1XMBA

X-ray structure of iaa-aminoacid hydrolase from arabidopsis thaliana gene at5g56660
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
392
structure length
375
Chain Sequence
KLLEFAKSPEVFDWMVKIRRKIHENPELGYEELETSKLIRSELELIGIKYRYPVAITGVIGYIGTGEPPFVALRADMDALPIQEGVEWEHKSKIAGKMHACGHDGHVTMLLGAAKILHEHRHHLQGTVVLIFQPAEEGLSGAKKMREEGALKNVEAIFGIHLSARIPFGKAASRAGSFLAGAGVFEAVITGKTIDPVVAASSIVLSLQQLVSRETDPLDSKVVTVSKVNPDSITIGGTLRAFTGFTQLQQRVKEVITKQAAVHRCNASVNLTPNGREPMPPTVNNKDLYKQFKKVVRDLLGQEAFVEAAPVMGSEDFSYFAETIPGHFSLLGMQDETNGYASSHSPLYRINEDVLPYGAAIHASMAVQYLKEKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of ILL2, an auxin-conjugate amidohydrolase from Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
molecule keywords IAA-amino acid hydrolase homolog 2
total genus 122
structure length 375
sequence length 392
ec nomenclature
pdb deposition date 2004-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1xmbA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1xmbA01
3H8FA 2HB6A 1ELMP 4FBEA 4MRIA 4ZYQA 4YWYA 4UF4A 1LAMA 4MHZA 3FH4A 2GLFA 1ZG7A 7CPAA 4P45A 2DEAA 4X8IA 4P10A 4NGTA 4EFDA 2QYVA 3PB7X 1ARMA 4DYOA 4NGSA 4MCPA 1Z8LA 4R7MA 2PJAA 3VARA 2OR4A 3NFZA 3IEHA 3KASA 4P6YA 1ZG8A 3VH9A 2OOTA 1UWYA 2IJZA 3PBBA 3FX6A 4A39A 2PJ8A 1HDQA 2C1CA 3FVLA 4OP4A 5D29A 3HLPA 2C6PA 3V38A 5JM6A 3S9NA 2CF4A 3SJEA 3D68A 3WC5A 3K2KA 3B3VA 1AMPA 4YU9A 4P4FA 1CX8A 3KL9A 2FVGA 3FEDA 5JGFA 4NGMA 5I4MA 4NJQA 1Q7LA 1PYTB 2PJ2A 5LYLA 1TF8A 2BO9A 2AFWA 1CP6A 1LANA 4ZI6A 3KGQA 4DUKA 3PB4X 3I1UA 4FAIA 1XJOA 3WC6A 4R8FA 4KSIA 5LYIA 3CT9A 2QVPA 3D66A 2O53A 3CDXA 1XFOA 2VL1A 2QJ8A 2PVWA 1DTDA 3PBEA 4OMEA 4CPAA 4X2TA 1CPSA 2XEIA 2ZEFA 3KZWA 1PCAA 1R43A 3BHXA 3H8GA 2ZEDA 2ZEEA 2AFOA 2XEJA 2PRQA 3PB8X 2CTBA 5HXDA 1FT7A 3QNVA 4F9VA 2IQ6A 4P4IA 4R6TA 4GM5A 4W9YA 1ELLP 4ZX9A 5DS0A 3SJXA 4NGRA 1KWMA 4TWEA 1VIXA 4OC3A 1Y0RA 3RZAA 2RFHA 2AFUA 3GB0A 3PFOA 1ZG9A 4FUUA 1NSAA 2G9DA 4ZY2A 1LFWA 4ZX8A 1QQ9A 2GLJA 1TXRA 2PIYA 3RBUA 5CBMA 4X3RA 1H8LA 4OKOA 3JRUA 3SI0A 4NFRA 1M4LA 3B3TA 4EWTA 4ZY0A 5D8NA 5CPAA 4O23A 4NGQA 2CTCA 3PFEA 1GYTA 3CPAA 3S9LA 3B3SA 1BLLE 8CPAA 1VGYA 4OC0A 4WJBA 1F2OA 2PJBA 1IY7A 3KHXA 1XBUA 3N5FA 2Q51A 3K9TA 2PJ4A 3ISXA 2PCUA 2XEFA 2CIJA 2EWBA 2V8HA 1BPNA 4PXEA 2PJCA 2AFXA 2NSMA 4OC1A 3DGVA 2AFSA 1FNOA 4P4DA 1ZLHA 3KQZA 3IIBA 3NH8A 3HUVA 1EE3P 3IJ3A 4PXCA 2PJ3A 1AYEA 4OC5A 4JYWA 3CPXA 3V7ZA 2V8GA 3WT4A 2PE3A 2JBJA 3T8WA 1DE4C 4B6ZA 1VHOA 1VHEA 1CG2A 5IB9A 2J9AA 1HEEA 3SI2A 2PJ0A 1BPMA 3VATA 3SJGA 1RTQA 2C6GA 2PJ7A 3IFEA 2XEGA 1LAPA 4P44A 4UEEA 4UEFA 3LMSA 1F57A 2ABZA 2Q4ZA 3PRTA 1R3NA 3KQXA 5HVGA 2NYQA 5LRKA 4MHPA 4NGPA 3PB9X 2AFMA 3RAMA 3PEIA 3IWWA 4MHYA 1F2PA 2EK8A 3D4UA 3KR5A 3B35A 3BI1A 1LCPA 3B2YA 2V77A 6CPAA 2ZOGA 2JEWA 4RUHA 1Z2LA 5J1QA 3D67A 1Y7EA 3FMCA 4NJRA 3B3WA 3B3CA 3NA6A 2PJ6A 4EMEA 4F9UA 1Y0YA 4IHMA 4BD9A 3WABA 4MCQA 5K8MA 1YLOA 2EK9A 2BCOA 3PB6X 2WZNA 2PJ5A 2WYRA 2Q43A 2F8HA 3D7DA 2C6CA 4P4JA 4PXBA 1XMBA 1LOKA 4OIWA 5HVFA 3BXMA 4MCRA 1JQGA 4UEZA 4UIBA 3LWUA 2AFZA 4P4EA 2GU2A 5HVHA 2F7VA 4LQGA 2ZENA 1QMUA 4UIAA 1ZLIA 2ANPA 3D7HA 3TC8A 2PJ1A 2HC9A 4G1PA 4PXDA 2ZEHA 1YMEA 3L2NA 4FWUA 4OC4A 5K8PA 2PIZA 2PJ9A 1YW4A 3FF3A 2O4HA 3GUXA 1BAVA 4NGNA 4A38A 2ZOFA 3D7FA 3SI1A 3IC1A 2V8DA 4PQAA 4ONWA 1Z5RA 4Q7AA 2PVVA 5ELYA 4Z65A 3D7GA 4MXUA 3MRUA 4P4BA 5F09A 2POKA 4ZY1A 2ZEMA 4AXVA 1TKJA 4R76A 3FEEA 2GREA 5LRJA 4MCSA 1YW6A 3WC7A 4MHNA 5LYDA 2V8VA 3SJFA 4IK2A 4JZ0A 3KR4A 4MMOA 4WWVA 3ISZA 1TF9A 4OIDA 3IO1A 1TKHA 4DJLA 4H2KA 4K3NA 2I3CA 3MN8A 3KHZA 3DLJA 3NH5A 3FJUA 3GLJA 4TNUA 4IAVA 3KI9A 1CPXA 4A94A 1OBRA 5K8OA 3B7IA 1TKFA 1CBXA 3TX8A 1IGBA 1ARLA 1CP7A 5LYFA 2ZEOA 2ZELA 4PPZA 3H8EA 5THWA 2ZEPA 3FECA 4A37A 2BOAA 1HDUA 5LRGA 5JH9A 4OC2A 3S9MA 2ZEGA 1YSJA 2JBKA 2RB7A 5K8NA 4F8ZA 2IMOA 3BI0A 3NH4A 1XRYA
chains in the Genus database with same CATH superfamily
5C42B 3Q8QB 4ZMMA 2YH1A 1IOFA 4UQGA 5F8MA 4WWSA 2B8PA 2K7JA 3FH4A 4YR2A 1SH3A 2J6TA 2MZRA 4OLLA 1RO5A 3HVTB 1CQMA 5DQIA 1CLFA 3W66A 4MCPA 2Q1LA 5F8IA 3OXFA 4RNFA 1S1XA 1MU2A 1MK4A 2IVYA 4WP9A 4A39A 1MU2B 4TY9A 3X3UA 4Z7CA 2C6PA 4MKAA 3JAMY 2V2QA 1M0SA 4U9ZA 2YWGA 3LP0A 3DU5A 2DGTA 2H51B 3LOUA 4WIQA 2I00A 2MLZA 1TFWA 2JEFA 4J9SA 1RLDA 1PJ5A 1T9UA 3H98A 4J5OA 4DSLA 3VAJA 1J5OA 1Q4RA 4RUCA 1TUVA 3R1LA 4KY3A 4DR4J 3CDXA 2HHVA 1LK5A 2FJAB 3W1YC 2PVWA 1WHXA 4ZCKA 4ZIWA 2FLOA 3T1HJ 2HW3A 3M8RA 3M2RB 1Y5IB 1IKYB 3J80U 4A48A 2Z57B 4LF2A 2HMIA 3CUNA 3V4MA 1GQEA 2MKJA 1FT7A 5EWGA 4CO3A 3T5LA 1TZ0A 2HFUA 2RDDA 4W9YA 4ZX9A 1Q95G 4FN5A 4NGRA 1IR0A 4UOCA 3RZAA 5C2CA 1HNWJ 3AXMA 4NYZA 2H4YB 2MQPA 3QYYA 1N32F 1DJ0A 1VLOA 2GLJA 1YRUA 1KQKA 3F73A 1NK4A 3KHRA 4JJXA 2AJ2A 4NLTA 3QGIA 3VQSA 5I3PA 2WVBA 3LWLA 2NREA 1OMSA 2OAUA 1KHWA 2BOPA 1GYTA 3NP5A 3QWPA 1SV5B 2LEBA 3B3SA 3GG0A 2DR7A 2PMZD 2Y1RI 3QSIA 3A4TA 3QGHA 2AGQA 3NWGA 4MBUA 5KOWA 2JH3A 1JK9B 3R3TA 4P4DA 5F49A 4TKTA 1YVKA 1NKBA 3RRKA 3K5OA 2J9EA 3HI9A 1L3TA 4JI4F 2CUYA 1IOIA 3BLNA 2RJZA 2XI2A 3GJSB 2QSWA 4UFWA 5EMIA 2XNRA 4WFNQ 1QSRA 4JI4J 1RQ0A 2F9JA 4FYYB 3SI2A 3PEJA 1HPZA 1REVA 2QIFA 1HA1A 3C6TA 4LF4J 3GZ7A 3GYGA 4O3QA 2R42A 3LMSA 3POTB 5IQQA 2ALZA 3QGPA 1TKDA 2HUZA 2QEXS 4G65A 4DZ6A 4O4GA 4DDFA 1TKXB 2BANB 1RT6A 2KVQE 4C4WA 2CQGA 2VPZB 2O01C 2I38A 3KTQA 3FKBA 2H5MA 3KR5A 3BI1A 1YQHA 4OMFG 4D3GA 1YBAA 4RW6B 2O67A 1R89A 4K50A 2QMLA 4NL5A 4DV6F 4H4MB 1UA0A 3GV8B 4ILLA 5D4LA 2D3ZA 1YRTA 1E6YB 2EK9A 2LQ8A 5F3ZA 3UN2A 3PB6X 2OZUA 1IQZA 5HATA 2PJ5A 5KFBA 4Q8EA 2VPWB 2Q43A 2CQCA 2IM2A 2B56A 4P2SA 2VFUA 1WSRA 1VQNS 1Q8IA 2QL7B 4J3GA 1CJTA 5L38A 1RHUB 5DM7Q 1ZA2B 4KGKA 2FIAA 5E7OB 4NI2B 1JXLA 4B9UA 1AW0A 4F0KA 3A8EA 3C14B 2WPXA 4ZP9A 1EETB 1N36F 3PACA 1V9OA 2E7WA 1UVKA 2LA4A 4FF1A 5DDRC 3ULHA 2EK6A 3MCSA 3MAAB 5AG4A 3IWNC 4BBYA 4X66F 5JPHA 1MJBA 4KBIA 2J7WA 3CJ8A 3IBCB 1M5HA 1M44A 3K2YA 1UA1A 3V8IA 3UDLA 3Q8PB 1ICEB 2UV8G 5A6WA 3OTOF 4K4SA 1RU1A 2VASA 2W8KA 5AG6A 2MLYA 5D4PA 2DHAA 2OPQA 2VQFJ 1CSJA 4LFBJ 1P27B 3M2UB 4WXWA 3FIXA 3NMAA 2MZ1A 4PG8A 5KFEA 2VG7A 4KSAA 3A12A 4C8YA 3UPFA 2I1RA 5A8WA 4K4VA 1FRIA 3JSYA 1V0CA 1VMBA 4KGZB 1BQMA 1UVLA 2LXIA 3HVAA 5HK4A 3TX8A 2IC3A 1ARLA 3SCIE 3C19A 1FWPA 5KFTA 4CGNA 1TELA 2P6SA 1LW2B 1VQYA 2R98A 2HURA 4DR2F 2MZTA 4U6PA 5DZ6A 3Q83A 3SSQA 2K3IA 2NQPA 1U0HB 2VF3A 2M52A 1IR2A 3VHQA 1FEEA 2F65A 4IQMA 1N5TA 1H73A 5J1NA 4MHZA 2Q3PA 4RS2A 1F9FA 2JRSA 3PB7X 1AZSA 1S1VA 4RU9A 2HVZA 5DZ7A 2ACYA 3J81U 4LFCJ 4HT7A 1SQGA 4WF9Q 1X5SA 2P5VA 1U1QA 1SCJB 1D9AA 2DIVA 4DPTA 5CYQB 3UVJB 4YR0A 1XC9A 1KOHA 4ZPTR 2YBVA 3NCRA 3MEKA 3LH2S 1Y9KA 1RTZA 3S9NA 3HP6A 3WC5A 1LWCA 1GH8A 4JI1J 4ES3A 1J5EJ 3TA0A 3G96A 2MSSA 2FZKB 4I2PB 1WHWA 3D1HA 1UPMB 3GTYX 3VALA 4HNXB 5J2MB 4CAVA 2PR8A 2UUBF 3JTOA 3O5TB 3O1LA 5F8HA 4MAKA 1IWAA 3WIVA 2MQ8A 1DTDA 4OI6A 1F2GA 1VC0A 3GYNA 5K20B 4B5PB 2HZAA 3KZWA 2GMHA 1N4LA 3RBZA 1YX2A 1URNA 2XEJA 3UD4P 3CEDA 5J1EA 3M30B 3JTNA 3IXQA 4P7TA 5KFNA 4C6AA 1WC0A 2MB0B 2C2KB 1S9FA 4ECRA 4X5KA 1VCTA 1KOOA 4QPTA 2OIHA 3B4DA 3PRVA 4Z2XA 2L41A 2ASYA 2PC6A 3OT9A 1YJ7A 2HBYB 2PEHA 4QYZJ 1NHKL 1QY7A 4DSIA 5E2QA 2VV5A 3N5BA 1LFWA 1C1BA 2HRTA 1JJ4A 1HR0J 3KK3B 4A46A 1Q79A 4EWTA 1VBYA 1R57A 4ZY0A 1UEKA 1WTBA 4ZK7M 3LW5C 3CD6S 2A4NA 1BXNA 5G21A 1TKXA 2BANA 1K4JA 3Q2SC 5IX3A 5J2QA 3H25A 2LEPA 1X60A 1VKCA 5EBVA 2EWBA 3TYTA 2AFSA 5E33A 3H5YA 2BDPA 2MQNA 4WFYA 2QYCA 1HPZB 1Y4ZB 4LIWA 4Y65A 3Q0AA 4O3SA 2XCAA 4OI2A 1H38A 3R8YA 3FEYB 3CF5Q 1GEHA 4ANEA 2YX7A 4NOHA 4XO0A 3OTCA 4IH5A 1BPMA 3IRXA 1EARA 2ZKTA 3KHHA 3CZXA 5T7LB 4X64J 1W25A 1FX4A 4LBIA 1V3ZA 1JLGA 4KOXA 3OQ2A 4ECXA 3KQXA 4N5SA 4USJC 2V8PA 3M6WA 5EX3A 3CCLS 1K73T 2UU9F 2WW8A 4CAXA 4K0KF 1S5ZA 1R0AB 2W7PA 4IG3B 3IWLA 5J1QA 1QSNA 2VDIA 3D67A 2BQUA 3FMCA 4NJRA 2I2YA 4CGLA 4K4TA 1NSQA 1N54B 1FNMA 1Y0YA 4NYOA 4B9VA 3MEGA 1RUSA 4WCEQ 2L48A 2GVDA 2REFA 3MR5A 3FGVA 3NS6A 4DMZA 1Y3KA 3V81A 2VG7B 4GKKF 3H0PA 2G3AA 3D5MA 1JNRB 2YKNB 2F7VA 5D15A 4LQGA 5LMNF 4QU7A 2FJBB 1BHNA 3R2DJ 1RHQB 2AZ1A 4DV1F 2R8IA 3PNIA 1CJVA 2HC9A 3M6XA 3K59A 3J80Y 4OIXA 2YQ0A 4ENOA 2XCPA 1XR7A 2MJNA 3MAQA 4M5GA 1BAVA 4KVOE 3R6GB 3IC1A 1S77D 4DNCA 4Y28C 1WWHA 4DSKA 3MUMP 1YG0A 1Q78A 5HQ8A 1S0VA 1GAOA 2YKQA 3MDFA 3FNCA 2MKKA 4KFBB 1F5AA 2CZVC 2OU2A 1Q7YT 2B3VA 3PX4A 2UVUA 3GPAA 2CPZA 2FGCA 1LWEB 5LSRA 2KCWA 4ED1A 2ZH8A 3M6VA 1NJWA 2RT3A 4WYLA 1FKOB 1RA7A 1A2ZA 2HVIA 1LWEA 2OKQA 1RE1B 2HHPA 1KSPA 2LQ9A 4ICLB 3T9NA 1ITPA 1YWXA 2V9KA 2GZOA 3OL9A 3LWMA 4ANDA 3CJKA 3A3PB 3BV8A 4IG3A 5H9FK 1JX4A 3GIUA 1IR1A 2Z8QA 4P72A 4LFAJ 1HNZJ 5LRGA 5ETPA 1YSJA 3GSDA 4K0KJ 4GC7A 1KLNA 4M6GA 3EZ5A 3C14A 2WOMA 1C2PA 2Z3MA 4YWYA 5KFVA 1ZG7A 3MR7A 4EFDA 2X1GA 1JWQA 1WC4A 4DYOA 2XYGB 4OHYA 4ETZA 1LWXA 2HS3A 4ZITA 2WVFA 1WOOA 3NFZA 4JWPA 1S4EA 2Z3LA 3I5AA 3VH9A 1FFSB 2IJZA 3M8WA 2AJ4A 2VBZA 2F5GA 3T5KA 3EGNA 1KHVA 1HI0P 3HJVA 2CVEA 2R2TA 1Y7RA 3A8JA 3M4XA 1M4GA 1YGYA 3V38A 5JM6A 5D0GA 4H4OB 3MPUB 3T1HF 5B0DA 5B0GA 1PU9A 3AB4B 3GFYA 4WP8A 2A3JA 2HK2A 1XE4A 3TEHB 1LANA 3HF5A 1YK3A 3PB4X 4DV5F 2ZDOA 4QBUA 7AT1B 2VQEJ 4R8FA 4JI0J 3PW7A 2VH7A 3D66A 2AZ3A 1IM4A 4NEYA 1S12A 2R8HA 2VA3A 1FDNA 5L8RC 1RTHB 2HQYA 4O44B 1WACA 4U8YA 4A32A 4FD7A 1UVNA 4DV4J 5H86A 4YN3B 4B3MJ 2P9GA 3N0VA 4OX9J 3PW2A 2MLXA 4ZOSA 2R1IA 3B54A 3EDRB 4NSQA 1VC6A 3GB0A 2PI5A 3JQMA 2G9DA 3GR1A 2QT7A 2CJAA 1FDBA 1TKZA 3BJ7A 4TU7A 3RG6A 3LGMA 3B4MA 1VFJA 1JLBA 3NE8A 4MFBA 5D8NA 5L9XA 1YIJS 1PAEX 4QBJA 3HO1A 2Y1LB 1HLWA 2AV5A 2H1YA 1JLFB 4OJ1A 4CRJA 2JEGA 5JJBA 3ICLA 1BD6A 1I1GA 1BPNA 1SJ1A 2NYHA 3GU0A 3OXGA 2Q04A 2EC0A 3FMWA 1KQSR 3RGIA 4PXCA 1UAWA 5IT4A 3RRHA 1RWXB 4IF5A 1LXNA 3TW0A 1NPPA 1AYEA 2XZTB 1RT1A 4OZJA 1TFYA 4CYNA 2H5EA 2FCKA 2HHTA 3LGNA 3EYZA 3OTDA 3MGJA 1QSOA 2XY6A 1HEEA 3G6YA 4KOSA 5C7PA 1N5VA 3NEKA 3G82B 1YZ6A 1KVKA 3HVTA 5DG9A 2PC1A 4M5MA 5K14B 1ZPWX 3M8PB 4CT8A 1FKPB 5LRKA 1SIWB 1WOSA 4J9QA 1Y00A 1HNXJ 3PEIA 3E01B 5EUHA 2W8LA 4K59A 2QL9B 2DO4A 4J9MA 2QA4S 1HNIA 4DUZF 1X9MA 1YJ9S 4NZ7A 3S6KA 5HBMB 3H42A 1LW2A 3VCDA 2ADCA 4XAKA 2PJ6A 4EMEA 3WABA 2ZXVA 1SJ3P 3R5AA 3R6LB 4FS2A 3TZZA 3SEOA 2XG8A 4OIWA 1QUVA 5RUBA 1FESA 4JXRA 3FQKA 3OFFA 2B4PA 3U1LA 2EKYA 3VGSA 4IR1A 1S5KA 1KC8T 4UWIA 4OFZA 3PGPA 3BO2A 3DRXA 3CCQS 3BSOA 3D7HA 1YK9A 5AG7A 1PBUA 3GP9A 5IQ6A 5IWAF 3HHDA 3WC2A 3JAMU 2XZDB 1NDLA 4CYUB 1S6QA 3HD1A 1RTJB 4Z65A 2MEWA 3FVYA 1V6HA 2ZEMA 1U6FA 2DH8A 2B51A 2QE5A 5LMUF 2HS4A 4K4UA 3PJWA 2GV1A 3M2VA 2RDIA 1H2VZ 3KHLA 5IM0B 1RT4B 1ZAWA 2YKNA 4IRDA 3T90A 3TO8A 2IAJB 4DU7A 1KTQA 1J2VA 2CJYB 4A8XA 2FHOB 1T7PA 4CM2A 1IBLF 4JD6A 3H90A 3T9ZA 1Q2YA 3CJ4A 2OD6A 4B14A 4HHUA 4C98A 1CJUA 1V5IB 2JL9A 4PSWA 4AD6A 2DR5A 1A6LA 1K1QA 1VYAA 4C2ZA 4G6VB 5GMDA 4Q45A 4USTA 4LF9F 3QATA 1Q1KA 5DDQC 2DPSA 4NLWA 4TN2A 1M5KC 2HHSA 2C2MB 2WAQD 4IR9A 4P6YA 1HFEL 3OFEA 4B3OB 4BCAA 2Q0YA 2K5TA 5DGAA 5DWNA 4QIGA 1FKPA 3S8SA 1LAMA 1NPKA 4AVCA 1RT5A 2PRBA 3D3BJ 1RAFB 3L4BC 3KDNA 4Y2IA 2XY5A 1ARMA 2DNYA 4JUZA 4DR6J 3JSRA 4KJIA 2VD3A 1PYOB 4R5PB 1CC8A 1FK9B 4KAIA 1HNVA 4IOCQ 2EKNA 4ETXA 2BQ3A 4JI7J 4DJBA 4BWMA 1S79A 4R57A 5F8JA 3BYPA 3PM9A 3CJ3A 3MOJB 3ZZ0A 3MEGB 3ZZYA 2PJ8A 5DRKA 3C26A 1O51A 1VQOS 3W60A 1NRKA 3HLPA 4NEXA 3SJEA 2D74B 3ILJA 3NGUA 5HSPA 3AH6A 2E9RX 1AFIA 1NAQA 3W9JA 1XIQA 3GCXP 1GXUA 4Q43A 1APSA 4RUBA 1U02A 5DG7A 1T11A 3D4JA 2JLGA 3TAQA 3IU2A 3I1UA 1FERA 4M5DB 2FD2A 3DDIA 4E8UA 2LDIA 1YJWS 1R0BG 4Y49C 4UZCA 4WFAQ 3CDAA 2QLBB 3DM2B 1FDAA 1OSCA 3H8GA 1HL6A 1Q2DA 2CFXA 3W63A 4CO1A 3TO7A 5DWMA 1C0TB 4OL8A 4OZ3A 2E1PA 2KH9A 1WF0A 4F9VA 4CAEA 1UEVA 2AYEA 2AIRB 3GKRA 1ELLP 4C68A 3DLLQ 1NHVA 1EQMA 4DZDA 2DCLA 1FRHA 1NJZA 1KP6A 1R8CA 1P6TA 2Z2YB 1B7FA 1S0OA 3CJTA 3PYDA 4PQUA 5G1ZA 4UTGA 3GJRB 3H4QA 1NK6A 2M8HA 3VAKA 5CHCB 3DLHA 2DR8A 5A2QU 2REEA 2JVOA 4CP5A 4CYUA 2P6FA 3O8WA 3BBFA 4LF9J 1YGHA 4LRDA 4ZVSB 3DHWC 1R31A 3R5JB 3EXYA 4JP8A 3GG1A 2OHDA 1QSYA 4BS2A 1P8GA 1F2OA 1NEEA 1FHTA 1HBMB 4NXNJ 2FLPA 3CJQA 4QOTA 4GVBB 2YWEA 1CC7A 3DGVA 3OLBA 3RJMB 3SBMA 1EE3P 1U0SA 1X31C 1S7HA 1HQ2A 4LF7F 2P9EA 5JVHQ 1X5OA 1VHOA 4DXLA 3K58A 4B02A 4CH7A 4LR7A 2Z11A 1MMDA 3KLIB 3HHLB 2LECA 2G0JA 2XQCA 2GVDB 4WZQA 2PJ7A 3EFAA 2DPTA 4KHRA 4M8LA 2WSEC 2IMWP 2ZHAA 1M1KT 5HVGA 1SH0A 4DR4F 3MCOA 5HMXA 4FXDA 4ECZA 4KPCA 1S7IA 1LCPA 2Q6CA 2OELA 1O8BA 1LKZA 1WG1A 5A6PA 4KOVA 1QVGR 4OI3A 4O3OA 2D41A 2KYZA 4F9UA 4ZBGA 2RH3A 3KK1A 2WPWA 4WKRA 1TP7A 2BA9A 4F25A 3HLUA 3EGWB 1EKSA 3D7DA 3DLEA 3M1VA 2W2MP 3MURP 4OZ0A 4QWCA 1ZTWA 1PC4A 5G4DA 5IC4B 3V2UC 4B3RF 2O5DA 1WF2A 2OPQB 3QT8A 4J37A 4M85A 3IM8A 1IWGA 1WI6A 2ZNZA 2IYIA 1XJWB 3IU1A 1S1WA 5F9LA 4G1PA 3CSKA 1VIOA 4JI0F 4N8NA 2F40A 1S0NA 3U1NA 3OVSA 4IRKA 2YQ3A 5BYRA 3ZTRA 2ZZTA 3GUXA 4TLQA 2ZD1B 1HW8A 2V9WA 2YWWA 2IM1A 1NK5A 1EX8A 4NPOA 1JLEA 1WC5A 3QZ7A 3I5BA 1YRXA 1JLQA 5KG3A 2H54B 5GAGU 4MCSA 4CQ1A 3TJ8A 4UBRA 3KK3A 1QE1A 1SXLA 5T7LA 3HJFA 1UZHA 3S6GA 4ID8A 2QIRA 3F56A 3IO1A 3VAIA 2HEKA 2RVJA 1RTDB 1RU2A 2N4DA 3DLJA 3C16B 4FZVA 1XBWA 3SXNA 3QSYB 1SB6A 3D0IE 2JEIA 1PYSB 4DI6A 1T03B 5LMUJ 5K8OA 2ZVSA 3BS9A 2W7OA 3ZTSA 4KKOA 3KLEB 4URSA 3T1AA 3UDEA 5KFIA 2NUUG 2B4BA 3M7VA 3P96A 4A37A 3I5CA 1S6QB 4KUBA 5JH9A 3C15A 3FXTA 5IV0A 2UU9J 4RW7B 3I32A 4J90A 5AGEA 1TK0A 1RWUA 1S1TA 3C2PA 3EVOA 3S1TA 4CI0B 4DX8H 3I56S 1RT6B 2PFFB 3M8PA 2J9DE 5KFSA 3POTA 3H2UB 3VAFA 1NK8A 4P45A 4NGTA 4CH0S 4ZVTB 2OTJS 1JLCB 4WU2A 1Z8LA 5F8GA 4RNMA 2PJAA 2G13A 2QL5B 1XF8A 2DRAA 5LJ5Y 3IEHA 2KKHA 2ARHA 2ERRA 1L5UA 2RSQA 1J27A 4AXIA 4IOBA 3EPGA 4X4OA 3KK1B 3LF0A 3VWDA 4RKUC 1WORA 3LGHA 3NCQA 4UY85 1Z8WA 3UNYA 3RTVA 1RKJA 4XPDB 2G0BA 3K2KA 2OFGX 3HX9A 2QRRA 4UW2A 2VC0A 4KS9A 4CO4A 4PWUA 3ZTQA 1IJEB 2D9PA 4ZVOB 2YKMA 4ZP6A 1XJOA 2HZVA 1ZBTA 4GRSA 1PC5A 4KSIA 5LYIA 4OX8A 1VK8A 4DV3J 3F44A 1RAAB 3EO4A 4YHHF 4X62F 1UJ4A 2P9CA 3P5BP 2G2YA 2C28A 4OLOA 1SIZA 5IV4A 1QAIA 2ZEEA 1ULRA 2D7SA 1DY3A 2J0QD 1RT2A 4LR9A 3R27A 4KC5A 4KO0B 4EGLA 4KO0A 2FY8A 1ZA1B 1PSDA 1QDUB 5HANA 3GYAA 1RHKB 3MMCB 4OC3A 2CJKA 4E0AA 1HWUA 3Q8RB 3G6XA 4P2FA 3NE7A 1ZM9A 1S1VB 3W91A 2W9CA 1U09A 4C2XA 2F1FA 1TL1A 4NYPA 3SQOP 4PKDB 2X7BA 1NBEB 4C8MA 1WKKA 3BO4A 1MG7A 1LOUA 3LA0A 4XPEA 1M4LA 1VQ9S 3FBEA 4JYAJ 4WFBQ 2CADA 3Q89A 2VG5A 4IG0A 3LANA 4F0YA 2Z3KA 4LVNP 1JLAA 1JB0C 2NPFA 3TZYA 2CQIA 4OZNA 2XEFA 2I5JA 4DS5A 2HVEA 4PWDA 2B4DB 1T02A 1VC5A 1FJ7A 3HUVA 3HXMA 3LQVA 4USKA 2IL4A 1B4SA 3QB8A 2VOOA 5I42A 1IJFB 4DR7J 2J5AA 3WT4A 3VVTA 1RWOB 3Q8VA 4ED0A 1TIQA 1MROB 3WBZA 4ILMA 2ZWPA 3CIMA 1RACB 3M2UA 1CJKA 3MEDA 3IGNA 4NXNF 1F9EB 2F4VJ 4ELTA 4X4RA 4DPYA 4NLPA 1FRLA 2Q4ZA 3HHEA 4H4KC 2NYQA 4R3LA 4MHPA 3MD3A 1D9FA 2RUSA 1HD0A 4NXYA 2XMTA 1EHWA 3G4SS 2H4WB 3IWEA 2V77A 2VXKA 1MMNA 2MHNA 3ZNUA 1FF2A 4M94A 2OUGA 1HW9A 1REVB 4N7TA 1GMVA 3KLFB 4MHDA 4RW8B 1SKWA 1YQEA 3NOGA 2C2NA 4ECYA 4DX7A 4CGOA 1TQLA 2FIWA 4RW4B 1YJUA 3KLIA 1V5VA 3DRRA 2IBKA 5FDLB 2MXYA 1JQGA 2C2RA 4WBFA 3H20A 4ES2A 2R8VA 4L8AA 2BKNA 4R8UA 1WTFA 2OEMA 1QJHA 3TANA 1VI7A 3LUYA 4DV2J 4MTPA 3GIKA 1D9DA 5AE1A 4OC4A 2E5HA 3TRGA 3RR8A 1IXKA 1YW4A 3FF3A 2V94A 1I5OB 2W4PA 4A38A 5G22A 2ZOFA 5HJYA 3KK2B 4ITSA 5C82A 1Y3JA 4L76A 2JFKA 1VDHA 1KD1T 2FC9A 1RWPB 3H8YA 3ZO7A 2CQ3A 5J2PB 1NK9A 1TKJA 2KN4A 2N7CA 3WC7A 8ATCB 1JLGB 4WIIA 4JZ0A 4URGA 1X9WA 2KTQA 4FDFA 1IKVA 4AXJA 3FC9A 2RC4A 4QWEA 2AJFE 4U67Q 2I3CA 2BKPA 4OJ3A 2I6WA 2Y0SD 3PTWA 2RE1A 3HZGA 2DNRA 2W1BA 4QIWD 4HH0A 4TXSA 4I64A 3CC4S 2VFRA 1MSWD 1VQ4S 3MECB 4M5DA 4L72B 3VAMA 1P0HA 3NNAA 2XS5A 4BC9A 2R4FA 3DDDA 2KT3A 1F5BA 4DFPA 2RB7A 2RF2B 4R25A 4QB9A 3GIIA 2RRNA 4ZGYB 3EZOA 2B9XA 2BKOA 1SH2A 9RUBA 1L0CA 4JI8F 4ZYQA 1WC6A 3IG1B 3P5TL 2DEAA 2EXUA 3JYTB 2CYYA 3L09A 4ER8A 2W01A 1S7FA 3WHIA 4NCBA 2J8RA 4PSXA 4R7MA 2QLFB 2X1BA 1QAXA 2OR4A 3M32A 4DV0F 4B13A 3MR2A 1BQNB 3KDOA 4P7VA 1M4DA 3ELHA 1XR6A 3FJ2A 1P1TA 2B5JA 1NB7A 4BDPA 5KFPA 1OZPA 3I31A 1HDQA 4DSEA 2XBPA 3SDEB 3PX0A 2MKHA 3QLHA 1RI7A 1YVOA 2DO0A 2LCWA 4NCZA 3PX6A 3FEDA 1HBMA 4F4YA 2ZFHA 3M9MB 4NRUA 4GMKA 2QFJA 3FB3A 1WC1A 1B6BA 4DQRA 1QD1A 2A18A 4YOEA 2RU9A 5DDPC 3TQ1A 2CXAA 1N6QB 3RAXA 4I0WA 2YNFB 2V69A 1S0MA 1DBDA 2Z4PA 8RUCA 2N7YA 2RRAA 2IJFA 3MECA 1VQMS 1U1PA 1MLAA 1HBNB 3VVUA 4MKVA 4I2QB 3K8VA 4X4TA 2OZHA 2PA3A 4CLYA 1B0TA 1GK8A 3IRWP 1SL1A 2HQGA 4KV8B 3MZIA 5IOLA 2BQRA 3TX0A 2OB0A 4Q38A 2UUAF 2IVMA 1ZG9A 4OZ5A 4ZY2A 3PJ9A 3RBUA 1UFKA 5CBMA 2YNIB 2ZH9A 2HFOA 1RHRB 3DMJB 3AQOA 3SI0A 2QLJB 4NA1A 1RT5B 5F9NA 4DQQA 1NJIT 1XNRJ 4OADA 2UVVA 3SCKE 2B4VA 2H5JB 1PJ7A 2QA1A 4HTJA 5D4OA 4WJBA 2OMOA 4F26A 1X4AA 2WB1D 1HMVB 4K5RA 2DF5A 2RKIB 1S59A 5HLFA 2CQ1A 4AUKA 1Q8LA 3TCVA 2BJEA 4N77A 3THVA 2GE3A 4PZVA 1WEXA 1VHEA 4YB1P 3WC0A 4O44A 4Y3CA 4KUAA 2KJWA 4DR1F 2W2NP 5FDLA 4JI2F 4NXMJ 1ZH5A 3RU0A 2VBXA 3LO3A 2UXBF 1ZAVA 3SJGA 1D1UA 3NMRA 2AYBA 3DM2A 4IFYB 1F57A 1RBOB 1E6VB 2GIQA 2GAHC 1R3NA 2W25A 1JMTA 4HNWB 2UUBJ 3IAS9 2CPYA 1EIYB 4HH1A 2AFMA 2G1HA 4TY8A 5KOXA 5KFXA 2V63A 3HHNB 1PG5B 3CCVS 3MWBA 4LUAA 2J0WA 4NMLA 1Q8BA 3D1QA 4ZLJA 4H4OA 4ZVFA 3BO3A 4A8MP 4UA3A 2KB2A 1URRA 3B3WA 4NLGA 3MF5A 2DHXA 3QNWB 5K8MA 1YLOA 1A0OB 2SXLA 3R7SB 2ZM6F 3NNHA 3NGDA 3PHTA 3OW2R 1M5PC 2RILA 2G3TA 4I7FA 1OSDA 2W9BB 4LSLB 1G4CA 1PAUB 2CY2A 1BQNA 4PXBA 5F48A 1IUJA 5HP1A 3OR2A 3IMQJ 4ZCLA 4F36A 2ODFA 2PFDA 4HHJA 3DNCA 4MY3A 1HHTP 2AFZA 1NK0A 2AEFA 2IRYA 4X4UA 5ETSA 1SKUB 3UFCX 4OZ1A 3W5YA 2UUTA 4ELVA 5I42B 4F4AA 3TARA 1TMMA 2BM0A 5M2UA 4N41A 4H4MA 3A8KA 3DRPB 2XULA 5J2PA 2CQ4A 1G3OA 3NBPB 3BKFA 2ZH4A 2GW8A 2X3GA 3QAYA 4RU2A 1FJGF 2ZHOA 3DMJA 5IT9U 2DH7A 4WYWA 2AW0A 3MRUA 3PV8A 4A8OA 2DNLA 2CXEA 4UZBA 2CJBA 2WTFA 2HNDA 1YW6A 1UP1A 1N0UA 2GIVA 1CVJA 3LAMA 2JC1A 2E5JA 2MTLA 1UWBA 3R7BB 4H2KA 3L3CA 2G1DA 3C16A 5B0AA 4NLQA 2L3MA 4OYPA 1HYSA 1TL3B 2B3TB 4J9VA 4M5HA 3NH5A 2NXEA 2GQCA 5FD1A 3KLHB 3RBXA 4ZPDA 1FXLA 3N28A 1OQ3A 4CWBA 1KFDA 4K4ZA 1KLMB 1ZYQA 3GSIA 5F8LA 1JLEB 2E9ZA 2VC1A 4JLYA 5C24B 3C15B 4DFKA 3MM6B 2FYXA 4RNHA 3KHGA 3E3XA 1VBZA 2DPIA 3BI0A 2VHGA 4LRCA 1T8EA 2LQBA 4R9MA 3TNVA 4PEOA 3GIMA 1S7KA 4U7UD 4X4NA 3UO0A 1H2UX 1Q82T 4XPCA 3NAIA 1IB1E 1U45A 4ICLA 2UVRA 4A8KA 1G2EA 4QJVA 3HHLD 5CZXA 2BR0A 4PK2A 2AJ0A 3KLGB 3KG0A 4WK1A 4Z7YA 2CNTA 1JWWA 1T05B 2DHSA 2JX2A 1U1KA 1BMQB 4E8OA 4JXQA 1HARA 2CQHA 3IGVA 3IAM9 5B7WA 2HNZA 4L73A 2C1CA 3FVLA 5I3QA 2AEJA 4RWWA 4CLUA 3OL8A 2ZKUA 4ED3A 2QN6B 3TAMB 3LTOA 5D3GB 1N6QA 1RAJA 4NJQA 2OP5A 4ID5B 2U1AA 3T6BA 3FBUA 3I3GA 3K5MA 1YLXA 1N32J 4Q8FA 4P75A 4EVYA 2V0NA 1S72S 2DD8S 3I0RA 1HKAA 3MM7A 1UMJA 3MFIA 2ZC4A 1F9HA 1A7GE 2AFOA 5KT6A 2XWYA 2OO4A 3PB8X 1X4EA 1NKCA 3QJLA 3E2EA 4C8OA 2GIRA 2R8JA 3PZPA 1MJ9A 2HLUA 5F47A 4RN7A 4RBVA 1L3KA 4A30A 3ITHA 3PDNA 1KWMA 4MJKA 4DFMA 3OSPA 2RFHA 3PFOA 3I82A 1M90T 5LJ3Y 3AD8C 5HQMA 3PW5A 1Z1ZA 2K1RA 2KJVA 4IFVA 4FD5A 3I9SA 4OYAA 3SQGB 3EZUA 4RLEA 4ECSA 4UT4A 3QMQA 4RI1A 4ED2A 1NMEB 1JLFA 1F3VA 1HQEA 3EXNA 4LRAA 2FDNA 3H5UA 5EGYA 1HQEB 9ATCB 3PFEA 4IDKB 2Y1JA 3ETOA 1XK8A 3VWEA 4OJHA 1FNOA 3KJVB 1NH7A 3IIBA 4NLRA 1U25A 4OHVA 5C25A 2BJ7A 1QAYA 2P2CB 2MKIA 4LQ3A 4FF2A 2PE3A 2V68A 2IA6A 1QVFR 4RBTA 1N34J 4AG7A 1RBAA 3R5DA 2B5GA 1C0TA 1DZ5A 3FRYA 4G3IA 4USWA 4QYZK 2EFQA 2B7BB 4HI1A 2C6GA 1MWZA 1Y11A 4UEEA 4UEFA 2RIJA 5HMNA 3T1YJ 1S3ZA 3JYTA 4UFXA 5J2QB 3KJNB 1ROFA 3C8YA 2Z30B 2F4FA 2YY3A 5DETA 1RXOB 1YZ7A 2G0CA 3N79A 3PYFA 2EK8A 4C11A 4DPOA 3DN9A 4FVCA 2I0XA 2CJQA 2WSCC 2E9TA 1WEZA 2HWTA 2FS5A 1FKAF 4JI2J 4NXMF 1I21A 4F2SA 1S97A 3IRXB 4CDIA 3N9UC 4NA2A 1SPBP 4BD9A 3J81Y 1CJVB 1RBLA 2LYVA 3TJ9A 1T9XA 2YPZA 1U7LA 2WYRA 2ZJQQ 1JIHA 2MY7A 3PYGA 5KG7A 3RRGA 1LOKA 1TL3A 2ZDPA 3Q86A 2UXCJ 3K8WA 5KTAA 1H7XA 1RT7A 3K57A 3QBCA 4P4EA 1UWBB 4C2YA 3DDKA 3U7JA 2ZOMA 1HHSA 4RUAA 4H54A 5L1JA 4LF8J 1KN6A 1ZLIA 3QIPB 2ANPA 1R8HA 4LRBA 2OSRA 2DPJA 4I4BA 3D6MB 3GIJA 4XNHC 3R1KA 1N36J 3US5A 2DCUB 2GQ2A 4NX9A 2IFXA 3TA1A 3SI1A 4OYWA 3NL0A 4R0JA 4Q7AA 4DV2F 2PVVA 4X66J 5C24A 4IO9Q 3LALA 5KFGA 4WE1B 2NXUA 1RISA 2WRMA 4M6HA 4FPIA 4V19X 5L1LA 4CGMA 4R76A 3QT7A 5ETMA 2G4BA 5LRJA 1LNQA 3HD2A 3QIPA 3SQGA 5CYJA 1NO8A 2Z2ZA 4P71A 3MEDB 2R7TA 1NB2A 2UUAJ 3CCUS 3AXKA 4DBQA 3H5XA 1GTHA 1AFJA 1BY9A 4DPUA 2JLMA 1Q5YA 2LU2A 4C2MA 3N4WA 3A9LA 3UD3P 4J91A 4AVAA 1UWAA 4B9TA 4GKJF 4KFBA 1CP7A 3KLFA 2AQ4A 2VJVA 4WZMA 2O28A 2OJ3A 2M88A 2E29A 3H8EA 2PO4A 1S7LA 2ZH5A 4B5PA 4EK2A 3E01A 4DL0C 1YI2S 1CULA 1DRZA 4Q2LA 4J7CA 4RPFA 3CTRA 3BKUA 4DHVA 4W98A 3A13A 1E6VA 2DGOA 2R7VA 1S1WB 4WKYA 5I3UB 4DL4A 4PG6A 3IN5A 1ZTTA 2QLXA 4QIVA 1X0FA 4IFVB 4IH6A 2BACA 4DV7J 4YMEA 1U6ZA 2FQQB 4OX6A 5A0YA 2C3OA 4MYTA 3OSNA 3MTKA 3MMCA 3KASA 4LFCF 5B0CA 3LP2B 2UXCF 1UWYA 3M8QA 2XGQA 1OY9A 3BGOP 3NGKA 2EW9A 2YNHA 5D29A 1XMOJ 2KM8B 2VA2A 1NJYA 3KWMA 4WFXA 1NDPA 4HYKA 1FJEB 1Y7PA 2R2SA 5GCNA 4G1QB 2KFYA 1QTMA 2HV2A 3IBWA 1B0VA 2IDLA 2KRBA 4ZPAA 4WXOA 3MAAA 5A2QY 3GYXB 2VG5B 4IG0B 2Y9HA 2KXNB 5CH7B 1TL7B 2W2OP 3G8SA 4OMEA 2MQOA 2MZSA 2ZBCA 2Q4YA 2QLWA 2HKEA 2NZ4A 1TL1B 3H5ZA 2HQIA 3LPYA 3ET6B 2HRUA 3BDEA 4KV8A 3Q8UA 1QM9A 4RO0A 2VFSA 4L74A 3JQJA 3BGRA 4AQYF 4FPRA 4DG1B 2W9BA 2WZ1A 4UCNA 3ZZOA 4DG1A 2X1AA 1DHMA 4OYMA 1S9EB 3W62A 1K9MT 2W24A 2C3MA 1RWMB 4DL3A 3BB5A 4XNHB 2HGMA 1WI8A 5H1SV 4F2RA 4MIBA 4B10A 2W9AA 4PRFA 4DOZA 5CYMA 5E3QA 4MK8A 2AP6A 4CLFA 2J8AA 1UJ6A 4O23A 4HACB 3THTA 3DYAA 3WZ0A 1RCOB 1PJ6A 3G71S 3DYAB 1HQUB 1B70B 5KFJA 5BYQA 1DLOA 3K5PA 3AAWB 1U4BA 3N5FA 2Q51A 2YNGB 2EFOA 3D6TB 5FIIA 2ZZNA 5I0CA 1M1HA 2IM3A 2CQ2A 1C1BB 4OC1A 3H59A 3RW6A 2ZJPQ 3HKZD 4PYAA 3MOZA 5CCLA 4L75A 1R0CB 2DNGA 4HL9A 3O6QA 4KHPF 4PK3A 4ZHRB 2NXCA 3PEHA 4UUWA 3WDOA 4DV4F 2E7XA 3CDWA 1OWXA 2YQ1A 3PRBA 4NLUA 3VATA 3ILIA 3QQCD 5DJBA 1JLCA 4RL1A 1NM2A 4U9YA 2NSCA 3PRTA 3QWUA 1FTRA 4CTAB 2VG6A 4USHA 1QTNB 3FMBA 3N7ZA 3CMQA 3AD7C 4F04B 4JYAF 4Y2MA 1BLUA 2XZWA 2GVZA 3ENWA 5ETTA 1I94F 4Q0BA 2RRBA 3DGPB 3I9ZA 2CZ4A 1RWKB 3HT0A 4QW8A 1Y7EA 2XS2A 1OJ4A 3S6HA 3A3OB 4H6UA 2FLNA 3T1YF 2Z58B 1SQFA 1YREA 3TVZA 1UW4A 3SSRA 4KB7A 2C6CA 4RZRA 4DR7F 3ZZPA 4F02A 1DURA 4TLRA 4NWBA 2KFNA 4IRCA 4ELUA 4GO7X 3OR2B 2KM8C 1KUYA 4CAWA 4I6AA 3TO6A 1H0HB 3CCWA 1IKWB 4F50A 2FZCB 3BN4A 2NSBA 4ED6A 4DPWA 4ORFA 2J6SA 2BRLA 2RKIA 1NJXA 4YS2A 5IT0A 4QQBA 4YY3J 3FRMA 2BEIA 3DRSA 2ZH1A 2YNGA 3MCNA 1UETA 1YJNS 1TV6A 4KSFA 5DDOC 1NNDA 1OY6A 5ELYA 3F41A 4LF6F 1AROP 2POKA 4ZY1A 4AXVA 1VRUA 4I68A 1IVZA 1TVRA 2Q66A 2FPHX 3HULA 2VKRA 2HFNA 3G86A 3H4BA 3ZTPA 3CC2S 2ZBRA 1FFWB 3EUNA 3SJFA 4IK2A 3KR4A 4FKYA 3PKMA 4O0NA 1I3OB 4ES1A 1FEHA 2R3VA 2G2OA 5HAOA 5B09A 3W2WB 4XDDA 4UY8T 3OLAA 1V3RA 2Z2MA 4KGXB 2A10A 2Y8YA 2MMYA 5B0FA 3ZZIA 1CBXA 5LXYA 1S1UA 1JLQB 4JI5F 3RBEA 2H65B 3C6UB 4OI0A 1LV5A 1V3SA 1EKRA 4WE1A 2E5IA 1OYEA 4NMXA 2JBKA 1I94J 4XK8C 5IT9Y 1RGVA 3UI3A 2FVRA 2R7UA 1ZAXA 1ELMP 3IGRA 3MPVA 1O5JA 4BHQA 1RAHB 3MPDA 2Q7BA 5A76A 1FA0A 2VBQA 1F0XA 3CJ2A 4P10A 4P73A 3QFWA 2CPFA 5ETVA 3VV2B 3J7YI 3C3LA 5EC4A 3DI6B 3QPIA 4JI3J 3ZZRA 4B3RJ 2HFSA 2HRYA 1NZ8A 4QCLA 1ZG8A 2HQCA 4N8OA 2DNHA 3Q2TC 4KORA 2KFZA 3GFZA 3QIDA 2DYAA 3OBIA 4D3HA 1IKXA 3B3VA 3CCZA 3T6JA 4ZA1A 3Q8SB 2YNCA 1TF8A 4TU9A 1XIXA 4C3LA 2ABYA 2OPRB 2MSTA 2ZWOA 4LSNB 2OPRA 1T9YA 3WC6A 1ACMB 4LF6J 3D1OA 1DTTB 3I0SB 3OWCA 4CLLA 1P4NA 4CO5A 4L3KA 1CJUB 3BSNA 3QAUA 1KDNA 2BVZA 4F3MA 3QRPA 2JLEA 1YJRA 1WKJA 3R96A 2L08A 4PQUB 4Z37A 2EC2A 2FHMA 2XI3A 2KT5A 1DAXA 3B8HA 2VZ9A 4RW4A 2B9WA 5DS0A 2JFDA 3KOAA 1Y0HA 3PIPQ 5E3AA 1SJ4P 4JI6J 4CLWA 3TOBA 4JV5J 4XPDC 3BQ1A 1TU0B 1IBMJ 5KT5A 3N6NA 1D3WA 2KT2A 4GVBA 3TTHA 3JRUA 1YBUA 2AJ1A 3MCMA 2C42A 1JLAB 1H72C 3P3DA 3AOCA 1XMTA 3MMBA 2XY7A 2V34A 3K0JA 1KQGB 3OL7A 1BWVA 2L9DA 1B99A 5KT2A 4Y2AA 4HKQA 2FE7A 1RZMA 3MM8B 4M6IA 1WKLA 2PN6A 2PCUA 2PJ4A 5F3TA 1IKWA 2V8HA 2DHGA 4PXEA 3UCZP 5IWAJ 1BUXA 5J1PA 2HNZB 2HGNA 4DCOB 3D8PA 2ZE2A 3CJ0A 1RKIA 3MFHA 3N01A 3BQ2A 3MHYA 4JV0A 2ILYA 4GO5X 2N3OA 3QT5A 5J1EB 3M32B 4DV6J 4TQSA 5ETOA 4JOUA 3UR3C 1XQIA 1MJAA 2W4DA 3DGPA 2NCKL 5LL6d 2FJWA 2E44A 1S49A 3PB9X 2IYGA 3LODA 1WD6A 3ZZTA 3VGUA 1XNRF 3FUYA 1F2PA 4CTAA 3UN3A 3B35A 4QR2A 3UW1A 1HBOA 3QO9B 1LWFA 2W9CB 4OYBA 3JSMA 3CCES 3W3SA 5E41A 3W8GA 2NZCA 2FLLA 3V6JA 4MJ8A 4DF8A 3K7RA 2LLZA 1Z4RA 2H3EB 1WSVA 2WZNA 4CLZA 5F41A 1U24A 4AL7A 2ZH7A 4JI1F 2HHXA 5LMNJ 4ZKAA 2FIUA 1B64A 3DOLA 4ZVUB 2KRRA 4DR3F 4FYVB 1X8DA 2F63A 4OV6A 3SHPA 1RB0A 2GAGC 3AJ2A 1GX6A 2BSWA 1TAUA 3OUYA 1S6OA 4A2ZA 3MM9A 3KJVA 2ASJA 4BINA 2PJ9A 2PSWA 2Z0GA 3ZZUA 3B8GA 4KQZA 5A8KA 1TL4A 2YNDA 5J2MA 1RTJA 1S4FA 4LF8F 1SL2A 2UXDJ 2XWXA 2XTJP 1AXQA 4MIWA 4LX9A 2VFVA 4ZPVR 1N33F 1RWVB 3TZXA 4BMHA 2FGOA 1F6TA 1GXLA 4YFJA 4TU8A 2X1FA 2CPDA 1DFDA 4CYQA 2GHVC 2FJDB 2ZM6J 1TKHA 1GHEA 3MN8A 2J7UA 4WPAA 3THPA 3SFGA 3KLGA 4X4SA 4KOWA 4C8LA 5KG1A 2WSFC 2XEXA 3ZJ0A 3R2CJ 3FJUA 4C7IA 3JTPA 1SKRA 3L9ZA 2CRLA 2DITA 3KI9A 5D0HA 2OLWA 1L3SA 3ENVA 3PXGa 2CPIA 3MR3A 1K47A 1IICA 2GIFA 2GGPB 3AOAA 3MPYA 3PG9A 5THWA 2CQPA 2DY1A 4X84A 5CD4H 3BJ8A 3LP1A 1RTIB 3LP1B 3UCUP 4NZ6A 3L95X 1XTZA 2M4MA 1JJ2R 4EEYA 1U49A 3PY8A 3FQLA 3VQTA 4MRIA 1XERA 2JOQA 1W7WA 5EX0A 5CXTA 2VG6B 2YWHA 2X51A 3M8YA 3D3CJ 5SZTA 4X65J 1S10A 2QYVA 2EFVA 2MQMA 3VZIA 3T41A 2M8DB 5KFQA 3LP2A 3VARA 1C1CB 5LOQA 2ZW4A 3BPDA 4OYIA 4OYOA 3CC7S 2LXUA 2FHJD 2QX0A 1C0UB 4MFZA 5U47A 2DVIA 4B5OA 1T95A 4I7FB 3ONQA 2COLA 1KRPA 1WUUA 2ADBA 3JSMB 2V67A 3A3NB 3P49B 1S99A 3D68A 4MK7A 4Y2KA 2YKAA 4ZLLA 2KG0A 4YU9A 1Q5VA 2DJWA 1M4IA 1FRJA 5KT3A 1CP6A 3NRBA 2LDYA 4FAIA 4GC6A 2PDOA 1NUEA 2DHHA 3MXHP 4U96A 4LRFA 2VL1A 1Q16B 5EHHA 2VPYB 3FCHA 1VISA 2VIHA 5T41A 4YRHA 1IU8A 4ECQA 4O3RA 1R43A 4KZTA 5ADZA 3MI7X 2ZBIA 3BSAA 2AX1A 1UFWA 2FHJA 2K8GA 2GJFA 4ERDA 4R6TA 4GM5A 1WDDA 2EFNA 4LSLA 3KNGA 4ZVQB 4Q36A 4RW9B 4KVME 4DX6A 2DR6A 3SJXA 5CQGA 2A0FB 4TWEA 1KTVA 2QO3A 4HT5A 5AJ3F 2OGUA 3WR7A 1FXRA 2PQ8A 2AFUA 4FKXA 4FUUA 1A9NB 1RTHA 3AOBA 1QQ9A 4M5LA 1TXRA 2PIYA 1RT3B 4LF7J 4OKOA 2WW4A 3L7OA 5I3UA 1YLEA 3RBDA 3GQCA 3ENAA 2ZZMA 3IR5B 4CH1A 1J5OB 3BPSP 4M1KA 4C9DA 4HACA 3EPIA 4FF4A 1TKTA 1Q7LB 4LR8A 5BYSA 1ELOA 3BSCA 1YX0A 3HMJG 4DWIA 4OYXA 2CPHA 1U1RA 1AA1B 2BE2A 1H2TZ 3NH8A 4B3SJ 1OO0B 3WX4A 1N8RT 1WG4A 3H4DA 1HBUB 2WHOA 4QVTA 5EDWA 4FBUA 2HLTA 3ITHB 2PJ3A 4FD6A 2UUCJ 3CPXA 1VHSA 5C5JA 4OQJA 3BH7B 5KFHA 3ISND 1VRTA 5KFLA 2O3DA 5IB9A 1QAJA 3RB0A 2ZH2A 1NMTA 2ZH6A 1WHYA 4PCQA 4ATNA 1RTQA 1RA6A 1VQ7S 4DPXA 2YNFA 1GMWD 4CLKA 3RYLA 1RYRA 3I96A 4M5NA 3CMAS 1Q8KA 4ZPBA 4IDKA 3EDQB 1H98A 1RP5A 2V6AA 4I56A 3HSZA 2A6MA 2RF2A 2F3JA 2J76E 4RW7A 4YDDB 1Q53A 5AE3A 3HCXA 3FEXB 4C11B 4TYBA 1VHIA 4LMZA 3C66A 3C6UA 1J5EF 1WEYA 1IYLA 3R9LA 1LRZA 4K4YA 3K17A 4QIEA 3JVNA 2F8HA 4B11A 4ECWA 4ONUA 5A8WB 4P4JA 3L7UA 3HSDA 3VTIA 4LF5F 4DX5A 2XSJA 1VBKA 4UIBA 3D2PA 2DBBA 2UZAA 2C3PA 2EFGA 4QZVB 5BXIA 1WWZA 2BJ1A 4ED8A 4ZP7A 1Y9WA 1N5YB 3NAHA 3V4IB 1YMEA 1JXEA 3D3SA 1U0HA 2RMLA 3ZC4A 5DQHA 3QZ8A 1XEBA 5ETRA 1HI1A 1TK5A 5D3GA 3PYEA 1UL3A 5IXUA 1QSLA 2AJQA 3FEZA 1WJ9A 2D9OA 4F4XA 5CNPA 2RS8A 2XLJA 2HQDA 2O1PA 4DV1J 1N34F 1FRXA 1BWEA 4HDHA 2YKPA 4FNHA 4K3NA 1HNVB 2BXJA 3MUVP 2HHWA 4LFBF 2ATCB 4YB6A 3NS5A 2DGVA 4DUZJ 2GFFA 1SJRA 1IGBA 1N48A 2DISA 2DB1A 2BE2B 1FE0A 2NXNA 3M9OB 4PPZA 1WHVA 4A8YA 2ZEPA 3FECA 4LJMA 3G8WA 4WFZA 1R8BA 2IMOA 2VKZG 1QSTA 2ATLA 1ZM2A 2DIUA 2C2ZB 2IJRA 1T9VA 4DR5F 3VR1A 5K14A 4XTTA 2GLFA 4KLWA 1IYKA 2V50A 2JZ5A 1HR0F 4JI7F 3KKWA 3TR5A 2PI4A 2XYPB 2E7VA 4RWXA 5JVGQ 1EQ0A 3F0AA 1RXTA 2ROEA 5E5NA 3IS9A 3BF4A 5EWEA 4U5YA 1VRTB 4C0BA 3KJQB 3UDCA 3FBCA 3FX6A 3Q8YA 1LW0A 5KG2A 1TVRB 2RQMA 4G1IA 4W92B 2YKOA 4P4FA 3KL9A 5CD4A 1DARA 1N5SA 1U8WA 3GR0A 2P6GA 4CO0A 1Q86T 1RTIA 2AFWA 4ZI6A 1VJWA 4DLGA 2QVPA 5D0RA 3HFZB 3MM5B 5H84A 4Y34A 1U6MA 2GS8A 3B82A 3BR9A 4LF1A 1SL0A 3UY5A 1R7IA 1ZZNA 4RBUA 5KFZA 2ZEFA 1PCAA 4DL6A 2ZHBA 1KQFB 4U9RA 2QC3A 3CULA 1S1UB 3JSBA 1KLMA 3FSYA 2GFQA 2B5GB 2YPYA 4ZLPA 5J8FA 3TJAA 3T5HA 5JMNA 4CLSA 3DRYA 1ZO0A 1XNQF 4NLXA 3O3LA 4NZ0A 2QJ3A 1CS4B 3FZBA 2B0GA 3L7PA 3TOQA 2CJ9A 2EG2A 3QGGA 1Z4UA 1NSAA 1T3NA 1IKVB 3OTEA 1T9WA 4P9SA 1H8LA 2J9DA 1I51B 2R7HA 4DSFA 4Q0BB 4ZVHA 4MK9A 3PW0A 4B3OA 3SI8A 2HNYB 2CTCA 1RAOA 4EZ6A 3S9LA 5GAGI 1RAGB 1RAEB 4QC6A 4G1QA 2IJNA 2VUGA 3BEGB 3FNNA 3IWXA 1VQ5S 3UCGA 2C2EA 4I67A 4TYAA 2NR0A 4JV2A 2CQBA 1Y10A 2ROPA 4KGVB 4ZN3A 3KMSA 5HL7Q 3W6XA 5L39A 3BM7A 3H5SA 2FB0A 3OHAA 3QAHA 1AB8A 2HGLA 5J2NB 2QMWA 4IYQA 8AT1B 2RU3A 2XMKA 1EP4A 4RW9A 1VBXA 2BJDA 5KFOA 1H7WA 1CG2A 2AT1B 2V4QA 2JDDA 4DUYF 1UTAA 1NHUA 3O2IA 3DI6A 3FCVA 2V2VA 4YP3A 4PWDB 3FRZA 4QIFA 3UNGC 2KXHA 3M05A 2HG4A 4IUSA 1UCNA 4JV1A 3I0RB 2U2FA 2UVWA 1ZM3A 3PR4A 2ABZA 3W6SA 4YUDA 2FZGB 5DGBA 5GAHI 2JEVA 1SJQA 5ITHA 1NK7A 3D4UA 3SMZA 3CWJA 3R9GA 4ZPWR 4BLGA 3TI0A 1FX2A 2CQDA 4ID5A 4KGMA 2YNIA 2MDAA 2GGPA 2AYGA 1LEOA 2IC3B 1U1MA 1SC6A 3NA6A 5DG8A 1UFHA 3GJTB 4IFYA 4ZPCA 5KFFA 2QGFB 1L3UA 5CYQA 4KHPJ 5HVFA 1GNKA 4JB8B 1FD2A 2QFIA 1XMOF 3W2WA 3RR7A 3DOLB 2MKYA 2YXLA 1MROA 5A0YB 3QJJA 3W61A 2KU7A 4UQTA 3GMGA 3S01A 5KFUA 4FS1A 2H48B 2HSEB 3NS7B 4IUFA 3AHPA 1N33J 1S7NA 3L2NA 3IM9A 1LWFB 2B4DA 1FWKA 4DL5A 1HWJA 2O4HA 1U1NA 2Q4VA 1S1TB 3AQPA 4W90B 3GCWP 4LBPA 2AU0A 2ZW5A 5J8CA 4CZCA 3P6YC 2O66A 4J9KA 1FVSA 5L9NA 4PAAA 4YB7A 3PKYA 3NGRA 5F46A 3V6DA 4O4GB 2BJ3A 2Q79A 4P52A 1U1LA 1NSLA 5CYMB 2DGQA 4HHHA 4EO6A 2HWHA 2PEBA 2QA4G 4ZVGA 2HQ3A 1SJFA 3CCJS 2ZUAA 2J6UA 4LUBA 4NCAA 1U2FA 4YQWA 4DN9A 2E1MC 3D2WA 4DV0J 3DLEB 1VQ8S 2WBMA 2GNKA 1JJHA 4TNUA 1VR6A 3KG1A 1BGXT 2ZE2B 4DR5J 1X4HA 1RHMB 5A8RB 3TA2A 2CPEA 2VONA 2AWZA 3QO9A 2E5LF 4F3QA 2H9ZA 2YTCA 3U1MA 4JBCA 4N76A 2HBZB 3SV4A 4FP9A 5K8NA 3NLCA 3R95A 2ZW7A 2M2BA 3UQSA 4I69A 2D3O1 1SUQB 4MFBB 3V4IA 4UCMA 2J8NA 3D0HE 1IIDA 2Z3NA 5GADI 2LP4A 4X8IA 4ZVPB 2GANA 2HQFA 4MFJA 3CJ5A 2XGPA 4II9A 4PUOA 2NLWA 3JS9A 2HIQA 2CAJA 3HVWA 1LW0B 5LXRA 4KH1B 4XIUA 3QFHA 2B5JB 1VRQC 3NGSA 3PO4A 1YR0A 4C3MA 3JXOA 1HBUA 4FXVA 4OP4A 2CF4A 3J7Z5 3KYLA 3TP2A 2FTRA 2FVGA 5JGFA 2LMIA 4YR3A 1T94A 3NNCA 4R87A 2PGCA 3R5BA 4HDGA 1HWLA 4YY3F 5BR8F 1U1OA 3CJKB 1EB0A 2HNYA 3OL6A 2WB4A 2W2PP 4CPAA 2BL1A 2VEZA 3OR1B 4GVLA 3BZQA 2RQKA 2PA8D 5HXDA 1RWWB 4DUYJ 4CNZA 5FLXU 3U27A 3GONA 4UCPA 4CGPA 3QNVA 2VZYA 1C4CA 3V81B 7FDRA 2LU1A 1S6PB 2DNMA 3W9HA 2MZJA 1S6PA 2ZPAA 2UP1A 1SC1B 4ECTA 4W4MA 3KUGA 3LD2A 2E5GA 1IN0A 1X4BA 2GA7A 2DRDA 5HMZA 2OPSA 2EK1A 2EUIA 3PIOQ 4X4VA 2DGUA 1RYSA 2GX8A 3IR6B 1EAYC 2QSFA 4X3RA 1D09B 2Y1IA 3BREA 2VU5A 2EFPA 2ZJRQ 3I0SA 5KFWA 1K8AT 3GFXA 2CKWA 3M9NB 1OY8A 1YJTA 3CPAA 4RR5A 3EWGA 1RWNB 2WONA 1X4CA 2HWIA 1N5YA 3KHXA 1GMWA 1XBUA 3TAMA 4B12A 3MMAA 1DTQA 3E8OA 5CCMA 2VZZA 2FT0A 3BBCA 3E0KA 5JUMA 3I4PA 5A8RA 3KNAA 4N47A 1SC3B 3CCTA 2PD1A 2FJXA 1YJVA 2BE9B 2DTJA 1S9GB 2EWHA 2JSXA 4M95A 4R8UB 2D4PA 3M8QB 4I2QA 1BO4A 2M70A 2AMCB 3TZWA 1UVIA 3KJFB 4R5PA 3H40A 5GMEA 4B3SF 2F8EX 3GV7B 3VAGA 2PJ0A 5KG0A 1P9YA 4DQSA 3VGTA 3IFEA 1MN9A 3G6ES 1R0AA 1VQPS 4ZN1A 4KR0B 4USMA 5ETNA 5G20A 5LT5A 3RO0A 5DQGA 5C42A 2A2CA 2LQ5A 2IBOA 4Y2CA 2YNEA 4MHYA 2CPJA 4O4RA 3G6VA 1OPZA 1X12A 5E96A 3MM6A 4MFKA 3R97A 2JDJA 4ED5A 4KTQA 4NASA 1Z2LA 4K4XA 4ZJOA 2C3YA 4C3KA 3CXQA 4ZLNA 4C97A 2ZH3A 4OX7A 3EGVA 3GIRA 5HROA 2QMUB 1RJJA 2IVFB 1TUGB 3RAQA 1IBKJ 4AYBD 1UZDA 2XC9A 4OHZA 1F60B 2AJ6A 3BBBA 2YX1A 2LFVA 3DHXA 2C3UA 3P2HA 4NEZA 3ADAC 1WF1A 1F1BB 1RHJB 4IKAA 2JHEA 4PXDA 4JI8J 1Z4EA 3IWGA 3G3SA 1BC6A 4NA3A 4IQXA 3AA8A 5GADU 3MMAB 2GO8A 2HS0A 1FJGJ 3FSIA 6AT1B 3DRPA 3P4UB 3HHKA 2BM1A 1OS5A 5HMYA 5KTDA 5CA5A 3DOMA 5KFYA 2CNMA 3ISNC 4KPYA 2FHKA 4K5SA 3KLHA 1Z8XA 1SC4B 2V8VA 2WSAA 1PUAA 2QA2A 2RUGA 2HHHF 4K2JA 4FNIA 3OJSA 3BGRB 4F0MA 4KHMA 1RT2B 2AGOA 1KR4A 4QUSA 4CT9A 3ET6A 1N0VC 3HDSA 4DR6F 1FRMA 2R8KA 3DCAA 2PSZA 1UVMA 3BGUA 1CPXA 5D0EA 5F0WA 4OAEA 2ZUGA 1IBLJ 2Z3OA 1X4GA 4YDXA 1NDCA 2RHSB 4DCPB 2B9EA 2JNJA 3K5NA 3W5XA 2YKMB 4E2FB 3R1HA 2CNOB 3MUTP 4WU3A 2LA6A 2BOAA 5KG6A 2ZEGA 4EBDA 4U8VA 1XMQF 5F0UA 5SUHA 4L6V3 1NU4A 3J81j 5H9EK 2IA0A 3CDBA 1GXTA 2LXFA 2M7SA 4UF4A 1OPIA 2ZEJA 2CDRB 3PP9A 7CPAA 2PDAA 2G2ZA 4AG9A 2MKCA 3AA9A 1IM6A 3D54A 1KONA 4U95A 3D7SB 4J9PA 4DR3J 2J9CA 2Q44A 3CIZA 2C22A 1M5SA 2KHDA 1TUWA 4KH0B 5AG5A 4MYUA 3NY0A 3FSXA 4A8FA 4DU8A 4Y0FA 1OQ6A 3GY9A 4PG5A 2BUNA 5HMWA 1FDDA 4A47A 3D6FB 2FC8A 1X4DA 2IIHA 3ZNJ1 4RW8A 4NF1A 3P2FA 2HNDB 3G2XA 3FBBA 1UEUA 7FD1A 3PZJA 1AMPA 3IR7B 3J7YU 2UUWA 4NGMA 2IDEA 5HJXA 2GCFA 1VHFA 1HNZF 4LFAF 1PYTB 4YEAA 2BO9A 3KFWX 4DUKA 1NSKL 1FTCA 2E1AA 2DGSA 1YHQS 3KLEA 2EI5A 4FVMA 4I6YA 4OHXA 2D1CA 3CT9A 2J8MA 4O3PA 3SYZA 2IRXA 4ZVEA 3WIUA 3PBEA 5IV3A 4IOAQ 1U2CA 1B0PA 1W26A 1KVJA 3LACA 2WBRA 4K4WA 3HHLA 5DLGA 1RT3A 1IQTA 2OEKA 2ZEDA 2CJXB 1PBAA 1CPZA 2HBRB 4OX9F 2DNOA 4USUA 1TK8A 3DLKA 4EYIB 4GS4A 1VQLS 1EJ7L 1VIXA 4TQRA 2D4OA 5JQ4A 1X0PA 2J0SD 3TFYA 1BQXA 4ZX8A 2MJUA 1GFWB 2V4JB 1F2HA 3PCOB 2WVDA 3CXPA 5D8HB 1XEZA 1PO6A 3MM5A 1GX5A 2PR1A 4Q44A 1Q0NA 2OMLA 1TL7A 1U47A 3NGTA 2XS7A 2QMXA 3QRRA 4F0XA 2Y3YA 2VBYA 2RQ4A 2PT0A 5A28A 2VQEF 1XMQJ 3MM9B 8CPAA 5M2PA 4OC0A 2NPIA 3V6HA 3DNSA 3Q24A 2M9KA 3RB4A 3BN7A 4P6QA 1IKXB 1K1SA 3ZFVA 2VOPA 4P2XA 3KQZA 3BGFA 4I1TA 1HD1A 3VZHA 4CRZB 5IC6B 5KFCA 2VJUA 2V8GA 4EBEA 2H5IB 4B9SA 2D3UA 1KKHA 1N52B 5HROB 1LQ9A 2V2ZA 5ETQA 1U8SA 4R0EA 2MY8A 2ZITA 3TVYA 5GAEU 2HFZA 1SI9A 1FD8A 3ZZZA 1X7VA 1Q81T 4QW9A 2XEGA 4KOTA 3SXLA 5KFRA 2DEIA 2W2QP 1AT1B 3EVMA 5AXNA 2XMJA 1UPPA 3HT3A 1MWQA 1HNXF 4ZJQA 2XHCA 4QU6A 2DKOB 2AD9A 3AJ1A 4MKYA 1AUGA 3RAMA 1I12A 1QUPA 3GFHA 3T19A 4V1Ak 3R9EA 2OZGA 2DXFA 3C46A 1XOVA 2QYGA 4RUHA 3R9FA 5AXKA 1NZAA 3NG8A 1FJCA 4QYRA 1EETA 1TAQA 2X3DA 2ZVIA 3BGLA 2NXJA 4KIAA 3PO5A 4ANCA 4AVBA 5BWAB 1J4JA 3AY0A 4X64F 3W64A 1KVIA 2KXFA 2A2DA 3TVKA 2C1EB 4MCRA 4FYWB 4N56A 2UXBJ 5EWFA 2BW2A 4PG7A 1HYSB 3W7BA 3LWUA 2CQ0A 2CNNB 4C8ZA 4F3OA 5HVHA 2YX4A 4DV7F 2JWNA 4M3SA 1R6VA 2BRKA 2XMAA 3HM9A 2CG8A 2V2KA 5L1KA 2EBEA 1FY7A 3G8QA 1SKSA 3TC8A 2PJ1A 4NCGA 4DUTA 1U6BA 2ZEHA 4FWUA 1WDTA 3EM1A 4UOFA 2PIZA 3W5ZA 2WOMB 2WVCA 4B3TF 5FJ4A 2CWKA 2JLFA 4NGNA 4CO2A 3N6LA 3LPEA 2N3LA 1Z5RA 4PG4A 1EZZB 2XO6A 4EBCA 1CBKA 2D69A 4UOHA 2DNPA 3D7GA 4CRYB 3EX7B 4P4BA 1F3FA 1YKWA 4DR1J 4JI6F 3KUEA 2GO9A 3JQKA 1NE9A 1H74A 4MFPA 2MQQA 2PE8A 3DXBA 3M6UA 4MHNA 1T03A 4QR1A 2XHWA 2Y0MA 4ZJLA 4WWVA 2F4VF 1N5QA 3ISZA 4OIDA 2OH2A 3HFKA 2ACMA 4HTIA 1ZPVA 4RJVA 3GWCA 5B08A 2LVWA 1FFGB 4LF5J 1P9QC 2NS1B 4CYPA 3EY5A 3R5GA 2FVQA 1M1GA 4E98A 2Z0ZA 1X10A 3TOAA 5HO4A 4CIOA 1KUXA 2FJVA 1X9SA 4F67A 4J9NA 3RYOA 2I9SA 5KFKA 1FCAA 5GVQA 1TKFA 5K9FA 3J7A1 4PPDA 4A95A 2VICA 4DV5J 1NXIA 2HHQA 3SZ2A 2R7QA 1HBOB 3KK2A 3AODA 2B43A 1WK4A 4J9OA 1DTTA 2DXDA 1YTYA 2K7KA 3EMTA 3H8FA 3TUZC 2P6TA 1SQEA 1HIYA 3CDUA 1RDRA 3ENQA 2FXFA 2CZ9A 1B87A 5H9EJ 5IZHA 2EVZA 2YGWA 2L9WA 3JB9k 2LKZA 1FWLA 3EJMA 5AE2A 4F4ZA 3UE2A 5HH1A 3DC2A 2IAJA 2OOTA 2HZCA 1UFLA 3PBBA 2MGZA 3OPKA 2MGZB 1WNEA 1S60A 2ZBPA 2KI2A 3X1LB 3S7RA 1S1XB 4DS4A 1FK9A 4LT6A 5KG5A 1SUQA 2KYXA 3F5BA 5B0BA 2A6OA 2BBEA 4AE5A 1MNEA 4DCJB 2LQJA 1DTQB 1Q7LA 1HMVA 5CABA 2GVZB 3MM8A 1Z8TA 3HSGA 5L46A 4USIA 4CLPA 3TO9A 3K89A 5A27A 2IM0A 1NKEA 1OYDA 1XN9A 2M5YA 2QJ8A 4EUVA 3UWTA 3CB4A 2JDCA 2DNNA 3D0GE 2FVCA 4A8WA 3MD1A 4LSZB 4X2TA 1CPSA 2XEIA 2GHPA 2IPOB 1YBTA 2N4CA 2AHOB 2X7IA 1S76D 2GJIA 4WP3A 2KG1A 4ZDNA 4H89A 1S9EA 4P4IA 4AFFA 4DQPA 4MI4A 2B3UA 5D78A 2C2OB 3HSJA 4A33A 4GKKJ 2B7CB 1VRUB 3CCSS 2R7OA 1WG5A 5KTCA 3KUHA 1JKHB 3M2RA 1REGX 1RCXB 2KZMA 2OFHX 1LFPA 1UVJA 3VGVA 3V6KA 1NPRA 3CJSA 2N82B 4AL6A 2FY1A 2AX0A 1ZM4A 1TL5A 2YWKA 3AB2B 3RUBL 2Y8WA 4M5JA 1BLLE 3H7HB 1D8ZA 3J7ZT 5KAKA 3FFIB 3OVBA 2ZW6A 1TKZB 3K9TA 4KYZA 4KRWA 1XR5A 3ISXA 3BQ0A 1R8AA 3CCRS 2HBQB 3CE8A 3ILOA 5ETKA 2GJ2A 3BDPA 2RQCA 4KOUA 2VBWA 3MEEB 2JVRA 3IJ3A 2AEMA 4LIRA 2DNZA 1YDLA 1TTHB 4HI2A 3BH6B 2DH9A 1DE4C 3P45B 4URQU 1KS2A 2CWXA 1IBCB 3W65A 1NLKL 5DS7A 3DKDA 1QSMA 2XLIA 4CYOA 1WC3A 3PW4A 1ZETA 4B9NA 3FBFA 4X4QA 4K7QA 2BMBA 4DR2J 3NKYA 1N88A 4IH7A 1X5PA 3IA0A 2NYIA 1RSCA 2VI7A 1RLCL 2OI2A 5KTQA 2Z2LA 5JXSA 2ROGA 5BR8J 1RABB 3N6MA 3I55S 2WUUA 1B3TA 3A8IA 2R2UA 4O3NA 3OTBA 2ZOGA 5DLFA 2JEWA 1M5VC 2QTWA 4ALZA 1CJWA 3QRQA 2AKWB 5IFMA 5HQLA 1CQNA 3FCWA 4HPSA 5G0RA 5C2GA 4XPKA 4IHMA 2DR9A 4R3KA 4GXHA 3HZEA 2QZ8A 3I4HX 2KZZA 3UVJA 2B9YA 1VK3A 3NOCA 4E0DA 1XMBA 1JXVA 5T14A 2MKSA 2DY9A 1W2BR 2GU2A 5E0OA 1GMUA 2R9LA 4HKFA 1X5TA 2CA9A 4PUOB 2ZENA 1QMUA 1EP4B 1TR0A 4F8RA 2GMJA 1IBKF 2B58A 2XM3A 2XNQA 1HHQA 2RD5C 4L3NA 2W7AA 1M1DA 2ZC3A 5L1IA 1CULB 3DDNA 3IBFB 1JLBB 3D7FA 3KKFA 2PMHA 2V8DA 4CAFA 1FXDA 1P1LA 1TKTB 2HAIA 2KDOA 1NDKA 4KLVA 1JKHA 1NH8A 2CNLB 4OYZA 1FNXH 2DEJA 3WQPA 2VDHA 3VWSA 2Z3PA 4ED7A 1Y9OA 3FEEA 3MR6A 4NI2A 5LYDA 1XNQJ 2V4JA 4B08A 1TF9A 3DLGB 1T9TA 4HVZA 3CDEA 1C0UA 5FVJA 2GHWA 5GAHU 3KHZA 3OXLA 4Q2MA 3IS9B 4USVA 4A31A 4OZ2A 1C1CA 4PABA 1RTDA 5AXLA 3CVKA 3ZTOA 4Q5VA 4XPLA 1QE1B 4QPXA 2Q7SA 3CCMS 4IAVA 4B3MF 1K0TA 4KOYA 4A94A 2B8QA 3DOMB 1Y5NB 2DNKA 2OEJA 4QWDA 1OBRA 3B7IA 3D28A 4AL5A 2ZEOA 5AXMA 1Q2CA 1L3VA 2P8IA 2HVHA 2KL8A 4ZCMA 4CLTA 2APOA 2XMVA 4F7VA 2HYIB 2ZD1A 4MH8A 2EO8A 3OVAA 3NH4A 1SVDA 1IBMF 3T3FA 5DM6Q 3LP0B 1WELA 4KKOB 4ZS6A 4FBEA 4K2XA 3FK4A 4OI4A 3HVRA 2L9NA 5AJ3J 2UXDF 4EI2A 3W2VB 2RHQB 2DXEA 4L89A 4NGSA 2CG4A 1RT7B 1CJKB 4YB5A 3HK2A 2Z56B 2CPXA 3D6HB 5KT4A 2ASLA 2G9OA 3SIPB 4LVOP 3G9CA 1HI8A 2EBGA 1RT1B 3SV3A 2IY5B 3CO0P 5H9FJ 2P6EA 4YGOA 3I6PA 3DOKB 3K5LA 5HBMA 3PJXA 4A4JA 1K44A 5I4MA 4RNOA 2DXQA 5LYLA 2VODA 2QECA 3KGQA 3G87A 4LQ9A 4C7HA 2BABA 3CW2C 3GE9A 4BC7A 4ZP8A 3TQEA 3BYRA 4M5IA 4V19J 2O53A 1JNZB 1XFOA 3UN5A 4A8QA 4U7CA 1U48A 1HWKA 3TWZA 4BWJA 4FBTA 3G82A 4AQYJ 3BHXA 5CAAA 3QLHB 5MAOA 4P2MA 3OJUA 1FKOA 2OPSB 3J7AN 4DL7A 2Z10A 1BQMB 2FJEB 3PR5B 5M2RA 1KZFA 4A8SA 2MYFA 2XMMA 3DLKB 3QJPA 3TUIC 1BE4A 5KFMA 1ON0A 1R8PA 4AT1B 3TEGA 4CNYA 1VJQA 4C8NA 3EE3A 1M5OC 2HMIB 4OZLA 2I5JB 1T0TV 1UKUA 2HHUA 2B6AA 2C27A 1O0PA 4X62J 4NFRA 3QT6A 4LBHA 3B3TA 3CD7A 4OHWA 3G8TA 2E5LJ 3DR6A 4PV6A 4PYDA 3NXZA 4I49A 5CPAA 1SV5A 1QLNA 2B4UA 4ECUA 3UR0A 4UOGA 3V5RA 5GMKa 3RB6A 4PWWA 1CEZA 1VGYA 4C48A 2OTLS 3OFHA 2CIJA 2PJCA 3ILLA 1X4FA 2AFXA 3C6TB 5D6GA 2DGWA 2OPPB 1VOMA 1ZLHA 4B9MA 2BE7D 1AUSL 2NUHA 1LK7A 5AT1B 3AJDA 1MW7A 4MIAA 4OJGA 2DT9A 4FXWA 3TUPA 2JBJA 5KT7A 4O0IA 1T05A 3T8WA 5KFDA 3M30A 3SFUA 2J9AA 1DQ9A 1HBNA 2F9DA 2GQQA 3PRDA 2XSJB 2PIIA 2RAQA 3M1VB 4DFJA 2ZNYA 2OD4A 1WOPA 2RNEA 2BUEA 4OV1A 4YFUA 1R27B 3EVWA 2R2RA 2DNQA 3IG1A 2ALYB 2IRUA 1MMLA 4NGPA 4EO8A 2WVEA 2DRBA 2K2PA 4FD4A 4X4PA 4NLVA 2WCXA 4EYHB 3W8PA 2LEAA 3F0NA 3DOKA 3IP0A 2BW7A 3RB3A 3EGZA 1NCLA 4EZ9A 1I6JA 1KUVA 1N71A 2F5IA 4AB7A 4Y49B 2BCOA 1FVQA 3B78A 1DQ8A 5LM7E 5K5MA 5HN0A 3BXMA 2ASDA 4P74A 1C4AA 3TAPA 4UEZA 2XB2D 1VS3A 3MTJA 1O6XA 3DRRB 2MPUA 3M8ZA 3D9BA 2HFVA 4IO1A 2V4RA 1GT8A 5C25B 2K06A 1FI4A 1HQUA 1YVFA 3TE4A 3FDSA 3FYNA 2ZBQA 4WK3A 4OI1A 5BJRA 4NRTA 5GAEI 1RK8A 1UJ5A 3R5CA 3B6BA 1CM0A 4GKJJ 4B3TJ 2JC0A 4LREA 4NCGB 2GC8A 2GREA 4UWJA 3OD2A 4H4KA 2XYHB 3HKWA 2B6AB 4S0MA 3OHBA 4DEZA 2RDJA 5HI7A 3F8KA 1VQSA 4DF4A 3CD5A 2BJ8A 4WTYA 1RT4A 1R6YA 4X65F 4KSEB 3GLJA 1OIAA 3VF0B 3KXDA 3R7NB 2E1RA 2BX6A 5KFAA 2BJ9A 3EC4A 2XMWA 3CPWR 4K8RA 1G7CB 4ED4A 2OPPA 1MN7A 2ZELA 1QSSA 1SBRA 3HHLC 2GMLA 3BJYA 3PHEA 5E3PA 3DLBA 1HDUA 4KE5A 4OC2A 2OSQA 3S9MA 4DV3F 4YHHJ 2CNSA 4KT0C 3DRSB 3NBPA 2BV3A 2Y0BB 1XRYA 2HB6A 5E3CA 4ZIVA 1XWLA 1Z9UA 2C2DA 3P8BB 4I2PA 3KLVA 2BZ2A 2Q6BA 3KG4A 2MHEA 1DQAA 3PVXA 1FRKA 1KFSA 2AE6A 4DL2A 3HFVA 1S6UA 1G1XA 2I79A 1S48A 4E2AA 5D77A 1FO1A 1ZS6A 2PMWA 3W9IA 3E51A 4ZHRA 4J9RA 2R7RA 1GTEA 5IM0A 2CVIA 2AYMA 3AFGA 3NWRA 2HVDA 1VQ6S 2YVSA 3UD5A 2R7WA 1KEKA 2J8SA 3A1YG 3T9YA 1CX8A 1N56A 2G0IA 4F4KA 3SCJE 4LQ6A 2PJ2A 1D0EA 2UV8A 4UFVA 2FVPA 4I6WA 4OLPA 1HNWF 1RADB 4FYDA 4HNYB 2NMTA 3TT2A 1H6KX 2EVNA 3D2MA 1CJTB 4Y6IA 4CM0A 2K1RB 3UDVA 4J9UE 2PRQA 2CTBA 2FL4A 2VPXB 5C88A 4B17A 3DU6A 3CXCR 2KVIA 3LAKA 5FLXY 2IQ6A 2HHHJ 2KHCA 2EBJA 5DO2A 3ZXWA 4EMDA 3OTOJ 3M8SA 1HWIA 1ZZFA 1LXJA 3MEEA 1Y0RA 1RAIB 4ZVRB 4C0HA 3K9UA 2VFTA 1FE4A 4HLBA 3EXCX 1ZOTA 4NLDA 3W2VA 1Z2ZA 3CXSA 3OR1A 3FFIA 3M2VB 1HNIB 5F8NA 4EFAC 2WONB 5B0EA 2AGPA 3SCLE 4NGQA 2I8EA 4C0OC 2HK3A 4MFQA 4TVAB 1G6BA 1TV6B 3OUYB 2PJBA 1IY7A 3MMJA 6FDRA 4MFLA 3MGDA 2E1CA 4LF4F 4U7UK 2NSMA 4EU0A 1I1DA 1PILA 5EN1A 4XDCA 4C8KA 5IB0A 3AD9C 1CS4A 3WX8A 1JJCB 3BR8A 4OC5A 4JYWA 3S6FA 2EEYA 2R7SA 3V7ZA 2CDQA 1MWYA 2UUCF 3NCPA 4B6ZA 1BOBA 1E6YA 3SSSA 3Q22A 2FSRA 2K3KA 1VLYA 4M63A 3SXOA 4CS0B 3AT1B 4ECVA 4NLOA 4K30A 2FVSA 1AZSB 1LAPA 2ATRA 4P44A 2JEJA 5LSOA 3RW7A 2E66A 3O44A 5ISVA 2W4CA 4QR0A 5ETLA 4PR6A 4NLSA 5D4NA 2J7KA 3Q23A 6FD1A 2IHR1 3IWWA 4C7QA 1PGZA 2A1BA 4B9LA 3B2YA 1B7YB 3H2LA 2VQYA 1PYTA 6CPAA 4TY8B 3OV7A 3VAHA 2XO7A 3MPWA 2AF6A 2XLKA 1VQKS 3SDEA 1SQHA 1LWCB 2XSFA 2MZQA 3B3CA 2FUG9 2QV6A 4JV5F 1NSPA 4MCQA 1S57A 2CIMA 1W2IA 3GV5B 4QWAA 4RNNA 3ETMA 3CGIA 4MY0A 3MAHA 2DK2A 3CO9A 4TNOA 4FF3A 2XMUA 4J9LA 4KVXA 4DN0A 4F4WA 4MKBA 2MQLA 2BYCA 1TMJA 3CNQP 4F0HA 1KBRA 5HP1B 2JJ4D 1UW9A 3JUWA 3DLGA 2EPIA 2EG1A 5J2NA 4UIAA 4DLEA 3OFGA 3FZ2A 3HPOA 4DSJA 2M3DA 4H6ZA 1FT8A 3CJRA 5K8PA 3CD0A 2CNKB 2BEFA 2YWFA 3V6DB 3GJQB 3EICA 3I87A 4RW6A 2QG9B 5LSLA 4PQAA 1H3DA 4ILRA 4ONWA 4HR2A 4UUXA 2YNCC 3T5JA 3DXSX 4BBHA 2WK4A 5IS2A 5MLCV 4MT1A 2D3OR 1DLOB 5E3RA 3GILA 1U2RA 4MXUA 5F09A 1PIEA 3I9V9 3CMES 4DQIA 3QAEA 4RX6A 4JI5J 3H2VE 1F5CA 2HPUA 1Y5LB 2M0GB 4Y00A 2VB6A 2YNHB 3DR8A 1KNZA 4QWBA 3S6EA 3DFEA 4MMOA 2R7XA 2RS2A 5KG4A 2R8GA 1K0VA 2OH1A 3KMQA 4DJLA 4FYXB 2HAFA 2DGXA 2HIYA 2F8MA 1IKYA 2J0XA 2P0WA 4CCHA 5CZVA 3MM7B 1U26A 1S9GA 3BKTA 1D8YA 4NE9C 1YITS 5HLFB 2YH0A 4JI3F 3DSBA 3JTKA 5G0RB 5LYFA 4NLYA 4LSNA 4M5KA 4WTOB 2VQFF 3U02A 2KO1