWEA 2P6FA 2BEIA 2Y0MA 4AG7A 5KTDA 3F5BA 3TFYA 3EFAA 2BUEA 3C26A 4QB9A 1M1DA 1M4IA 1NE9A 4X5KA 3R1KA 2J8MA 2VZYA 4KUAA 5HMNA 2ZW6A 4NCZA 2PQ8A 4KVXA 1MK4A 1KZFA 2REEA 3MGDA 4CAVA 5E96A 3EXNA 3B8GA 4R87A 4ORFA 1V0CA 2QIRA 2G3AA 4NF1A
chains in the Genus database with same CATH superfamily
1KUXA 2C6PA 1WWZA 2O4HA 4KLVA 5FVJA 3DDDA 4R7MA 1SQHA 3GIUA 4F9VA 1FY7A 3P2FA 4LX9A 4PPZA 5C88A 1PCAA 3D67A 3R9EA 1ZLHA 3PP9A 1M4DA 4J3GA 4JXQA 1KWMA 4OC1A 3TOBA 4B5OA 2PJ0A 4BD9A 5IB0A 4II9A 1RXTA 2I79A 4L8AA 1L0CA 1S7KA 1UFHA 1FNOA 4WJBA 4W9YA 5KTAA 3S6GA 4NXYA 4OC2A 2V8HA 3NA6A 1I21A 4PSWA 4KORA 1TXRA 1YK3A 3B35A 1ON0A 5EBVA 4EMEA 2AFSA 1LRZA 3TCVA 1F2PA 2ZW4A 2A4NA 1AYEA 2GLJA 2Z0ZA 4TNUA 1U6MA 2F8HA 2B3UA 4PQAA 4OC5A 2BOAA 4ZI6A 4B11A 5LYIA 2Q04A 2ZEGA 2VZZA 4MFLA 3H8GA 2Z3NA 2EK9A 1ELMP 5G20A 4UWJA 4ZY1A 1RTQA 1QSOA 3NH8A 1IGBA 5AGEA 3T8WA 4FWUA 1P0HA 4JYWA 2FIAA 3GKRA 3NE7A 3TT2A 5J8FA 5BWAB 1XBUA 1S7LA 4IF5A 3VATA 4MJ8A 5HVFA 1CJWA 4KSFA 4NFRA 4RUHA 4KOTA 4H89A 2G3TA 1IOFA 1ARLA 4DNCA 1PU9A 3D7HA 3CPAA 3GYAA 5HXDA 4NGNA 2OZUA 2K5TA 2IL4A 3D7DA 4NEXA 4FBEA 5JPHA 2ZW5A 1Q2DA 3FEEA 4BINA 4NJRA 4X2TA 2RB7A 1F2OA 2PJCA 1IB1E 1S3ZA 4K3NA 1AUGA 4OIWA 2PJ1A 5K8PA 4C2XA 3I9SA 3RBUA 3HUVA 1ARMA 4A38A 2CXAA 4ZY0A 5DWNA 5HVHA 2G0BA 1IYLA 4XPDB 2NYQA 3B7IA 2H5MA 2HB6A 4JWPA 1F57A 2PR1A 4U9ZA 1N71A 4JLYA 2KCWA 4CYPA 1QQ9A 2ZPAA 1PUAA 1PYTB 3G8WA 4KOUA 2B3VA 1R43A 1B6BA 5AG5A 4F8ZA 2PRBA 4ZX9A 4A37A 1HDQA 1H8LA 1UWYA 2RFHA 4KSIA 3FF3A 4CGMA 2Z3LA 1LAPA 2XEGA 5JQ4A 4F0YA 2ZEEA 2PJAA 4AVCA 3BHXA 2FIWA 4MHZA 1YLEA 4X8IA 3B3TA 3R9FA 2JLMA 1TKFA 4HKFA 5DS0A 1Z9UA 1ZO0A 4RN7A 4CAEA 4CS0B 3BJ7A 4EWTA 2YNEA 3I3GA 4FAIA 2JEVA 4EFDA 3GY9A 2EWBA 4E2AA 1M4GA 1LANA 2OU2A 2HUZA 2FCKA 2FS5A 4MHNA 4UCMA 4IUSA 1Z4RA 3BJ8A 3IU1A 4KSAA 1KUVA 3WR7A 2Z3KA 2Q44A 3PB8X 1Y9WA 2V8VA 4M3SA 1LCPA 3FEDA 3G3SA 1IU8A 2BO9A 3DNSA 3H4QA 3LODA 3PFOA 4KS9A 3RNZA 4CYOA 1QSNA 3BI1A 5C82A 4OC4A 3B3CA 3B3VA 3PBEA 3FIXA 4MMOA 4P4EA 1K4JA 4PXDA 5G22A 3TX8A 4A31A 1NSAA 3D7FA 4XNHB 4IK2A 2VI7A 4ZGYB 2HQYA 4RI1A 1XIXA 3IEHA 4MRIA 2Z3OA 3H8EA 4LQGA 2J8NA 4UEFA 1Y9KA 3P2HA 2ZEHA 3IWWA 5AG7A 3I1UA 2VBQA 5IX3A 3RYOA 2BCOA 4Q36A 4P44A 3PFEA 4B5PA 7CPAA 2AE6A 2CTCA 1ZG8A 3D2PA 4PSXA 4B13A 2FL4A 3K9TA 1TF9A 4CPAA 8CPAA 2D4PA 1BAVA 3IWEA 4P4IA 1Q2CA 4MY0A 2GE3A 4HNYB 4P4BA 5G1ZA 2I00A 1QSTA 3S6HA 4P4DA 3SI2A 4CGOA 2RC4A 3D7GA 2CNTA 2Q0YA 4H6ZA 2Z11A 5EMIA 2PVWA 1AMPA 1YW6A 4M6GA 4MHDA 4CAXA 2PJ2A 2P6GA 3BI0A 1ZG7A 1M44A 3DSBA 4B14A 2YNCA 1XJOA 4MBUA 5EC4A 1A2ZA 1Y0RA 3VWDA 4UEZA 3JTKA 1S7FA 3W6XA 1S5KA 4NGRA 3VARA 2CF4A 2B5GA 2B4DB 5F49A 1CM0A 4M85A 1YLOA 1B87A 3TO7A 1RO5A 2PJBA 2CIJA 2JDDA 4UWIA 4DYOA 4ZBGA 4NGMA 2VEZA 4DJLA 3SHPA 1CP6A 3KR5A 1BO4A 2OH1A 3TTHA 4JD6A 3F0AA 1QSRA 3KHXA 4B5PB 1GYTA 5H84A 3JUWA 2FE7A 4G1PA 3WC5A 4CRYB 1VIXA 4OP4A 4AB7A 4JJXA 4QVTA 1IIDA 4MHYA 3TC8A 3T90A 4C2YA 4E8OA 5ISVA 4JXRA 3NH4A 5IB9A 4P10A 4Z65A 2DEAA 4LQ6A 4TWEA 2FSRA 4QBJA 5JM6A 4FD4A 4OC3A 1OBRA 2ZEFA 3RAMA 5F46A 4IHMA 3ZZIA 4BBHA 1NSLA 4OC0A 4A2ZA 3TE4A 5HH1A 1I1DA 1X10A 4R3LA 2Q7BA 4I49A 4CGNA 4F9UA 1J4JA 3D4UA 1YVKA 2CY2A 4OAEA 2J8RA 4K30A 2B5GB 4GM5A 4GS4A 4F6AA 1JQGA 5CPAA 1IICA 1MJBA 1Z5RA 2ARHA 3K2KA 3NE8A 3PB7X 4FD7A 1CP7A 4QC6A 3D68A 4X3RA 5LRGA 1R3NA 1CPSA 3CXPA 3BXMA 4MCSA 4MFJA 1S7NA 1CX8A 1YQEA 3F8KA 3VH9A 3T9YA 4KOVA 2JBKA 3SJXA 4DUKA 4P4FA 2CNMA 3FJUA 4XPLA 2PDOA 1KUYA 3MRUA 2C1CA 1XMBA 4FD6A 2WYRA 4M6IA 3ZJ0A 5G21A 2QJ8A 1Y7EA 2EO8A 3FBUA 3PEIA 1YVOA 3KASA 5AG4A 4XPDC 1YGHA 3HLPA 1QSMA 4AXVA 2FT0A 2V8DA 4KVOE 4UBRA 4CAFA 5CBMA 5K8OA 5K8NA 2Q7SA 3FB3A 1TKJA 4B12A 2EVNA 4Y49B 5I0CA 3KQXA 3R96A 2WPXA 4YU9A 1Z8LA 2FXFA 2OR4A 3IC1A 3QNVA 5JH9A 2VXKA 3CT9A 2DPTA 2PSWA 3PRTA 2AFXA 2POKA 4UFXA 1YSJA 2R8VA 2OZGA 2PVVA 1R57A 2AJ6A 1LFWA 1XEBA 2Q4YA 1YREA 2DF5A 3CDXA 3GB0A 3PZJA 5AG6A 2PRQA 4R3KA 3S9NA 2Z3MA 3IWGA 2YNDA 4KVME 1HEEA 3K9UA 3IFEA 2PJ8A 4R9MA 3SJGA 4C68A 3N5FA 1XF8A 3QAHA 2DPSA 5JGFA 2IMOA 2AFWA 4OLLA 2J9AA 1EE3P 1XE4A 4YWYA 3TO6A 2B4DA 4R57A 3QAYA 2BL1A 4R8FA 1LOKA 2B58A 3QB8A 4HPSA 4KLWA 2GFQA 3CPXA 4MCPA 1ELLP 2CNSA 5KTCA 2ATRA 2PE3A 4NSQA 5J1QA 3ISZA 4MFQA 2PJ9A 4GXHA 2AFOA 1QMUA 4A95A 4XNHC 3R9GA 3KL9A 5A28A 4Q38A 4L89A 4ZY2A 1JWQA 3IO1A 2ANPA 2BSWA 2HC9A 2NMTA 2PJ3A 1YW4A 4M6HA 3BLNA 1OZPA 4LUAA 4UF4A 2IQ6A 3FXTA 2XEJA 4NGTA 5CNPA 1Q7LA 3EO4A 2GIVA 3D8PA 2PJ5A 2R1IA 4MXUA 4YGOA 2Q4ZA 2PJ6A 1YX0A 3OWCA 3KGQA 4UCNA 1XFOA 2EUIA 4OMEA 4B10A 3TO9A 2PIYA 4EVYA 3LACA 5LYLA 3V38A 2O53A 1ZG9A 4U9YA 2PCUA 4H2KA 2OB0A 4CRZB 4O23A 3IU2A 4HNXB 3B3SA 4A33A 4MCQA 2VQYA 3JVNA 3RO0A 3WC7A 5LYDA 2G9DA 3CXSA 2GU2A 4KOSA 1BOBA 1TF8A 4FUUA 4MFPA 1Z8WA 4PV6A 3A9LA 3LWUA 3GLJA 4A32A 5D8NA 3KR4A 1YR0A 2ABZA 4PXCA 3SXOA 1IOIA 4A39A 3DLJA 3WABA 4AG9A 2R98A 2O28A 2XEIA 4C7HA 3DR6A 1Z4EA 3FNCA 4CAWA 2PIZA 3FYNA 1IYKA 1TKHA 4QUSA 2OZHA 3B3WA 2QMLA 2X7BA 3D3SA 5THWA 5H86A 2R7HA 3DR8A 1Z2LA 3ISXA 3V7ZA 3S6KA 3JRUA 1MJAA 1NMTA 4JZ0A 4UIBA 3EY5A 3FMCA 3GUXA 5J8CA 2C6CA 2EBJA 4OIDA 4OKOA 4NGQA 4ONWA 4A94A 2REFA 4CGPA 1DE4C 2ZOGA 4UA3A 3E0KA 3CXQA 4BMHA 5IV0A 4MCRA 2JBJA 3WT4A 3FX6A 4ZX8A 3KZWA 1S60A 1P4NA 4KOXA 3H5ZA 2ZEMA 3V8IA 4MI4A 2Z10A 4P4JA 1CG2A 2YGWA 4PK2A 2GREA 4UCPA 5K8MA 2AFMA 2ZXVA 2YNCC 3L2NA 4OADA 2Q51A 3W91A 4E0AA 5ELYA 2F7VA 1Y7RA 3EC4A 4KOYA 2VL1A 2GANA 1TIQA 4MY3A 1CPXA 4XPKA 2NSMA 1VHSA 2ZOFA 4B6ZA 1Z8TA 2QECA 5LYFA 4F0XA 5F09A 5DWMA 3IGRA 1VHEA 1Q2YA 4PXEA 3SJEA 4RS2A 4R76A 5GCNA 3KKWA 4AVBA 2IJZA 2Z3PA 3FVLA 4HNWB 1GHEA 3IIBA 2Q4VA 2V77A 3LMSA 4P45A 3DGVA 2PJ7A 4H6UA 4KZTA 2WSAA 4CYQA 2ODFA 4U5YA 1XRYA 3PB4X 3KHZA 2PR8A 3SJFA 3CZXA 3PB6X 4NJQA 2PC1A 3R95A 1CBXA 1X12A 3D2MA 2AFUA 3D66A 2C6GA 3H8FA 4C7IA 2HV2A 1Z8XA 1WK4A 1BPMA 2ZEOA 3KQZA 4PK3A 3S9MA 1I12A 2PJ4A 3TOAA 3FRMA 4KUBA 4UEEA 3UY5A 2WUUA 4MFKA 2EK8A 3LD2A 3B2YA 4Q7AA 5F48A 3PGPA 2ZELA 1XMTA 1VGYA 2WPWA 2C27A 2XEFA 1IY7A 2I3CA 4KOWA 4Y49C 1ZLIA 6CPAA 1FT7A 5HVGA 3FH4A 3WC6A 2B4BA 4ONUA 2ZEPA 3PB9X 1VKCA 4FD5A 1BLLE 2JEWA 4P6YA 5F47A 1MJ9A 4YRHA 5D29A 4MHPA 2P6EA 1DTDA 2F5IA 3PBBA 4MFZA 3FECA 3KI9A 2GLFA 1BPNA 2FVGA 3N7ZA 1HDUA 2ZW7A 4ZYQA 2P0WA 4YFJA 3IJ3A 5I4MA 3S9LA 2DXQA 2CTBA 1YMEA 3S6FA 2WZNA 3SXNA 2JDCA 3W6SA 2D4OA 4AVAA 3VWEA 2P6FA 2BEIA 2Y0MA 2ZEDA 2OOTA 4AG7A 4C2ZA 3F5BA 5KTDA 3TFYA 4UFWA 3EFAA 2BUEA 3C26A 2QYVA 4PXBA 4QB9A 3NH5A 3SI0A 1M1DA 1M4LA 1M4IA 1NE9A 4X5KA 3R1KA 4NGSA 2AFZA 1LAMA 2ZENA 4CGLA 3MN8A 2J8MA 2VZYA 2Q43A 5A27A 4UFVA 4KUAA 5LRKA 4IAVA 5HMNA 1Y0YA 2ZW6A 4NCZA 1VHOA 1XOVA 2PQ8A 4KVXA 3SI1A 1MK4A 1KZFA 4R6TA 4NGPA 4CYNA 2V8GA 2REEA 3MGDA 4CAVA 5E96A 3EXNA 3B8GA 3RZAA 2QVPA 4R87A 4ORFA 1V0CA 4UIAA 5LRJA 2QIRA 3NFZA 4A30A 4WWVA 2G3AA 4NF1A
chains in the Genus database with same CATH topology
1KUXA 1WWZA 4KLVA 5FVJA 3DDDA 1SQHA 1FY7A 3P2FA 4LX9A 5C88A 3R9EA 3PP9A 1M4DA 4J3GA 4JXQA 4B5OA 3TOBA 5IB0A 4II9A 1RXTA 2I79A 4L8AA 1L0CA 1S7KA 1UFHA 5KTAA 3S6GA 4NXYA 1I21A 4PSWA 4KORA 1YK3A 1ON0A 5EBVA 1LRZA 3TCVA 2ZW4A 2A4NA 2Z0ZA 1U6MA 2B3UA 4B11A 2Q04A 2VZZA 4MFLA 2Z3NA 5G20A 4UWJA 1QSOA 5AGEA 1P0HA 2FIAA 3GKRA 3NE7A 3TT2A 5J8FA 5BWAB 1S7LA 4IF5A 4MJ8A 1CJWA 4KSFA 4KOTA 4H89A 2G3TA 4DNCA 1PU9A 3GYAA 2OZUA 2K5TA 2IL4A 4NEXA 5JPHA 2ZW5A 1Q2DA 1IB1E 1S3ZA 4C2XA 3I9SA 2CXAA 5DWNA 2G0BA 1IYLA 4XPDB 2H5MA 4JWPA 2PR1A 4U9ZA 1N71A 4JLYA 2KCWA 4CYPA 2ZPAA 1PUAA 3G8WA 4KOUA 2B3VA 1B6BA 5AG5A 2PRBA 4CGMA 2Z3LA 5JQ4A 4F0YA 4AVCA 2FIWA 1YLEA 3R9FA 2JLMA 4HKFA 1Z9UA 1ZO0A 4CAEA 4CS0B 3BJ7A 2YNEA 3I3GA 2JEVA 3GY9A 4E2AA 1M4GA 2OU2A 2HUZA 2FCKA 2FS5A 4UCMA 4IUSA 1Z4RA 3BJ8A 3IU1A 4KSAA 1KUVA 3WR7A 2Z3KA 2Q44A 1Y9WA 4M3SA 3G3SA 3H4QA 3DNSA 3LODA 4KS9A 4CYOA 1QSNA 5C82A 3FIXA 5G22A 1K4JA 4A31A 4XNHB 2VI7A 4ZGYB 2HQYA 4RI1A 1XIXA 2Z3OA 2J8NA 1Y9KA 3P2HA 5AG7A 2VBQA 5IX3A 3RYOA 4Q36A 4B5PA 2AE6A 3D2PA 4B13A 4PSXA 2FL4A 2D4PA 3IWEA 1Q2CA 4MY0A 2GE3A 4HNYB 5G1ZA 2I00A 1QSTA 3S6HA 4CGOA 2RC4A 2CNTA 2Q0YA 4H6ZA 2Z11A 4MHDA 4CAXA 2P6GA 3DSBA 1M44A 4B14A 2YNCA 4MBUA 5EC4A 3VWDA 3JTKA 1S7FA 3W6XA 1S5KA 2B5GA 2B4DB 5F49A 1CM0A 4M85A 1B87A 3TO7A 1RO5A 4UWIA 2JDDA 4ZBGA 2VEZA 3SHPA 1BO4A 2OH1A 3TTHA 4JD6A 3F0AA 1QSRA 4B5PB 5H84A 4CRYB 3JUWA 2FE7A 4AB7A 4JJXA 4QVTA 1IIDA 3T90A 4C2YA 4E8OA 5ISVA 4JXRA 2FSRA 4QBJA 4FD4A 5F46A 3ZZIA 4BBHA 1NSLA 4A2ZA 3TE4A 5HH1A 1I1DA 4R3LA 2Q7BA 4CGNA 4I49A 1J4JA 1YVKA 2CY2A 4OAEA 2J8RA 4K30A 2B5GB 4GS4A 4F6AA 1IICA 1MJBA 2ARHA 4FD7A 4QC6A 3CXPA 4MFJA 1S7NA 3F8KA 3T9YA 4KOVA 2CNMA 4XPLA 2PDOA 1KUYA 4FD6A 3ZJ0A 5G21A 3FBUA 5AG4A 1YVOA 4XPDC 1YGHA 1QSMA 2FT0A 4KVOE 4CAFA 4UBRA 3FB3A 4B12A 2EVNA 4Y49B 5I0CA 3R96A 2WPXA 2FXFA 2VXKA 2DPTA 2PSWA 4UFXA 2R8VA 2OZGA 1R57A 2AJ6A 1XEBA 2Q4YA 1YREA 3PZJA 5AG6A 4R3KA 2Z3MA 3IWGA 2YNDA 4KVME 3K9UA 4R9MA 4C68A 1XF8A 3QAHA 2DPSA 4OLLA 1XE4A 3TO6A 2B4DA 4R57A 2BL1A 2B58A 3QB8A 4KLWA 2CNSA 5KTCA 2ATRA 4NSQA 4MFQA 4A95A 4XNHC 3R9GA 5A28A 4Q38A 4L89A 2BSWA 2NMTA 3BLNA 1OZPA 4LUAA 5CNPA 3FXTA 3EO4A 2GIVA 3D8PA 2R1IA 4YGOA 1YX0A 3OWCA 4UCNA 2EUIA 4B10A 3TO9A 4EVYA 4U9YA 2OB0A 4CRZB 3IU2A 4HNXB 4A33A 2VQYA 3JVNA 3CXSA 4KOSA 1BOBA 4MFPA 4PV6A 3A9LA 4A32A 1YR0A 3SXOA 4AG9A 2R98A 2O28A 4C7HA 3DR6A 1Z4EA 3FNCA 4CAWA 3FYNA 1IYKA 4QUSA 2OZHA 2QMLA 2X7BA 3D3SA 5H86A 2R7HA 3DR8A 3S6KA 1MJAA 1NMTA 5J8CA 3EY5A 4CGPA 2REFA 4UA3A 3E0KA 3CXQA 4BMHA 5IV0A 1S60A 1P4NA 4KOXA 3H5ZA 3V8IA 4MI4A 2Z10A 2YGWA 4PK2A 4UCPA 2ZXVA 2YNCC 4OADA 4E0AA 3W91A 1Y7RA 3EC4A 4KOYA 2GANA 1TIQA 4MY3A 4XPKA 1VHSA 2QECA 4F0XA 5DWMA 3IGRA 1Q2YA 4RS2A 5GCNA 3KKWA 4AVBA 4HNWB 2Z3PA 1GHEA 2Q4VA 4H6UA 4KZTA 2WSAA 4CYQA 4U5YA 2PR8A 2PC1A 3R95A 3D2MA 4C7IA 2HV2A 1WK4A 4PK3A 1I12A 3TOAA 3FRMA 4KUBA 3UY5A 2WUUA 4MFKA 5F48A 3LD2A 3PGPA 1XMTA 2WPWA 4Y49C 2C27A 4KOWA 2B4BA 4ONUA 1VKCA 4FD5A 5F47A 1MJ9A 4YRHA 2P6EA 2F5IA 4MFZA 3N7ZA 2ZW7A 2P0WA 4YFJA 2DXQA 3S6FA 3SXNA 2JDCA 3W6SA 2D4OA 4AVAA 3VWEA 2P6FA 2BEIA 2Y0MA 4AG7A 4C2ZA 5KTDA 3F5BA 3TFYA 4UFWA 3EFAA 2BUEA 3C26A 4QB9A 1M1DA 1M4IA 1NE9A 4X5KA 3R1KA 4CGLA 5A27A 2J8MA 2VZYA 4UFVA 4KUAA 5HMNA 2ZW6A 4NCZA 2PQ8A 4KVXA 1MK4A 1KZFA 4CYNA 2REEA 3MGDA 4CAVA 5E96A 3EXNA 3B8GA 4R87A 4ORFA 1V0CA 4A30A 2QIRA 2G3AA 4NF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KUX A;  1WWZ A;  4KLV A;  5FVJ A;  3DDD A;  1SQH A;  1FY7 A;  3P2F A;  4LX9 A;  5C88 A;  3R9E A;  3PP9 A;  1M4D A;  4J3G A;  4JXQ A;  4B5O A;  3TOB A;  5IB0 A;  4II9 A;  1RXT A;  2I79 A;  4L8A A;  1L0C A;  1S7K A;  1UFH A;  5KTA A;  3S6G A;  4NXY A;  1I21 A;  4PSW A;  4KOR A;  1YK3 A;  1ON0 A;  5EBV A;  1LRZ A;  3TCV A;  2ZW4 A;  2A4N A;  2Z0Z A;  1U6M A;  2B3U A;  2Q04 A;  2VZZ A;  4UWJ A;  1QSO A;  1P0H A;  2FIA A;  3GKR A;  3NE7 A;  3TT2 A;  5J8F A;  1S7L A;  4IF5 A;  4MJ8 A;  1CJW A;  4KOT A;  4H89 A;  2G3T A;  4DNC A;  1PU9 A;  3GYA A;  2OZU A;  2K5T A;  2IL4 A;  4NEX A;  5JPH A;  2ZW5 A;  1Q2D A;  1IB1 E;  1S3Z A;  3I9S A;  5DWN A;  2G0B A;  1IYL A;  4XPD B;  2H5M A;  4JWP A;  2PR1 A;  4U9Z A;  1N71 A;  4JLY A;  2KCW A;  2ZPA A;  1PUA A;  3G8W A;  4KOU A;  2B3V A;  1B6B A;  2PRB A;  5JQ4 A;  4F0Y A;  4AVC A;  2FIW A;  1YLE A;  3R9F A;  2JLM A;  4HKF A;  1Z9U A;  4CS0 B;  3BJ7 A;  3I3G A;  2JEV A;  3GY9 A;  4E2A A;  1M4G A;  2OU2 A;  2HUZ A;  2FCK A;  2FS5 A;  4IUS A;  1Z4R A;  3BJ8 A;  3WR7 A;  1KUV A;  2Q44 A;  1Y9W A;  4M3S A;  3G3S A;  3H4Q A;  3DNS A;  3LOD A;  1QSN A;  5C82 A;  3FIX A;  1K4J A;  4XNH B;  2VI7 A;  2HQY A;  4RI1 A;  1XIX A;  2J8N A;  1Y9K A;  3P2H A;  2VBQ A;  5IX3 A;  3RYO A;  4B5P A;  2AE6 A;  3D2P A;  4PSX A;  2FL4 A;  2D4P A;  1Q2C A;  4MY0 A;  2GE3 A;  4HNY B;  2I00 A;  1QST A;  3S6H A;  2RC4 A;  2CNT A;  2Q0Y A;  4H6Z A;  2Z11 A;  4MHD A;  4CAX A;  2P6G A;  3DSB A;  1M44 A;  4MBU A;  5EC4 A;  3VWD A;  1S7F A;  3W6X A;  1S5K A;  2B5G A;  2B4D B;  5F49 A;  1CM0 A;  4M85 A;  1B87 A;  3TO7 A;  1RO5 A;  4UWI A;  2JDD A;  4ZBG A;  2VEZ A;  3SHP A;  1BO4 A;  2OH1 A;  3TTH A;  4JD6 A;  3F0A A;  1QSR A;  4B5P B;  5H84 A;  4CRY B;  3JUW A;  2FE7 A;  4AB7 A;  4JJX A;  4QVT A;  1IID A;  3T90 A;  4E8O A;  5ISV A;  4JXR A;  2FSR A;  4QBJ A;  4FD4 A;  5F46 A;  3ZZI A;  1NSL A;  3TE4 A;  5HH1 A;  1I1D A;  4R3L A;  2Q7B A;  4I49 A;  1J4J A;  1YVK A;  2CY2 A;  4OAE A;  2J8R A;  4K30 A;  2B5G B;  4GS4 A;  4F6A A;  1IIC A;  1MJB A;  2ARH A;  4FD7 A;  4QC6 A;  3CXP A;  1S7N A;  3F8K A;  3T9Y A;  4KOV A;  2CNM A;  4XPL A;  2PDO A;  1KUY A;  4FD6 A;  3ZJ0 A;  3FBU A;  1YVO A;  4XPD C;  1YGH A;  1QSM A;  2FT0 A;  4KVO E;  4UBR A;  3FB3 A;  2EVN A;  4Y49 B;  5I0C A;  3R96 A;  2WPX A;  2FXF A;  2VXK A;  2PSW A;  2R8V A;  2OZG A;  1R57 A;  2AJ6 A;  1XEB A;  2Q4Y A;  1YRE A;  3PZJ A;  4R3K A;  3IWG A;  4KVM E;  3K9U A;  4R9M A;  1XF8 A;  3QAH A;  4OLL A;  1XE4 A;  3TO6 A;  2B4D A;  4R57 A;  2BL1 A;  2B58 A;  3QB8 A;  4KLW A;  2CNS A;  5KTC A;  2ATR A;  4NSQ A;  4XNH C;  3R9G A;  4L89 A;  2BSW A;  2NMT A;  3BLN A;  1OZP A;  4LUA A;  5CNP A;  3FXT A;  3EO4 A;  2GIV A;  3D8P A;  2R1I A;  4YGO A;  1YX0 A;  3OWC A;  2EUI A;  3TO9 A;  4EVY A;  4U9Y A;  2OB0 A;  4CRZ B;  4HNX B;  2VQY A;  3JVN A;  3CXS A;  4KOS A;  1BOB A;  4PV6 A;  1YR0 A;  3SXO A;  4AG9 A;  2R98 A;  2O28 A;  3DR6 A;  1Z4E A;  3FNC A;  4CAW A;  3FYN A;  1IYK A;  4QUS A;  2OZH A;  2QML A;  2X7B A;  3D3S A;  5H86 A;  2R7H A;  3DR8 A;  3S6K A;  1MJA A;  1NMT A;  5J8C A;  3EY5 A;  2REF A;  4UA3 A;  3E0K A;  3CXQ A;  4BMH A;  5IV0 A;  1S60 A;  1P4N A;  4KOX A;  3V8I A;  4MI4 A;  2Z10 A;  4PK2 A;  2ZXV A;  4OAD A;  4E0A A;  3W91 A;  1Y7R A;  3EC4 A;  4KOY A;  2GAN A;  1TIQ A;  4MY3 A;  4XPK A;  1VHS A;  2QEC A;  5DWM A;  3IGR A;  1Q2Y A;  4RS2 A;  5GCN A;  3KKW A;  4AVB A;  4HNW B;  1GHE A;  2Q4V A;  4H6U A;  4KZT A;  4U5Y A;  2PR8 A;  2PC1 A;  3R95 A;  3D2M A;  2HV2 A;  1WK4 A;  4PK3 A;  1I12 A;  3TOA A;  3FRM A;  4KUB A;  3UY5 A;  5F48 A;  3LD2 A;  3PGP A;  1XMT A;  2WPW A;  4Y49 C;  2C27 A;  4KOW A;  2B4B A;  4ONU A;  1VKC A;  4FD5 A;  5F47 A;  1MJ9 A;  4YRH A;  2P6E A;  2F5I A;  3N7Z A;  2ZW7 A;  2P0W A;  4YFJ A;  2DXQ A;  3S6F A;  3SXN A;  2JDC A;  3W6S A;  2D4O A;  4AVA A;  3VWE A;  2P6F A;  2BEI A;  2Y0M A;  4AG7 A;  5KTD A;  3F5B A;  3TFY A;  3EFA A;  2BUE A;  3C26 A;  4QB9 A;  1M1D A;  1M4I A;  1NE9 A;  4X5K A;  3R1K A;  2J8M A;  2VZY A;  4KUA A;  5HMN A;  2ZW6 A;  4NCZ A;  2PQ8 A;  4KVX A;  1MK4 A;  1KZF A;  2REE A;  3MGD A;  4CAV A;  5E96 A;  3EXN A;  3B8G A;  4R87 A;  4ORF A;  1V0C A;  2QIR A;  2G3A A;  4NF1 A; 
#chains in the Genus database with same CATH topology
 1KUX A;  2C6P A;  1WWZ A;  2O4H A;  4KLV A;  5FVJ A;  3DDD A;  4R7M A;  1SQH A;  3GIU A;  4F9V A;  1FY7 A;  3P2F A;  4LX9 A;  4PPZ A;  5C88 A;  1PCA A;  3D67 A;  3R9E A;  1ZLH A;  3PP9 A;  1M4D A;  4J3G A;  4JXQ A;  1KWM A;  4OC1 A;  3TOB A;  4B5O A;  2PJ0 A;  4BD9 A;  5IB0 A;  4II9 A;  1RXT A;  2I79 A;  4L8A A;  1L0C A;  1S7K A;  1UFH A;  1FNO A;  4WJB A;  4W9Y A;  5KTA A;  3S6G A;  4NXY A;  4OC2 A;  2V8H A;  3NA6 A;  1I21 A;  4PSW A;  4KOR A;  1TXR A;  1YK3 A;  3B35 A;  1ON0 A;  5EBV A;  4EME A;  2AFS A;  1LRZ A;  3TCV A;  1F2P A;  2ZW4 A;  2A4N A;  1AYE A;  2GLJ A;  2Z0Z A;  4TNU A;  1U6M A;  2F8H A;  2B3U A;  4PQA A;  4OC5 A;  2BOA A;  4ZI6 A;  4B11 A;  5LYI A;  2Q04 A;  2ZEG A;  2VZZ A;  4MFL A;  3H8G A;  2Z3N A;  2EK9 A;  1ELM P;  5G20 A;  4UWJ A;  4ZY1 A;  1RTQ A;  1QSO A;  3NH8 A;  1IGB A;  5AGE A;  3T8W A;  4FWU A;  1P0H A;  4JYW A;  2FIA A;  3GKR A;  3NE7 A;  3TT2 A;  5J8F A;  5BWA B;  1XBU A;  1S7L A;  4IF5 A;  3VAT A;  4MJ8 A;  5HVF A;  1CJW A;  4KSF A;  4NFR A;  4RUH A;  4KOT A;  4H89 A;  2G3T A;  1IOF A;  1ARL A;  4DNC A;  1PU9 A;  3D7H A;  3CPA A;  3GYA A;  5HXD A;  4NGN A;  2OZU A;  2K5T A;  2IL4 A;  3D7D A;  4NEX A;  4FBE A;  5JPH A;  2ZW5 A;  1Q2D A;  3FEE A;  4BIN A;  4NJR A;  4X2T A;  2RB7 A;  1F2O A;  2PJC A;  1IB1 E;  1S3Z A;  4K3N A;  1AUG A;  4OIW A;  2PJ1 A;  5K8P A;  4C2X A;  3I9S A;  3RBU A;  3HUV A;  1ARM A;  4A38 A;  2CXA A;  4ZY0 A;  5DWN A;  5HVH A;  2G0B A;  1IYL A;  4XPD B;  2NYQ A;  3B7I A;  2H5M A;  2HB6 A;  4JWP A;  1F57 A;  2PR1 A;  4U9Z A;  1N71 A;  4JLY A;  2KCW A;  4CYP A;  1QQ9 A;  2ZPA A;  1PUA A;  1PYT B;  3G8W A;  4KOU A;  2B3V A;  1R43 A;  1B6B A;  5AG5 A;  4F8Z A;  2PRB A;  4ZX9 A;  4A37 A;  1HDQ A;  1H8L A;  1UWY A;  2RFH A;  4KSI A;  3FF3 A;  4CGM A;  2Z3L A;  1LAP A;  2XEG A;  5JQ4 A;  4F0Y A;  2ZEE A;  2PJA A;  4AVC A;  3BHX A;  2FIW A;  4MHZ A;  1YLE A;  4X8I A;  3B3T A;  3R9F A;  2JLM A;  1TKF A;  4HKF A;  5DS0 A;  1Z9U A;  1ZO0 A;  4RN7 A;  4CAE A;  4CS0 B;  3BJ7 A;  4EWT A;  2YNE A;  3I3G A;  4FAI A;  2JEV A;  4EFD A;  3GY9 A;  2EWB A;  4E2A A;  1M4G A;  1LAN A;  2OU2 A;  2HUZ A;  2FCK A;  2FS5 A;  4MHN A;  4UCM A;  4IUS A;  1Z4R A;  3BJ8 A;  3IU1 A;  4KSA A;  1KUV A;  3WR7 A;  2Z3K A;  2Q44 A;  3PB8 X;  1Y9W A;  2V8V A;  4M3S A;  1LCP A;  3FED A;  3G3S A;  1IU8 A;  2BO9 A;  3DNS A;  3H4Q A;  3LOD A;  3PFO A;  4KS9 A;  3RNZ A;  4CYO A;  1QSN A;  3BI1 A;  5C82 A;  4OC4 A;  3B3C A;  3B3V A;  3PBE A;  3FIX A;  4MMO A;  4P4E A;  1K4J A;  4PXD A;  5G22 A;  3TX8 A;  4A31 A;  1NSA A;  3D7F A;  4XNH B;  4IK2 A;  2VI7 A;  4ZGY B;  2HQY A;  4RI1 A;  1XIX A;  3IEH A;  4MRI A;  2Z3O A;  3H8E A;  4LQG A;  2J8N A;  4UEF A;  1Y9K A;  3P2H A;  2ZEH A;  3IWW A;  5AG7 A;  3I1U A;  2VBQ A;  5IX3 A;  3RYO A;  2BCO A;  4Q36 A;  4P44 A;  3PFE A;  4B5P A;  7CPA A;  2AE6 A;  2CTC A;  1ZG8 A;  3D2P A;  4PSX A;  4B13 A;  2FL4 A;  3K9T A;  1TF9 A;  4CPA A;  8CPA A;  2D4P A;  1BAV A;  3IWE A;  4P4I A;  1Q2C A;  4MY0 A;  2GE3 A;  4HNY B;  4P4B A;  5G1Z A;  2I00 A;  1QST A;  3S6H A;  4P4D A;  3SI2 A;  4CGO A;  2RC4 A;  3D7G A;  2CNT A;  2Q0Y A;  4H6Z A;  2Z11 A;  5EMI A;  2PVW A;  1AMP A;  1YW6 A;  4M6G A;  4MHD A;  4CAX A;  2PJ2 A;  2P6G A;  3BI0 A;  1ZG7 A;  1M44 A;  3DSB A;  4B14 A;  2YNC A;  1XJO A;  4MBU A;  5EC4 A;  1A2Z A;  1Y0R A;  3VWD A;  4UEZ A;  3JTK A;  1S7F A;  3W6X A;  1S5K A;  4NGR A;  3VAR A;  2CF4 A;  2B5G A;  2B4D B;  5F49 A;  1CM0 A;  4M85 A;  1YLO A;  1B87 A;  3TO7 A;  1RO5 A;  2PJB A;  2CIJ A;  2JDD A;  4UWI A;  4DYO A;  4ZBG A;  4NGM A;  2VEZ A;  4DJL A;  3SHP A;  1CP6 A;  3KR5 A;  1BO4 A;  2OH1 A;  3TTH A;  4JD6 A;  3F0A A;  1QSR A;  3KHX A;  4B5P B;  1GYT A;  5H84 A;  3JUW A;  2FE7 A;  4G1P A;  3WC5 A;  4CRY B;  1VIX A;  4OP4 A;  4AB7 A;  4JJX A;  4QVT A;  1IID A;  4MHY A;  3TC8 A;  3T90 A;  4C2Y A;  4E8O A;  5ISV A;  4JXR A;  3NH4 A;  5IB9 A;  4P10 A;  4Z65 A;  2DEA A;  4LQ6 A;  4TWE A;  2FSR A;  4QBJ A;  5JM6 A;  4FD4 A;  4OC3 A;  1OBR A;  2ZEF A;  3RAM A;  5F46 A;  4IHM A;  3ZZI A;  4BBH A;  1NSL A;  4OC0 A;  4A2Z A;  3TE4 A;  5HH1 A;  1I1D A;  1X10 A;  4R3L A;  2Q7B A;  4I49 A;  4CGN A;  4F9U A;  1J4J A;  3D4U A;  1YVK A;  2CY2 A;  4OAE A;  2J8R A;  4K30 A;  2B5G B;  4GM5 A;  4GS4 A;  4F6A A;  1JQG A;  5CPA A;  1IIC A;  1MJB A;  1Z5R A;  2ARH A;  3K2K A;  3NE8 A;  3PB7 X;  4FD7 A;  1CP7 A;  4QC6 A;  3D68 A;  4X3R A;  5LRG A;  1R3N A;  1CPS A;  3CXP A;  3BXM A;  4MCS A;  4MFJ A;  1S7N A;  1CX8 A;  1YQE A;  3F8K A;  3VH9 A;  3T9Y A;  4KOV A;  2JBK A;  3SJX A;  4DUK A;  4P4F A;  2CNM A;  3FJU A;  4XPL A;  2PDO A;  1KUY A;  3MRU A;  2C1C A;  1XMB A;  4FD6 A;  2WYR A;  4M6I A;  3ZJ0 A;  5G21 A;  2QJ8 A;  1Y7E A;  2EO8 A;  3FBU A;  3PEI A;  1YVO A;  3KAS A;  5AG4 A;  4XPD C;  1YGH A;  3HLP A;  1QSM A;  4AXV A;  2FT0 A;  2V8D A;  4KVO E;  4UBR A;  4CAF A;  5CBM A;  5K8O A;  5K8N A;  2Q7S A;  3FB3 A;  1TKJ A;  4B12 A;  2EVN A;  4Y49 B;  5I0C A;  3KQX A;  3R96 A;  2WPX A;  4YU9 A;  1Z8L A;  2FXF A;  2OR4 A;  3IC1 A;  3QNV A;  5JH9 A;  2VXK A;  3CT9 A;  2DPT A;  2PSW A;  3PRT A;  2AFX A;  2POK A;  4UFX A;  1YSJ A;  2R8V A;  2OZG A;  2PVV A;  1R57 A;  2AJ6 A;  1LFW A;  1XEB A;  2Q4Y A;  1YRE A;  2DF5 A;  3CDX A;  3GB0 A;  3PZJ A;  5AG6 A;  2PRQ A;  4R3K A;  3S9N A;  2Z3M A;  3IWG A;  2YND A;  4KVM E;  1HEE A;  3K9U A;  3IFE A;  2PJ8 A;  4R9M A;  3SJG A;  4C68 A;  3N5F A;  1XF8 A;  3QAH A;  2DPS A;  5JGF A;  2IMO A;  2AFW A;  4OLL A;  2J9A A;  1EE3 P;  1XE4 A;  4YWY A;  3TO6 A;  2B4D A;  4R57 A;  3QAY A;  2BL1 A;  4R8F A;  1LOK A;  2B58 A;  3QB8 A;  4HPS A;  4KLW A;  2GFQ A;  3CPX A;  4MCP A;  1ELL P;  2CNS A;  5KTC A;  2ATR A;  2PE3 A;  4NSQ A;  5J1Q A;  3ISZ A;  4MFQ A;  2PJ9 A;  4GXH A;  2AFO A;  1QMU A;  4A95 A;  4XNH C;  3R9G A;  3KL9 A;  5A28 A;  4Q38 A;  4L89 A;  4ZY2 A;  1JWQ A;  3IO1 A;  2ANP A;  2BSW A;  2HC9 A;  2NMT A;  2PJ3 A;  1YW4 A;  4M6H A;  3BLN A;  1OZP A;  4LUA A;  4UF4 A;  2IQ6 A;  3FXT A;  2XEJ A;  4NGT A;  5CNP A;  1Q7L A;  3EO4 A;  2GIV A;  3D8P A;  2PJ5 A;  2R1I A;  4MXU A;  4YGO A;  2Q4Z A;  2PJ6 A;  1YX0 A;  3OWC A;  3KGQ A;  4UCN A;  1XFO A;  2EUI A;  4OME A;  4B10 A;  3TO9 A;  2PIY A;  4EVY A;  3LAC A;  5LYL A;  3V38 A;  2O53 A;  1ZG9 A;  4U9Y A;  2PCU A;  4H2K A;  2OB0 A;  4CRZ B;  4O23 A;  3IU2 A;  4HNX B;  3B3S A;  4A33 A;  4MCQ A;  2VQY A;  3JVN A;  3RO0 A;  3WC7 A;  5LYD A;  2G9D A;  3CXS A;  2GU2 A;  4KOS A;  1BOB A;  1TF8 A;  4FUU A;  4MFP A;  1Z8W A;  4PV6 A;  3A9L A;  3LWU A;  3GLJ A;  4A32 A;  5D8N A;  3KR4 A;  1YR0 A;  2ABZ A;  4PXC A;  3SXO A;  1IOI A;  4A39 A;  3DLJ A;  3WAB A;  4AG9 A;  2R98 A;  2O28 A;  2XEI A;  4C7H A;  3DR6 A;  1Z4E A;  3FNC A;  4CAW A;  2PIZ A;  3FYN A;  1IYK A;  1TKH A;  4QUS A;  2OZH A;  3B3W A;  2QML A;  2X7B A;  3D3S A;  5THW A;  5H86 A;  2R7H A;  3DR8 A;  1Z2L A;  3ISX A;  3V7Z A;  3S6K A;  3JRU A;  1MJA A;  1NMT A;  4JZ0 A;  4UIB A;  3EY5 A;  3FMC A;  3GUX A;  5J8C A;  2C6C A;  2EBJ A;  4OID A;  4OKO A;  4NGQ A;  4ONW A;  4A94 A;  2REF A;  4CGP A;  1DE4 C;  2ZOG A;  4UA3 A;  3E0K A;  3CXQ A;  4BMH A;  5IV0 A;  4MCR A;  2JBJ A;  3WT4 A;  3FX6 A;  4ZX8 A;  3KZW A;  1S60 A;  1P4N A;  4KOX A;  3H5Z A;  2ZEM A;  3V8I A;  4MI4 A;  2Z10 A;  4P4J A;  1CG2 A;  2YGW A;  4PK2 A;  2GRE A;  4UCP A;  5K8M A;  2AFM A;  2ZXV A;  2YNC C;  3L2N A;  4OAD A;  2Q51 A;  3W91 A;  4E0A A;  5ELY A;  2F7V A;  1Y7R A;  3EC4 A;  4KOY A;  2VL1 A;  2GAN A;  1TIQ A;  4MY3 A;  1CPX A;  4XPK A;  2NSM A;  1VHS A;  2ZOF A;  4B6Z A;  1Z8T A;  2QEC A;  5LYF A;  4F0X A;  5F09 A;  5DWM A;  3IGR A;  1VHE A;  1Q2Y A;  4PXE A;  3SJE A;  4RS2 A;  4R76 A;  5GCN A;  3KKW A;  4AVB A;  2IJZ A;  2Z3P A;  3FVL A;  4HNW B;  1GHE A;  3IIB A;  2Q4V A;  2V77 A;  3LMS A;  4P45 A;  3DGV A;  2PJ7 A;  4H6U A;  4KZT A;  2WSA A;  4CYQ A;  2ODF A;  4U5Y A;  1XRY A;  3PB4 X;  3KHZ A;  2PR8 A;  3SJF A;  3CZX A;  3PB6 X;  4NJQ A;  2PC1 A;  3R95 A;  1CBX A;  1X12 A;  3D2M A;  2AFU A;  3D66 A;  2C6G A;  3H8F A;  4C7I A;  2HV2 A;  1Z8X A;  1WK4 A;  1BPM A;  2ZEO A;  3KQZ A;  4PK3 A;  3S9M A;  1I12 A;  2PJ4 A;  3TOA A;  3FRM A;  4KUB A;  4UEE A;  3UY5 A;  2WUU A;  4MFK A;  2EK8 A;  3LD2 A;  3B2Y A;  4Q7A A;  5F48 A;  3PGP A;  2ZEL A;  1XMT A;  1VGY A;  2WPW A;  2C27 A;  2XEF A;  1IY7 A;  2I3C A;  4KOW A;  4Y49 C;  1ZLI A;  6CPA A;  1FT7 A;  5HVG A;  3FH4 A;  3WC6 A;  2B4B A;  4ONU A;  2ZEP A;  3PB9 X;  1VKC A;  4FD5 A;  1BLL E;  2JEW A;  4P6Y A;  5F47 A;  1MJ9 A;  4YRH A;  5D29 A;  4MHP A;  2P6E A;  1DTD A;  2F5I A;  3PBB A;  4MFZ A;  3FEC A;  3KI9 A;  2GLF A;  1BPN A;  2FVG A;  3N7Z A;  1HDU A;  2ZW7 A;  4ZYQ A;  2P0W A;  4YFJ A;  3IJ3 A;  5I4M A;  3S9L A;  2DXQ A;  2CTB A;  1YME A;  3S6F A;  2WZN A;  3SXN A;  2JDC A;  3W6S A;  2D4O A;  4AVA A;  3VWE A;  2P6F A;  2BEI A;  2Y0M A;  2ZED A;  2OOT A;  4AG7 A;  4C2Z A;  3F5B A;  5KTD A;  3TFY A;  4UFW A;  3EFA A;  2BUE A;  3C26 A;  2QYV A;  4PXB A;  4QB9 A;  3NH5 A;  3SI0 A;  1M1D A;  1M4L A;  1M4I A;  1NE9 A;  4X5K A;  3R1K A;  4NGS A;  2AFZ A;  1LAM A;  2ZEN A;  4CGL A;  3MN8 A;  2J8M A;  2VZY A;  2Q43 A;  5A27 A;  4UFV A;  4KUA A;  5LRK A;  4IAV A;  5HMN A;  1Y0Y A;  2ZW6 A;  4NCZ A;  1VHO A;  1XOV A;  2PQ8 A;  4KVX A;  3SI1 A;  1MK4 A;  1KZF A;  4R6T A;  4NGP A;  4CYN A;  2V8G A;  2REE A;  3MGD A;  4CAV A;  5E96 A;  3EXN A;  3B8G A;  3RZA A;  2QVP A;  4R87 A;  4ORF A;  1V0C A;  4UIA A;  5LRJ A;  2QIR A;  3NFZ A;  4A30 A;  4WWV A;  2G3A A;  4NF1 A; 
#chains in the Genus database with same CATH homology
 1KUX A;  1WWZ A;  4KLV A;  5FVJ A;  3DDD A;  1SQH A;  1FY7 A;  3P2F A;  4LX9 A;  5C88 A;  3R9E A;  3PP9 A;  1M4D A;  4J3G A;  4JXQ A;  4B5O A;  3TOB A;  5IB0 A;  4II9 A;  1RXT A;  2I79 A;  4L8A A;  1L0C A;  1S7K A;  1UFH A;  5KTA A;  3S6G A;  4NXY A;  1I21 A;  4PSW A;  4KOR A;  1YK3 A;  1ON0 A;  5EBV A;  1LRZ A;  3TCV A;  2ZW4 A;  2A4N A;  2Z0Z A;  1U6M A;  2B3U A;  4B11 A;  2Q04 A;  2VZZ A;  4MFL A;  2Z3N A;  5G20 A;  4UWJ A;  1QSO A;  5AGE A;  1P0H A;  2FIA A;  3GKR A;  3NE7 A;  3TT2 A;  5J8F A;  5BWA B;  1S7L A;  4IF5 A;  4MJ8 A;  1CJW A;  4KSF A;  4KOT A;  4H89 A;  2G3T A;  4DNC A;  1PU9 A;  3GYA A;  2OZU A;  2K5T A;  2IL4 A;  4NEX A;  5JPH A;  2ZW5 A;  1Q2D A;  1IB1 E;  1S3Z A;  4C2X A;  3I9S A;  2CXA A;  5DWN A;  2G0B A;  1IYL A;  4XPD B;  2H5M A;  4JWP A;  2PR1 A;  4U9Z A;  1N71 A;  4JLY A;  2KCW A;  4CYP A;  2ZPA A;  1PUA A;  3G8W A;  4KOU A;  2B3V A;  1B6B A;  5AG5 A;  2PRB A;  4CGM A;  2Z3L A;  5JQ4 A;  4F0Y A;  4AVC A;  2FIW A;  1YLE A;  3R9F A;  2JLM A;  4HKF A;  1Z9U A;  1ZO0 A;  4CAE A;  4CS0 B;  3BJ7 A;  2YNE A;  3I3G A;  2JEV A;  3GY9 A;  4E2A A;  1M4G A;  2OU2 A;  2HUZ A;  2FCK A;  2FS5 A;  4UCM A;  4IUS A;  1Z4R A;  3BJ8 A;  3IU1 A;  4KSA A;  1KUV A;  3WR7 A;  2Z3K A;  2Q44 A;  1Y9W A;  4M3S A;  3G3S A;  3H4Q A;  3DNS A;  3LOD A;  4KS9 A;  4CYO A;  1QSN A;  5C82 A;  3FIX A;  5G22 A;  1K4J A;  4A31 A;  4XNH B;  2VI7 A;  4ZGY B;  2HQY A;  4RI1 A;  1XIX A;  2Z3O A;  2J8N A;  1Y9K A;  3P2H A;  5AG7 A;  2VBQ A;  5IX3 A;  3RYO A;  4Q36 A;  4B5P A;  2AE6 A;  3D2P A;  4B13 A;  4PSX A;  2FL4 A;  2D4P A;  3IWE A;  1Q2C A;  4MY0 A;  2GE3 A;  4HNY B;  5G1Z A;  2I00 A;  1QST A;  3S6H A;  4CGO A;  2RC4 A;  2CNT A;  2Q0Y A;  4H6Z A;  2Z11 A;  4MHD A;  4CAX A;  2P6G A;  3DSB A;  1M44 A;  4B14 A;  2YNC A;  4MBU A;  5EC4 A;  3VWD A;  3JTK A;  1S7F A;  3W6X A;  1S5K A;  2B5G A;  2B4D B;  5F49 A;  1CM0 A;  4M85 A;  1B87 A;  3TO7 A;  1RO5 A;  4UWI A;  2JDD A;  4ZBG A;  2VEZ A;  3SHP A;  1BO4 A;  2OH1 A;  3TTH A;  4JD6 A;  3F0A A;  1QSR A;  4B5P B;  5H84 A;  4CRY B;  3JUW A;  2FE7 A;  4AB7 A;  4JJX A;  4QVT A;  1IID A;  3T90 A;  4C2Y A;  4E8O A;  5ISV A;  4JXR A;  2FSR A;  4QBJ A;  4FD4 A;  5F46 A;  3ZZI A;  4BBH A;  1NSL A;  4A2Z A;  3TE4 A;  5HH1 A;  1I1D A;  4R3L A;  2Q7B A;  4CGN A;  4I49 A;  1J4J A;  1YVK A;  2CY2 A;  4OAE A;  2J8R A;  4K30 A;  2B5G B;  4GS4 A;  4F6A A;  1IIC A;  1MJB A;  2ARH A;  4FD7 A;  4QC6 A;  3CXP A;  4MFJ A;  1S7N A;  3F8K A;  3T9Y A;  4KOV A;  2CNM A;  4XPL A;  2PDO A;  1KUY A;  4FD6 A;  3ZJ0 A;  5G21 A;  3FBU A;  5AG4 A;  1YVO A;  4XPD C;  1YGH A;  1QSM A;  2FT0 A;  4KVO E;  4CAF A;  4UBR A;  3FB3 A;  4B12 A;  2EVN A;  4Y49 B;  5I0C A;  3R96 A;  2WPX A;  2FXF A;  2VXK A;  2DPT A;  2PSW A;  4UFX A;  2R8V A;  2OZG A;  1R57 A;  2AJ6 A;  1XEB A;  2Q4Y A;  1YRE A;  3PZJ A;  5AG6 A;  4R3K A;  2Z3M A;  3IWG A;  2YND A;  4KVM E;  3K9U A;  4R9M A;  4C68 A;  1XF8 A;  3QAH A;  2DPS A;  4OLL A;  1XE4 A;  3TO6 A;  2B4D A;  4R57 A;  2BL1 A;  2B58 A;  3QB8 A;  4KLW A;  2CNS A;  5KTC A;  2ATR A;  4NSQ A;  4MFQ A;  4A95 A;  4XNH C;  3R9G A;  5A28 A;  4Q38 A;  4L89 A;  2BSW A;  2NMT A;  3BLN A;  1OZP A;  4LUA A;  5CNP A;  3FXT A;  3EO4 A;  2GIV A;  3D8P A;  2R1I A;  4YGO A;  1YX0 A;  3OWC A;  4UCN A;  2EUI A;  4B10 A;  3TO9 A;  4EVY A;  4U9Y A;  2OB0 A;  4CRZ B;  3IU2 A;  4HNX B;  4A33 A;  2VQY A;  3JVN A;  3CXS A;  4KOS A;  1BOB A;  4MFP A;  4PV6 A;  3A9L A;  4A32 A;  1YR0 A;  3SXO A;  4AG9 A;  2R98 A;  2O28 A;  4C7H A;  3DR6 A;  1Z4E A;  3FNC A;  4CAW A;  3FYN A;  1IYK A;  4QUS A;  2OZH A;  2QML A;  2X7B A;  3D3S A;  5H86 A;  2R7H A;  3DR8 A;  3S6K A;  1MJA A;  1NMT A;  5J8C A;  3EY5 A;  4CGP A;  2REF A;  4UA3 A;  3E0K A;  3CXQ A;  4BMH A;  5IV0 A;  1S60 A;  1P4N A;  4KOX A;  3H5Z A;  3V8I A;  4MI4 A;  2Z10 A;  2YGW A;  4PK2 A;  4UCP A;  2ZXV A;  2YNC C;  4OAD A;  4E0A A;  3W91 A;  1Y7R A;  3EC4 A;  4KOY A;  2GAN A;  1TIQ A;  4MY3 A;  4XPK A;  1VHS A;  2QEC A;  4F0X A;  5DWM A;  3IGR A;  1Q2Y A;  4RS2 A;  5GCN A;  3KKW A;  4AVB A;  4HNW B;  2Z3P A;  1GHE A;  2Q4V A;  4H6U A;  4KZT A;  2WSA A;  4CYQ A;  4U5Y A;  2PR8 A;  2PC1 A;  3R95 A;  3D2M A;  4C7I A;  2HV2 A;  1WK4 A;  4PK3 A;  1I12 A;  3TOA A;  3FRM A;  4KUB A;  3UY5 A;  2WUU A;  4MFK A;  5F48 A;  3LD2 A;  3PGP A;  1XMT A;  2WPW A;  4Y49 C;  2C27 A;  4KOW A;  2B4B A;  4ONU A;  1VKC A;  4FD5 A;  5F47 A;  1MJ9 A;  4YRH A;  2P6E A;  2F5I A;  4MFZ A;  3N7Z A;  2ZW7 A;  2P0W A;  4YFJ A;  2DXQ A;  3S6F A;  3SXN A;  2JDC A;  3W6S A;  2D4O A;  4AVA A;  3VWE A;  2P6F A;  2BEI A;  2Y0M A;  4AG7 A;  4C2Z A;  5KTD A;  3F5B A;  3TFY A;  4UFW A;  3EFA A;  2BUE A;  3C26 A;  4QB9 A;  1M1D A;  1M4I A;  1NE9 A;  4X5K A;  3R1K A;  4CGL A;  5A27 A;  2J8M A;  2VZY A;  4UFV A;  4KUA A;  5HMN A;  2ZW6 A;  4NCZ A;  2PQ8 A;  4KVX A;  1MK4 A;  1KZF A;  4CYN A;  2REE A;  3MGD A;  4CAV A;  5E96 A;  3EXN A;  3B8G A;  4R87 A;  4ORF A;  1V0C A;  4A30 A;  2QIR A;  2G3A A;  4NF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...