1NSLA

Crystal structure of probable acetyltransferase
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
180
structure length
176
Chain Sequence
GMFTCKVNEHITIRLLEPKDAERLAELIIQNQQRLGKWLFFSSADTYRETIIPDWRRQYADLNGIEAGLLYDGSLCGMISLHNLDQVNRKAEIGYWIAKEFEGKGIITAACRKLITYAFEELELNRVAICAAVGNEKSRAVPERIGFLEEGKARDGLYVNGMHHDLVYYSLLKREW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable acetyltransferase
publication title Crystal structure of Bacillus subtilis YdaF protein: A putative ribosomal N-acetyltransferase
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 47
structure length 176
sequence length 180
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2003-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1nslA00
3IGRA 4KOYA 1BOBA 3DNSA 3BLNA 1TIQA 2BL1A 2QIRA 3PGPA 1XMTA 2Q4YA 3KKWA 4KOWA 2P6GA 5IB0A 4H89A 4XPDB 2B4BA 2ZXVA 1IIDA 4QBJA 3GYAA 2R8VA 4R87A 3DR8A 4PK3A 4CRYB 5DWNA 1I1DA 3FRMA 2FL4A 2FSRA 4QB9A 5H84A 2RC4A 4UA3A 5CNPA 3EY5A 2PR1A 1YVOA 4PK2A 4KLWA 2Y0MA 4JD6A 1M4DA 3D2PA 5E96A 2J8RA 1IYLA 4CS0B 3OWCA 1YREA 2VQYA 5C88A 1XEBA 3BJ8A 4KLVA 2KCWA 4B5OA 3QAHA 1RO5A 2C27A 4AG7A 1YGHA 3R9GA 1S7LA 3TFYA 2Z11A 4PV6A 4KVXA 2EVNA 4YFJA 4AG9A 2BEIA 3RYOA 2R1IA 2J8NA 2Q7BA 2HQYA 4HNYB 4F0YA 1P0HA 2FCKA 2PDOA 3ZZIA 2R98A 1NMTA 3G3SA 3F8KA 2ZW4A 2B3VA 3PZJA 1YLEA 4NSQA 2D4PA 4AVAA 3BJ7A 2I79A 4H6UA 4JXQA 3CXPA 4XPDC 4U9YA 4MI4A 1CM0A 2AE6A 5ISVA 4RI1A 1P4NA 1WWZA 4OAEA 4IF5A 4II9A 4QUSA 1YX0A 4MJ8A 4R9MA 3TCVA 4AVCA 2JDDA 2X7BA 4U9ZA 5IV0A 5JPHA 3F5BA 5HMNA 2VBQA 1S7FA 4KORA 4KUBA 3TO9A 3EC4A 5DWMA 3V8IA 1N71A 3S6GA 3UY5A 2ZW5A 2OU2A 4H6ZA 5EBVA 5F49A 2PR8A 3SXNA 2P6EA 3QB8A 5KTAA 4I49A 4GS4A 1PU9A 4E8OA 3G8WA 5JQ4A 3EFAA 4M85A 1S7KA 3FYNA 2OB0A 3FB3A 2PC1A 3E0KA 1VHSA 2Q4VA 2A4NA 2CY2A 4NF1A 4E0AA 4K30A 3IWGA 4MY0A 2WPWA 2QECA 1I21A 4U5YA 3JUWA 3SHPA 1NE9A 4JWPA 1I12A 1XIXA 2HUZA 3FIXA 1LRZA 3JVNA 1Q2YA 5F48A 4MHDA 3R9EA 2J8MA 4ORFA 4R57A 4L8AA 4QC6A 5EC4A 3FNCA 2CNTA 4KOSA 1KUXA 4YRHA 3LD2A 2BSWA 2G3AA 2P6FA 1B6BA 1WK4A 2GE3A 3MGDA 1KZFA 4LX9A 2B58A 1IB1E 4FD7A 4KOUA 1S5KA 3DSBA 3FBUA 4XPLA 2VZYA 4KVOE 2IL4A 1YK3A 5C82A 2OZGA 1VKCA 4NXYA 2H5MA 5J8CA 4L89A 2REEA 3I9SA 1ON0A 3W91A 5F47A 5GCNA 2B5GA 4KOTA 1QSTA 4UWIA 2GIVA 2VI7A 3D3SA 4PSXA 4LUAA 3T9YA 3FXTA 2K5TA 5I0CA 1QSMA 3TE4A 3PP9A 4HNXB 2FIWA 3R96A 1RXTA 4XNHB 3S6FA 2JEVA 4KZTA 4NCZA 5FVJA 4YGOA 2OH1A 4OADA 3W6SA 3W6XA 1V0CA 3P2FA 3R95A 3P2HA 1PUAA 3I3GA 2Q44A 4IUSA 1B87A 4B5PA 2B4DA 4XPKA 3TOAA 3B8GA 4ZBGA 4JJXA 2Q0YA 1M44A 4Y49B 1Q2CA 4B5PB 2B4DB 4KOXA 5KTDA 2NMTA 1Y9KA 4HKFA 2GANA 2D4OA 2CNSA 1Q2DA 4CRZB 2EUIA 2QMLA 3DR6A 1BO4A 1CJWA 3TOBA 2VXKA 5J8FA 3LODA 1M4IA 2Z10A 4RS2A 5H86A 1IICA 2I00A 4EVYA 2ZPAA 4OLLA 3CXSA 4CAWA 4F6AA 1QSNA 3S6KA 2ARHA 2JLMA 4NEXA 4AB7A 4X5KA 1GHEA 1MJBA 3TO7A 3SXOA 2Q04A 4M3SA 4MY3A 2F5IA 4CAVA 2FT0A 1Z9UA 2FXFA 3S6HA 1Z4RA 3TTHA 2R7HA 1U6MA 3EXNA 1QSOA 4QVTA 3C26A 4XNHC 4KOVA 1NSLA 3DDDA 2G3TA 3VWDA 4BMHA 3D2MA 1MJ9A 1MJAA 5KTCA 2FIAA 2REFA 3F0AA 1IYKA 1M1DA 3T90A 5F46A 1SQHA 2P0WA 3R1KA 2BUEA 3WR7A 2G0BA 3R9FA 2DXQA 4Y49C 4AVBA 2O28A 3D8PA 2Z0ZA 2FS5A 1XF8A 2ATRA 1J4JA 4FD6A 2PRBA 2PQ8A 3N7ZA 1Y9WA 4JLYA 2PSWA 4KUAA 3VWEA 4KVME 4UBRA 1FY7A 1MK4A 2WPXA 1OZPA 2B5GB 3ZJ0A 1YR0A 1Z4EA 2JDCA 2ZW7A 4JXRA 4PSWA 4ONUA 1K4JA 2OZUA 3TO6A 4CAXA 2VZZA 3CXQA 2VEZA 1S7NA 3GY9A 1Y7RA 3NE7A 1L0CA 2ZW6A 1S60A 1KUYA 1QSRA 4DNCA 1KUVA 4HNWB 2CNMA 4E2AA 4J3GA 1YVKA 2AJ6A 4R3KA 2B3UA 1M4GA 3TT2A 2OZHA 3EO4A 1R57A 1UFHA 3GKRA 4MBUA 4UWJA 4R3LA 2FE7A 3H4QA 3K9UA 4FD5A 5HH1A 2HV2A 1XE4A 4FD4A 1S3ZA 5IX3A
chains in the Genus database with same CATH superfamily
3IGRA 4KOYA 4F9UA 5HVHA 1BOBA 2ZEGA 3BLNA 3DNSA 2GREA 4RUHA 1TIQA 4A2ZA 4MCSA 3IWEA 4OIDA 1YQEA 1Z5RA 1Y7EA 2BL1A 4B12A 2QIRA 4CAFA 5IB9A 1BPMA 3PGPA 1XMTA 2Q4YA 3KKWA 2P6GA 4KOWA 4TNUA 4H89A 5IB0A 4XPDB 4C2XA 2B4BA 3KHXA 4MCQA 2PJBA 4YWYA 1ZLIA 2ZXVA 1IIDA 4QBJA 3GYAA 2R8VA 4R87A 5HVGA 4LQGA 1Z8LA 2IJZA 5A28A 3DR8A 4PK3A 4CRYB 2XEJA 5DWNA 1I1DA 3FRMA 2FL4A 2FSRA 3LACA 4QB9A 1DE4C 1CP6A 2RC4A 4UA3A 5CNPA 1R3NA 5H84A 3EY5A 4UFWA 2PR1A 1YVOA 2PJAA 3B7IA 4PK2A 3FJUA 4KLWA 2DEAA 2Y0MA 4JD6A 1M4DA 3D2PA 5E96A 4P4IA 2AFSA 3PB6X 2J8RA 2PJ9A 1IYLA 2Q4ZA 4CS0B 3BHXA 3OWCA 4R6TA 4P45A 3I1UA 1YREA 2VQYA 2PJ8A 4UEEA 1TF9A 1XEBA 5AG5A 3PB8X 5C88A 3BJ8A 4KLVA 3IJ3A 2C6GA 2KCWA 2EO8A 3SJXA 4MRIA 4B5OA 4CPAA 2AFWA 3QAHA 1RO5A 2C27A 4Z65A 4F0XA 4AG7A 1YGHA 8CPAA 1QQ9A 1YMEA 4P6YA 3R9GA 1S7LA 2Q7SA 5K8PA 4MXUA 3TFYA 4MFQA 2WZNA 4UFVA 2Z11A 4MFJA 4PV6A 3PB4X 3QNVA 4KVXA 2V8DA 1S3ZA 2V8HA 1XRYA 2EVNA 4YFJA 4AG9A 2PVVA 3CPXA 1H8LA 2BEIA 3B3CA 3JTKA 4BD9A 2GLFA 3FH4A 2R1IA 3RYOA 5G20A 4CGNA 2IQ6A 2AFMA 2J8NA 2WYRA 4WWVA 4A37A 2Q7BA 1DTDA 2HQYA 4HNYB 1FT7A 4F0YA 1P0HA 4UCPA 2FCKA 3WC7A 2AFZA 2PDOA 3ZZIA 2R98A 3VATA 2V8GA 1NMTA 2QVPA 2DPTA 3G3SA 3F8KA 3RZAA 1LFWA 2B3VA 2ZW4A 4LQ6A 4OIWA 1XMBA 3GLJA 1YLEA 3PZJA 4NSQA 3PRTA 4A39A 1Q7LA 4EWTA 1CPSA 3B3TA 2Z3NA 3B35A 2D4PA 2EK9A 4M6GA 4X8IA 4AVAA 3BJ7A 2I79A 2C1CA 4H6UA 1ZG8A 3CPAA 4JXQA 3CXPA 4XPDC 1TKFA 3PBEA 2OOTA 1YW4A 4U9YA 4MI4A 4FBEA 1CM0A 2AE6A 1X12A 5ISVA 1ZO0A 4RI1A 5CBMA 3S9LA 1ELLP 4MHPA 1P4NA 1WWZA 3FMCA 4OAEA 4IF5A 4OP4A 4II9A 4QUSA 3D4UA 1YX0A 3PEIA 5K8NA 4A33A 4MJ8A 4R9MA 4UIAA 3TCVA 4AVCA 2JDDA 3BXMA 4C68A 2AFXA 2X7BA 5AG6A 3SJEA 4A38A 3NE8A 2ZOGA 3FF3A 1EE3P 4NJQA 2CTCA 4U9ZA 4B11A 5IV0A 5JPHA 3F5BA 5HMNA 1ELMP 3VH9A 4A30A 2VBQA 1S7FA 2RFHA 4KORA 4KUBA 4NGPA 3TO9A 3IC1A 1VHOA 3K9TA 1TXRA 3CT9A 5DS0A 3EC4A 5DWMA 3V8IA 1N71A 3S6GA 3PBBA 2EWBA 3UY5A 2ZW5A 2OU2A 4P4DA 4H6ZA 5EBVA 5F49A 2PR8A 2Z3PA 3SXNA 1AMPA 2P6EA 3QB8A 4X2TA 3D66A 3KASA 2IMOA 3KR5A 2GLJA 2GFQA 1CBXA 2PJ3A 3BI0A 4UFXA 5KTAA 1IOIA 4G1PA 4CGMA 4I49A 4ONWA 4CGOA 4GS4A 4MCRA 1PU9A 4E8OA 4ZI6A 3G8WA 5JQ4A 3EFAA 1LAPA 4JZ0A 4M85A 5F09A 1XJOA 1S7KA 3IWWA 3FYNA 4MMOA 2OB0A 3FB3A 2PC1A 1TKJA 3E0KA 1VHSA 3GB0A 2WUUA 4IAVA 2AFUA 2Q4VA 4PQAA 2CTBA 4R8FA 5G1ZA 2A4NA 4NGTA 2CY2A 4NF1A 2BOAA 2XEFA 3BI1A 4IHMA 4EFDA 2Q43A 1F57A 3B3WA 5LRJA 4E0AA 4M6HA 3D68A 4CGLA 4K30A 3IWGA 4MY0A 2WPWA 2QECA 2ZELA 1I21A 4U5YA 2V8VA 3JUWA 3SHPA 1NE9A 2ZEMA 2V77A 4JWPA 1I12A 1XIXA 2HUZA 3FIXA 2F7VA 1LRZA 4X3RA 2PRQA 3JVNA 4ZGYB 1BPNA 4P10A 4FWUA 1GYTA 1Q2YA 4KSFA 4MHDA 5F48A 3R9EA 2ZEOA 6CPAA 4NJRA 1PYTB 2J8MA 3HUVA 4M6IA 4ORFA 4R57A 2XEIA 4L8AA 4Q38A 4QC6A 5EC4A 5BWAB 1XBUA 2YNCA 2CNTA 3FNCA 4KOSA 1KUXA 3H8FA 4YRHA 2BSWA 2G3AA 2P6FA 1B6BA 3LD2A 1WK4A 2GE3A 4R7MA 3MGDA 1TKHA 3LWUA 1KZFA 4LX9A 2B58A 1IB1E 3FX6A 4FD7A 4KOUA 3NH5A 1BLLE 4YU9A 4NGRA 4TWEA 1S5KA 3D7HA 3DSBA 3FBUA 3IO1A 1YLOA 4MHNA 2ZEDA 4FAIA 4MHZA 4PPZA 2ZEHA 2Z3MA 2CIJA 3NFZA 4XPLA 4CGPA 3FECA 2VZYA 2C6PA 4KVOE 2IL4A 4MHYA 4NFRA 1YK3A 5C82A 1AYEA 2OZGA 2XEGA 1VKCA 3B3VA 4ZY2A 1PCAA 2ODFA 2H5MA 4NXYA 4L89A 5J8CA 2REEA 3I9SA 1ON0A 4P4JA 4FD4A 3D7GA 3W91A 5F47A 2PJ7A 3WC6A 2PJ6A 5GCNA 3QAYA 3B2YA 3IEHA 2Z3OA 3RO0A 3MN8A 2B5GA 4KOTA 4B13A 1R43A 1QSTA 2VL1A 4UWIA 2GIVA 1OBRA 2BO9A 2VI7A 2ZENA 4NGNA 4P4EA 3D3SA 4CAEA 4C7HA 3JRUA 3KZWA 4PSXA 2ZEPA 4LUAA 3T9YA 3FXTA 2BCOA 1A2ZA 2K5TA 5I0CA 1QSMA 3WABA 3IU1A 1YW6A 3TE4A 4PXDA 3PP9A 2YGWA 4HNXB 4CYQA 3T8WA 4RN7A 2FIWA 2RB7A 1F2OA 3R96A 1Y0RA 5CPAA 4DYOA 4PXCA 2OR4A 1RXTA 4XNHB 5G21A 3S6FA 2PCUA 1IGBA 4F9VA 2JEVA 3B3SA 1RTQA 4KZTA 4NCZA 4GM5A 3DGVA 3FEDA 4YGOA 2Z3KA 5FVJA 2OH1A 4OADA 3W6SA 3W6XA 1XOVA 3RBUA 1V0CA 3P2FA 3R95A 4CYNA 3WT4A 3P2HA 1Z2LA 2QJ8A 4BBHA 5LRKA 1PUAA 2PVWA 3H5ZA 3I3GA 4ZX8A 2ABZA 4OC5A 2Q44A 4IUSA 1B87A 5AGEA 4B5PA 2B4DA 2G9DA 2NYQA 4XPKA 5D29A 3N5FA 4B6ZA 4UF4A 3TOAA 5JGFA 2PIZA 3V38A 3B8GA 1LAMA 4ZBGA 4P4BA 4JJXA 2PIYA 2Q0YA 3SI1A 1M44A 5D8NA 4DJLA 3S9MA 4Y49B 2QYVA 3KI9A 1Q2CA 5ELYA 4B5PB 5JH9A 2B4DB 3H8GA 4KOXA 5KTDA 1TF8A 2NMTA 1Y9KA 4HKFA 2GANA 4NGMA 1LANA 4NGSA 1BAVA 2J9AA 2D4OA 2CNSA 2YNEA 2YNCC 1Q2DA 4CRZB 4CYPA 2EUIA 3NA6A 1IOFA 2PJ2A 2QMLA 3DR6A 3PFOA 1BO4A 1HDUA 1CJWA 2ZEEA 4BINA 3TOBA 3KR4A 3NH8A 4OKOA 2VXKA 5J8FA 3LODA 1M4IA 3FVLA 2Z10A 4ZY1A 4KSAA 4RS2A 3GUXA 1IICA 5H86A 2O53A 2I00A 4EVYA 2ZPAA 2Z3LA 5THWA 3IU2A 4OLLA 1AUGA 3CXSA 5HXDA 4IK2A 4MFKA 4CAWA 4F6AA 1QSNA 4C2YA 3S6KA 2ARHA 2AFOA 4ZX9A 2JLMA 4NEXA 4NGQA 1HEEA 4P44A 4OC0A 4X5KA 4A31A 4AB7A 5K8OA 1GHEA 1MJBA 3IFEA 3TO7A 3SXOA 2Q04A 3RAMA 5A27A 2JBKA 4M3SA 4A95A 2PJ4A 4MY3A 1F2PA 2F5IA 4CAVA 3S9NA 2FT0A 1Z9UA 2ANPA 5J1QA 2FXFA 3S6HA 1Z4RA 2JEWA 3D7FA 2R7HA 3D7DA 4OC4A 4UIBA 3TTHA 1U6MA 2HB6A 1QSOA 3EXNA 4QVTA 3C26A 3IIBA 4XNHC 4KOVA 3L2NA 3DLJA 2PJCA 1NSLA 3CDXA 3DDDA 2G3TA 4WJBA 3VWDA 4BMHA 3D2MA 3KQXA 4MFZA 1MJ9A 1MJAA 5KTCA 1CX8A 2FIAA 3MRUA 5LYDA 2REFA 4R76A 1UWYA 3F0AA 2CXAA 1IYKA 2FVGA 3GIUA 4B14A 1M1DA 3SJFA 2PE3A 2EBJA 3A9LA 3T90A 5F46A 4UCNA 4FUUA 1SQHA 2P0WA 2CF4A 2DF5A 2BUEA 3HLPA 2G0BA 3ISXA 3R1KA 3WR7A 3H8EA 3FEEA 3PFEA 1ARLA 4UEZA 2GU2A 3R9FA 1Z8TA 5AG7A 5I4MA 3RNZA 2DXQA 3SI2A 4Y49C 4JYWA 4AVBA 1CG2A 4MFPA 4C2ZA 2WSAA 2O28A 3D8PA 1IU8A 2Z0ZA 2C6CA 2FS5A 4GXHA 1XF8A 1ZLHA 2PJ5A 2ZOFA 4UEFA 3VARA 2ATRA 1VGYA 1NSAA 1J4JA 4F8ZA 4FD6A 2PRBA 2PQ8A 1QMUA 4C7IA 3ISZA 3N7ZA 3SJGA 1M4LA 1Y9WA 4JLYA 2PSWA 5LYLA 5HVFA 4KUAA 4P4FA 3VWEA 5EMIA 4A94A 4EMEA 4KVME 4UBRA 3V7ZA 1FY7A 1MK4A 2WPXA 1OZPA 3KHZA 2B5GB 4KS9A 3ZJ0A 2HC9A 1YR0A 3PB7X 1Z4EA 2EK8A 2JDCA 4OC2A 4W9YA 2PJ1A 4ZYQA 2ZW7A 4MCPA 3LMSA 7CPAA 1YSJA 4JXRA 4PSWA 4OC1A 4CYOA 5G22A 4ONUA 1K4JA 2OZUA 3TO6A 4Q7AA 4MFLA 1LCPA 4CAXA 4OC3A 3WC5A 1ZG9A 4O23A 1CPXA 3KGQA 2O4HA 5K8MA 1Z8WA 1ZG7A 2I3CA 2VZZA 2VEZA 3CXQA 3KL9A 4UCMA 4OMEA 1S7NA 4AXVA 1FNOA 3GY9A 4PXEA 1Y7RA 3NE7A 3KQZA 5AG4A 4H2KA 1L0CA 3K2KA 2ZW6A 5LYIA 3TC8A 1S60A 1KUYA 1QSRA 4DNCA 3TX8A 1KUVA 4HNWB 2PJ0A 2CNMA 1KWMA 4E2AA 3D67A 1ARMA 4J3GA 1HDQA 1YVKA 3PB9X 1XFOA 1Z8XA 1JQGA 4R3KA 2B3UA 4B10A 1M4GA 1VHEA 5LRGA 3TT2A 4Q36A 2NSMA 2OZHA 2YNDA 2ZEFA 4K3NA 3EO4A 3NH4A 3SI0A 1R57A 1IY7A 1UFHA 3GKRA 5JM6A 4KSIA 4ZY0A 2JBJA 1X10A 4HPSA 4MBUA 4UWJA 1VIXA 1JWQA 4R3LA 4PXBA 1CP7A 1LOKA 2FE7A 2F8HA 3H4QA 3K9UA 4FD5A 4DUKA 5HH1A 5LYFA 1Y0YA 2HV2A 3CZXA 1XE4A 2AJ6A 2Q51A 2DPSA 5IX3A 4A32A 2POKA
chains in the Genus database with same CATH topology
3IGRA 4KOYA 1BOBA 3DNSA 3BLNA 1TIQA 4A2ZA 3IWEA 4B12A 2BL1A 4CAFA 2QIRA 3PGPA 1XMTA 2Q4YA 3KKWA 2P6GA 4KOWA 5IB0A 4H89A 4XPDB 4C2XA 2B4BA 2ZXVA 1IIDA 4QBJA 3GYAA 2R8VA 4R87A 5A28A 3DR8A 4PK3A 4CRYB 5DWNA 1I1DA 3FRMA 2FL4A 2FSRA 4QB9A 5H84A 2RC4A 4UA3A 5CNPA 3EY5A 4UFWA 2PR1A 1YVOA 4PK2A 4KLWA 2Y0MA 4JD6A 1M4DA 3D2PA 5E96A 2J8RA 1IYLA 4CS0B 3OWCA 1YREA 2VQYA 5AG5A 1XEBA 5C88A 3BJ8A 4KLVA 2KCWA 4B5OA 3QAHA 1RO5A 2C27A 4F0XA 4AG7A 1YGHA 3R9GA 1S7LA 3TFYA 4MFQA 4UFVA 2Z11A 4MFJA 4PV6A 4KVXA 2DPSA 2EVNA 4YFJA 4AG9A 2BEIA 3JTKA 3RYOA 2R1IA 5G20A 4CGNA 2J8NA 2Q7BA 2HQYA 4HNYB 4F0YA 1P0HA 4UCPA 2FCKA 2PDOA 3ZZIA 2R98A 1NMTA 3G3SA 2DPTA 3F8KA 2ZW4A 2B3VA 3PZJA 1YLEA 4NSQA 2Z3NA 2D4PA 4AVAA 4JXQA 2I79A 3BJ7A 4H6UA 3CXPA 4XPDC 4U9YA 4MI4A 1CM0A 2AE6A 5ISVA 1ZO0A 4RI1A 1P4NA 1WWZA 4OAEA 4IF5A 4II9A 4QUSA 1YX0A 4A33A 4MJ8A 4R9MA 3TCVA 4AVCA 2JDDA 4C68A 2X7BA 5AG6A 4B11A 4U9ZA 5IV0A 5JPHA 3F5BA 5HMNA 4A30A 2VBQA 1S7FA 4KORA 4KUBA 3TO9A 3EC4A 5DWMA 3V8IA 1N71A 3S6GA 3UY5A 2ZW5A 2OU2A 4H6ZA 5EBVA 5F49A 2PR8A 2Z3PA 3SXNA 2P6EA 3QB8A 4UFXA 5KTAA 4CGMA 4CGOA 4I49A 4GS4A 1PU9A 4E8OA 3G8WA 5JQ4A 3EFAA 4M85A 1S7KA 3FYNA 2OB0A 3FB3A 2PC1A 3E0KA 1VHSA 2WUUA 2Q4VA 5G1ZA 2A4NA 2CY2A 4NF1A 4E0AA 4K30A 3IWGA 4MY0A 2WPWA 2QECA 1I21A 4U5YA 3JUWA 3SHPA 1NE9A 4JWPA 1I12A 1XIXA 2HUZA 3FIXA 1LRZA 3JVNA 4ZGYB 1Q2YA 4KSFA 5F48A 4MHDA 3R9EA 2J8MA 4ORFA 4R57A 4L8AA 4Q38A 4QC6A 5EC4A 5BWAB 3FNCA 2CNTA 2YNCA 4KOSA 1KUXA 4YRHA 3LD2A 2BSWA 2G3AA 2P6FA 1B6BA 1WK4A 2GE3A 3MGDA 1KZFA 4LX9A 2B58A 1IB1E 4FD7A 4KOUA 1S5KA 3DSBA 3FBUA 2Z3MA 4XPLA 4CGPA 2VZYA 4KVOE 2IL4A 1YK3A 5C82A 2OZGA 1VKCA 4NXYA 2H5MA 5J8CA 4L89A 2REEA 3I9SA 1ON0A 3W91A 5F47A 5GCNA 2Z3OA 4B13A 2B5GA 4KOTA 1QSTA 4UWIA 2GIVA 4CGLA 2VI7A 4C7HA 4CAEA 3D3SA 4PSXA 4LUAA 3T9YA 3FXTA 2K5TA 5I0CA 1QSMA 3IU1A 3TE4A 3PP9A 2YGWA 4HNXB 4CYQA 2FIWA 3R96A 1RXTA 4XNHB 5G21A 3S6FA 2JEVA 4KZTA 4NCZA 5FVJA 4YGOA 2Z3KA 2OH1A 4OADA 3W6SA 3W6XA 1V0CA 3P2FA 3R95A 4CYNA 3P2HA 4BBHA 1PUAA 3H5ZA 3I3GA 2Q44A 4IUSA 1B87A 5AGEA 4B5PA 2B4DA 4XPKA 3TOAA 3B8GA 4ZBGA 4JJXA 2Q0YA 1M44A 4Y49B 1Q2CA 4B5PB 2B4DB 4KOXA 5KTDA 2NMTA 1Y9KA 4HKFA 2GANA 2D4OA 2CNSA 2YNEA 2YNCC 1Q2DA 4CRZB 4CYPA 2EUIA 2QMLA 3DR6A 1BO4A 1CJWA 3TOBA 2VXKA 5J8FA 3LODA 1M4IA 2Z10A 4KSAA 4RS2A 5H86A 1IICA 2I00A 4EVYA 2ZPAA 2Z3LA 3IU2A 4OLLA 3CXSA 4MFKA 4CAWA 4F6AA 1QSNA 4C2YA 3S6KA 2ARHA 2JLMA 4NEXA 4A31A 4AB7A 4X5KA 1GHEA 1MJBA 3TO7A 3SXOA 2Q04A 5A27A 4M3SA 4A95A 4MY3A 2F5IA 4CAVA 2FT0A 1Z9UA 2FXFA 3S6HA 1Z4RA 3TTHA 2R7HA 1U6MA 3EXNA 1QSOA 4QVTA 3C26A 4XNHC 4KOVA 1NSLA 3DDDA 2G3TA 3VWDA 4BMHA 3D2MA 4MFZA 1MJ9A 1MJAA 5KTCA 2FIAA 2REFA 3F0AA 2CXAA 1IYKA 4B14A 1M1DA 3A9LA 3T90A 5F46A 4UCNA 1SQHA 2P0WA 3R1KA 2BUEA 3WR7A 2G0BA 3R9FA 5AG7A 2DXQA 4Y49C 4AVBA 4MFPA 4C2ZA 2WSAA 2O28A 3D8PA 2Z0ZA 2FS5A 1XF8A 2ATRA 1J4JA 4FD6A 2PRBA 2PQ8A 4C7IA 3N7ZA 1Y9WA 4JLYA 2PSWA 4KUAA 3VWEA 4KVME 4UBRA 1FY7A 1MK4A 2WPXA 1OZPA 2B5GB 4KS9A 3ZJ0A 1YR0A 1Z4EA 2JDCA 2ZW7A 4JXRA 4PSWA 4CYOA 5G22A 4ONUA 1K4JA 2OZUA 3TO6A 4CAXA 4MFLA 2VZZA 3CXQA 2VEZA 4UCMA 1S7NA 3GY9A 1Y7RA 3NE7A 5AG4A 1L0CA 2ZW6A 1S60A 1KUYA 1QSRA 4DNCA 1KUVA 4HNWB 2CNMA 4E2AA 4J3GA 1YVKA 2AJ6A 4R3KA 2B3UA 4B10A 1M4GA 3TT2A 4Q36A 2OZHA 2YNDA 3EO4A 1R57A 1UFHA 3GKRA 4MBUA 4UWJA 4R3LA 2FE7A 3H4QA 3K9UA 4FD5A 5HH1A 2HV2A 1XE4A 4FD4A 1S3ZA 5IX3A 4A32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IGR A;  4KOY A;  1BOB A;  3DNS A;  3BLN A;  1TIQ A;  2BL1 A;  2QIR A;  3PGP A;  1XMT A;  2Q4Y A;  3KKW A;  4KOW A;  2P6G A;  5IB0 A;  4H89 A;  4XPD B;  2B4B A;  2ZXV A;  1IID A;  4QBJ A;  3GYA A;  2R8V A;  4R87 A;  3DR8 A;  4PK3 A;  4CRY B;  5DWN A;  1I1D A;  3FRM A;  2FL4 A;  2FSR A;  4QB9 A;  5H84 A;  2RC4 A;  4UA3 A;  5CNP A;  3EY5 A;  2PR1 A;  1YVO A;  4PK2 A;  4KLW A;  2Y0M A;  4JD6 A;  1M4D A;  3D2P A;  5E96 A;  2J8R A;  1IYL A;  4CS0 B;  3OWC A;  1YRE A;  2VQY A;  5C88 A;  1XEB A;  3BJ8 A;  4KLV A;  2KCW A;  4B5O A;  3QAH A;  1RO5 A;  2C27 A;  4AG7 A;  1YGH A;  3R9G A;  1S7L A;  3TFY A;  2Z11 A;  4PV6 A;  4KVX A;  2EVN A;  4YFJ A;  4AG9 A;  2BEI A;  3RYO A;  2R1I A;  2J8N A;  2Q7B A;  2HQY A;  4HNY B;  4F0Y A;  1P0H A;  2FCK A;  2PDO A;  3ZZI A;  2R98 A;  1NMT A;  3G3S A;  3F8K A;  2ZW4 A;  2B3V A;  3PZJ A;  1YLE A;  4NSQ A;  2D4P A;  4AVA A;  3BJ7 A;  2I79 A;  4H6U A;  4JXQ A;  3CXP A;  4XPD C;  4U9Y A;  4MI4 A;  1CM0 A;  2AE6 A;  5ISV A;  4RI1 A;  1P4N A;  1WWZ A;  4OAE A;  4IF5 A;  4II9 A;  4QUS A;  1YX0 A;  4MJ8 A;  4R9M A;  3TCV A;  4AVC A;  2JDD A;  2X7B A;  4U9Z A;  5IV0 A;  5JPH A;  3F5B A;  5HMN A;  2VBQ A;  1S7F A;  4KOR A;  4KUB A;  3TO9 A;  3EC4 A;  5DWM A;  3V8I A;  1N71 A;  3S6G A;  3UY5 A;  2ZW5 A;  2OU2 A;  4H6Z A;  5EBV A;  5F49 A;  2PR8 A;  3SXN A;  2P6E A;  3QB8 A;  5KTA A;  4I49 A;  4GS4 A;  1PU9 A;  4E8O A;  3G8W A;  5JQ4 A;  3EFA A;  4M85 A;  1S7K A;  3FYN A;  2OB0 A;  3FB3 A;  2PC1 A;  3E0K A;  1VHS A;  2Q4V A;  2A4N A;  2CY2 A;  4NF1 A;  4E0A A;  4K30 A;  3IWG A;  4MY0 A;  2WPW A;  2QEC A;  1I21 A;  4U5Y A;  3JUW A;  3SHP A;  1NE9 A;  4JWP A;  1I12 A;  1XIX A;  2HUZ A;  3FIX A;  1LRZ A;  3JVN A;  1Q2Y A;  5F48 A;  4MHD A;  3R9E A;  2J8M A;  4ORF A;  4R57 A;  4L8A A;  4QC6 A;  5EC4 A;  3FNC A;  2CNT A;  4KOS A;  1KUX A;  4YRH A;  3LD2 A;  2BSW A;  2G3A A;  2P6F A;  1B6B A;  1WK4 A;  2GE3 A;  3MGD A;  1KZF A;  4LX9 A;  2B58 A;  1IB1 E;  4FD7 A;  4KOU A;  1S5K A;  3DSB A;  3FBU A;  4XPL A;  2VZY A;  4KVO E;  2IL4 A;  1YK3 A;  5C82 A;  2OZG A;  1VKC A;  4NXY A;  2H5M A;  5J8C A;  4L89 A;  2REE A;  3I9S A;  1ON0 A;  3W91 A;  5F47 A;  5GCN A;  2B5G A;  4KOT A;  1QST A;  4UWI A;  2GIV A;  2VI7 A;  3D3S A;  4PSX A;  4LUA A;  3T9Y A;  3FXT A;  2K5T A;  5I0C A;  1QSM A;  3TE4 A;  3PP9 A;  4HNX B;  2FIW A;  3R96 A;  1RXT A;  4XNH B;  3S6F A;  2JEV A;  4KZT A;  4NCZ A;  5FVJ A;  4YGO A;  2OH1 A;  4OAD A;  3W6S A;  3W6X A;  1V0C A;  3P2F A;  3R95 A;  3P2H A;  1PUA A;  3I3G A;  2Q44 A;  4IUS A;  1B87 A;  4B5P A;  2B4D A;  4XPK A;  3TOA A;  3B8G A;  4ZBG A;  4JJX A;  2Q0Y A;  1M44 A;  4Y49 B;  1Q2C A;  4B5P B;  2B4D B;  4KOX A;  5KTD A;  2NMT A;  1Y9K A;  4HKF A;  2GAN A;  2D4O A;  2CNS A;  1Q2D A;  4CRZ B;  2EUI A;  2QML A;  3DR6 A;  1BO4 A;  1CJW A;  3TOB A;  2VXK A;  5J8F A;  3LOD A;  1M4I A;  2Z10 A;  4RS2 A;  5H86 A;  1IIC A;  2I00 A;  4EVY A;  2ZPA A;  4OLL A;  3CXS A;  4CAW A;  4F6A A;  1QSN A;  3S6K A;  2ARH A;  2JLM A;  4NEX A;  4AB7 A;  4X5K A;  1GHE A;  1MJB A;  3TO7 A;  3SXO A;  2Q04 A;  4M3S A;  4MY3 A;  2F5I A;  4CAV A;  2FT0 A;  1Z9U A;  2FXF A;  3S6H A;  1Z4R A;  3TTH A;  2R7H A;  1U6M A;  3EXN A;  1QSO A;  4QVT A;  3C26 A;  4XNH C;  4KOV A;  1NSL A;  3DDD A;  2G3T A;  3VWD A;  4BMH A;  3D2M A;  1MJ9 A;  1MJA A;  5KTC A;  2FIA A;  2REF A;  3F0A A;  1IYK A;  1M1D A;  3T90 A;  5F46 A;  1SQH A;  2P0W A;  3R1K A;  2BUE A;  3WR7 A;  2G0B A;  3R9F A;  2DXQ A;  4Y49 C;  4AVB A;  2O28 A;  3D8P A;  2Z0Z A;  2FS5 A;  1XF8 A;  2ATR A;  1J4J A;  4FD6 A;  2PRB A;  2PQ8 A;  3N7Z A;  1Y9W A;  4JLY A;  2PSW A;  4KUA A;  3VWE A;  4KVM E;  4UBR A;  1FY7 A;  1MK4 A;  2WPX A;  1OZP A;  2B5G B;  3ZJ0 A;  1YR0 A;  1Z4E A;  2JDC A;  2ZW7 A;  4JXR A;  4PSW A;  4ONU A;  1K4J A;  2OZU A;  3TO6 A;  4CAX A;  2VZZ A;  3CXQ A;  2VEZ A;  1S7N A;  3GY9 A;  1Y7R A;  3NE7 A;  1L0C A;  2ZW6 A;  1S60 A;  1KUY A;  1QSR A;  4DNC A;  1KUV A;  4HNW B;  2CNM A;  4E2A A;  4J3G A;  1YVK A;  2AJ6 A;  4R3K A;  2B3U A;  1M4G A;  3TT2 A;  2OZH A;  3EO4 A;  1R57 A;  1UFH A;  3GKR A;  4MBU A;  4UWJ A;  4R3L A;  2FE7 A;  3H4Q A;  3K9U A;  4FD5 A;  5HH1 A;  2HV2 A;  1XE4 A;  4FD4 A;  1S3Z A;  5IX3 A; 
#chains in the Genus database with same CATH topology
 3IGR A;  4KOY A;  4F9U A;  5HVH A;  1BOB A;  2ZEG A;  3BLN A;  3DNS A;  2GRE A;  4RUH A;  1TIQ A;  4A2Z A;  4MCS A;  3IWE A;  4OID A;  1YQE A;  1Z5R A;  1Y7E A;  2BL1 A;  4B12 A;  2QIR A;  4CAF A;  5IB9 A;  1BPM A;  3PGP A;  1XMT A;  2Q4Y A;  3KKW A;  2P6G A;  4KOW A;  4TNU A;  4H89 A;  5IB0 A;  4XPD B;  4C2X A;  2B4B A;  3KHX A;  4MCQ A;  2PJB A;  4YWY A;  1ZLI A;  2ZXV A;  1IID A;  4QBJ A;  3GYA A;  2R8V A;  4R87 A;  5HVG A;  4LQG A;  1Z8L A;  2IJZ A;  5A28 A;  3DR8 A;  4PK3 A;  4CRY B;  2XEJ A;  5DWN A;  1I1D A;  3FRM A;  2FL4 A;  2FSR A;  3LAC A;  4QB9 A;  1DE4 C;  1CP6 A;  2RC4 A;  4UA3 A;  5CNP A;  1R3N A;  5H84 A;  3EY5 A;  4UFW A;  2PR1 A;  1YVO A;  2PJA A;  3B7I A;  4PK2 A;  3FJU A;  4KLW A;  2DEA A;  2Y0M A;  4JD6 A;  1M4D A;  3D2P A;  5E96 A;  4P4I A;  2AFS A;  3PB6 X;  2J8R A;  2PJ9 A;  1IYL A;  2Q4Z A;  4CS0 B;  3BHX A;  3OWC A;  4R6T A;  4P45 A;  3I1U A;  1YRE A;  2VQY A;  2PJ8 A;  4UEE A;  1TF9 A;  1XEB A;  5AG5 A;  3PB8 X;  5C88 A;  3BJ8 A;  4KLV A;  3IJ3 A;  2C6G A;  2KCW A;  2EO8 A;  3SJX A;  4MRI A;  4B5O A;  4CPA A;  2AFW A;  3QAH A;  1RO5 A;  2C27 A;  4Z65 A;  4F0X A;  4AG7 A;  1YGH A;  8CPA A;  1QQ9 A;  1YME A;  4P6Y A;  3R9G A;  1S7L A;  2Q7S A;  5K8P A;  4MXU A;  3TFY A;  4MFQ A;  2WZN A;  4UFV A;  2Z11 A;  4MFJ A;  4PV6 A;  3PB4 X;  3QNV A;  4KVX A;  2V8D A;  1S3Z A;  2V8H A;  1XRY A;  2EVN A;  4YFJ A;  4AG9 A;  2PVV A;  3CPX A;  1H8L A;  2BEI A;  3B3C A;  3JTK A;  4BD9 A;  2GLF A;  3FH4 A;  2R1I A;  3RYO A;  5G20 A;  4CGN A;  2IQ6 A;  2AFM A;  2J8N A;  2WYR A;  4WWV A;  4A37 A;  2Q7B A;  1DTD A;  2HQY A;  4HNY B;  1FT7 A;  4F0Y A;  1P0H A;  4UCP A;  2FCK A;  3WC7 A;  2AFZ A;  2PDO A;  3ZZI A;  2R98 A;  3VAT A;  2V8G A;  1NMT A;  2QVP A;  2DPT A;  3G3S A;  3F8K A;  3RZA A;  1LFW A;  2B3V A;  2ZW4 A;  4LQ6 A;  4OIW A;  1XMB A;  3GLJ A;  1YLE A;  3PZJ A;  4NSQ A;  3PRT A;  4A39 A;  1Q7L A;  4EWT A;  1CPS A;  3B3T A;  2Z3N A;  3B35 A;  2D4P A;  2EK9 A;  4M6G A;  4X8I A;  4AVA A;  3BJ7 A;  2I79 A;  2C1C A;  4H6U A;  1ZG8 A;  3CPA A;  4JXQ A;  3CXP A;  4XPD C;  1TKF A;  3PBE A;  2OOT A;  1YW4 A;  4U9Y A;  4MI4 A;  4FBE A;  1CM0 A;  2AE6 A;  1X12 A;  5ISV A;  1ZO0 A;  4RI1 A;  5CBM A;  3S9L A;  1ELL P;  4MHP A;  1P4N A;  1WWZ A;  3FMC A;  4OAE A;  4IF5 A;  4OP4 A;  4II9 A;  4QUS A;  3D4U A;  1YX0 A;  3PEI A;  5K8N A;  4A33 A;  4MJ8 A;  4R9M A;  4UIA A;  3TCV A;  4AVC A;  2JDD A;  3BXM A;  4C68 A;  2AFX A;  2X7B A;  5AG6 A;  3SJE A;  4A38 A;  3NE8 A;  2ZOG A;  3FF3 A;  1EE3 P;  4NJQ A;  2CTC A;  4U9Z A;  4B11 A;  5IV0 A;  5JPH A;  3F5B A;  5HMN A;  1ELM P;  3VH9 A;  4A30 A;  2VBQ A;  1S7F A;  2RFH A;  4KOR A;  4KUB A;  4NGP A;  3TO9 A;  3IC1 A;  1VHO A;  3K9T A;  1TXR A;  3CT9 A;  5DS0 A;  3EC4 A;  5DWM A;  3V8I A;  1N71 A;  3S6G A;  3PBB A;  2EWB A;  3UY5 A;  2ZW5 A;  2OU2 A;  4P4D A;  4H6Z A;  5EBV A;  5F49 A;  2PR8 A;  2Z3P A;  3SXN A;  1AMP A;  2P6E A;  3QB8 A;  4X2T A;  3D66 A;  3KAS A;  2IMO A;  3KR5 A;  2GLJ A;  2GFQ A;  1CBX A;  2PJ3 A;  3BI0 A;  4UFX A;  5KTA A;  1IOI A;  4G1P A;  4CGM A;  4I49 A;  4ONW A;  4CGO A;  4GS4 A;  4MCR A;  1PU9 A;  4E8O A;  4ZI6 A;  3G8W A;  5JQ4 A;  3EFA A;  1LAP A;  4JZ0 A;  4M85 A;  5F09 A;  1XJO A;  1S7K A;  3IWW A;  3FYN A;  4MMO A;  2OB0 A;  3FB3 A;  2PC1 A;  1TKJ A;  3E0K A;  1VHS A;  3GB0 A;  2WUU A;  4IAV A;  2AFU A;  2Q4V A;  4PQA A;  2CTB A;  4R8F A;  5G1Z A;  2A4N A;  4NGT A;  2CY2 A;  4NF1 A;  2BOA A;  2XEF A;  3BI1 A;  4IHM A;  4EFD A;  2Q43 A;  1F57 A;  3B3W A;  5LRJ A;  4E0A A;  4M6H A;  3D68 A;  4CGL A;  4K30 A;  3IWG A;  4MY0 A;  2WPW A;  2QEC A;  2ZEL A;  1I21 A;  4U5Y A;  2V8V A;  3JUW A;  3SHP A;  1NE9 A;  2ZEM A;  2V77 A;  4JWP A;  1I12 A;  1XIX A;  2HUZ A;  3FIX A;  2F7V A;  1LRZ A;  4X3R A;  2PRQ A;  3JVN A;  4ZGY B;  1BPN A;  4P10 A;  4FWU A;  1GYT A;  1Q2Y A;  4KSF A;  4MHD A;  5F48 A;  3R9E A;  2ZEO A;  6CPA A;  4NJR A;  1PYT B;  2J8M A;  3HUV A;  4M6I A;  4ORF A;  4R57 A;  2XEI A;  4L8A A;  4Q38 A;  4QC6 A;  5EC4 A;  5BWA B;  1XBU A;  2YNC A;  2CNT A;  3FNC A;  4KOS A;  1KUX A;  3H8F A;  4YRH A;  2BSW A;  2G3A A;  2P6F A;  1B6B A;  3LD2 A;  1WK4 A;  2GE3 A;  4R7M A;  3MGD A;  1TKH A;  3LWU A;  1KZF A;  4LX9 A;  2B58 A;  1IB1 E;  3FX6 A;  4FD7 A;  4KOU A;  3NH5 A;  1BLL E;  4YU9 A;  4NGR A;  4TWE A;  1S5K A;  3D7H A;  3DSB A;  3FBU A;  3IO1 A;  1YLO A;  4MHN A;  2ZED A;  4FAI A;  4MHZ A;  4PPZ A;  2ZEH A;  2Z3M A;  2CIJ A;  3NFZ A;  4XPL A;  4CGP A;  3FEC A;  2VZY A;  2C6P A;  4KVO E;  2IL4 A;  4MHY A;  4NFR A;  1YK3 A;  5C82 A;  1AYE A;  2OZG A;  2XEG A;  1VKC A;  3B3V A;  4ZY2 A;  1PCA A;  2ODF A;  2H5M A;  4NXY A;  4L89 A;  5J8C A;  2REE A;  3I9S A;  1ON0 A;  4P4J A;  4FD4 A;  3D7G A;  3W91 A;  5F47 A;  2PJ7 A;  3WC6 A;  2PJ6 A;  5GCN A;  3QAY A;  3B2Y A;  3IEH A;  2Z3O A;  3RO0 A;  3MN8 A;  2B5G A;  4KOT A;  4B13 A;  1R43 A;  1QST A;  2VL1 A;  4UWI A;  2GIV A;  1OBR A;  2BO9 A;  2VI7 A;  2ZEN A;  4NGN A;  4P4E A;  3D3S A;  4CAE A;  4C7H A;  3JRU A;  3KZW A;  4PSX A;  2ZEP A;  4LUA A;  3T9Y A;  3FXT A;  2BCO A;  1A2Z A;  2K5T A;  5I0C A;  1QSM A;  3WAB A;  3IU1 A;  1YW6 A;  3TE4 A;  4PXD A;  3PP9 A;  2YGW A;  4HNX B;  4CYQ A;  3T8W A;  4RN7 A;  2FIW A;  2RB7 A;  1F2O A;  3R96 A;  1Y0R A;  5CPA A;  4DYO A;  4PXC A;  2OR4 A;  1RXT A;  4XNH B;  5G21 A;  3S6F A;  2PCU A;  1IGB A;  4F9V A;  2JEV A;  3B3S A;  1RTQ A;  4KZT A;  4NCZ A;  4GM5 A;  3DGV A;  3FED A;  4YGO A;  2Z3K A;  5FVJ A;  2OH1 A;  4OAD A;  3W6S A;  3W6X A;  1XOV A;  3RBU A;  1V0C A;  3P2F A;  3R95 A;  4CYN A;  3WT4 A;  3P2H A;  1Z2L A;  2QJ8 A;  4BBH A;  5LRK A;  1PUA A;  2PVW A;  3H5Z A;  3I3G A;  4ZX8 A;  2ABZ A;  4OC5 A;  2Q44 A;  4IUS A;  1B87 A;  5AGE A;  4B5P A;  2B4D A;  2G9D A;  2NYQ A;  4XPK A;  5D29 A;  3N5F A;  4B6Z A;  4UF4 A;  3TOA A;  5JGF A;  2PIZ A;  3V38 A;  3B8G A;  1LAM A;  4ZBG A;  4P4B A;  4JJX A;  2PIY A;  2Q0Y A;  3SI1 A;  1M44 A;  5D8N A;  4DJL A;  3S9M A;  4Y49 B;  2QYV A;  3KI9 A;  1Q2C A;  5ELY A;  4B5P B;  5JH9 A;  2B4D B;  3H8G A;  4KOX A;  5KTD A;  1TF8 A;  2NMT A;  1Y9K A;  4HKF A;  2GAN A;  4NGM A;  1LAN A;  4NGS A;  1BAV A;  2J9A A;  2D4O A;  2CNS A;  2YNE A;  2YNC C;  1Q2D A;  4CRZ B;  4CYP A;  2EUI A;  3NA6 A;  1IOF A;  2PJ2 A;  2QML A;  3DR6 A;  3PFO A;  1BO4 A;  1HDU A;  1CJW A;  2ZEE A;  4BIN A;  3TOB A;  3KR4 A;  3NH8 A;  4OKO A;  2VXK A;  5J8F A;  3LOD A;  1M4I A;  3FVL A;  2Z10 A;  4ZY1 A;  4KSA A;  4RS2 A;  3GUX A;  1IIC A;  5H86 A;  2O53 A;  2I00 A;  4EVY A;  2ZPA A;  2Z3L A;  5THW A;  3IU2 A;  4OLL A;  1AUG A;  3CXS A;  5HXD A;  4IK2 A;  4MFK A;  4CAW A;  4F6A A;  1QSN A;  4C2Y A;  3S6K A;  2ARH A;  2AFO A;  4ZX9 A;  2JLM A;  4NEX A;  4NGQ A;  1HEE A;  4P44 A;  4OC0 A;  4X5K A;  4A31 A;  4AB7 A;  5K8O A;  1GHE A;  1MJB A;  3IFE A;  3TO7 A;  3SXO A;  2Q04 A;  3RAM A;  5A27 A;  2JBK A;  4M3S A;  4A95 A;  2PJ4 A;  4MY3 A;  1F2P A;  2F5I A;  4CAV A;  3S9N A;  2FT0 A;  1Z9U A;  2ANP A;  5J1Q A;  2FXF A;  3S6H A;  1Z4R A;  2JEW A;  3D7F A;  2R7H A;  3D7D A;  4OC4 A;  4UIB A;  3TTH A;  1U6M A;  2HB6 A;  1QSO A;  3EXN A;  4QVT A;  3C26 A;  3IIB A;  4XNH C;  4KOV A;  3L2N A;  3DLJ A;  2PJC A;  1NSL A;  3CDX A;  3DDD A;  2G3T A;  4WJB A;  3VWD A;  4BMH A;  3D2M A;  3KQX A;  4MFZ A;  1MJ9 A;  1MJA A;  5KTC A;  1CX8 A;  2FIA A;  3MRU A;  5LYD A;  2REF A;  4R76 A;  1UWY A;  3F0A A;  2CXA A;  1IYK A;  2FVG A;  3GIU A;  4B14 A;  1M1D A;  3SJF A;  2PE3 A;  2EBJ A;  3A9L A;  3T90 A;  5F46 A;  4UCN A;  4FUU A;  1SQH A;  2P0W A;  2CF4 A;  2DF5 A;  2BUE A;  3HLP A;  2G0B A;  3ISX A;  3R1K A;  3WR7 A;  3H8E A;  3FEE A;  3PFE A;  1ARL A;  4UEZ A;  2GU2 A;  3R9F A;  1Z8T A;  5AG7 A;  5I4M A;  3RNZ A;  2DXQ A;  3SI2 A;  4Y49 C;  4JYW A;  4AVB A;  1CG2 A;  4MFP A;  4C2Z A;  2WSA A;  2O28 A;  3D8P A;  1IU8 A;  2Z0Z A;  2C6C A;  2FS5 A;  4GXH A;  1XF8 A;  1ZLH A;  2PJ5 A;  2ZOF A;  4UEF A;  3VAR A;  2ATR A;  1VGY A;  1NSA A;  1J4J A;  4F8Z A;  4FD6 A;  2PRB A;  2PQ8 A;  1QMU A;  4C7I A;  3ISZ A;  3N7Z A;  3SJG A;  1M4L A;  1Y9W A;  4JLY A;  2PSW A;  5LYL A;  5HVF A;  4KUA A;  4P4F A;  3VWE A;  5EMI A;  4A94 A;  4EME A;  4KVM E;  4UBR A;  3V7Z A;  1FY7 A;  1MK4 A;  2WPX A;  1OZP A;  3KHZ A;  2B5G B;  4KS9 A;  3ZJ0 A;  2HC9 A;  1YR0 A;  3PB7 X;  1Z4E A;  2EK8 A;  2JDC A;  4OC2 A;  4W9Y A;  2PJ1 A;  4ZYQ A;  2ZW7 A;  4MCP A;  3LMS A;  7CPA A;  1YSJ A;  4JXR A;  4PSW A;  4OC1 A;  4CYO A;  5G22 A;  4ONU A;  1K4J A;  2OZU A;  3TO6 A;  4Q7A A;  4MFL A;  1LCP A;  4CAX A;  4OC3 A;  3WC5 A;  1ZG9 A;  4O23 A;  1CPX A;  3KGQ A;  2O4H A;  5K8M A;  1Z8W A;  1ZG7 A;  2I3C A;  2VZZ A;  2VEZ A;  3CXQ A;  3KL9 A;  4UCM A;  4OME A;  1S7N A;  4AXV A;  1FNO A;  3GY9 A;  4PXE A;  1Y7R A;  3NE7 A;  3KQZ A;  5AG4 A;  4H2K A;  1L0C A;  3K2K A;  2ZW6 A;  5LYI A;  3TC8 A;  1S60 A;  1KUY A;  1QSR A;  4DNC A;  3TX8 A;  1KUV A;  4HNW B;  2PJ0 A;  2CNM A;  1KWM A;  4E2A A;  3D67 A;  1ARM A;  4J3G A;  1HDQ A;  1YVK A;  3PB9 X;  1XFO A;  1Z8X A;  1JQG A;  4R3K A;  2B3U A;  4B10 A;  1M4G A;  1VHE A;  5LRG A;  3TT2 A;  4Q36 A;  2NSM A;  2OZH A;  2YND A;  2ZEF A;  4K3N A;  3EO4 A;  3NH4 A;  3SI0 A;  1R57 A;  1IY7 A;  1UFH A;  3GKR A;  5JM6 A;  4KSI A;  4ZY0 A;  2JBJ A;  1X10 A;  4HPS A;  4MBU A;  4UWJ A;  1VIX A;  1JWQ A;  4R3L A;  4PXB A;  1CP7 A;  1LOK A;  2FE7 A;  2F8H A;  3H4Q A;  3K9U A;  4FD5 A;  4DUK A;  5HH1 A;  5LYF A;  1Y0Y A;  2HV2 A;  3CZX A;  1XE4 A;  2AJ6 A;  2Q51 A;  2DPS A;  5IX3 A;  4A32 A;  2POK A; 
#chains in the Genus database with same CATH homology
 3IGR A;  4KOY A;  1BOB A;  3DNS A;  3BLN A;  1TIQ A;  4A2Z A;  3IWE A;  4B12 A;  2BL1 A;  4CAF A;  2QIR A;  3PGP A;  1XMT A;  2Q4Y A;  3KKW A;  2P6G A;  4KOW A;  5IB0 A;  4H89 A;  4XPD B;  4C2X A;  2B4B A;  2ZXV A;  1IID A;  4QBJ A;  3GYA A;  2R8V A;  4R87 A;  5A28 A;  3DR8 A;  4PK3 A;  4CRY B;  5DWN A;  1I1D A;  3FRM A;  2FL4 A;  2FSR A;  4QB9 A;  5H84 A;  2RC4 A;  4UA3 A;  5CNP A;  3EY5 A;  4UFW A;  2PR1 A;  1YVO A;  4PK2 A;  4KLW A;  2Y0M A;  4JD6 A;  1M4D A;  3D2P A;  5E96 A;  2J8R A;  1IYL A;  4CS0 B;  3OWC A;  1YRE A;  2VQY A;  5AG5 A;  1XEB A;  5C88 A;  3BJ8 A;  4KLV A;  2KCW A;  4B5O A;  3QAH A;  1RO5 A;  2C27 A;  4F0X A;  4AG7 A;  1YGH A;  3R9G A;  1S7L A;  3TFY A;  4MFQ A;  4UFV A;  2Z11 A;  4MFJ A;  4PV6 A;  4KVX A;  2DPS A;  2EVN A;  4YFJ A;  4AG9 A;  2BEI A;  3JTK A;  3RYO A;  2R1I A;  5G20 A;  4CGN A;  2J8N A;  2Q7B A;  2HQY A;  4HNY B;  4F0Y A;  1P0H A;  4UCP A;  2FCK A;  2PDO A;  3ZZI A;  2R98 A;  1NMT A;  3G3S A;  2DPT A;  3F8K A;  2ZW4 A;  2B3V A;  3PZJ A;  1YLE A;  4NSQ A;  2Z3N A;  2D4P A;  4AVA A;  4JXQ A;  2I79 A;  3BJ7 A;  4H6U A;  3CXP A;  4XPD C;  4U9Y A;  4MI4 A;  1CM0 A;  2AE6 A;  5ISV A;  1ZO0 A;  4RI1 A;  1P4N A;  1WWZ A;  4OAE A;  4IF5 A;  4II9 A;  4QUS A;  1YX0 A;  4A33 A;  4MJ8 A;  4R9M A;  3TCV A;  4AVC A;  2JDD A;  4C68 A;  2X7B A;  5AG6 A;  4B11 A;  4U9Z A;  5IV0 A;  5JPH A;  3F5B A;  5HMN A;  4A30 A;  2VBQ A;  1S7F A;  4KOR A;  4KUB A;  3TO9 A;  3EC4 A;  5DWM A;  3V8I A;  1N71 A;  3S6G A;  3UY5 A;  2ZW5 A;  2OU2 A;  4H6Z A;  5EBV A;  5F49 A;  2PR8 A;  2Z3P A;  3SXN A;  2P6E A;  3QB8 A;  4UFX A;  5KTA A;  4CGM A;  4CGO A;  4I49 A;  4GS4 A;  1PU9 A;  4E8O A;  3G8W A;  5JQ4 A;  3EFA A;  4M85 A;  1S7K A;  3FYN A;  2OB0 A;  3FB3 A;  2PC1 A;  3E0K A;  1VHS A;  2WUU A;  2Q4V A;  5G1Z A;  2A4N A;  2CY2 A;  4NF1 A;  4E0A A;  4K30 A;  3IWG A;  4MY0 A;  2WPW A;  2QEC A;  1I21 A;  4U5Y A;  3JUW A;  3SHP A;  1NE9 A;  4JWP A;  1I12 A;  1XIX A;  2HUZ A;  3FIX A;  1LRZ A;  3JVN A;  4ZGY B;  1Q2Y A;  4KSF A;  5F48 A;  4MHD A;  3R9E A;  2J8M A;  4ORF A;  4R57 A;  4L8A A;  4Q38 A;  4QC6 A;  5EC4 A;  5BWA B;  3FNC A;  2CNT A;  2YNC A;  4KOS A;  1KUX A;  4YRH A;  3LD2 A;  2BSW A;  2G3A A;  2P6F A;  1B6B A;  1WK4 A;  2GE3 A;  3MGD A;  1KZF A;  4LX9 A;  2B58 A;  1IB1 E;  4FD7 A;  4KOU A;  1S5K A;  3DSB A;  3FBU A;  2Z3M A;  4XPL A;  4CGP A;  2VZY A;  4KVO E;  2IL4 A;  1YK3 A;  5C82 A;  2OZG A;  1VKC A;  4NXY A;  2H5M A;  5J8C A;  4L89 A;  2REE A;  3I9S A;  1ON0 A;  3W91 A;  5F47 A;  5GCN A;  2Z3O A;  4B13 A;  2B5G A;  4KOT A;  1QST A;  4UWI A;  2GIV A;  4CGL A;  2VI7 A;  4C7H A;  4CAE A;  3D3S A;  4PSX A;  4LUA A;  3T9Y A;  3FXT A;  2K5T A;  5I0C A;  1QSM A;  3IU1 A;  3TE4 A;  3PP9 A;  2YGW A;  4HNX B;  4CYQ A;  2FIW A;  3R96 A;  1RXT A;  4XNH B;  5G21 A;  3S6F A;  2JEV A;  4KZT A;  4NCZ A;  5FVJ A;  4YGO A;  2Z3K A;  2OH1 A;  4OAD A;  3W6S A;  3W6X A;  1V0C A;  3P2F A;  3R95 A;  4CYN A;  3P2H A;  4BBH A;  1PUA A;  3H5Z A;  3I3G A;  2Q44 A;  4IUS A;  1B87 A;  5AGE A;  4B5P A;  2B4D A;  4XPK A;  3TOA A;  3B8G A;  4ZBG A;  4JJX A;  2Q0Y A;  1M44 A;  4Y49 B;  1Q2C A;  4B5P B;  2B4D B;  4KOX A;  5KTD A;  2NMT A;  1Y9K A;  4HKF A;  2GAN A;  2D4O A;  2CNS A;  2YNE A;  2YNC C;  1Q2D A;  4CRZ B;  4CYP A;  2EUI A;  2QML A;  3DR6 A;  1BO4 A;  1CJW A;  3TOB A;  2VXK A;  5J8F A;  3LOD A;  1M4I A;  2Z10 A;  4KSA A;  4RS2 A;  5H86 A;  1IIC A;  2I00 A;  4EVY A;  2ZPA A;  2Z3L A;  3IU2 A;  4OLL A;  3CXS A;  4MFK A;  4CAW A;  4F6A A;  1QSN A;  4C2Y A;  3S6K A;  2ARH A;  2JLM A;  4NEX A;  4A31 A;  4AB7 A;  4X5K A;  1GHE A;  1MJB A;  3TO7 A;  3SXO A;  2Q04 A;  5A27 A;  4M3S A;  4A95 A;  4MY3 A;  2F5I A;  4CAV A;  2FT0 A;  1Z9U A;  2FXF A;  3S6H A;  1Z4R A;  3TTH A;  2R7H A;  1U6M A;  3EXN A;  1QSO A;  4QVT A;  3C26 A;  4XNH C;  4KOV A;  1NSL A;  3DDD A;  2G3T A;  3VWD A;  4BMH A;  3D2M A;  4MFZ A;  1MJ9 A;  1MJA A;  5KTC A;  2FIA A;  2REF A;  3F0A A;  2CXA A;  1IYK A;  4B14 A;  1M1D A;  3A9L A;  3T90 A;  5F46 A;  4UCN A;  1SQH A;  2P0W A;  3R1K A;  2BUE A;  3WR7 A;  2G0B A;  3R9F A;  5AG7 A;  2DXQ A;  4Y49 C;  4AVB A;  4MFP A;  4C2Z A;  2WSA A;  2O28 A;  3D8P A;  2Z0Z A;  2FS5 A;  1XF8 A;  2ATR A;  1J4J A;  4FD6 A;  2PRB A;  2PQ8 A;  4C7I A;  3N7Z A;  1Y9W A;  4JLY A;  2PSW A;  4KUA A;  3VWE A;  4KVM E;  4UBR A;  1FY7 A;  1MK4 A;  2WPX A;  1OZP A;  2B5G B;  4KS9 A;  3ZJ0 A;  1YR0 A;  1Z4E A;  2JDC A;  2ZW7 A;  4JXR A;  4PSW A;  4CYO A;  5G22 A;  4ONU A;  1K4J A;  2OZU A;  3TO6 A;  4CAX A;  4MFL A;  2VZZ A;  3CXQ A;  2VEZ A;  4UCM A;  1S7N A;  3GY9 A;  1Y7R A;  3NE7 A;  5AG4 A;  1L0C A;  2ZW6 A;  1S60 A;  1KUY A;  1QSR A;  4DNC A;  1KUV A;  4HNW B;  2CNM A;  4E2A A;  4J3G A;  1YVK A;  2AJ6 A;  4R3K A;  2B3U A;  4B10 A;  1M4G A;  3TT2 A;  4Q36 A;  2OZH A;  2YND A;  3EO4 A;  1R57 A;  1UFH A;  3GKR A;  4MBU A;  4UWJ A;  4R3L A;  2FE7 A;  3H4Q A;  3K9U A;  4FD5 A;  5HH1 A;  2HV2 A;  1XE4 A;  4FD4 A;  1S3Z A;  5IX3 A;  4A32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...