1XMBA

X-ray structure of iaa-aminoacid hydrolase from arabidopsis thaliana gene at5g56660
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
392
structure length
375
Chain Sequence
b'KLLEFAKSPEVFDWMVKIRRKIHENPELGYEELETSKLIRSELELIGIKYRYPVAITGVIGYIGTGEPPFVALRADMDALPIQEGVEWEHKSKIAGKMHACGHDGHVTMLLGAAKILHEHRHHLQGTVVLIFQPAEEGLSGAKKMREEGALKNVEAIFGIHLSARIPFGKAASRAGSFLAGAGVFEAVITGKTIDPVVAASSIVLSLQQLVSRETDPLDSKVVTVSKVNPDSITIGGTLRAFTGFTQLQQRVKEVITKQAAVHRCNASVNLTPNGREPMPPTVNNKDLYKQFKKVVRDLLGQEAFVEAAPVMGSEDFSYFAETIPGHFSLLGMQDETNGYASSHSPLYRINEDVLPYGAAIHASMAVQYLKEKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IAA-amino acid hydrolase homolog 2
publication title X-ray structure of ILL2, an auxin-conjugate amidohydrolase from Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 122
structure length 375
sequence length 392
ec nomenclature
pdb deposition date 2004-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1xmbA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1xmbA01
3SI2A 3PBBA 4MHPA 2IMOA 1AMPA 3KQXA 2PJ0A 3SI0A 1Y0RA 3QNVA 3PB6X 4F9UA 5CPAA 3IJ3A 3KHXA 1QQ9A 1YSJA 4YWYA 4ZY1A 5D29A 2Q51A 3KQZA 3BI1A 3SJGA 4BD9A 4ONWA 2GREA 1RTQA 4P4JA 4OKOA 5JGFA 4IHMA 1Y7EA 2AFZA 2XEJA 3BHXA 4MCPA 4MXUA 4YU9A 1YLOA 4MCQA 2F8HA 7CPAA 3H8FA 4ZY2A 3LMSA 3D66A 2GLJA 5F09A 3B2YA 4OP4A 4RUHA 3S9NA 2ANPA 1BPNA 2J9AA 2I3CA 1YMEA 2XEGA 3PEIA 4OC5A 1PCAA 2RB7A 2V8VA 5LRJA 3CT9A 2EK8A 2PVVA 5LRGA 2Q4ZA 3RBUA 4OC1A 3PB7X 1Z5RA 3S9LA 3KR5A 5LYFA 3KGQA 3SI1A 4DUKA 5J1QA 1DTDA 3SJFA 3RZAA 5HVFA 1ARLA 5LRKA 1UWYA 2PJ1A 4MHNA 3KHZA 2ZEOA 3MRUA 2XEIA 6CPAA 3K2KA 3KL9A 2PJ6A 3PRTA 1DE4C 1R3NA 3HLPA 3NH5A 5HVHA 2QYVA 1TF9A 4FBEA 2POKA 2EK9A 2EWBA 4MMOA 2HC9A 4EMEA 5K8OA 1VHEA 1BPMA 3FMCA 1YW4A 3V38A 2WYRA 1LCPA 3HUVA 2AFSA 3TX8A 2ZEDA 5HXDA 3BXMA 3MN8A 3NFZA 5LYLA 4R6TA 1HEEA 5K8NA 3D67A 2PE3A 2HB6A 2CTBA 2JEWA 3D68A 5D8NA 5LYDA 3JRUA 4NGMA 4P4EA 3B3CA 2C6PA 3WT4A 3GUXA 4EWTA 1HDQA 2V8DA 1VGYA 4UEFA 3WABA 1TKFA 2IQ6A 3D7DA 4OMEA 3SJXA 2NSMA 2AFOA 3T8WA 1BLLE 1VHOA 4ZX8A 8CPAA 2AFWA 4OIWA 3IWWA 4IAVA 4NGQA 3NH4A 1ARMA 1F2PA 1XBUA 2PJBA 5LYIA 2PJ7A 3D7FA 2GLFA 1F57A 2C1CA 2C6CA 3NA6A 3NH8A 4P4BA 3KZWA 3DLJA 4P4DA 2CIJA 1QMUA 1CP6A 4MCSA 4NGRA 1XJOA 2ZELA 2JBJA 1ZLIA 1XFOA 4NFRA 4F8ZA 4NGNA 4OC0A 2AFUA 4UF4A 1TXRA 4UEEA 3ISXA 3V7ZA 1Z2LA 4W9YA 4TWEA 3RAMA 2PJ8A 2BO9A 5HVGA 3B3WA 4R8FA 4PXEA 2AFXA 3N5FA 4Q7AA 5K8PA 4MCRA 3FVLA 4TNUA 1CG2A 2BCOA 3KR4A 3H8EA 4GM5A 4FWUA 1IY7A 1ZLHA 5CBMA 4P10A 2ZEFA 4OIDA 4X3RA 2G9DA 4B6ZA 3IIBA 3IO1A 2PJAA 4MHZA 3FEDA 2QVPA 4NGSA 3PB8X 3CPXA 4P6YA 4X8IA 3L2NA 2PJ4A 1XRYA 4Z65A 1R43A 5JH9A 4DJLA 1PYTB 3FF3A 3GB0A 1AYEA 4X2TA 1LFWA 2PIZA 4WJBA 4P45A 1H8LA 4WWVA 4NJQA 2GU2A 3VARA 2OR4A 2Q43A 2CTCA 4NGPA 4PQAA 1CBXA 1ZG9A 5IB9A 4AXVA 3PBEA 4IK2A 1HDUA 2NYQA 3CPAA 3SJEA 1FT7A 2BOAA 4OC2A 1TKHA 4R7MA 4CPAA 1LOKA 4PXBA 1LAPA 3CDXA 2VL1A 4ZX9A 1BAVA 3PB4X 2PRQA 2XEFA 4JYWA 4UIAA 4PXDA 1EE3P 1ZG8A 2QJ8A 1ELLP 4F9VA 4MHYA 2PJCA 4ZI6A 3LWUA 3FH4A 2CF4A 4ZY0A 4P44A 2O53A 5THWA 3FX6A 1OBRA 4NGTA 3WC5A 3IEHA 5I4MA 3D7GA 1NSAA 2PJ3A 2ZEGA 3DGVA 5K8MA 2WZNA 1TKJA 3PFEA 1Y0YA 3B3VA 1LAMA 4UEZA 3WC6A 1VIXA 1CPSA 1CPXA 4P4FA 2PJ5A 4OC4A 2JBKA 2O4HA 1F2OA 3D7HA 2ZOGA 4K3NA 3TC8A 1Z8LA 3H8GA 4FAIA 4UIBA 3S9MA 2C6GA 2PJ2A 3FJUA 4G1PA 4A94A 3PFOA 4FUUA 3VATA 3I1UA 2PJ9A 5DS0A 2ZENA 2ZEHA 3B3TA 1XMBA 2ABZA 3KASA 3GLJA 3K9TA 2PIYA 3ISZA 1YW6A 1JQGA 4A37A 2ZEEA 4MRIA 2DEAA 1CX8A 4A38A 4P4IA 3KI9A 3D4UA 2V8GA 2ZEMA 3BI0A 4A39A 1FNOA 2IJZA 4PPZA 1IGBA 4KSIA 5ELYA 3WC7A 4EFDA 4DYOA 4LQGA 3B35A 3FEEA 1GYTA 5JM6A 3PB9X 2AFMA 1M4LA 4OC3A 1LANA 1CP7A 1KWMA 2F7VA 4O23A 3B3SA 2FVGA 3FECA 3VH9A 2V8HA 2ZEPA 2OOTA 1Q7LA 2V77A 2PVWA 3IFEA 2ZOFA 4ZYQA 3B7IA 4JZ0A 1TF8A 1ZG7A 2RFHA 1ELMP 4R76A 4H2KA 3IC1A 4PXCA 2PCUA 4NJRA
chains in the Genus database with same CATH superfamily
4GMKA 7FDRA 5M2PA 2PJ0A 4C48A 5J2PA 4B3MF 2AV5A 2QX0A 1HBNA 1SJ3P 2HIYA 1GQEA 3BKUA 1D09B 2KB2A 2KKHA 2LDIA 1QQ9A 4IQMA 2VZYA 2Y0SD 1TUVA 3KQZA 2E29A 1HNWJ 3MR2A 4CQ1A 1CJUB 3ZZUA 3WIVA 4YU9A 3CD7A 3DDDA 2DVIA 1S1WA 2GLJA 5CA5A 3W8PA 1BE4A 2O3DA 4RUAA 2ZD1A 1OPIA 1SH2A 4GRSA 3M8QB 4DV0F 3EJMA 2XWXA 3N6NA 5CYMB 3NBPB 2PVVA 4OYZA 4C2ZA 3NS6A 1T05B 3MR6A 4QYZK 1DTDA 2MZJA 2C2NA 3BBCA 2ALYB 2JFKA 2V4QA 4JI7J 3FKBA 4DSLA 2PJ1A 3SEOA 1GMVA 3BS9A 2D9OA 3D1OA 4L72B 2IA0A 4UWIA 1URRA 5DDPC 5IV3A 4F6AA 3PW5A 2YPYA 1L5UA 2C1EB 1Y5LB 4USHA 5ETLA 2PC1A 1NDCA 4K4SA 2G4BA 2DK2A 4KPCA 2LKZA 4HACA 2EK9A 4NZ0A 3A8EA 2H4WB 2HSEB 5HAOA 3PO4A 1LCPA 3CD0A 4X62J 2ZHOA 3CXSA 1YR0A 2AFSA 3MHYA 3T5LA 2VG7B 4R6TA 4LF8F 1HI8A 2B5GB 4OZNA 5D8NA 3HCXA 1AROP 4HL9A 3P2FA 1ROFA 1NE9A 5B09A 2BYCA 3ZZ0A 2QE5A 2AGQA 4LUAA 1K44A 2IAJB 4HDHA 3J7YU 3D2PA 2GFQA 3I0RB 3SJXA 1V3SA 2Z3MA 1N5TA 3CULA 2NSMA 1RDRA 1N34J 4C9DA 3A9LA 3KJVB 4EK2A 2BABA 4LQ9A 3RU0A 4OIWA 2HVDA 1DLOA 3FSIA 4MHDA 4L89A 3NH4A 5KFNA 1S72S 2PJ7A 3CD5A 3KOAA 4OL8A 4KSEB 1T03A 4NMLA 1FRKA 3NA6A 2DPIA 2WBMA 5J1NA 2KL8A 3M05A 4K4VA 3PTWA 3KZWA 2GHWA 1U8SA 4DXLA 1PGZA 2MY8A 1HBOB 1W26A 2R4FA 4C0OC 1FXRA 1KQKA 4IF5A 3C15A 3DRSB 4II9A 2AFUA 1A2ZA 1FKPB 1QSSA 5GADI 2VJUA 3TTHA 4M5HA 4UOGA 4KH1B 2G0BA 2BO9A 4FNHA 3V4IA 4PXEA 2F9DA 4Q7AA 4I0WA 3FVLA 2ZJPQ 1I1GA 4X3RA 2WK4A 2R7TA 2CPYA 4LF6J 1DRZA 4KY3A 2I5JA 1SKSA 2W9CB 3IBWA 2AWZA 1NUEA 1XRYA 2VG5A 4U67Q 1RT3A 3KLIB 2DHAA 1Q79A 2M3DA 2NPFA 5JVGQ 1WTFA 2RHSB 3M2RA 4JI6F 2CNSA 4KGZB 3BREA 3D1QA 4NGPA 4C7IA 4WFZA 2GHVC 3MM6A 3DYAA 2XCAA 4E2FB 4M5IA 4CGPA 2RDIA 1PU9A 3B8HA 3AY0A 5FD1A 2HFNA 3D1HA 2XEFA 1KLMB 3JSRA 4B9SA 4JI3F 3BQ1A 3HHLC 3O44A 3BH6B 4DQQA 4DR6F 3T1YF 2QTWA 2W9AA 3QJLA 3MZIA 3ENQA 2FL4A 5H84A 3IEHA 2EBEA 2ZUAA 5IXUA 5IT0A 3M6WA 2BBEA 3CCJS 4ICLA 4B3RF 1U48A 5L8RC 3CJQA 3MEKA 2FZKB 2O4HA 2A1BA 3AJ2A 1X9SA 1S7NA 3PX0A 1V5VA 5F47A 3CSKA 1QSOA 2DCUB 4URGA 2YKAA 3AAWB 1O51A 4IOBA 4P73A 3MOJB 2MGZB 3CZXA 4ZHRB 1U26A 2YNGB 5LXYA 1L0CA 3R1HA 4KOYA 1ACMB 3ENVA 1IBMJ 3GONA 2AEMA 1JLCB 3OFEA 4DLGA 3CJ2A 3V2UC 3HLUA 3FBFA 5IM0B 4DG1B 2MZRA 2DEAA 2UXBF 1LW2A 3DGPA 2WVEA 2CPIA 4KS9A 1M0SA 2QZ8A 4DL6A 4OHVA 5LMNJ 4UFXA 4RNMA 4OC3A 1M5PC 1QAJA 3VR1A 3FEZA 1TL7B 4QW9A 2VBYA 4KRWA 1NJWA 2VQYA 3MMAA 4GXHA 3IN5A 1ZA1B 3PVXA 2PMWA 3RO0A 2OSRA 1OO0B 3QMQA 2RRAA 1S7LA 2YWHA 4WFAQ 3Q2TC 3OTOF 4IUFA 2P2CB 2ZZTA 2HNDB 2W7AA 1Y0RA 1KBRA 2XB2D 2DO4A 2PE8A 4JI5F 3DDIA 5L39A 4KGKA 4ZY1A 2Q51A 4I69A 2UU9J 1Q4RA 3GR0A 2CNTA 4KAIA 3J81Y 1JJ4A 3I4PA 3HT3A 1YLOA 2PDAA 3H8FA 4YMEA 4OI1A 4CGNA 4ZVSB 1G4CA 3DMJA 1G2EA 2WHOA 1U7LA 4AVCA 2P6EA 3TOAA 2J9AA 3MM5A 1IQTA 3BDPA 4NCBA 3UDVA 3TOBA 3SI1A 1OJ4A 4F26A 5B0EA 2KZZA 1S3ZA 4I2PA 2QFJA 3H8YA 4ED5A 1U25A 3DOKA 1TR0A 3RBXA 4YR2A 5IX3A 1AXQA 1M1HA 3PZPA 4WZQA 1MROB 5KFWA 4MYUA 3R9EA 1R3NA 3TAMA 1KVJA 2J0XA 3CJRA 2Z57B 2DT9A 4NRTA 2VU5A 4NCZA 1BPMA 3FMCA 2ZC3A 4EBCA 1X10A 1DJ0A 1X8DA 3KLHA 2GV1A 1M4DA 3CWJA 4QU6A 1HEEA 1KUYA 1N52B 3QO9A 2LXFA 1NEEA 5F8GA 4C8MA 1SUQA 5LYDA 3CD6S 4P4EA 2VHGA 2CKWA 4EWTA 1HDQA 3IXQA 4WFYA 2VQEJ 3FBCA 3M30A 1S6UA 4O3PA 3EPIA 4ZLPA 3GIMA 3K0JA 3DNCA 5F9NA 1GNKA 1IB1E 4N41A 2J5AA 5T7LA 5EUHA 1U2CA 1WUUA 2MQPA 2HUZA 4DR2F 5C2CA 1RT5A 2WONB 2YX4A 3LUYA 4P9SA 2VDIA 4I4BA 5L38A 3L4BC 1DTTB 4LQ3A 3BKTA 1NBEB 3G8TA 4P4BA 3ULHA 5IOLA 4P4DA 2FXFA 2CAJA 1RGVA 3ZC4A 5FLXU 3NCPA 3NAIA 4NGRA 4DL2A 2J6UA 1Y5NB 3HHLA 3VZIA 4DV3J 1ZM3A 4R0JA 1ULRA 3BN4A 4NA1A 3IR7B 2CQBA 1FDAA 1U09A 4FBTA 4GVBB 3VZHA 1X0PA 3N5FA 4MCRA 4MK9A 2IJRA 4JI8J 2Z10A 2EKNA 1VQLS 2PIIA 3RR7A 4QW8A 3ZTQA 3ETMA 4DDFA 2Z56B 2DH7A 3R5AA 4Q5VA 5L1IA 4MIWA 2XMKA 3IA0A 1M4IA 1EQ0A 2W01A 3W2WB 2W9BA 1U4BA 3FF3A 3GB0A 1FE0A 5F48A 2ROEA 4WWVA 3DRRB 2IMWP 4L6V3 4HHJA 4NPOA 3TZZA 2CPHA 4OLLA 3Q8PB 4FVCA 4K2JA 1CULB 4URSA 3MWBA 3KG4A 1QAIA 4IK2A 4K4UA 2RILA 4ZCMA 4H4MB 3SV4A 1FESA 4NLDA 5HQ8A 3BV8A 4NLPA 2VKRA 4F0MA 1F0XA 3BO4A 2HMIA 2HHSA 1OWXA 2B4PA 4RWXA 5AXMA 2LP4A 2DXEA 2QJ8A 1QSLA 3H5ZA 5F8LA 1MJBA 4P2SA 4ZJQA 4PSXA 4X66F 4W90B 4KLVA 1ZTTA 2O67A 1OBRA 4ES2A 3BJ7A 2XULA 3LP2A 4F2RA 2DNRA 4LF4F 1CJVB 1B99A 5CH7B 1KHVA 5DRKA 3NGSA 3MD1A 1LWXA 3D7HA 2E9TA 2ZOGA 2LQJA 3E01A 2P6FA 3TC8A 4QIVA 1UVJA 4QWBA 3FBUA 2P8IA 2OEJA 3PY8A 4A48A 7FD1A 2J6TA 4KGMA 4TQSA 3RB6A 5D0RA 4XAKA 4JYAF 4QWAA 2AQ4A 4IFYA 1U2RA 4J7CA 4CTAB 5LJ5Y 3OHAA 1I3OB 2AJ2A 3DDKA 5F0WA 4A37A 1Q78A 3CDAA 4WTYA 5KFOA 3LTOA 1QSYA 2Y1LB 3QLHB 1NB7A 1LNQA 1Q8LA 1FNOA 1B7FA 4J9MA 3TX0A 1TK0A 2MQNA 4B14A 2RQCA 3C6UA 3MPYA 3G71S 5KFPA 3EVWA 3FDSA 5KFBA 2AFMA 4I6YA 1UVLA 5GVQA 4NXMF 1CJTB 3CCES 2UVWA 1C0UA 4WCEQ 4DFKA 4ETXA 1SL2A 2MKCA 1HPZB 3JXOA 2XY5A 1UVIA 1TKDA 1WC0A 2AHOB 1FNXH 5G0RB 2Q7SA 2AJFE 4X4RA 1VRTB 2JVOA 4A8QA 3TQEA 1WEXA 2VF3A 4KOXA 4F9UA 1N36F 4M85A 4Z7CA 1H73A 1XTZA 2OHDA 3GJRB 1OYEA 2AZ3A 3AJDA 3BI1A 5KFHA 2FHMA 3H59A 5EX0A 5ETSA 2K1RB 1TVRB 4ZVEA 1VI7A 4B9VA 2VOOA 5KG3A 2EUIA 3M8QA 5F8IA 3IR5B 3NBPA 2CQPA 4PYAA 4HH1A 2FZCB 3MR3A 1RXTA 4DV4F 1T05A 4OC5A 4R8UA 4JI1F 2RB7A 5A8WB 4FD5A 2OB0A 1YLXA 3GJQB 2HS4A 4L74A 2XBPA 2Z2ZA 3AB2B 3NS7B 3TO6A 4G1IA 2H48B 1APSA 1CBKA 1N48A 4RI1A 3KLEB 2ZH4A 2NCKL 3I4HX 1QSMA 1IM6A 4OX7A 3NH5A 5ITHA 1RAGB 1I94F 2H5EA 3PZJA 4EMDA 4MTPA 3VAIA 3CMAS 3AJ1A 3GV7B 4ZCIA 1VBKA 2FVQA 3GKRA 4FDFA 2VG7A 4RBVA 3FCHA 3KHGA 4DX5A 1VQ7S 1V6HA 1NKEA 2B5GA 2B9XA 3W3SA 2UXCF 3MPUB 5E3AA 4IOCQ 1B64A 3KKWA 3HZEA 2MKYA 2MSTA 5D3GA 1URNA 1ZZNA 4DJBA 2BA9A 1QM9A 5BYSA 3I0RA 2V9KA 1RSCA 4A8FA 2PN6A 5E33A 2VA3A 3G6XA 1JKHB 3KJVA 1CVJA 5BWAB 2KFNA 2W8LA 2GJFA 4K4ZA 4CO0A 1RAFB 3I5BA 2QA4G 2ZZNA 2PJBA 3TFYA 3D7FA 3S6KA 1HBOA 3SMZA 3DRSA 3OTDA 1FKPA 4FKXA 2Y0MA 1CP6A 4M6IA 2X1FA 3SXNA 3OXLA 4HI2A 3T5HA 4OC0A 2ARHA 2FIWA 4UF4A 4UEEA 2IVMA 3ISNC 1IBLF 4W9YA 2HBQB 4F36A 4TWEA 2ZH8A 3D6TB 3I55S 4UBRA 5HVGA 3MM8B 2JJ4D 4ANDA 2BEIA 2OEKA 5ETRA 2EG2A 4PAAA 3V81B 2BCOA 3H8EA 3IGRA 1ZLHA 3BO3A 2AEFA 4ED8A 4NLGA 4DUZJ 4I6AA 2JL9A 3NMAA 2PJAA 4O3QA 2LXIA 2BZ2A 2N4DA 3V4MA 2BUNA 2EI5A 3KLIA 2GS8A 3JB9k 1X7VA 4JI4J 2XO6A 2VOPA 2R7RA 2FIAA 1M5HA 3MEEA 2OU2A 5F8HA 1IM4A 3ZNJ1 1RWUA 2W2MP 4FPIA 2ZE2B 3GFZA 5ETTA 1H8LA 3LD2A 1IJFB 4MFJA 2Q4VA 1BGXT 3VAGA 1YVKA 2G0CA 2E5JA 2VUGA 2KHDA 2JC0A 4K4XA 2YQ1A 1FT7A 1EKRA 3EY5A 1KLMA 4AE5A 2X3DA 2E5LF 1V0CA 1KUXA 1HHSA 4XK8C 1WC1A 1ELLP 5MAOA 4MHYA 3H2VE 4ZS6A 3PG9A 2CF4A 1OYDA 2XMJA 3THTA 3FZ2A 3GYGA 2Q1LA 4AG7A 2MQ8A 2C2ZB 2WZNA 4PKDB 1TKJA 4RUCA 3B3VA 3TP2A 2DHHA 4MKBA 4R5PB 4ZHRA 3VALA 1JNRB 2YNGA 1MN9A 4CLYA 4TU9A 2KJVA 2V69A 4RL1A 1YVFA 5H9FK 4A94A 3PFOA 1JLCA 1TL1B 2OD6A 3QATA 5IM0A 3FK4A 3OR1B 4NWBA 2ABYA 3W62A 2BANA 4G6VB 1RHQB 1D9FA 2CADA 4HVZA 2WB1D 2J9DE 4ED6A 2L9WA 4DI6A 3OHBA 3OSPA 1HNWF 5KFKA 3WZ0A 2Y1IA 4CRJA 3BR9A 3GY9A 4I2QB 3HHKA 1TUGB 1TL7A 2WOMA 1IKWB 4ECTA 1GYTA 3LGNA 4J3GA 3Q0AA 1KVIA 3MMCB 1S0OA 2XMMA 1SQGA 1FF2A 4USIA 1LFPA 3NGKA 4OYAA 3OJSA 4YEAA 4Y2MA 3I96A 4X65F 1SPBP 1TF8A 1DARA 3E51A 1ZG7A 4HI1A 1M44A 1E6VB 2HNDA 4AT1B 2XHCA 3TZXA 1ZM9A 5HROB 4DSIA 4MJKA 1F3FA 2YNDA 1MU2A 2FHJA 1HHQA 1HWUA 3QGGA 2BDPA 1NMEB 4U95A 4MFQA 1ZAWA 1RUSA 2HAFA 1FJGF 1NXIA 2AKWB 4X62F 1AUSL 4CDIA 1S7HA 2P6GA 3D2WA 3DOLB 4MCQA 4MY0A 4FVMA 5JJBA 3OXGA 3KNGA 3T19A 2VPWB 1XE4A 1FDDA 2MQOA 3C19A 1YMEA 1PCAA 1J4JA 4TYAA 5KFRA 1Y10A 2XHWA 1X31C 3G82B 4J9OA 4RWWA 3BBBA 5DM7Q 5IFMA 3HT0A 4QR1A 2ZPAA 1SCJB 3H20A 2ZUGA 1N34F 1VLYA 1OPZA 4DQIA 2ZBRA 6CPAA 2R3VA 1M1DA 4JI2J 2PJ6A 4CLWA 1UEUA 4XTTA 3CJSA 2IIHA 1S6PB 3MUMP 4B5PB 3UDCA 2DH9A 3QPIA 2DHGA 3DRYA 3TOQA 2NSCA 3B54A 5DG8A 2NXNA 1UFHA 2P6SA 2Y1RI 1NPPA 3OQ2A 3D67A 3MUVP 2WZ1A 2GJ2A 1RCOB 2WTFA 3Q86A 3AOBA 3C26A 3V5RA 3ILLA 3R9GA 4Z37A 4WFXA 4JWPA 1NJXA 8AT1B 2MQLA 1T9XA 4ECVA 1YDLA 2VZZA 1YJWS 4M6HA 1QE1B 3B8GA 4OMEA 2WONA 5KG5A 3PO5A 5HJXA 1OY6A 4LF6F 1SVDA 5GAEI 3TAQA 2R8JA 5EBVA 5I0CA 4F4AA 2V0NA 1DTTA 3U02A 4H4KC 4RW8A 4GKKJ 3OUYB 2FJVA 2GW8A 1EZZB 5JUMA 2OH2A 1YQEA 5F0UA 5H9EK 1UVMA 2C6CA 1VRUB 2QN6B 2V2QA 3NS5A 1FX4A 5A6WA 4JV5J 2JEFA 4NGNA 4K2XA 2FVCA 4GVBA 2XMAA 3FCVA 3F5BA 3MCOA 1T3OA 5H9EJ 2Y8YA 2FS5A 1DY3A 2XQCA 2YNCC 5AE1A 1WACA 2AD9A 4UCNA 2RRNA 1GTHA 1H2VZ 3HK2A 5B0BA 9RUBA 4H6ZA 3H5SA 2RU3A 1NDLA 1B70B 2MJNA 4LIWA 4S0MA 1K47A 2ZH6A 2ZW7A 3D6FB 3W2WA 3DXSX 4X8IA 3L2NA 1Q0NA 4CLFA 5I42B 5HBMA 4NLUA 1CULA 4JI0J 4EU0A 4QVTA 4DV7J 4H4MA 2JHEA 4QJVA 4F3OA 3ILOA 3BO2A 5GMEA 5IB9A 1O6XA 1YJ9S 2XZDB 1IBMF 5F41A 2C28A 1PJ7A 3FXTA 3NRBA 3LODA 2FGCA 1GH8A 3DSBA 4JYWA 3PXGa 4W4MA 3IRXB 4RN7A 3J81j 3PR4A 1DBDA 3DRPB 1CJVA 4DPXA 3CCLS 5LMNF 3WC5A 2A3JA 1H0HB 3N6MA 4OV6A 4CO2A 3NLCA 4WKYA 3NGRA 5ETQA 4U8VA 2IYGA 4E0DA 3PJ9A 4DX6A 1TFWA 2DGTA 3CMQA 2MKKA 2MKJA 4ID8A 5EWEA 5KFJA 4PYDA 4CTAA 2W8KA 2DGQA 1AFIA 3VVUA 1RT7B 1A0OB 2PJ9A 4QCLA 3EGNA 4UY85 2E9ZA 3DC2A 5KOXA 4ZPDA 2VICA 3GU0A 2XZTB 2YPZA 2KN4A 3QLHA 2EG1A 3CC2S 3PW2A 1CQNA 1PKUA 5A0YB 5AXKA 1YKWA 1LXJA 4CLUA 4A39A 2QLBB 4P2MA 2AU0A 4B3MJ 2UU9F 3HVWA 4KZTA 1WG1A 4X84A 3KUEA 1PYOB 4EYIB 1CJTA 1N71A 5A2QY 4RS2A 2Z2MA 1TK5A 2ZVIA 3GG1A 3U1NA 2E7VA 5J1EB 3HVRA 2ZEPA 3ZZIA 2QO3A 4X64J 1NSPA 3P8BB 5BXIA 5G0RA 4MYTA 3B7IA 1VRTA 4LJMA 1C0TB 4M6GA 1SIZA 3T1HF 1Q5YA 3LAMA 5AG6A 1MW7A 4M1KA 5EWGA 3CW2C 5C42B 1RTZA 3MEDB 3K57A 3SHPA 3P5TL 1JLQB 3N4WA 3ZTSA 2K1RA 1NK8A 1TVRA 4TVAB 3SJGA 2RUGA 4UQGA 5KFVA 3I9ZA 3NNCA 3A3NB 3PX4A 2M8DB 2RSQA 1H7WA 1EQMA 2BRLA 2LA4A 4BWMA 1VCTA 5KFLA 5A8WA 1AZSA 5E2QA 5I3UB 3B78A 4OP4A 4FF1A 3UVJA 3PW4A 4Q0BA 3THVA 2YBVA 4TN2A 2YWEA 2YH0A 1R8BA 4CLPA 4ES1A 2RUSA 4H4KA 4Y2KA 3QIPA 3LGHA 2EK1A 3HSGA 2UV8A 1LKZA 2FJDB 4JV1A 3THPA 2RQKA 5FDLB 2HVZA 5D78A 3C16B 1KVKA 3Q8RB 4CRZB 3C8YA 3M9NB 2VD3A 2QV6A 1NPKA 1IUJA 1X9MA 3C14A 4M5JA 5FJ4A 1HWIA 2ZFHA 3FCWA 4YB6A 2D74B 1YG0A 3GTYX 2RC4A 4ECQA 3NL0A 2ZH2A 3TX8A 2OGUA 1JJCB 1GXUA 2H51B 2I38A 1TQLA 4DV3F 5K8NA 3Q22A 5DG9A 3U1MA 1JKHA 4RBTA 2FYXA 1RWPB 2W2NP 2R8VA 2Z3LA 3V6HA 2PR8A 1LWEB 4JI8F 2HGMA 5CD4A 3T1AA 2R2SA 2HFVA 1YZ6A 3KUHA 4AYBD 1GK8A 1P1TA 2J76E 3A1YG 4AFFA 3TARA 1QAXA 4B9NA 5E96A 1TP7A 4RNHA 2DXFA 4U7UD 3S6EA 3VGTA 3R3TA 4K4TA 1F57A 1RU1A 3DLKB 2NLWA 3QT8A 4KHMA 3GZ7A 4TY9A 3MPWA 1U6MA 4AVBA 2KFZA 4F4YA 3WHIA 1XJOA 1R6YA 1XFOA 4OAEA 4YHHJ 4OYXA 3TVKA 5GCNA 3MM8A 1U0HB 1FT8A 3ISXA 1YZ7A 4CAXA 3V81A 3CIMA 3RG6A 3RW7A 3G6VA 3QZ8A 1N33F 5DETA 4NCAA 1U1OA 1RWWB 2K8GA 3HHLD 2OAUA 4ECZA 3CF5Q 2DITA 4RJVA 3UWTA 1IKYB 1U1QA 4TXSA 2I0XA 2VBWA 2GMHA 3RAXA 3T1YJ 3NAHA 1NU4A 1T9WA 1RA7A 2CNKB 1C1CB 1CJWA 2AYMA 3SQGB 3W9JA 2QMWA 2Z2YB 2I1RA 1WDTA 3MAQA 2CTCA 2BJ7A 1VC6A 3FFIB 3FNCA 1Q16B 5B0AA 3M2VB 3SV3A 3RBDA 1S99A 3CVKA 3QAYA 1S6QB 2HPUA 3E0KA 1WNEA 2XS7A 4L3KA 3PP9A 2O5DA 2UUTA 4NYOA 1QUPA 2O66A 2WRMA 4LF1A 2AT1B 2KG0A 4ZVQB 2C2RA 2WSEC 4ZY0A 4FZVA 4UUXA 2C3PA 1ZM2A 4FBUA 5J2QB 4DFMA 5GAGU 2PJ3A 4R5PA 3RYOA 4XNHB 2BOPA 5KAKA 4UEZA 3BKFA 1KN6A 1CPSA 4GO5X 2D3ZA 4J37A 4KUAA 1YBAA 3OR1A 2G3TA 3ZFVA 2IBOA 2O28A 1WKLA 1SB6A 1WWZA 1JLEB 2HEKA 4M5NA 1U47A 5F3ZA 1T0TV 3ISZA 3TO7A 1NJYA 1HNZJ 4EUVA 3CXPA 1TU0B 3D4UA 1Y11A 4I2QA 1IKWA 4OYIA 1X4HA 2B4DB 4IG0B 4DZ6A 3W91A 4JI5J 1Y7RA 3FYNA 3NEKA 4NLOA 3QAUA 4H4OB 2VZ9A 4DLEA 2YY3A 3VAKA 2BJ8A 1W25A 1W2IA 1ZETA 4M8LA 4HNWB 1WG5A 3B3SA 1KTQA 3KLFB 1NO8A 4M95A 2B51A 1NCLA 1KSPA 3IM8A 4OZJA 2R7QA 2BL1A 1MWQA 1N54B 2KM8C 2RFHA 3A8KA 4FXWA 3IC1A 4WKRA 1TKZB 4CAWA 3SYZA 2RT3A 2CFXA 3BGRA 1YJUA 1P6TA 4PG5A 4RU9A 3K5NA 1UPPA 2NREA 3D6MB 3CIZA 4RW4B 2QIFA 4YWYA 2CJAA 3DOLA 2JNJA 3UN3A 2IBKA 3EFAA 4MXUA 2BKNA 2ROGA 4DS4A 4PV6A 4A2ZA 4HNXB 3S9NA 2QA1A 3G82A 5KG7A 3PEIA 3TJ8A 1WC5A 2K06A 1MLAA 4LQ6A 4N76A 2YH1A 3S9LA 2E44A 1BO4A 2R8GA 1S1XB 3RUBL 5L1JA 2MDAA 1Q7YT 3T9ZA 2RQMA 1KC8T 5FIIA 2JEJA 2ZEOA 1S6PA 5CQGA 1SQFA 4DSKA 1FHTA 1M5SA 2JEGA 2V94A 5HVHA 2AEJA 3VWEA 1TF9A 4KUBA 2CDQA 1X5SA 3KG0A 4DL5A 4E2AA 1YW4A 4ED7A 2C2EA 4DL7A 3HVTB 2CJYB 2FY8A 2CUYA 3UI3A 4YUDA 4IG3B 4O44A 1H3DA 3BXMA 5KTDA 4A33A 3MM7B 4LFAJ 4ZPTR 4Y28C 2A4NA 3K8WA 3RBZA 5A28A 4W92B 2PA3A 1QE1A 1J27A 5IC6B 3B3CA 4JXRA 2D1CA 2CWXA 1L3VA 3P49B 1SV5A 1TL4A 2DY1A 3LA0A 3OUYA 2R7UA 2A0FB 2PC6A 2GVZB 4P75A 4OHYA 4DUZF 1HQUA 3JAMY 1VRUA 2HVIA 2B7BB 5E7OB 4JI4F 2DR9A 3QWPA 1ARMA 4O3SA 3F44A 3BN7A 2RMLA 3OTCA 3J7AN 1SBRA 3DLJA 3JQJA 4MCSA 1C1BB 2IHR1 3OSNA 2VH7A 3JSMB 1XEBA 4K5RA 3W9IA 4ZVHA 2DYAA 2OD4A 4A8SA 3OFHA 1O0PA 1FRHA 1YJRA 2JDCA 2FZGB 3K59A 4H89A 4PQUB 2DISA 1IU8A 4OX9J 2LVWA 2PT0A 1OY8A 2N3OA 1TAQA 3CB4A 2QLJB 4RNNA 1UWAA 4ITSA 4K50A 4P6YA 2YNEA 2C22A 2FD2A 2FLOA 4IDKA 2HZVA 4OI2A 1WKKA 4OJHA 1FDBA 1LFWA 2Z3NA 4P45A 1IIDA 3NE7A 1G6BA 3F73A 1S9GB 4PK2A 4DEZA 3HP6A 5KT7A 1XNRF 2OO4A 4K4WA 3IRXA 3MTKA 4UTGA 4IFVB 2LQBA 3IG1A 1S76D 3DRPA 1RT2B 1BAVA 2QYGA 2F5GA 1M5VC 1QTMA 1FRMA 2PRQA 2CA9A 1NK9A 1EE3P 4OYOA 3FB3A 2WUUA 1XERA 2BVZA 4L3NA 4CYUB 1TKXB 2JEIA 1VYAA 3CDUA 4C8KA 4DV2J 2XMVA 4U9YA 1RTIB 4CO4A 4YY3F 2V5HG 3AFGA 1X4AA 4Q38A 3UD4P 1LAMA 2D4PA 2C2KB 3E8OA 1DTQB 3EZ5A 2G9OA 4RLEA 3S01A 1IBKF 2L08A 4OLPA 5HMZA 1RT7A 1S48A 5AE2A 3PRBA 2XEXA 2HHWA 2HQYA 4MI4A 1KDNA 2DR5A 2GCFA 3I1UA 5DDOC 3OT9A 2VPYB 4U7CA 4BBYA 2LQ5A 9ATCB 2DNLA 2BRKA 2DXQA 3L95X 1JQGA 4XO0A 3EZOA 1WEZA 3MPDA 2ZW6A 5C5JA 2X1GA 4C0HA 3CJ0A 1D1UA 4WWSA 3AA8A 2HHUA 3AQOA 3D54A 2NSBA 3TUZC 5J1EA 3WC7A 5AXLA 1Z4EA 3T90A 1HARA 4QIGA 2M88A 2KVIA 4RX6A 2XMUA 1AA1B 4KJIA 4EGLA 2OOTA 2WW4A 2MMYA 1K8AT 1S4FA 4AL6A 2X1AA 1FKAF 2FTRA 1RKIA 2X51A 2G1DA 2AGOA 5JPHA 1RABB 3HHDA 5C42A 1D8ZA 3MEDA 2IRUA 2XTJP 4IRCA 3AODA 2DR8A 3A12A 4DR3F 3GV8B 1X4FA 1QD1A 4B13A 1X5TA 4FKYA 4C11B 5DWNA 1UPMB 3GMGA 1RAAB 3G2XA 4KHPJ 2DNKA 2XLKA 5LSLA 3CE8A 1MJ9A 1HL6A 3N9UC 5AE3A 2DBBA 2FHJD 4ONWA 4P4JA 5I3UA 5JGFA 3UCGA 3DU6A 1RTDB 4R9MA 3BHXA 3OR2B 3TVZA 1RWMB 2CPDA 1RACB 1A9NB 4CO1A 1Z9UA 2FJWA 3TA1A 3QBCA 2R2TA 4ZVTB 1NK5A 3DHXA 2AJ1A 3GYNA 5B0FA 5SZTA 3AA9A 3MEGB 2UXCJ 2Q79A 1XMQJ 3KGQA 4U5YA 5HMYA 1V5IB 4NLYA 5LOQA 5FDLA 2IDLA 2Y1JA 3C16A 4M63A 4U8YA 2JDJA 2NR0A 4YOEA 1DE4C 5DJBA 2HQDA 4GKKF 1P4NA 1XNQJ 4CAFA 1DQ8A 2GO8A 3KWMA 2HVHA 3CEDA 5KFFA 3NNHA 2XGQA 2XMTA 1B87A 1EB0A 2OEMA 5CZVA 1ZS6A 1L3KA 2QA4S 3C6TB 5B7WA 3ISND 1FCAA 2XO7A 1LWEA 4B3OB 3KJFB 4HEA9 2UZAA 3R1LA 2IM3A 4AD6A 2DNYA 3BGFA 3Q23A 4B12A 3GUXA 4ZK7M 1V3ZA 3QZ7A 4WP8A 3R5JB 3T41A 4ZIWA 3M6XA 4CGLA 4ECSA 1YHQS 1X60A 3HDSA 1GMWD 5GAGI 5KFEA 2CNLB 1WELA 4NLSA 3UDEA 1DQAA 1KFSA 3DLKA 1DURA 1B0PA 4PG4A 1SQHA 1PAEX 2B7CB 2MPUA 2ZW4A 1EJ7L 5A8KB 1XBUA 2KM8B 1PO6A 2C1CA 1NAQA 1IKXB 2U2FA 2UVVA 2ACMA 2DNNA 1NDKA 2PDOA 4DV7F 4X4PA 1Y0HA 4NI2A 4JOUA 2GIQA 1PILA 5L1LA 1ZLIA 4QPTA 5G1ZA 2RD5C 4TU7A 4NX9A 1HNVB 3UR0A 2CXAA 3PV8A 3V7ZA 4ZVGA 4NLTA 2PSZA 3SXOA 1TMJA 3RB0A 1IKYA 2LMIA 2BMBA 3TEHB 2D9PA 2XM3A 4DQSA 1H98A 1RYSA 3CCMS 1REVB 3LP0B 2VB6A 4CGMA 1RAHB 5BJRA 2CG8A 3PHEA 4WK3A 2FIUA 2FVPA 2PJ4A 2P9CA 3SQGA 4Z65A 1MWYA 2MHEA 5JH9A 2VFTA 2VKZG 4FYYB 2UXDJ 3JYTB 3FQKA 3FFIA 2Z2LA 4AXJA 1GX6A 3I56S 3Q8SB 2FQQB 5HL7Q 1N0VC 3Q89A 5AJ3J 2NYIA 1S6QA 2E5HA 4AXVA 2HHTA 1CPZA 4K5SA 2GIVA 3SZ2A 3G9CA 2BOAA 4OC2A 1VLOA 3LQVA 4E8OA 4ZX9A 4PUOB 2B4OA 1XJWB 4DOZA 1SL0A 5KOWA 2BSWA 1C4CA 3EUNA 1YWXA 1S1VB 4YR3A 1R8PA 3BSCA 5D4NA 3FX6A 4FD7A 4KC5A 1VJWA 5IQQA 4OZ0A 4JBCA 3JTKA 2V63A 3CUNA 3WC6A 2XZWA 3SDEB 4X64F 3UY5A 4M3SA 3IR6B 1IKVB 3K5OA 2IM2A 4DCPB 4EBEA 3TZWA 2HGLA 3IGNA 1F5CA 1JLEA 2DNHA 3UNGC 3RB4A 2NS1B 4C2YA 3P3DA 4ZP7A 3HJVA 1NPRA 2ZH1A 5ETKA 4X65J 2REEA 1BD6A 3LH2S 1SC6A 1NSLA 1EETB 3MURP 1FX2A 4IQXA 1JXEA 2B4DA 3M6VA 2FB0A 1HWKA 4K59A 1RZMA 4H4OA 2HNZB 2HHHF 5HSPA 3EXYA 4O0NA 3NY0A 3BB5A 1N5QA 1S59A 2BX6A 2QL7B 4FP9A 1RISA 2N7YA 3KLFA 4BCAA 3IS9B 2DPJA 3PB9X 4H6UA 4ECUA 1FJGJ 4DQRA 2A2DA 4KOWA 4LRBA 1H38A 3LWMA 5A8RA 4O23A 3GFXA 2ILYA 3D0GE 4DNCA 2VC1A 1TKZA 2UUBJ 4ED0A 4XPDB 1RWVB 4MFLA 1ELMP 2ATCB 4IR1A 2DNPA 1E6YB 5L9XA 5HMWA 3MMJA 2GIRA 1KOHA 1SC3B 3DR6A 4F4ZA 3CTRA 4R25A 4CCHA 2J9CA 4FS1A 3QNVA 3PB6X 4OYWA 1JLFB 2W25A 5CPAA 1CM0A 2GVDB 4A8KA 4LFCJ 1PJ5A 3MTJA 5G4DA 3T9NA 2GMJA 1SKRA 1KLNA 1MG7A 4BDPA 1J5OB 5L1KA 3J7ZT 2OLWA 2H5IB 1R8HA 4OV1A 2OKQA 3D7SB 1LOUA 4RW7B 4DR5F 3QFWA 1WHWA 2CNMA 4GKJF 3D4JA 4X4NA 5KFXA 1VQ9S 1OSDA 1KQGB 3D66A 4B17A 1CEZA 3TRGA 4P2XA 5D4PA 5KFCA 2HFSA 2I00A 1BQNB 4ETZA 3IGVA 2I3CA 1YI2S 1WHXA 3HX9A 1FWPA 5LRGA 3KHRA 4I6WA 2EK6A 2OFGX 4C98A 4Y2CA 2RDJA 3ZTOA 3B6BA 2ODFA 3SJFA 4KR0B 3RZAA 2CJKA 3J80Y 2FLPA 4C4WA 4WP9A 4ECXA 2EBJA 3VQSA 4ZVOB 3FIXA 3R9LA 3EPGA 3MF5A 2DEJA 1N5YB 2XNRA 3ZZTA 3KK3B 3GV5B 3HSDA 3HVTA 3MDFA 2GQ2A 3NE8A 2D3UA 4QWDA 3NP5A 4EMEA 2V50A 2MB0B 4DPUA 3WC0A 2WYRA 3T5KA 2DRBA 4C3MA 2AW0A 5HXDA 1S1UB 1P8GA 2ACYA 3F56A 1X0FA 4YHHF 1M1KT 1BHNA 1VKCA 2JC1A 4Z7YA 2HLTA 1I1DA 3TNVA 2DH8A 3KK2B 4R87A 2JEWA 5LL6d 2AYEA 4IRKA 4NGMA 5D15A 3MCMA 4MFKA 4L8AA 2HRUA 2GVZA 3FSXA 2EW9A 3OFGA 3CNQP 4NXYA 2YWFA 5GMKa 1FNMA 5J2PB 4E8UA 1GXTA 4PRFA 4MFBB 8CPAA 4ZPBA 4HPSA 1NRKA 3HXMA 2LFVA 3VQTA 2GLFA 1C1BA 2K7KA 5K20B 3G96A 3HFKA 3JSMA 2B9WA 3RTVA 2BJ3A 4KOTA 5BR8F 1GAOA 5DM6Q 3S6HA 4N5SA 2W2PP 3R7BB 1OQ3A 3ZJ0A 3MD3A 1SJRA 1NKBA 4NFRA 2R8HA 4PQUA 1HR0J 2GAHC 2FVSA 3I31A 4ILMA 4B9UA 2HK2A 3QRPA 4O4GB 3R6LB 4A31A 3PIPQ 3M8WA 4BC9A 4LR7A 1T3NA 3B3WA 2F9JA 1HQEB 3K5MA 2M52A 3ELHA 2NYHA 1CG2A 1UW4A 1YBUA 4JXQA 2BUEA 5HLFB 1GT8A 5JQ4A 4C97A 2J9EA 1DHMA 2GIFA 4ZN1A 3L3CA 4ZA1A 2DNOA 2DO0A 3CJ5A 2PEHA 1IOFA 1FKOB 1XIQA 2IVYA 3L9ZA 2ZXVA 3Q8UA 4HACB 2IJNA 2RJZA 1LWCB 1S9GA 2PMHA 2CZ4A 1IXKA 4NJQA 1Z4RA 3Q2SC 4AUKA 4XDCA 2RIJA 4JB8B 4DV1J 3QT7A 1F5BA 1RT2A 2V8PA 4KVOE 1HDUA 1F9EB 4Q8EA 2E1PA 3ADAC 2HYIB 2X7IA 4KO0B 1WKJA 1HNZF 4FF3A 1FK9B 3VCDA 4CYUA 3MECB 1TKXA 1R57A 2KYXA 3EZUA 1RTIA 2GQCA 4F4WA 1R0CB 2PJCA 3FH4A 2P9EA 2ZDOA 3O8WA 4PABA 2O53A 2M0GB 3GIKA 1TAUA 1DTQA 4GVLA 1YGYA 4XPKA 1DLOB 3DGVA 3KDNA 2DXDA 5KTCA 3PFEA 1Y0YA 1T03B 4KVXA 2HRTA 3RYLA 2HNYA 1CPXA 4MBUA 2PA8D 2PJ5A 3Q8YA 4RW9A 2H5MA 1F2OA 4XPEA 2B8QA 5J2MB 1FJ7A 4MFPA 4A8XA 1VHFA 4KOVA 2XYPB 1IWGA 2PJ2A 2M4MA 3ZNUA 3FBBA 1FFGB 3A8IA 1H2UX 1CSJA 2R7WA 3BM7A 3T1HJ 5HANA 1WOSA 1OSCA 1YBTA 4AB7A 4LSNA 2DR7A 1UEKA 4IH6A 4P4IA 3BGUA 3BI0A 1MK4A 2L3MA 2B9YA 2OTJS 4QQBA 4CWBA 1IGBA 4ILLA 2VJVA 5ELYA 4RZRA 4NRUA 4LQGA 4P7TA 4PWDB 3Q83A 1JXVA 4DS5A 2VG5B 1CP7A 2APOA 2C3MA 5KFDA 1RU2A 2V8HA 4P7VA 5AGEA 4YB1P 1BQMA 2F3JA 2HWIA 2V77A 4BWJA 3CCQS 1H7XA 2KTQA 2J0QD 1RLDA 3M2RB 3H5YA 4FF4A 1XWLA 2REFA 5CZXA 3W61A 4A8OA 4KQZA 4C11A 1Q7LB 1P1LA 4NA3A 2OELA 3MM6B 1WF0A 3D2MA 5ADZA 3MR7A 3W5XA 4ZGYB 2RQ4A 2W2OP 4J90A 1RHJB 2XY7A 4UA3A 4P52A 5GAHI 1LV5A 3CGIA 3UFCX 5HMNA 3UO0A 1RTDA 4ORFA 4LVOP 4Y00A 3OR2A 1AT1B 3RBEA 1RTQA 3DLGB 4OKOA 3R6GB 3H40A 2B43A 2H65B 4IHMA 4OI3A 2CZVC 1OMSA 2W4PA 3I3GA 3T3FA 3TUJC 2MQMA 4WF9Q 2LDYA 7CPAA 3MEGA 3CPWR 3I5AA 1WI8A 3MR5A 2FC9A 3GPAA 4LFAF 2KXHA 2EKYA 3I87A 2EO8A 4J9LA 4OYPA 4A46A 5LRJA 4MH8A 5E3QA 1S7FA 3KDOA 2LCWA 4HTJA 3EXCX 2QGFB 4EYHB 1AUDA 5HVFA 1XIXA 2MHNA 3FNNA 4F0KA 1FEHA 1KQSR 5D77A 1ITPA 2QLXA 2XWYA 1UMJA 4RO0A 4EI2A 2XEIA 1ZA2B 4DV5J 5CYJA 3S6FA 1FRXA 4ZLLA 3K2KA 3PW7A 3TW0A 4X4VA 4ID5A 2YQ3A 1RWXB 4A8YA 2PGCA 2JZ5A 2ZM6F 3QNWB 5KTAA 1U8WA 1SH0A 5K8OA 2PRBA 4UFVA 3HHEA 1BXNA 1UW9A 2YNHB 2PEBA 3C6TA 1BLUA 3D28A 4B3OA 2BV3A 2VEZA 4NEYA 1KONA 2YNIB 2EBGA 1S60A 1OY9A 3BLNA 3NFZA 4WIQA 3SSQA 3PIOQ 3D6HB 2ERRA 1VBYA 1LQ9A 3M1VB 2KI2A 2JLEA 1ZPWX 4KBIA 1KP6A 2XY6A 5IT9U 1NK7A 4UZCA 4OIXA 4ANCA 4OX9F 3IAM9 2R98A 4DL3A 1X9WA 1UFKA 1N33J 3AXMA 3HO1A 1ZYQA 3NWRA 3G87A 1IKXA 1IQZA 3QGHA 2C27A 2OH1A 4TKTA 2DCLA 2RE1A 4KT0C 4HTIA 4V19J 1BOBA 1PSDA 5GAEU 3O6QA 2V34A 2M7SA 1HNVA 4LF9J 5E3RA 1EKSA 3S7RA 2IC3B 4LT6A 1DZ5A 2JBJA 1QUVA 4F8ZA 5HP1B 3UD3P 1RA6A 3IP0A 4IO1A 5IV0A 3QAEA 1REVA 2LU1A 3LAKA 4P71A 3JUWA 4LVNP 2ALZA 4I2PB 4TNUA 4QWEA 4GC7A 4GM5A 1Z1ZA 3DLEA 5KFAA 2BEFA 3AOCA 4DV2F 3M32B 2OFHX 1SKWA 4U9ZA 3EWGA 3JYTA 2CZ9A 3TAMB 3CJ4A 4CP5A 4A8MP 1NMTA 3D9BA 5HJYA 1N8RT 3P4UB 3B4MA 4WJBA 4B5OA 2BQ3A 1NH8A 1QY7A 2AGPA 2WCXA 2RNEA 4PUOA 1FA0A 3SCKE 1K1SA 5LJ3Y 1TKHA 1PJ6A 1OS5A 2C3OA 3O5TB 1LAPA 2VL1A 2HGNA 1S1VA 1RT4B 1IYLA 2LQ8A 2CYYA 1TKTB 1Y4ZB 2OMLA 5KFIA 3TEGA 5T7LB 4EFAC 1GHEA 4ZPCA 2ASDA 4XDDA 3F0AA 5I4MA 3SDEA 5HMXA 2ZWOA 1RAJA 1WC3A 1CJUA 5FLXY 2E7WA 3BPSP 1Q8BA 1IKVA 2DPSA 3CCZA 5K9FA 1VIXA 4ED2A 4OC4A 3AOAA 3L7OA 4K3NA 3L7UA 4B9MA 3M4XA 3H8GA 1S57A 3EGWB 5CYMA 2C6GA 1X4EA 4M5MA 3CO0P 4X4SA 2DB1A 3O2IA 1EETA 4FUUA 3T6BA 1SI9A 3VGVA 3HHLB 1R8CA 5HQLA 4DFJA 3B3TA 2RAQA 3KASA 4HYKA 4I67A 3EXNA 2HNZA 3TA2A 4LR9A 1NSKL 4ER8A 3D0IE 4PR6A 4KHPF 4QIWD 4KE5A 2KDOA 2DF5A 3FEXB 4MRIA 2C42A 3G6ES 1R27B 3NG8A 2EFQA 4ZLNA 3IS9A 1RTJB 5J8CA 1FD2A 3CJKB 2RH3A 4UFWA 4YGOA 4WE1B 4CLKA 2MJUA 3AD9C 2WW8A 1WG4A 4DFPA 2XCPA 1WTBA 1X5OA 2CQ1A 2W9BB 4B3TJ 5IT9Y 2ZH5A 3CJTA 2PVWA 3IFEA 3KHHA 5T41A 2F63A 1TL5A 1XMQF 2R2RA 5M2UA 1M5KC 3GR1A 4USKA 1U1PA 2ZDPA 1SKUB 1JLFA 1VQ8S 2IAJA 2GVDA 2IMOA 2ZW5A 3PJWA 3SI0A 5B0CA 4F2SA 1MN7A 4OI4A 1J5OA 3H90A 2VG6B 1REGX 2ZBCA 1HNXJ 2DKOB 1XNQF 3VHQA 2HG4A 1YK3A 1RP5A 5IS2A 2GREA 1RTHB 4RW6B 4WTOB 3HM9A 1BQNA 3D0HE 3LP2B 6AT1B 3IWLA 2HFUA 2C2DA 4RUHA 2HIQA 3I5CA 1ZPVA 2JLMA 1UFLA 2KHCA 2QMUB 2QLFB 2DY9A 3UCZP 1LRZA 4OHXA 5KT2A 4OC1A 2B3UA 1Y3KA 2GMLA 4OJ1A 2M9KA 4CH7A 1SIWB 1DQ9A 2X7BA 3H25A 2Q6BA 1KEKA 2ZITA 3GIJA 3TZYA 5KG6A 5JVHQ 3KK3A 2CQCA 5DS7A 1J5EF 3R2DJ 2HS3A 2HAIA 4LRDA 3PRTA 2W9CA 2CJXB 3MXHP 3TJ9A 4FBEA 5K5MA 1VQYA 1WI6A 4CYQA 1ZAVA 1R7IA 3ZXWA 3OLAA 2K7JA 1JLBB 3KNAA 1QSRA 4ZPWR 2VBQA 1PYSB 4URQU 2J8NA 4QYRA 1JXLA 2PE3A 2YKQA 2I2YA 1WWHA 3D68A 2HURA 3QYYA 4TU8A 3WT4A 5KT6A 1N4LA 4MKAA 5DLGA 1X4DA 4MFBA 1Q5VA 3N79A 1KD1T 1HYSB 2HQGA 4DX7A 2JLFA 2YVSA 3MPVA 4U6PA 2B5JB 2ZNZA 2J8SA 4C8NA 2GC8A 3W66A 5IV4A 3WR7A 1K73T 2UXDF 1U1MA 2PO4A 2ZHAA 3BGOP 3BYRA 2Z58B 5DQHA 4WBFA 5AJ3F 4O4GA 2MGZA 1EARA 2CJQA 1FJCA 1RE1B 4B3SF 3DLBA 2WPWA 1HQEA 3TVYA 2DR6A 2W1BA 4UWJA 4CT8A 3V6JA 2LEPA 4DSFA 4R8UB 4UT4A 5HLFA 5E0OA 1ZOTA 2QFIA 1UJ5A 1VFJA 1W2BR 4DG1A 1XNRJ 4R0EA 1XR7A 4M94A 3HJFA 1FKOA 2DHSA 2HS0A 1K9MT 3FSYA 2RRBA 4B6ZA 1HA1A 4BLGA 2DEIA 1CS4B 2EXUA 3IO1A 4QYZJ 1BQXA 2W7PA 4TLQA 3WQPA 4Y49C 1LWCA 1UCNA 3CPXA 2IM1A 2BJ9A 2VBXA 1Y3JA 3Q8QB 2QMXA 2YKPA 2W7OA 4DJLA 1SXLA 3HZGA 3N01A 4JUZA 4YY3J 4Z2XA 3WDOA 3BGLA 1JB0C 3FRZA 3QSIA 1DFDA 2WSAA 5K14B 4NLVA 1B0VA 4KO0A 2KXFA 4ZBGA 1IBKJ 4FD6A 1X5PA 1KQFB 3Q24A 3DI6B 1FK9A 5D3GB 1VQ5S 3MECA 3SQOP 3W5ZA 4A32A 2A6MA 2A2CA 2PI5A 4PXBA 3I6PA 4QC6A 4MKVA 1XF8A 3SXLA 4CM0A 1KOOA 3RRHA 2PR1A 4F9VA 3K9UA 4F50A 1BWEA 2HQFA 5A6PA 4NGTA 1M5OC 2ZH7A 4NXNJ 1YITS 3N0VA 4B10A 2DIUA 5J2MA 3BJYA 3CCWA 2V9WA 2OZUA 3IAS9 3HD2A 4CO3A 3K8VA 3LANA 1I51B 1N56A 2PI4A 3J81U 5IWAF 3W7BA 2UUBF 2EFOA 1R89A 3S9MA 2J7KA 1NK6A 5BYRA 4DR7J 3BF4A 5DDQC 4YB5A 5DS0A 4NL5A 2QT7A 3PRVA 1U2FA 1FWLA 2CJBA 3KMQA 1XMBA 1EAYC 3RR8A 1MROA 4LFCF 2ZEEA 4DR3J 1CX8A 4A38A 1VS3A 5EX3A 3PKYA 4PWDA 2CQDA 4OHWA 5KFYA 4NOHA 4EFDA 1G3OA 2DGWA 3TWZA 1T8EA 3MEEB 4ALZA 3NKYA 2KT3A 1VQPS 4DR1J 1WD6A 1PBAA 1Q7LA 1CJKB 5C82A 2R1IA 2ZOFA 1SC4B 3OL9A 3PDNA 2ATLA 1L3SA 2OPPB 3KHLA 5DZ7A 2HHXA 3MCNA 5J2NB 2H1YA 2JVRA 3MOZA 3QGIA 2F5IA 5C7PA 4IH5A 4JV2A 3B4DA 4X4TA 1T9YA 2KRRA 2EVZA 2JFDA 3MAHA 1T7PA 2WB4A 2JH3A 4ELUA 3NCQA 3DLGA 4QU7A 2DHXA 1K0TA 4FF2A 3KHXA 1VHSA 1YSJA 1BY9A 4NCGB 2M5YA 1F1BB 3UN5A 2AFZA 2XEJA 1WORA 2HWHA 3UQSA 4QZVB 3M8RA 1S9EB 2AIRB 2G0IA 1HNIB 2F8HA 2B56A 2PD1A 3I32A 1YIJS 4I56A 2QL5B 3IWNC 4NEZA 2CVIA 5DGAA 3U1LA 3R96A 2X1BA 2KT5A 3DNSA 2EC0A 2Y9HA 2C2MB 4BS2A 1GMUA 2IJFA 3EICA 3T9YA 4E98A 2HBRB 1ARLA 3A4TA 4J9RA 3G4SS 4V19X 2GZOA 3B82A 1KRPA 2BANB 4I68A 3VVTA 3KUGA 3KK1B 2YNHA 2XS2A 1UVKA 3R95A 4DR4J 2A10A 4R57A 4CYPA 4U96A 5D4OA 2YNIA 2XSFA 3BJ8A 4DPTA 2FUG9 3CCVS 2JOQA 3UNYA 3OTBA 2WOMB 2HQ3A 3DRRA 3M1VA 4OLOA 1RT1B 2IDEA 4QB9A 4L73A 1HR0F 1HWJA 4HH0A 5CCLA 1WF1A 3NOCA 1RT6B 2CPZA 1BWVA 1TKFA 3CC7S 3T6JA 3D7DA 1MMDA 4F0YA 4Q36A 2ZH9A 3H2LA 1FVQA 2YKNB 2R2UA 4ZP9A 2LYVA 2DGXA 1MU2B 4C7HA 4LF7F 3JTOA 2N3LA 3JSYA 1BLLE 1OIAA 2OZGA 2D3OR 3LACA 3POTB 1F2PA 3ET6B 1VBXA 2EFPA 4EZ9A 4R3LA 3ICLA 3FJ2A 4GC6A 4ED1A 4O4RA 2IC3A 3WC2A 5KFTA 2MXYA 2XC9A 5EDWA 4CNZA 5HP1A 4F3QA 2E1AA 2ZBIA 4ECYA 4WP3A 2NXUA 1B6BA 2R42A 2RKIB 2GFFA 1UWBB 3R5GA 3RGIA 3AXKA 4DV1F 3HD1A 3BH7B 3KG1A 5KT4A 3PYDA 1XK8A 4ZITA 5KG2A 2F65A 3M8YA 2RHQB 2JWNA 5DZ6A 2HZAA 3HI9A 2PJ8A 2HFZA 4AQYJ 4R8FA 1D9DA 2ZJQQ 2HBZB 5K8PA 3OVSA 3M32A 1TMMA 3KR4A 3PYFA 4CH1A 2GQQA 1TV6B 2UUWA 4P10A 3AD7C 4OHZA 2E9RX 2G9DA 3OL6A 4CLLA 2QECA 5G20A 3IIBA 2HQCA 4MHZA 2DJWA 4NGSA 2ZH3A 2OJ3A 5L9NA 2AF6A 4WPAA 2ZJRQ 2DNMA 4IH7A 3X3UA 2B4UA 4USTA 1NM2A 4LREA 2MYFA 4X4UA 2Y8WA 2WSCC 2VASA 3VARA 2BM0A 1HPZA 1TZ0A 1V9OA 4PQAA 1FO1A 1WOPA 1NK4A 4OADA 2CPJA 2BQUA 2H4YB 1JLGB 2NYQA 3JVNA 1AW0A 4TYBA 1RT4A 1NLKL 1TKTA 1Y9WA 3V6DB 3QRQA 1UA1A 2VA2A 1FXDA 5DDRC 1NJZA 1GEHA 3HKWA 4QIEA 2OZHA 2VFVA 5D4LA 1RBLA 2DGOA 4C2XA 2WAQD 4WU3A 1X4CA 3I9V9 4PG6A 4QR0A 1R0BG 3D7GA 3F8KA 2R8KA 4IRDA 4RW8B 2HHHJ 4YRHA 3QFHA 1RHUB 1YJTA 2EFVA 4NLXA 3BR8A 1VQSA 4W98A 2FJBB 2XG8A 4M5GA 1XMOJ 2KRBA 1UL3A 4KSFA 5H86A 4MT1A 1IJEB 2CIMA 2KG1A 5E41A 3VV2B 1QVFR 1BMQB 1HI1A 2Z0GA 4FYVB 3W60A 2MZQA 3KLEA 3RAQA 1UAWA 2WSFC 1PC4A 4LFBJ 2PIYA 1RTJA 6FD1A 3MM9B 3CJKA 3TQ1A 5ETNA 2KFYA 4C8OA 3GFYA 1D9AA 4WE1A 4UCMA 2IJZA 3D3SA 4Y65A 4HR2A 4P6QA 3GE9A 2BE7D 3F0NA 3U7JA 2HHQA 4CYNA 1XN9A 1LANA 3IWXA 1KWMA 1IR1A 1TK8A 4CLSA 3FRMA 4DR5J 4F8RA 4GKJJ 4LSLB 5HBMB 2GO9A 4ATNA 2B6AB 3MGDA 1R0AB 3N6LA 1UFWA 4N56A 4C8ZA 1YJVA 4F04B 4H2KA 1RBAA 1ZO0A 4Y49B 3SI2A 3PBBA 2VG6A 4LRFA 4DPWA 3HVAA 3OV7A 2F8MA 3TUPA 3PACA 4DV5F 3HPOA 4BBHA 1QSTA 5J1PA 1RTHA 2HBYB 4RW6A 2J9DA 5E3PA 2FHKA 4DQPA 4HKQA 1LW0B 1FRLA 4BD9A 4ZCLA 3NCRA 1L3TA 3FQLA 2ZKTA 1RWOB 3UD5A 2PFDA 4CIOA 2FCKA 4OZ3A 3LMSA 1VJQA 2P5VA 4NF1A 2IPOB 3SCLE 4U7UK 2CWKA 1BPNA 2J8RA 4F4KA 3KJNB 1A6LA 4D3HA 2V8VA 2CNOB 4JV0A 2U1AA 2Q4ZA 5IQ6A 2VODA 4CGOA 2GE3A 4CO5A 1Y9OA 5J1QA 3IMQJ 4PPDA 4CT9A 1UWYA 2HQIA 3NGUA 3MRUA 3M8ZA 4BC7A 2K3KA 3I9SA 2Z3KA 1Q2DA 4ZMMA 4ELVA 1VMBA 4QPXA 2Q6CA 1H72C 2POKA 2Q0YA 1JLBA 4MMOA 4KV8B 3TI0A 2ASYA 2ZE2A 2L41A 3H0PA 3V38A 5KFZA 1FDNA 4J9UE 1AB8A 3TANA 4LF9F 4X4OA 2H54B 2N82B 4NZ7A 3M2UB 1LWFB 1V3RA 3GQCA 2NQPA 1VRQC 2CQ2A 4G1QB 4J9QA 4F25A 5BR8J 1AFJA 3J7YI 1X12A 4HLBA 4M5LA 4G3IA 3TJAA 1XOVA 1RXOB 4NLRA 4YFJA 4ZKAA 1D3WA 1HYSA 5GMDA 2V4JB 2W2QP 4WFNQ 2HV2A 4J91A 3HSZA 4DN0A 1FERA 1VGYA 2ZNYA 4UEFA 3WABA 4YS2A 2ZC4A 2B5JA 2V4RA 1NH7A 2AP6A 1VQ6S 3T8WA 1G7CB 4OJ3A 5EN1A 2R7XA 2DNQA 2FLLA 1N32J 3C66A 2BW2A 4NGQA 4ZVPB 4PZVA 3R97A 5AT1B 2EVNA 2COLA 5D6GA 4H54A 1XQIA 1Z2ZA 3N28A 3BDEA 1VC0A 2D4OA 2BJDA 3S8SA 4LX9A 3LPYA 4GO7X 1RJJA 1LEOA 1AZSB 1TL1A 1GX5A 3UVJB 2GA7A 4Q0BB 2F1FA 1C2PA 4FYWB 1F2HA 1HLWA 1CS4A 4UOCA 2J6SA 2YXLA 4AL5A 3QIPB 1RLCL 2IFXA 2ZOMA 2VXKA 3DU5A 3CXQA 2NMTA 4BHQA 2HFOA 2X3GA 5CD4H 2Z3OA 3PB8X 5JMNA 3QQCD 3J7A1 1HD1A 2OPRB 3US5A 3DFEA 2VI7A 3MMCA 1IICA 4NMXA 3W1YC 1PYTB 3C14B 4AVAA 3AT1B 5K14A 1QSNA 1Q81T 1Q86T 3DI6A 5B0GA 2GU2A 2Q43A 2P0WA 3VGSA 1E6VA 1ZG9A 2CG4A 3PBEA 2Z3PA 5I3PA 1UZDA 4DF8A 5HROA 2FHOB 4DUYJ 4MK8A 4I64A 2UUAJ 1JK9B 2WBRA 2NXCA 2VONA 3CDXA 4ZPAA 4N7TA 3SSRA 5KG4A 2VIHA 1EP4B 2IRXA 4OQJA 3LWUA 1T9TA 2C3YA 5THWA 1SJ4P 4ONUA 3JSBA 3P96A 2SXLA 1NSAA 2DTJA 4O3OA 1S12A 1XR5A 2UVRA 3VWDA 1TUWA 3W5YA 2XLJA 2MLZA 1HBUB 4B3TF 1VQOS 5F46A 4I7FB 4LBIA 1Z8WA 4FAIA 5D8HB 3NGTA 1T9UA 1JJHA 1EX8A 5KT5A 1FEEA 3VTIA 2XI3A 1U1NA 2HWTA 1SJ1A 1RAOA 4K30A 3IWEA 2ABZA 4CLZA 1VC5A 5ETPA 4IYQA 4LF2A 4KIAA 1T02A 1HNXF 2BJEA 1UP1A 3H5UA 4CRYB 3SCJE 2ZEMA 4C8LA 4B5PA 3P6YC 3HHNB 4YFUA 2KCWA 2YX7A 2YWGA 3AHPA 5JM6A 1OZPA 1H6KX 1S9FA 5DQGA 1CJKA 2OPPA 1N6QB 2FVGA 1U6FA 5J2NA 4FN5A 2QSFA 3KLGB 3ENAA 4ZYQA 2E1MC 3DXBA 4ZPVR 2K3IA 5LMUJ 1UJ4A 4MIBA 3OD2A 2ILZA 3OJUA 4ED4A 4ZJLA 4TQRA 1SJQA 4MHPA 2Y3YA 3MFIA 1JWQA 5H1SV 1XC9A 1NKCA 1S0NA 3K2YA 3LP1B 1FJEB 1NK0A 5T14A 2VC0A 4P72A 3EDRB 5LM7E 4PWUA 4CM2A 4NCGA 3MMBB 5CHCB 1U1LA 3FVYA 3SSSA 5C2GA 1S9EA 1R31A 1HNIA 2DGSA 2Q44A 2WVDA 2G2YA 3QT6A 1TTHB 2IA6A 1P9QC 2QA2A 1ELOA 5C24B 4C8YA 3VGUA 2KVQE 4JD6A 2ZM6J 4ZY2A 3JTPA 5U47A 2EFGA 1U45A 2Z4PA 3KYLA 5HI7A 3AD8C 2OI2A 3NGDA 2L48A 1MMNA 1F5AA 3OLBA 4N8OA 2UP1A 4MY3A 4J9NA 4WXWA 2UUCJ 3JQMA 5KFUA 5HO4A 2IVFB 3PB7X 1WDDA 4Y2AA 4DUKA 2HZCA 2GNKA 2DIVA 2VQFJ 3DR8A 3KK1A 2M2BA 5LRKA 3PNIA 4D3GA 1WK4A 1VK8A 3ETOA 3KHZA 4EZ6A 3QJJA 2ATRA 3W63A 5H9FJ 2W4CA 4NYPA 5LXRA 4DBQA 1IBCB 4O3NA 3KL9A 4F7VA 2CPFA 4L75A 2BACA 2V2KA 2QYVA 5L46A 2BQRA 2N7CA 5I42A 3ZTPA 2CQGA 2KZMA 5D0EA 1RT1A 2WPXA 3QWUA 1HQ2A 1JWWA 2KT2A 4OYBA 2B8PA 1RT6A 5LYLA 1ZAXA 5I3QA 2AJQA 4LF5J 3ZZOA 5LSRA 4C0BA 2ZBPA 5DWMA 3H4QA 1S0VA 4K4YA 4JI7F 1FRIA 1PAUB 2YKNA 1N5VA 3N5BA 4Y6IA 2F4VJ 1G1XA 3ILJA 2HRYA 2CQ0A 2FJEB 5E5NA 2IQ6A 4Y2IA 3BGRB 2Z8QA 3P45B 2MEWA 1YK9A 1F60B 3POTA 3ET6A 5AG7A 3K89A 3P2HA 2I8EA 4ZX8A 1HIYA 4XIUA 2XSJB 1U0SA 2AFWA 3OFFA 1WF2A 2B9EA 2NUUG 3ZZYA 2H3EB 3TO9A 7AT1B 3CCSS 2RKIA 1SQEA 1N5SA 1UWBA 1UVNA 4K0KJ 2CIJA 3NWGA 1QMUA 4P2FA 5IB0A 1RAEB 4HT7A 1SC1B 2CRLA 2DRAA 3UDLA 2FSRA 2K5TA 3JQKA 1RYRA 2FDNA 4DWIA 3M9MB 1S1TB 3H5XA 3EC4A 1TV6A 3MAAB 5A0YA 4ZN3A 2JRSA 5D0GA 4FWUA 3AB4B 4NYZA 5CBMA 2KO1A 4DV6J 1FWKA 2QMLA 1M1GA 3KXDA 1KR4A 4NXNF 1Q8KA 5CYQB 3C3LA 2GX8A 3CDBA 4U9RA 3CXCR 3TE4A 1R8AA 2R9LA 4AXIA 5AXNA 3BSNA 3SCIE 1NDPA 2E7XA 2JDDA 1AYEA 3NOGA 1TIQA 2PIZA 5C88A 5A2QU 1S10A 1JLGA 2BKOA 3SI8A 4O44B 1C0TA 3DOMB 4XNHC 1U6BA 1GMWA 1B4SA 4DR7F 3V6DA 2VV5A 3QT5A 1XMTA 1YX0A 2CQHA 4OZ2A 3SJEA 3W6SA 5ISVA 3R5DA 4CPAA 4NA2A 1DAXA 4J5OA 1U1KA 1FRJA 4KPYA 1SV5B 1YGHA 3GJSB 1JLQA 3M8PB 2BE9B 1ZG8A 3RW6A 2GHPA 2LXUA 4P44A 1HQUB 2BM1A 1UTAA 4KLWA 2ZEGA 2QRRA 3UN2A 2MKHA 2I79A 4KFBB 3FZBA 4A8WA 3TCVA 2JBKA 4DR1F 3L7PA 2Q4YA 1F9FA 3PYGA 1S5KA 4IOAQ 3UCUP 4F0XA 3FJUA 4GS4A 2FC8A 1X4BA 4G1PA 4DX8H 3IM9A 4YQWA 1GTEA 3MM9A 4DN9A 3BQ0A 2OTLS 5J8FA 3DRXA 4Y0FA 4ZDNA 3GCXP 3K9TA 3EX7B 1QTNB 1N88A 2KYZA 3HULA 3E3XA 2ZEJA 2BR0A 2V8GA 1O5JA 4DSEA 4EO6A 4DUTA 5KT3A 4WFBQ 2MZTA 1QJHA 3WX8A 1YTYA 1CC8A 1NSQA 4LBPA 4LSLA 1NZAA 1I21A 4PCQA 1ON0A 4IDKB 2CQIA 3JS9A 3OL7A 2Z11A 2B6AA 2YNFB 1R0AA 1C4AA 4N77A 1P0HA 3KFWX 5KFQA 4WZMA 4ANEA 2VFRA 4KYZA 1HKAA 2J8MA 2OMOA 4JZ0A 4ZP6A 3PKMA 3OXFA 4JJXA 3R8YA 2Q66A 3FEYB 4FXVA 3LALA 2HHPA 3EVOA 5A27A 2QIRA 3IG1B 3R1KA 3QB8A 1LW0A 4HKFA 2YKMB 3IRWP 3CMES 4LBHA 4DR4F 3RNZA 1QDUB 2R7HA 4AG9A 5IT4A 2CNNB 1IR0A 3LWLA 4FNIA 2EC2A 1WC6A 4CLTA 1D0EA 1J5EJ 4C6AA 1PIEA 5KTQA 1B0TA 3DM2B 4NLWA 5GAHU 4MCPA 2VPZB 1YLEA 2FJXA 2V67A 2D7SA 3S1TA 5F9LA 4DZDA 3B2YA 3GFHA 1VK3A 1B7YB 1U0HA 4MAKA 1VISA 2ANPA 4QWCA 1KNZA 1YRTA 2XEGA 3M9OB 2EK8A 3RBUA 2YQ0A 4ZVRB 2AJ4A 3WBZA 2BXJA 4OYMA 2PMZD 2NXJA 4CAVA 1T94A 4J9SA 3QRRA 4MHNA 5EWFA 1R6VA 1GFWB 3M6UA 4KV8A 3IWGA 2LU2A 2I6WA 2YTCA 5F49A 5IZHA 2BE2B 4JP8A 2AJ0A 1UKUA 2DD8S 2EWBA 2VFSA 1C1CA 4USMA 1EHWA 4DL4A 1VHEA 3M2UA 1LWFA 3BQ2A 4G1QA 4Q8FA 4OI0A 3VF0B 1A7GE 2V4JA 2OPSB 3LGMA 1Z8TA 4HHHA 1VDHA 1FTRA 3M2VA 3MGJA 4DV0J 2G1HA 4AQYF 3DHWC 1N0UA 4B3SJ 2V8DA 2FY1A 2RS2A 5ETMA 1TELA 3EMTA 1P27B 3UE2A 3HKZD 1UZHA 3BEGB 3GJTB 3DKDA 3VAMA 4LIRA 1Q53A 5J2QA 1U6ZA 4YDDB 4K8RA 4L76A 1LXNA 3W64A 4IAVA 1HMVB 1J2VA 2OPQB 4OX8A 2FJAB 4HNYB 3NH8A 1KUVA 4LRCA 3PHTA 5CCMA 3KTQA 3J7Z5 2JLGA 4ILRA 4J9KA 4X4QA 1AUGA 4MFZA 1Q2YA 4UY8T 3EM1A 4ELTA 3R9FA 2VQEF 2QG9B 3BPDA 1T9VA 4NEXA 1TXRA 1K0VA 2ASLA 4LF8J 3H42A 4DHVA 2M8HA 1FVSA 3GIIA 4NZ6A 1RHMB 2ROPA 2FE7A 2AFXA 3V6KA 1UEVA 1FFWB 4USVA 2MZSA 1VR6A 1NHVA 2Q3PA 1IY7A 3D5MA 4KORA 4WYWA 4OIDA 2OPRA 4LUBA 5F8NA 4M5DB 2MSSA 2QJ3A 4IG0A 1VIOA 5CNPA 2QVPA 1PYTA 2VDHA 2M70A 1WHYA 2MKIA 2YGWA 4BMHA 4QOTA 1Q95G 2EFNA 1XR6A 2NXEA 4IKAA 2YNCA 3PR5B 4M5KA 3BSAA 4KKOB 4X2TA 4OI6A 1XMOF 3FMBA 3K58A 5KG1A 3I0SB 3GIRA 4PK3A 4N8NA 4YP3A 1SL1A 5KFMA 3VAFA 2HW3A 4CZCA 4KOUA 2GJIA 3OPKA 3CC4S 2LECA 5IWAJ 4IUSA 2E5IA 1JIHA 3TAPA 2LLZA 1BC6A 2B3TB 2MTLA 2G0JA 3R7NB 4LFBF 1YRXA 1EP4A 4MJ8A 3PB4X 4WIIA 3FMWA 4IR9A 4UIAA 1X4GA 4PXDA 1HW8A 4RW4A 2RU9A 4ZI6A 2GGPB 2ZHBA 3QIDA 3R2CJ 1RKJA 1M90T 2PFFB 4UOHA 3VWSA 1HBUA 4AL7A 4I7FA 1HW9A 5C25B 2CJ9A 2LQ9A 2A6OA 4EVYA 5DG7A 2IL4A 3CJ8A 2XYGB 3P5BP 2V2ZA 3LPEA 2Z30B 1NJIT 1Z8LA 2AE6A 3GSDA 4NI2B 4JI6J 2WVFA 2JEVA 1S1XA 1FI4A 3ITHB 2ZENA 2ZZMA 3FUYA 2NZ4A 3K7RA 5D0HA 4EEYA 3PJXA 3H2UB 3AQPA 4C3LA 2RF2B 1F9HA 1RWKB 1JJ2R 2QSWA 1TFYA 4JI3J 1Y00A 1S7IA 1IYKA 3U27A 2A18A 3SIPB 1S0MA 2Y0BB 1KKHA 4DR6J 3BZQA 3TA0A 3W65A 3EGVA 1S4EA 1N6QA 5DO2A 4DYOA 1H2TZ 4TNOA 2FLNA 1S7KA 4RBUA 4IG3A 8RUCA 3N7ZA 3KLGA 3EE3A 4ZVFA 4LSZB 4B3RJ 4DPOA 3FECA 3VH9A 3MM7A 5FVJA 3GIUA 1RI7A 3EVMA 4TY8B 5BYQA 1O8BA 1HBMB 4LRAA 3ONQA 4UW2A 2P6TA 3LP1A 1WC4A 3G86A 4NJRA 5ETVA 3A8JA 1TL3B 2QL9B 3PEHA 2FPHX 4PG7A 3MMBA 4C7QA 5DQIA 5LT5A 1JLAB 1F3VA 3W2VB 2EWHA 3A3PB 3CCTA 4F3MA 3FRYA 3RJMB 4A30A 3K5PA 4ZCKA 3IJ3A 1ZBTA 3EYZA 2B3VA 2W24A 2UXBJ 1NZ8A 2B4VA 4X2BA 5M2RA 5C24A 2LEAA 1VQ4S 2Z0ZA 1HBNB 3JAMU 1I5OB 4CS0B 4DF4A 3KKFA 1RWNB 5F09A 3C46A 2CQ3A 4N47A 3GILA 2NUHA 3X1LB 4G65A 1S77D 1S1WB 3CT9A 3L09A 1MNEA 1NHUA 3KR5A 5LYFA 3OL8A 3W9HA 2ZD1B 4B11A 2F4FA 3DLLQ 3OTOJ 4FXDA 1S5ZA 2F40A 5E3CA 2DNZA 1N32F 5LSOA 4KOSA 3LF0A 3HLPA 6FDRA 2O1PA 1S49A 1Q82T 4LF7J 3GP9A 3WIUA 4X5KA 3NXZA 5F8JA 3HUVA 2NPIA 2HLUA 3VAJA 1VQNS 3EDQB 1KFDA 2MY7A 4WYLA 1I6JA 4YN3B 2ZEDA 5HATA 2AYGA 3MN8A 5A8RB 1Q2CA 2WVCA 5DLFA 2CTBA 2CXEA 1S97A 1MWZA 4IFVA 1U24A 1VHIA 4XPCA 2VFUA 5EGYA 4K7QA 2FT0A 1U1RA 2D3O1 5G22A 2XSJA 4UQTA 2R7VA 2E1CA 4ES3A 4RUBA 4ZLJA 3IBCB 2V2VA 1VHOA 1P9YA 4Q44A 3FC9A 3IWWA 2EEYA 4BINA 2AMCB 4USJC 5F8MA 4HDGA 1RBOB 3TO8A 3GSIA 3HFZB 2HKEA 2IRYA 3R27A 4FYXB 3DCAA 2QEXS 1S1TA 3QGPA 4F67A 2CDRB 2ZELA 1OQ6A 3GWCA 4O0IA 3MAAA 2E66A 3TT2A 4RNOA 1MSWD 3IU2A 3IBFB 2MZ1A 4DUYF 2AYBA 2UUAF 2AZ1A 3E2EA 2XI2A 1Z2LA 2JSXA 2MKSA 3TYTA 2RVJA 3C15B 4Q45A 1T11A 3HMJG 5CYQA 4CNYA 2AX0A 3V4IB 1Y5IB 4ZIVA 3PEJA 2DRDA 3FEDA 2IY5B 4KH0B 3FGVA 4A4JA 4DR2J 2CPXA 4EO8A 2MQQA 4QBUA 4FYDA 1RHRB 4J9VA 4B08A 3WX4A 4DU7A 1R43A 3OVBA 1K4JA 2FGOA 4OX6A 5IC4B 3DOMA 3W8GA 1KZFA 3OWCA 4CI0B 2I5JB 1PUAA 1RADB 3A13A 2R7SA 1RT3B 4KHRA 3SFGA 4NSQA 2FVRA 2OR4A 3W6XA 1CBXA 4OZ1A 4B02A 2YX1A 3UPFA 3M8PA 4R7MA 1LOKA 2O01C 1WOOA 2D69A 3LW5C 1BUXA 4O3RA 4UCPA 5G21A 1RHKB 1WSVA 3DDNA 3DYAB 1RQ0A 2DGVA 4V1Ak 1GXLA 3ZZRA 1Y9KA 4QIFA 3DN9A 2Q7BA 4KFBA 3D3CJ 3QSYB 5KG0A 4HT5A 2HHVA 5KFSA 4ERDA 1FXLA 2ZKUA 5DGBA 4TLRA 2QLWA 1LK5A 2R7OA 4ICLB 4ZJOA 3BBFA 4F02A 4KTQA 2UV8G 3PCOB 4OJGA 1QVGR 5LMUF 2J0SD 1FY7A 5AG4A 3VATA 3KMSA 3GG0A 5EHHA 4YR0A 3R5CA 2KXNB 3PX6A 1WEYA 2ZEHA 5B08A 2ZVSA 3GLJA 5GADU 3NNAA 4XPDC 4XPLA 4C3KA 1YW6A 2MLYA 2XNQA 4YB7A 3VAHA 4RU2A 3OVAA 3RRKA 3G8SA 1ZZFA 3QAHA 2EPIA 2J7WA 2ZBQA 1FE4A 4J9PA 3LO3A 1M4GA 3UW1A 1CQMA 3TR5A 4C68A 4X66J 2YNFA 3ILIA 4EBDA 2BW7A 1LW2B 3DGPB 4Q43A 1KHWA 3B35A 4UZBA 2J8AA 2XYHB 3FEEA 1Q1KA 4WXOA 4LF4J 1RO5A 2UVUA 4ED3A 3H7HB 1IN0A 1HWLA 4HHUA 1S79A 1F2GA 4KVME 3H4DA 2CY2A 4FPRA 2UUCF 4PEOA 4R3KA 3G3SA 3MCSA 4P74A 2QYCA 3EO4A 4R76A 2DGUA 2I9SA 4PXCA 2VQFF 3JTNA 1JNZB 4DCJB 3PW0A 2YKMA 4JYAJ 2B58A 3MMAB 1AMPA 3LOUA 3KQXA 2YKOA 3CCUS 1YQHA 1UETA 4ENOA 3H4BA 1NB2A 2P9GA 3EGZA 3Q8VA 3R7SB 1K1QA 3DM2A 2L9DA 5A8KA 2W4DA 3CDEA 2OIHA 5D29A 3G6YA 4F4XA 2G2ZA 1MJAA 2KU7A 3OTEA 4DU8A 3MI7X 1ZTWA 1Y7EA 4I49A 4WK1A 1HFEL 5CAAA 2B0GA 4OFZA 3S6GA 1PG5B 4DMZA 2HNYB 4DPYA 4NXMJ 4RW9B 3CDWA 4LF5F 1D8YA 2YWKA 1RCXB 4KB7A 1QAYA 2MLXA 2RDDA 1UA0A 2OUGA 2E1RA 1Z5RA 2F4VF 3DMJB 1VOMA 2ADBA 2JX2A 5F3TA 1RK8A 1CLFA 3MM5B 1YREA 4CYOA 2DPTA 1MMLA 3BYPA 4NASA 3KJQB 3LP0A 1I12A 2IYIA 1IR2A 3ZZZA 1Z4UA 2BE2A 4RPFA 1VBZA 1N36J 4LSNB 5HH1A 3C2PA 3DOKB 2E5GA 4RKUC 3HF5A 1Q8IA 2HC9A 4JLYA 2H9ZA 3OBIA 2ASJA 3H98A 1F6TA 2G2OA 3K17A 4Y34A 2GAGC 4K0KF 4B9LA 2OPSA 3FBEA 1L3UA 4NLQA 1FD8A 1WJ9A 4DSJA 3O3LA 2VBZA 3IU1A 2J0WA 4ECRA 3NMRA 4KGXB 3RRGA 4ZP8A 4DV4J 1BQMB 2HB6A 1H74A 2QC3A 3KLHB 2BJ1A 2Q04A 3G8WA 4JI1J 3JRUA 2IM0A 2C6PA 2GANA 3QO9B 1RB0A 1SUQB 5EMIA 4A95A 4JI2F 1NNDA 3T5JA 4KSAA 4YDXA 4DV6F 1ZH5A 1HMVA 4C2MA 2OPQA 1RAIB 3A3OB 2AFOA 1Z8XA 3M30B 3ZO7A 2G3AA 2V68A 4CH0S 4PSWA 4B9TA 2AJ6A 5B0DA 5JXSA 1ICEB 3HSJA 5MLCV 4MKYA 5LYIA 1I94J 2ADCA 2RS8A 3RB3A 1RT5B 3BSOA 2HK3A 2C3UA 2LA6A 8ATCB 1ZM4A 1FFSB 1XEZA 5CABA 1U49A 3AH6A 1IVZA 2BKPA 4OZLA 2DNGA 4CAEA 2AX1A 1IOIA 2J7UA 1SH3A 1QLNA 4A47A 5KFGA 2ZWPA 4E0AA 1KS2A 3RAMA 3D3BJ 4UOFA 4M5DA 3PM9A 4Q2LA 4PWWA 5EC4A 2LEBA 1CC7A 3M8SA 1YX2A 4FS2A 2ZEFA 3D8PA 3PGPA 4NE9C 2N4CA 1PC5A 3GCWP 5CXTA 1S6OA 1EIYB 4ID5B 1XBWA 4KKOA 5RUBA 3CO9A 3SBMA 3I0SA 1WHVA 2OSQA 1W7WA 3F41A 1YRUA 4JV5F 4MIAA 2HVEA 2KH9A 1JX4A 3K5LA 3ZZPA 1NHKL 2G13A 4USWA 2CQ4A 1E6YA 3CPAA 1PBUA 2PQ8A 1VQMS 4IO9Q 1SJFA 1IBLJ 4ECWA 4FD4A 3PYEA 3TUIC 5HQMA 1WSRA 5SUHA 3QJPA 4QR2A 1VQKS 2GGPA 1HI0P 1HD0A 2H5JB 1U02A 4LR8A 3KLVA 4MK7A 4Y3CA 2XMWA 4OMFG 2YWWA 3R5BA 2HMIB 4QUSA 5C25A 4RW7A 4ZVUB 3HFVA 1T95A 2CVEA 2B4BA 5HN0A 4JI0F 5K8MA 1YVOA 3DLHA 1B3TA 2OP5A 4Q2MA 4P4FA 5HK4A 1HHTP 4KGVB 2PSWA 4UUWA 4RR5A 2CPEA 2L9NA 3ITHA 4UIBA 1YJNS 3M7VA 2D41A 3ZTRA 2XS5A 3E01B 3PRDA 4OZ5A 5A76A 2NZCA 2RF2A 4PG8A 4USUA 3CJ3A 2WVBA 2E5LJ 1IWAA 5AG5A 3I82A 1N5YA 2R8IA 2K2PA 4F0HA 4IFYB 3J80U 4DCOB 4I1TA 3KI9A 3DLEB 3CCRS 3UR3C 4PPZA 1FTCA 4KSIA 3OW2R 3G8QA 1JMTA 2V6AA 4WU2A 1KTVA 2KJWA 3GYAA 1M4LA 4TY8A 3SFUA 1Y7PA 2C2OB 1HBMA 2F7VA 4ZOSA 3MFHA 3GYXB 1S1UA 4DL0C 1UJ6A 3O1LA 1LK7A 3C6UB 4RNFA 1YJ7A