1NSLA

Crystal structure of probable acetyltransferase
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
180
structure length
176
Chain Sequence
GMFTCKVNEHITIRLLEPKDAERLAELIIQNQQRLGKWLFFSSADTYRETIIPDWRRQYADLNGIEAGLLYDGSLCGMISLHNLDQVNRKAEIGYWIAKEFEGKGIITAACRKLITYAFEELELNRVAICAAVGNEKSRAVPERIGFLEEGKARDGLYVNGMHHDLVYYSLLKREW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable acetyltransferase
publication title Crystal structure of Bacillus subtilis YdaF protein: A putative ribosomal N-acetyltransferase
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 47
structure length 176
sequence length 180
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2003-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1nslA00
3FNCA 4AVCA 1SQHA 1Q2DA 4MI4A 2X7BA 4PSXA 2WPXA 5KTCA 4NF1A 4CRYB 2P6GA 1IB1E 4R9MA 5CNPA 3CXQA 4IUSA 3ZJ0A 1L0CA 3IGRA 5J8FA 1CM0A 3DR8A 2Y0MA 2I00A 2GE3A 2P0WA 1KUVA 4AVAA 4KUAA 5I0CA 1YX0A 4QBJA 5HMNA 4II9A 1Q2CA 3G3SA 2OB0A 1M4GA 4LX9A 1Y9KA 3VWDA 3W6XA 4QVTA 5HH1A 2GANA 4MHDA 2PDOA 4E0AA 4LUAA 2CNTA 4KVME 1S3ZA 3BJ7A 2B3UA 3D3SA 3VWEA 1XE4A 2PRBA 4ZBGA 3K9UA 4HKFA 2Q0YA 1QSRA 4AB7A 1S7FA 3S6GA 1M4DA 1YREA 2BL1A 2P6FA 4YRHA 2FIAA 2QMLA 2ATRA 3TE4A 1R57A 4KLVA 4GS4A 3KKWA 1VKCA 3EO4A 2B3VA 2AE6A 4F6AA 1Z4RA 3D2PA 3FBUA 4CRZB 3G8WA 1IYKA 4NCZA 1LRZA 5F46A 2I79A 4UA3A 3BJ8A 4R3LA 4AG7A 4H89A 3GYAA 3OWCA 3S6HA 4KOVA 4EVYA 3GKRA 3SXOA 4UWIA 5JQ4A 2REFA 3CXPA 3MGDA 2D4PA 1RO5A 3R95A 2OZGA 4QC6A 2C27A 2VXKA 1B87A 5C88A 1NSLA 1IYLA 4KOXA 2OZHA 3IWGA 4KVOE 3LODA 2J8MA 3S6FA 1U6MA 3R96A 5H84A 1YVOA 5FVJA 4JLYA 2Q7BA 2Q4VA 3T90A 1B6BA 1PUAA 4AG9A 2VI7A 3PZJA 3P2FA 3FIXA 4KOYA 3TO9A 1KUYA 2FSRA 2OU2A 4X5KA 2PSWA 1I21A 3F5BA 3PP9A 2B4DB 4UWJA 1P0HA 2Z0ZA 3W91A 4CAXA 3I9SA 4U5YA 4CAWA 4M3SA 2DXQA 5IX3A 2CNSA 4R57A 4KVXA 4QB9A 2VZYA 2B4DA 4PK3A 3EXNA 2O28A 4FD7A 2ARHA 2OZUA 2KCWA 1TIQA 3QB8A 3TCVA 2R7HA 4KORA 3TFYA 4HNXB 3DSBA 4HNWB 4FD4A 4KOSA 2J8RA 1Q2YA 4FD6A 1Y7RA 1Z9UA 2RC4A 3CXSA 4UBRA 3D2MA 2Q4YA 2Z11A 1NE9A 1S5KA 2A4NA 2JDDA 5C82A 3EY5A 1GHEA 1S7LA 1BOBA 1CJWA 2REEA 3W6SA 4MJ8A 2EUIA 3P2HA 2HUZA 3S6KA 2D4OA 2FT0A 2NMTA 4L8AA 4XPLA 3BLNA 1KUXA 1WWZA 2ZXVA 1QSOA 4KOUA 1M1DA 2CY2A 4I49A 1P4NA 3DDDA 2PC1A 1WK4A 1M44A 2G3AA 2BEIA 3JVNA 4B5PB 3TO6A 2VBQA 2F5IA 3FXTA 1N71A 2R8VA 4KUBA 5IB0A 2PR8A 4NEXA 4R87A 1OZPA 2QECA 4M85A 5KTDA 4B5PA 3SXNA 2FIWA 3TO7A 2IL4A 3R9FA 5E96A 4MY3A 3TOBA 4JXRA 4JJXA 4RI1A 3R1KA 2B58A 4CAVA 1NMTA 2ZW6A 2Q04A 3F0AA 3EC4A 2AJ6A 4AVBA 1I1DA 1IIDA 2G0BA 2WPWA 5J8CA 3R9GA 2BSWA 3DNSA 3WR7A 1FY7A 3V8IA 3B8GA 1PU9A 2PR1A 2CNMA 1MJBA 4E8OA 4PSWA 1XF8A 2ZPAA 3C26A 4RS2A 4QUSA 4E2AA 3FB3A 1K4JA 1I12A 1S7NA 1XIXA 2HV2A 2Z10A 4J3GA 5DWMA 3RYOA 1YLEA 1MJ9A 4BMHA 1BO4A 4Y49C 2VZZA 2J8NA 3NE7A 2P6EA 4JWPA 1V0CA 4XNHC 4CS0B 3I3GA 3PGPA 5GCNA 3JUWA 4JD6A 3TTHA 4ONUA 3R9EA 3ZZIA 3N7ZA 4U9YA 4F0YA 1ON0A 2BUEA 4PK2A 4PV6A 4MBUA 4K30A 5EBVA 5IV0A 1VHSA 4L89A 4YFJA 2ZW5A 2FL4A 2FS5A 3FYNA 2B4BA 3EFAA 5ISVA 2EVNA 3LD2A 1J4JA 5EC4A 2Q44A 4XPDB 1XMTA 3UY5A 2FCKA 1S60A 2GIVA 2PQ8A 2JDCA 3H4QA 3T9YA 2ZW7A 4H6ZA 4OAEA 1QSNA 1Y9WA 1MJAA 4XPKA 4Y49B 4B5OA 2H5MA 4KOWA 1YR0A 1Z4EA 2VEZA 2G3TA 1YGHA 5H86A 1S7KA 4KLWA 4XNHB 4R3KA 4HNYB 2R1IA 3FRMA 4OADA 1MK4A 1XEBA 1IICA 2R98A 4NSQA 4OLLA 1UFHA 2B5GB 3D8PA 3F8KA 2QIRA 2VQYA 4IF5A 1YVKA 3SHPA 4FD5A 4DNCA 1RXTA 2B5GA 4JXQA 1YK3A 2HQYA 1QSTA 4KZTA 2JLMA 3DR6A 2OH1A 4KOTA 4NXYA 3GY9A 2JEVA 3E0KA 2FXFA 2ZW4A 3QAHA 2K5TA 4YGOA 3TOAA 5JPHA 1QSMA 4ORFA 5KTAA 2FE7A 1KZFA 4XPDC 5F47A 4U9ZA 5DWNA 5F49A 4H6UA 5F48A 3TT2A 4MY0A 1M4IA
chains in the Genus database with same CATH superfamily
1Z8XA 3FNCA 4AVCA 1SQHA 3SJGA 2Z3PA 1Q2DA 2ZENA 2X7BA 2ZEFA 4MI4A 1XJOA 4PSXA 5HXDA 3BXMA 2ZEHA 2WPXA 3H8EA 3KHXA 4KSFA 5KTCA 4CYPA 5CBMA 4NF1A 4CRYB 4B6ZA 2P6GA 2HC9A 2GU2A 4MFZA 1IB1E 3IJ3A 4R9MA 4CGLA 3L2NA 5CNPA 3B3TA 5JGFA 3CXQA 4CGMA 3KASA 5AG6A 4IUSA 3ZJ0A 1L0CA 4RUHA 3IGRA 5J8FA 1CM0A 3DR8A 2Y0MA 1ZG9A 2I00A 2GE3A 2ODFA 1KUVA 2P0WA 3IU1A 4KUAA 1YX0A 4NGPA 4TWEA 3VARA 4MHNA 1Q2CA 4QBJA 5HMNA 4II9A 2AFXA 4DYOA 1RTQA 3G3SA 2ZEGA 2OB0A 1M4GA 2OOTA 4CYNA 4MFLA 4LX9A 1Y9KA 3VWDA 3W6XA 2HB6A 4QVTA 3H5ZA 1ARMA 5HH1A 2GANA 2PJAA 4MHDA 4OP4A 4NGTA 2CTBA 5I0CA 2PDOA 4E0AA 4LUAA 2CNTA 2AFUA 4KVME 1S3ZA 4PXBA 3BJ7A 2B3UA 2IMOA 3D3SA 1XE4A 2PRBA 4ZBGA 3K9UA 5G22A 4P4DA 1Y7EA 5LYLA 4HKFA 2Q0YA 1XBUA 1QSRA 4M6IA 3WC6A 4A32A 4AB7A 1S7FA 2EK8A 1ZLHA 2G9DA 3S6GA 4OC0A 4DJLA 5A28A 1M4DA 5LRJA 2VL1A 4A30A 1YREA 2BL1A 2P6FA 1HDUA 2C6GA 1TKJA 2XEIA 4NJRA 2FIAA 2QMLA 4YRHA 4PPZA 2ZEDA 2ATRA 1VGYA 3CT9A 3TE4A 2CF4A 1LFWA 1R57A 1Z8TA 4KLVA 2YGWA 4GS4A 2Q4ZA 3JTKA 3KKWA 3D67A 1VKCA 3EO4A 4G1PA 1YW6A 2B3VA 3V38A 3D7DA 2AE6A 1QMUA 8CPAA 4EMEA 3SJFA 3IFEA 3NE8A 1Z2LA 4BD9A 4F6AA 1Z4RA 2OR4A 1ZO0A 3PFEA 4JYWA 3D2PA 3FBUA 7CPAA 3D7FA 4R7MA 2GREA 3KI9A 3BHXA 4CRZB 2PVWA 5F09A 3G8WA 2ZOGA 3B35A 4F9VA 2PJ6A 1LCPA 1EE3P 3SI0A 1LOKA 1IYKA 2RFHA 4RN7A 4NCZA 1CG2A 1LRZA 4P4EA 4A39A 2I79A 4UA3A 5F46A 3BJ8A 1CP7A 1KWMA 4C2XA 1F2PA 4R3LA 4CGNA 2IQ6A 1YQEA 4OKOA 3GLJA 1Z5RA 4AG7A 3IC1A 4H89A 3GYAA 3KGQA 3OWCA 3S6HA 4KOVA 2Z3LA 3MN8A 4NFRA 4P6YA 4EVYA 3GKRA 3PFOA 3SXOA 1YW4A 4FUUA 2NSMA 4UWIA 5LRGA 3RZAA 4BBHA 5JQ4A 2REFA 3CDXA 3CXPA 1QQ9A 3MGDA 4YU9A 2D4PA 5A27A 2DF5A 2AFOA 1RO5A 3R95A 3NH4A 1IGBA 2YNDA 4OC4A 2OZGA 2ZEOA 2C27A 2VXKA 4QC6A 1B87A 1Y0YA 3NA6A 3RNZA 5C88A 1NSLA 1IYLA 4KOXA 2OZHA 3IWGA 4KVOE 3LODA 2YNCC 1YLOA 2J8MA 1YSJA 2FVGA 3PBEA 4MCQA 3S6FA 1U6MA 4UFXA 3R96A 5H84A 1YVOA 5FVJA 3S9LA 4JLYA 2Q7BA 2Q4VA 3T90A 1B6BA 1GYTA 1PUAA 4AG9A 2VI7A 4CGPA 3PZJA 1NSAA 1PYTB 3KR4A 3K2KA 1BAVA 3DGVA 4LQ6A 4UEZA 3P2FA 3FIXA 3RAMA 3GUXA 4KOYA 2AFWA 2WZNA 5AG4A 3TO9A 1KUYA 2EBJA 4LQGA 3LMSA 2J9AA 2FSRA 2I3CA 3VATA 2OU2A 4MHZA 4X5KA 4CPAA 4MFPA 2PSWA 2PJ4A 2DEAA 4MFQA 1I21A 3F5BA 3PP9A 3SI2A 2B4DB 4UWJA 3V7ZA 1ELMP 3D7HA 1P0HA 1XFOA 4NGMA 4M6HA 5JM6A 2Z0ZA 3W91A 2WUUA 2XEFA 2ZELA 4CAXA 1IOFA 5IB9A 3I9SA 4PXEA 4U5YA 4M3SA 4CAWA 2DXQA 1TKFA 3MRUA 5IX3A 2CNSA 4R57A 3HLPA 4KVXA 4QB9A 2VZYA 2B4DA 4IAVA 4NGSA 5AG7A 4MCPA 4PK3A 3QNVA 5K8OA 3EXNA 2O53A 3IEHA 3B7IA 4MCSA 2O28A 4C7IA 2F7VA 4F0XA 4A2ZA 3PB7X 3KR5A 4FD7A 3LACA 3IO1A 3KL9A 2ARHA 2OZUA 1XOVA 4UIBA 2KCWA 1TIQA 4IHMA 3QB8A 4CYOA 1JWQA 3S9MA 3SJEA 3TCVA 2R7HA 4KORA 3TFYA 4HNXB 3DSBA 4HNWB 2PJ1A 1TKHA 3JRUA 4FD4A 4KOSA 3FH4A 4GXHA 2J8RA 1Q2YA 4FD6A 1Y7RA 2BO9A 4NJQA 1Z9UA 2RC4A 3CXSA 3FF3A 4A38A 4UBRA 1TF8A 3D2MA 2CIJA 2Q4YA 2Z11A 4M6GA 1NE9A 1S5KA 2ABZA 2A4NA 2JDDA 2YNCA 4CYQA 4ZYQA 3EY5A 1GHEA 5C82A 1BLLE 4GM5A 5LYFA 1S7LA 4NGQA 3PB9X 1BOBA 1CJWA 2JBJA 2REEA 3D4UA 3W6SA 4B11A 4MJ8A 2EUIA 4F8ZA 3NH5A 3P2HA 2HUZA 3S6KA 3SI1A 2Q43A 1IU8A 1IOIA 3ISXA 5D29A 2D4OA 4ZY0A 2FT0A 5AGEA 1YMEA 1LANA 5HVFA 2NMTA 4L8AA 4XPLA 1LAPA 4Q38A 3BLNA 4NGRA 1BPMA 2O4HA 1KUXA 1WWZA 3FEEA 3IWWA 1JQGA 4MFKA 3WABA 4DUKA 3VH9A 2ZXVA 3WT4A 1QSOA 4KOUA 1M1DA 2CY2A 2V77A 3A9LA 4I49A 4KSIA 4ZGYB 1P4NA 2XEGA 3B3CA 3CPXA 3DDDA 2PC1A 3HUVA 4MXUA 1WK4A 4X2TA 4MRIA 1M44A 3BI1A 2G3AA 2ZEMA 2BEIA 3GB0A 3JVNA 2WYRA 4P45A 4B5PB 3TO6A 2QVPA 2VBQA 3FX6A 2ZEPA 1R43A 2EWBA 2F5IA 3CPAA 3FXTA 5CPAA 1N71A 2R8VA 4KUBA 1ZLIA 4MMOA 4UFWA 2IJZA 5IB0A 4Q7AA 2PR8A 4NEXA 4R87A 1FNOA 3FECA 2PIZA 1OZPA 2QECA 2V8GA 4M85A 2PJCA 5HVHA 1AMPA 3WC5A 5KTDA 4P10A 4B5PA 1ARLA 2YNEA 3DLJA 3SXNA 2FIWA 1CPXA 3K9TA 1Y0RA 3TO7A 3TX8A 2IL4A 4JZ0A 3R9FA 4TNUA 4ZY1A 5E96A 4KS9A 4MY3A 4JXRA 4OIDA 4JJXA 4RI1A 3TOBA 3R1KA 4UCNA 2XEJA 1LAMA 3H8FA 2PRQA 3LWUA 3NFZA 2B58A 2JBKA 4C68A 5AG5A 4CAVA 1AUGA 1NMTA 4ZX8A 2ZW6A 4H2KA 4ZI6A 2BCOA 2Q04A 3F0AA 3PRTA 4A37A 3EC4A 5K8MA 3NH8A 4PXCA 2AJ6A 5G21A 4P4IA 4AVBA 2PJ2A 3B3VA 1I1DA 1IIDA 1DTDA 2G0BA 4Z65A 2WPWA 2CTCA 3D68A 5J8CA 4MHYA 3KZWA 4OMEA 5G20A 2GFQA 4UCMA 3R9GA 2CXAA 2BSWA 3DNSA 3WR7A 2QYVA 4P4FA 1FY7A 3V8IA 3B8GA 5DS0A 1PU9A 2PR1A 2CNMA 1MJBA 1VHOA 4E8OA 5K8NA 3PB8X 4MFJA 4PSWA 1XF8A 5J1QA 2ZPAA 3C26A 3FMCA 4EWTA 4PQAA 4RS2A 3B2YA 4QUSA 2PJBA 4E2AA 3FB3A 4CGOA 4NGNA 1XMBA 3H8GA 4A95A 1K4JA 1FT7A 1VIXA 3IWEA 2HV2A 1I12A 1S7NA 1XIXA 1PCAA 2DPTA 4MCRA 2Z10A 4J3GA 5DWMA 3KQXA 3RYOA 1YLEA 5LYIA 1MJ9A 1XRYA 4BMHA 3RBUA 4Q36A 2C6PA 1BO4A 4UEFA 4Y49C 2VZZA 1M4LA 2J8NA 1X12A 4W9YA 3B3SA 3NE7A 2PJ3A 2P6EA 4JWPA 5HVGA 1H8LA 1V0CA 4A94A 4XNHC 4R8FA 2PVVA 4ZX9A 4CS0B 2Z3NA 3FJUA 3I3GA 3PGPA 4UIAA 5GCNA 3JUWA 3PEIA 4JD6A 4ZY2A 3I1UA 3TTHA 4ONUA 1ZG7A 3R9EA 3N7ZA 4U9YA 3VWEA 3ZZIA 4C2YA 4F0YA 1ON0A 2ANPA 2BUEA 1CX8A 4PK2A 1BPNA 4PV6A 4MBUA 4K30A 5BWAB 1IY7A 5EBVA 1UWYA 2Q51A 4OC1A 5IV0A 4UFVA 1VHSA 2PJ8A 5D8NA 4CAEA 4L89A 2Z3MA 1AYEA 1ELLP 5ELYA 4YFJA 4ONWA 3PBBA 4UF4A 4X8IA 2ZW5A 2FL4A 2FS5A 3FYNA 4A33A 2B4BA 2PE3A 2ZOFA 3CZXA 4R76A 3EFAA 2AFZA 4OC5A 1CPSA 2EVNA 3LD2A 1J4JA 4KSAA 2Q44A 5EC4A 5ISVA 2PJ9A 1Z8LA 2DPSA 1XMTA 4XPDB 4O23A 4OC2A 5I4MA 3IIBA 2QJ8A 1OBRA 4OIWA 3UY5A 5JH9A 2RB7A 1Z8WA 2FCKA 1S60A 3QAYA 3FVLA 4FBEA 1F57A 2GIVA 4P4JA 2PQ8A 2JEWA 3D7GA 5LRKA 2PJ7A 2V8HA 5THWA 3GIUA 4EFDA 4F9UA 2JDCA 4MHPA 3PB6X 3H4QA 3T9YA 3D66A 3N5FA 2ZW7A 4AVAA 4P4BA 4H6ZA 4OAEA 3PB4X 1QSNA 1CBXA 3B3WA 1Y9WA 1HDQA 1MJAA 4XPKA 4Y49B 2EK9A 2PJ0A 4B5OA 2H5MA 1A2ZA 3IU2A 4KOWA 4B12A 1TF9A 4CAFA 2GLJA 2AFMA 1YR0A 1Z4EA 2VEZA 3WC7A 2G3TA 1YGHA 5H86A 1S7KA 4KLWA 2PJ5A 3FEDA 4XNHB 3SJXA 1DE4C 2Z3KA 4HNYB 4R3KA 2R1IA 3FRMA 4OADA 1MK4A 4B14A 2V8DA 2NYQA 1XEBA 1IICA 1VHEA 2PIYA 4P44A 1TXRA 2R98A 4NSQA 4OLLA 1UFHA 2B5GB 2EO8A 3KQZA 3D8PA 3F8KA 2F8HA 2QIRA 4PXDA 2BOAA 2V8VA 2VQYA 4IF5A 4FWUA 2AFSA 3T8WA 4OC3A 1YVKA 5G1ZA 4YWYA 2C1CA 1R3NA 1F2OA 3SHPA 4B13A 1CP6A 4BINA 4FD5A 1HEEA 4DNCA 4UCPA 1RXTA 2B5GA 5K8PA 4JXQA 1YK3A 4FAIA 2HQYA 4WWVA 2JLMA 1QSTA 4KZTA 4IK2A 3DR6A 2C6CA 2OH1A 4C7HA 4KOTA 4NXYA 6CPAA 3S9NA 3GY9A 2JEVA 4UEEA 3E0KA 2FXFA 3TC8A 2ZW4A 4B10A 3QAHA 2K5TA 4WJBA 4YGOA 3TOAA 5JPHA 4R6TA 1QSMA 4A31A 4ORFA 2WSAA 5KTAA 1Q7LA 2ZEEA 4X3RA 2FE7A 4K3NA 2Z3OA 4C2ZA 2GLFA 1KZFA 2POKA 5LYDA 4HPSA 4XPDC 5F47A 2PCUA 4U9ZA 5DWNA 3RO0A 3ISZA 5F49A 4H6UA 1X10A 3KHZA 2Q7SA 5EMIA 1ZG8A 5F48A 4AXVA 3TT2A 3BI0A 4MY0A 1M4IA
chains in the Genus database with same CATH topology
3FNCA 4AVCA 1SQHA 2Z3PA 1Q2DA 4MI4A 2X7BA 4PSXA 2WPXA 4KSFA 5KTCA 4CYPA 4NF1A 4CRYB 2P6GA 4MFZA 1IB1E 4R9MA 4CGLA 5CNPA 3CXQA 4CGMA 5AG6A 4IUSA 3ZJ0A 1L0CA 3IGRA 5J8FA 1CM0A 3DR8A 2Y0MA 2I00A 2GE3A 2P0WA 1KUVA 3IU1A 4KUAA 4AVAA 1YX0A 4QBJA 5HMNA 4II9A 1Q2CA 3G3SA 2OB0A 1M4GA 4CYNA 4MFLA 4LX9A 1Y9KA 3VWDA 3W6XA 4QVTA 3H5ZA 5HH1A 2GANA 4MHDA 5I0CA 2PDOA 4E0AA 4LUAA 2CNTA 4KVME 1S3ZA 3BJ7A 2B3UA 3D3SA 3VWEA 1XE4A 2PRBA 4ZBGA 3K9UA 5G22A 4HKFA 2Q0YA 4A32A 1QSRA 4AB7A 1S7FA 3S6GA 5A28A 1M4DA 4A30A 1YREA 2BL1A 2P6FA 4YRHA 2FIAA 2QMLA 2ATRA 3TE4A 1R57A 4KLVA 2YGWA 4GS4A 3JTKA 3KKWA 1VKCA 3EO4A 2B3VA 2AE6A 4F6AA 1Z4RA 1ZO0A 3D2PA 3FBUA 4CRZB 3G8WA 1IYKA 4NCZA 1LRZA 5F46A 2I79A 4UA3A 3BJ8A 4C2XA 4R3LA 4CGNA 4AG7A 4H89A 3GYAA 3OWCA 3S6HA 4KOVA 2Z3LA 4EVYA 3GKRA 3SXOA 4UWIA 4BBHA 5JQ4A 2REFA 3CXPA 3MGDA 2D4PA 5A27A 1RO5A 3R95A 2YNDA 2OZGA 4QC6A 2C27A 2VXKA 1B87A 5C88A 1NSLA 1IYLA 4KOXA 2OZHA 3IWGA 4KVOE 3LODA 2YNCC 2J8MA 3S6FA 1U6MA 4UFXA 3R96A 5H84A 1YVOA 5FVJA 4JLYA 2Q7BA 2Q4VA 3T90A 1B6BA 1PUAA 4AG9A 2VI7A 4CGPA 3PZJA 3P2FA 3FIXA 4KOYA 5AG4A 3TO9A 1KUYA 2FSRA 2OU2A 4X5KA 4MFPA 2PSWA 4MFQA 1I21A 3F5BA 3PP9A 2B4DB 4UWJA 1P0HA 2Z0ZA 3W91A 2WUUA 4CAXA 3I9SA 4U5YA 4CAWA 4M3SA 2DXQA 5IX3A 2CNSA 4R57A 4KVXA 4QB9A 2VZYA 2B4DA 5AG7A 4PK3A 3EXNA 2O28A 4C7IA 4F0XA 4A2ZA 4FD7A 2ARHA 2OZUA 2KCWA 1TIQA 4CYOA 3QB8A 3TCVA 2R7HA 4KORA 3TFYA 4HNXB 3DSBA 4HNWB 4FD4A 4KOSA 2J8RA 1Q2YA 4FD6A 1Y7RA 1Z9UA 2RC4A 3CXSA 4UBRA 3D2MA 2Q4YA 2Z11A 1NE9A 1S5KA 2YNCA 2A4NA 2JDDA 4CYQA 5C82A 3EY5A 1GHEA 1S7LA 1BOBA 1CJWA 2REEA 3W6SA 4B11A 4MJ8A 2EUIA 3P2HA 2HUZA 3S6KA 2D4OA 2FT0A 5AGEA 2NMTA 4L8AA 4XPLA 4Q38A 3BLNA 1KUXA 1WWZA 4MFKA 2ZXVA 1QSOA 4KOUA 1M1DA 2CY2A 3A9LA 4I49A 4ZGYB 1P4NA 3DDDA 2PC1A 1WK4A 1M44A 2G3AA 2BEIA 3JVNA 4B5PB 3TO6A 2VBQA 2F5IA 3FXTA 1N71A 2R8VA 4KUBA 4UFWA 5IB0A 2PR8A 4NEXA 4R87A 1OZPA 2QECA 4M85A 5KTDA 4B5PA 2YNEA 3SXNA 2FIWA 3TO7A 2IL4A 3R9FA 5E96A 4KS9A 4MY3A 4JXRA 3TOBA 4JJXA 4RI1A 3R1KA 4UCNA 2B58A 4C68A 5AG5A 4CAVA 1NMTA 2ZW6A 2Q04A 3F0AA 3EC4A 2AJ6A 5G21A 4AVBA 1I1DA 1IIDA 2G0BA 2WPWA 5J8CA 5G20A 4UCMA 3R9GA 2CXAA 2BSWA 3DNSA 3WR7A 1FY7A 3V8IA 3B8GA 1PU9A 2PR1A 2CNMA 1MJBA 4E8OA 4MFJA 4PSWA 1XF8A 2ZPAA 3C26A 4RS2A 4QUSA 4E2AA 3FB3A 4CGOA 4A95A 1K4JA 3IWEA 1I12A 1S7NA 1XIXA 2HV2A 2DPTA 2Z10A 4J3GA 5DWMA 3RYOA 1YLEA 1MJ9A 4BMHA 4Q36A 1BO4A 4Y49C 2VZZA 2J8NA 3NE7A 2P6EA 4JWPA 1V0CA 4XNHC 4CS0B 2Z3NA 3I3GA 3PGPA 5GCNA 3JUWA 4JD6A 3TTHA 4ONUA 3R9EA 3ZZIA 3N7ZA 4U9YA 4F0YA 4C2YA 1ON0A 2BUEA 4PK2A 4PV6A 4MBUA 4K30A 5BWAB 5EBVA 5IV0A 4UFVA 1VHSA 4CAEA 4L89A 2Z3MA 4YFJA 2ZW5A 2FL4A 2FS5A 3FYNA 4A33A 2B4BA 3EFAA 5ISVA 2EVNA 3LD2A 1J4JA 4KSAA 2Q44A 5EC4A 2DPSA 4XPDB 1XMTA 3UY5A 2FCKA 1S60A 2GIVA 2PQ8A 2JDCA 3H4QA 3T9YA 2ZW7A 4H6ZA 4OAEA 1QSNA 1Y9WA 1MJAA 4XPKA 4Y49B 4B5OA 2H5MA 3IU2A 4B12A 4KOWA 4CAFA 1YR0A 1Z4EA 2VEZA 2G3TA 1YGHA 5H86A 1S7KA 4KLWA 4XNHB 2Z3KA 4R3KA 4HNYB 2R1IA 3FRMA 4OADA 1MK4A 4B14A 1XEBA 1IICA 2R98A 4NSQA 4OLLA 1UFHA 2B5GB 3D8PA 3F8KA 2QIRA 2VQYA 4IF5A 1YVKA 5G1ZA 4B13A 3SHPA 4FD5A 4DNCA 4UCPA 1RXTA 2B5GA 4JXQA 1YK3A 2HQYA 1QSTA 2JLMA 4KZTA 3DR6A 2OH1A 4C7HA 4KOTA 4NXYA 3GY9A 2JEVA 3E0KA 2FXFA 2ZW4A 4B10A 3QAHA 2K5TA 4YGOA 3TOAA 5JPHA 1QSMA 4A31A 4ORFA 2WSAA 5KTAA 2FE7A 4C2ZA 2Z3OA 1KZFA 4XPDC 5F47A 4U9ZA 5DWNA 5F49A 4H6UA 5F48A 3TT2A 4MY0A 1M4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FNC A;  4AVC A;  1SQH A;  1Q2D A;  4MI4 A;  2X7B A;  4PSX A;  2WPX A;  5KTC A;  4NF1 A;  4CRY B;  2P6G A;  1IB1 E;  4R9M A;  5CNP A;  3CXQ A;  4IUS A;  3ZJ0 A;  1L0C A;  3IGR A;  5J8F A;  1CM0 A;  3DR8 A;  2Y0M A;  2I00 A;  2GE3 A;  2P0W A;  1KUV A;  4AVA A;  4KUA A;  5I0C A;  1YX0 A;  4QBJ A;  5HMN A;  4II9 A;  1Q2C A;  3G3S A;  2OB0 A;  1M4G A;  4LX9 A;  1Y9K A;  3VWD A;  3W6X A;  4QVT A;  5HH1 A;  2GAN A;  4MHD A;  2PDO A;  4E0A A;  4LUA A;  2CNT A;  4KVM E;  1S3Z A;  3BJ7 A;  2B3U A;  3D3S A;  3VWE A;  1XE4 A;  2PRB A;  4ZBG A;  3K9U A;  4HKF A;  2Q0Y A;  1QSR A;  4AB7 A;  1S7F A;  3S6G A;  1M4D A;  1YRE A;  2BL1 A;  2P6F A;  4YRH A;  2FIA A;  2QML A;  2ATR A;  3TE4 A;  1R57 A;  4KLV A;  4GS4 A;  3KKW A;  1VKC A;  3EO4 A;  2B3V A;  2AE6 A;  4F6A A;  1Z4R A;  3D2P A;  3FBU A;  4CRZ B;  3G8W A;  1IYK A;  4NCZ A;  1LRZ A;  5F46 A;  2I79 A;  4UA3 A;  3BJ8 A;  4R3L A;  4AG7 A;  4H89 A;  3GYA A;  3OWC A;  3S6H A;  4KOV A;  4EVY A;  3GKR A;  3SXO A;  4UWI A;  5JQ4 A;  2REF A;  3CXP A;  3MGD A;  2D4P A;  1RO5 A;  3R95 A;  2OZG A;  4QC6 A;  2C27 A;  2VXK A;  1B87 A;  5C88 A;  1NSL A;  1IYL A;  4KOX A;  2OZH A;  3IWG A;  4KVO E;  3LOD A;  2J8M A;  3S6F A;  1U6M A;  3R96 A;  5H84 A;  1YVO A;  5FVJ A;  4JLY A;  2Q7B A;  2Q4V A;  3T90 A;  1B6B A;  1PUA A;  4AG9 A;  2VI7 A;  3PZJ A;  3P2F A;  3FIX A;  4KOY A;  3TO9 A;  1KUY A;  2FSR A;  2OU2 A;  4X5K A;  2PSW A;  1I21 A;  3F5B A;  3PP9 A;  2B4D B;  4UWJ A;  1P0H A;  2Z0Z A;  3W91 A;  4CAX A;  3I9S A;  4U5Y A;  4CAW A;  4M3S A;  2DXQ A;  5IX3 A;  2CNS A;  4R57 A;  4KVX A;  4QB9 A;  2VZY A;  2B4D A;  4PK3 A;  3EXN A;  2O28 A;  4FD7 A;  2ARH A;  2OZU A;  2KCW A;  1TIQ A;  3QB8 A;  3TCV A;  2R7H A;  4KOR A;  3TFY A;  4HNX B;  3DSB A;  4HNW B;  4FD4 A;  4KOS A;  2J8R A;  1Q2Y A;  4FD6 A;  1Y7R A;  1Z9U A;  2RC4 A;  3CXS A;  4UBR A;  3D2M A;  2Q4Y A;  2Z11 A;  1NE9 A;  1S5K A;  2A4N A;  2JDD A;  5C82 A;  3EY5 A;  1GHE A;  1S7L A;  1BOB A;  1CJW A;  2REE A;  3W6S A;  4MJ8 A;  2EUI A;  3P2H A;  2HUZ A;  3S6K A;  2D4O A;  2FT0 A;  2NMT A;  4L8A A;  4XPL A;  3BLN A;  1KUX A;  1WWZ A;  2ZXV A;  1QSO A;  4KOU A;  1M1D A;  2CY2 A;  4I49 A;  1P4N A;  3DDD A;  2PC1 A;  1WK4 A;  1M44 A;  2G3A A;  2BEI A;  3JVN A;  4B5P B;  3TO6 A;  2VBQ A;  2F5I A;  3FXT A;  1N71 A;  2R8V A;  4KUB A;  5IB0 A;  2PR8 A;  4NEX A;  4R87 A;  1OZP A;  2QEC A;  4M85 A;  5KTD A;  4B5P A;  3SXN A;  2FIW A;  3TO7 A;  2IL4 A;  3R9F A;  5E96 A;  4MY3 A;  3TOB A;  4JXR A;  4JJX A;  4RI1 A;  3R1K A;  2B58 A;  4CAV A;  1NMT A;  2ZW6 A;  2Q04 A;  3F0A A;  3EC4 A;  2AJ6 A;  4AVB A;  1I1D A;  1IID A;  2G0B A;  2WPW A;  5J8C A;  3R9G A;  2BSW A;  3DNS A;  3WR7 A;  1FY7 A;  3V8I A;  3B8G A;  1PU9 A;  2PR1 A;  2CNM A;  1MJB A;  4E8O A;  4PSW A;  1XF8 A;  2ZPA A;  3C26 A;  4RS2 A;  4QUS A;  4E2A A;  3FB3 A;  1K4J A;  1I12 A;  1S7N A;  1XIX A;  2HV2 A;  2Z10 A;  4J3G A;  5DWM A;  3RYO A;  1YLE A;  1MJ9 A;  4BMH A;  1BO4 A;  4Y49 C;  2VZZ A;  2J8N A;  3NE7 A;  2P6E A;  4JWP A;  1V0C A;  4XNH C;  4CS0 B;  3I3G A;  3PGP A;  5GCN A;  3JUW A;  4JD6 A;  3TTH A;  4ONU A;  3R9E A;  3ZZI A;  3N7Z A;  4U9Y A;  4F0Y A;  1ON0 A;  2BUE A;  4PK2 A;  4PV6 A;  4MBU A;  4K30 A;  5EBV A;  5IV0 A;  1VHS A;  4L89 A;  4YFJ A;  2ZW5 A;  2FL4 A;  2FS5 A;  3FYN A;  2B4B A;  3EFA A;  5ISV A;  2EVN A;  3LD2 A;  1J4J A;  5EC4 A;  2Q44 A;  4XPD B;  1XMT A;  3UY5 A;  2FCK A;  1S60 A;  2GIV A;  2PQ8 A;  2JDC A;  3H4Q A;  3T9Y A;  2ZW7 A;  4H6Z A;  4OAE A;  1QSN A;  1Y9W A;  1MJA A;  4XPK A;  4Y49 B;  4B5O A;  2H5M A;  4KOW A;  1YR0 A;  1Z4E A;  2VEZ A;  2G3T A;  1YGH A;  5H86 A;  1S7K A;  4KLW A;  4XNH B;  4R3K A;  4HNY B;  2R1I A;  3FRM A;  4OAD A;  1MK4 A;  1XEB A;  1IIC A;  2R98 A;  4NSQ A;  4OLL A;  1UFH A;  2B5G B;  3D8P A;  3F8K A;  2QIR A;  2VQY A;  4IF5 A;  1YVK A;  3SHP A;  4FD5 A;  4DNC A;  1RXT A;  2B5G A;  4JXQ A;  1YK3 A;  2HQY A;  1QST A;  4KZT A;  2JLM A;  3DR6 A;  2OH1 A;  4KOT A;  4NXY A;  3GY9 A;  2JEV A;  3E0K A;  2FXF A;  2ZW4 A;  3QAH A;  2K5T A;  4YGO A;  3TOA A;  5JPH A;  1QSM A;  4ORF A;  5KTA A;  2FE7 A;  1KZF A;  4XPD C;  5F47 A;  4U9Z A;  5DWN A;  5F49 A;  4H6U A;  5F48 A;  3TT2 A;  4MY0 A;  1M4I A; 
#chains in the Genus database with same CATH topology
 1Z8X A;  3FNC A;  4AVC A;  1SQH A;  3SJG A;  2Z3P A;  1Q2D A;  2ZEN A;  2X7B A;  2ZEF A;  4MI4 A;  1XJO A;  4PSX A;  5HXD A;  3BXM A;  2ZEH A;  2WPX A;  3H8E A;  3KHX A;  4KSF A;  5KTC A;  4CYP A;  5CBM A;  4NF1 A;  4CRY B;  4B6Z A;  2P6G A;  2HC9 A;  2GU2 A;  4MFZ A;  1IB1 E;  3IJ3 A;  4R9M A;  4CGL A;  3L2N A;  5CNP A;  3B3T A;  5JGF A;  3CXQ A;  4CGM A;  3KAS A;  5AG6 A;  4IUS A;  3ZJ0 A;  1L0C A;  4RUH A;  3IGR A;  5J8F A;  1CM0 A;  3DR8 A;  2Y0M A;  1ZG9 A;  2I00 A;  2GE3 A;  2ODF A;  1KUV A;  2P0W A;  3IU1 A;  4KUA A;  1YX0 A;  4NGP A;  4TWE A;  3VAR A;  4MHN A;  1Q2C A;  4QBJ A;  5HMN A;  4II9 A;  2AFX A;  4DYO A;  1RTQ A;  3G3S A;  2ZEG A;  2OB0 A;  1M4G A;  2OOT A;  4CYN A;  4MFL A;  4LX9 A;  1Y9K A;  3VWD A;  3W6X A;  2HB6 A;  4QVT A;  3H5Z A;  1ARM A;  5HH1 A;  2GAN A;  2PJA A;  4MHD A;  4OP4 A;  4NGT A;  2CTB A;  5I0C A;  2PDO A;  4E0A A;  4LUA A;  2CNT A;  2AFU A;  4KVM E;  1S3Z A;  4PXB A;  3BJ7 A;  2B3U A;  2IMO A;  3D3S A;  1XE4 A;  2PRB A;  4ZBG A;  3K9U A;  5G22 A;  4P4D A;  1Y7E A;  5LYL A;  4HKF A;  2Q0Y A;  1XBU A;  1QSR A;  4M6I A;  3WC6 A;  4A32 A;  4AB7 A;  1S7F A;  2EK8 A;  1ZLH A;  2G9D A;  3S6G A;  4OC0 A;  4DJL A;  5A28 A;  1M4D A;  5LRJ A;  2VL1 A;  4A30 A;  1YRE A;  2BL1 A;  2P6F A;  1HDU A;  2C6G A;  1TKJ A;  2XEI A;  4NJR A;  2FIA A;  2QML A;  4YRH A;  4PPZ A;  2ZED A;  2ATR A;  1VGY A;  3CT9 A;  3TE4 A;  2CF4 A;  1LFW A;  1R57 A;  1Z8T A;  4KLV A;  2YGW A;  4GS4 A;  2Q4Z A;  3JTK A;  3KKW A;  3D67 A;  1VKC A;  3EO4 A;  4G1P A;  1YW6 A;  2B3V A;  3V38 A;  3D7D A;  2AE6 A;  1QMU A;  8CPA A;  4EME A;  3SJF A;  3IFE A;  3NE8 A;  1Z2L A;  4BD9 A;  4F6A A;  1Z4R A;  2OR4 A;  1ZO0 A;  3PFE A;  4JYW A;  3D2P A;  3FBU A;  7CPA A;  3D7F A;  4R7M A;  2GRE A;  3KI9 A;  3BHX A;  4CRZ B;  2PVW A;  5F09 A;  3G8W A;  2ZOG A;  3B35 A;  4F9V A;  2PJ6 A;  1LCP A;  1EE3 P;  3SI0 A;  1LOK A;  1IYK A;  2RFH A;  4RN7 A;  4NCZ A;  1CG2 A;  1LRZ A;  4P4E A;  4A39 A;  2I79 A;  4UA3 A;  5F46 A;  3BJ8 A;  1CP7 A;  1KWM A;  4C2X A;  1F2P A;  4R3L A;  4CGN A;  2IQ6 A;  1YQE A;  4OKO A;  3GLJ A;  1Z5R A;  4AG7 A;  3IC1 A;  4H89 A;  3GYA A;  3KGQ A;  3OWC A;  3S6H A;  4KOV A;  2Z3L A;  3MN8 A;  4NFR A;  4P6Y A;  4EVY A;  3GKR A;  3PFO A;  3SXO A;  1YW4 A;  4FUU A;  2NSM A;  4UWI A;  5LRG A;  3RZA A;  4BBH A;  5JQ4 A;  2REF A;  3CDX A;  3CXP A;  1QQ9 A;  3MGD A;  4YU9 A;  2D4P A;  5A27 A;  2DF5 A;  2AFO A;  1RO5 A;  3R95 A;  3NH4 A;  1IGB A;  2YND A;  4OC4 A;  2OZG A;  2ZEO A;  2C27 A;  2VXK A;  4QC6 A;  1B87 A;  1Y0Y A;  3NA6 A;  3RNZ A;  5C88 A;  1NSL A;  1IYL A;  4KOX A;  2OZH A;  3IWG A;  4KVO E;  3LOD A;  2YNC C;  1YLO A;  2J8M A;  1YSJ A;  2FVG A;  3PBE A;  4MCQ A;  3S6F A;  1U6M A;  4UFX A;  3R96 A;  5H84 A;  1YVO A;  5FVJ A;  3S9L A;  4JLY A;  2Q7B A;  2Q4V A;  3T90 A;  1B6B A;  1GYT A;  1PUA A;  4AG9 A;  2VI7 A;  4CGP A;  3PZJ A;  1NSA A;  1PYT B;  3KR4 A;  3K2K A;  1BAV A;  3DGV A;  4LQ6 A;  4UEZ A;  3P2F A;  3FIX A;  3RAM A;  3GUX A;  4KOY A;  2AFW A;  2WZN A;  5AG4 A;  3TO9 A;  1KUY A;  2EBJ A;  4LQG A;  3LMS A;  2J9A A;  2FSR A;  2I3C A;  3VAT A;  2OU2 A;  4MHZ A;  4X5K A;  4CPA A;  4MFP A;  2PSW A;  2PJ4 A;  2DEA A;  4MFQ A;  1I21 A;  3F5B A;  3PP9 A;  3SI2 A;  2B4D B;  4UWJ A;  3V7Z A;  1ELM P;  3D7H A;  1P0H A;  1XFO A;  4NGM A;  4M6H A;  5JM6 A;  2Z0Z A;  3W91 A;  2WUU A;  2XEF A;  2ZEL A;  4CAX A;  1IOF A;  5IB9 A;  3I9S A;  4PXE A;  4U5Y A;  4M3S A;  4CAW A;  2DXQ A;  1TKF A;  3MRU A;  5IX3 A;  2CNS A;  4R57 A;  3HLP A;  4KVX A;  4QB9 A;  2VZY A;  2B4D A;  4IAV A;  4NGS A;  5AG7 A;  4MCP A;  4PK3 A;  3QNV A;  5K8O A;  3EXN A;  2O53 A;  3IEH A;  3B7I A;  4MCS A;  2O28 A;  4C7I A;  2F7V A;  4F0X A;  4A2Z A;  3PB7 X;  3KR5 A;  4FD7 A;  3LAC A;  3IO1 A;  3KL9 A;  2ARH A;  2OZU A;  1XOV A;  4UIB A;  2KCW A;  1TIQ A;  4IHM A;  3QB8 A;  4CYO A;  1JWQ A;  3S9M A;  3SJE A;  3TCV A;  2R7H A;  4KOR A;  3TFY A;  4HNX B;  3DSB A;  4HNW B;  2PJ1 A;  1TKH A;  3JRU A;  4FD4 A;  4KOS A;  3FH4 A;  4GXH A;  2J8R A;  1Q2Y A;  4FD6 A;  1Y7R A;  2BO9 A;  4NJQ A;  1Z9U A;  2RC4 A;  3CXS A;  3FF3 A;  4A38 A;  4UBR A;  1TF8 A;  3D2M A;  2CIJ A;  2Q4Y A;  2Z11 A;  4M6G A;  1NE9 A;  1S5K A;  2ABZ A;  2A4N A;  2JDD A;  2YNC A;  4CYQ A;  4ZYQ A;  3EY5 A;  1GHE A;  5C82 A;  1BLL E;  4GM5 A;  5LYF A;  1S7L A;  4NGQ A;  3PB9 X;  1BOB A;  1CJW A;  2JBJ A;  2REE A;  3D4U A;  3W6S A;  4B11 A;  4MJ8 A;  2EUI A;  4F8Z A;  3NH5 A;  3P2H A;  2HUZ A;  3S6K A;  3SI1 A;  2Q43 A;  1IU8 A;  1IOI A;  3ISX A;  5D29 A;  2D4O A;  4ZY0 A;  2FT0 A;  5AGE A;  1YME A;  1LAN A;  5HVF A;  2NMT A;  4L8A A;  4XPL A;  1LAP A;  4Q38 A;  3BLN A;  4NGR A;  1BPM A;  2O4H A;  1KUX A;  1WWZ A;  3FEE A;  3IWW A;  1JQG A;  4MFK A;  3WAB A;  4DUK A;  3VH9 A;  2ZXV A;  3WT4 A;  1QSO A;  4KOU A;  1M1D A;  2CY2 A;  2V77 A;  3A9L A;  4I49 A;  4KSI A;  4ZGY B;  1P4N A;  2XEG A;  3B3C A;  3CPX A;  3DDD A;  2PC1 A;  3HUV A;  4MXU A;  1WK4 A;  4X2T A;  4MRI A;  1M44 A;  3BI1 A;  2G3A A;  2ZEM A;  2BEI A;  3GB0 A;  3JVN A;  2WYR A;  4P45 A;  4B5P B;  3TO6 A;  2QVP A;  2VBQ A;  3FX6 A;  2ZEP A;  1R43 A;  2EWB A;  2F5I A;  3CPA A;  3FXT A;  5CPA A;  1N71 A;  2R8V A;  4KUB A;  1ZLI A;  4MMO A;  4UFW A;  2IJZ A;  5IB0 A;  4Q7A A;  2PR8 A;  4NEX A;  4R87 A;  1FNO A;  3FEC A;  2PIZ A;  1OZP A;  2QEC A;  2V8G A;  4M85 A;  2PJC A;  5HVH A;  1AMP A;  3WC5 A;  5KTD A;  4P10 A;  4B5P A;  1ARL A;  2YNE A;  3DLJ A;  3SXN A;  2FIW A;  1CPX A;  3K9T A;  1Y0R A;  3TO7 A;  3TX8 A;  2IL4 A;  4JZ0 A;  3R9F A;  4TNU A;  4ZY1 A;  5E96 A;  4KS9 A;  4MY3 A;  4JXR A;  4OID A;  4JJX A;  4RI1 A;  3TOB A;  3R1K A;  4UCN A;  2XEJ A;  1LAM A;  3H8F A;  2PRQ A;  3LWU A;  3NFZ A;  2B58 A;  2JBK A;  4C68 A;  5AG5 A;  4CAV A;  1AUG A;  1NMT A;  4ZX8 A;  2ZW6 A;  4H2K A;  4ZI6 A;  2BCO A;  2Q04 A;  3F0A A;  3PRT A;  4A37 A;  3EC4 A;  5K8M A;  3NH8 A;  4PXC A;  2AJ6 A;  5G21 A;  4P4I A;  4AVB A;  2PJ2 A;  3B3V A;  1I1D A;  1IID A;  1DTD A;  2G0B A;  4Z65 A;  2WPW A;  2CTC A;  3D68 A;  5J8C A;  4MHY A;  3KZW A;  4OME A;  5G20 A;  2GFQ A;  4UCM A;  3R9G A;  2CXA A;  2BSW A;  3DNS A;  3WR7 A;  2QYV A;  4P4F A;  1FY7 A;  3V8I A;  3B8G A;  5DS0 A;  1PU9 A;  2PR1 A;  2CNM A;  1MJB A;  1VHO A;  4E8O A;  5K8N A;  3PB8 X;  4MFJ A;  4PSW A;  1XF8 A;  5J1Q A;  2ZPA A;  3C26 A;  3FMC A;  4EWT A;  4PQA A;  4RS2 A;  3B2Y A;  4QUS A;  2PJB A;  4E2A A;  3FB3 A;  4CGO A;  4NGN A;  1XMB A;  3H8G A;  4A95 A;  1K4J A;  1FT7 A;  1VIX A;  3IWE A;  2HV2 A;  1I12 A;  1S7N A;  1XIX A;  1PCA A;  2DPT A;  4MCR A;  2Z10 A;  4J3G A;  5DWM A;  3KQX A;  3RYO A;  1YLE A;  5LYI A;  1MJ9 A;  1XRY A;  4BMH A;  3RBU A;  4Q36 A;  2C6P A;  1BO4 A;  4UEF A;  4Y49 C;  2VZZ A;  1M4L A;  2J8N A;  1X12 A;  4W9Y A;  3B3S A;  3NE7 A;  2PJ3 A;  2P6E A;  4JWP A;  5HVG A;  1H8L A;  1V0C A;  4A94 A;  4XNH C;  4R8F A;  2PVV A;  4ZX9 A;  4CS0 B;  2Z3N A;  3FJU A;  3I3G A;  3PGP A;  4UIA A;  5GCN A;  3JUW A;  3PEI A;  4JD6 A;  4ZY2 A;  3I1U A;  3TTH A;  4ONU A;  1ZG7 A;  3R9E A;  3N7Z A;  4U9Y A;  3VWE A;  3ZZI A;  4C2Y A;  4F0Y A;  1ON0 A;  2ANP A;  2BUE A;  1CX8 A;  4PK2 A;  1BPN A;  4PV6 A;  4MBU A;  4K30 A;  5BWA B;  1IY7 A;  5EBV A;  1UWY A;  2Q51 A;  4OC1 A;  5IV0 A;  4UFV A;  1VHS A;  2PJ8 A;  5D8N A;  4CAE A;  4L89 A;  2Z3M A;  1AYE A;  1ELL P;  5ELY A;  4YFJ A;  4ONW A;  3PBB A;  4UF4 A;  4X8I A;  2ZW5 A;  2FL4 A;  2FS5 A;  3FYN A;  4A33 A;  2B4B A;  2PE3 A;  2ZOF A;  3CZX A;  4R76 A;  3EFA A;  2AFZ A;  4OC5 A;  1CPS A;  2EVN A;  3LD2 A;  1J4J A;  4KSA A;  2Q44 A;  5EC4 A;  5ISV A;  2PJ9 A;  1Z8L A;  2DPS A;  1XMT A;  4XPD B;  4O23 A;  4OC2 A;  5I4M A;  3IIB A;  2QJ8 A;  1OBR A;  4OIW A;  3UY5 A;  5JH9 A;  2RB7 A;  1Z8W A;  2FCK A;  1S60 A;  3QAY A;  3FVL A;  4FBE A;  1F57 A;  2GIV A;  4P4J A;  2PQ8 A;  2JEW A;  3D7G A;  5LRK A;  2PJ7 A;  2V8H A;  5THW A;  3GIU A;  4EFD A;  4F9U A;  2JDC A;  4MHP A;  3PB6 X;  3H4Q A;  3T9Y A;  3D66 A;  3N5F A;  2ZW7 A;  4AVA A;  4P4B A;  4H6Z A;  4OAE A;  3PB4 X;  1QSN A;  1CBX A;  3B3W A;  1Y9W A;  1HDQ A;  1MJA A;  4XPK A;  4Y49 B;  2EK9 A;  2PJ0 A;  4B5O A;  2H5M A;  1A2Z A;  3IU2 A;  4KOW A;  4B12 A;  1TF9 A;  4CAF A;  2GLJ A;  2AFM A;  1YR0 A;  1Z4E A;  2VEZ A;  3WC7 A;  2G3T A;  1YGH A;  5H86 A;  1S7K A;  4KLW A;  2PJ5 A;  3FED A;  4XNH B;  3SJX A;  1DE4 C;  2Z3K A;  4HNY B;  4R3K A;  2R1I A;  3FRM A;  4OAD A;  1MK4 A;  4B14 A;  2V8D A;  2NYQ A;  1XEB A;  1IIC A;  1VHE A;  2PIY A;  4P44 A;  1TXR A;  2R98 A;  4NSQ A;  4OLL A;  1UFH A;  2B5G B;  2EO8 A;  3KQZ A;  3D8P A;  3F8K A;  2F8H A;  2QIR A;  4PXD A;  2BOA A;  2V8V A;  2VQY A;  4IF5 A;  4FWU A;  2AFS A;  3T8W A;  4OC3 A;  1YVK A;  5G1Z A;  4YWY A;  2C1C A;  1R3N A;  1F2O A;  3SHP A;  4B13 A;  1CP6 A;  4BIN A;  4FD5 A;  1HEE A;  4DNC A;  4UCP A;  1RXT A;  2B5G A;  5K8P A;  4JXQ A;  1YK3 A;  4FAI A;  2HQY A;  4WWV A;  2JLM A;  1QST A;  4KZT A;  4IK2 A;  3DR6 A;  2C6C A;  2OH1 A;  4C7H A;  4KOT A;  4NXY A;  6CPA A;  3S9N A;  3GY9 A;  2JEV A;  4UEE A;  3E0K A;  2FXF A;  3TC8 A;  2ZW4 A;  4B10 A;  3QAH A;  2K5T A;  4WJB A;  4YGO A;  3TOA A;  5JPH A;  4R6T A;  1QSM A;  4A31 A;  4ORF A;  2WSA A;  5KTA A;  1Q7L A;  2ZEE A;  4X3R A;  2FE7 A;  4K3N A;  2Z3O A;  4C2Z A;  2GLF A;  1KZF A;  2POK A;  5LYD A;  4HPS A;  4XPD C;  5F47 A;  2PCU A;  4U9Z A;  5DWN A;  3RO0 A;  3ISZ A;  5F49 A;  4H6U A;  1X10 A;  3KHZ A;  2Q7S A;  5EMI A;  1ZG8 A;  5F48 A;  4AXV A;  3TT2 A;  3BI0 A;  4MY0 A;  1M4I A; 
#chains in the Genus database with same CATH homology
 3FNC A;  4AVC A;  1SQH A;  2Z3P A;  1Q2D A;  4MI4 A;  2X7B A;  4PSX A;  2WPX A;  4KSF A;  5KTC A;  4CYP A;  4NF1 A;  4CRY B;  2P6G A;  4MFZ A;  1IB1 E;  4R9M A;  4CGL A;  5CNP A;  3CXQ A;  4CGM A;  5AG6 A;  4IUS A;  3ZJ0 A;  1L0C A;  3IGR A;  5J8F A;  1CM0 A;  3DR8 A;  2Y0M A;  2I00 A;  2GE3 A;  2P0W A;  1KUV A;  3IU1 A;  4KUA A;  4AVA A;  1YX0 A;  4QBJ A;  5HMN A;  4II9 A;  1Q2C A;  3G3S A;  2OB0 A;  1M4G A;  4CYN A;  4MFL A;  4LX9 A;  1Y9K A;  3VWD A;  3W6X A;  4QVT A;  3H5Z A;  5HH1 A;  2GAN A;  4MHD A;  5I0C A;  2PDO A;  4E0A A;  4LUA A;  2CNT A;  4KVM E;  1S3Z A;  3BJ7 A;  2B3U A;  3D3S A;  3VWE A;  1XE4 A;  2PRB A;  4ZBG A;  3K9U A;  5G22 A;  4HKF A;  2Q0Y A;  4A32 A;  1QSR A;  4AB7 A;  1S7F A;  3S6G A;  5A28 A;  1M4D A;  4A30 A;  1YRE A;  2BL1 A;  2P6F A;  4YRH A;  2FIA A;  2QML A;  2ATR A;  3TE4 A;  1R57 A;  4KLV A;  2YGW A;  4GS4 A;  3JTK A;  3KKW A;  1VKC A;  3EO4 A;  2B3V A;  2AE6 A;  4F6A A;  1Z4R A;  1ZO0 A;  3D2P A;  3FBU A;  4CRZ B;  3G8W A;  1IYK A;  4NCZ A;  1LRZ A;  5F46 A;  2I79 A;  4UA3 A;  3BJ8 A;  4C2X A;  4R3L A;  4CGN A;  4AG7 A;  4H89 A;  3GYA A;  3OWC A;  3S6H A;  4KOV A;  2Z3L A;  4EVY A;  3GKR A;  3SXO A;  4UWI A;  4BBH A;  5JQ4 A;  2REF A;  3CXP A;  3MGD A;  2D4P A;  5A27 A;  1RO5 A;  3R95 A;  2YND A;  2OZG A;  4QC6 A;  2C27 A;  2VXK A;  1B87 A;  5C88 A;  1NSL A;  1IYL A;  4KOX A;  2OZH A;  3IWG A;  4KVO E;  3LOD A;  2YNC C;  2J8M A;  3S6F A;  1U6M A;  4UFX A;  3R96 A;  5H84 A;  1YVO A;  5FVJ A;  4JLY A;  2Q7B A;  2Q4V A;  3T90 A;  1B6B A;  1PUA A;  4AG9 A;  2VI7 A;  4CGP A;  3PZJ A;  3P2F A;  3FIX A;  4KOY A;  5AG4 A;  3TO9 A;  1KUY A;  2FSR A;  2OU2 A;  4X5K A;  4MFP A;  2PSW A;  4MFQ A;  1I21 A;  3F5B A;  3PP9 A;  2B4D B;  4UWJ A;  1P0H A;  2Z0Z A;  3W91 A;  2WUU A;  4CAX A;  3I9S A;  4U5Y A;  4CAW A;  4M3S A;  2DXQ A;  5IX3 A;  2CNS A;  4R57 A;  4KVX A;  4QB9 A;  2VZY A;  2B4D A;  5AG7 A;  4PK3 A;  3EXN A;  2O28 A;  4C7I A;  4F0X A;  4A2Z A;  4FD7 A;  2ARH A;  2OZU A;  2KCW A;  1TIQ A;  4CYO A;  3QB8 A;  3TCV A;  2R7H A;  4KOR A;  3TFY A;  4HNX B;  3DSB A;  4HNW B;  4FD4 A;  4KOS A;  2J8R A;  1Q2Y A;  4FD6 A;  1Y7R A;  1Z9U A;  2RC4 A;  3CXS A;  4UBR A;  3D2M A;  2Q4Y A;  2Z11 A;  1NE9 A;  1S5K A;  2YNC A;  2A4N A;  2JDD A;  4CYQ A;  5C82 A;  3EY5 A;  1GHE A;  1S7L A;  1BOB A;  1CJW A;  2REE A;  3W6S A;  4B11 A;  4MJ8 A;  2EUI A;  3P2H A;  2HUZ A;  3S6K A;  2D4O A;  2FT0 A;  5AGE A;  2NMT A;  4L8A A;  4XPL A;  4Q38 A;  3BLN A;  1KUX A;  1WWZ A;  4MFK A;  2ZXV A;  1QSO A;  4KOU A;  1M1D A;  2CY2 A;  3A9L A;  4I49 A;  4ZGY B;  1P4N A;  3DDD A;  2PC1 A;  1WK4 A;  1M44 A;  2G3A A;  2BEI A;  3JVN A;  4B5P B;  3TO6 A;  2VBQ A;  2F5I A;  3FXT A;  1N71 A;  2R8V A;  4KUB A;  4UFW A;  5IB0 A;  2PR8 A;  4NEX A;  4R87 A;  1OZP A;  2QEC A;  4M85 A;  5KTD A;  4B5P A;  2YNE A;  3SXN A;  2FIW A;  3TO7 A;  2IL4 A;  3R9F A;  5E96 A;  4KS9 A;  4MY3 A;  4JXR A;  3TOB A;  4JJX A;  4RI1 A;  3R1K A;  4UCN A;  2B58 A;  4C68 A;  5AG5 A;  4CAV A;  1NMT A;  2ZW6 A;  2Q04 A;  3F0A A;  3EC4 A;  2AJ6 A;  5G21 A;  4AVB A;  1I1D A;  1IID A;  2G0B A;  2WPW A;  5J8C A;  5G20 A;  4UCM A;  3R9G A;  2CXA A;  2BSW A;  3DNS A;  3WR7 A;  1FY7 A;  3V8I A;  3B8G A;  1PU9 A;  2PR1 A;  2CNM A;  1MJB A;  4E8O A;  4MFJ A;  4PSW A;  1XF8 A;  2ZPA A;  3C26 A;  4RS2 A;  4QUS A;  4E2A A;  3FB3 A;  4CGO A;  4A95 A;  1K4J A;  3IWE A;  1I12 A;  1S7N A;  1XIX A;  2HV2 A;  2DPT A;  2Z10 A;  4J3G A;  5DWM A;  3RYO A;  1YLE A;  1MJ9 A;  4BMH A;  4Q36 A;  1BO4 A;  4Y49 C;  2VZZ A;  2J8N A;  3NE7 A;  2P6E A;  4JWP A;  1V0C A;  4XNH C;  4CS0 B;  2Z3N A;  3I3G A;  3PGP A;  5GCN A;  3JUW A;  4JD6 A;  3TTH A;  4ONU A;  3R9E A;  3ZZI A;  3N7Z A;  4U9Y A;  4F0Y A;  4C2Y A;  1ON0 A;  2BUE A;  4PK2 A;  4PV6 A;  4MBU A;  4K30 A;  5BWA B;  5EBV A;  5IV0 A;  4UFV A;  1VHS A;  4CAE A;  4L89 A;  2Z3M A;  4YFJ A;  2ZW5 A;  2FL4 A;  2FS5 A;  3FYN A;  4A33 A;  2B4B A;  3EFA A;  5ISV A;  2EVN A;  3LD2 A;  1J4J A;  4KSA A;  2Q44 A;  5EC4 A;  2DPS A;  4XPD B;  1XMT A;  3UY5 A;  2FCK A;  1S60 A;  2GIV A;  2PQ8 A;  2JDC A;  3H4Q A;  3T9Y A;  2ZW7 A;  4H6Z A;  4OAE A;  1QSN A;  1Y9W A;  1MJA A;  4XPK A;  4Y49 B;  4B5O A;  2H5M A;  3IU2 A;  4B12 A;  4KOW A;  4CAF A;  1YR0 A;  1Z4E A;  2VEZ A;  2G3T A;  1YGH A;  5H86 A;  1S7K A;  4KLW A;  4XNH B;  2Z3K A;  4R3K A;  4HNY B;  2R1I A;  3FRM A;  4OAD A;  1MK4 A;  4B14 A;  1XEB A;  1IIC A;  2R98 A;  4NSQ A;  4OLL A;  1UFH A;  2B5G B;  3D8P A;  3F8K A;  2QIR A;  2VQY A;  4IF5 A;  1YVK A;  5G1Z A;  4B13 A;  3SHP A;  4FD5 A;  4DNC A;  4UCP A;  1RXT A;  2B5G A;  4JXQ A;  1YK3 A;  2HQY A;  1QST A;  2JLM A;  4KZT A;  3DR6 A;  2OH1 A;  4C7H A;  4KOT A;  4NXY A;  3GY9 A;  2JEV A;  3E0K A;  2FXF A;  2ZW4 A;  4B10 A;  3QAH A;  2K5T A;  4YGO A;  3TOA A;  5JPH A;  1QSM A;  4A31 A;  4ORF A;  2WSA A;  5KTA A;  2FE7 A;  4C2Z A;  2Z3O A;  1KZF A;  4XPD C;  5F47 A;  4U9Z A;  5DWN A;  5F49 A;  4H6U A;  5F48 A;  3TT2 A;  4MY0 A;  1M4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...