1XMBA

X-ray structure of iaa-aminoacid hydrolase from arabidopsis thaliana gene at5g56660
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
392
structure length
375
Chain Sequence
KLLEFAKSPEVFDWMVKIRRKIHENPELGYEELETSKLIRSELELIGIKYRYPVAITGVIGYIGTGEPPFVALRADMDALPIQEGVEWEHKSKIAGKMHACGHDGHVTMLLGAAKILHEHRHHLQGTVVLIFQPAEEGLSGAKKMREEGALKNVEAIFGIHLSARIPFGKAASRAGSFLAGAGVFEAVITGKTIDPVVAASSIVLSLQQLVSRETDPLDSKVVTVSKVNPDSITIGGTLRAFTGFTQLQQRVKEVITKQAAVHRCNASVNLTPNGREPMPPTVNNKDLYKQFKKVVRDLLGQEAFVEAAPVMGSEDFSYFAETIPGHFSLLGMQDETNGYASSHSPLYRINEDVLPYGAAIHASMAVQYLKEKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IAA-amino acid hydrolase homolog 2
publication title X-ray structure of ILL2, an auxin-conjugate amidohydrolase from Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 122
structure length 375
sequence length 392
ec nomenclature
pdb deposition date 2004-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1xmbA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1xmbA01
2V8HA 3FJUA 4NGPA 5DS0A 4MHPA 2G9DA 3IEHA 4Z65A 4NFRA 4PXEA 1LCPA 3B2YA 1HEEA 1Z5RA 4FBEA 1TF9A 3PB9X 2PJ9A 2ZEOA 3H8FA 3SI1A 2GLJA 5K8NA 1TKJA 2V77A 2I3CA 2WZNA 3GLJA 4R6TA 4EFDA 5K8OA 4EWTA 2PVVA 4B6ZA 3PBBA 2PJCA 2PJ0A 1ZLHA 2PJ8A 3DGVA 3B35A 4GM5A 3SJEA 5LRKA 3NA6A 6CPAA 2XEGA 4PXBA 2ZEDA 5F09A 1QQ9A 2CF4A 4MCQA 3KR5A 1ELMP 2PE3A 5I4MA 5D29A 1XBUA 2NYQA 1BPNA 3B3VA 1AMPA 2ZOGA 1CP7A 3S9MA 1OBRA 2GREA 1LANA 4FWUA 3IO1A 5CBMA 4F9UA 3KGQA 5K8PA 2F7VA 2PJ1A 3BHXA 3KL9A 1ELLP 4R76A 4FAIA 4MCPA 2GLFA 3QNVA 4A37A 3ISZA 2RFHA 2XEIA 4R7MA 5LRJA 4P4IA 1DTDA 1TF8A 5THWA 2EK9A 2CTBA 2O4HA 4NGSA 5LYDA 4F8ZA 2EWBA 4UEEA 4NJQA 1GYTA 3LMSA 8CPAA 2QYVA 3K2KA 4ZX8A 4ZYQA 2PJ2A 3KR4A 7CPAA 4JYWA 4ZX9A 2PRQA 3S9LA 2V8GA 2ZEMA 4P44A 3ISXA 1YW6A 4YU9A 3KQXA 5HVFA 1AYEA 3PEIA 4PPZA 5LYIA 3B3WA 1F57A 1YSJA 2HB6A 2AFXA 3VATA 2ZEEA 2ZENA 5CPAA 4OC1A 1YW4A 4YWYA 3GUXA 1TKHA 1CBXA 1JQGA 1LAMA 2CTCA 3I1UA 5IB9A 4X2TA 1TKFA 1IY7A 3PB7X 3NFZA 4NGTA 4X3RA 5LYFA 3D7HA 2HC9A 1F2PA 3FF3A 3VH9A 2PJ4A 1Y0RA 1ZG8A 1KWMA 1XMBA 4EMEA 1ARMA 4ZY2A 4MCRA 4Q7AA 3KZWA 3T8WA 1QMUA 4CPAA 4MHZA 2DEAA 4ONWA 2VL1A 3N5FA 4OC5A 3SJGA 2WYRA 3WC7A 1H8LA 5JM6A 2OR4A 3D7FA 3FH4A 1Y7EA 3NH8A 1Y0YA 2AFOA 4DYOA 1M4LA 2IJZA 4TNUA 1CP6A 2EK8A 2RB7A 2PCUA 2ZEGA 1VHEA 3SI0A 2JBJA 4UIAA 3RZAA 2BCOA 5LRGA 3PB8X 3WC5A 3KASA 4K3NA 3D66A 4P4EA 4A39A 4NJRA 5ELYA 2J9AA 4BD9A 1YLOA 4P4DA 1EE3P 3VARA 1RTQA 1LFWA 3B3TA 4TWEA 4PXCA 2V8VA 3D7DA 3PRTA 2O53A 2POKA 2C6GA 3D68A 4MXUA 1VGYA 3B7IA 2ZEHA 1Q7LA 3FMCA 1XFOA 3MRUA 3FEDA 5J1QA 2PVWA 4UEFA 1ZLIA 4O23A 5JGFA 3BXMA 3CPXA 4OC4A 2Q4ZA 3SJXA 1DE4C 2PJ5A 2V8DA 3B3SA 3MN8A 1PYTB 3HUVA 2ZEPA 3IFEA 3CT9A 4A38A 1ARLA 4P6YA 5K8MA 2ZOFA 2AFMA 2BO9A 3PBEA 3H8EA 3V7ZA 1Z2LA 2NSMA 4DJLA 3JRUA 3KI9A 2PIZA 2ZEFA 1XJOA 1ZG9A 2PIYA 1UWYA 1Z8LA 3IWWA 1ZG7A 4UIBA 2PJBA 1BAVA 4JZ0A 4MHNA 1R43A 4OC0A 2PJAA 1NSAA 1VHOA 1FT7A 4P4BA 1R3NA 4OIWA 2XEFA 2ZELA 1CPSA 3BI0A 3D7GA 2C1CA 4P10A 2CIJA 4R8FA 5LYLA 3HLPA 4ZI6A 1CG2A 5HXDA 2IQ6A 2OOTA 1LAPA 3WABA 3TC8A 3DLJA 3CPAA 4IHMA 2IMOA 4ZY0A 4NGNA 3L2NA 3SI2A 3K9TA 3IIBA 2QVPA 4LQGA 4FUUA 3NH5A 4NGQA 1CX8A 3FVLA 4AXVA 4OC3A 3PFOA 4X8IA 4W9YA 1VIXA 2AFUA 4RUHA 4KSIA 1XRYA 1YMEA 2ANPA 3WT4A 3WC6A 3S9NA 2XEJA 1BPMA 3B3CA 4IAVA 4MCSA 4DUKA 1F2OA 3GB0A 3KQZA 1TXRA 3KHXA 1LOKA 4WJBA 2GU2A 4MRIA 2QJ8A 4IK2A 1HDQA 3RAMA 1IGBA 3LWUA 1PCAA 3PFEA 4PQAA 3FX6A 3SJFA 2F8HA 3PB6X 5D8NA 1HDUA 2AFZA 4ZY1A 2AFWA 4OIDA 4P4FA 3BI1A 5HVGA 2JEWA 4P4JA 2AFSA 4NGRA 1BLLE 3D67A 2Q43A 4MHYA 3TX8A 2Q51A 2PJ6A 4OMEA 4PXDA 3V38A 3PB4X 2BOAA 4OKOA 4H2KA 4NGMA 4OP4A 4WWVA 4MMOA 4UF4A 3H8GA 1FNOA 3IJ3A 3RBUA 4A94A 2C6PA 4F9VA 3IC1A 3KHZA 3FECA 2FVGA 4P45A 2ABZA 2PJ7A 4OC2A 3FEEA 4UEZA 2JBKA 5HVHA 3D4UA 3NH4A 1CPXA 4G1PA 3CDXA 2C6CA 2PJ3A 5JH9A
chains in the Genus database with same CATH superfamily
3MOJB 3R2DJ 1X5SA 3R5JB 2D9PA 2ASYA 3MAHA 4NFRA 5B0AA 4FBEA 2B5JB 2GE3A 4AG9A 1SCJB 3PW2A 4ELTA 5EBVA 4FP9A 3HSGA 3HCXA 2FD2A 3KFWX 4ICLA 4GKJJ 1CSJA 3KJFB 3H5YA 1KONA 4PWDA 1OMSA 2CZ9A 2F3JA 4F4AA 2Z2ZA 2RSQA 4LQ3A 4PXBA 2CJKA 2VG5A 4ZPBA 5L1KA 1XBUA 1WOSA 2ZOGA 4KUBA 2JHEA 3AOAA 2XZDB 1PBAA 2HS3A 1SL1A 2Q0YA 3DMJA 2HVZA 3GU0A 2L41A 3MCNA 2VBZA 4YB6A 1GH8A 5L1IA 3E0KA 4FAIA 2DR7A 2XEIA 4ED6A 1RHRB 4P4IA 5HQLA 2R7XA 2VKRA 2CTBA 2GIQA 2RMLA 3T1HF 1AZSA 5J8FA 2H4WB 3IWLA 1XR7A 4AYBD 3T3FA 4Q43A 4IQMA 4I1TA 2X1FA 4B3OB 3VGTA 3PP9A 2VICA 2PA3A 1DHMA 1TKHA 1CBXA 3T5KA 3T5JA 5D3GB 1UPPA 2PI5A 4F0HA 2N4CA 2ZITA 1T9YA 4RNMA 1RWVB 4RW9B 2W2QP 2HV2A 3BDEA 3FGVA 4KBIA 3QJJA 2IAJB 3T1YF 2GQQA 4ZVHA 3M8YA 2Z3LA 1R8BA 3HZGA 3IM8A 4PUOB 3BJ7A 4M3SA 1JLCA 4W98A 2XZTB 3DM2B 4F04B 1YG0A 4ITSA 3H40A 2Z8QA 3SHPA 3CF5Q 4I0WA 4LFCF 2Z3PA 3TJAA 3R1LA 1LK7A 2BDPA 2RB7A 1I21A 2CQIA 3IWGA 3RZAA 6FD1A 5FDLB 2I0XA 3NBPB 3WC5A 1RTIA 2RT3A 4DV0F 2CWKA 3W2VA 3UNYA 4BDPA 3HSDA 2PC1A 2V4JA 2QGFB 2Z57B 1YLXA 1N8RT 1GX5A 4YY3F 3FSIA 2AJ1A 4PQUB 4C68A 3FSXA 3DNSA 4RW6A 3GPAA 4QQBA 1GQEA 3IRXA 3MM5B 2J7KA 3OUYB 2YKPA 3SJXA 2HGLA 1HW8A 4B3SJ 4WZMA 4LRCA 3BKTA 3AFGA 4QW8A 2PR1A 2P6FA 3JSBA 5B08A 1T9XA 1QY7A 4EI2A 3H8EA 2NSMA 1HNVB 2V6AA 1V9OA 1EARA 1A6LA 3GZ7A 1FDAA 1R8PA 5EHHA 1AUDA 2M4MA 2PJBA 4JZ0A 1JLGB 1UJ5A 1R43A 3DDDA 2X7BA 2W4PA 3H5SA 4TVAB 1R3NA 4WFZA 2DNQA 4NLQA 4ZHRB 1YJNS 3QYYA 2OHDA 1W7WA 4PK3A 3HVWA 2IQ6A 2PFFB 1B4SA 2ZHBA 2F8EX 3RB4A 3NH5A 5KFMA 4OADA 1N34J 3M9OB 3E01B 2OTLS 1IM4A 2P2CB 3BM7A 4QOTA 3SV3A 3ITHA 4QIEA 2CJQA 1UJ6A 1UEVA 4DQPA 1BQNB 2HHPA 4WXWA 5CZXA 2DD8S 2XZWA 4DLGA 4OZ3A 2KZMA 5I3UB 2WONB 2NLWA 3JQJA 1YJ7A 4QJVA 3ZTQA 1SV5A 4UUXA 1HDUA 4MFKA 1M5KC 3AT1B 2XY5A 2R7WA 2XMAA 1NUEA 4HLBA 1IR0A 2GVZA 5DWNA 1S4FA 2R3VA 5F8LA 3DXBA 3UD5A 4WE1B 3R7BB 5HO4A 2I5JA 2B4DA 1TL7A 2DRBA 3W63A 2FVPA 5KG5A 3U1NA 3J7YU 3RU0A 4ATNA 2AQ4A 1X4FA 2ROEA 2ZPAA 4NYPA 5JMNA 4Y34A 3NEKA 3TP2A 1DTQA 1M1DA 2KCWA 2PMWA 8ATCB 2V8HA 2JFKA 4RR5A 3BSAA 3GE9A 3N6LA 4USWA 3VVUA 4RU2A 1ZM3A 4R57A 1LQ9A 4KLWA 1AA1B 2LEAA 1FJEB 1PC4A 1JIHA 2I3CA 1RAGB 3ULHA 1VQMS 4JV2A 4EWTA 3G9CA 4B3TF 4WP8A 3N4WA 3D6MB 1N0VC 4XPEA 3VAIA 1KHWA 3CCRS 3T6JA 5EMIA 5J1PA 5KFJA 4DQIA 2B7CB 2MKHA 4B3MJ 4CAXA 3M8SA 3LP1B 5DZ6A 3KJVB 4TN2A 1VYAA 3CCMS 4FWUA 5DGAA 2UUAF 2OFGX 3ZZTA 2PJ1A 2CJAA 2Q3PA 2IRXA 4YR3A 1M5HA 5CABA 3W6XA 3QNVA 2ATLA 2QA4S 3K5PA 3IS9A 1RT4B 1T94A 2EK9A 4CGNA 3GR0A 4X4VA 1NHKL 8CPAA 1QD1A 3WIVA 4J9QA 4CH1A 3FZ2A 2RRNA 1FFSB 2PRQA 3RR8A 1RLDA 2VG7B 4ZVSB 3UI3A 4ZS6A 2V8PA 3NS6A 2HNZA 4RUBA 5C7PA 2D4OA 2R7QA 2EVZA 1C2PA 3THPA 1L3UA 2BE9B 4KR0B 4ECUA 2OGUA 1KP6A 1NJYA 3GONA 5ETSA 1Y3JA 1RT1A 3AA8A 5IC4B 5DG7A 2ZW7A 2NZCA 3G8TA 2FZCB 2HHHJ 3VGVA 3LPEA 1L3TA 1ZPWX 4RWWA 2CRLA 4OZ1A 3G3SA 5F49A 4BLGA 3AHPA 1IKXA 4B10A 1GK8A 3Q2TC 2BUEA 3D7HA 3QB8A 1X4EA 3FF3A 2HZCA 1YZ7A 1KWMA 4OHWA 1WSRA 2V68A 3CJ4A 3CSKA 1J5OB 2XG8A 1R0AA 5HLFA 3WC7A 4F25A 4KOYA 5FLXY 1IKYA 1NKCA 1Y7EA 3NH8A 4X2BA 1U47A 1UFWA 3UW1A 2VEZA 3MTKA 1VFJA 3RRKA 3H5ZA 3OQ2A 2OH1A 3EDQB 2CNOB 4KOWA 3SI0A 4Z37A 4JI4J 1LV5A 2QIFA 4K3NA 2K06A 4MT1A 1TKZB 2DO0A 2JEGA 1KS2A 5K5MA 3RGIA 4CDIA 5DQGA 2ZH2A 1H6KX 1OJ4A 2COLA 4P52A 2F9JA 2HNYB 5LMUF 5EN1A 1TUGB 1JJ4A 2CJBA 5KT4A 3F73A 2ASDA 3KLFB 3RRHA 4B9TA 3ZTPA 3FMCA 3CDWA 5KT7A 2B3VA 5IV3A 3LTOA 5HK4A 5U47A 2RHQB 1FO1A 1LW2B 3ADAC 4UOGA 3BBFA 2MZRA 3LANA 1JLQB 4K2XA 1S6QB 4O4RA 4M5DB 1RHJB 3BLNA 1DE4C 4N5SA 4CIOA 2XY6A 1D1UA 3HZEA 4JLYA 3UDCA 4ILLA 1LEOA 1S5KA 1YRUA 2AZ3A 2DCLA 3M7VA 2ERRA 5F41A 2ZH8A 4CYNA 2ZW6A 1QLNA 1RT2A 4NLOA 4EZ6A 1B0VA 2AHOB 2LDIA 3W65A 5HP1B 3G96A 4DR4F 1FD2A 5L9XA 3M8WA 5KG1A 5D4OA 1QDUB 1UAWA 2GVDB 4CRJA 4RNNA 4MHNA 1RDRA 4XIUA 1N0UA 1F2GA 3DXSX 5IQQA 4YOEA 1WF2A 5KFKA 1C1BB 1XR6A 2DXDA 2MZQA 1T3NA 1Q78A 4FKXA 2ZELA 3MD1A 4DN9A 3Q23A 2XSJA 3HLPA 3O8WA 1HBOA 3VZIA 4IHMA 4CLWA 2AJ6A 2Q7BA 2ZNZA 1X10A 3IU2A 3U1LA 2RRAA 5E33A 3MFIA 2YNIA 3PFOA 4X8IA 5AE2A 2H1YA 1WTFA 3OSNA 3RBXA 1IBKJ 3OXGA 4KSIA 2WB1D 1XRYA 3MMBB 1MU2B 2VG6A 3TTHA 2U2FA 4MCSA 3CNQP 2CQ0A 2DEJA 1OPZA 1LOKA 3RR7A 1TL1B 4LF5J 4YMEA 3P2HA 2K7JA 3W2WB 3ILJA 5G20A 2XMJA 3RW7A 4C2YA 2QX0A 5HATA 5KFDA 5HVGA 4RU9A 3N6MA 2AFSA 2R7RA 1CS4A 4UFWA 1TR0A 3D67A 1NRKA 2Q51A 1TUVA 2PJ6A 5KTCA 3NNHA 3HMJG 3CVKA 2V5HG 2BJ8A 3N9UC 4NXNF 4UF4A 2OUGA 2YNFA 3R6GB 3R2CJ 2ODFA 3KHZA 3DLEA 2HZAA 4CM0A 2FVGA 4M6IA 1XNRJ 1VBKA 2ABZA 4QWAA 3SSRA 1N32J 1HARA 3IWEA 5C42A 4QU6A 2YWEA 5K14B 2QLFB 2XNQA 2WOMB 4NGPA 3NL0A 2IDLA 5L39A 2PI4A 2FJEB 4CYUB 1QSNA 2DXEA 3N6NA 3JUWA 2A6MA 1MW7A 1HNWJ 2MZ1A 1HKAA 4IG3B 2CXEA 4ZGYB 2F4FA 4E2FB 2WZNA 3A9LA 3QRRA 4LSZB 3PM9A 4KVOE 4P71A 3M30B 2FJDB 4F02A 2IVFB 4DNCA 4L6V3 1FKAF 3B35A 1RTJA 3LGHA 3NWRA 3CC4S 2XEGA 2FT0A 4P2XA 3NCRA 1FCAA 1QAXA 1YVFA 3KHHA 1MSWD 3UN3A 1XIQA 4LR8A 2A3JA 3KLVA 4DU7A 1WHXA 4C0OC 5C25A 5GAEU 1JJHA 1PO6A 4DQQA 3HM9A 2KO1A 4CLSA 3KWMA 2KRRA 1JKHA 3KGQA 1SH0A 4LIWA 3BBBA 4PZVA 5JVHQ 2MQNA 1SKUB 3BYPA 2HWHA 3CCJS 4C98A 4R7MA 3M6UA 3D0HE 5M2RA 5E3RA 2ATCB 1VRTA 3HHKA 1GYTA 4BBHA 2NPFA 4CTAA 2AJ2A 3K2KA 2Y8YA 5HROA 2A4NA 1TL3A 2I1RA 1YX0A 5LJ5Y 1ROFA 3W7BA 2LP4A 4F4YA 3QIPA 4EBCA 4M95A 1RA6A 1DARA 4FD5A 4ICLB 2KVQE 1RYRA 3PY8A 2RF2A 3CB4A 4KSAA 4DCOB 4X2TA 4BHQA 4ECWA 1IY7A 3NLCA 4B9VA 6AT1B 4KHPF 4X3RA 3ZZPA 2VG5B 4K5RA 1YK3A 2WCXA 3TRGA 3VAKA 2CXAA 1ZG8A 5FVJA 4WP9A 4OLPA 2YKMA 4C8ZA 1PIEA 4QR1A 2FSRA 3ZZIA 1T03A 1B64A 5AG6A 1RKJA 3H42A 3D2WA 2OMLA 4K7QA 3IRWP 2XMUA 3FBBA 3PYEA 3DMJB 1WC1A 2VJVA 4ED0A 4NRTA 3ICLA 1X12A 2IJZA 3WZ0A 1EQ0A 1VQLS 1NPPA 5J8CA 2JX2A 3OTOJ 4KSEB 3DDIA 4KH0B 2UUTA 3Q24A 1AZSB 5K20B 4IG0A 5L1LA 2VFTA 1HHTP 3PIOQ 1QVFR 5ELYA 1UEKA 4IH7A 4Q5VA 4BD9A 1DLOB 5A8KA 2ZH4A 2J8AA 5DO2A 1WG5A 3R5GA 5KFHA 2MLYA 3UVJA 5GAGI 1KOOA 5I42A 5KG2A 2W9BA 3RBDA 2AW0A 3PGPA 1K1SA 5F8IA 5KG0A 1WC5A 3M1VA 4RI1A 3C6UB 3IGNA 4OC4A 1TIQA 5LSOA 2C2ZB 3ZFVA 4P73A 4PG6A 3W61A 4ZJLA 4OHZA 5EC4A 2B51A 2WAQD 4IKAA 3TVZA 2DNYA 1N5SA 4B02A 3R7SB 4CH7A 1KC8T 1SQFA 2HRUA 4EO8A 3N7ZA 3S6FA 2QC3A 2DNKA 1VOMA 1CPZA 2CQ3A 4FVCA 4LBHA 1S0VA 3A8JA 1HQEB 2OAUA 3VTIA 1UW4A 2JJ4D 3W2VB 1Q82T 1KZFA 1O51A 1JB0C 2R2UA 1KLMB 1RU2A 1YJUA 1NM2A 2V4JB 3EE3A 5IC6B 3GIJA 2HAFA 4M5MA 3A13A 2CNTA 1RTDB 2RUSA 4C11B 3SI2A 3M05A 3NAIA 2FJBB 3T9ZA 5IWAJ 2P0WA 3UCGA 1UA0A 3IWXA 2DPIA 1H74A 1JLFA 4C7IA 2VZZA 5E5NA 4CYPA 3CC2S 1YMEA 4OYXA 3H20A 4A31A 3P6YC 2ALZA 3R5BA 2ILZA 5LM7E 4DUKA 3GB0A 4XNHC 2ZJRQ 4MKBA 5IX3A 1XMQJ 1WTBA 1M4GA 2VV5A 4MRIA 4KH1B 3FBCA 4X84A 4IK2A 3RW6A 3RAMA 3L4BC 2CQPA 4X65J 2W9AA 3PFEA 4LSNA 4WKYA 1UWBA 5G0RA 3EWGA 3OHAA 2Z3MA 3WR7A 2HHVA 5G4DA 1JLAA 3TANA 2VONA 2Q1LA 2REFA 1QM9A 2ATRA 3DLKA 4P4JA 2EFNA 4DCJB 5C2GA 3DLLQ 3NRBA 4PXDA 3V38A 1Y9WA 1VK3A 2WBMA 2F5GA 3MEEB 2AYMA 3X1LB 4NEXA 3KLGA 4YN3B 2F65A 2C2RA 3D4JA 3DOKA 2HVIA 3THVA 4BMHA 4P9SA 2Y3YA 3DLBA 3DN9A 1U1QA 2GA7A 3AODA 4DL6A 4MHPA 2D4PA 1LCPA 4JI7F 1Z5RA 4KOXA 4JV5F 1P1LA 3L95X 3ITHB 2PJ9A 2HHSA 2X3DA 3LGMA 1VQYA 5LXYA 4DSEA 1KN6A 3MAQA 2B3TB 1T95A 5HBMA 4FD7A 4KGKA 2HMIB 3LF0A 3VALA 1I12A 1RAIB 3ZXWA 2HIYA 3PDNA 4QUSA 1SV5B 2N4DA 4O4GA 5CCLA 4Z7YA 3MM6A 3J7ZT 2R98A 1YRTA 1CEZA 5I4MA 4FD4A 2ADCA 3EVMA 3MMCB 4OI1A 3QSIA 2VFRA 1CP7A 4ED7A 2I5JB 1IBMF 5A76A 2B4DB 2C3PA 3G4SS 1FA0A 5EUHA 1TL7B 3ZZ0A 2FLLA 4MFJA 2G1DA 4EO6A 4LIRA 1GMWA 4LFCJ 4JI2F 2IYGA 4PWWA 1M1KT 2BOPA 2Y0SD 4O3QA 3MM9A 1DTQB 4F8ZA 3HHLD 1R8HA 2XMMA 3AOBA 1Y9KA 4ZYQA 1VQ8S 2AKWB 4LF9F 5HVFA 3KQXA 4NI2A 3PR4A 4KO0A 3J81U 1YSJA 1UZDA 4HT7A 1H2VZ 3OPKA 2ZENA 2AZ1A 3BJYA 2O66A 2E7XA 3D5MA 3QFWA 2JNJA 4GVBA 2F9DA 4F0YA 4UZBA 3LAMA 2FB0A 4CAVA 3E2EA 5SUHA 3AH6A 2E7VA 2GJ2A 3AY0A 1NNDA 2GQCA 3OLBA 3CDEA 3MOZA 1VC0A 3MMJA 1VIOA 4ZY2A 5CD4H 4KYZA 2J5AA 5A27A 4B9UA 4CAWA 4ONWA 1IICA 3R5CA 3FNCA 1WELA 2MQ8A 2J9CA 4C9DA 4PG8A 1YZ6A 3RB0A 1MN7A 5H86A 2YQ0A 2FS5A 4ZVQB 4M63A 4RBUA 1X31C 1S72S 1XERA 4OZ2A 2PCUA 3IS9B 1TK5A 1N4LA 1VHEA 2BUNA 4HKFA 4CAEA 1APSA 4UIAA 1PILA 1WEYA 1C0UA 4EZ9A 4QWCA 1U6MA 3FNNA 2LXIA 1RWWB 1Y5IB 3IAM9 4F36A 2J8RA 1NPRA 2MQLA 2C3OA 4J9UE 2ZBIA 5HI7A 2JLFA 3WHIA 4AFFA 4S0MA 1HNIA 4ZVUB 1RT1B 3MCOA 3EDRB 5DM7Q 4WCEQ 2Z4PA 3MEKA 3MFHA 1RWUA 3PVXA 2HHTA 3JTOA 4A8FA 2LQ8A 2WPWA 1IKXB 3QGGA 3K8WA 3TEHB 4ZPAA 2Q4ZA 2JLGA 1QSSA 1M5VC 3AOCA 2E29A 2P6SA 3HUVA 1IKWB 3IFEA 5D78A 3TVYA 3VQTA 5HLFB 1S9GA 2HAIA 3CT9A 3K2YA 2V2QA 3GJTB 1IKYB 4L74A 2RJZA 3PBEA 4CLTA 4M5HA 4QBJA 4NCBA 5F46A 3F5BA 3KI9A 4PV6A 3MGDA 1XJOA 4U7UK 4PRFA 2AT1B 2D3ZA 4I7FA 1C4CA 3MR7A 4OAEA 2Q79A 1AFIA 4YRHA 2C42A 2B56A 4X4QA 3DRSA 4KTQA 1HNZF 3JXOA 3BI0A 3RAXA 4P10A 5HN0A 4LVNP 4QBUA 3LP0A 3TUJC 1S97A 4XNHB 1OPIA 1WEZA 3D3CJ 4NGNA 5KG3A 3BZQA 2JDDA 4USVA 2LEBA 2IA0A 2V67A 1N56A 3R1KA 3FVLA 2BM1A 4B12A 3OTDA 5ITHA 2J6SA 4W9YA 4RUHA 2ZFHA 3IBCB 2LQBA 5HMXA 3CCSS 5IM0A 3T19A 2RKIB 1PGZA 2QLWA 3KQZA 4MHDA 3KHXA 3CJTA 4RLEA 1S60A 2BANA 4B3TJ 1TKTA 1UWAA 2E5LF 3LH2S 1JLBA 2MTLA 4F4WA 2EUIA 3MDFA 2MGZA 4H6UA 2HLUA 1RT2B 4ZLPA 2Z56B 2XWYA 3DRPA 4WKRA 3BI1A 1V3ZA 3MI7X 3D28A 2H5IB 4IH5A 3P2FA 2X7IA 3HP6A 3QFHA 4AE5A 4IRKA 4ZPVR 1E6VB 2K5TA 4OP4A 4M85A 2J6UA 1U6ZA 1GEHA 3IJ3A 2XSJB 4USHA 1HBOB 1Y10A 2Y8WA 1VS3A 2W2MP 1SH3A 4TQSA 2PDOA 2Z58B 3Q86A 4YB5A 5HVHA 4GKJF 4RW4A 2FLPA 2CQHA 3MF5A 2YKAA 2VZ9A 3QGPA 3VWEA 3MR5A 2VG6B 4B9LA 2A1BA 2A2CA 4DWIA 4UY85 1HEEA 1Q7YT 5ETRA 1J2VA 3GIIA 2GLJA 3R9FA 3DRRA 2J0WA 2OFHX 3OJSA 2V77A 2LU1A 2MQOA 3CTRA 7FD1A 2WVEA 2VDHA 3V6KA 4NPOA 3DRXA 3MEDA 2PJCA 2BQRA 2EG1A 4A8OA 3TW0A 1HIYA 3UDEA 4URGA 1WDDA 3H25A 4ECTA 3NGSA 4MKAA 1NDLA 3TNVA 5DETA 1T3OA 1V3RA 2HSEB 3V5RA 1CS4B 3JYTA 4DFMA 2JSXA 2P9CA 3B3VA 5F48A 1BWEA 1JXLA 2A18A 1NB2A 3POTA 1X8DA 3FMBA 3GJRB 3GMGA 2QSWA 1N5YB 4F9UA 4QR2A 2Z0GA 4U9RA 2YNFB 4AXJA 2WB4A 1BLUA 1HD1A 2IA6A 3D8PA 3FQLA 2OTJS 2RFHA 2M70A 1OSDA 5D4NA 4P74A 3CC7S 5C42B 3VZHA 3MMAA 1VBXA 1CULB 3ZNUA 1MJBA 5LYDA 2CPZA 1FE0A 1RAFB 4WYWA 3TO8A 4H4MA 1QSRA 3MWBA 4F3MA 3EFAA 1Q79A 4ZX9A 3Q83A 2WUUA 3VGUA 2ZEMA 1FK9A 1MWYA 4Z7CA 3GJQB 2EBJA 2NXEA 2FCKA 4OV1A 4FF3A 4HKQA 2OMOA 3JSMA 3P5TL 2FLNA 1U8SA 2EBGA 4OJHA 1X9MA 4NA3A 3V2UC 4FD6A 2Y0BB 2AJ4A 1BUXA 4C3LA 3PB7X 3FBFA 4WK1A 1RTJB 1J27A 3H4BA 4TXSA 5LYFA 2HC9A 3EC4A 5KFTA 5JVGQ 3D54A 5D4PA 1RABB 2CNSA 1YGHA 2BL1A 4HR2A 3TZYA 4QIVA 2KL8A 3NNAA 3HF5A 3UY5A 4X4NA 1K0VA 5C25B 1W2IA 2GCFA 3ET6B 1T8EA 4OI4A 3H2LA 1JKHB 3FH4A 2Z2YB 2DHAA 1Y0YA 2MHNA 1WOPA 2AV5A 3BF4A 4DYOA 4F3QA 1QSOA 1NK9A 7FDRA 4CYOA 4J5OA 3KHGA 4LBIA 1VRTB 3H90A 4X66J 4CTAB 3D66A 3CJSA 2WSAA 1TL3B 4HACA 1ZM4A 2DNOA 1EE3P 4L8AA 2B5JA 1M5OC 1S99A 3B3TA 1P9YA 3P49B 3QIPB 2ZUAA 4KOSA 1L5UA 2UUBJ 3OFGA 4B3SF 2AP6A 3BQ1A 4WU3A 1M1HA 1S12A 2HVHA 3RAQA 1S6OA 3FEDA 4OYIA 5J1QA 4NLXA 1NJIT 4DL3A 4OYAA 2J7UA 2ZVSA 5AXKA 3MUTP 4ANCA 1ZA1B 4XK8C 2VKZG 2GFFA 3CPXA 2FC9A 2WVFA 1SBRA 4ES3A 4UBRA 1QTNB 1RWKB 1DQ8A 2VOPA 4NLSA 1T03B 3TAMA 1KEKA 3B4DA 5H9FJ 2ZOFA 3I96A 2Q66A 1R57A 4MFLA 4FDFA 4M5JA 3TUZC 2DGTA 2MLZA 2P5VA 4WF9Q 2FDNA 2PIYA 4DS4A 4ZVFA 2LXFA 4OL8A 4UIBA 2XGQA 3V81B 4ZA1A 4QU7A 2LKZA 3MM8A 1PYSB 4EK2A 1YREA 1OQ6A 1HR0J 2KDOA 4LMZA 2I6WA 4FS2A 4OV6A 4IG0B 2BW7A 4LQ6A 2HRTA 3KMQA 1RHMB 3EXCX 2JEJA 1VQ4S 4NXNJ 1K0TA 1NZ8A 2AX0A 2A10A 4CO2A 2RHSB 5A8KB 1UFKA 4K4YA 3HSJA 2AYBA 3W6SA 4ECYA 4MY0A 2C1EB 3C14A 1BD6A 1XEZA 1EETA 4U6PA 2W9BB 1RUSA 3EZOA 2M3DA 3M1VB 2CKWA 4F50A 1KHVA 2EFVA 1O0PA 1ZBTA 2DPJA 3OJUA 5KG6A 3OFHA 4DFKA 5D0RA 1URRA 1F2OA 2B9WA 3PX0A 2RIJA 2DPSA 2ZC3A 5F8MA 3DLHA 3HHEA 4WJBA 1DQ9A 2UUCJ 2DRAA 3OD2A 4C8YA 1UA1A 2E5JA 4RN7A 2ZBPA 2CPEA 3BGLA 1ZM2A 1N5TA 4ZY1A 2AFZA 2K3KA 4WPAA 1H73A 3CGIA 4HT5A 3DHXA 5H9EK 2B8QA 2VC0A 2B6AA 3NMRA 3CJKB 3CCZA 4OJGA 3F41A 4NGRA 3FIXA 3G87A 3KG1A 1W25A 3NBPA 5FDLA 3TX8A 4J9LA 2BOAA 3QSYB 2RRBA 3F8KA 5FIIA 2E1MC 1CJTB 1T9WA 1AB8A 4O0IA 5IT9U 4CO5A 2DR8A 1ITPA 1GNKA 2PJ7A 1FRLA 3QGHA 4P72A 1VHSA 4ZVRB 2I38A 2ZVIA 3DU5A 4PQUA 2LU2A 4I6YA 2PJ3A 2DIVA 1SJRA 1BXNA 1ACMB 2E44A 3HKWA 4Q0BB 2FHKA 4C0HA 2KH9A 4OYBA 4JBCA 5CYJA 2ACMA 4B3MF 3MM5A 2K3IA 3BDPA 3UN2A 2WW4A 3EMTA 4B5OA 4WYLA 1Q8IA 4BINA 2B9XA 2OZHA 5DLGA 5FD1A 3I0SA 4LSNB 2CVIA 1UWBB 5G0RB 2HFOA 2KHCA 1IBLJ 3OVBA 3W5XA 4KHPJ 3C16A 4OI3A 5EWEA 3TQ1A 2KVIA 4YUDA 3CCLS 3MURP 2ZEDA 1ZAWA 2Y1LB 2MJUA 3NOCA 4HTJA 4DV3F 1Z8XA 3OSPA 3CW2C 3S9MA 2JVRA 2LXUA 4HDGA 2UZAA 5F8NA 2NUUG 2R2SA 1U09A 4OLOA 2D9OA 3Q8SB 3NGKA 2WSCC 2MZTA 2ZZTA 3KLGB 2G4BA 2W9CB 2C2NA 1CQMA 3DOKB 1F2HA 1HI8A 2GX8A 2GMHA 2HHHF 1IXKA 1OIAA 2XCAA 2Z11A 2E5IA 3M8ZA 1CVJA 3JVNA 5JJBA 4J91A 5HJYA 1M4IA 4AL7A 2B9YA 1JLEA 2ZEEA 3KUHA 3IXQA 4DL5A 3TO9A 2F63A 4HL9A 4IOBA 1LK5A 2H54B 2CTCA 1X0FA 3RB6A 1H38A 5CAAA 4N56A 3T9NA 2DJWA 3HO1A 2R2TA 5A6PA 1U2RA 4JI0J 2BVZA 2GJFA 4GKKJ 1VC5A 2M88A 1MG7A 2YWFA 4JI4F 1DAXA 2PEHA 4I2PA 4D3GA 5KTDA 2DEAA 1VLOA 4ZVEA 2QE5A 4E2AA 3IN5A 4C2ZA 4TU7A 5JM6A 4Y28C 1S1UA 1NDKA 1S7NA 1SB6A 3W64A 1X4HA 2EK8A 4XTTA 3H2VE 3MM9B 2C2MB 2VPXB 1TMMA 1EP4A 4URSA 4Y2CA 4DN0A 1QAJA 1MJ9A 1A9NB 2YNHA 2QIRA 1UVIA 1NHUA 4DSLA 4J9SA 4LX9A 1D8YA 4QIGA 4QYRA 4NI2B 4NX9A 1YLEA 2P8IA 5I3QA 2V8VA 2JC0A 1B70B 3EVOA 3I6PA 2LQJA 2O53A 2DBBA 4LF7F 3OV7A 4RBTA 1LWFA 4LRDA 2BRKA 1U2FA 3W60A 3CJQA 1XTZA 2VQYA 4GVBB 4Y0FA 4ZPDA 4RS2A 1D9AA 2KFYA 2FTRA 1IUJA 2V2ZA 1KD1T 3QQCD 2W7AA 1MK4A 2ZXVA 3SI8A 2QSFA 4ALZA 4Q45A 3PZJA 1X4BA 4TQRA 1R8CA 3LP1A 2PJ5A 4AG7A 1OSCA 5J2PB 2LA4A 3CIMA 3KJVA 2FJVA 1WHWA 4MK9A 2RDIA 4A38A 1T02A 4KZTA 4P6YA 1TK8A 2BO9A 1H2TZ 4DX8H 3FBUA 2KYXA 4H6ZA 4DV6J 4PR6A 3PRVA 5AXMA 4I68A 2AMCB 2BJ7A 4UCMA 4EGLA 3BKUA 3KKFA 4IO9Q 4OX9J 1BAVA 4JUZA 2OPRB 2RUGA 2VZYA 1NSAA 1IBKF 4PSWA 4YFJA 3TE4A 2DT9A 4MIAA 3OL6A 1CPSA 4C3KA 2QTWA 3TOQA 2XI3A 1SQEA 4C7QA 4M1KA 2BJDA 3GCXP 2D7SA 4LF5F 4ZY0A 2QVPA 4FUUA 2XO6A 1X4GA 5BYRA 2G0CA 4ZPWR 4BS2A 1F9HA 2LYVA 3SMZA 2R7HA 2G0JA 2NS1B 4FNHA 2ANPA 1I6JA 5C5JA 3V4IA 4JI7J 4JV5J 1EZZB 1R31A 2FIUA 3PEHA 1RXTA 1J5OA 2JVOA 2OPPA 3CCVS 2GU2A 2Y0MA 4F26A 1S9GB 4DCPB 4NLRA 2AX1A 3DLGB 4FPIA 3C6TB 3V6JA 1RU1A 2FVRA 1FERA 1XNRF 5JQ4A 4E8OA 4FS1A 3ZZZA 4R9MA 8RUCA 3SSSA 3KMSA 4DZDA 1S48A 2B8PA 3UE2A 3GCWP 3TVKA 4I7FB 1KR4A 3CD6S 1OO0B 2QLJB 1CJVA 3KLEA 2RILA 2V69A 4ED2A 4DMZA 4WWVA 3KDOA 3DRSB 2XHCA 1HBNA 1YBAA 3C19A 3MEGA 4HH0A 3LP0B 1HNWF 4NL5A 1ZZFA 4Y65A 4P2FA 3N0VA 2ALYB 4PAAA 3G86A 2EC0A 3KLFA 2F4VF 3GQCA 3IR5B 4MIBA 5JH9A 3QIDA 3UQSA 1FDNA 1FEEA 5DS0A 1LW2A 1Q1KA 1YQEA 1JLQA 1S6QA 2J8MA 1WHYA 3PX6A 3B2YA 5F0UA 5IM0B 1IYLA 5H84A 4ORFA 3PO4A 3PW5A 4N47A 3JQKA 3EJMA 1K73T 2BANB 4R8UA 1Z4RA 3WX4A 2HQGA 1TKTB 1KUVA 4K30A 1JLBB 5DQIA 2MGZB 5F9LA 2MJNA 4DV4J 5HP1A 3BO2A 2IHR1 2C2EA 3CE8A 3BV8A 4C8OA 4OQJA 5GAHI 2HVEA 1SKSA 5A2QU 3QRQA 3D3SA 3ZC4A 3BS9A 1Q2DA 3HT0A 4NOHA 3FRYA 3S6GA 2PFDA 2X51A 2YNEA 3VCDA 2KM8C 4I2QA 5K8PA 1TL4A 5E3QA 2DPTA 4OX6A 1XOVA 4K2JA 4FYVB 2VXKA 1I51B 2R8JA 1P1TA 2VHGA 1S57A 1S7IA 3PJXA 4RW4B 4C8LA 3KOAA 2E7WA 5HMNA 2ROGA 4DR6F 4CO4A 1FWKA 1ZAXA 2IBOA 4ZX8A 2HFSA 3NCPA 4K0KJ 3G6XA 1PAEX 3OVSA 1QSTA 3MMBA 2W01A 1RGVA 1OYEA 2HHUA 3ISXA 4ANEA 1U25A 4X4RA 3DRRB 4C6AA 4KGMA 2UXBF 1F57A 1TL1A 1U8WA 5KFGA 2G13A 2OEKA 2PGCA 4HI2A 4IFVB 4ED3A 3BO4A 2NXUA 3I1UA 5GMKa 1IB1E 3MEDB 3J81Y 2RDJA 1FVSA 4ECRA 3CJ0A 4ZVGA 1F5AA 4NE9C 1GHEA 2IMWP 3X3UA 3JYTB 1RCOB 2BBEA 3FMWA 2ZH6A 4NLWA 4ZVPB 4MCRA 4PYAA 3POTB 4ZK7M 2OPQA 4PCQA 5T14A 2IY5B 2WYRA 3D7FA 2DNRA 2FY8A 4MK8A 4LFBJ 5DG9A 3EGNA 1EKSA 2MY8A 2AYGA 4RNFA 1PSDA 1F1BB 3MMAB 4FKYA 3O44A 5K14A 2WOMA 4BCAA 3AD8C 4P4EA 3F56A 2UU9J 5A6WA 3MAAB 4JP8A 1U1MA 4JXRA 2V50A 4KHMA 1HNZJ 1FK9B 2LDYA 1IKVA 4IDKA 4IOCQ 3I32A 5H1SV 4PXCA 3WC0A 1LWCA 2FHOB 3LPYA 3IU1A 3JSMB 3ETOA 1Z8TA 2F5IA 2R9LA 3NS5A 2BR0A 2ILYA 2PVWA 4UEFA 3CJRA 1SJFA 5GMDA 3LW5C 3KYLA 4A46A 1UTAA 4AVAA 2GMJA 4FYWB 3OL9A 3I82A 1B0TA 3PO5A 1WOOA 1XF8A 3WX8A 2RD5C 4CWBA 3AB4B 3I5CA 2C28A 1U4BA 2KXHA 3BR9A 2NCKL 1YI2S 2RDDA 1YWXA 2FUG9 2MSTA 1S1WA 3DDKA 4PWUA 5CA5A 5F3ZA 4AUKA 2E5HA 4M6HA 2OIHA 2BMBA 4OC0A 3PNIA 1WEXA 1VHOA 2FHMA 3H59A 4HACB 4WIIA 3QWUA 3D7GA 4DV5J 2C1CA 5KFRA 4XDCA 1IQZA 3FJ2A 3DHWC 2PSWA 1W2BR 2RE1A 4NASA 2OOTA 4QCLA 3E8OA 4Y2KA 1XMQF 3CCQS 3R5DA 4KY3A 3FXTA 1WKJA 3N28A 1Y5NB 4DUTA 3NMAA 4X65F 3HKZD 4UUWA 4QPXA 2XS5A 4WFYA 2AGQA 5KFZA 1A0OB 3NG8A 1FNMA 3DKDA 4ECSA 5LL6d 1N71A 2YY3A 3MCMA 3C2PA 2GO9A 3BGFA 3PRBA 2EK1A 1FWPA 1H72C 1RTZA 4DX7A 4A32A 5F8GA 3CCTA 4DSKA 2B4PA 4ID5A 1D09B 3TAMB 3HVRA 4TKTA 1K47A 5L8RC 4ZBGA 1RTHA 3VVTA 2LQ9A 1RADB 2RC4A 3GJSB 2F8HA 1Q5VA 2I9SA 2KKHA 1U1KA 4MTPA 1IJEB 1T9VA 3TJ8A 4P4FA 2UP1A 5HMWA 3MM8B 2Q43A 4OMEA 4NSQA 4PG5A 4ZP6A 3JSRA 1FF2A 3O5TB 4MMOA 3QLHB 1NSPA 5AXLA 3HT3A 1URNA 4F9VA 1NK7A 1DLOA 1C4AA 2CPHA 2XB2D 5KFYA 3NE7A 3FEEA 2R1IA 5L38A 3C66A 3C14B 2DXQA 5BR8J 3HLUA 2OD4A 1EETB 4TYAA 3IEHA 3C6UA 4PXEA 4UY8T 2G2ZA 3AXKA 2B3UA 3SI1A 2IPOB 4DV1F 1TKJA 2L08A 1ZYQA 1GTEA 5KFUA 3NP5A 4GO7X 5L9NA 2BA9A 3NOGA 2DKOB 2PVVA 2KM8B 4ERDA 2XYHB 1ZLHA 4RPFA 3CIZA 2Y1RI 5KFAA 4LRAA 1N33J 1B87A 3NA6A 3L9ZA 2B6AB 3FCVA 3TYTA 3V8IA 1QQ9A 2J9DA 2B0GA 3LAKA 3FCHA 4HYKA 2P9GA 2LECA 1V0CA 2PRBA 1HQEA 3R7NB 2GREA 1C1CA 1NJZA 8AT1B 3VGSA 2J76E 1NSKL 4J9VA 4DPXA 1KLMA 4J3GA 3R97A 5IV0A 1RTDA 4C11A 1HWKA 3I0RA 1VHIA 2ZH7A 3LMSA 4N77A 1B6BA 5LOQA 2HEKA 2GO8A 3EZ5A 3HXMA 1YK9A 5LYIA 2ZNYA 4ETZA 3PHEA 2JH3A 3P5BP 2PEBA 3JS9A 1LAMA 3I0SB 5F47A 3S6HA 2DR6A 4KKOB 2OP5A 3D1QA 2V63A 1DURA 2M7SA 1S7FA 4NGTA 3C16B 2W7OA 4NZ7A 4ED8A 4HDHA 4OIXA 4CH0S 2RS2A 3T8WA 5KT2A 1SH2A 3IA0A 5F0WA 2O01C 3R8YA 1TK0A 3EYZA 4BWJA 1Z2ZA 5D15A 2HG4A 3QT6A 3MEEA 4A2ZA 4LF2A 3OVAA 1TV6A 4TNUA 4HH1A 2PR8A 1T0TV 2B43A 3UN5A 2KN4A 2XEXA 2ZEGA 4Q2LA 2D3UA 4NLGA 3QRPA 1WACA 4ELVA 5E3AA 2B4BA 3TI0A 3GSIA 2H5MA 4A39A 3IGVA 1FE4A 2GNKA 1SJQA 3EGVA 4R5PA 3D0GE 1JWQA 4NLPA 4WBFA 5E3PA 4H4OB 3I3GA 3D7DA 3PRTA 1DBDA 4MXUA 4MKVA 1JLEB 1Q8LA 2HMIA 4J9OA 3SCIE 1CM0A 4I69A 5D8HB 4ECZA 5C24A 1G1XA 1T11A 1TL5A 5J1EA 3IM9A 1U2CA 2WHOA 4M8LA 3CZXA 4NCAA 2A6OA 2QN6B 1S6PA 3MMCA 2HLTA 4I2PB 2QT7A 3UR3C 1GMVA 5G21A 1RI7A 4RO0A 4C2MA 2XI2A 3ETMA 1HBMA 2YX7A 1S1UB 1NEEA 3SFGA 2L9NA 2Z10A 4XDDA 2V9WA 3HX9A 1UVKA 3GY9A 3H2UB 2EW9A 4CLZA 3EUNA 1ZG9A 3T41A 3Q8PB 1R7IA 4HHJA 1EP4B 2GZOA 1VLYA 4TLQA 3FBEA 4ECQA 4NCGB 2YNHB 1NB7A 4ZOSA 1YTYA 3TJ9A 5A0YA 5ISVA 1VQ7S 2FL4A 1S1VB 3BPDA 3NXZA 1LAPA 5CQGA 3M9MB 3GIUA 4OZ5A 3CPAA 2HWIA 1HL6A 2IMOA 1LWFB 3UWTA 4X4UA 4DU8A 2CPJA 4FNIA 1RA7A 5IQ6A 1DRZA 3OL8A 1V6HA 3PTWA 4G6VB 1PJ6A 4NXMJ 4B17A 3IWNC 2VDIA 2V4RA 5CYMA 1JJ2R 3OXLA 2CG4A 4QB9A 2RH3A 4KRWA 2H9ZA 3Q8RB 1NE9A 4I67A 1EJ7L 1PCAA 1N5VA 5T41A 3ZO7A 2Q44A 2OELA 3I31A 3EGZA 1Q86T 3L09A 4YGOA 4A30A 4N41A 1BQMB 3UFCX 3QATA 2JEWA 3I87A 4DV3J 1JNRB 2XYPB 3KDNA 2IM1A 1P0HA 3CJ2A 1N5QA 2ZH5A 1N36F 3QT8A 3W91A 3HSZA 3H8GA 3ISNC 1QTMA 1NK4A 4EYHB 4ZN1A 2BABA 5DDRC 1T9TA 5IT9Y 2OSRA 3NH4A 2HQ3A 4C3MA 2XS2A 2V2VA 2D3O1 2OEJA 1UVNA 5DWMA 2VD3A 5DRKA 4K4SA 1RKIA 2OZUA 1MMLA 3VAFA 1HHQA 4WFXA 3CXQA 1SC3B 3M8PA 3CJ3A 3V4IB 2HNDA 2AJFE 2VF3A 2WVCA 3LQVA 3TA2A 3B54A 1ZS6A 1IKWA 1LWEB 2OPPB 3L7OA 1NK6A 3IBFB 3OFEA 3EO4A 1RZMA 1XJWB 1RXOB 3KNAA 3L7UA 1EX8A 1FVQA 2VPZB 2PJ0A 4Q36A 4DG1A 3Q22A 3RYOA 4JI6J 2XS7A 6CPAA 2DNPA 3G82A 4TNOA 5I3PA 3TA0A 2V4QA 3GV5B 1XN9A 4NRUA 3PZPA 1FKPA 1I1DA 3HD1A 2XLIA 1CJVB 3KLEB 3TAQA 2FJWA 4DSJA 4M5GA 5CH7B 2VPYB 2XSFA 1PJ5A 4MFQA 4ZIVA 1HBNB 1PBUA 3MEGB 4JJXA 2F7VA 3TCVA 5KTAA 1RO5A 3KL9A 3C26A 4KUAA 5J2QA 3O2IA 3CCUS 2Z2MA 4L76A 4D3HA 2ASJA 4M5LA 2F40A 4Y49B 2XYGB 1WF0A 3SQGA 2QYVA 2BE7D 2JZ5A 4MIWA 3IR7B 2J8SA 2VASA 3W8PA 2N3OA 2RKIA 3BB5A 3CCWA 1B7FA 3I55S 2QV6A 1BQXA 1OWXA 2PDAA 1VCTA 4LF7J 1F5BA 4E0DA 1OY9A 4R8UB 4DQSA 4KGXB 4WTOB 5ETKA 4E0AA 2QL9B 3NWGA 3NFZA 2DH9A 2BEIA 2IVYA 2EKNA 1FDDA 2W2OP 5RUBA 5JPHA 3DRYA 3HD2A 3HHNB 4DLEA 2A2DA 4X66F 2FGCA 3BR8A 1E6VA 1GAOA 3MPUB 4L75A 3GP9A 2FJAB 3TT2A 4I2QB 4RW7A 5MLCV 4IUSA 1U02A 2XLJA 4WZQA 2CIMA 4KGVB 3E51A 1SXLA 3PCOB 2UUBF 4IOAQ 2HYIB 2WVBA 4PG7A 1KVIA 1KUXA 3LUYA 3NGDA 1KSPA 2G3TA 4RUCA 2HHWA 4Y00A 5HANA 1NH8A 3BSCA 3U1MA 2ZEHA 1IOFA 2BSWA 4LREA 2RQCA 1N6QA 2C2OB 2KFNA 2ABYA 4NWBA 1FT8A 1S0MA 3TZXA 3PHTA 1VKCA 2AD9A 3FYNA 1HR0F 1FXDA 2IM2A 2KZZA 3PIPQ 2JFDA 2GGPA 2OPQB 4P2MA 1H7WA 3J7YI 1N48A 3CMES 1N5YA 2MYFA 5K8MA 2HVDA 3CJ8A 2VOOA 2JOQA 1BY9A 3JRUA 1RAEB 2PIZA 3Q8VA 2GHPA 2MSSA 5KFBA 3IWWA 1CULA 4EU0A 2QMXA 1HPZA 2VFUA 2ROPA 4UFXA 4JWPA 2QA2A 5G1ZA 1FT7A 3OT9A 3R1HA 3GFYA 5J2NA 1QVGR 4R8FA 1IKVB 4IDKB 4ZI6A 2IC3A 1BGXT 1LWCB 3TAPA 3WABA 4DHVA 1H3DA 4PKDB 2UUCF 4QYZK 3IIBA 2NSBA 4LQGA 2F4VJ 3FEZA 2VB6A 4X62F 1M5PC 1EAYC 4MJKA 2YX4A 5F9NA 2R8GA 3EX7B 2G2OA 2J6TA 4P7VA 1F9FA 1PAUB 5E0OA 3F44A 3WT4A 3WC6A 3GV8B 3TZWA 3TO6A 1JMTA 4FXDA 2CDRB 2FVQA 3CCES 5A28A 3OW2R 4CLYA 1HA1A 5GVQA 2DR9A 3LWUA 3OFFA 4USMA 3ET6A 4U67Q 2Z0ZA 3W9JA 1KOHA 2CJ9A 1AUSL 2V2KA 3AQPA 1TUWA 1S1WB 1HWLA 5F3TA 4XO0A 2GIFA 1U0SA 1S10A 5BJRA 4CCHA 4C2XA 4K4TA 1HYSA 2I8EA 1WORA 4Z2XA 1ZO0A 2QMLA 4JI1J 3SDEA 4LR9A 4KS9A 4WU2A 1HNXJ 2QLBB 1RT3B 1XQIA 2K2PA 1T05A 2GIVA 1DJ0A 4OC2A 1AW0A 2DGOA 2Y1JA 3W5YA 1G7CB 2H51B 2JEIA 3VF0B 4OI2A 4DR6J 3FC9A 1IBLF 3C8YA 2IVMA 3IR6B 5IV4A 4Z65A 1S6UA 2N3LA 2KRBA 4A48A 2GQ2A 2RQ4A 1RACB 3QZ7A 2OD6A 3W3SA 2UXBJ 3B4MA 4IRCA 3KTQA 1UFHA 4ID5B 3TWZA 1RTHB 3GG1A 4ZCLA 3PBBA 4WFAQ 4JB8B 4CO0A 4UT4A 3CXCR 5BWAB 3DGVA 1YBUA 3BGUA 3U02A 1R0CB 2HBZB 1GXLA 3PV8A 2FZGB 4MCQA 4A8QA 3V81A 3J80U 2R7TA 2JC1A 1RWMB 1IJFB 4CLUA 2ZW5A 3R3TA 3H4QA 2HUZA 5A2QY 1UMJA 3BHXA 1U1NA 4OYZA 2N82B 3MUVP 2EG2A 2HFVA 3ISZA 3CMQA 4OHXA 2IM0A 3BYRA 1GMWD 1QSYA 1X60A 2EWBA 2ARHA 1PJ7A 3BQ2A 7AT1B 3K17A 4HVZA 4DPOA 4JI0F 5AT1B 4GKKF 2W8LA 5CCMA 4DPYA 4MKYA 2EFQA 2NXCA 4PPZA 4UCPA 1U0HA 1AROP 1HQUA 2XHWA 4ZCMA 5KFOA 2VA2A 2AFXA 3VATA 1N88A 1VHFA 1TP7A 2KI2A 4YWYA 1WWZA 1KFSA 2HURA 1UVJA 1RLCL 1KRPA 2EFOA 2L48A 4NLVA 2E1CA 3MECA 4R3LA 4U9YA 4KOUA 2BEFA 3ILIA 4X4OA 1DTTA 3ENVA 4W92B 5GCNA 3CJKA 4W90B 4USUA 3MR6A 4F2RA 3L7PA 4DV2J 5LT5A 5AG4A 3Q0AA 1DFDA 1C1CB 3N5FA 3MPVA 4NZ6A 2AWZA 1CJTA 2DXFA 4CO1A 3VAGA 3O1LA 1Y7RA 1Q95G 2B5GA 2VI7A 1LXJA 2M52A 3K58A 2R7UA 1PU9A 3D7SB 1TAQA 2H65B 4TLRA 1RBOB 3TO7A 3J7Z5 1SJ4P 1SJ3P 3NGRA 1U6BA 3I0RB 1SKWA 4B5PA 4WXOA 3I4HX 1VK8A 1DZ5A 1TVRA 4Q0BA 1J4JA 4YDDB 2HS4A 4U8VA 2XQCA 2HFUA 3AQOA 4P4DA 5CYQA 1CJKB 5KFEA 4OLLA 5HMZA 5DG8A 3RRGA 3SCLE 2BM0A 4NCZA 1NKEA 1FTRA 2NSCA 3AXMA 2HGMA 1Q4RA 1RWNB 1FX4A 3GG0A 2CPDA 4LF1A 3M6VA 4O3NA 4LF6F 3GV7B 1FFWB 2CNLB 1XR5A 4GMKA 1NK0A 4DV6F 2DGXA 2PC6A 3AD9C 4OX9F 4QVTA 1NH7A 4P7TA 1OS5A 2V8DA 4LF8F 2VBWA 3T1AA 1I3OB 4FYXB 1RWPB 2PT0A 1YHQS 4ZJOA 3S1TA 3S6KA 4JI8F 4NMLA 2DVIA 1WKLA 4LF4J 2QFJA 1TV6B 3V4MA 4C7HA 2GAGC 2V9KA 1TKDA 3EM1A 2ZEFA 4JYAF 5DDQC 2W9CA 2R4FA 1UWYA 4B13A 1U1PA 1FXLA 3K5OA 2YNCA 4XPKA 4DXLA 4DOZA 1YX2A 2MKKA 4FVMA 3F0NA 3VAJA 4R5PB 3IG1A 1CG2A 5HXDA 4UQTA 3FEXB 2ZDPA 4TY9A 2WPXA 1FJGJ 2EVNA 3E3XA 3L2NA 3K9TA 2QL7B 9RUBA 4I49A 3A3OB 1Z4EA 3GR1A 2JDCA 2MZJA 2MKIA 5C24B 3Q2SC 3EXNA 5J1EB 1FKOA 3B8GA 3WDOA 1P4NA 3ZJ0A 1T7PA 4V19X 2YKQA 1WJ9A 5L1JA 2RU9A 1QSLA 2XEJA 4DV1J 4ILMA 1J5EJ 1S6PB 3DOMA 5GAEI 1UJ4A 4DR2J 1D9FA 2H5JB 4K50A 4UW2A 4CLLA 1GT8A 4HTIA 1FJCA 1HBMB 4CGPA 3PX4A 5ETNA 1EB0A 2ZZMA 4KT0C 4JI3F 4KHRA 4OIDA 2DYAA 2VQEF 2QYCA 2RS8A 3TARA 4ZP8A 2R42A 4OI0A 3M2UA 5ETTA 4KVME 3SSQA 2KTQA 5A0YB 1F3VA 1RT5B 4ZJQA 3IC1A 2G0BA 5C82A 3ZTRA 1WC0A 4P45A 3ILLA 3KG0A 4KPYA 4H4KA 4U7CA 3GIKA 4CI0B 3T90A 3A12A 4OZNA 3EPIA 1B99A 4BC7A 2CQBA 4DQRA 2EPIA 4O3PA 3K7RA 4DV4F 3NCQA 1DY3A 2MKCA 5HQMA 2PIIA 2XMVA 1X4AA 1EKRA 2QLXA 2OU2A 3M32A 4UOCA 5CYMB 5J2PA 5K9FA 1XK8A 5D4LA 4JXQA 4HNWB 2CZ4A 3THTA 3BGRB 4EFDA 2CY2A 5F8JA 2CPFA 4B6ZA 2VBYA 2HQIA 3BEGB 5KFLA 3MR3A 4WTYA 3MM7A 2PJ8A 4GM5A 1VQ6S 3ENWA 3KKWA 3LALA 2UXCJ 1S9FA 1ELMP 3BH7B 1PC5A 2C2DA 4NEYA 2NYQA 1NZAA 3BPSP 1QUPA 1VQ5S 2OPRA 3H5UA 2XNRA 4P75A 1LANA 4K0KF 2GANA 4ZLLA 4U96A 3IO1A 1NDCA 1H7XA 2JL9A 4CM2A 4PPDA 2LQ5A 2W25A 2IJRA 1FRMA 2W24A 3PACA 3C3LA 1YBTA 2GS8A 1LW0A 1CC7A 3D6HB 4PYDA 4LFAJ 4KAIA 2ZM6J 5D0HA 5H9FK 3QZ8A 1YJRA 1UL3A 3KNGA 1DTDA 2JWNA 3PYDA 1VQSA 2NUHA 3D2MA 1VRQC 4ZN3A 3UR0A 4ELUA 2B4UA 3GILA 5EGYA 2CJXB 3J81j 2DISA 7CPAA 2G1HA 4OHYA 3QJLA 3S9LA 3M8PB 2HNDB 4ZLJA 4ANDA 4DPWA 4F4XA 2CWXA 3M9NB 1WSVA 2PA8D 2YQ3A 4OC1A 1YW4A 3MUMP 3DLGA 3C6TA 6FDRA 4CRZB 4FF2A 4I64A 4DG1B 4LBPA 3CULA 2R8VA 4LFBF 4FYDA 3ZNJ1 3G82B 3LACA 2KU7A 4X64J 4M94A 2DGVA 3ZTOA 1RT6A 3HI9A 2M0GB 3NGUA 4DR3J 2DRDA 2QA1A 3K5NA 1XMBA 1FKPB 1HQ2A 2F8MA 1ARMA 3LO3A 1IWGA 2IYIA 2BKNA 3TA1A 3FB3A 4CPAA 2UU9F 3NKYA 1NK5A 5HAOA 4OC5A 1U7LA 1REVA 5KFWA 5T7LA 5J2QB 3B82A 3QAUA 1YKWA 3VAMA 2BJ9A 2KFZA 1JK9B 4R0JA 4CLPA 2GC8A 3K57A 2DNGA 3SXLA 3DC2A 1RAAB 3CWJA 2UV8G 2VH7A 3SQGB 2HQYA 1TMJA 3FK4A 3M6XA 1LNQA 3D6TB 2VIHA 4AQYJ 2CVEA 2BV3A 1RJJA 3IMQJ 4ECXA 1M90T 2KT5A 1Q7LA 1NJWA 3GWCA 1VJQA 4QPTA 3P96A 1WC4A 4O23A 4EUVA 3K59A 4TU8A 1NMTA 3KLHA 4AT1B 2CAJA 1ZTWA 2X1BA 3ENQA 1HFEL 4ID8A 3B3SA 1G4CA 2XC9A 3LWLA 2FIAA 2B7BB 3M6WA 2Z30B 1PKUA 2GHVC 4YHHJ 5BYQA 4DV5F 2HPUA 4ZP9A 3BH6B 4DUYF 4RW7B 1U1RA 2IIHA 4LUAA 1Z4UA 5B0BA 4WFBQ 4KFBA 1FEHA 5AJ3J 1P9QC 4OHVA 3FFIA 3SYZA 3J7AN 4DPTA 1D9DA 1N36J 3ELHA 2O5DA 3PJ9A 2N7CA 2B9EA 4ED4A 1FRXA 2YWWA 1UEUA 4IFVA 2CQ2A 5JXSA 2L9DA 4EEYA 5KG7A 3DSBA 1N6QB 3PW4A 5AXNA 1A2ZA 2CJYB 2P6TA 4DR7J 1TQLA 2ZW4A 1HMVB 2BW2A 1QE1B 1F9EB 1BPMA 1OZPA 4ZVOB 3VWDA 3TFYA 3B78A 1A7GE 4B14A 1HBUA 3CXSA 2GGPB 3WC2A 3GYXB 3D2PA 2QJ8A 4J9PA 1IGBA 4DEZA 1RAOA 1N52B 3SEOA 5GAGU 1NHVA 5E3CA 1EQMA 2AJQA 2H48B 2YVSA 1PYOB 1GMUA 4BWMA 3DYAA 5BR8F 3HVTA 1RHUB 1HWJA 1HPZB 4MHYA 1UKUA 1Q5YA 2L9WA 3DR8A 4NGMA 2OO4A 2AEFA 1IU8A 4UTGA 3MAAA 4UOHA 2X1AA 1JXEA 5J2NB 4OI6A 1NLKL 3TX0A 2CQGA 2IC3B 4EMDA 2WSFC 1UVLA 4MYTA 5SZTA 1LRZA 1Y00A 3RBZA 3D4UA 3QBCA 2C6CA 2AU0A 2YNCC 1S7KA 4L72B 5B7WA 4YP3A 2QMWA 1N33F 1ZAVA 3JB9k 5E96A 1XNQJ 2RU3A 2WRMA 4EVYA 1M4DA 5GMEA 1VJWA 2MPUA 4KE5A 2ZE2A 2BYCA 5K8NA 2M8HA 5AE3A 3OTBA 4K8RA 3NNCA 3AAWB 2A0FB 1S3ZA 4R6TA 1SVDA 4CZCA 2UVRA 4YDXA 1NMEB 2XLKA 1QUVA 2QYGA 1S5ZA 4J9NA 2G9OA 1BMQB 3FZBA 1XC9A 3SJEA 3DDNA 2CF4A 4O3RA 3G8SA 4RW8A 2CQ4A 1WK4A 4I6AA 1HYSB 4X4SA 3VV2B 1S76D 3DOLB 3SDEB 4U7UD 2RNEA 4B3RJ 1TU0B 2WBRA 2KJVA 3RNZA 2UXDF 4OZ0A 1TFWA 4K59A 1T05B 4URQU 2VPWB 5KFCA 2W8KA 3LA0A 4NZ0A 4DR5F 1K9MT 5LRJA 3CO9A 1S77D 1TF8A 4CP5A 1YRXA 2E9TA 3K5LA 1KTVA 3A4TA 2NR0A 2AGOA 1I94J 2GW8A 4L3KA 3K8VA 3KR4A 4O3SA 2V8GA 4NA1A 2YWKA 4YR0A 4L89A 4CYQA 2P9EA 1RWXB 3UD3P 4IH6A 1TFYA 2ZHAA 2ZBQA 2OKQA 4H4KC 4GC7A 3B3WA 3K89A 4LSLA 2QA4G 2FHJD 2CZVC 5DS7A 4MFBA 2DGSA 4CNYA 1S9EB 1BOBA 5FJ4A 2CFXA 4YS2A 1MLAA 2MB0B 4HHUA 4RL1A 3WBZA 4WFNQ 5LMNJ 2BKOA 3PG9A 4HNXB 2PJ4A 1TZ0A 3BN4A 2DY9A 1Y5LB 4EMEA 2XULA 2MDAA 4BBYA 2NQPA 4OZLA 1H8LA 2ZHOA 3QMQA 3QLHA 4F0MA 3A8KA 2C3MA 4TU9A 2UVVA 2OR4A 1VISA 9ATCB 5D0EA 4MFZA 3RB3A 4U5YA 3W9HA 2AFOA 4ZCIA 1M4LA 4DDFA 4A47A 3TEGA 1V5IB 1WC3A 2FPHX 2JBJA 3TUIC 2PE8A 1X4CA 5LRGA 2OB0A 2N7YA 3BN7A 1ZTTA 2OEMA 4Q38A 4H54A 1SJ1A 5EX3A 4NJRA 2QRRA 3GYNA 3SIPB 1NJXA 4WP3A 1YLOA 1O5JA 3NAHA 4TWEA 1H98A 3C46A 1U0HB 3RO0A 1HQUB 2CNKB 3FUYA 1VGYA 2CDQA 3V6DA 4UCNA 2J9EA 2DH7A 1JXVA 4A8KA 3SXNA 5B0CA 1F3FA 2O1PA 1HW9A 1NSLA 2G3AA 2EWHA 4X62J 4B11A 3FCWA 4TY8A 4IRDA 1YIJS 1RYSA 1M44A 2MHEA 1LFPA 2RQMA 3MECB 2MKJA 1N54B 2JLMA 1IR1A 1W26A 1JNZB 2VC1A 1DTTB 2GJIA 5KT5A 2K1RA 4DL0C 1LWXA 2ZD1A 2HFZA 2VQFJ 2DHSA 3MR2A 2BX6A 1R8AA 3OR2A 4A8SA 4ZCKA 4AB7A 3JSYA 2B5GB 4PWDB 4CS0B 1FXRA 4LT6A 4UWJA 4RX6A 2U1AA 1XE4A 2ZBCA 4QWBA 2E9ZA 3US5A 2VJUA 2RVJA 1Z8LA 3O3LA 4WK3A 4RBVA 3CD7A 2FVCA 2UUWA 4B5PB 4RZRA 1TVRB 2IM3A 2MKYA 2LEPA 4QIFA 4ER8A 2WTFA 3MZIA 2L3MA 4NXMF 2PN6A 4Y2IA 1TELA 2CIJA 1R89A 5CYQB 2GFQA 2E1RA 1U26A 2E9RX 4FZVA 1L3SA 4KKOA 4OC3A 4K5SA 2FLOA 4WIQA 1WKKA 3AD7C 2DGQA 2ZEJA 1YJ9S 2GAHC 4LRBA 4AXIA 4DUZJ 5DGBA 1Z1ZA 4DV7J 4V19J 1B0PA 2P6GA 4LJMA 3H5XA 4PQAA 5IOLA 3BO3A 2O28A 2KB2A 2XTJP 1AUGA 2R8KA 3I9V9 1HD0A 2GIRA 1ZPVA 4LRFA 3MCSA 2NXNA 4UWIA 1BLLE 5KFPA 2DB1A 4ES2A 1U48A 5EDWA 2HQDA 2LVWA 5DDOC 3G6ES 1RE1B 4YEAA 1JLCB 2MZSA 4C8KA 3RBUA 3IG1B 4H4OA 3N01A 3BSNA 2H5EA 2HQCA 4AD6A 2CQDA 3KJNB 4IO1A 1Z8WA 4GC6A 2MEWA 4J37A 4NA2A 4M5IA 3KK3A 2FJXA 3CDXA 1K4JA 1FI4A 4HNYB 1VDHA 1RTIB 2BRLA 2XGPA 1FKOB 4JI6F 4GXHA 1V5VA 3MPDA 3G71S 1TF9A 1MWZA 1UP1A 1F0XA 2BJ3A 5GADI 2NMTA 3DOMB 3CD5A 1VQOS 5ETMA 4OX8A 2J9DE 4RW6B 1X5PA 4OMFG 4USIA 4I6WA 2HS0A 4LR7A 1HI1A 2IJFA 5B0GA 5F09A 3IRXB 4KIAA 1JJCB 3IGRA 2DTJA 1G3OA 1FY7A 1SI9A 3Q8QB 1WC6A 3M2UB 1P27B 4ENOA 1YJTA 4DPUA 3SCKE 4NCGA 4ZDNA 4DFPA 4CT8A 1B3TA 1UCNA 3J80Y 2D1CA 2XMWA 1S1VA 1X0PA 1M0SA 3D1HA 4R76A 3PKYA 4A37A 4O44A 4BC9A 5THWA 1E6YA 3FRMA 2O4HA 1Q0NA 2ZC4A 4K4WA 3PW0A 2MY7A 1XMOF 4NJQA 2YTCA 1Q8BA 1VRUA 4P44A 3LP2A 2D41A 4G1QA 3FEYB 3M32B 1F5CA 3R27A 5LSLA 2HB6A 3EICA 3F0AA 2Q7SA 5CPAA 3NE8A 3M8QA 2HQFA 3VR1A 3T1HJ 1MJAA 4Q8EA 4UZCA 4LF6J 3GSDA 3MM7B 3T6BA 1U1OA 1BC6A 1YDLA 2M9KA 1FNXH 2QZ8A 3KHRA 1F2PA 1D8ZA 3VH9A 1BQMA 3CEDA 3QAHA 1PYTA 4LF8J 4FXVA 2KHDA 4YR2A 1O6XA 4OX7A 5CZVA 5D0GA 5DM6Q 3SJGA 1KQFB 2QMUB 5KTQA 4JI8J 4DSFA 2X1GA 1FFGB 5JUMA 2IFXA 4R3KA 2F1FA 1X4DA 1LW0B 4JI5F 3ZTSA 4DBQA 1CP6A 4JYAJ 3EZUA 3ZZOA 4F8RA 2GVZB 2CNNB 3T1YJ 3LOUA 1YQHA 1H0HB 4QYZJ 3B8HA 4NLUA 2RQKA 4NLYA 2W4CA 3VARA 3AB2B 4ONUA 4QIWD 1RTQA 1KQKA 5E7OB 4ED5A 3KUGA 4FXWA 5M2PA 3QWPA 4AL6A 2W1BA 1PG5B 3GIMA 1HWIA 1LWEA 5KT3A 1SIWB 2EBEA 4P2SA 5AG5A 1NDPA 3EVWA 4DV0J 3M2RA 3QT5A 2CUYA 1S1XA 4C8NA 2B4OA 1RT6B 4PG4A 4OJ3A 5A8WA 4UOFA 2ZOMA 2YH1A 3EY5A 4ZMMA 3Q89A 1QAIA 3MN8A 2NZ4A 4CRYB 2ZEPA 1KVKA 1YR0A 4YY3J 1G2EA 3W5ZA 4DX6A 2I79A 3EXYA 2AFMA 1REVB 1KFDA 4E8UA 2FIWA 1GX6A 5T7LB 1RSCA 2KJWA 3ISND 4ZIWA 1ZETA 4O0NA 4JI3J 2LMIA 2CADA 1SUQA 4Y6IA 2BJ1A 3KK1A 2VQEJ 2C3YA 1S49A 2YNGA 3EGWB 1TKXA 2CPYA 4XPLA 1DQAA 4RJVA 1WHVA 4MFPA 4Q44A 3UDLA 1NCLA 4CGOA 3B6BA 4P4BA 2JLEA 4X4PA 4DR1F 4USJC 4J90A 2RAQA 2KG1A 5KFIA 3SV4A 3TC8A 2G0IA 2AGPA 1QAYA 1Q7LB 3VWSA 4NGQA 2DNHA 1U6FA 4GRSA 2AE6A 1NAQA 1MMDA 3K5MA 2HGNA 4AVCA 3ONQA 3DGPA 4DX5A 2C27A 3KLHB 5HL7Q 2MMYA 2HNZB 3W66A 4X5KA 1WI6A 4ILRA 3HDSA 4JI1F 5KOWA 4B9NA 1HNXF 2QEXS 3FQKA 1C0TA 1CJUA 2QJ3A 3KG4A 4NLDA 2XBPA 2AFWA 4O3OA 5CD4A 4ZKAA 4C4WA 1RAJA 2VFSA 1MNEA 2I00A 4KFBB 1CJWA 1S4EA 3JAMU 3FFIB 4FF1A 3SCJE 4OYOA 4ED1A 4H2KA 1R0AB 5KFQA 4USTA 1LOUA 3KLIA 4F6AA 1RB0A 3M2VA 1IOIA 4A94A 2DHGA 4QWDA 3GYGA 4OFZA 2IRYA 3TQEA 2NYHA 3GFHA 1IVZA 2VA3A 3LGNA 2KXNB 2XM3A 3GYAA 1HLWA 3R5AA 4PSXA 4CNZA 5MAOA 2HBYB 3QO9A 2EFGA 4DSIA 3PJWA 2YPYA 3HPOA 1YVOA 2FZKB 3FSYA 2BE2A 2K8GA 3AJDA 2NREA 3H8FA 2JDJA 5A8RA 1WUUA 1HBUB 4J7CA 4OYWA 1UETA 1SQHA 5K8OA 3R95A 1AFJA 2M8DB 4MH8A 4DFJA 4ZPCA 4YQWA 1D0EA 4DZ6A 2H4YB 1QSMA 2HWTA 2HRYA 3I9SA 4CLKA 3DYAB 2YQ1A 2AF6A 3HVTB 2YKNA 1RT7A 2PE3A 5D29A 2E5GA 1BPNA 3P8BB 2Q04A 1KNZA 3UDVA 5CBMA 2OPSA 1V3SA 2WW8A 1UW9A 3NGTA 2IL4A 3S8SA 1RWOB 4MCPA 1R6YA 4IQXA 3HFZB 2CPIA 2MXYA 2DEIA 3HHLA 2CQ1A 1UZHA 3TUPA 2ZBRA 1SQGA 3TR5A 4UEEA 3S01A 1KBRA 1KQSR 2R8HA 4IFYA 4MJ8A 3CXPA 4U8YA 3QNWB 4ZITA 2UUAJ 3PYFA 1VBYA 1AYEA 2ZE2B 4DV2F 5LSRA 2YH0A 2EFPA 3CMAS 4DS5A 2EEYA 2SXLA 3D9BA 2DY1A 5IB9A 2YWGA 2D3OR 2YNIB 1NSQA 4RKUC 3OR1A 1Q81T 2B58A 3MPYA 1ULRA 4KPCA 3KK2A 4GS4A 5J2MA 4RW8B 4DL7A 4XPDC 1S1TA 2MQPA 2DITA 4MHZA 2ZWOA 4MBUA 1Q8KA 3DI6A 1RP5A 5DLFA 3G8WA 1VQKS 4KC5A 4DUYJ 1Y7PA 1RT3A 2W2PP 4ECVA 4R87A 5B0EA 1SKRA 4FN5A 2FE7A 4F4ZA 2Q4YA 2KYZA 2HBQB 1Y3KA 2YKOA 3U27A 3KASA 3SBMA 2VU5A 4MK7A 2J9AA 1MROA 2NPIA 3C15A 4ZP7A 1KVJA 4G65A 2DNZA 4JD6A 4KVXA 5C2CA 1RHQB 3DLEB 1LFWA 2XMKA 2C6GA 5D77A 2ZJQQ 3UCUP 4LSLB 1UPMB 1NKBA 3QT7A 4L3NA 5DZ7A 4MFBB 3GTYX 5ETVA 2HK3A 3MXHP 4UFVA 1HWUA 3I5AA 3TOBA 1RBAA 5DDPC 5BXIA 4LF4F 1F6TA 2UV8A 3SFUA 4IR9A 2CA9A 1CC8A 1REGX 3OL7A 5LMUJ 2G2YA 5BYSA 3M8RA 4A33A 5CXTA 2DGUA 3MHYA 2CQCA 3OHBA 3HVAA 4RWXA 3CDBA 2OZGA 1OQ3A 4Y3CA 5HSPA 4U95A 1VQPS 1FJGF 4R0EA 4OZJA 2WZ1A 1VQNS 2K7KA 1I5OB 1Q2CA 3T5LA 2ADBA 3OBIA 2VBXA 4CLFA 3MD3A 2JEVA 4F0KA 4RUAA 3QPIA 3WIUA 2PJAA 2HKEA 1K44A 1U24A 2ZH9A 3R9LA 1FWLA 4N7TA 5GADU 4OIWA 4PEOA 2XEFA 4NF1A 1K1QA 4ZPTR 3LWMA 3I56S 2Y1IA 3BQ0A 5LJ3Y 1J5EF 2KG0A 3CDUA 4A8WA 3DLJA 4DR2F 4DR4J 3V6DB 4HHHA 5LXRA 2Z3OA 4KSFA 4F2SA 4KV8A 1CX8A 3HK2A 1SPBP 3QGIA 4WWSA 4TY8B 4Q8FA 3MTJA 3RJMB 4PK2A 5HROB 2HHXA 1Y9OA 5IB0A 3R9GA 1S59A 2K1RB 3HJVA 1FRKA 3S9NA 2VFVA 2ZD1B 1IR2A 1BO4A 2C2KB 3A3NB 5B09A 2UVWA 3OR2B 3UD4P 3R9EA 2YWHA 1HDQA 3K9UA 3TOAA 2RF2B 2J0XA 4F7VA 3FRZA 1B7YB 1P6TA 3GKRA 2BACA 1F60B 2MQMA 1BWVA 2WK4A 4R25A 2OJ3A 4C97A 3A8IA 2OSQA 1P8GA 2X3GA 2YKMB 2AJ0A 5IZHA 1MWQA 3PB4X 3PRDA 4CT9A 3GFZA 2YPZA 2EKYA 1LKZA 1IN0A 4N8OA 2UXDJ 1CJKA 3FECA 5AGEA 3RBEA 1SL0A 4IR1A 2LLZA 1I1GA 3OXFA 4B9MA 4DR5J 4UEZA 3HFVA 4YFUA 1O8BA 5KOXA 1N34F 4Y49C 4TYBA 2EC2A 1KTQA 5KFSA 1SC1B 4MAKA 4RNOA 2GV1A 2ASLA 1R6VA 3BREA 1NU4A 3BKFA 4JV1A 1HI0P 3G6VA 3PB9X 2UXCF 3BBCA 1YJWS 2DO4A 2R7VA 1FHTA 4K4UA 1VMBA 3IBWA 4B3OA 2Z2LA 3GLJA 3UVJB 3FKBA 2OLWA 4EBEA 5I42B 1M5SA 5D3GA 2O3DA 3BGOP 2Y9HA 4IUFA 2D69A 1OYDA 3N5BA 4RW9A 4LFAF 5ETPA 2ZM6F 1ZOTA 1S0NA 1WG1A 3HFKA 1VBZA 4RNHA 2IAJA 3VQSA 2YGWA 3MGJA 3W1YC 1AMPA 2XCPA 4YB1P 4F0XA 3QAEA 4L73A 2PSZA 4PUOA 3U7JA 1S7HA 3DM2A 2PMHA 1ZA2B 1YJVA 4QR0A 3W8GA 1CQNA 1VQ9S 3ZZYA 2E66A 4U9ZA 1KUYA 1KDNA 2GLFA 4NGSA 3KK3B 2FYXA 2I2YA 3GFXA 2DH8A 1Y0HA 4X64F 1IM6A 1WD6A 3I9ZA 5ETOA 4DR3F 4YU9A 1S7LA 4XPDB 4C48A 1PUAA 3G2XA 3PW7A 3W9IA 5M2UA 3PR5B 5CHCB 2V0NA 3FDSA 4F4KA 2W7PA 4FPRA 4A8XA 2KXFA 3GUXA 1JQGA 2CPXA 4AVBA 4P6QA 1JLFB 4CAFA 1NO8A 5IFMA 5E41A 1TTHB 2XWXA 4HPSA 1Y0RA 5FLXU 3OUYA 4J9RA 2M2BA 3O6QA 3KZWA 1QMUA 1X5TA 2VL1A 2ZUGA 3G8QA 1VI7A 3AA9A 2VODA 1IYKA 1SL2A 3ILOA 4QWEA 1RT5A 1NPKA 3SQOP 4CQ1A 4LVOP 1K8AT 4AQYF 2E1AA 1JLAB 1HNVA 2FC8A 4E98A 4O44B 2AEJA 1L3VA 3DLKB 1E6YB 3Q8YA 3SXOA 2BCOA 1XWLA 3KJQB 3OLAA 1JLGA 5GAHU 2MKSA 1X7VA 1FD8A 4K4ZA 5ETQA 1VRUB 3D3BJ 1RHKB 3MPWA 1ICEB 4ZHRA 3LP2B 4G1QB 2ZH3A 4ZVTB 3D68A 4CGMA 1UFLA 3HHLC 3D6FB 2IBKA 2R8IA 4G1IA 4G3IA 3M8QB 3BGRA 4YHHF 2QFIA 2WSEC 4XAKA 2E1PA 2FVSA 2QECA 5E2QA 3E01A 1GXTA 1IBCB 5IXUA 5IT4A 1AXQA 3R6LB 2Z3NA 3BXMA 3OWCA 2XMTA 5IT0A 3EPGA 5AJ3F 4N76A 2BXJA 2ACYA 2FHJA 4EBDA 1IQTA 4MY3A 4NMXA 2GMLA 1PYTB 2W2NP 3OTEA 1BQNA 1GXUA 2WVDA 5HBMB 1Y11A 4XPCA 1BHNA 1ARLA 5I3UA 2V94A 4DL2A 2WONA 2IDEA 3PEJA 2IRUA 2BQ3A 4OYPA 1LXNA 3K0JA 1ZZNA 4DJLA 4O4GB 5EWFA 3AJ2A 3A3PB 3MM6B 3I4PA 3DR6A 3CPWR 3H8YA 4J9KA 1ZG7A 4DF4A 2QG9B 1CBKA 2P6EA 5DQHA 4NLTA 4WE1A 5KFNA 2FY1A 4DR7F 5KFXA 4ZLNA 2QL5B 1U49A 1MMNA 4UQGA 5B0DA 4J9MA 5LYLA 1XBWA 2XO7A 2BQUA 4IYQA 4B9SA 1IIDA 2PMZD 2OH2A 3TZZA 2DHHA 1WF1A 3H7HB 1MN9A 2QO3A 2ZKUA 4KB7A 4AXVA 3HULA 1WI8A 3CJ5A 2PO4A 3QAYA 4DI6A 3M2RB 3PYGA 1S1XB 4IF5A 3S6EA 4B08A 5A8WB 3UPFA 4F67A 2VUGA 4K4XA 4KO0B 2LCWA 2CG8A 4N8NA 3T5HA 2W4DA 4HI1A 2HBRB 2KT3A 2HK2A 3JTKA 3FX6A 1G6BA 2REEA 2APOA 5I0CA 4DJBA 4FBUA 5HH1A 5C88A 2R2RA 1NXIA 1SUQB 3KUEA 3PKMA 3KK1B 5DJBA 1SIZA 1XIXA 2YNGB 1TKXB 4F3OA 4KLVA 3J7A1 1QJHA 4K4VA 4OKOA 5AE1A 2NYIA 4LQ9A 1XNQF 1FNOA 5KG4A 2C6PA 3LODA 3FVYA 1RCXB 3VHQA 1RBLA 5AG7A 2ZKTA 2JBKA 2BJEA 3RUBL 1JWWA 1RT4A 4G1PA 4I56A 1C0UB 1XMOJ 1EIYB 2HIQA 2KT2A 1D3WA 4QC6A 3FJUA 4JV0A 2EXUA 2HFNA 2YXLA 2G9DA 3P4UB 5D6GA 3DGPB 2VG7A 3P3DA 3R96A 2ZEOA 4Y2AA 1Q2YA 4NXYA 3KHLA 1HNIB 3DCAA 4B3RF 2C22A 1FRJA 4MI4A 1CLFA 1Y4ZB 1C0TB 3DU6A 1CJUB 2J7WA 2H3EB 1FRIA 1NK8A 3ENAA 4GO5X 2Q4VA 4HEA9 1FRHA 3LD2A 5LRKA 3AJ1A 3KR5A 4V1Ak 3M4XA 4KGZB 5ADZA 1NBEB 4KOTA 5L46A 2C3UA 3BJ8A 3SZ2A 3A8EA 1OBRA 2DNLA 1I94F 3OTCA 1KQGB 1VR6A 2M5YA 2ZDOA 3KLIB 3G6YA 3M2VB 2ZH1A 3RTVA 1ELLP 2PD1A 2JEFA 4NYOA 2ZJPQ 5HMYA 4CO3A 1Q16B 4JI5J 1N32F 5HJXA 3DFEA 1WNEA 2YNDA 1AT1B 1EHWA 3QO9B 2XY7A 3N79A 4EFAC 1GFWB 4Y2MA 1TKZA 1IBMJ 1RQ0A 5LMNF 2PJ2A 1WG4A 2JRSA 1JX4A 4JYWA 1KKHA 1HMVA 1QE1A 1YW6A 2BE2B 3PXGa 3IAS9 3CD0A 3PEIA 2HNYA 1XMTA 1OY6A 4LUBA 5A8RB 4A4JA 2DHXA 4JI2J 2R7SA 2OI2A 5H9EJ 2FXFA 3W62A 3D0IE 3QJPA 5ETLA 1TKFA 4FBTA 4M6GA 3JTNA 4USKA 4KOVA 1FESA 1WWHA 4LF9J 2BKPA 2Q6CA 2YKNB 1RT7B 2R7OA 1X5OA 5KFFA 4M5DA 4Q7AA 2J0QD 2B4VA 5J1NA 2OPSB 3I5BA 1S79A 3RG6A 4DF8A 4YB7A 1WDTA 1M1GA 5B0FA 4JOUA 2DF5A 3DRPB 4Q2MA 3IP0A 3HHLB 3UNGC 3CDAA 3H4DA 4FYYB 2GVDA 1L0CA 3PB8X 4IFYB 2MLXA 1KLNA 1C1BA 3JQMA 1X9SA 3RYLA 4DR1J 4QW9A 1UVMA 2VQFF 2Q6BA 2POKA 5HQ8A 3B7IA 1TAUA 2DNNA 2V34A 1XFOA 3MRUA 5CNPA 1X9WA 2PQ8A 2YBVA 1YGYA 5G22A 3OR1B 1ZLIA 2HHQA 4NEZA 4C8MA 4A8MP 5JGFA 4CGLA 1MU2A 3WQPA 3KK2B 4II9A 1H2UX 2DNMA 5J2MB 1XEBA 1YVKA 2DGWA 1S1TB 2J0SD 3CO0P 3DOLA 2ZWPA 3DI6B 3Q8UA 1VC6A 5KAKA 3A1YG 3W2WA 4QZVB 2DCUB 3T9YA 3D1OA 4M5NA 3V7ZA 3NS7B 1Z2LA 1FDBA 3ZZRA 2J8NA 2CYYA 3OTOF 2NXJA 5EX0A 4FF4A 1OY8A 3HHDA 3UO0A 2LA6A 4DL4A 3ZZUA 2FQQB 1MROB 3C15B 2EK6A 1FTCA 2IJNA 4NYZA 3GIRA 2DR5A 2DK2A 3P45B 1RISA 4DUZF 5KT6A 4PABA 4ES1A 4DV7F 4A95A 3H98A 2HW3A 2AYEA 2AIRB 2CNMA 1GTHA 3HJFA 1S9EA 4H4MB 4ETXA 1VIXA 2AFUA 4KJIA 3BSOA 1SC6A 1ON0A 4CYUA 1L3KA 1T9UA 2DIUA 2UVUA 3B3CA 4IAVA 1R0BG 4H89A 5EWGA 3H0PA 4I4BA 4AL5A 4IG3A 2VBQA 2ZZNA 1TXRA 4M5KA 1SC4B 4KQZA 3CUNA 5IS2A 1S0OA 2GHWA 1RK8A 1U1LA 3DNCA 2LFVA 4W4MA 1Q53A 3M30A 3SJFA 3S7RA 1FJ7A 4X4TA 3PB6X 5D8NA 4EYIB 1ZH5A 2O67A 3UCZP 3JTPA 2EO8A 4KORA 1Z9UA 3NY0A 1ZM9A 2D74B 1R27B 2MQQA 1IWAA 1HHSA 1ELOA 1YITS 2AEMA 1RAHB 4OJ1A 4A8YA 2HZVA 2BZ2A 1U45A 4GVLA 3JAMY 2E5LJ 2YX1A 3VAHA 4UA3A