1XMBA

X-ray structure of iaa-aminoacid hydrolase from arabidopsis thaliana gene at5g56660
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
392
structure length
375
Chain Sequence
KLLEFAKSPEVFDWMVKIRRKIHENPELGYEELETSKLIRSELELIGIKYRYPVAITGVIGYIGTGEPPFVALRADMDALPIQEGVEWEHKSKIAGKMHACGHDGHVTMLLGAAKILHEHRHHLQGTVVLIFQPAEEGLSGAKKMREEGALKNVEAIFGIHLSARIPFGKAASRAGSFLAGAGVFEAVITGKTIDPVVAASSIVLSLQQLVSRETDPLDSKVVTVSKVNPDSITIGGTLRAFTGFTQLQQRVKEVITKQAAVHRCNASVNLTPNGREPMPPTVNNKDLYKQFKKVVRDLLGQEAFVEAAPVMGSEDFSYFAETIPGHFSLLGMQDETNGYASSHSPLYRINEDVLPYGAAIHASMAVQYLKEKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of ILL2, an auxin-conjugate amidohydrolase from Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
molecule keywords IAA-amino acid hydrolase homolog 2
total genus 122
structure length 375
sequence length 392
ec nomenclature
pdb deposition date 2004-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1xmbA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1xmbA01
1ZG7A 3BXMA 5LYLA 2ZENA 4IHMA 4ONWA 2IJZA 2PJ8A 3FMCA 2PJ1A 3B3TA 2Q43A 4P6YA 1QMUA 3NA6A 1IGBA 2VL1A 3PB6X 3FX6A 2AFWA 3PB4X 4Z65A 2QVPA 4OC2A 3SJEA 4P10A 4YU9A 1ELMP 4BD9A 3KGQA 4KSIA 1Z2LA 2AFOA 2PJ2A 2RFHA 3FJUA 4OC1A 4Q7AA 4MCRA 4MHPA 1F57A 2PJ3A 1NSAA 3SJGA 5K8OA 1ELLP 1Y0YA 4GM5A 4EFDA 3RBUA 4MXUA 2V8HA 2PJ7A 4UEFA 1AMPA 2DEAA 3NH4A 1BPNA 1RTQA 1ZLIA 3T8WA 4FWUA 4OC3A 4JYWA 2RB7A 1BPMA 4YWYA 2OR4A 3CPAA 4WJBA 2F7VA 1YMEA 3S9NA 4A37A 4AXVA 1YSJA 5JH9A 4NGQA 1CP7A 3KHZA 3B3WA 1Z8LA 2PRQA 4DYOA 2ABZA 4OC0A 2BOAA 3D68A 1UWYA 3KASA 4ZYQA 3ISZA 4UEEA 2PJCA 1CBXA 4ZY0A 3S9LA 3D7DA 1HEEA 3PB8X 4OP4A 3D7GA 2XEGA 2GU2A 1AYEA 2G9DA 3FVLA 4PXDA 2AFUA 8CPAA 4PXBA 1ZG8A 1TXRA 2ZEGA 3WC5A 3DGVA 4MMOA 4ZI6A 2BCOA 1KWMA 3IJ3A 5DS0A 3KL9A 5LRGA 4P4EA 2ZEEA 1YW6A 4P45A 4UIAA 1QQ9A 1YW4A 3GUXA 4TNUA 3B3SA 1DE4C 4TWEA 3BI1A 1LCPA 5HXDA 3VATA 4PPZA 1M4LA 3CDXA 3GLJA 3PRTA 1FNOA 3MRUA 2AFSA 1BAVA 1LAPA 1XMBA 1EE3P 5THWA 1TKFA 2PVVA 1LFWA 2PJ0A 4P4JA 3NH8A 2ZEMA 4R7MA 2V77A 2O53A 2ANPA 3GB0A 5CBMA 3PFOA 1LOKA 5D8NA 3TX8A 3HUVA 2HC9A 1XJOA 2J9AA 2XEFA 3CPXA 5LRKA 4R8FA 4PXEA 4ZX9A 3ISXA 1TKHA 5LYFA 3B3VA 2IMOA 4OIWA 4NGRA 1XRYA 2PJ6A 5CPAA 4CPAA 1VIXA 4X3RA 4G1PA 4WWVA 1Q7LA 2V8DA 4NGNA 3B35A 3WT4A 4F8ZA 5K8PA 2QYVA 2NYQA 4OIDA 1ZLHA 3VARA 5HVFA 2C6CA 1VHOA 4IAVA 4ZY1A 1TKJA 3B3CA 2AFXA 4K3NA 1LAMA 1CX8A 2QJ8A 4MRIA 4NJRA 4F9VA 2FVGA 5D29A 5LYIA 4P44A 3FEDA 3QNVA 4OC4A 3KQXA 3TC8A 3K9TA 3PBBA 4MHZA 3IIBA 3FH4A 4A39A 4NFRA 3N5FA 3CT9A 4NGSA 2JBJA 4F9UA 2EK8A 3D7FA 3D67A 3KR5A 4FAIA 1F2OA 3SJFA 1VHEA 3RZAA 4MHNA 4FBEA 1TF9A 4P4IA 2IQ6A 2PJ5A 4UIBA 3PB9X 3IEHA 2CTCA 2C6GA 5I4MA 4B6ZA 2Q51A 4MCQA 3H8FA 6CPAA 4DJLA 5ELYA 4NGMA 3B7IA 5K8NA 5JGFA 4R6TA 4OC5A 3WC7A 1JQGA 4MCPA 3VH9A 4LQGA 4EMEA 3JRUA 1IY7A 1Z5RA 3PB7X 4H2KA 3MN8A 5JM6A 1XBUA 3SI2A 2F8HA 2GLFA 2O4HA 1VGYA 2PIYA 1R3NA 2CTBA 3H8GA 3I1UA 3KQZA 5LYDA 3H8EA 3IO1A 1PCAA 3IFEA 4NJQA 1GYTA 1CPSA 3LMSA 2PJAA 4OKOA 3BI0A 1YLOA 2C1CA 5HVGA 2ZELA 1PYTB 2PIZA 2V8VA 4RUHA 1ARMA 5LRJA 1Y0RA 2ZEDA 1TF8A 2POKA 3FEEA 4FUUA 2Q4ZA 4DUKA 1H8LA 4A38A 2GREA 4X2TA 3FF3A 3PBEA 4EWTA 2JEWA 2WYRA 3LWUA 3SI0A 4ZX8A 3S9MA 3WABA 3D7HA 2ZEFA 2XEIA 2XEJA 3SJXA 2EK9A 1FT7A 1CG2A 3WC6A 3B2YA 4R76A 3V7ZA 2CF4A 2PE3A 2ZOGA 5K8MA 1BLLE 3KHXA 4OMEA 2AFMA 3FECA 3NFZA 4W9YA 1DTDA 2I3CA 3KI9A 2NSMA 2OOTA 2HB6A 5IB9A 4A94A 4O23A 2ZEPA 4PQAA 4P4DA 3PFEA 2PCUA 4UEZA 1OBRA 4ZY2A 2CIJA 3NH5A 4P4FA 3IWWA 1Y7EA 5J1QA 4MCSA 4PXCA 1LANA 3RAMA 4UF4A 2ZEHA 7CPAA 4JZ0A 3V38A 2ZOFA 2V8GA 3KR4A 3HLPA 5HVHA 3BHXA 4X8IA 2WZNA 3SI1A 3KZWA 3D66A 1CP6A 2JBKA 2PJ9A 1R43A 1ZG9A 1ARLA 2PVWA 2PJ4A 3DLJA 3IC1A 2GLJA 3L2NA 2PJBA 3D4UA 1CPXA 1XFOA 1HDQA 4MHYA 3PEIA 2AFZA 3K2KA 4IK2A 2C6PA 1HDUA 5F09A 4P4BA 2BO9A 4NGTA 2ZEOA 2EWBA 1F2PA 4NGPA
chains in the Genus database with same CATH superfamily
4QU7A 3TOAA 1LXJA 4AB7A 2JVRA 4M6HA 2E9RX 3CCQS 4C8LA 2OTJS 1KFDA 5DLFA 1EZZB 1T3OA 3NGKA 3TUPA 4DPYA 4JV5J 1LWXA 3QIPB 4WIQA 1VR6A 1V6HA 1Y5LB 1EJ7L 3J81Y 3KJQB 2N3OA 4DV4J 1N54B 3G8TA 1UFKA 4I6YA 2I79A 2QVPA 3MMCB 2YXLA 2XLKA 2DR5A 2G1HA 1K47A 1TVRA 2BJ8A 4OC1A 5KFLA 2PFDA 2VPZB 3HHEA 1NSPA 2QG9B 3K5NA 1PIEA 2AJQA 1Y0YA 1MWZA 3QGIA 3HT3A 4CO1A 1XTZA 4MT1A 2HLUA 2K7JA 5LSLA 4B3TF 4FYXB 2GQ2A 3GWCA 2PDOA 4AUKA 1R8HA 4OI1A 4OLOA 2BJDA 1P6TA 3BJYA 4HL9A 5E96A 2QSFA 3AA9A 2ODFA 2CRLA 4ZVSB 4DG1A 2Y0SD 5LXYA 3M6WA 3EUNA 1RT5A 4OYMA 2ABZA 4DYOA 2HAFA 4QYZK 2GZOA 2PR8A 5GAGI 3ISZA 3SDEA 1S6PB 1SC6A 4ED5A 3D7DA 2DGSA 5HBMB 4OP4A 2XEGA 1SKWA 5KOXA 4RW4A 3CC7S 2I5JB 2KFNA 4UCNA 3GIIA 2KT2A 2EC2A 3WC5A 3R7SB 4ZDNA 1NB2A 1Y10A 1FO1A 1MW7A 1L3VA 3PKMA 2HNZA 5GAGU 3D28A 5I0CA 1VJQA 4KH0B 4KSFA 3BSNA 4B9TA 4WKRA 1E6VB 1TELA 3GUXA 2WSEC 1YJRA 4DG1B 4KHMA 1KKHA 3IGVA 5KG2A 1K1SA 1OO0B 2XG8A 4CRZB 1LFWA 4LRAA 1S7IA 1D8YA 3MHYA 2AJ1A 3NH8A 4DX8H 1HWJA 4DR7F 5CBMA 2YPYA 1E6YB 2B9EA 2BW7A 2IPOB 3SMZA 4LF7J 2HQIA 4UUXA 5E3QA 1NRKA 2B9WA 4ZCKA 2DXFA 2YWEA 1YBAA 2FDNA 1YTYA 2EEYA 4NEZA 5HROB 4GKJJ 3FCWA 2UUAF 4A33A 3ZZPA 4ED2A 1X0PA 3W6XA 1Q79A 2GHWA 1K8AT 4B17A 4UZCA 4H6ZA 5LOQA 5DG7A 3EZOA 4CLSA 4RW6A 4G6VB 3WIVA 4X66F 2KZZA 4ETZA 5J8CA 2MHNA 4ER8A 1U02A 3DRPA 2XS7A 4O44A 3CT9A 3G9CA 4XPLA 4F9UA 1IBMF 2UXCJ 4RJVA 1SC3B 1AB8A 4EO8A 4CH0S 3C15B 4ZS6A 5KFQA 1KBRA 2W4PA 1N32F 2VBZA 5L9XA 4B6ZA 4FF4A 4IUSA 3R9GA 1XF8A 4OLLA 3A12A 4DJBA 2NYIA 3ET6A 3V6DA 3DDIA 3MM6A 2M0GB 4OC5A 4ZLLA 1CULA 2CXEA 2UVUA 2CAJA 5F47A 4QIVA 1WOPA 1JLQA 4QYRA 4G3IA 5HQLA 2YVSA 1VGYA 1H2UX 1L3TA 4LF8F 1GTEA 1R3NA 2CG4A 3VAHA 4C98A 3HD1A 2HHHJ 4CYUA 1V5IB 1X9WA 2REFA 4L74A 4Y2AA 4I7FB 5KFIA 1XWLA 1KFSA 4A38A 3T1HF 4EBCA 4GKKF 4YY3F 1QVFR 2WYRA 1RT2A 2JEWA 2XSFA 3CJ5A 3E0KA 4UBRA 4A48A 2W24A 1SI9A 2OU2A 4OYAA 5ETOA 4YB6A 3KYLA 2D3ZA 1Q0NA 1K1QA 1UA0A 5K8MA 1S60A 1U8WA 1EETA 2QA4G 3FECA 2MJUA 3I3GA 2GW8A 1HBOA 2FHKA 2XO6A 3I96A 2OOTA 3QRPA 3R97A 4CO5A 4A94A 3NLCA 5HATA 2JRSA 4PCQA 2FD2A 3AXMA 2AYBA 4BDPA 4R8UA 2UV8G 2FJVA 1OBRA 4ZVFA 2Y0BB 2HHHF 5AJ3J 3JB9k 4F4XA 2KYXA 4FP9A 2Y3YA 3SEOA 2ATLA 4DL6A 1RTDB 2BEFA 1BLUA 1AFJA 5IC6B 1A9NB 4AVBA 1P9QC 3M2VA 1TL7A 3BGRA 3KMQA 3GG0A 1CJKB 1D8ZA 2KT3A 3R1KA 2P6EA 4IK2A 1ZA1B 1HDUA 2GCFA 4NCAA 4KOTA 3UCUP 2DNNA 3QSIA 2JC0A 3DNCA 1PGZA 2QA4S 4ZCMA 2HMIA 2WVFA 4L73A 2ZENA 4ED4A 2UP1A 3BQ2A 3MPUB 3JQKA 1IWGA 4P6YA 1R57A 4OI4A 3D0GE 3EVWA 1S7NA 1B0TA 4X66J 1OQ6A 3IM8A 4WTYA 3TJAA 1YK3A 4BD9A 4HHHA 4OFZA 1OS5A 2ROPA 2Y8YA 4F0MA 3GZ7A 2HKEA 2MMYA 1JLQB 3N7ZA 3ZZOA 4BINA 3H2VE 4CLTA 3GJTB 1NSAA 4P2SA 3I31A 3C6UA 5ETLA 2J6TA 3QWPA 3OUYA 1S77D 2ZUAA 1AMPA 5ADZA 1M5HA 4A8FA 5BXIA 1SJFA 2DGTA 2F40A 4UOHA 4JB8B 3MAAB 5AE1A 3HVRA 1FJCA 2OD6A 1WDDA 1M4IA 1JJCB 2VB6A 3J80Y 4ZLJA 4JI2F 4K4TA 2ACYA 2R7VA 2C2DA 3M05A 1Q95G 3IWLA 2FZGB 2DH8A 5DS7A 1CBXA 2UXBF 4PWUA 5IQ6A 3PB8X 4ELTA 3M8QB 1NJXA 2KG0A 4JI6J 4B5PA 1AW0A 1VK8A 3DGVA 4OZ5A 4B9UA 2A2CA 4K4WA 4OYOA 5LJ3Y 1YVFA 4CO4A 1VS3A 5KFSA 1YKWA 2DO0A 5B0AA 2QLJB 3MURP 3ZTSA 3TA2A 3FNNA 1J4JA 3K2YA 1LCPA 4DL7A 2RQCA 3VATA 1VOMA 5E33A 1LXNA 1QSLA 2RRBA 3OJSA 1KC8T 2XMJA 2FZCB 2O53A 3BGRB 1WTFA 2ZJPQ 4RU9A 1NKCA 4ZVEA 2J0WA 2YNFB 3TX8A 1YDLA 1SVDA 3RB0A 4HKQA 2XEFA 1S0VA 4PG6A 4ZX9A 3M2UB 3N01A 3VHQA 2AE6A 1H2VZ 4DSIA 3AXKA 2Q7BA 2HMIB 2NYHA 3KXDA 3PZJA 2GFFA 1URRA 3ELHA 4TY8A 5IOLA 3WT4A 3MR5A 4B14A 2CJXB 2XMKA 5KTAA 4RW9A 5C2GA 2J8AA 5AG6A 3GU0A 1AA1B 4X84A 2OUGA 4QWCA 2I1RA 2CPHA 4C3LA 2V4QA 1VQSA 2W2OP 2C27A 3PRVA 3UI3A 3G71S 2FUG9 1X4DA 2AIRB 1ULRA 2JDCA 3BJ7A 5E0OA 4PZVA 1DJ0A 4NZ7A 2YQ1A 2AX1A 2UXDJ 2FYXA 2O67A 2CADA 3VAKA 3L7OA 4LQ6A 3AAWB 4NSQA 3SJFA 4LX9A 4MY0A 4DNCA 2GA7A 2LQ9A 4I4BA 5B0FA 4ES3A 1IKWA 3L9ZA 4DCOB 4IF5A 3TZXA 4RNOA 3E8OA 2WW8A 1PYSB 2G0IA 4J9PA 1EP4B 3D3CJ 4NGMA 1BQMA 3JYTB 4MCPA 4LQGA 4EMEA 4JBCA 2GGPA 1N88A 4F3OA 3FKBA 2O4HA 1Y00A 1QSOA 3J7ZT 2FTRA 1CQMA 4MJ8A 3OWCA 3JSYA 2KH9A 2VG5A 1BQXA 1FXDA 3VV2B 2HWTA 4FUUA 3FEEA 4CLFA 1RHJB 1VLYA 2Y8WA 3ZJ0A 1WTBA 1IB1E 1FERA 1KR4A 3S9MA 4OX6A 2BVZA 1UW4A 1HYSA 2DO4A 3NEKA 4OHYA 1NSLA 1NLKL 4TU7A 3KK2A 3SJXA 3VGTA 8ATCB 2GIVA 4JI0F 4DS4A 2ADBA 1C0TA 1J5EF 4L89A 1HQ2A 2DRAA 2VQYA 4JI5J 1F2GA 2WSCC 5AGEA 1WD6A 3I0SB 4MH8A 1YR0A 3PX0A 2KVQE 3LAKA 3NE8A 2I9SA 2V63A 5DJBA 1Q5YA 1X0FA 4J9OA 3OFFA 3NRBA 1HWKA 2ZNYA 1IQTA 4WFAQ 4PXCA 2HVIA 3BGUA 5HK4A 1B0VA 3ADAC 3VWDA 1EHWA 4F7VA 3QT5A 1SJRA 2YKQA 1NZAA 2CYYA 3VF0B 1AUGA 1LK7A 1RBLA 4RW9B 4YR0A 4DL3A 4A31A 4DV0J 2PJ9A 5B0EA 5DETA 1ARLA 1T94A 1WSRA 4MHDA 3HXMA 5GAHU 1NDCA 1FRXA 1VQKS 3LANA 1RAFB 3RW7A 1XFOA 5DQHA 4MHYA 1KHWA 2HFNA 1UEVA 4M5GA 5U47A 2KXHA 1HWIA 3U02A 2FJAB 2A1BA 1Q86T 1DTQB 2BM0A 5DQIA 1VISA 3Q8QB 4O44B 2A6OA 5CXTA 1VRUA 4QR2A 4UT4A 4YFJA 3UD5A 2OPPA 2J7UA 2FHMA 3M9NB 3IXQA 4IHMA 3CXQA 1YQEA 2VG7A 3OW2R 1HBMB 1HI0P 4NLTA 5LJ5Y 3NA6A 2G2OA 2IFXA 1UJ6A 3M2RB 5E7OB 3L7PA 2RMLA 5ETTA 1Y3KA 2WOMA 2XNQA 1B4SA 1TL1A 3SJEA 1KN6A 1ELMP 4U67Q 4XPKA 4F4WA 4U7UD 2AFOA 4EI2A 3MTKA 1KTQA 3E3XA 2A10A 3IGNA 1F57A 1WC4A 2OP5A 4BLGA 1SH3A 5J1NA 4WFNQ 2BQUA 4UEFA 3SYZA 3KKFA 3VVUA 5DDQC 1RHRB 3QFHA 3SBMA 3OTOJ 5EC4A 4PWDB 1HHQA 5H9EJ 2F4VJ 4PV6A 3M4XA 4WJBA 3SCIE 4JI2J 1RLDA 3OXLA 2AZ3A 2FVCA 3B3WA 1P0HA 3THPA 2F8EX 1S7LA 3R9EA 2KO1A 1WG4A 1RSCA 1F5CA 2HS4A 3QIDA 1RB0A 2GHPA 5DWMA 4NEYA 5DQGA 2ZFHA 2MYFA 3D3BJ 4C2MA 8CPAA 1DQ9A 4IG0B 5KFGA 1VBXA 2BV3A 4PXBA 1VCTA 1JJ2R 4ORFA 4CDIA 2VQEF 2ATCB 1VHSA 2YWKA 2GO8A 3DLKA 3OBIA 2F9JA 1JJ4A 5H9EK 5C82A 4TNOA 1WORA 4A8KA 2H5JB 4J9UE 1Q81T 1XOVA 1JWQA 4F6AA 4DEZA 1LFPA 3GB0A 3OSNA 2DT9A 3PW0A 4ZVPB 4CYNA 1M5KC 1X31C 2MKSA 3BKTA 1RXTA 2RDDA 3UW1A 3DYAA 4LREA 4NLQA 3X1LB 4DF4A 4I67A 1FCAA 3O8WA 1Q7LA 2ZH2A 1T7PA 2LXIA 4DWIA 4KH1B 5B0CA 2J76E 4HNXB 1H2TZ 2B7CB 2H54B 2HS3A 2H5MA 2HVZA 5CYQA 1T9VA 2ASJA 3TWZA 2PD1A 2AW0A 4CYPA 1A6LA 4YB5A 4MRIA 2KM8B 1AFIA 1KNZA 2R8GA 4KGXB 4B3MJ 3FH4A 4A39A 2IYGA 3OV7A 4ZPDA 2ZJRQ 4I6WA 3Q2SC 4MFBB 1RYRA 3CULA 4JV1A 4FBEA 1UW9A 1VC5A 5B7WA 5GAEU 3G8SA 3C6TA 2DRDA 2DBBA 4NCGA 3CW2C 3B7IA 2JZ5A 3TAPA 5F8NA 1OQ3A 1AZSA 5M2UA 2LDYA 1FFSB 2E1CA 1YBTA 4KY3A 3DM2A 4KBIA 1CJWA 1HNVB 1ZA2B 2BANB 2VFRA 2IA0A 2AV5A 3EPIA 4ED1A 4CQ1A 3AD9C 1N48A 3LMSA 5DO2A 4OKOA 3KG0A 4ZVOB 3OR1A 5HVGA 3MM9A 4DFMA 3MUTP 1N6QA 2CPJA 4LRCA 2JL9A 3HHNB 2J9DA 3HDSA 3NCPA 3R96A 4OQJA 4WKYA 3BF4A 4IO1A 4HI2A 4I2QA 1UL3A 3JVNA 2BYCA 3JXOA 3SHPA 3TQEA 1VBZA 3QQCD 1B87A 3GTYX 2O5DA 3CUNA 1RGVA 3THVA 4X4VA 4K0KJ 3QZ7A 4Q5VA 1NDLA 1RTZA 1Y5IB 2Z0ZA 4ICLB 2CF4A 2QFIA 1S1XA 2V0NA 3KLGA 2X7IA 1HBNA 4TQSA 2R2UA 5HANA 1FD8A 4K50A 1T95A 2NPIA 1UEKA 3W91A 2IMWP 2HEKA 4R3LA 1PC5A 3PFEA 4TKTA 4B9NA 1M1KT 4YS2A 2FJBB 1NK5A 4EBDA 2H3EB 1CM0A 4FXVA 2R7XA 4RBVA 4BC7A 4ECQA 3BM7A 4KGVB 1LANA 2RE1A 2DCUB 4DOZA 2YWHA 2ZOMA 1UZHA 2FIUA 4DV7F 4G1QB 1S6OA 3P96A 1M5SA 4CS0B 1VBYA 1CP6A 4MIWA 1S1XB 2PJ4A 4URQU 1Z4UA 4Z7CA 4LBHA 3L2NA 3GCXP 4H4MB 5G4DA 5SZTA 3CEDA 3C16B 2IJFA 3DLGA 4F0YA 1RE1B 2BKNA 2YNHA 3DRSA 1Z9UA 4UQTA 2N3LA 3B3TA 2XYPB 1Q53A 2BQRA 4MKBA 1BO4A 3AJ1A 3R5JB 1LW0B 3DI6B 3D0IE 4QR1A 4USKA 3D2MA 1UVLA 4MYUA 1HNZF 3OTBA 2XY7A 5D15A 2HURA 1V3ZA 2JLMA 2HS0A 2ARHA 2MLYA 5D4OA 3IBCB 5AE3A 2PEBA 1JXVA 2NXEA 4A8YA 3OPKA 2WBRA 3IMQJ 3C26A 3NH4A 1R8AA 1BOBA 3DRSB 4JI5F 2OR4A 1J5EJ 2ZZTA 1RHKB 3US5A 2BBEA 4KHRA 3PW5A 5HQMA 2F7VA 2AEMA 4WCEQ 1N56A 2FS5A 3KHZA 3QYYA 2GAGC 1FT8A 7FD1A 2K3KA 4RKUC 3EXNA 3GFYA 3NY0A 4XPDB 4M5IA 1FE4A 5AG5A 2RJZA 2YKAA 2LVWA 2N7YA 3GFHA 2BMBA 1IWAA 3V6KA 3FVLA 1KDNA 2AFUA 3MFHA 1LWFA 4KUBA 1TXRA 2DNHA 2O3DA 1VQ7S 5K9FA 1NBEB 3MR6A 3N6NA 1RCOB 3V81B 3R2CJ 4OJHA 1GAOA 4NLYA 4AL5A 3NNHA 3V8IA 2EBGA 3KKWA 2EC0A 3T6BA 1K44A 4DV3J 3DC2A 2NREA 2MLZA 2FLPA 1C1CA 2IJNA 3QBCA 6FD1A 1ZAVA 1UVNA 4DX7A 4DSLA 3ZXWA 2C3OA 4ZPBA 1XMQF 1U7LA 3KLFB 2WSFC 3CF5Q 3FBEA 1W2BR 4LF9F 1XJOA 5K5MA 2J9AA 1LK5A 5D0RA 4FYWB 4DCPB 1N34J 2J9EA 1TKHA 1IBLJ 2R8IA 1Y5NB 4E8UA 1LQ9A 2IVFB 1SJ1A 3OJUA 3X3UA 4M5NA 1N5YA 1U24A 1FY7A 2V8DA 4O3QA 2PT0A 2CNLB 1BE4A 2BXJA 2WOMB 1TL1B 2VC0A 1VHOA 1S7HA 4KGZB 4RL1A 4USMA 1NHVA 4OJ1A 1LAMA 4R0JA 4J91A 2R7WA 3M8WA 3CCLS 2C3UA 2E5IA 2LXUA 1RAIB 4USVA 2HNDB 4DUTA 4FYYB 1GX5A 1KVJA 4OI2A 3JSMA 2QSWA 2YNDA 3ILOA 5L39A 4DFJA 4OJGA 3DLEB 3M32B 4P4IA 3DDDA 3N9UC 1R6VA 4WK3A 3DXBA 3TJ9A 3BN7A 3AA8A 1MMNA 2YH0A 3MEKA 3OT9A 4O3PA 1T9YA 3MM5B 5FD1A 4M6GA 1PKUA 5CYMB 2Z2MA 5JM6A 2I0XA 2LDIA 3KLVA 2OEMA 4IFYA 3SI2A 3MGDA 2Z0GA 3CJTA 5A8RB 1NH8A 1VYAA 4NCBA 7AT1B 1TV6B 1QTNB 2DGOA 2GC8A 3OSPA 3IFEA 1NSQA 1ZAXA 5AJ3F 1SCJB 1RT5B 4ZKAA 5L38A 4UWJA 4NMXA 3SXLA 1GYTA 2DF5A 1W7WA 2UVWA 5A8KA 4PK2A 2V8VA 1U2FA 2RHQB 2D9PA 1CJTB 2RD5C 1X4AA 2IM1A 3M6VA 3PO5A 3PBEA 1WC0A 2Z56B 1YQHA 4JI8F 3FZBA 2XMUA 4ZVTB 2OIHA 3M2RA 2XEIA 2RDIA 4P9SA 4DR2J 3WC6A 3M30B 2ZH9A 3CCZA 4GC7A 3G87A 4ETXA 3FFIB 3Q89A 3W2VB 4B3OA 5T7LB 3D7SB 4P6QA 3FSIA 2JDDA 5AT1B 3R9FA 4KZTA 4LBPA 1OSDA 2XO7A 1XNRF 4W9YA 2WUUA 1TV6A 3C14A 1S1TA 2HQDA 2UXDF 2RNEA 4XNHB 2MKKA 1ZETA 2HVEA 2NMTA 1C4AA 2ILYA 2EG1A 5A8WB 1T9TA 3W63A 1S12A 4UEZA 5KT5A 1P4NA 1Y3JA 3AD7C 4O4RA 1WF0A 2HAIA 1BY9A 4QWAA 2ZHOA 4C3KA 1H6KX 2C3YA 2R7SA 1OWXA 4YN3B 3TO9A 1FKOB 1PJ6A 3OHAA 3B4DA 4OADA 4BBYA 2ABYA 4DR5F 3D6MB 2OKQA 2XHWA 4HNYB 5CZXA 2VONA 2RF2A 1HBNB 4KHPF 2VKRA 2PVWA 2DITA 2FY1A 3MEDA 1PBAA 3P5BP 2GLJA 4YGOA 2KHCA 4DL4A 3GYXB 4DMZA 3K2KA 4ECVA 2ERRA 3BH6B 4YHHJ 4RZRA 2HBYB 4CGNA 2ZEOA 2CIMA 2HIYA 1GEHA 2WBMA 3OXGA 1FVSA 5IX3A 3LW5C 5HN0A 4HTJA 4HHJA 4NZ0A 1SL0A 5A28A 1SPBP 2FGCA 2EK6A 1QUVA 1QMUA 3KJVB 4HTIA 3DOMA 2HHXA 4M5DA 1EQMA 1I94J 3MF5A 4KPYA 3QMQA 3T5HA 4LQ3A 4YU9A 3NXZA 2GVZA 2BUNA 3DM2B 3TO6A 5IWAJ 4CWBA 2KXFA 2AT1B 5KFUA 3I9SA 1ELLP 1S79A 1D1UA 2B58A 3UPFA 4EFDA 4R57A 2H5IB 1X10A 3OR1B 3BEGB 4KPCA 3AHPA 1XNRJ 4ZP6A 3PW4A 2GHVC 4Z37A 5KG3A 1VDHA 2HZAA 2DR7A 4OYPA 2A4NA 2YWGA 4CNZA 1RTHA 4N47A 3NOCA 4ZP8A 2RVJA 4DR7J 4A37A 1JKHA 1U1NA 5LMNJ 3UNYA 1WHVA 3GFZA 4ITSA 3K5MA 1UVIA 5ETSA 3HSDA 4ZYQA 4GKKJ 3MUVP 2YWFA 1LEOA 3H4BA 5A0YA 3M1VA 3S9LA 3UQSA 5HJXA 2I38A 1N5TA 2E7XA 3DU6A 3VGUA 4II9A 5KFEA 2PI4A 2PFFB 2MSSA 4OYIA 4NRUA 3KG4A 3H5XA 3NCQA 3R6GB 1YBUA 4G1IA 4LF6J 2VASA 3P6YC 3RB4A 2XWYA 3FGVA 4FVMA 2Z57B 4DQRA 1L3UA 3I32A 1S9GA 4FF3A 2OELA 3SQGA 3HFVA 2FVSA 1YW4A 3S6HA 2UUWA 3E2EA 1HFEL 3GLJA 2YQ3A 3EICA 1LAPA 5A2QU 1GMUA 2H51B 4I2PA 3GIRA 2PJ0A 2HRTA 2K2PA 2UXCF 2G0BA 2E5GA 2BW2A 1UCNA 2BE7D 4U7UK 2MKYA 2KDOA 2W01A 3DLGB 2R7UA 1MMLA 4F02A 2VFVA 5D0EA 3NNAA 1SQFA 1ZM3A 4ED0A 2Q44A 4CIOA 3EO4A 4NGRA 1XRYA 2ALZA 5F3ZA 3KHGA 5D4PA 4DR5J 4DUZJ 1U1PA 2CWKA 5JPHA 4Y28C 4UFWA 4ELUA 4WFZA 3LF0A 2HHSA 4MFJA 2DIVA 4WYLA 3MFIA 4JOUA 2NZ4A 1M44A 3AODA 2AJ0A 2KJVA 1M4GA 3LP2B 3KUEA 3QLHB 5KG6A 3THTA 4FKYA 1HQUB 2IBKA 3TC8A 1SIWB 3MD1A 4HH0A 1X4CA 1Z1ZA 4IOAQ 3FDSA 2V68A 4CAFA 1TVRB 3Q2TC 5EBVA 4C8MA 3TCVA 2ATRA 2HSEB 4FAIA 1F2OA 3PX6A 1XERA 1N5YB 2XYGB 3MI7X 3R7NB 3H4QA 4MHNA 3T9YA 4NF1A 3VAGA 2WVCA 2MZRA 2CTCA 2FJXA 4QU6A 4H4KC 5CCMA 4XPDC 2QL7B 1LKZA 3MAAA 5D0GA 5EWFA 1IY7A 1S48A 2BUEA 3RBXA 3MMBA 2KT5A 1HARA 1WSVA 3G86A 3H25A 4CGOA 5C24B 5HJYA 5E3CA 4IG3A 1U09A 1T0TV 1QSTA 2JFDA 3M8SA 1P27B 5D78A 5KFVA 2GREA 3DDKA 2ASYA 3DHXA 4J3GA 2IRUA 4NLOA 2B5GA 1RU1A 1T9WA 4ZVQB 3D6HB 4UTGA 2FQQB 3QT8A 2D41A 2AYGA 1C1BB 1N32J 4PABA 3CCWA 3ULHA 1RKJA 3TUIC 3LUYA 3HF5A 2ZW4A 3F5BA 3CJKB 4FD6A 4RLEA 2IYIA 2GMLA 3CJRA 3MOJB 3MM7B 4IG3B 1EKSA 3OXFA 3BGOP 4ZJLA 2VZ9A 1NM2A 5ITHA 4ES1A 4MTPA 1MWQA 3IWWA 2CPYA 2GV1A 4UOGA 4TQRA 4F0KA 1NHUA 4IOCQ 5IS2A 1T8EA 1R8BA 2LXFA 4ZK7M 2CQBA 4QWDA 4KVME 1R0AA 1XIQA 2J6SA 4PG5A 2VKZG 3LP1A 2QA1A 3KDNA 1ZG9A 3T6JA 4KFBA 5DRKA 4KYZA 3JSRA 5BR8J 2HNDA 1YJWS 4WZQA 2WB1D 3LA0A 2HRYA 5IM0B 2KZMA 2BO9A 3A8EA 2QFJA 1N33F 1XNQF 4LSZB 1NMTA 1TKTB 2LQ5A 1RQ0A 2XZDB 5HBMA 1JLCB 1L3SA 1DAXA 2B9YA 2E5JA 2IJZA 3T1AA 3H5YA 5ETNA 3ONQA 2YKMB 2L48A 4DU7A 3GYGA 2IDEA 2G2ZA 3PB6X 3ZTPA 3HVWA 4YMEA 2AFWA 2J7KA 4DBQA 2DNRA 1R0AB 4KSIA 1ZS6A 3EDRB 1ELOA 1SBRA 2B7BB 5A8RA 2OPQA 3NS5A 1S5ZA 4MFZA 1X4FA 5CD4A 1LWCA 3IG1B 2V2ZA 2IBOA 1NJIT 3BH7B 3PNIA 3HLUA 2W8KA 1IICA 3G82A 1YJUA 1E6YA 1DTQA 1UVMA 3TQ1A 2BACA 2CFXA 3GV5B 1PJ7A 2FIAA 4DV1F 3S9NA 4MKVA 4OV1A 1CPZA 2G1DA 3HHLA 2LA4A 3OVSA 2CNTA 3S8SA 2ZH8A 1N36F 3O44A 1BD6A 9ATCB 3V5RA 1AXQA 5AG4A 2ZVSA 4R25A 3JAMY 2IIHA 4UEEA 4ZY0A 5AXKA 2IRXA 5EX0A 3KK2B 2PN6A 1YZ7A 4ILMA 4UOCA 1FK9A 4ZHRB 1RT6A 2YNIA 2YX1A 1I3OB 2IA6A 3BSCA 4KV8B 1OZPA 2GJFA 2G4BA 1PYOB 4N56A 4NYOA 1RAOA 4DQPA 1ZM2A 2HFSA 2XC9A 4RNFA 1W25A 5EWGA 4ID5A 5EGYA 4NLPA 4UIAA 4C48A 3RB3A 4BCAA 4PRFA 3BV8A 1AUSL 2IC3A 1XMBA 5CYMA 3FVYA 2XS2A 2E9TA 1Q8BA 3ET6B 4XPCA 2ANPA 4B3SF 3DRRA 3NWRA 1LOUA 3NG8A 2KFYA 4YDDB 1F2HA 2AHOB 3KK1B 4TYAA 4KO0B 3Q24A 2FVQA 2E5LJ 1T9UA 4DUYF 2JNJA 5KFPA 1VIXA 1NDPA 2WZ1A 4F0XA 1UWBB 2DR8A 2M7SA 3DOLA 5DM7Q 4NGNA 1UJ4A 3IWEA 3VCDA 4PG8A 4HNWB 1ZPWX 1YIJS 3D2PA 2C2OB 4QUSA 3FFIA 3EC4A 2CJAA 2YKNB 5F8HA 2Z8QA 2JH3A 4FPRA 2HNYB 4P44A 3FEDA 3QNVA 2ZITA 2H5EA 4ZA1A 1TKDA 2P6GA 1S0MA 2HHTA 2IAJA 5ETQA 3LQVA 1FXLA 3TANA 2ADCA 4RW6B 2DNPA 4W4MA 1YHQS 2YTCA 4JP8A 3TI0A 3H2LA 4CT9A 3TUJC 1BXNA 4IR9A 2PJ5A 2VOOA 3PB9X 5G22A 5I4MA 3DYAB 3H8FA 1JK9B 1VHIA 3NNCA 1TL3B 1XMTA 4R6TA 1GTHA 1S97A 2EPIA 3H0PA 4HR2A 4Q43A 3MN8A 1V9OA 4KLWA 2F1FA 4EK2A 3MXHP 3NGUA 3DOKB 3DCAA 1DHMA 4N76A 2VUGA 3QRQA 3GYNA 4QVTA 4DZDA 5B0BA 4LFCJ 2NLWA 1Y9WA 1EAYC 8AT1B 1RT3A 3F56A 4GVLA 2J5AA 1IU8A 2XHCA 5BJRA 1U0SA 4DR1F 3FF3A 3CJ8A 3OTCA 4JD6A 4CH7A 2RS2A 3SI0A 2OHDA 2W9CB 3T41A 3DMJB 4K4VA 2EK9A 1FT7A 2QC3A 1CG2A 4ECWA 5J2MA 1S76D 3HVTA 2ROGA 3KOAA 4Y34A 4K30A 2Z3LA 1VQ4S 1WG5A 3TJ8A 4MFLA 1I1DA 4DR6F 1S57A 4ZCIA 3BO2A 1RYSA 4M95A 2LMIA 1U48A 3ISNC 4ANEA 2EXUA 2V67A 2IM2A 4A8OA 2AZ1A 1Z8WA 5L1KA 4DV7J 4TLQA 2CIJA 3NMRA 4K5SA 3WR7A 2PIIA 2W7AA 1Y7EA 2VC1A 2NS1B 4X4NA 4MFQA 1KLMB 5IV4A 2V8GA 1JKHB 3FK4A 4H54A 4IRKA 4DV2F 2DXQA 2P5VA 3I87A 2Z11A 3SI1A 3QT7A 1O51A 4B3RF 3TEHB 3R5BA 3U7JA 4WK1A 4NASA 1HNWF 4CM2A 5LXRA 3IC1A 2PJBA 5A0YB 1HNXF 2CPEA 2C6PA 1BQNB 4XIUA 4J5OA 3R9LA 1C2PA 2CPXA 1KOOA 2GIRA 1TFYA 2LA6A 2PA3A 3LTOA 1RAAB 3QJJA 2DR6A 5LYLA 3K9UA 1TU0B 4QPTA 2U2FA 3V4MA 2XZWA 5IB0A 3SQGB 3PY8A 2QYCA 1DRZA 3DHWC 4XO0A 2V6AA 2QLFB 5HLFB 4OC2A 2MQPA 5FVJA 4B9LA 1O5JA 5J2NB 2BRKA 1OMSA 2WAQD 3FJUA 4BBHA 4KOSA 1JLFA 4L72B 4XPEA 2CPZA 1FTRA 3HSGA 3SJGA 5AG7A 2FPHX 2N7CA 3BGLA 1B70B 1N71A 2IJRA 2B4DA 2V8HA 2VG6B 4C9DA 5MAOA 2ZVIA 4N5SA 1HNVA 2BANA 4W90B 4OL8A 4USIA 3TRGA 4FWUA 4AL7A 3LP0A 3RU0A 5HP1A 2YKMA 5HMZA 1VLOA 1P8GA 2BA9A 3BBBA 5HH1A 1SV5A 2NSBA 4ZGYB 4NWBA 1WHXA 2B4OA 2B8QA 1I21A 2SXLA 3KK3B 3HMJG 1TL5A 1CJUB 1EARA 3MM8A 2PJCA 1UJ5A 3W3SA 4ES2A 4FYDA 2J7WA 1H0HB 1FXRA 2VEZA 4RWXA 3IRWP 3HULA 1G1XA 4AVCA 2GQCA 1NPKA 2RSQA 1NK0A 2HFUA 4KKOA 3KLEA 2Q79A 4FYVB 4CLWA 3VQTA 5KFCA 2ZZMA 3NGTA 1TAUA 3B3SA 5KFJA 3VAJA 4CGPA 3FYNA 3LP1B 4LF9J 5G0RB 4B3SJ 1V0CA 3HK2A 4U8VA 1S6QA 3CXSA 1H7WA 1XMQJ 4E8OA 4B5OA 3LWMA 2GGPB 1G4CA 4N8OA 2Q6BA 3UCGA 2QRRA 4C8NA 4NZ6A 5EHHA 2MXYA 3WC0A 2HWHA 2RRAA 1FKPB 2L9WA 3AQPA 3T9ZA 4KQZA 1RT4A 2FJWA 3FB3A 3RNZA 1X9MA 2JDJA 4C97A 3CCUS 2XI2A 1ZZNA 2K5TA 2BX6A 4OIDA 1CJVA 2UUCJ 1ZLHA 2Z30B 4NLVA 2DPTA 4KOXA 3B3CA 2AFXA 2KG1A 2ZH6A 2BJ1A 4DR3J 4XDCA 4MBUA 3WX4A 5J2NA 2CJYB 3TFYA 4ED7A 1FRIA 3KHRA 2B4BA 4ANCA 1JLBA 2VZZA 1F9FA 5BYRA 1MK4A 4LF7F 4H4OA 3PJ9A 4M63A 3SSSA 2XGQA 1XBWA 2P0WA 1HBUA 3UN3A 1M5VC 7FDRA 3DRPB 5L1IA 3NL0A 2AMCB 2ZW7A 2C22A 3UDEA 1HNIB 2V9WA 5A6WA 2FGOA 3I0RB 1KEKA 1SV5B 4AT1B 3ENWA 4A8SA 3WQPA 3R1HA 2YGWA 1Z5RA 2ZXVA 3SSRA 2APOA 5HMNA 2LYVA 4U9RA 2CUYA 3EGVA 3JQJA 1ACMB 4JI6F 5LM7E 4CO0A 2MZTA 2C1CA 1Q8IA 1F3VA 3LD2A 4YOEA 3WHIA 4X2TA 2CQ4A 5GVQA 4ZX8A 4A8XA 3KLEB 4F4AA 4UZBA 1BWVA 1OY8A 1GK8A 2QMLA 3PIOQ 1NK4A 4EFAC 2Q04A 1KOHA 3RR7A 2AWZA 2Z58B 4RW8A 2HGMA 3J7A1 1WDTA 2HGNA 4MK9A 3IAM9 2P8IA 1JLAA 5ETVA 2BE2B 2XNRA 4QIGA 4KIAA 3P4UB 3V6JA 2OPSB 3KMSA 4NLRA 5A76A 3HHLD 1S6PA 4UCPA 3KLFA 2PCUA 3HHKA 3TVZA 5A6PA 1FF2A 3KG1A 3HM9A 3MMAA 1RTJA 1NJYA 1UTAA 1M1GA 1W2IA 3NBPB 1WJ9A 1GT8A 2OPRB 5LMUJ 5G20A 4U96A 5JUMA 3HLPA 5HMXA 2BJEA 2E7WA 1RHUB 2B51A 2F8MA 4WE1A 1K0VA 4LVOP 4BWMA 4MIBA 1FX4A 2VH7A 3H2UB 3GJQB 3MEEA 2DR9A 2CZ9A 2YQ0A 4RO0A 2E1RA 2VPYB 1OYEA 3K8WA 2UZAA 4LFBJ 4RN7A 4C7HA 4NGTA 3CDBA 3HKZD 2NZCA 3K5OA 3PW2A 3BXMA 3MR3A 3W66A 1FKAF 3TW0A 5F48A 4I69A 3KLHB 1HWUA 4NXMF 5A8WA 5CD4H 4YB7A 1S1UA 1SJQA 4LR7A 4FZVA 1T3NA 4TLRA 2MB0B 5IQQA 4NLUA 4EO6A 1YITS 1YI2S 4OYXA 5KFHA 2PJ2A 3CJ0A 1HKAA 3DOKA 1SUQB 3MECB 1UP1A 1NKEA 2OFGX 1ON0A 4AE5A 4AYBD 2EO8A 4DUZF 4K7QA 3V2UC 3EVMA 2D69A 1RI7A 1VRTA 3IRXA 4GM5A 1X4HA 4MXUA 2XCPA 2D1CA 1JJHA 1HR0J 3CDAA 2YNFA 1VQMS 2J0XA 2FY8A 2D3O1 4B9SA 5DG8A 3I0SA 2GO9A 3BLNA 3HX9A 4AL6A 3PEHA 2XCAA 4WZMA 3KHLA 1S1UB 1YLXA 3EM1A 4J7CA 2B6AA 5HI7A 1LWEA 2HQGA 2B5JB 3LGHA 2CNNB 2Q6CA 3LPEA 1KQFB 4F3QA 4K8RA 4IUFA 1RAJA 1HIYA 2W2NP 2B4DB 4ENOA 1DLOA 2BE2A 2QV6A 4KR0B 1TAQA 2QTWA 5J2QA 3LH2S 4AQYF 2IAJB 1C0UA 3JUWA 4FD4A 3BZQA 2L9DA 3V4IA 5KG1A 2JLFA 2BJ7A 1U1KA 3M8PA 3OD2A 1YJVA 3D1HA 2DVIA 4UCMA 1IQZA 1U26A 1FDAA 1IXKA 5CYJA 1I94F 3AJDA 3IR6B 4HEA9 4TY9A 5KFTA 1RA7A 4TWEA 2OPPB 2OJ3A 3CDXA 2J8SA 3PRTA 3UDLA 1DBDA 2B4PA 4F25A 2PVVA 1HBMA 2ZZNA 3C6TB 2V2VA 4KTQA 3IWGA 4DFPA 3HUVA 2KCWA 1YJ7A 3OTOF 3BBCA 3Q86A 1KZFA 2RF2B 4H6UA 4LBIA 3PO4A 5LYFA 2AYEA 4KKOB 1WOOA 3M8PB 3WX8A 2F3JA 4Q2MA 1IBKJ 2D4PA 3SCJE 2QYVA 1ZAWA 5E2QA 1VQ6S 1IKXB 1YGHA 4OYZA 3I9V9 2C2MB 4OZ2A 3T1YF 3BN4A 2VJUA 3W2WA 5AXMA 2R8HA 5LYIA 4X4QA 4ATNA 3DLHA 1FJEB 1RADB 5DZ7A 5F0UA 2JBJA 2V4JB 3W6SA 1FDDA 4LF1A 3TNVA 4N8NA 4X64F 2EFQA 2VZYA 3D67A 4ZITA 4MKAA 3KR5A 3CJSA 2BE9B 4R9MA 1WG1A 3CCMS 1KUYA 3FSYA 1Y7PA 4NLXA 4BHQA 3IWXA 1REVB 3CD6S 2P9GA 2MKCA 2K06A 3NCRA 1JQGA 4B08A 4F04B 4QCLA 1IKWB 3KLIA 1PILA 1NHKL 3I1UA 4PSWA 2YY3A 2I2YA 1RZMA 4L8AA 4WFYA 2B3UA 2HWIA 4K59A 4CLKA 4P71A 1JLGA 4CI0B 3PX4A 2OSQA 2RUSA 2DXEA 3HZEA 3UDCA 3C6UB 1FEHA 2DHXA 2OAUA 1Z2ZA 4K4ZA 3SFGA 3T5LA 4I1TA 3P3DA 1UWAA 5HQ8A 1HQEA 3B2YA 3TX0A 2H1YA 5IV0A 2KRRA 4NRTA 1HA1A 4MK8A 4OMEA 3EJMA 5ETMA 1HR0F 4OZNA 1SH2A 4LMZA 2IVMA 2I3CA 2C3PA 1TP7A 3UD3P 4LF4F 5IB9A 4PUOB 2KHDA 2KI2A 1VI7A 1CC8A 3VWEA 2PE8A 5EUHA 1RKIA 3PGPA 2GFQA 2HZCA 2FC8A 4JLYA 4FBUA 1FRKA 2HFZA 5JVHQ 4ECTA 1SQHA 2R1IA 4JI3F 4L76A 5KG4A 2DCLA 4HACA 4Z7YA 5F8IA 1FVQA 5JXSA 4X8IA 5E41A 2CQ0A 4UQGA 3DRXA 4NXNF 4MFBA 3IWNC 5EN1A 4C0HA 2OMOA 2XS5A 3W9JA 3ZZTA 2HFVA 2D9OA 4YP3A 2FL4A 2W9BB 1CPXA 1HDQA 5CQGA 1XNQJ 2AFZA 2ZEJA 1YJNS 4H4OB 3LP2A 2XM3A 4Y2KA 4JI0J 3HHLC 4J9VA 3EFAA 4NX9A 1SL2A 3F0AA 1RT1B 4JI8J 4IFVA 3RTVA 4OX9J 4MJKA 2XBPA 3OLBA 3QB8A 1RAGB 4YY3J 4DX5A 2VL1A 5CZVA 4Q8EA 1X5OA 3TOBA 1IR0A 2GS8A 3QAUA 4NOHA 3UR0A 1N6QB 3NMAA 1H38A 2DGWA 1NB7A 2FVPA 1EKRA 5KT3A 1XMOF 3GJSB 5KFFA 4UY8T 1D3WA 3HJFA 2WTFA 5IT9Y 4E2FB 1SKRA 3PHTA 2R7TA 1B6BA 2PJ7A 3RAXA 1YX2A 3BJ8A 3TZWA 3KLGB 1ZLIA 2V69A 2MPUA 2HBQB 4HKFA 1HI8A 5C24A 3AOAA 3HVAA 3GV8B 2VBWA 4QC6A 2YPZA 3QZ8A 3NGDA 1JLEB 2G0CA 1GXTA 5I3UA 2FLOA 1IM6A 2V94A 1JWWA 1MROA 1RK8A 2H9ZA 4WXWA 1EB0A 2GVDB 2C2KB 2RHSB 2OGUA 3I5AA 4DU8A 1UAWA 3MCNA 3W2VA 3BKUA 4MIAA 4ELVA 1XMOJ 1S1WB 2MY8A 1XE4A 4ZI6A 1NPPA 3R27A 2BCOA 4KJIA 2VXKA 2L9NA 2WPWA 3NBPA 5H9FJ 2ZEEA 1APSA 2DGXA 3C46A 1M1DA 1U0HA 3MR7A 1N52B 2CZ4A 1WK4A 4DPXA 3BI1A 3PP9A 5I3UB 4OX9F 2LP4A 2AFSA 1S72S 4WE1B 1LWEB 1F9HA 4K2JA 2JEIA 3EWGA 2WVDA 1I12A 3I5BA 3R3TA 4R7MA 4DV6F 1NCLA 2A3JA 2HHVA 5KOWA 3PFOA 3FSXA 2LEPA 4MAKA 4MYTA 3W61A 4YQWA 1UMJA 1OY6A 4M3SA 4PXEA 1XR7A 5BR8F 1FNMA 2OEJA 4IDKB 3MAHA 2HK2A 1VFJA 2WK4A 2FHJA 4N7TA 5CPAA 5KFBA 1HI1A 2QMXA 3MPYA 1WEXA 4IFVB 2FZKB 4O3NA 5D8HB 2FJDB 3L3CA 1QLNA 3CXPA 4ID5B 1KRPA 4IAVA 4ZY1A 2DNMA 4O0NA 3TZZA 1OYDA 2FCKA 2M9KA 4F9VA 1TK8A 4OHZA 4C68A 3G6XA 1PUAA 3K9TA 4IQMA 1G7CB 1NH7A 1SQEA 4ERDA 2K1RA 5IV3A 4C8KA 4C8ZA 2G2YA 3CJ3A 4OAEA 2DEIA 3R5CA 4YHHF 5JJBA 1HNXJ 3CJQA 3IEHA 2C6GA 1RWWB 1T11A 3D6TB 2DNZA 1DY3A 2B6AB 3NAIA 4ZJQA 4QPXA 1RWXB 4Y6IA 2ZUGA 3PM9A 3LWLA 5IT9U 2PIYA 2KXNB 1ZOTA 2CTBA 3MM5A 2C3MA 4S0MA 3OL6A 1BUXA 4DV5J 1TMJA 4NXYA 1G2EA 1G6BA 5K14A 4K2XA 2Q4ZA 2DY1A 3LGMA 2LKZA 2M5YA 2MKHA 3I5CA 4PAAA 2CY2A 1WACA 3LWUA 1A2ZA 1KS2A 3T5KA 2BRLA 3A8KA 3TP2A 5I3PA 4URGA 5GAEI 2PC1A 2HGLA 1JNZB 2R7QA 1IR2A 3AOBA 4FNIA 4TU8A 2BZ2A 2EFOA 4F36A 1U1OA 2J9DE 3KHXA 1SUQA 3MECA 2BKOA 3RAQA 3SCLE 2DPIA 5C2CA 1H73A 2N82B 3FXTA 1B3TA 2GVZB 2NSMA 3A3PB 1OJ4A 3R7BB 2ZEPA 2FHJD 3SI8A 1TL7B 2MQLA 4DV2J 1KTVA 5C42A 4IRDA 1S1TB 2D4OA 4JI3J 3C8YA 2QX0A 2W4CA 2XSJB 1N0VC 2B3VA 1DTTA 2ZEHA 3MCSA 5D4NA 2LECA 3V38A 2ZOFA 3UVJA 1FEEA 3KR4A 2G0JA 4DSEA 3OL9A 1HBOB 1QAYA 2R98A 3DLKB 4DPOA 4D3HA 1PAEX 1QD1A 2OSRA 2B5JA 1KVIA 3HVTB 3RW6A 5DDRC 3RJMB 4ILRA 1D9DA 3CIZA 4LFBF 3P45B 5KG7A 2ZH3A 2V4JA 2F5IA 2R4FA 4DPUA 1U1LA 1ZG7A 4OHXA 1C0UB 1GMWD 2H4WB 4PEOA 4JXQA 4RNHA 4ZP7A 1NK7A 3ZNUA 1IGBA 4LF5F 4DXLA 5GADI 4YUDA 3J7Z5 1Z4RA 5KFRA 2NXNA 3MPDA 3R5GA 2CQ3A 2IY5B 5LMUF 2GIFA 3K5PA 3MUMP 1Z2LA 1PU9A 4LQ9A 2RFHA 4GO5X 3CCSS 3CO9A 4DI6A 4JI4J 4Y65A 4I6AA 4Y0FA 2CPFA 4AQYJ 1SIZA 1HHSA 1XEBA 2ZWPA 1J5OA 4RNMA 3N6LA 1QAXA 3RBUA 2A6MA 4NA3A 4EBEA 1Q2CA 1JLGB 5HMYA 3HI9A 3GP9A 3GSDA 3RO0A 1IIDA 3R8YA 4ALZA 5L9NA 3K57A 4J37A 4CLPA 2B3TB 4LUBA 1YMEA 2DISA 4Q36A 4EUVA 4B11A 4ECYA 1F1BB 4X64J 3NS7B 1HD1A 3D4JA 1RTHB 3OR2A 1U8SA 1J2VA 2XMAA 3PTWA 5KFAA 3SQOP 4IQXA 5FDLA 2XMWA 3QT6A 1HEEA 3CGIA 4MKYA 1AZSB 3M8RA 1ZG8A 1OY9A 3GIMA 3IS9B 5B0GA 1KONA 1IYLA 3B8HA 1KWMA 2VF3A 3Q8UA 2DHHA 3KL9A 1KQKA 4USWA 1YW6A 4P45A 3CD5A 1QSYA 4Q0BB 5DM6Q 1QUPA 3KUGA 4HACB 2VBXA 3V81A 3LP0B 1M4LA 4DQQA 4A8WA 3UDVA 1SC4B 2DD8S 2DPSA 4OLPA 2KYZA 2O1PA 5KFZA 2X1GA 3OR2B 1HPZA 4NYPA 3W60A 1R7IA 3ZO7A 5F3TA 4K4XA 4ZVGA 2K3IA 1O0PA 1SH0A 4M5DB 3G8QA 3M6UA 4W98A 1HMVA 5LRKA 1OPIA 2ZE2B 5F49A 2BJ3A 3NAHA 3OFHA 2J8RA 1FESA 2MQQA 4FD7A 1WC1A 3AB2B 5AXNA 3DKDA 1FFGB 4V19J 1NXIA 4J90A 4KS9A 1T03A 1NK6A 1CJTA 2PGCA 2VFSA 1OPZA 5BWAB 5HVFA 2FIWA 1UEUA 2XB2D 3A13A 1HNZJ 2MEWA 3ILJA 1OSCA 5D29A 3M30A 2YKOA 2DGQA 3P5TL 3PG9A 5HLFA 2BEIA 2EBEA 4O3OA 3FCVA 1MMDA 1S1VA 1KD1T 4IDKA 1Y0HA 3D7FA 4DLEA 2E29A 3FMBA 4H4MA 3BO4A 2Z2LA 3A3OB 3W7BA 3MM7A 4KOUA 2DNGA 3H90A 1GMVA 3PYDA 2VU5A 1ZYQA 1RHMB 3WC7A 3ISND 1L0CA 1F9EB 3JRUA 1RWPB 1Y7RA 1QSNA 4H2KA 4FNHA 1Q2DA 3PJWA 4X62F 1VC6A 4IRCA 2GLFA 2X1FA 2F8HA 3P8BB 3N28A 3QO9B 1NPRA 4LT6A 4DQIA 2EI5A 4B9MA 3RRHA 4PSXA 3Q8YA 4M5JA 1MLAA 3K5LA 1X12A 2R2SA 1U6FA 2WB4A 5CH7B 4C2XA 4K4YA 1FJ7A 3MMBB 1MU2A 4Q2LA 3UE2A 1I5OB 4LIWA 4J9QA 5HMWA 4ZVHA 2X3GA 3U27A 3G6ES 2QLXA 1KSPA 4EWTA 3FEZA 3OHBA 3WABA 3D7HA 2RQKA 2VBQA 1HBUB 1SB6A 4A8QA 4WXOA 4GS4A 4E0DA 3EZUA 1VMBA 4KSEB 2FE7A 2GJIA 5BYQA 4E0AA 4WIIA 1LW2A 2KL8A 3F41A 2R2TA 2K8GA 3FCHA 1PC4A 4M5MA 2H4YB 3BBFA 1PG5B 1WI6A 4RW7A 2HIQA 2YNEA 2CXAA 5F46A 3O1LA 4LVNP 1G3OA 3TVKA 3VGSA 2C2RA 2B56A 1WWZA 2HK3A 2XTJP 3NH5A 2V8PA 2DNOA 3EXYA 4MCSA 2CVEA 4UF4A 4DL5A 1ZTTA 5J1PA 4CLYA 4DV4F 4OZJA 3JS9A 2WZNA 4FF1A 4FXWA 2VG7B 1IKYB 3CNQP 3VZHA 4KSAA 1RJJA 2R2RA 1U47A 3W62A 4XAKA 4QB9A 3PEIA 3ZZZA 1VQ5S 1NKBA 2F5GA 3OFEA 4RW7B 3CDWA 4BWJA 2R7RA 2YKNA 3M9MB 3VAIA 3SXOA 3L4BC 4C2YA 3D0HE 2ZM6J 2DKOB 5CNPA 3H5ZA 4ONWA 4DR4J 4X4OA 3WIUA 1DQ8A 2CDQA 2Q43A 2Z2ZA 1VHFA 1AROP 2QE5A 2NUHA 2Q4YA 2J6UA 5E5NA 4J9LA 3HFKA 2JEGA 2PQ8A 2F63A 3EZ5A 2VQFF 1N4LA 3B78A 1WC6A 1R89A 2Z3MA 4MHPA 2AF6A 1EIYB 2CQ1A 3BPSP 1F60B 1REGX 4WP8A 2UVVA 3AFGA 5EDWA 5ISVA 3J81j 1NUEA 4JYWA 4OC3A 1RBOB 1B7FA 4FS2A 3FC9A 1FX2A 1Q16B 4AXVA 4H4KA 4N41A 1TK0A 2JJ4D 2VPXB 4TXSA 3TZYA 3FRMA 1NDKA 1R8PA 2I5JA 5FLXU 2V5HG 2VDHA 2DYAA 3DRYA 2W7OA 4HHUA 2G9DA 4O4GA 3G6YA 5F9NA 4IYQA 2IM3A 1NSKL 2BR0A 4KVOE 2WVEA 4KORA 4M85A 3ZZYA 3GV7B 4O0IA 3RR8A 5IM0A 5SUHA 4JI1F 2FVRA 1XJWB 2EUIA 1QE1B 3GQCA 4FBTA 4U7CA 1HHTP 1DE4C 4CYUB 3DLBA 4P75A 2MHEA 2YX7A 3DFEA 1XQIA 3DNSA 1XN9A 1IOIA 2G3AA 2VI7A 4ONUA 1XEZA 2AYMA 3SIPB 3UN5A 5HROA 3AB4B 3C3LA 3KNAA 4R8FA 2X51A 2IM0A 2Q0YA 4B3MF 2ZHBA 1YGYA 2WRMA 2AJFE 3HKWA 2Y1LB 1S4FA 1N5QA 4X3RA 2XLJA 3CIMA 4ZVUB 3BYRA 4F8ZA 1YVKA 2BQ3A 5KTQA 2R8JA 2B0GA 4FF2A 4WFBQ 1UKUA 4MFPA 3MEGB 2C6CA 2B5GB 4M5KA 2I00A 1N5SA 4NJRA 1C1BA 4KB7A 5KFMA 1KUXA 2UXBJ 2EFPA 3VTIA 1GHEA 4HDHA 3OLAA 4NGSA 4DL0C 4ZLNA 4F4KA 2MQMA 4O3SA 2IQ6A 4UIBA 4OZ1A 2XSJA 2EW9A 1VQ9S 2GIQA 4KV8A 5EX3A 5ELYA 4I68A 1CJKA 1RU2A 3W9HA 3Q23A 1S9GB 3PB7X 4DV0F 3EGWB 4F3MA 3SSQA 5J1EA 3CO0P 2ZDPA 4EGLA 2CNSA 3KQZA 1RACB 2MQ8A 3H8EA 4LF6F 4MFKA 4NJQA 3D5MA 2E44A 4NLGA 3UNGC 4DV5F 3QNWB 3E01B 2HHPA 2IC3B 2RU9A 3ZTOA 3BI0A 1UZDA 4YEAA 1MJAA 1UPPA 1ARMA 5KTCA 1CQNA 3PDNA 4JJXA 4NXMJ 1RP5A 3TR5A 4EEYA 4IO9Q 1QAJA 3FMWA 1RAHB 4UW2A 1UA1A 1TKTA 4UWIA 4MI4A 1S99A 3W5ZA 2HQYA 3HSZA 2CQ2A 4NYZA 2XEJA 1BHNA 4GO7X 3TT2A 4UOFA 4CYOA 1Z8TA 1M1HA 3PJXA 4RUCA 1V5VA 3V7ZA 3R5DA 3P49B 4EU0A 2CA9A 2ZOGA 3CMAS 1GH8A 2ZD1B 5A27A 1RT7B 3BDPA 2KM8C 3FBFA 1LNQA 3KUHA 4ZIWA 4UFVA 1WKKA 3IR5B 2ZH1A 2ZE2A 4X5KA 1MU2B 1RAEB 4YRHA 2OPQB 1S6QB 2GMHA 2I8EA 2CQCA 4BC9A 3GR0A 2DNLA 4P4FA 4PQUB 4KT0C 1RO5A 4DPWA 3MM6B 3GR1A 5J1QA 3IBFB 3Q8PB 5B09A 4M6IA 3G82B 2JLEA 3CB4A 3DGPA 1U2CA 3TARA 4KOYA 3RUBL 2QA2A 1EQ0A 5CABA 3I6PA 4C11B 1R43A 3D1QA 1TUVA 3S1TA 1VK3A 4FDFA 4WBFA 3DI6A 1VC0A 2WHOA 2ZM6F 1N5VA 3CE8A 4X4UA 3F8KA 1QJHA 5H84A 3G8WA 4P2FA 2ASDA 2HHWA 3UR3C 3DXSX 4KFBB 2BKPA 1K0TA 1S7KA 1H3DA 3HP6A 2M52A 2QYGA 3MCOA 3R5AA 1RHQB 3BKFA 4USHA 1CVJA 2V2QA 4LRBA 5D3GA 4L3KA 1HWLA 1RT3B 1FJGF 2OD4A 4ZP9A 4OHWA 1IKYA 3H4DA 4FKXA 1S9FA 2YNHB 2QEXS 2W9CA 2L08A 4MCRA 4LFCF 1UPMB 2REEA 3LAMA 4N77A 3CCJS 5J2MB 2QL9B 1PO6A 4CCHA 1Q5VA 3C19A 1W26A 2D7SA 2ZW5A 4PK3A 4OMFG 2Z3KA 4CM0A 4E98A 3H98A 5B0DA 1QAIA 2JHEA 4X4SA 1LWFB 4O3RA 1T03B 4DR2F 1WEZA 1VKCA 1KP6A 2HVDA 2Z10A 4OC0A 3W1YC 2GJ2A 2GNKA 3JQMA 3JSBA 3A9LA 2JOQA 2AGQA 1BC6A 2FHOB 1S6UA 3ZZ0A 3C15A 4C0BA 3GILA 4I0WA 1YRTA 4KLVA 3P2HA 4JWPA 2HNYA 2QL5B 1JNRB 3POTA 1Z4EA 4RU2A 2ZKTA 3GG1A 1M0SA 3E51A 2W8LA 4LSNB 4RR5A 2HV2A 3RRKA 1BQNA 3VQSA 2UVRA 3GIUA 1IKVB 1SQGA 4F26A 1JLCA 3CC4S 5HXDA 1Y9KA 1N34F 1NJWA 1B7YB 4FVCA 1S0NA 2Y0MA 2RT3A 3OL8A 2W2PP 5EWEA 3A4TA 2VG5B 4P4JA 1R6YA 1YVOA 2XMTA 6FDRA 3A8IA 5KTDA 1F5AA 5D8NA 1NO8A 4IH6A 1ZO0A 1S9EB 3CDEA 3BQ0A 3MMJA 2M3DA 1TMMA 2C42A 2IHR1 4BS2A 1GNKA 2F9DA 1LRZA 4OIWA 2YWWA 1JLFB 2PJ6A 1S59A 3G3SA 2PA8D 2PSZA 4WWVA 4JXRA 1CLFA 4YDXA 4OZLA 5K8PA 2GX8A 2JX2A 1X4GA 3EDQB 4NMLA 5AE2A 3JSMB 2V2KA 1FA0A 4HPSA 4AG7A 5JMNA 3D54A 1U6MA 1S5KA 4OYWA 5M2RA 2B4UA 4RI1A 4WU3A 4LF2A 1QM9A 2KVIA 1IJEB 4PWDA 4V1Ak 1M5PC 3EY5A 3GJRB 3IIBA 3CVKA 3NS6A 3W5YA 2E1AA 2VOPA 1SJ4P 5KFXA 3V6DB 1CJUA 2JLGA 3NP5A 1RXOB 2F4FA 1FK9B 2QLBB 4WP9A 2LU1A 3L7UA 4ZHRA 1TF9A 4I56A 4ZPAA 3K8VA 3M2VB 2N4CA 5D6GA 4Q44A 2NCKL 1PJ5A 2CQHA 2Q51A 2WSAA 3R95A 4DJLA 2Y9HA 1OIAA 3KTQA 3TYTA 4DSKA 3MPVA 1P9YA 2M2BA 3J7YI 4DS5A 2OPRA 1U6ZA 3Q8SB 4URSA 3ZC4A 5KT2A 3B82A 1T02A 2ZHAA 1WC5A 3H8GA 3IO1A 3EMTA 3HHDA 4PR6A 1WNEA 2ZELA 2XI3A 5B08A 3POTB 1DURA 1FJGJ 4JYAF 1XC9A 2ZBQA 4JV5F 2AKWB 3DU5A 2BL1A 4LJMA 4X2BA 3EVOA 1QE1A 5FIIA 3SDEB 3QSYB 1IKVA 4QQBA 2NQPA 4U6PA 4CH1A 2HHUA 2V50A 2J8MA 2JFKA 4EYHB 4C3MA 5D4LA 4YB1P 3DMJA 3NKYA 1UWBA 5DDOC 2PE3A 3GYAA 3IP0A 2IVYA 2Q7SA 2AFMA 4P2MA 5CAAA 4TVAB 2KJWA 5KAKA 2XY6A 3F0NA 1IR1A 4P4DA 5F8GA 1S9EA 3R6LB 5J2PA 1VQ8S 4RW8B 1C4CA 2E9ZA 5DG9A 2XGPA 4K4UA 6AT1B 1E6VA 1VBKA 3KWMA 4ZY2A 1EP4A 1I6JA 3FEYB 2NR0A 2HLTA 1T05A 2LQBA 2WW4A 1RT6B 2YNIB 3TAMB 4QIFA 4AVAA 5GMKa 2FB0A 2OPSA 3CMES 1CSJA 5L1JA 4UFXA 5HVHA 1U2RA 2HZVA 2UU9J 1RTJB 2DXDA 3A1YG 3KZWA 2MSTA 1WUUA 3D4UA 1TL3A 3U1MA 3FNCA 4W92B 4ECUA 5F09A 4O4GB 2VPWB 4P4BA 5C25B 3D3SA 1MN9A 2EWBA 5J2PB 1FKOA 4P7VA 1ZPVA 1IBMJ 4NI2A 1J27A 5RUBA 4L3NA 5H86A 3S7RA 5ETPA 5FJ4A 1XIXA 4DN9A 3I4PA 2DH7A 4ECRA 1C0TB 1VQNS 2LQ8A 2KB2A 2RAQA 1IBCB 4Z65A 2QN6B 3MPWA 2MQOA 1NE9A 2ZBCA 3M2UA 1IM4A 3ZZRA 2RS8A 2RH3A 2DNQA 4CZCA 3AD8C 2VFUA 3MGJA 4A32A 5K8OA 1CC7A 5GAHI 5C88A 1VIOA 4TY8B 3UY5A 2DGUA 2CQPA 2M88A 4B13A 4NPOA 3QPIA 3U1NA 5AXLA 3PYFA 4NI2B 2Z2YB 2COLA 3RB6A 1U1MA 2FT0A 1TKZA 1BPMA 5I42B 4NA2A 2OEKA 4Y49B 2PSWA 2MY7A 2CPDA 1NK9A 2CJBA 4NGQA 4B10A 2NSCA 4ED3A 2IL4A 2ZH5A 2C2EA 1MSWD 4FPIA 2AP6A 3SZ2A 3GFXA 2EFVA 4GVBA 4ZN3A 2QJ3A 2EFGA 2ZDOA 2FJEB 1U45A 2Z3OA 4NL5A 3D7GA 5L8RC 4CYQA 4K5RA 3EGZA 3PRBA 3DLLQ 3MM8B 2ZC4A 1TR0A 1FE0A 2K7KA 1TTHB 2RC4A 3WC2A 4MMOA 2PMWA 2IRYA 4OYBA 3PR4A 5LRGA 2CKWA 1DLOB 4Y49C 1U25A 2E66A 3AJ2A 3DGPB 3S6GA 3WDOA 4A46A 4HH1A 5J8FA 2E5LF 3V4IB 1FNOA 4KVXA 4NA1A 4C11A 2W25A 5THWA 1TKFA 1BMQB 3OUYB 2X1AA 4ZJOA 4TU9A 2GE3A 1WI8A 4NCZA 4QZVB 2ZEMA 3HO1A 1SKUB 5GCNA 2F4VF 3T9NA 2HC9A 4DFKA 2XMMA 5JQ4A 1KHVA 4OI6A 1I51B 3OVAA 5G0RA 4QR0A 1Y11A 4ECZA 4NE9C 2L3MA 5M2PA 1CS4B 2H65B 4PYAA 3VGVA 5E3PA 1WF2A 5F9LA 3K59A 1VRTB 3IRXB 3B35A 3VARA 3B4MA 3AOCA 3MCMA 1RT4B 1X4BA 2LFVA 2MZQA 1S4EA 4UUWA 1KQSR 3ENVA 5LSRA 3ZNJ1 5F8JA 4Q0BA 2QJ8A 4B5PB 1UVJA 2WVBA 4CLZA 2R42A 4G65A 1FFWB 1PSDA 3KQXA 4B9VA 3JAMU 1FWKA 1IN0A 3Q22A 5T41A 3GY9A 3N5BA 4NFRA 2R3VA 4HYKA 2HQFA 3LOUA 4KOWA 5L46A 3ENAA 3MMCA 1WWHA 1FRLA 1CS4A 4DSFA 4L6V3 1AT1B 3I55S 2RILA 1HQUA 3G6VA 6CPAA 3MMAB 2ASLA 1A7GE 1X8DA 4DV3F 3Q8RB 3TEGA 2KTQA 2OH1A 4HT7A 3SV4A 5DDPC 3I56S 3TOQA 1UETA 1ICEB 3EX7B 3FBBA 2JSXA 4RUBA 4Q8FA 4GVBB 4PG7A 4FD5A 2J0SD 5LYDA 2D3UA 1TK5A 3GSIA 4DDFA 4KGKA 5KFNA 2Y1IA 3S6KA 2VQFJ 1Q82T 2PO4A 1TQLA 1H8LA 4DHVA 4Y00A 4LSNA 4XNHC 1URNA 1RUSA 4M8LA 4PG4A 3RBEA 1N36J 2DEJA 4ICLA 2MJNA 4DX6A 2VG6A 3C66A 4J9RA 3M7VA 1FRHA 2GANA 2OZUA 5ETKA 2VJVA 1FDBA 1X5PA 1R0BG 1VQLS 1X7VA 2YNCA 4J9KA 4B3TJ 4X65F 3KI9A 2XLIA 3Q8VA 3CDUA 1DQAA 1O8BA 2HNZB 3QGHA 3KK3A 2DRBA 1DARA 3AY0A 4CRJA 1TFWA 2Q4VA 3TO8A 4CNYA 3QATA 3CTRA 3VZIA 2Q66A 2W2QP 2ZWOA 3JYTA 1JXLA 4XDDA 4EVYA 2MGZB 4LUAA 4JUZA 3W64A 4R3KA 4HI1A 3ZTQA 1H72C 2VDIA 2AX0A 1FRJA 1FI4A 1ZM4A 1P1LA 5DGBA 1HNIA 3FZ2A 4ZVRB 5EMIA 2UUBF 1JLEA 2B8PA 1IBLF 5CCLA 4BMHA 1I1GA 2PRBA 1PYTA 3RYLA 2KN4A 1EX8A 4NGPA 4DV6J 1WHYA 5C5JA 3H40A 2DGVA 1ZZFA 2K1RB 1IOFA 2I6WA 2J8NA 1S1VB 3D1OA 4KAIA 3QJPA 3ZFVA 4QWEA 3PIPQ 4JYAJ 4E2AA 1RCXB 2O66A 2J9CA 4OI0A 4FS1A 2HRUA 3KGQA 3KFWX 1RT1A 3T1YJ 1U1RA 2G9OA 2DHSA 4CRYB 3IA0A 1IUJA 2UUCF 4USTA 3N6MA 1RA6A 3C2PA 3GMGA 5F41A 3UFCX 4AD6A 2HYIB 3SXNA 3J7AN 5IXUA 4F8RA 5HSPA 3PYGA 2DEAA 3BSOA 2XQCA 3G4SS 1X5SA 1BQMB 3KJNB 3MDFA 2NXUA 1TKXB 5K14B 2P9EA 2W1BA 1BGXT 5JH9A 3CCTA 1FD2A 3QAYA 1SXLA 2RQMA 4CGLA 3KHHA 1Z8LA 1HW8A 3SV3A 4RNNA 4X4RA 4F4ZA 2VIHA 3BREA 2EKYA 3HSJA 3GCWP 5C7PA 1K9MT 1N0UA 4IKAA 4F2RA 4MY3A 4I7FA 2AEFA 4CLLA 3CD7A 3RBZA 1NAQA 1UVKA 4PKDB 2GMJA 3V6HA 1RT2B 3ZZUA 1B99A 4ZBGA 3TVYA 2KRBA 2GVDA 4NCGB 2Z3NA 3MD3A 3HJVA 1YRUA 4LRDA 4Y2MA 4KUAA 3K7RA 1HYSB 2OH2A 1TKZB 4LR8A 1K4JA 1X5TA 3GIJA 1QVGR 2QZ8A 3DRRB 2QMUB 1QTMA 4P4EA 2A0FB 2MGZA 3TA1A 4CP5A 1QSSA 3JTPA 1HL6A 4JI7F 2DTJA 5G21A 2XULA 3PACA 2V9KA 4CAWA 3OFGA 4WFXA 3KDOA 1NK8A 3IM9A 2ALYB 3KLHA 3T90A 5FLXY 1REVA 3SFUA 3GE9A 2RKIB 1S49A 4R8UB 1YLEA 2CQGA 4QYZJ 4CLUA 2YNCC 1LOKA 4M1KA 1N8RT 3RBDA 2AEJA 1IJFB 4WYWA 2W2MP 3J80U 3CPXA 4P73A 3MTJA 3FUYA 4C7IA 4WF9Q 2IMOA 4Y2IA 3AH6A 3FJ2A 4Q38A 4M94A 2J0QD 3LPYA 3UCZP 4B3OB 2YBVA 3TA0A 3P2FA 3I82A 2M8HA 2DY9A 4C8OA 2LLZA 3MAQA 5DLGA 2CG8A 1A0OB 2HQCA 4EYIB 1Q4RA 4USJC 2PC6A 4TYBA 3L09A 2R8VA 3BQ1A 4IH7A 1WHWA 1LV5A 3CC2S 2X1BA 2VD3A 5T14A 4X4TA 3UD4P 4OC4A 2VA3A 4LF5J 4MHZA 2LU2A 1RWUA 1Q2YA 2CVIA 4LRFA 3DLEA 3M32A 4U95A 3U1LA 4QW9A 4P2XA 3W9IA 3CZXA 3PCOB 2ZBPA 2MDAA 1J5OB 2DNYA 1QY7A 5I42A 2FSRA 3HT0A 3ETMA 1YJTA 3LGNA 2G3TA 1T9XA 3M1VB 1RABB 2CJ9A 2L41A 1F5BA 1M4DA 1D9AA 3NWGA 5KG0A 1VRQC 3CXCR 3DDNA 4DZ6A 2EVZA 4ED6A 2MKIA 3EGNA 4CAXA 1DFDA 4LFAJ 1ZM9A 1MG7A 2EBJA 1U0HB 1Q78A 3LACA 2PDAA 4A95A 3VALA 3KLIB 2W7PA 2PMZD 1CPSA 1MJ9A 3LODA 2PJAA 1P1TA 3W65A 5GADU 4RBUA 1WF1A 4TN2A 4C2ZA 5C25A 2AD9A 3Q0AA 4LFAF 5LRJA 3GKRA 2X7BA 4A4JA 4CAEA 2BSWA 1S3ZA 1NMEB 3M9OB 1WELA 3BS9A 3W8GA 4C7QA 3IS9A 2ZKUA 5LMNF 3PHEA 3OVBA 3F73A 1R31A 4LR9A 1B64A 4R76A 2DJWA 3C14B 1RTIB 1S7FA 2NUUG 2R8KA 4AXJA 3ENQA 4ZLPA 2HFOA 4OZ0A 3T19A 1HQEB 2RKIA 4J9MA 4ECXA 1HD0A 2Z4PA 2EFNA 4KHPJ 1SJ3P 3W2WB 5J1EB 4C6AA 1V3SA 3BGFA 4DR1J 4IR1A 2R9LA 4ZPCA 5G1ZA 5IWAF 1KUVA 4JI4F 2QIRA 3EPGA 1NEEA 1HLWA 1NZ8A 2E1MC 2HBZB 1R0CB 3UWTA 3N0VA 3PRDA 3B54A 1O6XA 2ZH7A 1JIHA 4A47A 2HW3A 4GXHA 4PWWA 3C16A 3UO0A 4C8YA 4P52A 1IBKF 4L75A 2JBKA 4QIEA 1FWLA 3PXGa 1DTTB 4UA3A 3RG6A 4QIWD 3HCXA 2ZPAA 4OHVA 3I4HX 2UUTA 3G96A 2HQ3A 2DNKA 1F3FA 3BB5A 1NNDA 3LO3A 4R5PB 2HUZA 4H89A 3FBUA 2MZSA 1U49A 2V34A 4M5LA 4X4PA 4KE5A 3EXCX 3VWSA 2E1PA 2ZBIA 5IT4A 4CGMA 3PR5B 2VA2A 3TO7A 2PJ1A 4A2ZA 4NLWA 2UU9F 2DB1A 2PR1A 2W4DA 2O01C 4HDGA 3O2IA 3JTNA 2IDLA 4P10A 4U8YA 3M8QA 4CO2A 2CPIA 4USUA 4RWWA 2D74B 1R8CA 4K4SA 1FHTA 2C1EB 2D3OR 1F0XA 1YX0A 1IKXA 1FRMA 4F0HA 3ILIA 1S0OA 1RTQA 4DUYJ 2HVHA 1ZH5A 1UFWA 3LALA 4CT8A 4YWYA 3CCES 4ZIVA 3CPAA 1YWXA 3J7YU 1YSJA 4FN5A 3MEDB 3SCKE 2PRQA 2RU3A 2BOAA 1F6TA 1UWYA 1XR5A 1D09B 5KT7A 1MN7A 3NGRA 3T1HJ 4KRWA 5H9FK 2C28A 3PVXA 1RDRA 4Z2XA 5GMEA 1RWOB 2OZGA 3CCRS 3UVJB 2CNOB 1QDUB 2A18A 2GU2A 1AYEA 2AJ4A 5H1SV 3O6QA 2ZW6A 3S6FA 5A2QY 2G13A 2CNMA 2ZJQQ 2MKJA 2ZD1A 4I2QB 5KFWA 1YZ6A 3KJVA 5KFOA 1C1CB 3IJ3A 1ZBTA 3DOMB 3Q83A 2WPXA 4LSLA 4GMKA 1TKXA 2RDJA 1S1WA 3MWBA 4UY85 1QQ9A 1FNXH 5ETRA 5L1LA 4TNUA 1RBAA 2EK1A 5IT0A 4V19X 4P74A 2W9AA 2ZH4A 4U5YA 1BAVA 5GMDA 3R1LA 3MOZA 1EE3P 3H59A 1CBKA 4U9ZA 4DN0A 3PEJA 5IZHA 2V77A 2OTLS 1N33J 3UN2A 2XWXA 4OX7A 4KC5A 3BR9A 3PYEA 2NXCA 3DR6A 1HPZB 4A8MP 3B3VA 4XTTA 4G1QA 2P2CB 4RS2A 4JI1J 5T7LA 2HBRB 4CPAA 1JB0C 5LSOA 2NXJA 1B0PA 4G1PA 2Z3PA 1HW9A 1MNEA 4AXIA 4ZOSA 2Y1JA 3QLHA 5HL7Q 4GC6A 4YFUA 2MZ1A 3CJKA 3WBZA 1QSRA 2VQEJ 2QECA 1Q1KA 4ED8A 1TKJA 3CPWR 3MR2A 1L5UA 4K3NA 4OX8A 1CX8A 1RLCL 3S6EA 4IH5A 3JTKA 3CWJA 2LCWA 1RWMB 1JXEA 1Q8LA 3BPDA 3I0RA 1U4BA 2OZHA 1IYKA 2O28A 4RW4B 1MROB 5BYSA 2EK8A 1GQEA 5D77A 3GIKA 2W9BA 1VHEA 2FLNA 4DV1J 2R7OA 4P7TA 3BYPA 2XEXA 3HZGA 2CQIA 2YNGA 3K0JA 1SC1B 3QIPA 4B12A 1M90T 3RRGA 2UUBJ 2JVOA 5C42B 4WPAA 1TZ0A 3TTHA 5K8NA 5JGFA 2B43A 1GXUA 1NU4A 1RISA 4NXNJ 5A8KB 5IFMA 9RUBA 3AQOA 3FIXA 2CJQA 2B4VA 4F50A 3D9BA 3QAEA 3VAFA 4NEXA 2CWXA 1ZTWA 3N4WA 4AG9A 1PCAA 3ZTRA 3WZ0A 4ZPTR 4OI3A 5KG5A 3RGIA 1BWEA 4GRSA 4KOVA 2KKHA 1PYTB 2PIZA 4WWSA 2RQ4A 4RUHA 4NLSA 3H7HB 1Y0RA 3QFWA 2ZEDA 2POKA 2CQDA 1JLAB 2LQJA 4LF4J 4DCJB 2WCXA 2H48B 5DZ6A 3H5SA 1TIQA 4DR6J 1S10A 5F8MA 4J9SA 5KFYA 3RYOA 2QMWA 1XR6A 2R7HA 4DSJA 2QLWA 3KJFB 3NGSA 1D0EA 1BLLE 1VRUB 3QAHA 3OL7A 1KQGB 3B6BA 2HB6A 1NJZA 1PBUA 4DPTA 3KNGA 2AJ6A 3QJLA 4ZMMA 5DGAA 2YKPA 4DL2A 2YH1A 1SKSA 4F2SA 4OZ3A 3FEXB 5CHCB 2VHGA 4EZ6A 1VQYA 3RAMA 3D6FB 1SL1A 7CPAA 4JZ0A 2AGOA 3DR8A 3BHXA 4DQSA 3VAMA 2MQNA 2BABA 2EWHA 1GFWB 1X60A 3D66A 1H7XA 2XMVA 4NLDA 3PZPA 4X65J 3DLJA 1KVKA 3S01A 3IU2A 1JX4A 2VFTA 3O5TB 3QGGA 3DN9A 4HT5A 1U6BA 1Q7LB 4K0KF 4F67A 1F2PA 4HLBA 4ANDA 2LEAA 3A8JA 4C0OC 5LL6d 4Q45A 5CYQB 1HNWJ 1FWPA 1WKLA 2PJ8A 5DWNA 3FMCA 5LT5A 4AFFA 2FLLA 3EE3A 2JEVA 3HD2A 3IR7B 2YNGB 3ICLA 3H42A 3MEEB 3CJ2A 2FC9A 3FX6A 3JTOA 4ZPVR 3PB4X 2OB0A 2GQQA 1Y9OA 2X3DA 2CNKB 2KU7A 5KT6A 4ZN1A 3L95X 1UFLA 1AUDA 2UV8A 3TUZC 3IN5A 4IG0A 2CZVC 3KK1A 4ID8A 5CA5A 1EETB 2N4DA 4Q7AA 1Z8XA 2PJ3A 4P72A 1RWKB 3M6XA 4ILLA 4QBJA 1WOSA 2DHAA 2BJ9A 2C2ZB 3DOLB 5MLCV 4Y3CA 2JEFA 2PEHA 3D2WA 2ILZA 1BPNA 4DF8A 2P9CA 3T8WA 5KFKA 2RB7A 2Q3PA 3ZZIA 1M5OC 3D8PA 4IFYB 1RWNB 2BDPA 1CP7A 1PAUB 5E3RA 3ITHA 4ZCLA 1CULB 3CJ4A 2P6TA 1RTIA 3D68A 3KASA 3FRZA 5I3QA 5IC4B 2A2DA 3MM9B 2DH9A 2JC1A 1DZ5A 2VV5A 3MEGA 2U1AA 1WEYA 4PXDA 4OJ3A 4D3GA 2M70A 2AJ2A 2M4MA 2ZEGA 1RT7A 1FDNA 4XK8C 4LF8J 3ILLA 3QRRA 5DS0A 3FQLA 2AGPA 2VICA 3H8YA 4RBTA 1GX6A 1Y4ZB 4I2PB 2VBYA 2CJKA 1WC3A 1YG0A 4WTOB 1D9FA 2FXFA 3DSBA 4PPZA 2XZTB 1IVZA 2LEBA 3ITHB 3OTEA 3MRUA 4R0EA 3J81U 3IAS9 1T05B 3TAMA 4RX6A 5J2QB 1TUGB 1H74A 2XYHB 4KO0A 3G2XA 4OV6A 3W8PA 1CEZA 2CDRB 4YR3A 4RUAA 2P6SA 4WU2A 3K58A 5F0WA 2QIFA 2RIJA 2XY5A 1VQPS 4R5PA 2YX4A 3FBCA 5D0HA 4J9NA 4C4WA 4QWBA 3ISXA 5HO4A 2P6FA 4LSLB 5HAOA 1HMVB 2QT7A 4CO3A 1TUWA 4B3RJ 3NE7A 3PW7A 2PI5A 1MWYA 1XK8A 3H5UA 4CAVA 2PMHA 2NYQA 3CMQA 2EKNA 2OMLA 3IU1A 4RPFA 4F4YA 2Q1LA 4WP3A 2RRNA 4DLGA 3F44A 1U1QA 2MLXA 5D3GB 3OQ2A 2FVGA 2HG4A 3OTDA 3O3LA 1GMWA 2DPJA 3PBBA 5KT4A 2QGFB 2ZBRA 3BSAA 3I9ZA 3MZIA 3CCVS 1Q8KA 3N5FA 2ZC3A 4QBUA 2B9XA 4U9YA 3GPAA 1JMTA 3HPOA 3RZAA 3H20A 2EG2A 3W5XA 2MTLA 5JVGQ 2WONB 4ECSA 3CD0A 1Q7YT 4MCQA 2JWNA 3AT1B 2C2NA 4CTAA 4JI7J 2QO3A 4PQUA 1ROFA 4FXDA 3VH9A 2HPUA 1XBUA 3ETOA 5K20B 4I64A 3R2DJ 1YK9A 2E5HA 1YREA 1TL4A 3HFZB 4EZ9A 3A3NB 4QOTA 3T5JA 1H98A 2OLWA 2GAHC 2EVNA 3VVTA 4LIRA 2AU0A 1YLOA 4I49A 3N79A 2KFZA 5E3AA 1X9SA 1TF8A 4PPDA 4DUKA 3FQKA 3GONA 1RWVB 2M8DB 3TE4A 2WONA 4PUOA 3E01A 4DR4F 1KLNA 3M8ZA 2ZEFA 4A30A 1YRXA 4CTAB 1WKJA 4IOBA 1LWCB 2OO4A 3IG1A 8RUCA 3EYZA 1RTDA 4M5HA 4YR2A 3CSKA 1R27B 2DIUA 3B8GA 1FTCA 1FKPA 3NFZA 1DTDA 5HP1B 2DK2A 2ROEA 3TAQA 4O23A 1LW2B 2E7VA 4PQAA 3T3FA 3HHLB 4R87A 1KLMA 2ACMA 3QWUA 1UFHA 2AQ4A 2HHQA 3K89A 1LW0A 1CJVB 2BM1A 2BOPA 4QW8A 4PYDA 5FDLB 3K17A 1VJWA 4ZPWR 2JEJA 1K73T 1YJ9S 4OIXA 4DR3F 4B02A 4KGMA 3IBWA 5F8LA 3M8YA 4JV2A 2OI2A 3FRYA 3BO3A 4HVZA 2DHGA 2MZJA 1MJBA 1JLBB 2V4RA 4QJVA 2ZNZA 4X62J 1VQOS 2F65A 3PKYA 2UUAJ 5KFDA 2OFHX 3VR1A 1V3RA 3QGPA 4GKJF 2VODA 2NPFA 1X4EA 3PV8