1XMBA

X-ray structure of iaa-aminoacid hydrolase from arabidopsis thaliana gene at5g56660
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
392
structure length
375
Chain Sequence
KLLEFAKSPEVFDWMVKIRRKIHENPELGYEELETSKLIRSELELIGIKYRYPVAITGVIGYIGTGEPPFVALRADMDALPIQEGVEWEHKSKIAGKMHACGHDGHVTMLLGAAKILHEHRHHLQGTVVLIFQPAEEGLSGAKKMREEGALKNVEAIFGIHLSARIPFGKAASRAGSFLAGAGVFEAVITGKTIDPVVAASSIVLSLQQLVSRETDPLDSKVVTVSKVNPDSITIGGTLRAFTGFTQLQQRVKEVITKQAAVHRCNASVNLTPNGREPMPPTVNNKDLYKQFKKVVRDLLGQEAFVEAAPVMGSEDFSYFAETIPGHFSLLGMQDETNGYASSHSPLYRINEDVLPYGAAIHASMAVQYLKEKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of ILL2, an auxin-conjugate amidohydrolase from Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
molecule keywords IAA-amino acid hydrolase homolog 2
total genus 122
structure length 375
sequence length 392
ec nomenclature
pdb deposition date 2004-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1xmbA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1xmbA01
2EK8A 1F2OA 2ZEGA 4ZY0A 4Q7AA 1HDQA 4TWEA 3LMSA 2O4HA 3PB6X 1TKJA 2J9AA 4DYOA 3PFOA 1Z2LA 4JZ0A 5LYLA 1ARMA 4MMOA 2EWBA 1M4LA 4P4BA 2AFWA 2Q4ZA 5LRJA 3B7IA 1YSJA 2PJAA 4OIDA 2G9DA 3D7GA 4UIBA 1R43A 2V8HA 1BAVA 4P4IA 2RB7A 1XBUA 1DTDA 4EWTA 2ZEDA 3KASA 3L2NA 5LYDA 2C6CA 3TX8A 6CPAA 1F57A 1HEEA 3IO1A 3WABA 4DJLA 5K8PA 1LOKA 1VIXA 4KSIA 5ELYA 3FH4A 5HVFA 1CX8A 2WYRA 3NFZA 3GLJA 2IJZA 4IHMA 4PQAA 1VHEA 3PB9X 4ZY1A 3JRUA 3K9TA 2CTBA 4P4JA 2PJ8A 2IQ6A 3B3SA 5D29A 3RBUA 1BPMA 3KR5A 4K3NA 4FAIA 2PJ1A 5F09A 3PB8X 3RZAA 1R3NA 4YWYA 3FEDA 4F9UA 3D7HA 3NH8A 3PBEA 8CPAA 2QJ8A 2AFXA 4LQGA 4R7MA 5LYFA 4OC5A 1BLLE 3B2YA 2HB6A 2OR4A 1LFWA 1F2PA 2CF4A 5CBMA 4TNUA 3BI1A 3PFEA 2BOAA 2PJ6A 3S9LA 3BI0A 5THWA 2PJ2A 1Z5RA 4NGPA 4P44A 3CT9A 2QYVA 3FX6A 4ONWA 1TKHA 3DGVA 4P4EA 2I3CA 1ELLP 4A37A 2V8DA 4MRIA 2VL1A 3IEHA 2ZELA 4R76A 3KR4A 4CPAA 1JQGA 3SI0A 2V77A 1CG2A 4MHPA 1Z8LA 1Y7EA 4EMEA 3QNVA 2AFUA 1RTQA 3NA6A 2BO9A 2PJCA 4NFRA 3LWUA 3FEEA 3IFEA 4MCPA 4OC0A 3IC1A 3FVLA 4NGNA 1AMPA 1H8LA 1PCAA 1DE4C 3CPXA 1QMUA 1ZG9A 3SJGA 2BCOA 4MCRA 4UEZA 3B3TA 3KZWA 1CPXA 4NJQA 2GLFA 2AFMA 3CPAA 2F7VA 5CPAA 3WC5A 4R8FA 3WC7A 2XEFA 3ISZA 2ZOFA 3D7DA 1VHOA 1CPSA 4NGRA 3GB0A 3WT4A 1CBXA 2ZEFA 5JGFA 5D8NA 3TC8A 4YU9A 4X2TA 4IK2A 2OOTA 4OC1A 2PCUA 4MCSA 4A94A 4WWVA 3VH9A 3BHXA 4EFDA 2NSMA 3B3WA 1EE3P 3D68A 1LAMA 2XEGA 4P10A 1GYTA 5K8OA 2NYQA 2AFSA 4NJRA 2CIJA 2XEJA 4W9YA 2PIZA 1OBRA 3KL9A 4A39A 4FUUA 2JBJA 2C6GA 2ABZA 3FECA 3SJXA 2V8VA 1Y0YA 7CPAA 5J1QA 4F8ZA 2WZNA 2RFHA 1AYEA 3V7ZA 2C1CA 4UIAA 4FWUA 1XRYA 3HUVA 3IIBA 3SJEA 2JBKA 1XJOA 5IB9A 2PJ4A 1ZLIA 2PVWA 3KQXA 4H2KA 3IJ3A 4UEEA 2ZEHA 1XFOA 3K2KA 5K8NA 3S9MA 1ARLA 2GLJA 1BPNA 1YLOA 5HVGA 1YMEA 3RAMA 2ZENA 1CP7A 5JH9A 1TF8A 3KHZA 2PJ7A 1IGBA 2PJ9A 3SI1A 2PIYA 1TKFA 3FF3A 4MHZA 3H8EA 4P6YA 4BD9A 4FBEA 2C6PA 1TXRA 2ZOGA 4OKOA 1YW4A 2PRQA 3SI2A 2Q43A 5HVHA 4GM5A 4OMEA 4OP4A 3B35A 2HC9A 3PRTA 2POKA 4UF4A 4OIWA 5HXDA 2ZEMA 3KHXA 1CP6A 3NH5A 2V8GA 4ZX8A 2F8HA 4MCQA 3ISXA 3DLJA 2PJ5A 3KGQA 4MXUA 4OC2A 3D4UA 3SJFA 4DUKA 4PPZA 4IAVA 4R6TA 2EK9A 5K8MA 4MHYA 3VARA 4OC4A 1YW6A 3WC6A 1ZG7A 1ZG8A 1LANA 4G1PA 1UWYA 2ANPA 2DEAA 4NGMA 5LYIA 3S9NA 4B6ZA 2QVPA 4WJBA 4NGQA 1Q7LA 4X8IA 3D67A 4AXVA 2ZEEA 4P4DA 4Z65A 4X3RA 5LRKA 1ZLHA 4F9VA 4P4FA 2JEWA 4UEFA 3D66A 1FNOA 2GU2A 3B3VA 3V38A 3T8WA 2O53A 3VATA 3PB4X 1LCPA 3FMCA 3PB7X 3GUXA 4NGTA 3PBBA 1VGYA 2Q51A 4ZYQA 3NH4A 4PXCA 4JYWA 2FVGA 2ZEPA 3HLPA 2GREA 2ZEOA 4MHNA 1PYTB 4ZX9A 2PE3A 2AFZA 3IWWA 3H8FA 4PXEA 1IY7A 3MN8A 3H8GA 1HDUA 3KQZA 3PEIA 4OC3A 5DS0A 4ZY2A 4NGSA 2PJ0A 2PJ3A 1TF9A 3FJUA 2IMOA 3D7FA 1FT7A 1XMBA 4PXDA 5LRGA 1LAPA 1NSAA 2PJBA 3BXMA 4O23A 4ZI6A 4PXBA 2AFOA 3N5FA 1KWMA 5I4MA 4P45A 2CTCA 3CDXA 3I1UA 4A38A 1Y0RA 3KI9A 5JM6A 4RUHA 3B3CA 3MRUA 1QQ9A 2XEIA 1ELMP 2PVVA
chains in the Genus database with same CATH superfamily
3CPWR 3Q8RB 3EZOA 2NLWA 2DNRA 2YY3A 4TWEA 4FS1A 2FZCB 1TKJA 2G0CA 2WCXA 3FYNA 3ET6B 5A6PA 3TVYA 5EGYA 1C4AA 2RF2A 2ADBA 3UW1A 4L72B 2EG2A 1NKBA 1NHKL 2FLOA 2VODA 4ZP7A 4JI4F 3MUTP 4OYMA 4P4IA 1S6QA 1RWOB 4OI4A 3VGUA 2WSFC 1JKHA 4UFVA 3IA0A 4A8OA 5DG8A 4YR2A 3TR5A 1JLBA 2Z2LA 3FUYA 3RU0A 2VG5A 1RXTA 2VDIA 1U49A 3ZNUA 5HVFA 4DF8A 3W62A 4ED5A 3WC0A 4O44B 1FRLA 1VQOS 1B7FA 4LFCJ 1HMVA 1RLDA 2JLMA 1UWBB 2IPOB 4P4JA 2AT1B 1HA1A 1RT2B 2IQ6A 4DR4J 2BE2B 3KR5A 1BQMA 5GAHI 3D1OA 1LK5A 1R3NA 2OELA 3FMWA 4WYWA 1HFEL 3VQSA 5CCLA 4ZLPA 8RUCA 2GHPA 2HHWA 1S1XB 3TO8A 3DRSB 4O4RA 2Q7BA 3ZTSA 1XOVA 2OMLA 2HG4A 1RWWB 2RU9A 2V2ZA 3M1VA 4X65J 4YY3F 4LQ3A 1RT7B 2W9BB 3J7AN 4XO0A 4P44A 2MKHA 3FX6A 2EPIA 4OV1A 3BJYA 4DQSA 1KVKA 2GVZB 2Y0BB 3NE7A 2YKNA 3NS6A 3KR4A 3CCES 2GVDB 5HMXA 3PNIA 2B3UA 4K4XA 5L9NA 4BDPA 4V19J 2AFUA 2DPJA 1RTHB 2J9CA 4WF9Q 3R9EA 3D1QA 4B9VA 5JVHQ 4F8RA 3NGKA 3M8QB 1HI8A 2Z58B 3IC1A 2EKYA 1HWKA 2AHOB 3G6XA 5KFYA 3CPXA 2R8IA 5T7LB 4YQWA 4LF9F 1H38A 4FXWA 1UJ5A 2IA0A 1RI7A 4DV2F 2F4VJ 2PC6A 1FJGJ 2G2OA 3NMRA 2UVUA 3W5YA 4ZHRA 3POTA 5GVQA 2RHSB 3KKFA 1SL0A 1LW0B 4FYXB 4KE5A 3N6MA 3QGGA 2CDRB 2MKCA 1AW0A 3OJUA 3W5ZA 4B3OB 1LOUA 4WWVA 4F3OA 4GVBB 2XY5A 2M3DA 3PXGa 5LSOA 5EWFA 4TLQA 2UUAF 3DLGA 3W2VA 1EE3P 5IWAF 4DFKA 4C8LA 2HIYA 4YP3A 2PIZA 4LF7F 2W24A 2OLWA 2NCKL 1WC3A 2HQGA 3DU5A 2ZJQQ 2RFHA 3HHLA 2C1CA 1FE0A 4IRDA 4EK2A 4KOUA 3RJMB 1XMTA 1S76D 1QSNA 4OYZA 4CAEA 4XPLA 1N5SA 2CJAA 1RDRA 2C3OA 2G13A 2ZW6A 1XNQJ 3M32B 2FB0A 4UEEA 1ZM9A 2VQEJ 1QSRA 3TUJC 2GLJA 4X62F 4NXMF 1V9OA 1C2PA 2DGWA 1TF8A 1D0EA 2V2QA 2VBZA 1UA1A 4H4MA 3U1MA 3ZZPA 4H4KC 2OPQB 4MHZA 2OPPB 3GZ7A 5A6WA 5DWNA 4AB7A 3F73A 2PEHA 4Q38A 5DGAA 1RKIA 4MK9A 4YB5A 1L3SA 4UZBA 1TP7A 2FIWA 3H2LA 1RT3B 3TEGA 1OO0B 2QL5B 2BE9B 2M4MA 2M5YA 4JXQA 4MCQA 2MGZB 3C26A 3GFYA 4X4QA 4FS2A 4R6TA 1AT1B 2HNYA 1UVNA 5CYQA 1TMMA 4WXWA 5B0AA 3CJKB 3O8WA 1D3WA 5LRKA 1S7NA 3K5OA 1T03B 3MM5B 4AXJA 3GSDA 2PA3A 3THVA 3KK3B 3FZBA 1WEXA 4NLDA 3A8IA 3N0VA 3GIKA 2V8PA 2PMHA 4OQJA 3RNZA 1X5SA 3SFUA 5I3UA 4LMZA 1NXIA 1LWEB 2GNKA 1F1BB 3G8WA 5GADU 4NCGB 2AP6A 3M30A 4M1KA 4Y2IA 4KHRA 4ZPDA 3R5JB 5KTAA 1HDUA 5A8RA 4LQ9A 2PJ0A 1RT4A 1FVSA 4JI2J 4QUSA 3GR1A 2CPFA 4DUYF 1P8GA 1KTVA 2LA4A 2AU0A 4M5NA 5KOXA 1SL1A 1Q82T 1HQEA 2E1AA 4N41A 5IZHA 4A8QA 4RUHA 4ZPVR 1HD1A 3JAMU 4YHHJ 3SDEA 2F9JA 1R8BA 1MN9A 1VLYA 2DK2A 2HVIA 1UFLA 3PB6X 2B4PA 1A6LA 1K8AT 2YH0A 3V81B 1NLKL 2VB6A 4FYVB 1JLQA 3JS9A 4GMKA 9RUBA 5F3TA 5J1EA 2BR0A 4JV5J 1TVRA 3KJVB 2UXDF 1IBKF 1WD6A 2MLYA 4CM0A 4EBCA 4OLOA 4ANEA 2GIRA 4R8UA 3BR8A 1T9UA 2V9KA 4KFBB 2RB7A 3T5LA 3PW5A 5KT3A 5K14B 4J3GA 4JI6J 4X66J 2NYHA 2FHJD 4QU6A 1X60A 5F8IA 3IP0A 3KLFB 3FDSA 3QAUA 5EWGA 1WJ9A 2LU1A 5GCNA 5KFTA 5J2NA 1M5OC 2GGPB 3SI8A 4W90B 2AJFE 2XULA 3ETOA 1HARA 3CCJS 5LJ3Y 2MY8A 3BV8A 3ILOA 2Z2ZA 5C5JA 5GAEI 4X64J 2MZJA 2KHDA 1L3KA 4K3NA 5F09A 3BYRA 2NR0A 2HUZA 3J80Y 3D7HA 5L1IA 5C88A 3PBEA 2IRUA 4RW8B 2A1BA 8ATCB 4R7MA 3HVRA 3SZ2A 2ZE2A 2DF5A 3B2YA 2OR4A 3BSNA 3C6UB 3BI0A 2AJ1A 2MMYA 4CH7A 4F2SA 1WC1A 3O3LA 1GFWB 2X1FA 3RG6A 3DRRA 3CULA 2QMUB 3VAIA 3H2UB 1M5HA 2ZELA 4LF8J 2K2PA 4CPAA 2HGLA 2PQ8A 2V77A 1TELA 4RW4A 2X7IA 4HPSA 5E3QA 2QYGA 4MKVA 1IYLA 4ANDA 2D9OA 1UFHA 1GHEA 3DDDA 3MUVP 4IG0B 2PJCA 2VFRA 5D0RA 2DGOA 3CJ2A 1MJBA 1YDLA 4NF1A 1F9EB 3ENAA 1SJ3P 1FCAA 4WIIA 3FVLA 4RBTA 4ALZA 2Z3OA 2FC9A 4WFYA 1RWVB 1U02A 2YKPA 3TZZA 4OI3A 3EMTA 1YBUA 1PC5A 3DM2A 4F2RA 3GMGA 1X4EA 4I7FB 1KLNA 4Q8EA 4C8NA 4KRWA 4JI4J 4JI7J 4J7CA 4QWBA 4YY3J 1X7VA 5F49A 3KHLA 3CZXA 4B08A 2PCUA 1B0PA 5BYQA 2RH3A 2MHEA 4ZIWA 4YB7A 4CLPA 4DCOB 1YREA 2D4OA 4EEYA 4IOBA 3U27A 3KNAA 3KJNB 1S1WA 5HQMA 5HMZA 1U6FA 3W64A 3HO1A 3AJ2A 4MT1A 4O3PA 2BV3A 4PG6A 3UCGA 2OH2A 3JXOA 4FBTA 2V8VA 4DR2F 4WTOB 5J1QA 2IM1A 4C6AA 2NXUA 4JI2F 3RYOA 1DJ0A 4RUCA 4OX9J 1FDAA 2PFFB 2NZCA 2HMIB 2YGWA 4M6IA 3CMQA 2GQCA 4DR6F 2DEJA 3G9CA 4DQQA 2ZXVA 2UVWA 2MZSA 4PG5A 1FJGF 2XWXA 4C3KA 4OZLA 5K8NA 2ZUAA 1YLOA 1NDCA 1YJ7A 3ILLA 1YLEA 2FJAB 1YJTA 5D4OA 5HROA 4DL7A 5F47A 1BWEA 3CJ8A 4RUBA 1QTNB 2ZPAA 3OLAA 4HNXB 5F8LA 2E1MC 4UOCA 1N5QA 4QW8A 4KHPJ 3VR1A 1YTYA 4ZCLA 2YQ3A 4OMEA 2CPXA 2KXHA 3MF5A 1LW2B 1UEUA 4LVOP 2O3DA 4ZX8A 2WPWA 3HD1A 3IRXB 2Q79A 3QSIA 2MSSA 3VGVA 1T05B 2M8DB 3UDVA 5H9FJ 4X4VA 3UN5A 1WDTA 1Y5IB 2BE2A 1XBWA 2RDJA 4J9LA 3RBZA 3S1TA 1TK0A 2HHSA 2MHNA 2HFOA 5E41A 1REVB 4F6AA 1EX8A 4OLPA 3PHTA 4OZ0A 1J5OA 2DBBA 5IT0A 4DUZF 5B0BA 3PTWA 3LP0A 2O53A 3TA1A 1OIAA 2ZC3A 3GUXA 2H4WB 5E33A 3I32A 2HK2A 2Z0GA 1AUDA 2M88A 4ZITA 1VJQA 1WWZA 3GSIA 5C24B 1IR1A 1YIJS 3UD4P 1Q16B 3ENWA 2QX0A 1YZ7A 2R2SA 2VXKA 3TCVA 4LUAA 2KDOA 1KUXA 3Q2TC 3OTOJ 3T9NA 3HVTA 2P6FA 4F0MA 2IDEA 4LR7A 4LF4F 4E2FB 4P75A 1XEBA 4LIWA 3QLHB 3I0SA 2HHPA 1ZTTA 2KYXA 2EFGA 3DFEA 4OZNA 1K1QA 1QE1B 2BRKA 4M95A 4MFQA 5KFXA 3H8YA 4OFZA 2A0FB 1ZH5A 1HDQA 5KFRA 2MJNA 3EX7B 1C0UB 4PYAA 2N3LA 1JLAB 2ATLA 4IDKA 4YEAA 4GC6A 4Q8FA 3B4DA 2DITA 1XNRF 3BQ1A 4CDIA 3NBPB 2RRAA 3DLHA 2UP1A 4Q45A 3L7UA 4ECVA 2WPXA 2CQCA 5EBVA 5IB0A 1HNIB 3RAQA 1NJIT 2ROPA 2UVRA 1CJWA 3HPOA 2V8HA 4UTGA 1C0TA 4U8YA 1DY3A 3A3OB 5ETOA 2QLWA 4YDDB 4M5LA 3TX8A 3QWUA 1C1CB 2J0QD 1FX4A 3DDIA 4B3MJ 3NXZA 3KDOA 3AA9A 1NPRA 5HJYA 3IRWP 3VAJA 3PRDA 1WACA 3ZXWA 1BO4A 3GV8B 4JI1J 2C27A 1HQUA 3DLLQ 4YR0A 2AD9A 3W9IA 2G0IA 4FNIA 3EVWA 1TKZB 2XS2A 1CJVB 1NDPA 3M8ZA 3BO2A 3H42A 1DFDA 2B4OA 4F9UA 1Z8TA 1QSSA 4PSWA 4RW6B 2HLTA 2N4DA 2BJ7A 5J1PA 1BC6A 1U1QA 3F8KA 4EYHB 3S9LA 1CQMA 2HS4A 4DSIA 3T5KA 5SUHA 4WWSA 4F0HA 4ONWA 5B0CA 1LV5A 3Q8QB 3D54A 4RS2A 2YX4A 1FDNA 4NCZA 1W2IA 3J81Y 2GE3A 3LANA 3A8JA 2OJ3A 1JQGA 2R2UA 1CG2A 1QVGR 4MHPA 2R7HA 2YNFB 1AUSL 2XSJA 3OL6A 1RXOB 2AGPA 3KWMA 1WI6A 3MM7A 2UUCF 3QIPB 4MFBA 5I42B 1FKPA 3FEEA 4B5PB 1Q79A 4MFLA 4J9VA 3LACA 2R9LA 3HLUA 6FDRA 1R6VA 4KKOB 2WBRA 4A8XA 2ACYA 1R0AA 2CADA 5IM0A 2MKSA 3CCSS 1T02A 4OADA 1HBNB 3FXTA 2ODFA 1S4EA 3K17A 3ENQA 2AIRB 3C3LA 2JWNA 3BO4A 1FE4A 2M9KA 5EWEA 2ZW7A 1SXLA 4AFFA 1NJYA 2K06A 1VHOA 3TC8A 1TQLA 2XCPA 1J5EF 1ZAXA 1J27A 2J0SD 2V34A 3R2DJ 1OY6A 2NSMA 1R89A 3DGPA 4WKYA 4CH1A 2CKWA 3EGZA 3EFAA 2MKJA 5CABA 1KOHA 4G1QB 1RABB 1HQEB 5DDQC 4TQRA 1YQHA 2JBJA 3HZGA 3CDEA 2FVQA 4NLGA 3PYGA 4JI0J 4OJ1A 1U26A 1U8SA 4X64F 1T03A 2CRLA 2B8PA 2Q4VA 2WRMA 4X4OA 4D3HA 1AYEA 2XGPA 2COLA 1FKOA 3N6LA 3IIBA 2VC1A 2ZWPA 5A0YA 1ZLIA 4NA2A 3US5A 1OY8A 4JJXA 2DNNA 1XFOA 1GXTA 2FHJA 3K2KA 1WKJA 4I2QA 5HROB 2HQDA 3S9MA 1H2UX 1TL1A 3P5BP 4JP8A 5C82A 4Y00A 2WONA 3RAMA 4RPFA 4HH1A 2ZENA 2LQ8A 2UU9J 4JV1A 4KFBA 3UCZP 1CC8A 5U47A 3SXOA 3H5XA 3T6JA 1HWUA 4Y6IA 1TL7B 1SJQA 4OP4A 1JWWA 3HHLB 5KFBA 3FIXA 2P6SA 2YKOA 1YJ9S 2RRNA 3CDBA 3RRGA 5AG5A 4KUBA 5A76A 1S97A 4GKJF 4HHHA 3OR2B 3FQLA 2CJYB 5K8MA 1UKUA 1YKWA 1RTIA 3OJSA 1UWYA 4CO2A 3OVBA 4PG7A 4EZ6A 4C0BA 4AQYJ 4ZP9A 1R57A 4RW8A 2A2DA 1FXRA 5GMEA 4I2PA 4HKQA 4EZ9A 3GYAA 1FK9B 4ES1A 4G1IA 2XLIA 3K59A 3QRQA 2JEJA 1VHSA 1Q78A 4DFJA 5FD1A 1MLAA 3PB4X 1SVDA 3OXGA 4CRZB 1KS2A 4PXCA 1S7HA 3UWTA 4MK7A 4O3QA 4JYWA 4ZVOB 4DQRA 2ZEPA 4MHNA 4UOHA 4NA3A 1VDHA 1MROB 1U1RA 5H86A 2EO8A 1UEVA 3A8KA 1RT1B 1M5SA 2EKNA 4K2JA 3LAKA 5KT6A 3PDNA 2K7KA 1TUWA 3Q22A 1OPIA 1UTAA 2W7PA 4NYZA 4URSA 3SYZA 3TANA 4Y34A 2AFOA 1JXLA 3H4QA 2FJVA 1QAXA 2CTCA 4HH0A 1BOBA 2AEFA 3RBDA 3P8BB 1QQ9A 2GIVA 2V2KA 2ZWOA 3A3NB 1FJ7A 1NJWA 3BQ0A 2BA9A 1IJFB 4K7QA 3HP6A 1UPPA 3H4BA 4ILRA 1FI4A 1Y9WA 2CNTA 4JZ0A 4MFKA 1ARMA 2VI7A 3K58A 5FIIA 5BWAB 4OHYA 3HHLC 1P1TA 5EDWA 2CJ9A 4URGA 3D7GA 3BSAA 2YWKA 3N7ZA 4CH0S 4KOYA 4B9MA 1BAVA 4TY9A 3R2CJ 4J90A 1RAEB 3EM1A 4JBCA 2B5GB 2Q0YA 5CYJA 5GAEU 5T7LA 3AB4B 1WC0A 1HEEA 5DDOC 3E51A 2Z57B 1RBLA 2YPYA 2DO4A 1X0FA 3D0GE 3K2YA 5FLXY 1NJXA 1WUUA 4DU7A 2DTJA 4Q43A 3HULA 3S6GA 3TW0A 4KOWA 3LP2A 2OTLS 2KL8A 4AD6A 1OPZA 1T9VA 2HVZA 4XPCA 1TL4A 5ETSA 4OLLA 1H3DA 4CYUA 1S7FA 2EFNA 1MJAA 1P9YA 3MR5A 5DQHA 5A2QU 1VR6A 2Y0MA 3UR0A 3CDWA 4NLTA 5K14A 4C8OA 3MEGA 1XIQA 2VKRA 1UFKA 4ONUA 1RHMB 1N88A 1Q5VA 3M2RA 4TNUA 3CCQS 1I94J 3MCSA 3I96A 2WSAA 3LWMA 4Q2MA 2N82B 3OR1A 4P9SA 4NLQA 3GQCA 1YK9A 4B13A 3PEJA 3HKZD 1YHQS 5M2RA 1LWFA 4R76A 2JC1A 2WHOA 1Z8LA 2VH7A 4H4KA 4C7QA 2OZHA 3SXNA 3R1LA 1BHNA 3NA6A 3PEHA 2HHHF 1G7CB 2P2CB 3JYTB 1B6BA 3B8HA 1F3FA 1JIHA 3ZTRA 3IGRA 3PP9A 3OXLA 3C6UA 2DNZA 1SC6A 3GIUA 1VQ8S 3K5PA 1FD2A 3FSYA 4CLWA 3PZPA 3W2VB 1VQ6S 4DG1B 3MEKA 4PAAA 3K5MA 1WKKA 1CPXA 1FA0A 1FVQA 1Q8LA 1Q7YT 4DR5J 1EKSA 4LFBF 4H54A 3F0AA 3JQKA 5C24A 3RAXA 4IH6A 3BJ7A 4YU9A 2QT7A 2W2NP 4AL6A 1YRUA 3VH9A 2H51B 2I2YA 1VRTA 4BC7A 1Y10A 2R2RA 2B58A 4DCPB 3E0KA 4FVMA 2XEGA 5K8OA 3QLHA 4JYAJ 2BL1A 4W9YA 2J7UA 5AJ3F 3DDNA 3HJFA 2C6GA 2VICA 2IVYA 1Y5LB 4I6YA 3W65A 2L9DA 4MYUA 1PIEA 3MAAB 3V7ZA 3GCXP 4CM2A 2HZVA 1JLAA 3I56S 2QZ8A 4K4WA 4A33A 4A8SA 2ZBIA 2V9WA 3EE3A 2FS5A 1X4FA 3DLKA 3N9UC 4CLYA 4JI8J 3OXFA 3CJQA 1YMEA 3FRZA 1U2RA 1CVJA 2C42A 3W63A 5DDRC 1IWGA 1Y00A 2C6PA 3OPKA 2M7SA 3VAHA 2LECA 3KDNA 3HVAA 2B4VA 5L1LA 3PR4A 2P9CA 3THTA 1XR7A 4ZCIA 2CIMA 2RRBA 2GMJA 1Y4ZB 1X5TA 4UF4A 1S1VB 4A30A 2JL9A 2BBEA 2MKKA 4K50A 2GAHC 1YW6A 1UJ4A 1CJVA 3OTOF 3MM9B 4B6ZA 4LF4J 4ES2A 3MD3A 3FCHA 3DMJB 3CMES 3RB6A 3KTQA 5LMUF 4I2PB 2ACMA 3FFIA 4M6HA 4LFCF 2FT0A 5CHCB 2XYGB 3EPGA 1CM0A 3DOMB 2XZTB 1WG4A 3ILJA 3IWLA 3T1HF 1SBRA 2F1FA 1LRZA 3P5TL 4RBVA 1XIXA 1NK4A 1MROA 2PA8D 2E9ZA 1EETA 2ROGA 1TKTA 2KG0A 2YWHA 3W6XA 2D41A 4ZS6A 2A4NA 2A2CA 3MPDA 2KM8B 2AYEA 6FD1A 4E2AA 4OX9F 2J9DA 4F0XA 2PJBA 3W7BA 2KO1A 2ZZMA 5KOWA 2ALYB 4LF2A 2R7QA 2GIFA 4ZPCA 5G1ZA 3FNCA 2AJQA 4PYDA 5HBMB 4WCEQ 1JLBB 1SUQA 3BR9A 4N76A 2BYCA 2KRRA 3FMBA 3IU2A 3LMSA 4XPEA 1Z2LA 1B7YB 3TZWA 4S0MA 4DV7J 4TYAA 2AGOA 3QSYB 5LRJA 1IBCB 3PW7A 1SJ1A 3V5RA 2D3ZA 1LNQA 3CJKA 1NZAA 4UIBA 1HNWJ 4G1QA 3NLCA 4QOTA 2IC3A 1N5VA 5LSLA 3KK3A 3BKUA 5AXMA 1UVLA 3CJSA 3FBBA 4NLUA 3RR7A 2ZW5A 1FKOB 2HNDA 2Q4YA 3T41A 2PT0A 1N54B 5F0UA 3BH6B 4MIAA 1KKHA 1MU2A 5E2QA 3JRUA 3MAQA 4WPAA 1FY7A 4R25A 4I49A 5D29A 3RBUA 3BPDA 1QY7A 4PK2A 4HKFA 2E1RA 4RI1A 4UUXA 3VGSA 4PRFA 3PYEA 1WSRA 1CPZA 1Q5YA 2QTWA 1RWMB 1RT2A 4F25A 3QWPA 3OR1B 4NXMJ 3D6HB 2Q3PA 3Q24A 3MEEA 1MMLA 1B4SA 3KLHA 3DGVA 2UVVA 4G65A 3W9HA 1NK5A 3IEHA 1JLQB 3PW4A 2OPSA 1RTIB 1B64A 1VKCA 3MMBB 4WFNQ 5CXTA 1SQGA 3VAGA 3MCNA 3KJVA 2DRBA 1RU2A 1L5UA 3FBFA 1KONA 4P7VA 2NXJA 4QYZJ 2ZJPQ 1YJVA 3FK4A 4I64A 3IN5A 1S9EA 3IFEA 4MCPA 1NAQA 3PRBA 2VBXA 3IMQJ 2CNMA 3U7JA 4FKYA 1SC4B 2FLPA 4NL5A 4NJQA 1YJRA 1UVMA 2F7VA 2OI2A 4DSLA 4WE1B 5ETQA 3OLBA 4FN5A 4ATNA 2VJVA 4XAKA 5E96A 3A9LA 3HSGA 1X0PA 4RU9A 2DYAA 3IWNC 1ZA2B 3I55S 4HACB 3MMCB 1RAGB 4LFAJ 3W6SA 3FZ2A 3WZ0A 4DL0C 3FEXB 1Q2DA 2BKPA 4NE9C 4FZVA 2YWWA 4DWIA 4DX5A 1WOOA 3T5HA 4CYQA 3BGOP 4HYKA 2GX8A 1T11A 5G0RA 4OZ5A 3TI0A 5J8CA 1G6BA 4QCLA 2YTCA 1MSWD 4F02A 1M44A 1NKCA 2DNQA 2ZKUA 5DQIA 3J7A1 2PE8A 4DUYJ 3Q89A 4QIGA 2C22A 3V2UC 4CGMA 2ILYA 4D3GA 3I0RA 2B3TB 3C14B 3M8YA 3I3GA 3KQXA 4MTPA 2XTJP 3NAHA 4DPTA 4CO5A 2YXLA 1SC3B 4NPOA 4CT9A 3PGPA 2O66A 4C11A 4OI2A 2CQPA 2X7BA 3AXMA 3H0PA 2HQIA 4KV8B 1WHWA 3I5AA 2W9AA 3D6TB 1IB1E 4LBPA 5G4DA 4M5GA 2HNZA 3DRXA 1FRIA 2FJEB 5LL6d 2GQ2A 3KLVA 4ENOA 1CC7A 4PEOA 5GAGI 2RAQA 4RBUA 3LP2B 2EI5A 5I3UB 4X66F 3DLJA 3MI7X 1RWNB 4K4SA 3D4UA 4PPZA 2E1PA 4CAVA 1ELOA 3OUYA 1SC1B 4G1PA 1I1DA 1XWLA 2BOPA 1TL5A 3J7Z5 5KFKA 2OD6A 2XMTA 3JSRA 1IYKA 2MQNA 1SPBP 2BJ9A 1JJHA 2JEWA 2MKYA 4YFUA 5DWMA 2MEWA 1KSPA 2QA2A 3FCWA 2I79A 2CY2A 2ZC4A 3BH7B 3P2FA 2C2KB 3TZYA 1JNZB 2VZYA 4P6QA 3AAWB 1SIZA 1V0CA 4RJVA 3VATA 1RWPB 1K47A 1B87A 3B4MA 3ZFVA 2R2TA 5E7OB 4CS0B 2JC0A 1PYTB 2PO4A 2PE3A 3W91A 4ZVFA 3JSBA 3OVAA 3HSZA 2CJKA 1VIOA 1NDKA 3T90A 2AMCB 1S6PB 4Y2AA 1TKZA 3MN8A 2VA3A 4NGSA 2D3OR 4JI6F 5DZ7A 1XJWB 3D6MB 1RAAB 4QZVB 4CYUB 3CB4A 4DPYA 2DT9A 5LXYA 2CNOB 3CDXA 2VBYA 2DKOB 1HWJA 1Y0RA 4UOGA 1XN9A 3VF0B 4OHXA 4LRCA 3M8SA 3CXQA 3BKFA 3I87A 4DQIA 4Q7AA 3QYYA 9ATCB 4USMA 1S48A 3IRXA 1EHWA 1JXEA 2ZDOA 1H0HB 1CJUB 2CVEA 3GJSB 3M32A 4M8LA 4MMOA 3GIMA 3Q2SC 4JI3F 5KT7A 3EGWB 1U2FA 2W2OP 1V6HA 2VOOA 2HFVA 2M8HA 2DY9A 2GJ2A 3TOQA 1HHSA 4KLVA 3B78A 2QGFB 1FXDA 3V4MA 4DV5J 5MLCV 2ZDPA 1LKZA 2ZE2B 3Q8YA 3OFFA 3CIZA 1FFWB 2H9ZA 3L7OA 2HRUA 3MAAA 4ECQA 3WABA 2QMWA 1XC9A 5HP1B 2CXEA 4YN3B 1R8HA 2MXYA 2YNGB 1WF1A 5F8NA 3JSMA 2BMBA 1ZZNA 1S1TB 5KG4A 4QWEA 2DR8A 2V4RA 3JAMY 1YGYA 1GXUA 2ZM6J 2BJ8A 2F65A 1RP5A 1RUSA 3S7RA 2ZD1B 3S6KA 2WW8A 3M6UA 4DV7F 3E8OA 4U8VA 2GCFA 2OIHA 2A6OA 4OC5A 1R31A 3E3XA 2BEFA 3KJQB 4IG3A 5BR8J 5IXUA 2RF2B 2PJ6A 3VV2B 1VHFA 4BWMA 3RW7A 2F5IA 3EY5A 1YRTA 3CCUS 1P6TA 2BJDA 2MZTA 4ED2A 3PW2A 3C8YA 3MMBA 1LWEA 5JPHA 3TJAA 2IJNA 2AW0A 5IWAJ 4QR1A 2FDNA 3M30B 1FHTA 3E01B 4XPDC 2FL4A 4NWBA 1SB6A 2R8KA 2CPZA 2B4UA 1RK8A 2BO9A 2OP5A 3L9ZA 1C0TB 4KGVB 2IJRA 4USIA 3PZJA 3H25A 3PR5B 3C46A 1KZFA 4IF5A 1JLFA 5ETRA 3EPIA 2GLFA 5HJXA 4R8FA 1Z4UA 1IIDA 1B0VA 2APOA 3HFZB 4J9OA 5JGFA 4IK2A 3IBFB 3G8TA 4OC1A 4TVAB 2MQMA 4RW9A 4PKDB 2Y1LB 2BUNA 3CWJA 1TR0A 2K5TA 1IR2A 2GW8A 4XK8C 4NJRA 3MAHA 2C2MB 3EDRB 3OFGA 2PI4A 3FECA 1N0VC 2GVDA 1Q4RA 1F5BA 1VMBA 2ROEA 3J7ZT 1Q8BA 4J9SA 2L08A 1HBUA 4QPTA 5AG6A 4C8ZA 5IB9A 2HQ3A 1ZA1B 1RWXB 3IJ3A 2ERRA 3W61A 2ZEHA 3SMZA 4NLYA 5CAAA 2ZH1A 1XERA 4C2XA 1CP7A 2GZOA 4DL4A 1FKPB 2C2ZB 1TUGB 2VQYA 1TKFA 4P6YA 4ZN3A 3DC2A 1REVA 1SQEA 1OQ6A 2IM3A 2MZQA 4LF8F 4XPDB 1J5OB 1QUPA 3VVUA 2HC9A 4B3SJ 1F3VA 2ZEMA 3ZZTA 4OV6A 3M2UA 3KXDA 3G8QA 4L76A 4MH8A 2CPDA 2M70A 3D9BA 1PKUA 1KRPA 1DQAA 3QRPA 2DNPA 4C68A 3QGIA 2EK9A 2CPHA 3F0NA 4OHWA 5KFSA 1JLGA 4I1TA 1T9XA 4M5IA 1CS4A 1ZG8A 2DEAA 3TUIC 1FEEA 1GT8A 1N33J 2ZEEA 4P2MA 3HVWA 5CYQB 4AG7A 4P4FA 4WP3A 1HYSA 4PWUA 1N32F 1S1UB 3BS9A 1VQNS 2XQCA 2DGSA 2HHVA 2VKZG 2R7XA 5IQ6A 4NGTA 3B8GA 4KIAA 2XMUA 4PWDB 2ZBQA 4DLGA 3GTYX 5ETPA 2QV6A 2N3OA 4M5JA 2H5MA 2AZ3A 2KXNB 4F3MA 5BR8F 4AG9A 3BM7A 2ZHAA 3WBZA 3VTIA 1WC5A 3R8YA 2KU7A 3LPEA 1WTBA 2H5JB 3HX9A 2DXFA 5KFJA 1FRMA 4H4OB 4HI2A 3D7FA 3BSOA 1I21A 3QJPA 5A8RB 1LAPA 4IUFA 4WTYA 4OZ1A 5D0HA 2Y1JA 1KWMA 4RN7A 3ZZRA 3BSCA 4ZVUB 3CXSA 4Q2LA 4XPKA 1VFJA 2DXEA 4ER8A 2LKZA 2WBMA 4YMEA 4FBUA 4WE1A 3S01A 4OJ3A 4ECYA 2IHR1 3MOZA 1LWFB 5LYLA 4DR1F 5JMNA 2FZKB 7FD1A 1AA1B 5KFQA 1MN7A 4DNCA 2K3IA 4NLVA 2J5AA 4UA3A 1Q7LB 2HWIA 1X4HA 3EXYA 5G21A 2WVFA 5DRKA 2B9YA 2F8EX 5IX3A 1QJHA 5J2MA 2QA1A 2ZH7A 3DRPB 1YQEA 3U1NA 4KPCA 2B5JA 1FRKA 4N56A 2AYMA 4KSIA 2WOMA 3FH4A 2Y3YA 4TQSA 4KVOE 2VG6B 3QFHA 4ED8A 3SCLE 2LCWA 1RYRA 3PO5A 4USUA 3MCMA 5HQLA 1XMQF 2XM3A 1U0SA 3IU1A 4DUZJ 3H98A 2ADCA 2H48B 4OYPA 3AD7C 1RT5A 2MLZA 3H40A 5LYFA 2NUUG 5AE2A 1FDBA 2VQEF 1R0BG 2OAUA 4B9SA 4B12A 1TVRB 1IKYA 4X5KA 2PJ2A 3T1YJ 3U1LA 4KB7A 2REEA 3B82A 2ZITA 2V8DA 1HNXJ 4IFYA 4P2FA 2BW2A 1WG5A 2RQMA 4AE5A 1B99A 4QWAA 1WELA 2BACA 3OSNA 3M6WA 1D8ZA 3DLKB 4EMEA 2MSTA 2Z3LA 5IS2A 1JJ4A 4KBIA 1HW8A 3GFZA 2I00A 4F4XA 3DN9A 3BN4A 2F5GA 1NK7A 1TFYA 4JV0A 3CJ4A 1AMPA 3I0SB 3IR6B 2HFNA 1S60A 3IXQA 3OFHA 4QIWD 1WC6A 5JJBA 3HHEA 4B3OA 4KSFA 3CPAA 3QATA 4QBUA 2LDIA 1M5VC 2OPSB 1CPSA 4RW9B 3GB0A 3BGRA 3J81U 2J8MA 3I5CA 4IFVB 4OX6A 3CCMS 1R8PA 2RILA 2JNJA 4L3NA 1PJ5A 4LSZB 2DGTA 1D9FA 3TZXA 2NYQA 2W4DA 4NLWA 1CLFA 1OBRA 3DOMA 4DL5A 3GV7B 3RTVA 2OZGA 4DJBA 5ETKA 4WXOA 4F67A 4LF9J 4C8KA 4CLUA 3G86A 2XB2D 4KOSA 1QVFR 3TVKA 2F4VF 3MFIA 1S0NA 4CLKA 2HRYA 3C15A 3TRGA 3HI9A 5KT2A 4QC6A 4G6VB 2WB4A 3ZZUA 4H89A 1YJWS 2D4PA 3FF3A 4RR5A 3SFGA 1S9FA 2IBKA 2VPZB 3H8EA 2YKQA 1KHWA 2ASYA 5G20A 1YW4A 2P5VA 2QO3A 1YJUA 3FRMA 4HT5A 3EJMA 2W4PA 2EFVA 2ZH5A 4RLEA 1EJ7L 4KZTA 2PIIA 1U48A 1AXQA 2BUEA 4RNHA 4K2XA 3KK1A 2NMTA 2B43A 2I8EA 2LEPA 2QYCA 3QGHA 2QA4S 4J9UE 4YUDA 5HMWA 3V6DA 4FD7A 1QAIA 5B0GA 3S6EA 3ZJ0A 4RWXA 2DNKA 3W60A 4LREA 1VCTA 1ZLHA 3ONQA 4OX8A 2LP4A 1IKXA 3SCKE 3WC2A 2VFVA 2IRYA 1FNOA 5CZXA 1YVKA 1J5EJ 5HL7Q 1WSVA 2QRRA 5K5MA 4DR4F 3CCTA 4F26A 3LUYA 3JQJA 3PB7X 3JTNA 4F7VA 1O5JA 2Q51A 3HM9A 4MYTA 3TQ1A 3TUPA 4GC7A 3M7VA 5D4LA 2XS7A 2GO9A 3CJTA 3BGLA 1IOIA 1I94F 2G3AA 1S49A 4F4KA 2J76E 5DS0A 1UZHA 3NNAA 1FRJA 1I51B 4Q5VA 1X4CA 2V69A 2R7WA 3DGPB 3D2PA 4WK3A 3LA0A 4K0KJ 3MHYA 1JMTA 2JLGA 1A0OB 1X8DA 4DFPA 1RTJB 1VK3A 4DX7A 3UCUP 4M3SA 1ELMP 2PJ8A 1O6XA 4ZVHA 2A6MA 4HEA9 5KTDA 2F4FA 4DV6F 3LAMA 2DD8S 3SCJE 4OIXA 4PPDA 3J80U 3B6BA 4B5OA 4P2XA 2W01A 2AFWA 2EXUA 3SIPB 1FTCA 4NI2B 3B7IA 2V0NA 1YSJA 3NS7B 3K5LA 4DV2J 3CGIA 1E6YB 3RR8A 3W1YC 3TP2A 4DHVA 2KZZA 4UFWA 4RNNA 1S9EB 4YR3A 3CCLS 2PFDA 2ZEDA 1KLMB 4FXVA 2GQQA 3KHRA 3G82A 4NLPA 2DRAA 5DJBA 2WOMB 3LGMA 1WG1A 1WF2A 1C1CA 1VQPS 4AQYF 4L74A 3NFZA 1N33F 2RQ4A 1IXKA 3O5TB 2R4FA 4IH7A 1YGHA 4JUZA 3PJWA 1ZM3A 2DR7A 5C7PA 2Z10A 1VYAA 1GEHA 5E3AA 3I31A 3PB8X 2Z4PA 1TK5A 3RB4A 4F0KA 3P2HA 1WTFA 2JHEA 1X9SA 3OWCA 1JNRB 2ZUGA 3TFYA 2MPUA 1NPKA 2HYIB 3T6BA 2BANA 2HHXA 4PWWA 5CBMA 4U7UD 3S6FA 3M6XA 5HP1A 3M4XA 4C4WA 2Q66A 3EGVA 3OTEA 4WP8A 4BS2A 1U09A 5CD4A 1RTZA 1TKHA 2VOPA 1VRUB 1PU9A 3SSRA 2KT3A 3UDCA 2G3TA 3C14A 4TU8A 2XMWA 4KC5A 1GMWD 1Q1KA 2CPEA 3SEOA 1S12A 2NREA 4ZLNA 1FX2A 5A8WB 4CO1A 3G2XA 4ICLA 4C3MA 2C2EA 3FC9A 4I69A 1LFPA 1VOMA 1YX2A 2IRXA 4EI2A 4NFRA 4L3KA 4LF6F 1N52B 1DBDA 1PCAA 1JLEA 3A4TA 1U6MA 4B5PA 3TA2A 3UN2A 2R3VA 3UQSA 4AL7A 4UEZA 3B3TA 2ZBRA 4KKOA 2LA6A 1QD1A 3K9UA 3WX8A 1U1OA 3MDFA 4M63A 4OHVA 5DLFA 4CGLA 2XEFA 1EB0A 3NCRA 3ICLA 2CQBA 3PJ9A 2XY6A 3N4WA 3WT4A 3IG1A 3CCVS 1UEKA 5LOQA 4YRHA 2OOTA 4O3SA 2UU9F 3T1HJ 1CJTB 2CQ1A 3B54A 3HT3A 3G3SA 2C3MA 2U1AA 4F4ZA 2QL9B 4M85A 4EFDA 1VC5A 4R87A 1GYTA 4DPXA 2E44A 1T3NA 1UWAA 1IKVB 4Y65A 3RO0A 4OI0A 3H5YA 2OEMA 4KGKA 4X4TA 3MECA 4QWDA 1U25A 1Q8KA 2CQ0A 1O51A 2X3GA 4HNWB 2RS8A 4MFBB 1JJ2R 1S4FA 5L8RC 3DLGB 2OB0A 5GAHU 2X3DA 4BWJA 1WEYA 3MXHP 3NCPA 1RCOB 3PKMA 1HNVA 4HTJA 3R6LB 5FLXU 4FNHA 3DNCA 1RA7A 4G3IA 3DNSA 3HT0A 2AYGA 2MY7A 4DF4A 3KHZA 1IM6A 2W2QP 3OTDA 3K8VA 5J2QA 5I0CA 3MMJA 4KTQA 4W4MA 1UJ6A 3B35A 2B4DA 4GO7X 1OY9A 5J2PB 4RNMA 3C16A 3R7SB 2XCAA 4F4YA 4IAVA 3T19A 1FWPA 3VARA 1LANA 4B3MF 4DZDA 2ZH6A 4FPIA 5I3QA 4WJBA 1U47A 1Q86T 4ZJOA 2WUUA 4IH5A 1Y5NB 4C8YA 4X3RA 2BJ3A 4JI8F 3QT6A 3GKRA 4O4GA 1SKUB 3R9LA 3GIRA 4UFXA 2WVCA 1UW4A 2Z8QA 2HHUA 3QZ8A 1T9YA 4B3RJ 4DV4J 2DNMA 2JFDA 2ALZA 2PRBA 1S6OA 4ZVEA 4CTAA 4QIEA 2E29A 2VQFJ 2VBWA 1FO1A 2CQGA 4FYDA 4RU2A 3LO3A 2OFGX 3KLGB 4JYAF 2NZ4A 3HVTB 4LBIA 3CO9A 4TKTA 4ETZA 5AXKA 4ZJQA 3M9OB 1DTTA 3D3SA 2XWYA 3V6JA 4B9LA 1TF9A 1BD6A 3FJUA 1UWBA 2HLUA 3G71S 4BCAA 1CJUA 4PXDA 3WQPA 4ZI6A 2CNLB 1GNKA 1C0UA 1T7PA 4ELVA 1T8EA 2C2NA 2E1CA 2OO4A 2XG8A 4NCGA 5KTCA 2MQLA 3CCWA 1HW9A 5KFUA 4J9KA 2EK8A 2HKEA 1XTZA 1SJRA 5KAKA 2YNIA 4OHZA 3BGRB 4NLOA 1OMSA 3P3DA 4DYOA 2XSFA 1NB7A 4NRUA 2JRSA 2Z2MA 4W92B 2MYFA 1VQSA 2G9DA 1S1TA 5IT9U 2M2BA 3CC2S 4RL1A 3CXCR 3M8WA 1NE9A 4YB6A 2ZD1A 3EDQB 4LVNP 4LFAF 2V94A 4QW9A 2AV5A 1AZSA 4I67A 1D09B 3V4IB 1LOKA 1YBTA 4LF5F 5ELYA 2WYRA 4DPWA 3GLJA 4A47A 1I12A 3DHWC 1RISA 3KLHB 1VHEA 1IU8A 1UZDA 3H2VE 4B11A 4N77A 4UOFA 1X4AA 3I4PA 3AT1B 1NJZA 4LRBA 4DG1A 3HDSA 4ECXA 3SV4A 1T9WA 1YX0A 4I56A 3WIVA 2DHHA 3B3SA 4OYIA 4HI1A 3D1HA 3RZAA 4J37A 1X4BA 4MFZA 5FVJA 2JDDA 5DO2A 1BLLE 2J8RA 2UUBF 1F2PA 2RE1A 1DAXA 1ROFA 2DPTA 2ZVIA 2YNFA 1RT6A 2HPUA 2QYVA 2BW7A 3LW5C 4WZQA 5EN1A 3M8PB 1TFWA 2FGCA 1NSKL 5CNPA 3ZO7A 1FERA 2Z2YB 1S10A 2V4JA 2VL1A 4P74A 4K0KF 5A8WA 4CYNA 3EO4A 3BGUA 2YNHA 2P6TA 1FKAF 2DXDA 2EK6A 2LEAA 5ETMA 1OWXA 1Y3KA 1AFJA 3QNVA 4E0AA 3MEEB 2VV5A 3E2EA 1HBNA 2FPHX 2HK3A 5KFNA 4R3KA 4ZVRB 4KSAA 2JSXA 1XK8A 1A9NB 2AF6A 2YKMB 1M5KC 4KT0C 2KFZA 3LD2A 1S0MA 4RUAA 5GAGU 4P2SA 3SJGA 2DHXA 3OHBA 3MM6B 4AXIA 2LQBA 2VZ9A 2KJWA 4PABA 4FD4A 2B51A 2CNNB 3GIIA 5ETTA 1MK4A 1R0CB 3QB8A 4NGRA 1CJTA 2H1YA 2ZEFA 4NLSA 2JEVA 1RHKB 4ECZA 5K20B 1VQMS 2VA2A 4HVZA 1RAOA 2CPYA 4JI5J 3B3WA 2RKIB 3UVJB 2XYHB 3NNCA 1HNZJ 3UO0A 1WKLA 2QJ3A 2BEIA 4HACA 1X5PA 3KUHA 3NGUA 2AEJA 5G22A 3CD7A 1NSPA 1M90T 1PJ7A 2RNEA 4J9RA 4F8ZA 1MNEA 4B10A 1FNMA 5KT5A 4UIAA 3AA8A 3OL8A 3SBMA 4UCPA 2ZVSA 4ANCA 2Y8WA 5A8KB 4C98A 1U7LA 3NOGA 2PJ4A 5IFMA 1VQ4S 1RAFB 2AGQA 3TARA 3KLEA 5LMUJ 4U9YA 3QFWA 3I9V9 1N5TA 5F48A 1F2GA 3A13A 3KNGA 3AQPA 3AQOA 4WFAQ 2DXQA 2PIYA 3SI1A 4NZ0A 1VK8A 1KOOA 4QIVA 4ZVQB 4BD9A 1SCJB 1DZ5A 1TXRA 4I68A 4O3OA 4KORA 1S72S 3SHPA 1A2ZA 5IT9Y 2QL7B 1C1BB 3BB5A 5T41A 4BBYA 4OIWA 1P4NA 5HXDA 5BYSA 1UA0A 4ZVTB 2OSQA 4JI0F 3DXSX 3ISXA 3DRYA 3VZHA 4MXUA 1RHUB 3MPWA 1BQNB 4MHYA 3J7YI 2ZW4A 2DO0A 3HZEA 1ZG7A 2DR6A 4NGMA 3IBCB 4CNYA 5E3RA 3Q23A 2XGQA 3MUMP 3RRHA 1Q7LA 2UV8A 5IOLA 4DCJB 4Z65A 1RHQB 2B6AA 2YQ0A 1WHXA 3R27A 4IO1A 4DUTA 1S57A 5CYMB 4ELTA 4FF1A 5AGEA 1ZZFA 2O01C 4U7CA 5I3PA 2YNCA 4DR3J 2H5IB 1G4CA 1VS3A 1QSTA 1TAQA 4GKKF 2B5JB 1T05A 5JQ4A 4CRJA 5KTQA 2CPJA 1ZPVA 2E7WA 3NH4A 4PCQA 2UUWA 1NSQA 2GREA 4RWWA 5BJRA 3HSJA 1AUGA 3A1YG 2FZGB 3JB9k 4HT7A 2HBZB 4CLZA 2ZZTA 1ULRA 2ASLA 1DTQA 5GADI 4OI6A 1KQFB 4JLYA 1Y7RA 3TA0A 2FJWA 1Q8IA 1XMBA 4BC9A 4ZOSA 1H74A 4NZ6A 1S59A 3MR2A 2K1RA 3ZNJ1 2VBQA 3MM8B 5DM7Q 4R9MA 3BBFA 3JTPA 1KFSA 3OD2A 1L3TA 4X4PA 4JI1F 3B3CA 3TAPA 2XEIA 2DNHA 2Y1IA 5C2GA 2EC2A 2Q1LA 1HR0F 1VI7A 4Q36A 3M2UB 2OGUA 2QFIA 5J1NA 2J9AA 3DRPA 1Q0NA 1RHRB 3QRRA 1YVFA 2GANA 2P6GA 2EWBA 1OYEA 2Q4ZA 5CA5A 3DRRB 2IVFB 1U1NA 2P6EA 3MM5A 3OHAA 4IR9A 3DOKA 4AVBA 4TYBA 2C28A 2LDYA 2FCKA 2XI3A 1CBKA 1AROP 2E7VA 3AY0A 4M5DB 2XHWA 4USVA 1FDDA 2YX7A 4U9RA 1MWQA 2C3YA 4K5SA 2JOQA 2ATRA 2KVQE 4IHMA 1HNIA 4PQAA 2FIUA 3TJ8A 3UPFA 5C2CA 3R97A 4X2BA 4LF6J 5JUMA 4HR2A 1XR5A 1S77D 2CZ4A 2OMOA 4IFYB 2OEJA 2RUGA 1NKEA 4DR1J 4DQPA 4ILLA 4R57A 1UFWA 2B3VA 2VONA 4UCMA 2CG8A 1M4GA 3SDEB 4ZJLA 3K5NA 5D8HB 2ZHOA 2WVEA 3FVYA 5F8GA 4FXDA 3MCOA 3PFEA 2V4QA 1S1WB 3FBUA 1RBAA 2B4DB 1HD0A 2IA6A 4NX9A 2HZCA 5KFZA 1RTDA 4KH1B 4NEZA 1GX6A 2YNHB 3GV5B 1B70B 4Z2XA 4DLEA 1P9QC 3M9NB 4MRIA 4CCHA 4AYBD 5KFAA 3X1LB 5D77A 3NMAA 1V3SA 4U7UK 4C7HA 3H90A 2R7RA 1CULB 1PJ6A 3IGVA 4LSNB 5F8JA 2BKOA 3NS5A 5EX0A 3FNNA 1FT8A 2CQ2A 4LF1A 1L3VA 3IS9B 3LWUA 3GFHA 4DV6J 1AB8A 4MK8A 5J2NB 2B9WA 2H54B 3LODA 2W2PP 4HHJA 3BBCA 4MCRA 1KQSR 2I0XA 5KG7A 1ZYQA 1KTQA 1MMDA 2UUBJ 2AFMA 5CPAA 3WC7A 4JD6A 2HGNA 1WWHA 4C11B 1IJEB 1PBUA 4Q44A 4PG8A 1SIWB 2FQQB 1CBXA 1UETA 2QN6B 5D8NA 2CZ9A 1BWVA 4ZBGA 4M5KA 1EZZB 3CEDA 2DH9A 3C16B 2VUGA 5KG5A 1PUAA 1HNXF 1SL2A 3R5AA 3O1LA 4ZPTR 2KTQA 5EC4A 5D0EA 4P10A 2KFYA 2PC1A 2REFA 3CCZA 1SKWA 2LQ5A 2HAFA 4B3SF 2WW4A 3EVOA 2GC8A 4L6V3 4AVAA 1RADB 1PBAA 2FHMA 3F56A 3R9GA 4UUWA 4CAWA 1K0TA 1CJKA 1LK7A 1VQ9S 4O4GB 4FWUA 4ZPBA 2WZ1A 2SXLA 4FVCA 3NRBA 2JBKA 2PVWA 3EC4A 2E5JA 3VGTA 1FRHA 1VQYA 4DR5F 3ZTPA 4YHHF 1APSA 3H20A 1N32J 4TY8A 1HBOB 2BKNA 4R5PB 2FD2A 1RA6A 5CH7B 3FSIA 1PILA 4RW7B 1TIQA 2LMIA 4NA1A 4ZLJA 2YQ1A 4ED1A 1S1VA 1HYSB 5A0YB 2Q43A 2RHQB 4KV8A 1S6PA 2OZUA 1H7WA 4KAIA 2N7YA 4Z7CA 1IBKJ 3D0IE 3CC4S 1IKXB 3GCWP 2QFJA 2GMHA 3NH5A 4MY0A 1TL1B 4CQ1A 1BQNA 2HNZB 2UUCJ 1WNEA 1WHYA 4DU8A 1T9TA 2RDDA 4DS5A 2P9GA 2NXNA 4WFBQ 2ZHBA 4OC2A 4KGXB 3CF5Q 2ZH8A 1KUVA 4LJMA 1XF8A 2ANPA 1X10A 3S9NA 5H9EK 1VQLS 2BX6A 4U6PA 4MFJA 1R8CA 4KPYA 4KJIA 2YNCC 1NNDA 5CYMA 4K59A 2HBQB 1LXNA 2ZH3A 4JV2A 2W9CA 5ADZA 1RT4B 3VWDA 2BE7D 1N0UA 1P27B 4DV0J 2XZWA 1UW9A 2IIHA 3HFKA 4KO0B 4DOZA 3I4HX 1TL3A 3GR0A 1QLNA 3TVZA 1PAUB 1LCPA 4HDGA 2M0GB 1JLFB 1WEZA 3P4UB 2VZZA 2E5GA 4Z7YA 2VC0A 4N8NA 3T5JA 2V4JB 1U4BA 4ZX9A 1URRA 2JJ4D 1BUXA 4YS2A 5EHHA 2CWXA 4LF7J 1BE4A 1Y9KA 4OYOA 2DY1A 5EMIA 5CZVA 1U1LA 2CA9A 3ZTOA 4B17A 3D0HE 3HHKA 2PJ3A 1I3OB 1UAWA 2QG9B 2IMOA 2RVJA 4CYPA 5LRGA 1NSAA 5C25A 2A18A 3QIDA 1LQ9A 4QU7A 4NI2A 4CT8A 3MR7A 4A38A 3MPYA 1NK6A 3KOAA 4EVYA 2H4YB 1T95A 1BGXT 4QYRA 3PHEA 4K4UA 4H6UA 2JDCA 4GKKJ 2XEXA 2HVHA 3QO9A 5D3GA 5LXRA 5L9XA 3PYFA 4P4BA 5HSPA 2D7SA 3M8PA 4DV1F 1K0VA 1FTRA 1NM2A 3K8WA 2PJAA 4NASA 4B9UA 4NSQA 5D4PA 1KC8T 3V8IA 4O0IA 3MZIA 1FESA 1Z9UA 3BDPA 1PYTA 1XBUA 3R6GB 1S79A 5AT1B 1GTHA 3BJ8A 4WFXA 2C6CA 3IWEA 4F4WA 3UY5A 2AEMA 4MFPA 2HIQA 2DB1A 3W8PA 3FB3A 1NMEB 2G2ZA 4Y3CA 4DL6A 3JSYA 2HGMA 5KT4A 4CLFA 1PG5B 3RBEA 4ITSA 3BQ2A 2KYZA 4FD5A 2IM0A 5DM6Q 1SH0A 2HHHJ 5AG4A 2MKIA 1G3OA 4OYBA 2F9DA 2FE7A 2IL4A 1BPMA 2OH1A 4B3RF 2PJ1A 1M1DA 2QLBB 5KG1A 3GYXB 8CPAA 2QJ8A 3TO6A 2V6AA 2FVRA 2D3O1 4X4SA 1QAYA 2O28A 3BI1A 1FFSB 4K4YA 1C1BA 1ZS6A 4NGPA 1QAJA 2QEXS 5SZTA 3CE8A 3NKYA 1XEZA 1D1UA 4CO0A 1ELLP 2LXIA 1CULA 3A8EA 1KUYA 4M6GA 3D8PA 3VAMA 3NG8A 3EZ5A 1K4JA 3FCVA 5HLFB 4C2MA 1DLOB 3DLEB 1HNVB 2J7WA 3M2RB 3I6PA 3HSDA 3H5SA 5LMNJ 2R7SA 1UP1A 3TTHA 1BQXA 2GMLA 1NEEA 2GFFA 1F60B 1R27B 2E5IA 1UMJA 2XC9A 1TKDA 1WC4A 2JVOA 3F44A 4OYWA 2D3UA 1UVJA 4OYAA 1VRQC 4ZK7M 1IR0A 2AJ0A 4LR9A 3PX0A 4HDHA 3MMCA 4GS4A 1V5IB 1SI9A 3H5ZA 2DIUA 3TQEA 1N34J 3CJ3A 3ISZA 2J0WA 2ZZNA 1F2HA 1S6UA 1ZOTA 1VBZA 2PMWA 4IG3B 1HQ2A 2I38A 3HK2A 4LRFA 5C42A 4ZMMA 1Z1ZA 5BXIA 3PW0A 4TNOA 3BPSP 1LAMA 3AJDA 1WI8A 3D5MA 2DH8A 3UE2A 4A2ZA 2AJ6A 4WU2A 3KL9A 3KMQA 1W26A 3VWEA 5J2MB 1VJWA 2D74B 4AT1B 1X12A 2EBEA 4KQZA 1CS4B 3TX0A 1S0VA 3CTRA 3A12A 3QZ7A 5HMYA 4DDFA 2KHCA 1XMOJ 2KN4A 2X51A 3ITHA 3ZZZA 5F8MA 1E6VB 3I9SA 4UQGA 2VG6A 1NH8A 3OV7A 3QQCD 3BDEA 2C1EB 4EMDA 3KK2A 2LQ9A 5LSRA 1HI0P 4CGPA 2Q6CA 3VVTA 2R7TA 1FRXA 3OL7A 4USHA 2R7VA 4B3TF 4O3RA 2BJEA 3UVJA 2MQPA 1F9FA 3DI6A 4PWDA 2HVEA 2L9WA 3X3UA 2GA7A 2AWZA 1M1HA 3OT9A 1IBMF 4MJ8A 2J6SA 2HZAA 3R1HA 3N6NA 3WHIA 3DCAA 1UL3A 5EUHA 4USWA 2AE6A 3DYAB 4WP9A 1HIYA 2G0BA 4N7TA 1Y0HA 3AFGA 4J9PA 4KSEB 5HQ8A 2KZMA 4C97A 3G6ES 1CP6A 4PZVA 5KFIA 1IUJA 3ULHA 4MHDA 1GQEA 2DGQA 3K89A 3IG1B 1FF2A 1JX4A 1QM9A 4DUKA 2BVZA 2CJQA 4OC4A 4J5OA 2CQIA 5FDLB 3TT2A 4KYZA 1S99A 1X5OA 3IWGA 5E3PA 1V3RA 1UVIA 4A32A 3VALA 4ID5A 1TAUA 2NXCA 4JXRA 1Q2CA 1MG7A 1PYOB 3D66A 5IT4A 1VC0A 2CQ3A 2GU2A 1KP6A 3B3VA 2KM8C 2LFVA 3V38A 4K4ZA 2HFUA 3NGTA 4OX7A 2ZM6F 3L95X 4CAFA 2EBGA 3V4IA 3FMCA 5KFWA 2DRDA 2WTFA 2Z3MA 4X4NA 3KJFB 4NLRA 4JV5F 3DHXA 3RW6A 4U96A 3PVXA 5DS7A 1JKHB 3EZUA 3AJ1A 4IYQA 2JH3A 1NCLA 4MKBA 4PG4A 2WSEC 4OC3A 3GYNA 2VG7B 4ZY2A 4J91A 5E5NA 1I6JA 1S7IA 1N48A 1R7IA 2C3PA 1NHUA 5LJ5Y 4O44A 3EXCX 5I4MA 2HHQA 1VBYA 4P45A 3I1UA 3SSQA 4CWBA 1JLGB 5F3ZA 2C2RA 3PYDA 4J9NA 4NOHA 4I0WA 3CO0P 1RT5B 1F2OA 3MEDB 4E98A 3GIJA 3JVNA 5BYRA 1QSOA 2O4HA 3AOBA 2E9TA 4DV4F 1RTDB 2NYIA 4C7IA 3PG9A 4EUVA 3FEZA 2VQFF 1H98A 4A8FA 4XIUA 5HK4A 3QNWB 4DXLA 4RO0A 1RT7A 3M2VB 3GILA 4OI1A 2CYYA 4PQUB 3V81A 3PJXA 5KFLA 3FQKA 1U0HA 2YKMA 3L2NA 3JSMB 4FD6A 3H59A 3C19A 4ZDNA 5KG3A 7AT1B 3PO4A 1HPZA 4IQXA 3O44A 3ETMA 1F57A 3GPAA 4KS9A 1CJKB 2CJXB 2JEGA 2R8GA 1U2CA 1JXVA 1Z8WA 3DSBA 3JTKA 2V2VA 5M2PA 1RT1A 3HD2A 2B9EA 3PACA 1F9HA 2MLXA 4UT4A 1KEKA 4UBRA 2P0WA 4Y0FA 2EBJA 2VFTA 4WKRA 4DR3F 1RWUA 1DTTB 4USJC 2MDAA 1NRKA 3R5CA 1EAYC 4YWYA 3FEDA 4ETXA 4XDCA 4CO3A 4FYYB 3G4SS 1RQ0A 4ZPAA 3NH8A 3IGNA 2H3EB 2AFXA 2XLJA 5KFVA 3G8SA 1C4CA 1H6KX 1NB2A 2AZ1A 3BKTA 2G4BA 3J7YU 3HHNB 1Z5RA 1CEZA 5D15A 4QPXA 3M8RA 2B56A 1R6YA 2EEYA 4ZCMA 3DDKA 1Y7PA 1Y7EA 3ZZYA 3NAIA 3PM9A 3NGDA 2ZH9A 3GE9A 4CGOA 3GJRB 1A7GE 2PSZA 1OJ4A 4TU7A 4KOXA 4DFMA 2JLEA 4C3LA 4DEZA 1HMVB 2RUSA 1ACMB 4N8OA 2UUTA 4DPOA 1YRXA 6AT1B 3MD1A 4ICLB 1IICA 2J9DE 4R0JA 1QSLA 4O0NA 2E5LJ 1FFGB 3SQOP 2UXDJ 1TTHB 3W9JA 2DH7A 2YNDA 3TUZC 2W4CA 4BINA 1JLEB 2ZKTA 3MFHA 1PC4A 2W9BA 4DSFA 3IAS9 3R5DA 1EQ0A 2RJZA 1RE1B 2G2YA 3BBBA 5D4NA 2MB0B 3FJ2A 2EUIA 3KLIB 1TMJA 4C48A 4DZ6A 2VF3A 2L41A 1TV6B 1N8RT 5LMNF 4PUOB 3ILIA 4P72A 3F41A 4RNOA 2IBOA 1U8WA 1Y0YA 1RAHB 1IBLJ 3NEKA 4OMFG 2I1RA 1R8AA 2VPYB 4QYZK 1O8BA 3QGPA 2WVDA 4CYOA 1I5OB 1XRYA 2XMMA 5A28A 3HUVA 4B9NA 2MQQA 3BO3A 4FDFA 4X84A 5ETNA 4H2KA 3FKBA 4DN9A 3RBXA 2GS8A 1N34F 3HMJG 4ECRA 1RAIB 1ARLA 3IR5B 2X1BA 3LOUA 5HVGA 1O0PA 2IVMA 3EWGA 2YWGA 4DV0F 1S6QB 2PJ7A 3FEYB 1IGBA 4USTA 1FD8A 4IR1A 4KGMA 3CDUA 1REGX 2MZRA 3I0RB 4IFVA 3RB0A 4JI3J 3PIOQ 1RT3A 5C25B 2B6AB 2R1IA 5L38A 1SQHA 5D78A 3TWZA 3M9MB 1X9WA 4XDDA 3N5BA 3BN7A 3AODA 1TKXB 3DOLA 4MJKA 1SUQB 4TXSA 1K9MT 4QQBA 3N01A 4QIFA 1HHTP 4RNFA 1S1UA 2E9RX 4C2YA 2D69A 3EGNA 4V1Ak 4IQMA 4NXYA 1RJJA 4WK1A 4GXHA 5D3GB 4MKYA 4UY8T 4ZKAA 3C66A 5D6GA 5JXSA 3PCOB 2W7AA 4UEFA 2DPSA 1J4JA 2VU5A 1U6BA 1YWXA 3P49B 1HKAA 5H1SV 2FJDB 3NCQA 4A46A 2YNEA 3W8GA 2PN6A 1HBMB 4FF2A 2K7JA 4IO9Q 2XZDB 1S7KA 1WK4A 2KVIA 2V68A 2DNOA 3MMAB 4ZGYB 5AE1A 4IKAA 2Q6BA 3HLPA 2ZEOA 4CLTA 4L8AA 2OHDA 4P7TA 1PSDA 3IWXA 3LGNA 2NSBA 4WFZA 2UV8G 4I4BA 1RGVA 2CPIA 3T1YF 1K44A 3KQZA 3PEIA 2GO8A 3LWLA 3W2WA 3CMAS 2V67A 4DX6A 3AOAA 3HJVA 1UVKA 3OFEA 4PXBA 1YBAA 4L89A 3TE4A 1BMQB 5L39A 3KUGA 4GO5X 3ZC4A 1YR0A 3QAHA 5JM6A 3ET6A 3MTKA 2Y0SD 1SKSA 4ECUA 4B3TJ 5F8HA 3KMSA 2FGOA 3CW2C 4DMZA 3TNVA 2ZEGA 3VZIA 5KFDA 2Z0ZA 1U24A 4WU3A 3BYPA 1CSJA 3BEGB 2KFNA 3LP1A 3PFOA 4Y2CA 3UFCX 3ISND 4FF3A 1GX5A 1JLCB 2OKQA 4ID8A 5HO4A 4PQUA 4P52A 1R43A 1YI2S 1VRUA 4P73A 3KLFA 5B0EA 1DTDA 1EQMA 2B8QA 3C6TA 2OD4A 3JQMA 5DLGA 3D6FB 5M2UA 2GGPA 4EYIB 1KLMA 2XYPB 4U9ZA 1VIXA 3MOJB 3G87A 1E6VA 3BF4A 2DGVA 4WYLA 2KKHA 1CX8A 4ES3A 4XNHB 1GMUA 2K8GA 4R3LA 3D3CJ 1L0CA 2FYXA 3GG0A 2UXCJ 3OQ2A 2GAGC 2IYIA 2X1AA 3BREA 2BQRA 4PSXA 2E5HA 4KOTA 4II9A 2MJUA 4CP5A 4ZN1A 4FAIA 4NYPA 4MBUA 1GMVA 2HWHA 2VJUA 2KRBA 3EICA 4F04B 4CLLA 4FPRA 2YNGA 2ASDA 4NMLA 3OW2R 2HVDA 4IOAQ 2J7KA 3T1AA 1HHQA 2HS3A 5DDPC 5THWA 1OYDA 2N4CA 1LWCA 4ED7A 1WOPA 3TYTA 3CT9A 3PV8A 2VASA 1GH8A 4Y49C 4P4EA 3P96A 3VAFA 5RUBA 1NBEB 1MW7A 1NK8A 4YDXA 4LF5J 1F0XA 2RSQA 1VQ5S 2AQ4A 2R8HA 4KVXA 4O3NA 4UZCA 1IM4A 1S9GB 2DHSA 2DEIA 1KHVA 2RMLA 4X4RA 2R8JA 2ZOMA 5KFHA 4QR2A 2QA4G 2Q04A 8AT1B 3D4JA 4UWJA 3W3SA 2JEFA 1D9DA 5K9FA 3TAQA 3WC5A 1SH3A 2UXBF 3KUEA 1WOSA 1Y3JA 3F5BA 1ZBTA 2QLFB 4NCAA 2R98A 1YG0A 1X4DA 3SSSA 4CIOA 1IBMJ 4OZJA 3LQVA 3JTOA 4YFJA 3VHQA 2FUG9 3ADAC 3MPUB 3H4DA 2PR8A 3CJ5A 1KD1T 4J9MA 1RYSA 3LH2S 5F41A 4WIQA 3R5BA 4FUUA 1HWLA 2HW3A 2YH1A 3KKWA 2JFKA 3WDOA 3BLNA 2RKIA 4RW7A 2WZNA 1VHIA 5DZ6A 4YB1P 1NDLA 4TU9A 2JVRA 3UR3C 5KFOA 3FGVA 4RZRA 4QBJA 3H5UA 1IVZA 3N79A 1KFDA 3HF5A 4Q0BB 2FIAA 4Y2KA 4GVBA 3AH6A 2E66A 4JI7F 1RHJB 1BPNA 1P0HA 2ARHA 1OZPA 3M2VA 3PKYA 1TK8A 4WZMA 3CCRS 3OSPA 2KG1A 4MIWA 2CAJA 2ZOGA 3SQGA 4NRTA 2DGXA 3SI2A 3TOBA 1N5YA 4ZVSB 4F50A 4CO4A 1YVOA 4GM5A 3UNGC 3K0JA 2FVSA 1N56A 3FFIB 4KOVA 2HNYB 2WVBA 4JOUA 3G6VA 4U95A 2EFQA 4Y2MA 3MPVA 1T3OA 1V5VA 4KGZB 3WIUA 2XLKA 1KN6A 4XNHC 2IMWP 3MEDA 1N4LA 4LSLB 3AD8C 3MECB 3IAM9 3N28A 1SV5A 1DQ9A 4DV3J 3FSXA 4DR6J 4AL5A 4EO6A 1AFIA 2XI2A 1VQ7S 2BDPA 2EVZA 2J9EA 1TKTB 3LPYA 3CD6S 2OTJS 4F9VA 5GMKa 1Z8XA 4GRSA 2C3UA 3T8WA 1ZETA 2VG5B 2CQDA 2Z30B 3MM6A 3PBBA 4QB9A 3GU0A 2MQOA 2XMVA 2H65B 4P71A 2QC3A 4WBFA 1OSCA 2XO6A 2WK4A 1HNZF 3KFWX 4USKA 5IC6B 3TO7A 1IY7A 2CZVC 4RW4B 2HURA 1IQZA 3LTOA 3PY8A 2NXEA 5HI7A 3ENVA 2FHKA 3Q8SB 1FJEB 3CD0A 4PK3A 2CFXA 1QSYA 2BZ2A 4K4TA 3DRSA 2DNGA 1HLWA 1MWYA 4ZA1A 3R1KA 1M4DA 2ILZA 3KI9A 3R7BB 2Y9HA 4N47A 3IM9A 1T94A 1W2BR 2AJ2A 3RYLA 3KG0A 3R7NB 4URQU 4K5RA 1SKRA 4NXNJ 1U1MA 4H4OA 2RQCA 1JLCA 2DHAA 4OJHA 1Q2YA 2R7OA 4E0DA 3Q8PB 3UN3A 3R96A 2HNDB 1W25A 5IV4A 3LALA 2V50A 2FVPA 3D28A 1RLCL 5JVGQ 3MGDA 2EC0A 2ZBCA 1EARA 5B08A 3TO9A 3KASA 3NL0A 1NH7A 4EBDA 1SJ4P 2FHOB 4KO0A 5ITHA 6CPAA 2FLLA 3IO1A 2XNRA 5H84A 3DU6A 5K8PA 4ECTA 3Q8UA 2RT3A 2EG1A 4M5DA 3MM7B 1KDNA 1N71A 3HHDA 3PB9X 4F0YA 4DX8H 1WHVA 2CTBA 1V3ZA 3OTBA 3I5BA 4HHUA 1FEHA 1QE1A 2DIVA 4LSNA 3QT8A 5B7WA 3BGFA 4DBQA 5DETA 2KXFA 2YNIB 4C9DA 2RC4A 4ERDA 2IYGA 3IS9A 2HB6A 2BQUA 4CNZA 2BOAA 1HNWF 1VLOA 4OAEA 2VDHA 4BBHA 5HH1A 3GFXA 3PIPQ 1QSMA 3MWBA 3L09A 4RKUC 1TV6A 4ZIVA 1IQTA 2C2DA 1JK9B 3JUWA 2BSWA 3GG1A 1RT6B 4A37A 4NEXA 3QO9B 4TN2A 2GJFA 1YITS 4KUAA 2I5JB 2CXAA 2UZAA 2ZEJA 1NU4A 3GY9A 2YPZA 1OSDA 3TAMA 2ZJRQ 1WF0A 1RTQA 4V19X 4LBHA 1ZAVA 1IBLF 4I7FA 1YLXA 2DISA 1M1GA 4I6AA 3UDLA 2AKWB 4ED6A 3S8SA 1NUEA 2K1RB 1URNA 1MWZA 4NGNA 1H8LA 3SXLA 2NS1B 1DE4C 2B7CB 2BCOA 4YGOA 1ZO0A 2YKNB 3LGHA 2DJWA 3CNQP 3QAEA 1YJNS 2B9XA 4OJGA 2WONB 3D7DA 2G1DA 3DR6A 1IKVA 1TKXA 4DS4A 3DOLB 2GV1A 2V5HG 2N7CA 1Q95G 2XHCA 3HKWA 1WORA 2D1CA 3DOKB 3BZQA 3G96A 4KHPF 5HANA 2HV2A 4ID5B 2DCLA 1FNXH 2CQHA 2G9OA 2J0XA 3R3TA 4L73A 4NZ7A 2HMIA 2GIQA 2ABZA 2JDJA 1J2VA 3QAYA 4CI0B 1B3TA 2QMLA 7CPAA 1N36F 1KVIA 3DM2B 4ZPWR 3HCXA 1S5KA 1SJFA 4LX9A 2HAIA 2GJIA 4C2ZA 4IDKB 3SJEA 2XO7A 4DI6A 1JJCB 2AYBA 1RZMA 3AHPA 2PDAA 2QSFA 3THPA 1L3UA 3MMAA 4K4VA 2QMXA 2OUGA 2DHGA 3I82A 4TLRA 1EP4A 3NGRA 5JH9A 1RWKB 2B7BB 2XS5A 2Z3KA 1VISA 3MGJA 1B0TA 3QT5A 2PRQA 1NK9A 1X9MA 1RO5A 3CD5A 2POKA 2LVWA 4KVME 3C15B 2CVIA 1W7WA 2F8HA 3EUNA 1RU1A 3KGQA 2M52A 3L3CA 3SJFA 3RGIA 2W7OA 1XMOF 1FWLA 5L46A 1TUVA 2OPPA 3WC6A 4A95A 1RBOB 4BHQA 2MTLA 4E8UA 4NGQA 4RW6A 2XMKA 1I1GA 1G2EA 3RUBL 2VG7A 1TZ0A 2EVNA 3MM9A 1PYSB 4M5MA 2MGZA 2R7UA 3DMJA 4EU0A 1TU0B 1XR6A 2ZBPA 1H2TZ 3V6KA 5AXLA 2Z56B 5IV0A 4ZYQA 1GXLA 1IKWA 3A3PB 1LXJA 2PGCA 3DXBA 3Q0AA 3G6YA 3H8FA 2CNKB 1M0SA 1ZPWX 3CC7S 1U1KA 5B0FA 3DR8A 5AJ3J 5AG7A 5A27A 4EBEA 4A8WA 3H8GA 1KQGB 2QSWA 5KFCA 2VHGA 2DR5A 5L1KA 5H9EJ 2BRLA 4C0OC 3ZZOA 1DTQB 2CUYA 4DR7F 2VFSA 3BXMA 2OPQA 4IUSA 2IAJA 2B0GA 2LXFA 1KR4A 3PRVA 1S0OA 3MM8A 2Y1RI 4MIBA 4ZLLA 3UNYA 3T9YA 2ZH2A 4ZY0A 2QLJB 4LIRA 2A10A 4LR8A 2KI2A 3HFVA 4KLWA 4ZP8A 3M6VA 3D2MA 1M4LA 1H72C 2P9EA 2B4BA 1FJCA 3AOCA 2OEKA 2BM0A 4RX6A 5E0OA 4OIDA 3QJLA 5B09A 2CDQA 1KQKA 1BXNA 4EWTA 5DG7A 1S1XA 2QIFA 4NCBA 1ITPA 5IV3A 1QUVA 5KFMA 4ILMA 2UUAJ 2XY7A 3NNHA 2KT5A 3OVSA 3KG1A 3I9ZA 4DV3F 1NSLA 3LP1B 3EVMA 2IFXA 2HQFA 2OPRB 1E6YA 2XMAA 4ZY1A 2GHVC 1DRZA 3CJ0A 1OQ3A 3NWGA 2HBYB 5DG9A 5T14A 1Z4EA 4BMHA 3MEGB 4NMXA 1UPMB 2IM2A 3KHHA 1MU2B 1GK8A 5F9LA 2OU2A 2F40A 3SV3A 3AD9C 5DGBA 2XMJA 1Y11A 4LQGA 1UCNA 3M8QA 4DPUA 1LFWA 1RB0A 3WR7A 2W9CB 3QMQA 2CF4A 1WDDA 4DN0A 1VBXA 1DURA 1HWIA 2YWEA 1NHVA 1VRTB 4ORFA 2J8NA 1Q53A 2KJVA 2VIHA 2Y8YA 1G1XA 7FDRA 4DSEA 2EW9A 2I3CA 3OR2A 2I5JA 1RAJA 3POTB 2DNLA 3SI0A 3UI3A 3EYZA 3VAKA 2Q7SA 4ZVGA 3D2WA 1N6QA 5J1EB 2OSRA 5CCMA 1X31C 4XTTA 1LEOA 4GKJJ 4EO8A 4GVLA 4OC0A 2I9SA 3NY0A 2Z3NA 4ED0A 3DLEA 5E3CA 1QMUA 2VPWB 2DPIA 4HLBA 2PEBA 1XNRJ 4F3QA 2W25A 4IRKA 2C2OB 3CXPA 3AXKA 5ISVA 5KFPA 2F8MA 4F36A 4K30A 3MTJA 2BABA 2IJFA 1ZM4A 2HS0A 3OBIA 1P1LA 4UW2A 4X2TA 3CSKA 4A94A 2XSJB 2BJ1A 3GWCA 3NP5A 1PGZA 3VQTA 2CQ4A 5EX3A 1S9GA 2YBVA 4A31A 5I42A 1U1PA 3D68A 4LQ6A 3U02A 3Q8VA 1ICEB 2L9NA 4UCNA 2QIRA 2K3KA 2XEJA 4B9TA 1R0AB 5C42B 1YZ6A 3M05A 3SJXA 4C8MA 2U2FA 3T9ZA 2GVZA 4A8KA 3LP0B 4OZ2A 3CIMA 5AXNA 4UY85 2OFHX 1K73T 4ELUA 3W66A 3JYTA 2KCWA 2RIJA 4DL3A 3Q86A 4KR0B 1EKRA 2WAQD 2HEKA 3L7PA 2LXUA 3VCDA 4I6WA 1Y9OA 4MAKA 4QVTA 4HNYB 3P6YC 4X4UA 1DARA 3O6QA 2J8AA 1HR0J 1BQMB 5F9NA 4EGLA 4A4JA 2HQYA 2PJ9A 3KK2B 4R5PA 2I6WA 3NOCA 4FBEA 1PO6A 4JI5F 1M5PC 4JWPA 4A8YA 3P45B 4W98A 5KFGA 4LT6A 2G0JA 2HRTA 3KHXA 2QE5A 3UD3P 2V8GA 1HL6A 1N36J 2O67A 2PJ5A 2RU3A 4Q0BA 1S3ZA 2GFQA 3O2IA 2FC8A 2ASJA 2W2MP 2NPFA 3UDEA 5J2QB 5LYIA 2BXJA 1DLOA 1FK9A 3RRKA 2QVPA 2KT2A 3K57A 5ETLA 1MMNA 4ZCKA 2AX1A 4DSKA 3D67A 4X8IA 4AXVA 4P4DA 4QJVA 4U5YA 1QTMA 3R95A 3R5GA 2NUHA 2UXBJ 2KH9A 5HMNA 1NPPA 1M1KT 4X62J 1XMQJ 1N5YB 2HFZA 2FTRA 2FY8A 2DVIA 4UWIA 2HFSA 1GAOA 2X1GA 4Y28C 4K8RA 2MZ1A 2HQCA 1U6ZA 1HBOA 1QDUB 4QWCA 1Z4RA 2HWTA 2RD5C 2HSEB 4DV1J 2FVGA 2LQJA 2DNYA 4A48A 2AFZA 3IWWA 4ZHRB 4LSLA 2IC3B 4PXEA 4E8OA 5DQGA 1LW0A 2BQ3A 1KVJA 3TJ9A 2AJ4A 2DCUB 3J81j 1NO8A 3TAMB 5IQQA 2CWKA 1FT7A 1MJ9A 4B14A 1HI1A 1OS5A 4MKAA 4R8UB 1F5CA 3C2PA 5HBMA 2CJBA 5KG0A 1ZAWA 1NZ8A 2J6TA 2BM1A 2QLXA 1HPZB 3MRUA 2Z3PA 4ECSA 2PVVA 2BANB 1D9AA 4FF4A 2FVCA 4ZVPB 3V6DB 3ITHB 4U67Q 1DQ8A 2A3JA 2LYVA 5A2QY 2PMZD 1NK0A 1KBRA 5HN0A 1TL3B 5FJ4A 4ECWA 4CAXA 2MQ8A 1BY9A 2VFUA 4Z37A 1M4IA 4ED3A 1SQFA 4LRAA 2WB1D 3FBCA 1CQNA 4H4MB 4YOEA 4X65F 3TOAA 3OTCA 2H5EA 5LYDA 5HLFA 4DR7J 2YKAA 4PV6A 5LT5A 4DJLA 3IR7B 2GHWA 4FP9A 1U45A 2OPRA 2V63A 3NBPA 2IJZA 3Q83A 2YVSA 5HAOA 2RQKA 1IKYB 5KFFA 3ELHA 4LUBA 3K9TA 4DR2J 2PDOA 1LWCB 4NLXA 2YWFA 3UD5A 2PD1A 1D8YA 4FKXA 4B02A 3W2WB 4IRCA 3MR3A 1H2VZ 1YK3A 1AZSB 1S7LA 1RTJA 3CVKA 1SH2A 4IG0A 2B5GA 2JEIA 4M5HA 2E5LF 4AUKA 2VD3A 4OZ3A 2NSCA 4EFAC 5H9FK 3QBCA 3ZTQA 3ISNC 2DR9A 1H73A 3M1VB 4F4AA 2FJBB 2ZFHA 3KG4A 4LRDA 1H7XA 2ZNZA 4A8MP 4DSJA 4OL8A 2EWHA 1GMWA 2VPXB 3RB3A 4HTIA 5D0GA 3NE8A 2G1HA 2R8VA 4I2QB 4CZCA 3GP9A 2LU2A 2LEBA 4HL9A 3AB2B 3G82B 1KNZA 2NPIA 5ETVA 1RTHA 3D7SB 3T3FA 4NXNF 1EP4B 2W8LA 3C6TB 2IY5B 2FXFA 3E01A 3R9FA 4L75A 1ZG9A 4ZP6A 5F46A 1TL7A 4PR6A 3W5XA 3GJTB 3KZWA 5J8FA 5MAOA 3QT7A 2LLZA 2PI5A 5HATA 2RS2A 4C0HA 1RKJA 2ZNYA 1IWAA 2ZOFA 1HQUB 1BLUA 3MR6A 3GONA 3QIPA 5J2PA 2D9PA 1PAEX 4DV5F 3V6HA 2JZ5A 4MCSA 1IOFA 3BHXA 1F5AA 5L1JA 1SV5B 1RACB 4AVCA 1T0TV 2EFOA 5G0RB 5GMDA 1S5ZA 4H6ZA 2NQPA 4ED4A 4FYWB 3KHGA 2IAJB 3DKDA 4IOCQ 2AFSA 2CIJA 2FJXA 4A39A 3IM8A 2DGUA 5CQGA 4KY3A 3L4BC 1ZTWA 3K7RA 5AE3A 3MURP 1VC6A 4J9QA 2FLNA 2KB2A 1ON0A 1DHMA 4TY8B 1F6TA 2WSCC 1XJOA 2HBRB 4KH0B 4M94A 5KG6A 3GJQB 4CTAB 4KHMA 1IKWB 3EXNA 5F0WA 3PX6A 4CLSA 1HBUB 2J8SA 3H7HB 3ZZIA 4BLGA 3KLGA 3LF0A 2FSRA 3CUNA 2J6UA 3KK1B 1ZM2A 4Y49B 2EFPA 2RDIA 3NWRA 4JB8B 5A8KA 4OKOA 2EK1A 5HVHA 2CNSA 5IM0B 5B0DA 2FY1A 3KLEB 1RCXB 2O1PA 1JB0C 3PRTA 3HXMA 2O5DA 1FXLA 1HBMA 4OYXA 1XQIA 4NEYA 1GTEA 3NGSA 2ABYA 2CG4A 3QPIA 4DL2A 1K1SA 3SCIE 2ZH4A 2Q44A 5LM7E 2AX0A 2W1BA 3KYLA 2HHTA 3FBEA 5FDLA 2L48A 2UXCF 1EIYB 3VWSA 4R0EA 3OL9A 1Q81T 4N5SA 3HHLD 2XNQA 1VBKA 4LFBJ 1IN0A 2PSWA 3QJJA 3D3BJ 1VQKS 1EETB 2XBPA 3CJRA 3TEHB 5CD4H 2F63A 3DI6B 2JX2A 1VGYA 1NMTA 4CRYB 2ATCB 3IBWA 2VEZA 5KFEA 5IC4B 1RSCA 1U0HB 3ZZ0A 2W8KA 2JLFA 2IDLA 1N6QB 3PX4A 3S6HA 3DYAA 4MI4A 3WX4A 3DLBA 4MY3A 1FWKA 2YX1A 1Z2ZA 4CGNA 2Z11A 4NYOA 2L3MA 3GYGA 2R42A 2P8IA 4O23A 4UQTA 2QECA 5KG2A 3N5FA 3KLI