1XMBA

X-ray structure of iaa-aminoacid hydrolase from arabidopsis thaliana gene at5g56660
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
392
structure length
375
Chain Sequence
KLLEFAKSPEVFDWMVKIRRKIHENPELGYEELETSKLIRSELELIGIKYRYPVAITGVIGYIGTGEPPFVALRADMDALPIQEGVEWEHKSKIAGKMHACGHDGHVTMLLGAAKILHEHRHHLQGTVVLIFQPAEEGLSGAKKMREEGALKNVEAIFGIHLSARIPFGKAASRAGSFLAGAGVFEAVITGKTIDPVVAASSIVLSLQQLVSRETDPLDSKVVTVSKVNPDSITIGGTLRAFTGFTQLQQRVKEVITKQAAVHRCNASVNLTPNGREPMPPTVNNKDLYKQFKKVVRDLLGQEAFVEAAPVMGSEDFSYFAETIPGHFSLLGMQDETNGYASSHSPLYRINEDVLPYGAAIHASMAVQYLKEKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords IAA-amino acid hydrolase homolog 2
publication title X-ray structure of ILL2, an auxin-conjugate amidohydrolase from Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 122
structure length 375
sequence length 392
ec nomenclature
pdb deposition date 2004-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1xmbA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1xmbA01
2ZEDA 1UWYA 2GU2A 5F09A 2IQ6A 2ABZA 2AFSA 4W9YA 4NFRA 2F7VA 4ZX8A 2ZEPA 3CT9A 2PVVA 3PRTA 2FVGA 1BLLE 4MCQA 4MMOA 2ZEFA 3D7DA 4UEEA 4NGMA 3QNVA 1BPNA 4R76A 4RUHA 1CG2A 4ONWA 1ELLP 1TKJA 4NGQA 3SJEA 2RFHA 4MHZA 4NGRA 4OMEA 3I1UA 1R3NA 4IAVA 2CIJA 2ZEOA 4OC3A 3D7HA 2ZEEA 1YSJA 4DUKA 3FF3A 4Z65A 4R8FA 4G1PA 2V8VA 2VL1A 3NH5A 1ZG9A 1VHOA 2QVPA 2AFWA 2PJ4A 3WC7A 5HVHA 4A37A 4MCSA 3HUVA 4X8IA 2Q51A 1EE3P 2PE3A 3RAMA 5HXDA 4ZX9A 3D67A 3KZWA 2PJ8A 3L2NA 1Y0YA 5K8MA 5LYDA 2RB7A 1F2PA 3V38A 2XEIA 3MRUA 3SJXA 3B3SA 1HEEA 3K9TA 5CBMA 1TF8A 2CTBA 4OIWA 1XMBA 2HB6A 3PEIA 5I4MA 1ARMA 3PFEA 3ISZA 3BI0A 4GM5A 3BXMA 4FWUA 5HVGA 1VHEA 4P4BA 4OKOA 3KGQA 1R43A 4P4EA 4BD9A 4P4JA 4AXVA 2ZELA 3PFOA 2G9DA 1ZLIA 1AMPA 1BPMA 1LCPA 3H8EA 2PJ6A 1IY7A 3K2KA 2F8HA 4OIDA 1HDUA 4PXEA 3GLJA 5LYLA 4NGSA 1NSAA 3SJFA 3CPXA 3S9LA 3N5FA 2GLJA 2AFZA 4FUUA 4R6TA 1Y0RA 5DS0A 4MCPA 4PPZA 1TKHA 1FNOA 1ARLA 2JBKA 2PJBA 2GLFA 3B7IA 1DTDA 1PYTB 4WJBA 4CPAA 2PJ1A 5LRJA 2ZENA 4DYOA 4F9VA 3WC6A 3CPAA 4NJQA 3FEDA 3FEEA 4OC5A 4K3NA 3B35A 4TWEA 1ZG8A 2ZEGA 3PB9X 4P45A 4O23A 2HC9A 4PXCA 5D29A 3PB8X 6CPAA 2ZEHA 3KHZA 4OP4A 4P4FA 1CBXA 1KWMA 4P4DA 2O4HA 1ELMP 4X3RA 4P44A 2PJ7A 1LFWA 4X2TA 3FX6A 2QJ8A 3BHXA 4ZI6A 3VARA 1OBRA 4MRIA 3FVLA 4PQAA 2Q4ZA 3JRUA 2C6CA 4UF4A 2EK8A 4UEZA 4UEFA 3NFZA 2AFMA 3D7FA 5J1QA 2PJ3A 2PJ9A 3SI2A 3KQZA 5K8NA 3IC1A 5ELYA 4TNUA 2GREA 1F57A 2CTCA 3IFEA 3KHXA 1CPSA 1Z8LA 2Q43A 4PXDA 1TXRA 1QQ9A 3TX8A 1Y7EA 4OC1A 3D4UA 4EFDA 2BO9A 2XEJA 4P10A 4ZY1A 5D8NA 3IWWA 3NA6A 2J9AA 1GYTA 3RBUA 2OR4A 4F9UA 1PCAA 1F2OA 2PCUA 3S9MA 1XJOA 5CPAA 2POKA 1ZLHA 3FH4A 5LYFA 3DGVA 3PBEA 2XEGA 3RZAA 4H2KA 2PVWA 4KSIA 2PIZA 4MHNA 4FAIA 1RTQA 4Q7AA 3HLPA 3IJ3A 4UIAA 4NGPA 5JH9A 4OC4A 5JM6A 4YU9A 3D66A 3NH4A 4MCRA 1VGYA 4NJRA 3B3WA 7CPAA 2IMOA 1XBUA 1YLOA 3SI1A 1CPXA 3VATA 1ZG7A 2C1CA 3LMSA 2BOAA 3H8FA 4B6ZA 3FMCA 5K8PA 3WC5A 1JQGA 3LWUA 3B3VA 1CP6A 3DLJA 3WABA 2BCOA 1LOKA 2PJ2A 1Q7LA 4JYWA 2AFXA 5IB9A 4EWTA 4FBEA 3VH9A 1XFOA 4P6YA 4PXBA 4EMEA 4YWYA 4ZY2A 3PB6X 1BAVA 3V7ZA 3KL9A 4NGTA 5LYIA 3WT4A 1LANA 2V8DA 2ANPA 4ZYQA 1DE4C 4WWVA 5LRGA 3KI9A 4F8ZA 1FT7A 1LAMA 3IIBA 4P4IA 1Z5RA 3BI1A 2QYVA 3H8GA 2WZNA 4JZ0A 2PIYA 3IO1A 3PB4X 1AYEA 2O53A 3NH8A 3SI0A 3T8WA 2PJAA 3FJUA 3FECA 2PJ5A 3ISXA 3SJGA 3TC8A 1H8LA 2EK9A 2EWBA 2XEFA 2OOTA 3D68A 2ZOGA 4A38A 1YW4A 4NGNA 1CP7A 5K8OA 2V8GA 2NYQA 1LAPA 4UIBA 8CPAA 4ZY0A 1VIXA 2I3CA 1HDQA 3PBBA 3B3TA 4IK2A 4OC2A 2IJZA 1YW6A 2NSMA 4MHYA 3S9NA 3GB0A 4OC0A 2DEAA 3B3CA 3KASA 1M4LA 2AFUA 4R7MA 5JGFA 4A39A 3MN8A 4MHPA 3KQXA 2PJ0A 5HVFA 2ZEMA 1YMEA 1CX8A 4LQGA 2PRQA 1IGBA 2CF4A 4IHMA 5LRKA 4A94A 2V77A 1TF9A 2PJCA 2C6PA 3CDXA 2AFOA 1XRYA 2ZOFA 1Z2LA 4MXUA 3IEHA 2WYRA 3B2YA 2V8HA 3GUXA 1TKFA 4DJLA 2JBJA 5THWA 3KR4A 3KR5A 2C6GA 3PB7X 2JEWA 1QMUA 3D7GA
chains in the Genus database with same CATH superfamily
2HGMA 1U45A 2WONB 3UNYA 4JI1F 4PYAA 4CO1A 1LK7A 4CAEA 4B9SA 2HPUA 5LM7E 2QMWA 2ZH6A 2IQ6A 2B9XA 2MKKA 4JI3J 3ETOA 2R7VA 4DDFA 1M5KC 4MCQA 5IXUA 4UEEA 4CYPA 4R76A 4K4WA 1Q1KA 3H2LA 1MJBA 3ZTPA 5MLCV 2FC8A 1YREA 3K5PA 3NS6A 1KKHA 2F5IA 2HVDA 5J2MA 4D3GA 2HFNA 3FRYA 2YH1A 3THVA 1S97A 2NXCA 3IU1A 4NZ7A 3I9SA 5CQGA 1S9EB 1U26A 1B6BA 3JTOA 4DOZA 4P71A 3FQLA 4RI1A 1RT4A 3DDIA 2RNEA 1OS5A 2AEMA 2WB4A 3TEGA 2A3JA 1FRKA 1C0TB 2ZOMA 3AOAA 2GA7A 1ZPVA 1FHTA 4GKJF 1X4BA 4A48A 2HNZB 3ILOA 2UXCF 3MGJA 3IR6B 4IF5A 2UXBJ 4KZTA 3G87A 4CM0A 2HB6A 3HHLA 1M44A 3IR5B 4DUYJ 3P3DA 4C4WA 2C27A 2UZAA 1ZETA 1ZO0A 5KG1A 3Q2TC 4MFZA 4DSEA 2DCLA 2LDYA 1IOFA 2V2QA 4MY0A 3UY5A 4ZGYB 1ZLIA 2YQ1A 5KFDA 3RJMB 1QUPA 2VIHA 1AB8A 1RT7B 1LCPA 4NLTA 1GXTA 3RNZA 4ORFA 1FXRA 4P2SA 3DOLA 5GADI 2BW2A 4CGMA 3H98A 3MECA 2E9RX 3KJQB 4P7TA 4QVTA 5EX3A 2XMAA 3KLEA 4S0MA 4FDFA 3A1YG 2PJBA 4ZN1A 5G0RA 5I42B 2GLFA 3I32A 2B5JB 1RWXB 2B3VA 5DLFA 5DG7A 3B35A 4P2FA 4XPDC 5D0EA 1RT6A 1M5SA 4RNOA 3DR8A 3S6HA 2BSWA 2RAQA 2ZW5A 3CDAA 4EBDA 3A8JA 3I55S 2LECA 2M8HA 1F3FA 3DNSA 3S1TA 1R8AA 6AT1B 4ANEA 1VI7A 1N33J 2PMWA 2CPJA 4JI0F 5DDQC 2RS8A 3M9NB 5HN0A 3FK4A 4TLQA 4DXLA 4NCZA 1VS3A 1PGZA 4WF9Q 2FCKA 3QLHA 1FEHA 1XIXA 3THTA 2CTCA 2G2YA 1C1CA 1QQ9A 1TL3A 5HATA 3VGVA 3NBPB 4AXJA 4PR6A 2BDPA 2KN4A 3OXGA 2DNOA 1JLBA 1FCAA 2MSTA 2E1PA 3LAMA 4BHQA 3BBBA 1TR0A 3F44A 4V19X 4ZBGA 4QC6A 2HGNA 3HT0A 4RPFA 3D3CJ 3DGVA 1RWOB 2KI2A 3RZAA 4H2KA 3ZZYA 2PVWA 2OZHA 4MIAA 2CIMA 3J7Z5 1HYSB 5JVHQ 2ZFHA 3MURP 4ZHRB 5DZ7A 4NJRA 1ZM3A 4ECVA 7CPAA 4LF5J 4FS1A 4Y2KA 1S5KA 3HSGA 4PWUA 1RTIB 3M2VB 5HAOA 1YBAA 1QD1A 2YQ3A 3ILJA 1OYDA 1P9YA 4ETZA 1VHIA 3NAHA 3VH9A 1KLMA 2YWWA 5KG0A 4ZY2A 3V7ZA 2Y0MA 4OZ1A 4KUAA 1K9MT 1U8SA 1UFLA 2OPPB 2LXFA 1R31A 1I21A 3KK1A 1LW2A 5I3UA 1KP6A 5ADZA 3N0VA 3QWPA 3SI0A 4ZPTR 1H38A 4IH6A 4DR7J 3A13A 3N01A 4PZVA 2XEFA 1K8AT 3D68A 4DPWA 1YLEA 2ZBPA 1CVJA 4NGNA 3KYLA 3A3PB 2IA6A 1AT1B 4B14A 3C16A 1YW6A 3PKMA 3ZC4A 4IQXA 3ADAC 3PO4A 2H48B 2VBYA 3D3SA 2AFUA 4FZVA 5HVFA 3GE9A 1CX8A 3G82B 2E29A 3D54A 4LIWA 1N5SA 2PSWA 2UP1A 4C11B 4A8KA 2FVQA 2FVSA 2HQDA 3MM9A 4WZQA 3IWEA 5ITHA 1U8WA 4DX7A 4DL4A 2JBJA 4RW9B 3KR4A 3FRZA 2AGQA 9RUBA 1U2FA 3W2VB 1RB0A 3D7GA 3JB9k 2DT9A 4WFYA 1IIDA 2OI2A 3P6YC 4LF9F 4W9YA 1W26A 4RNNA 4ED5A 3M32B 2BANA 4WFAQ 4LFAJ 1BLLE 3Q22A 2YNIB 3DDNA 3GYNA 4OYZA 3C6UB 5A6PA 4CLFA 1P27B 4UTGA 5DGAA 1CG2A 3K57A 3MAQA 1TV6A 2ADCA 4LR8A 3QQCD 3TO6A 3PVXA 2DGVA 3NCPA 3EWGA 4IAVA 1U1MA 4WK3A 4NLXA 3HVWA 1U6BA 1QE1A 2B4DB 2MZSA 1JLFA 3PYEA 4DPYA 4ED6A 2I5JA 3KXDA 2PJ4A 5HVHA 2CJKA 3TEHB 2J0QD 2DEIA 4B13A 2P9EA 1J5OB 2RC4A 4ECUA 1FNMA 5J8CA 5ETSA 5LT5A 4WFXA 3L2NA 1G4CA 1FERA 1RUSA 5E2QA 5FLXY 4OAEA 1QAYA 2ASYA 3LTOA 4AL7A 5GCNA 3FEXB 4UA3A 5B7WA 3P5BP 1QSSA 2VQEJ 3BJYA 2OEMA 1J5EF 3KLIB 3QT6A 4DG1A 1VCTA 2Q44A 1QUVA 1BE4A 2GO8A 2K1RB 3M2UA 4H4KA 1LK5A 3FRMA 3OL9A 4UWIA 3TW0A 4NI2A 3GTYX 1GMWD 2JFDA 1AMPA 5AT1B 3SSQA 4MFKA 2YVSA 3CJQA 4B5PA 4JI2J 2L48A 4B12A 4Y3CA 2QA2A 3TRGA 4OIXA 4OYIA 3IAM9 3ZZPA 3H5YA 3JXOA 3GIJA 4C3MA 1RKJA 3FGVA 4URSA 3BQ2A 3M7VA 2W25A 4ECTA 3EFAA 5GAEU 4Q44A 1SQFA 1PO6A 2H9ZA 2A1BA 3W66A 5LRJA 1HBOA 2ZENA 3MTJA 4F9VA 2J0WA 1XK8A 3GIUA 4TWEA 3EXNA 1T7PA 3R9GA 2HQFA 3M6XA 4PG5A 2OPSA 4CRZB 3FBUA 4J7CA 2DRBA 3A8KA 4O3SA 3TJ8A 1GNKA 1JLQA 4M6GA 4A95A 3W1YC 1RAOA 3LGMA 2GFQA 4Y28C 5HO4A 1FFWB 4Q5VA 1SL2A 1N36J 1B4SA 3Q0AA 2MJNA 3BSNA 4YRHA 3JRUA 4UF4A 3BGUA 4JXQA 4LSZB 2AJ4A 4RW4A 4OJ1A 3M6WA 2YNFA 5KFPA 1K1SA 4ATNA 1PAEX 4F7VA 3IWNC 1RA6A 2CQ0A 3CEDA 3DC2A 2O01C 3FCVA 1ZAVA 1MMNA 2XEJA 3SHPA 1ICEB 3NA6A 4O3QA 1Z4EA 3DRRB 4F9UA 2YNHA 4WWSA 3LW5C 2DNHA 1V5VA 2I0XA 4AT1B 1SI9A 1ZLHA 1UKUA 3LGNA 3HHKA 3BBFA 2W2MP 3HLPA 3MPDA 1N5TA 1ZH5A 3VHQA 4E0DA 1NJXA 5J1NA 4NSQA 4USIA 4KPYA 4KOWA 3QO9B 1XWLA 2WSFC 3VAFA 4IRKA 1Q2YA 1Q7LA 1IKWA 5DDOC 2CQ2A 5CABA 1IYKA 4KV8A 3P8BB 4NZ0A 2Z3KA 1RT1B 1LWFB 4P6YA 4R3KA 4OI6A 4YWYA 4F4KA 4CAFA 1HBNB 4L72B 1T9XA 3KI9A 2XMTA 3BZQA 1SKWA 1FD2A 2YWFA 2KT3A 2DB1A 1RTHB 2CJQA 2FJDB 1T9VA 3DLKA 4R0JA 3N4WA 2LQJA 4Y65A 3ETMA 5D3GB 1AYEA 3K2YA 2O53A 1MW7A 3UVJA 5CD4A 2PEBA 4X4VA 1REGX 4YOEA 2EK9A 2OPRA 3BSOA 4KFBA 4H4MB 1REVB 3I4PA 4KH1B 4X4PA 1HDQA 5F8IA 3MXHP 2B4PA 2MTLA 1AZSA 1OZPA 2AYGA 3IAS9 4MHYA 1YGHA 2XWYA 2Z56B 1VQ5S 1NDLA 1MWQA 2Y1IA 1B3TA 3TOQA 2NYHA 2XY5A 1YMEA 1CJUA 3L7PA 4PABA 3PTWA 4K2JA 4LSLA 2E1CA 3UNGC 3AA8A 2AZ1A 5CZVA 1S9FA 4C8KA 2J8MA 3CPWR 1IICA 2WYRA 3KHGA 2V8HA 3V6HA 4Q45A 2VODA 2NXUA 2NSCA 3KDNA 3PR4A 1IQTA 2JEWA 5C5JA 1FJGJ 4A8XA 2ZEDA 1KFDA 4M63A 4L76A 2B8PA 1NK8A 2HFOA 3RAXA 4USHA 2LQ5A 3CCTA 4MKBA 4P9SA 4LUAA 1FWKA 3POTA 2IRUA 2DXEA 2C3MA 1UFKA 3N5BA 2QA1A 1FVQA 1ZAWA 3QJLA 1PIEA 3AOCA 3KJFB 3CVKA 3WX4A 1GMVA 1PJ6A 3EO4A 1TUWA 5H9EJ 1XERA 4RUHA 2J9CA 2EFPA 2GO9A 1CJWA 4NGRA 1FX2A 4F0KA 1S1XA 1X0PA 1X0FA 3BGFA 2JSXA 5AGEA 4YHHJ 3FF3A 1KLNA 4DX6A 2BJ7A 3SIPB 2V8VA 3EDRB 2FIAA 2B9YA 1P4NA 3H4DA 3VR1A 3EDQB 1PILA 3MR2A 4J9QA 3I0SB 3MM6B 4JV5F 3OXFA 4WXOA 4B3OB 2KXHA 1CS4A 2QSWA 1YZ6A 4DQSA 1KUXA 4FXDA 2FZKB 1X7VA 3PR5B 2QMUB 2VU5A 4R5PB 3FBBA 5E3QA 3BI0A 3KLGB 2GS8A 3PO5A 2IRXA 5DLGA 1T03A 5H9EK 3KGQA 3PW2A 4DV0F 1MJAA 4Y2CA 4F36A 3MM7B 1RWNB 2V68A 2DY1A 4OIDA 1L0CA 5KFYA 5LYLA 5HROB 4NGSA 2IC3B 2HVZA 4P74A 3CPXA 4FUUA 2JLGA 4YY3J 2RT3A 1ZAXA 1RU2A 5KFHA 1EKRA 5B0FA 3QATA 5LOQA 2ALZA 5D0HA 4ILMA 2JH3A 3WC0A 2EFQA 4M5DB 2QMLA 1QSYA 5KT2A 1JLEA 4P45A 3M30B 3TR5A 4Y49C 4AG9A 1RAHB 3DLGB 3EY5A 5KG5A 2H51B 3PJ9A 2MYFA 3WQPA 4B9TA 1ELMP 4R8UB 1VRQC 2JRSA 2YNEA 3BHXA 2COLA 4DL0C 3A8IA 5KFGA 4WIQA 2R8IA 2CNSA 3D7FA 3QIDA 1TFYA 2B7BB 2OZUA 4IQMA 4HR2A 2FHMA 5K14B 3R27A 4X84A 2LEPA 3R7BB 4FYVB 3VAJA 4QU7A 3NS5A 2ZHBA 1L3UA 5K5MA 4HTJA 2IRYA 3MMBA 4MI4A 2B58A 4LX9A 3D4UA 4EFDA 1DTTA 1LW0A 3R5AA 1UZDA 1KTVA 3FB3A 4ZDNA 3VZIA 2KB2A 3RBUA 1CJKB 4RBVA 4YN3B 2B56A 2L08A 2VPZB 4D3HA 2PRBA 1Q8LA 1TVRB 4MYUA 3WBZA 2DH8A 4R0EA 1YKWA 4U9YA 2J8AA 1ZTTA 2ZDPA 4FAIA 5DETA 1D1UA 1R0AB 4Q7AA 2NUUG 1RYRA 1RT3B 4J9NA 3QT5A 1Z1ZA 3GU0A 1FDDA 4J9UE 4N76A 2VA3A 2MXYA 4MJ8A 3QRPA 2KG1A 4C0OC 2DRAA 3ISND 1RKIA 4MJKA 4X4SA 2Z11A 1SC1B 4N8OA 1SPBP 1UA1A 3D0HE 1JLGB 2D3O1 4YY3F 5F3ZA 4K2XA 1X4DA 3JAMY 1GFWB 2V5HG 1PSDA 4JI5J 3SEOA 2GHPA 3ULHA 2VJUA 2CQCA 2O67A 2Y0SD 2A2CA 3AQOA 2CAJA 2VKZG 2ANPA 2JEJA 2LLZA 3GYGA 1KVIA 3N6NA 1LAMA 1DBDA 5KFTA 3W3SA 4F02A 4KT0C 4ANDA 1QAXA 1YQEA 2PJAA 1Q4RA 2AJ2A 2ILZA 2CWXA 3EM1A 1S9GB 3J7YU 3MMCA 2PGCA 4F8RA 1LAPA 4NLQA 2DNZA 3S7RA 2I3CA 2HS4A 5AE3A 1YX2A 2J5AA 1ELOA 1SJ1A 4FPIA 2ZZMA 1NUEA 3BYPA 4OZLA 1S99A 3LP1B 1YI2S 1EIYB 3MUTP 2CQDA 4YB6A 4UOGA 1M4LA 2OB0A 4OI0A 4ZVHA 4LRCA 4WZMA 1C2PA 1D3WA 1V3SA 4JJXA 3HSDA 1OY9A 3KLHB 4HACB 3AODA 2FSRA 4ZJOA 2X51A 1K4JA 5IS2A 2BX6A 1RAFB 2FUG9 3OJSA 2KHDA 4NXNJ 2L9NA 4KVXA 1HBMB 2EC2A 3GSIA 3CCZA 5KFAA 2AU0A 1G6BA 1U0HB 1R57A 5F8MA 4EZ6A 1VC6A 2W4PA 2V2ZA 5AXNA 2QL9B 4M5HA 2F7VA 4ZX8A 4RUAA 2PVVA 2Z2MA 3OR1A 2CWKA 1BWEA 1YTYA 3DMJA 1NO8A 1WKKA 4ETXA 1NHKL 3GYAA 5KFEA 3C6TA 2RVJA 1UZHA 4KC5A 2MY8A 2W8KA 1XMOF 1ZZFA 4ERDA 1KEKA 2VFVA 4MKVA 3R5DA 2WPWA 1KVKA 2D3ZA 2XI3A 2CIJA 4I7FB 4DUKA 4RW6B 2BW7A 2AHOB 4JI6F 1U1OA 3TUJC 2VL1A 2UVUA 2EBJA 5BR8F 2MHNA 2ZE2B 3H4BA 2MSSA 4I67A 4MFJA 2HWTA 3T9YA 2HFVA 3TP2A 2V8PA 2G3AA 3OVSA 2CKWA 1EJ7L 2XC9A 1TL7A 3AH6A 1VQ8S 2C2EA 3G8SA 3CXPA 1QSMA 1XMBA 2QG9B 4F26A 5IM0B 1CJVA 3VGSA 1Q8KA 4LF2A 2R8KA 5A6WA 2Y0BB 1BQNB 1NJWA 3N6MA 4OZ0A 5AG4A 1S76D 2CG8A 3FFIB 1YBUA 2OKQA 1NEEA 1U49A 1IR0A 2QFJA 2DH7A 1LQ9A 2OEKA 4QZVB 4N8NA 1TL1B 1ZZNA 4OHXA 3HD2A 4RZRA 4PXEA 2UXDJ 4HTIA 3Q8VA 3N5FA 1RWMB 1VK3A 3FUYA 5IB0A 2F4VF 3ET6A 1FNOA 4LF4F 4OADA 3N79A 1FA0A 4WJBA 3R5BA 1IM6A 3FYNA 4TY8A 1TMJA 2F3JA 3I4HX 2YNDA 2VXKA 3A3OB 5DO2A 2WOMB 1EP4B 5BYQA 5IT9Y 2Z57B 4CYOA 3MZIA 1IJFB 3NWGA 4WYLA 3D5MA 4URGA 4ZP8A 2KZZA 5LJ5Y 1ZTWA 3KHZA 4OP4A 1APSA 1X31C 4CGLA 3LA0A 3D9BA 4O3OA 2IM3A 4XPKA 2H3EB 3TAQA 5DGBA 1RHMB 2EFGA 2XMUA 3K5MA 3CCMS 5DM7Q 3IG1A 1T05A 1N5VA 1X10A 1J2VA 4XIUA 4O44A 4UT4A 3NFZA 5J1QA 2QEXS 2HHUA 5HJYA 2VG6B 2DGXA 2QLJB 2RMLA 4WTOB 5FDLA 1ZS6A 3DM2B 5B0EA 4OV6A 5ETOA 1UVJA 4DN9A 3SSSA 2VPXB 2OD4A 3AY0A 4DL2A 5F48A 4ZLJA 3NOGA 3GZ7A 2VOPA 4ID5A 1ZOTA 4P10A 4IRCA 2B7CB 5D8NA 4KKOB 4JYAJ 1H74A 2B4UA 2OR4A 4PSWA 2UUWA 5A0YA 1S1TB 4FKXA 1SQEA 3NG8A 3S6EA 4DEZA 1KR4A 1WWHA 3T5JA 2CVIA 4ZKAA 2IM2A 2CPZA 4DV6F 2DF5A 1YLOA 3JYTB 2QYGA 5T7LA 1CPXA 3MMAA 3DRXA 4JI8J 3D1HA 1Q81T 2DNGA 3KOAA 2EW9A 4NEXA 2E9ZA 3DLHA 3WC5A 1SQGA 1CP6A 2ZH3A 4KHMA 3MAAA 2XYGB 4OHVA 2GAHC 1RZMA 5RUBA 1I94J 2VEZA 3OTOJ 1AA1B 1RTZA 2ACMA 2I9SA 4ED0A 3U27A 3HJFA 2YXLA 4YEAA 1EETB 3KG0A 2ZDOA 1R0CB 1S1UA 2HMIA 4M3SA 4F0YA 1IR2A 2P6TA 4EVYA 2CQBA 1VLOA 2AJ6A 2CPXA 2LDIA 2B6AB 2JOQA 3FC9A 4DR4J 3LGHA 2VI7A 1VKCA 4NX9A 4KOYA 4B3RJ 4BC7A 5KG3A 4K7QA 5F0UA 4DCOB 3Q8RB 2EXUA 3IN5A 2Q04A 5B09A 5KT7A 4EBEA 1HNXF 4MH8A 4ZITA 5ETVA 2IAJB 5C2GA 2F1FA 2HK2A 2EG2A 2K8GA 1PKUA 2PSZA 2AWZA 2W8LA 1L3SA 3TZWA 3RBXA 1FDNA 3DXSX 4YS2A 5LRKA 4NMLA 4A94A 1FKPB 1PYSB 4HH0A 2AE6A 1BWVA 5L1KA 2ACYA 2LU1A 3IEHA 3JVNA 4IR9A 2BE2A 5L1JA 2V4JA 2WVEA 2I79A 1SUQB 3W8GA 4ZP7A 4ONUA 4KJIA 2UUAJ 4FVCA 1Y9KA 4W92B 3Q86A 4C7IA 5KOXA 3I0RB 3MWBA 4JI4F 1XMQJ 4H6UA 4KBIA 2XLKA 4MIBA 2DD8S 4Q8EA 1N6QA 3CJ4A 2C2KB 3IRWP 4TLRA 3I31A 4L3NA 1W2IA 2ZNZA 3SQGA 4DR3F 3O5TB 4A8WA 1Y7RA 4ELTA 4R3LA 1S7LA 4FD4A 3DLBA 2DNRA 4L8AA 1ZA2B 4G1QA 4R8FA 5IWAJ 2RDIA 5LXYA 2BKOA 4G1PA 3QGPA 3PW4A 4U7UK 4KOVA 2CNKB 1S6UA 3TT2A 3M4XA 4J90A 1VRUB 4LF6F 1E6YB 4C0HA 1S7IA 4I2QA 1Q5VA 4A33A 4GVBA 4NEYA 1HWIA 4RWWA 2JWNA 1VHFA 3G71S 1JLAA 2OTLS 5C24A 3HCXA 2JNJA 2XSJB 2ROPA 5F9LA 2PA8D 4DV2J 2HRYA 2Y1RI 1DTQB 4CP5A 5I4MA 5JJBA 3DLEA 2XEXA 2X3DA 5CHCB 2C2OB 1K44A 3IWXA 4P4EA 3PIPQ 2ADBA 2ZVSA 3AQPA 4I68A 1BQMA 2VC1A 3QFHA 4NLSA 4KHRA 4X5KA 3MEGB 2Z58B 2P6GA 3L7OA 5GAHU 4KGKA 1V6HA 4XPLA 1WTBA 4OL8A 2HQCA 3OHBA 4I0WA 3KMQA 4KLWA 4ZPCA 2G13A 1BQXA 2XY7A 4ZVFA 5JPHA 4YDDB 1PU9A 3M8WA 1N0UA 2R1IA 3MPUB 4NJQA 4EFAC 2ZW4A 2ALYB 2XLIA 4KSFA 3EVOA 1VC5A 2FZCB 3HHNB 1NPPA 3KWMA 3JSMA 1YVFA 3LACA 2HC9A 5B0GA 2HQYA 4J9VA 1UJ4A 4BWJA 4K50A 4QUSA 4LF1A 5F8HA 3LQVA 4PQUB 3M9OB 2XWXA 2CQ3A 1PBAA 3TTHA 1QSLA 1SJFA 2YKAA 2O4HA 2F8MA 4F6AA 3THPA 4HL9A 1WJ9A 5J2MB 2C3YA 5AE1A 4E2FB 4OZNA 1RABB 2DHGA 2D4OA 5K20B 2R8HA 2DR9A 1FD8A 4CNYA 4AVCA 5C42B 3HHLC 4DR1F 1S1VA 1HNIA 3SI2A 4U67Q 2DKOB 1KONA 4XDCA 4WCEQ 2MMYA 2RRAA 3M2RA 2XYHB 4GRSA 1F5CA 3BKUA 4B17A 4OYAA 2XGQA 2NXJA 5D4OA 1YLXA 4OJHA 2FVCA 1IM4A 2D4PA 3I9ZA 4ED8A 3CXCR 4O4RA 1WC1A 4RS2A 1SH2A 2DXFA 2XZDB 1T02A 4FS2A 2DY9A 3FH4A 4GKKJ 1T3OA 3PBEA 4B3MF 3V6DA 2GGPA 3MFIA 4CGPA 3TI0A 4MFBA 2EBGA 3LO3A 5SZTA 2CJ9A 3H5SA 3D6TB 4WU3A 1RHKB 2IMOA 2KFYA 3QRRA 1IKVB 2W7PA 4UOFA 2EFNA 3DOLB 1I51B 1U6FA 3MMJA 4DSLA 3MECB 2D41A 1AUSL 4J9RA 4GXHA 2YX4A 4JUZA 3GIRA 3OL6A 3KLEB 2AFXA 4YFUA 3VQSA 4ZVSB 5G0RB 4QPXA 3DGPA 2M52A 3PB6X 4LSNA 4USKA 5IZHA 4ZVTB 4B3SJ 4LVNP 4F8ZA 5BXIA 2PA3A 1FT7A 4USJC 4O4GA 3VQTA 5DS7A 3SXNA 2DPTA 2V34A 3BI1A 3MPWA 3DOKA 3DNCA 4YP3A 3SQOP 1I6JA 1HQEA 3NCQA 5H9FJ 1MSWD 2RDJA 1NU4A 5IT0A 1Z8XA 4F0MA 2V2VA 1J4JA 5BWAB 2HS3A 1FDAA 4UIBA 3R1LA 4BWMA 4ZY0A 3HKZD 3SCIE 4M6HA 3M8QA 1I1DA 3W6XA 3UCZP 1H7WA 2E5JA 1N34F 2R7UA 5F8LA 3R9LA 5LMUJ 2HHTA 2OELA 1OYEA 2L3MA 3QLHB 5J1EB 1S59A 4DN0A 4MK9A 1IKYA 1C1CB 2J7KA 1DURA 1TL3B 2VDIA 2J0SD 3AXKA 5DRKA 2AJ1A 1QY7A 2RE1A 2FPHX 3E51A 1JLBB 3R96A 5HBMB 4I49A 4UCNA 2PIIA 4N56A 2QMXA 4OHWA 3BYRA 4OX6A 4AQYJ 3C15B 1Z2LA 1D9DA 3PJWA 4FF3A 1AFIA 4HHJA 4DV4F 3HFZB 4DR2J 3V4MA 1JJ4A 1B7FA 2AQ4A 2C6GA 5L46A 4B9MA 5H9FK 3VGUA 3QT7A 1CLFA 3HHEA 3EPGA 2JZ5A 2J6TA 5KFBA 1RJJA 5F09A 2ABZA 5BJRA 2AFSA 2KVQE 4LIRA 3PRTA 2NPFA 4AL5A 1UL3A 4JI7F 1HBUA 2ZEFA 3DHXA 1AUDA 3UR3C 1KZFA 4DQQA 4ZA1A 1WUUA 3EYZA 2GV1A 1KLMB 1IVZA 3DRYA 2FJAB 1IKXB 1RACB 2G3TA 5EN1A 1EKSA 3BO2A 2VZYA 4EO6A 3D7HA 2BKPA 1H98A 1UW9A 3PJXA 4NXMJ 3LAKA 5J2NA 4JV0A 1LW2B 1H0HB 5I3UB 3FZ2A 1MROA 4PRFA 2YKNB 2Q51A 3IGVA 4FXWA 2WBRA 4KGXB 2HHPA 2Z8QA 5L1LA 4F4WA 4C2XA 2R2UA 1Z9UA 4U9RA 3T41A 5CBMA 3C16B 2Z3PA 2IDEA 2OLWA 4E0AA 3TAPA 7AT1B 2JHEA 2CPYA 2DO4A 5L38A 5C25B 1YR0A 3E8OA 4OKOA 3S6GA 1MG7A 3ZZTA 2LQ9A 5AXKA 3PFOA 2XI2A 3WHIA 1E6VB 4L74A 2NZ4A 4C68A 2MHEA 3FVYA 4C2ZA 3HD1A 2RF2A 3Q89A 4OHZA 4C98A 2GIFA 1QSRA 1Z8WA 3MM9B 5I42A 4C8LA 1NSAA 3SJFA 2UUBF 2V69A 2WB1D 1CPZA 4NLWA 2PQ8A 1NK5A 4QJVA 5DS0A 4R87A 4PPZA 2KFNA 3SCLE 1FF2A 4HKQA 3DXBA 3ZNUA 2CNOB 3Q83A 1DTDA 2A6OA 2C22A 4QB9A 1HQ2A 5HH1A 3QAHA 3K0JA 4B9UA 1VQYA 2BUNA 2H5MA 1F60B 2HSEB 2K3KA 5KFVA 2DYAA 2WVBA 3OL7A 3T1YJ 2LYVA 2BANB 3GG1A 3U1LA 3MM5B 1XBWA 1BOBA 4J9OA 1JWWA 1HHTP 1NRKA 1YVOA 1TV6B 4O3NA 4X3RA 3TVKA 1YJVA 3M8SA 3R9FA 3FX6A 4ZI6A 1O0PA 5AJ3J 3H0PA 1QE1B 2M88A 4UEFA 1WHVA 1RBLA 1JLFB 2AGPA 1IBMF 2FJXA 1NCLA 2I5JB 1ON0A 3HULA 4ES1A 2PO4A 3T6JA 1S0OA 1UVLA 4FF1A 5H86A 2MQLA 2VICA 1N54B 3RYOA 2HHSA 4OX9J 3PW0A 2KKHA 3B78A 2W9CB 2AX0A 1QSNA 4OLPA 2J9AA 4CLTA 3OL8A 2OEJA 1UPMB 2IJNA 1SJRA 2PCUA 3GIIA 1VBYA 4ZHRA 3WC2A 1GX6A 4DG1B 5FVJA 4UCMA 1T11A 1D9FA 4NI2B 4F0HA 2HLUA 4B5PB 3B3WA 2DNPA 3MD3A 2XSFA 5B0CA 3OUYB 4R57A 1HWJA 5A2QY 4XNHC 3OFFA 5AG5A 4PYDA 1FJEB 3JSRA 2BOAA 1GH8A 3KK2B 4ITSA 4ELUA 3CCQS 5B0AA 1KUYA 1XEZA 2RQKA 1YK3A 1T9YA 2DR6A 2HNYA 3SDEB 4EK2A 1HBOB 2IJRA 4KRWA 2GANA 5LYIA 1VOMA 3D3BJ 5HJXA 1LV5A 4WWVA 2KJWA 3T1YF 5HMNA 4A8FA 2DR7A 2BM0A 3BKTA 1S7KA 4UQGA 2R2SA 2RUSA 5CXTA 2CZ4A 4N47A 2YPZA 2Z2YB 1XOVA 1VQ6S 2FY8A 3H5XA 1UMJA 3BGRA 4L75A 4FP9A 1JLQB 3FSXA 2Z2ZA 2CNLB 3KUHA 2FGCA 1JNRB 3UN2A 1GQEA 3LP2A 2VZZA 1UVNA 4A38A 4F4YA 2QC3A 3CIZA 1YW4A 4NLDA 3BO4A 3CJTA 3M05A 2KRRA 1XNQF 4NA1A 2XMVA 3MEDB 4DNCA 3FJ2A 1AUGA 4RW4B 5AG6A 5CD4H 5HMWA 2YNFB 3L9ZA 4LQ3A 2J8SA 3QGIA 4HDGA 1QJHA 4X66F 1HNWF 2P6EA 3W64A 1UVIA 2MQOA 2PJ0A 2MLYA 2HS0A 2ZHOA 5DM6Q 1QSTA 2HHWA 3W65A 3GWCA 4LFCJ 4DV7J 2UUCF 3GMGA 3A9LA 1M1DA 2K5TA 4NEZA 2P8IA 2C6PA 4NCBA 3MD1A 3OW2R 3JSBA 3Q8QB 3OSPA 4ZN3A 4XAKA 1S6PA 4JLYA 3GV8B 5U47A 4Q43A 2DRDA 2R7SA 3RAQA 3R5GA 2HFZA 5CCMA 1UWYA 4YDXA 4OJ3A 4EI2A 4W90B 3OTEA 4M8LA 3B4DA 3CT9A 2RJZA 5HMYA 2XLJA 1HHSA 4ECSA 3CCUS 4K0KJ 4IO1A 3L7UA 1Q7LB 4NGMA 3MUMP 1UAWA 1IKWB 2GE3A 5ETQA 1LNQA 2D74B 4LF8J 4CM2A 4NE9C 4DU8A 1KHWA 2MZ1A 1TKJA 3SZ2A 4C7HA 4DQIA 2A0FB 2H4WB 1EHWA 4X4NA 5KFSA 1MU2A 1B64A 1GAOA 1YSJA 1DLOA 3FBFA 6FD1A 1B70B 4KHPJ 3PRVA 3DLKB 3WC7A 1DARA 2XNQA 4ID8A 2JJ4D 3I3GA 2GJIA 1X4GA 2DXDA 2VHGA 2G1HA 2XM3A 2R7WA 1XF8A 2C28A 3CCLS 2OPRB 3D67A 3HSZA 4KFBB 1FK9A 1CULB 4PSXA 3G6YA 3CIMA 3TA0A 3SJXA 3MRUA 2ZHAA 1S49A 3OPKA 2DHHA 2DBBA 3DN9A 1RLDA 3PFEA 5IC4B 3TUIC 3QSIA 3BXMA 4GM5A 4O0IA 2APOA 4C7QA 2V0NA 1FRHA 1RWWB 1V3ZA 4WTYA 4NYZA 4LR7A 4M5MA 3W63A 3FZBA 3C8YA 4LSLB 1RHQB 2K7JA 3TOAA 4MAKA 2J9EA 5KTQA 3H5UA 2XULA 4G65A 1HNZJ 5A76A 3BV8A 2FJEB 2MY7A 4CO5A 2NYIA 4X62F 3CCJS 2RSQA 2WUUA 4MCPA 1V9OA 4M5NA 2JBKA 2EC0A 4RLEA 4ZP6A 3HJVA 1NLKL 1M1GA 1OJ4A 4TKTA 3RB4A 1RADB 2YNGA 2B5GA 2MZRA 1H2TZ 3WC6A 4ZVUB 2YX1A 3H4QA 1X9MA 2NMTA 4F67A 3POTB 3EX7B 2RKIA 4FBUA 3PB9X 1DHMA 2UU9J 3CCSS 4UFXA 2P2CB 2BL1A 2FIWA 1W2BR 3W5XA 2RHQB 5IT4A 4P4FA 1YG0A 1CBXA 4CLUA 3F8KA 1IBLF 1CEZA 2OFHX 3TOBA 1KTQA 2AJQA 3PX0A 2ZZNA 2ZBCA 1S1XB 3G8TA 2Y9HA 3K7RA 2QJ8A 1KQFB 3TZYA 3KJVB 2VBZA 2WPXA 1NJIT 4LF7F 2KU7A 4PUOA 3GFHA 4DL5A 2QSFA 4CRYB 1NK0A 2AFMA 2PJ3A 1OSCA 1N56A 3LUYA 1M5OC 2YWKA 5CYQA 2VQFF 4LBPA 1L5UA 3F0NA 4U9ZA 3NNAA 2Q43A 1IOIA 4HHHA 3T9ZA 4AB7A 2E7VA 3NEKA 4M94A 4OC1A 1MMLA 3DU6A 2E5GA 2JEFA 3HF5A 2FDNA 3ZTQA 4FNHA 2NQPA 4NLUA 3RG6A 1YJ9S 5CPAA 3NGSA 2POKA 3E3XA 4K4ZA 4WP9A 3SCJE 4F2RA 4KSIA 1D8YA 1R8BA 3TO8A 5HK4A 2E1MC 3T1HF 1HR0J 3QO9A 1U6ZA 1KQGB 5JM6A 3NH4A 2ZZTA 1TKDA 4BMHA 4ZK7M 1B0VA 3LF0A 4C2MA 5LJ3Y 2IVMA 1LWFA 1SJ3P 4B3TF 4G3IA 2XZWA 2M3DA 1FESA 1FRIA 1LOKA 2HW3A 1SKRA 3ZZRA 4KQZA 4FVMA 2CG4A 5MAOA 3M6VA 4A8QA 2BJ9A 2D3OR 4PV6A 1Y9WA 2CVEA 2BR0A 1UP1A 4ZYQA 4NWBA 4Y6IA 5KFFA 5D6GA 1JLEB 3I9V9 2FZGB 2WZNA 3PB4X 1O6XA 1M4DA 2ASLA 2UUTA 4C8YA 1N5YB 2R7HA 3FECA 1JXVA 4LBIA 1Y10A 3HM9A 2FLPA 4QQBA 3SFUA 4CDIA 1R8CA 2BV3A 3NCRA 3PEJA 3P2HA 1IR1A 3IGRA 4OC2A 4QWEA 4MK8A 1NKEA 1WKJA 3GB0A 1FDBA 3OSNA 3FNCA 4ER8A 3KDOA 2LEAA 4R7MA 2Y8YA 4MHPA 4LJMA 2CPFA 2R8GA 3MMBB 1DTTB 1LW0B 4N7TA 3BBCA 2ROEA 4ALZA 1T0TV 3DKDA 4OZ2A 3LODA 1YDLA 1PJ7A 2AW0A 2PJCA 2REFA 2LP4A 3HKWA 1CBKA 3I56S 3GUXA 3CW2C 2X1BA 1HR0F 3ONQA 2DGTA 1RBOB 1Z4UA 3QZ7A 1ZPWX 2X7IA 5KFQA 1B87A 1N5QA 4C97A 4OX7A 4CO4A 2ZXVA 4DV1J 2I00A 1X4FA 4HHUA 3ZTOA 1VQ4S 1G7CB 2ZH4A 9ATCB 3AHPA 8ATCB 3W5YA 3BEGB 4ZJLA 3TZZA 1BPNA 4JI3F 3CDWA 4KGMA 4ZVGA 4FF2A 4Q0BA 3EZ5A 1LEOA 1NMEB 1S4EA 4KAIA 4OC3A 2FY1A 3PZJA 2DISA 1JJCB 1XQIA 4CO0A 3UN3A 3QMQA 4DUZJ 1VHOA 3K8WA 4QYZJ 4X4UA 2VKRA 3DYAA 4DWIA 5GAGU 4UQTA 2HVIA 2NREA 2ZBRA 4CAWA 5F9NA 3BO3A 2KYXA 1A9NB 2PE3A 4XPDB 2CPHA 3RAMA 3MFHA 4IFYB 1VQPS 3MMCB 2ZC4A 4X4TA 3SBMA 2XY6A 1WD6A 2XMJA 2FJVA 1HEEA 2LCWA 1PYOB 3F0AA 1TF8A 1YK9A 3VAHA 1WHXA 1LRZA 3CTRA 2J7WA 1DFDA 3UE2A 4KPCA 4DV3J 3H40A 4AYBD 1RAGB 4ZLLA 2UXBF 2C2RA 1BUXA 2ZPAA 2ZELA 5EX0A 3G8QA 1DQ9A 2N4DA 2IC3A 4AD6A 2UVVA 4DUYF 3ISNC 5IV0A 4Y2AA 4A8OA 1FT8A 2W9BA 3ENWA 2K2PA 2NSBA 2BABA 2GAGC 2Q0YA 1LXJA 4NLRA 2RIJA 2DH9A 4NLVA 4X4QA 4QYZK 4LT6A 1HD0A 2CDRB 3G8WA 1SB6A 4RO0A 1FRLA 4I64A 3QSYB 3DOMA 1WSRA 3DLGA 4HYKA 1FWLA 1U1RA 1SC6A 3KK3A 3CDUA 1ZG8A 3OR1B 2AEFA 3DU5A 2M9KA 3C6TB 3PB8X 1RWVB 3CB4A 4AL6A 1WTFA 4F25A 3D6FB 2X3GA 4P44A 1GXUA 1LFWA 4IH5A 1SQHA 3G9CA 2FHJD 1N33F 4MBUA 4DUZF 4URQU 2QIRA 4DR5J 3N9UC 4NA2A 1L3KA 4BLGA 2PEHA 3T1AA 3GV7B 4K4XA 1RYSA 2IMWP 5HP1B 2XS5A 4WFZA 1TXRA 3TX8A 4KSEB 1CSJA 1TK5A 1TL7B 3AD7C 2ZJRQ 3DRPA 4ZY1A 3AJ2A 1X5SA 1Q53A 5ISVA 3UW1A 3K89A 3W61A 1KNZA 2YWHA 2VG7B 2EKNA 1XJWB 1WK4A 1CJVB 4NRUA 4B5OA 4DPOA 3J81U 3QFWA 2CXAA 1XNRJ 3QB8A 1Y9OA 2GIRA 2V63A 1IBCB 2YKPA 1UWBA 2YKOA 2LQBA 3TQEA 1VGYA 2FB0A 1JLGA 2H4YB 3HMJG 3H5ZA 3PIOQ 3QNWB 2C1CA 3D2MA 3WZ0A 3LMSA 2P6SA 1JXEA 4NYPA 3JAMU 1TQLA 4LF5F 3I96A 3PZPA 3PXGa 3SCKE 4JYWA 2D7SA 4DZDA 5IB9A 2WVDA 2O28A 3UR0A 1XFOA 4X65J 3JUWA 1NM2A 1U1KA 1RK8A 4Z2XA 1D0EA 4CCHA 4TY8B 2L9DA 3WT4A 2E5LJ 1RI7A 4RBTA 2DGUA 4C6AA 3AJDA 2J6SA 1EARA 4B9VA 2JEVA 2Q6BA 1GX5A 3UDLA 1Z2ZA 2B8QA 4NCGA 4YB7A 3ZXWA 5F8NA 1FEEA 3T8WA 2V50A 4BCAA 3R9EA 2VG5A 3HT3A 3ZTRA 2FVRA 1TUVA 5KT4A 3OV7A 3IG1B 2NYQA 2CJAA 3OFGA 1T05B 1TKZA 3MR3A 3EZOA 5E41A 3MR5A 4YR0A 4IUFA 3M8PB 1NSPA 3W9HA 5A8WA 4A8SA 4DR7F 2RILA 2W4CA 1KC8T 2O5DA 1UA0A 3Q2SC 4DUTA 2KT5A 3PX4A 2QL7B 1M5VC 1BC6A 3GJRB 4C8OA 5ETPA 1LWXA 2IVFB 1RGVA 1PUAA 4ID5B 2HZCA 2D69A 1KHVA 4CYNA 3BR8A 1H2UX 3BN4A 2IHR1 4WBFA 5A0YB 2C1EB 3RRGA 2B4BA 2HHXA 4RW8B 3RRHA 3MPYA 2EG1A 1UCNA 1Q16B 4I6YA 4WE1A 2FGOA 2E9TA 2QGFB 1NDPA 4FYDA 1PYTA 3RR7A 2VONA 3MM8A 4JV1A 4DPTA 1S7FA 3MMAB 2XMKA 2BRKA 2BMBA 2KM8C 1O8BA 4LQ6A 2G0CA 3OR2B 4E98A 1BHNA 1RP5A 1UVMA 2DGWA 1ROFA 4L3KA 4C3KA 3H2UB 3D7DA 2VJVA 1Q7YT 4DX5A 3MAAB 4MTPA 1U02A 4FBTA 3HZGA 4LFAF 3SJEA 4DL7A 2QV6A 2QZ8A 3GJSB 3L4BC 1VBKA 3OVAA 2NXEA 4OQJA 2PN6A 1IBKJ 2XO7A 4Z65A 3D8PA 4DX8H 4IOCQ 2CJBA 5DDRC 4LVOP 5F0WA 1RO5A 1LWEB 4NXYA 4E2AA 2BQRA 4GS4A 3P5TL 4A37A 1YITS 1C0UB 1YX0A 3PP9A 3J7A1 2D9PA 2KH9A 3T5LA 4CYUB 1C1BB 4DS5A 1SH3A 5K8MA 5GAEI 1BQNA 1TUGB 4CO2A 5IV4A 1YHQS 1WWZA 2A4NA 2CTBA 4OIWA 4EYIB 4IG3A 2FIUA 3R7NB 4FWUA 2R2RA 1TL1A 3MF5A 2VQEF 4QPTA 1FJCA 1SIWB 3ZNJ1 2NUHA 1SXLA 2DNKA 2NPIA 2DO0A 3LP0A 5A8KA 1GMWA 5KTAA 4IDKA 1N32J 3BGLA 1IUJA 4HPSA 4RKUC 5KOWA 5E33A 2BE2B 4JI2F 2GZOA 4MK7A 4DMZA 2PDAA 2BJ3A 2V4JB 3GIMA 1TKHA 4GC6A 3PEHA 2EFVA 3D7SB 2RQ4A 4HEA9 1DZ5A 5IT9U 2PJ1A 4HT7A 3QAUA 2YKQA 3CJKA 3R6GB 1HW8A 2CY2A 1RT2A 1N6QB 3NGTA 4ES2A 5HQMA 2MKHA 5DWNA 2ZM6J 2LMIA 3SQGB 2G4BA 1SC3B 2VPYB 4UUWA 4JD6A 3JQMA 3KTQA 5D4NA 4X2BA 5F8GA 3B8GA 2IY5B 5ETMA 3OLAA 3J80U 3HXMA 2MLXA 1R8HA 2C6CA 4G1QB 3HVAA 2J0XA 1S7NA 2BJEA 3TNVA 1NMTA 1N36F 1A6LA 2AYMA 1H6KX 3KQZA 4CGNA 1IWAA 2FL4A 5ELYA 3JS9A 5G1ZA 4M6IA 1UEVA 3CJRA 1N48A 4GVBB 4J9PA 2M5YA 1QTNB 1WG4A 2ZBIA 2CZ9A 3RB3A 1JLAB 4MFPA 5C24B 3QRQA 2E66A 3RU0A 4WP3A 2FD2A 5DQGA 2OTJS 1C4CA 1NZAA 4PAAA 3HO1A 1PCAA 2GIVA 1U7LA 1LWCA 2GHVC 2BE7D 5J1PA 3RB0A 3S9MA 2HNDA 1UTAA 2QRRA 3NS7B 3DLEB 2HBYB 1JB0C 2XCPA 3TYTA 1S6OA 1EQ0A 3D2PA 1HFEL 4MHNA 3CE8A 4NGPA 1OWXA 1BQMB 5G20A 2O66A 3WIUA 1XR6A 3CDBA 3F5BA 3SI1A 3VAGA 2N7CA 1CJTA 3ENQA 1R6YA 4ZIWA 3KKWA 1UPPA 3V81A 3CD7A 2ZITA 2GMHA 3UPFA 3GONA 5L8RC 2E7WA 2F4FA 2JLFA 3WABA 5GVQA 2O3DA 4I69A 4FXVA 2ZNYA 4FBEA 3DLLQ 2OD6A 5GMKa 2FE7A 5KFKA 4DV5J 2CQIA 3D6MB 3KHHA 5H84A 2A10A 1S6QA 1DE4C 4Q8FA 2W4DA 3G6ES 1NPRA 3JSMB 2XO6A 1Z5RA 2GFFA 2B6AA 4IH7A 3OWCA 2OPQA 5A27A 2J76E 4JZ0A 5I3QA 4C0BA 5G21A 4HI2A 2QLXA 1PJ5A 4JV2A 2OOTA 1SL1A 4B10A 4X64J 4ZP9A 3NNHA 2CUYA 2AJFE 3UDEA 5KFUA 4QW9A 2HHQA 3KMSA 2QE5A 3R5CA 1RTDA 1VQ7S 3AA9A 1HNIB 2HFUA 3C66A 3FQKA 1VIOA 3W2WA 3M2RB 3QIPB 1XR5A 1WEYA 4TVAB 1FRXA 4HLBA 3MN8A 4CLYA 3VCDA 3G2XA 4PG8A 1JLCA 1SKUB 1OQ3A 2Q7BA 1HPZB 3EXYA 2N7YA 5E3RA 2WBMA 2AFOA 2YQ0A 5E7OB 4JI1J 1XE4A 5HANA 3V6DB 2GGPB 1RHUB 5LSRA 1Q78A 2DHAA 2CJXB 3I0RA 1S3ZA 4MFBB 3DI6B 3EE3A 1IWGA 2F65A 1UWAA 4DSKA 2XYPB 2DNNA 2N3OA 5KFCA 3MR6A 2HFSA 2KG0A 2W01A 5JVGQ 1HI0P 1HW9A 1Y11A 4UOCA 5HL7Q 3IXQA 1S57A 2QA4S 1PC4A 3L95X 4YR2A 1FJGF 2BE9B 1G3OA 4OI2A 3O44A 3FKBA 3CCRS 2ZW6A 5L1IA 1N71A 3KUGA 3I82A 2ZH1A 3QNVA 5E3CA 3PRBA 1KD1T 1NPKA 2OP5A 1D09B 4NGQA 1WEXA 3DGPB 4PWDA 2MKYA 4RNHA 2R98A 2JDJA 4F4AA 1NJYA 2CNMA 1NK7A 3NGRA 4R9MA 4O4GB 1WF1A 5B0BA 4WYWA 1NKBA 3IM9A 2DVIA 3DOKB 2ZBQA 2AFWA 1WNEA 2HVHA 4GKJJ 1HQEB 4MCSA 4A8MP 4YHHF 3BR9A 3CCVS 2UXCJ 1JKHB 2DNQA 3C3LA 4ILLA 4Y49B 5GMDA 4JXRA 1R7IA 2DGQA 3M8QB 5CYMA 1RDRA 2IVYA 1KOOA 1ARMA 3GV5B 3BH7B 1IKYB 4P4BA 1R43A 2JC1A 4XDDA 2EO8A 4H6ZA 3NXZA 2MGZA 2B0GA 1QLNA 3VWSA 2Y8WA 3IRXA 4N77A 4NLPA 3PCOB 3AJ1A 1RCOB 2PJ6A 4YUDA 2O1PA 2W7OA 4K30A 1VRTA 2PDOA 3TUPA 1HDUA 1KFSA 2K06A 4KO0A 3J81Y 3SV4A 1QDUB 3KLFA 1RISA 3T19A 1X4EA 3W60A 1SV5B 4R6TA 5T41A 2QTWA 4RW7B 2CQ4A 2OUGA 4HNYB 1VC0A 2GVZA 2VFRA 4F4XA 3Q23A 5DJBA 4A47A 2XMMA 1D9AA 4PQUA 1U4BA 1XIQA 4USTA 1HBUB 3HLUA 3CC7S 2MKCA 4JI0J 2L9WA 3Q24A 4EO8A 5GADU 1EAYC 5C42A 1NK4A 1P1LA 4PPDA 4MHDA 2HKEA 3CO0P 2Z3OA 2IPOB 1YRTA 2C3PA 2VFTA 1VYAA 3D6HB 3D28A 2W1BA 5J2NB 1HKAA 1MROB 8RUCA 4CYQA 4B02A 2ZJPQ 1I5OB 5DQHA 4KIAA 1F5BA 1K0VA 2BM1A 2Z3LA 2R7RA 3M6UA 2BKNA 3L09A 2ATLA 2CFXA 2GQ2A 4BDPA 1BD6A 4CNZA 3CC2S 3DRSA 2I38A 4QWAA 5CNPA 1YRXA 2NR0A 2Z10A 1IKVA 1MN9A 4CO3A 3HFKA 3KNAA 3R5JB 4YU9A 2ZH9A 4UY8T 3U1NA 4PEOA 4UFWA 5IOLA 2RDDA 2KHCA 2JVOA 2GC8A 3PKYA 2RF2B 1M1KT 1Q5YA 1L3TA 2CADA 3H90A 4MIWA 3FMCA 1S5ZA 5K8PA 5LMNJ 3J7YI 1S0VA 1VJWA 4TN2A 3OBIA 2JC0A 3KLVA 3MCSA 1F9FA 4NLGA 3Q8UA 3W7BA 4I2PA 3AD8C 3ILIA 2P5VA 2PFDA 2HK3A 4JI5F 1HARA 2MLZA 3R97A 3IIBA 2ZH8A 1FVSA 2DR5A 2PMZD 1F0XA 1A2ZA 1IYLA 1WHWA 1TKTA 4NASA 5F47A 2WRMA 3ISXA 3AB4B 2RRNA 2XCAA 4RJVA 1H8LA 2XZTB 4OV1A 3IM8A 2YY3A 5J1EA 2DPIA 4IYQA 2ZUGA 3TAMA 2UVRA 1UW4A 1U48A 2MJUA 2IJZA 4TU8A 2NSMA 1F9EB 3TJ9A 3CJ5A 4OC0A 1LFPA 5D0RA 1M4IA 3B3CA 5DG8A 5HBMA 1WOOA 1TMMA 1O5JA 2FLLA 3CZXA 5J2PA 3GR0A 2J9DA 1RQ0A 3PYFA 4LQGA 3C15A 2PRQA 1MMDA 5L9XA 4ELVA 2Z30B 3WDOA 2P9GA 1RWKB 1SVDA 3CD0A 2E44A 3LWMA 1JMTA 2VDHA 1HNVA 2A2DA 2NXNA 4QW8A 1FKOA 1RA7A 2GW8A 2LEBA 2G2OA 4LF9J 3H8YA 2F8EX 4NXNF 1XMTA 2PC1A 1HQUA 1K1QA 2DGSA 1X60A 2KO1A 3IA0A 3X3UA 3TX0A 2R8VA 3K8VA 1Y5LB 2ZEPA 1QSOA 5LMNF 1BO4A 1GMUA 2FXFA 3G86A 1U09A 1IKXA 2BEIA 1CQNA 2DK2A 3VZHA 1JJHA 2HNYB 2AGOA 4OYBA 3HK2A 2R3VA 3GYXB 1M5HA 5KT5A 1FTCA 2MB0B 2IYIA 3GQCA 4OX8A 2YKNA 2JLMA 4BBHA 3M8YA 1JXLA 3GG0A 4FD5A 1BY9A 2WZ1A 4Q38A 1H2VZ 2ZEJA 3BGRB 5ETLA 4X8IA 3RRKA 2Q1LA 3EZUA 3LP2B 4QR1A 4QYRA 3R6LB 2PJ8A 2ASDA 1VISA 1G2EA 1B7YB 1N0VC 4GO5X 3J80Y 1J5EJ 5C25A 5E96A 3PGPA 4G6VB 3GFXA 1TL5A 4WXWA 1VBXA 1ZYQA 1RHRB 1S0MA 1E6VA 2QL5B 2DHXA 4DHVA 2C2DA 3QAYA 4P52A 4GO7X 4AXIA 5KTDA 3WR7A 3ZZOA 3CULA 2B3TB 2HZVA 4DFKA 2W2PP 1U2CA 4JP8A 5E3AA 2V67A 3UO0A 2N4CA 1BPMA 4CTAA 3H8EA 3RTVA 2MZQA 4DI6A 5KFNA 1NSKL 2QFIA 1RSCA 2XHCA 1FXLA 3BS9A 1VQ9S 4ANCA 3QT8A 3MEEA 3IS9A 3AOBA 4ICLA 1S6PB 5HLFA 3BLNA 3TQ1A 3H2VE 4PKDB 5E3PA 5HQLA 4WIIA 4NCAA 2UXDF 3OQ2A 3MM5A 4Y2MA 1PAUB 5L9NA 4P73A 4DZ6A 3M8ZA 4K3NA 3KUEA 3FEYB 3TZXA 4E8OA 2KZMA 2PC6A 4L73A 4PXCA 1V0CA 2CQHA 4LQ9A 5CAAA 4I6AA 2VV5A 4P2XA 1F1BB 4LRAA 1N52B 4OLLA 4QWDA 1C4AA 4OZ3A 4NLOA 4GVLA 4WKYA 2X7BA 4F50A 4HVZA 3P2FA 2YGWA 1MU2B 1S0NA 1NE9A 4KOTA 1DLOB 3W6SA 4HNXB 3V4IA 2Q4ZA 2XB2D 2ZKUA 2OSQA 3CMQA 3PW7A 2HZAA 1Y4ZB 3RYLA 4ZCIA 2W9CA 2DCUB 1NZ8A 2AKWB 3IP0A 4LFBJ 2ZWPA 1RLCL 1ITPA 3V8IA 1TKXA 2DNYA 2P6FA 1FK9B 4OYXA 2VBWA 3O2IA 5G4DA 1GYTA 2EWHA 2N3LA 4P7VA 4QCLA 1F2OA 1XJOA 1OIAA 2ZUAA 3HVTA 4CRJA 3PM9A 1Y0HA 1R27B 4JYAF 3W62A 2VC0A 3OUYA 1X9SA 2ASJA 3HHDA 5A2QU 1HA1A 3AB2B 3KK2A 3D66A 1WELA 3QJJA 5C82A 1EZZB 4OFZA 4ED2A 1R8PA 4RN7A 3SDEA 2HQGA 2GVDA 3EJMA 4Y2IA 1WF0A 4JI8F 2CQ1A 2PJ2A 1D8ZA 4FKYA 3OFHA 2Y1LB 2R42A 2YNGB 4QIWD 2B5GB 4H4OA 4HH1A 3MUVP 4ZOSA 4BS2A 4NGTA 2ZVIA 1KDNA 3NAIA 4CLLA 1UETA 3KNGA 1I94F 2RKIB 3U7JA 3OTOF 1NSQA 3B4MA 1WC5A 3JTNA 5EUHA 2Q66A 2QYVA 4USVA 4AVBA 2F5GA 3D1QA 3NH8A 3RW6A 3MEDA 3I5BA 4QIGA 2IA0A 3TVYA 4ZCMA 2MKJA 2ZOGA 2EPIA 4PG4A 5C88A 3K17A 4KVME 1RBAA 3ITHA 1IXKA 4PUOB 2E5IA 4DR4F 4F3QA 3MOJB 3FCHA 1HHQA 3FBCA 5CZXA 1YGYA 2XS2A 5I0CA 5CYQB 4B3RF 5KFOA 4ZPWR 2DEAA 4NA3A 1HWKA 1FX4A 2XGPA 4LFBF 2MQPA 4USMA 5KFXA 5JGFA 3CSKA 4A39A 1RT5A 5JXSA 2ZEMA 1P8GA 1K47A 2PE8A 4WFBQ 1IGBA 3ZZ0A 2SXLA 3LPEA 2VA2A 1X8DA 4QBUA 1TF9A 2YPYA 3E01A 5JUMA 4NMXA 4CLZA 1MWZA 1X9WA 2BJ8A 4B9NA 4V1Ak 3KJNB 2ZD1A 3C26A 1UJ6A 1EX8A 1H7XA 4IO9Q 4ZPAA 2Q3PA 5CCLA 4C8ZA 3UWTA 2F40A 2MZTA 1N4LA 3M1VA 1Z4RA 2M8DB 1YJ7A 1HMVA 2V9KA 5J8FA 2UUAF 2LKZA 4NRTA 1U1NA 3UCGA 3BPSP 4TYAA 3RBZA 1XMQF 2R7OA 2B51A 3TA1A 5JQ4A 2HURA 2YWEA 2KFZA 3BSAA 4IKAA 2RFHA 3BF4A 4PK2A 4QWBA 2XBPA 4Y0FA 4HDHA 4K4YA 2Y1JA 5A8RA 3D4JA 2X1GA 3PHTA 2MKSA 2HV2A 2YWGA 2J9DE 2C2MB 1Q2CA 3OTCA 4TU9A 3NH5A 4JV5J 1ZG9A 3C14A 1CULA 2KRBA 2OFGX 5IWAF 1EE3P 4OYPA 5IC6B 1DRZA 5HXDA 3IMQJ 5GAHI 4OI3A 3DHWC 1NH8A 1RT4B 5LYDA 2RB7A 1NHUA 2XEIA 1U1QA 4IFVA 2R7TA 4LREA 1S12A 5FJ4A 4DV0J 1ACMB 4YB1P 3GILA 5M2PA 2FHKA 3Q8SB 3K9UA 2AX1A 3FSIA 2W9AA 1TK0A 4DV2F 4V19J 4P4JA 3R7SB 3HHLB 4KR0B 2WCXA 1B0PA 2CQPA 3NMAA 3K2KA 2B4VA 5CYJA 3QWUA 4DQRA 3T5HA 3PDNA 4OZJA 4LMZA 1A7GE 5KAKA 1DQAA 3MEKA 5HI7A 3QJPA 1H73A 4ZVOB 2ATRA 2FC9A 3RW7A 3OLBA 2AFZA 3PACA 4NF1A 2V6AA 1JIHA 5D0GA 5LSOA 1F2GA 2DJWA 4U8YA 3CGIA 1SBRA 1HL6A 1X4AA 3AT1B 4A8YA 3BQ0A 4EU0A 4CLSA 3FEDA 2RQCA 5CA5A 3PW5A 2W24A 2ZWOA 5D29A 4K4SA 1FY7A 2LQ8A 4M5JA 4Q2MA 3KJVA 1RHJB 2ZEHA 1VR6A 3LANA 5J2QA 5EMIA 2BA9A 1KWMA 1K0TA 1RT6B 4ECQA 2BZ2A 3DCAA 4Q0BB 2PJ7A 1GTHA 4NYOA 2L41A 1OBRA 3VARA 4Q2LA 3HI9A 2YKMA 1MLAA 2K7KA 2OH2A 1S1WA 3DYAB 3EXCX 2B43A 4USWA 5K8NA 1S10A 4TNUA 2GREA 4J5OA 3IFEA 2J8RA 4QIVA 5D78A 2R2TA 1MWYA 2OGUA 1RTJA 4DL6A 2C2NA 4ED1A 3TO7A 2VASA 3GR1A 2GHWA 2VPWB 1WC3A 5KTCA 3C46A 3IWWA 4OYWA 3QGHA 3J7AN 4DPUA 4KTQA 2OMOA 3MPVA 3TANA 4IG0A 2VBQA 2FLOA 2BQUA 4HI1A 1NDCA 1MK4A 1Q86T 2XEGA 1YJWS 2D1CA 2QA4G 2WONA 4GKKF 2GQCA 3I87A 2W9BB 5EGYA 2JVRA 1U1PA 1ZG7A 5B0DA 2CZVC 1SCJB 3TCVA 4ZIVA 4B6ZA 3A3NB 1JQGA 4KSAA 2RD5C 1R6VA 1XTZA 1PBUA 3HDSA 1CQMA 4LRBA 3NGDA 2M2BA 3HSJA 4ZVQB 3VTIA 3DOMB 1IQZA 4EWTA 4U7UD 3T90A 5C7PA 4A31A 1NK9A 3EGZA 2QLWA 4ED3A 4BINA 3KK3B 3R8YA 4DQPA 2CRLA 3V5RA 4ZLPA 4DS4A 2IL4A 1N5YA 4P72A 4XK8C 1AFJA 3BM7A 1WI6A 4RWXA 3H59A 3H8GA 1I3OB 3RUBL 1S9EA 1SKSA 3PY8A 3IO1A 4A32A 4B3SF 1RE1B 4NZ6A 1S4FA 4F0XA 2XG8A 2M70A 4DLGA 3SJGA 2H54B 3TC8A 2EWBA 1C0TA 4M5LA 3UDVA 3KK1B 2HAIA 4U95A 1CP7A 1VQSA 4II9A 8CPAA 4DR6J 2Q79A 5C2CA 2HNZA 3PG9A 3UFCX 2NCKL 4IK2A 3NOCA 3NLCA 1WORA 2PMHA 2DNMA 2M4MA 2BXJA 1DJ0A 2GQQA 2OSRA 2Q7SA 2DIUA 3U1MA 2FT0A 3TFYA 4QOTA 4GC7A 1R0BG 5LMUF 4DFMA 2K3IA 3P49B 1Q8IA 1HIYA 3CXQA 3DRPB 4CIOA 4W98A 1RT7A 2CF4A 5ETKA 2WW4A 2W7AA 3ENAA 4WFNQ 2CA9A 1FFSB 2ZOFA 1QAIA 3NE8A 4RU9A 3GIKA 3B2YA 1GK8A 2A6MA 3IGNA 4CH7A 5THWA 3KR5A 2WK4A 5EBVA 1UWBB 1NB7A 4AQYF 4DR2F 2B5JA 5LL6d 1KS2A 4ECRA 2R8JA 3MAHA 1TELA 5EC4A 4TU7A 3KKFA 4OLOA 4DF8A 3KG4A 4JB8B 1P9QC 3I5CA 1XMOJ 4MMOA 5M2RA 1TP7A 1T9WA 3CMES 4ONWA 1U0SA 1IU8A 4JI6J 3S8SA 4P75A 1UFWA 2MPUA 3I1UA 1R3NA 5BR8J 3UD3P 2OZGA 3IBFB 2ZEOA 2ZEEA 2V2KA 3J81j 1RWPB 3QAEA 5K9FA 3HP6A 4IFYA 4NCGB 1S48A 1Q82T 4I1TA 3KHRA 4KGZB 2VG5B 4NXMF 3CF5Q 2EKYA 4K8RA 5I3PA 3OJUA 2HIYA 2GMLA 1BLUA 4OMFG 2HWHA 4Y00A 3K5OA 3NBPA 4DR6F 1TKZB 3M9MB 3FMWA 1MNEA 2GJ2A 3AAWB 5A8WB 2BUEA 2J8NA 4WP8A 4MFLA 2KJVA 4DF4A 1KRPA 3CDEA 4RUCA 1HLWA 1VHEA 2HQ3A 3BJ8A 3TJAA 1HYSA 3B82A 1IN0A 3AXMA 4KB7A 5KFRA 1X4CA 5KG6A 1YBTA 2VFSA 3EICA 4A30A 1IY7A 5ETTA 3M2UB 2F4VJ 4LF4J 1RTIA 3M2VA 4N41A 1ZM4A 4WE1B 3GFZA 3B7IA 1PYTB 3MM8B 4CPAA 4RNFA 3HVRA 4HNWB 4CZCA 4E8UA 3EUNA 1BXNA 4O3RA 2HQIA 2M7SA 2OPPA 1KOHA 2V4QA 2ZEGA 2FJBB 2I1RA 2RU3A 4CWBA 2JL9A 1O51A 1HD1A 1M0SA 4XNHB 2RUGA 4RX6A 4C3LA 2RRBA 1FI4A 1X4HA 1JX4A 3OFEA 1NB2A 3US5A 2OPSB 3FVLA 4PQAA 3MGDA 2RH3A 5DWMA 5HP1A 3TARA 4DU7A 7FD1A 4CI0B 2IM0A 3VWDA 2VH7A 3LALA 1NDKA 1I1GA 5AJ3F 1JK9B 5IV3A 5ETNA 1U25A 3IC1A 1WF2A 1F57A 4CGOA 1YRUA 3RGIA 4UZBA 4PG7A 5KG4A 3S6FA 4PWWA 4PXDA 2YX7A 3IWGA 2VG7A 3B6BA 2VB6A 3G82A 4K5RA 1Y7EA 3KFWX 5DG9A 3BQ1A 4IRDA 2R4FA 4WKRA 2GCFA 4C11A 4QIEA 4CAVA 4OX9F 5F46A 5EHHA 4KE5A 4IG3B 3BDPA 2XNRA 4DV6J 1T9TA 3PRDA 4RW9A 2PIZA 1YWXA 2YNHB 4UIAA 3GKRA 3W2VA 4OC4A 3ZO7A 2WSEC 1P6TA 2R7QA 2CNTA 3LP0B 2QN6B 1XBUA 5A8KB 4CLWA 2E5HA 2E1RA 4IDKB 4M95A 1VHSA 2ZH5A 3H8FA 2EK1A 4ZCLA 3M32A 4W4MA 3BSCA 2YNIA 3C6UA 3UN5A 3NWRA 2V9WA 1M1HA 4CT9A 4OYOA 2LA6A 2DPJA 1NSLA 3UI3A 4OZ5A 5D15A 4EMEA 1UEKA 3KL9A 3CJKB 4MFQA 3D0IE 3R2DJ 3GPAA 2ODFA 4U6PA 3BJ7A 3NKYA 1RT2B 4KV8B 1OY6A 4ILRA 2B4DA 1Y3JA 1EB0A 3I6PA 2D9OA 5FIIA 2PIYA 3M8PA 3VVUA 2HHHJ 2Z2LA 3ZFVA 4EZ9A 4ECXA 5KFMA 3UDCA 2QIFA 1J5OA 2GIQA 3OHAA 1Q2DA 3CXSA 1HNXJ 5D4LA 1UVKA 1VIXA 4WU2A 2HIQA 3UVJB 2CPDA 1T95A 4OI4A 3SMZA 4JWPA 4B11A 3MCNA 1NK6A 4J9LA 3FIXA 3KLIA 5KFIA 2H5EA 3VAIA 1YVKA 2K1RA 2Q4VA 1AZSB 4ZLNA 7FDRA 2HEKA 4KGVB 4CS0B 1VQOS 2IJFA 4I4BA 4RW8A 4IHMA 5KFZA 1NAQA 3D1OA 2B3UA 1CJUB 1LWCB 2HNDB 4LFCF 4MXUA 1T9UA 3UD4P 4DV7F 2B9EA 4YFJA 2RQMA 3E2EA 1CC7A 3K58A 2C3OA 1FRMA 4JI4J 2P0WA 3OVBA 3SFGA 3OR2A 2KT2A 4TY9A 2YNCC 3V6KA 4X4OA 2M0GB 2KXNB 2GU2A 1VJQA 2BRLA 1QVFR 2HRTA 1CJTB 4DR3J 4CAXA 2OO4A 4NFRA 3V81B 2AMCB 2FVGA 4ZVPB 5AE2A 1V5IB 2LXUA 5LXRA 3EVWA 1VQKS 3A8EA 4P2MA 4ENOA 1EQMA 3J7ZT 1L3VA 2KXFA 3D0GE 1ELLP 2BJDA 1YIJS 2WSAA 2B4OA 4K0KF 4OJGA 4FF4A 4AE5A 4C48A 1LWEA 2WTFA 5SUHA 3GFYA 1RXTA 1S6QB 4ZMMA 3MDFA 3G3SA 1C0UA 4LF8F 2Z3NA 4ZS6A 4LF6J 2G0IA 5FD1A 2BBEA 2FHOB 3JQJA 2OPQB 4DJBA 4CYUA 2EEYA 4WPAA 5DZ6A 2CNNB 1C1BA 4OI1A 3HUVA 2KCWA 2HHHF 2F63A 1WDDA 4KHPF 2AJ0A 3GJTB 2AEJA 1VDHA 4ZX9A 2J6UA 4UY85 1Y0YA 3CCWA 1XC9A 3VALA 3B8HA 3K9TA 3NMRA 1OY8A 1RTDB 4RNMA 3DRRA 2ILYA 3RB6A 4TQSA 4QR0A 3W2WB 4K59A 4KS9A 2X1AA 4C2YA 1CS4B 4JOUA 4TNOA 4DFJA 1HI8A 3TO9A 2HRUA 4KOSA 4J91A 4BD9A 2AV5A 1JLCB 1U1LA 2DEJA 1S72S 1KSPA 4EBCA 1WG1A 2BQ3A 4U7CA 1YJRA 1T03B 2P9CA 2RU9A 1PG5B 3CNQP 6FDRA 3GLJA 3VAMA 2HUZA 2CJYB 1H72C 3EMTA 4X4RA 5HQ8A 5AXMA 3ZJ0A 1ARLA 4USUA 1N8RT 4C9DA 3UCUP 1RAIB 1RCXB 1HNZF 3H20A 1RT1A 1HWLA 4B9LA 2Z4PA 3O6QA 3CPAA 1ULRA 3G4SS 4DSJA 1HBNA 3TUZC 4F3OA 3CUNA 3LPYA 1HWUA 1TAUA 3IWLA 1RTHA 1RAAB 3HX9A 4TYBA 4UWJA 1LKZA 4ECYA 3SV3A 4M5KA 5D3GA 4K4VA 4LUBA 2UU9F 4FPRA 2DTJA 4Z7YA 4Z7CA 3IU2A 4PWDB 3W9JA 2IBOA 4DR1J 4DFPA 4QIFA 2ZH7A 3P96A 4H4MA 1REVA 1RAEB 2EK8A 5D77A 4L6V3 1S60A 3BKFA 2MQ8A 4M5IA 4ZPBA 3LH2S 5B08A 1QVGR 3MCMA 2I6WA 2KDOA 1URNA 3OXLA 4YMEA 5KFWA 3AFGA 2HBZB 1NXIA 3PX6A 2MQNA 1TAQA 3QZ8A 4B3MJ 1U24A 2PT0A 2F9DA 5CYMB 4RBUA 1Y5NB 1OPIA 3CJSA 2EUIA 2Z0GA 4KVOE 4MT1A 2I2YA 3R1KA 2CPIA 3BREA 2MGZB 4A46A 1QM9A 3IJ3A 5D4PA 2WVFA 3IRXB 1VQLS 4NPOA 4MKYA 3MR7A 1FRJA 4U8VA 3N7ZA 3GCXP 1FTRA 5M2UA 2Q4YA 1OSDA 2DITA 2PFFB 2DGOA 1VRTB 1IJEB 5G22A 5EDWA 1WC6A 3JTPA 4KO0B 3KLFB 1NJZA 3LWUA 4LRDA 3DLJA 3CD6S 5EWEA 3LWLA 2DNLA 2GNKA 2ZKTA 2Q6CA 4XO0A 4U5YA 2GVZB 4PXBA 2ERRA 1FE0A 4OHYA 1Y3KA 2XMWA 1LANA 2V8DA 1TTHB 4FD7A 3SYZA 3EGVA 5LRGA 2YTCA 2PD1A 2BYCA 3O3LA 3F41A 1S7HA 4GMKA 3BGOP 4ED7A 2HGLA 2QJ3A 1M5PC 1S77D 1WACA 1KQSR 1OMSA 3CMAS 1WC0A 4C8MA 2WHOA 3DFEA 3I0SA 2VZ9A 3MM6A 4K4TA 1N34J 3X1LB 3OT9A 2G2ZA 1QAJA 2DPSA 5JMNA 3QIPA 1VFJA 3R1HA 4NOHA 8AT1B 4B3OA 1WG5A 2MQMA 4ECWA 1FJ7A 4K4UA 3B3TA 2MDAA 3PV8A 2AIRB 2LVWA 3CD5A 4R5PA 3FCWA 2JEIA 2QX0A 4DLEA 2OMLA 3KLGA 1G1XA 4UCPA 1HPZA 5BYRA 5E0OA 2IM1A 2Z0ZA 3KQXA 3IBWA 3UD5A 3K5LA 2JDDA 4DV4J 2KVIA 3T6BA 3MM7A 1UEUA 3DI6A 2V77A 2JFKA 3IBCB 3H25A 1A0OB 3W8PA 2ZW7A 3DRSB 5HROA 1YJUA 2FTRA 3G96A 2V4RA 4UOHA 1Z8TA 3OTDA 2N82B 1XR7A 2JEGA 4RR5A 1X12A 4IOBA 4B08A 4CH0S 1P0HA 2AYEA 1OPZA 3U02A 2XHWA 1TU0B 4JI7J 5GAGI 2GX8A 4P6QA 3DSBA 4M5DA 4M85A 2EVZA 1KUVA 2AT1B 5KFJA 3EC4A 3EGNA 3M30A 4I56A 2LA4A 4ES3A 2H5IB 2PI5A 4RL1A 3PHEA 4DV1F 5AG7A 2DXQA 2XS7A 4RU2A 4MHZA 1MJ9A 1N88A 2CYYA 3DMJB 2OU2A 2QLFB 3MOZA 4R8UA 4I2PB 5KFLA 3NGKA 4DSIA 3CWJA 3RBEA 3TVZA 2HYIB 2MKIA 4MKAA 1J27A 2R9LA 4Y34A 4K5SA 3K59A 1JKHA 5T14A 4Q36A 3ZTSA 4DCJB 1DY3A 1TIQA 3CJ3A 3TE4A 4J9KA 5K14A 1TKTB 2MEWA 1T8EA 1TZ0A 2ZJQQ 2BOPA 3KZWA 1GT8A 3P4UB 4I6WA 3OD2A 3TAMB 2IFXA 2DIVA 3CC4S 1SL0A 2BVZA 2CXEA 5BYSA 5HSPA 1WOPA 1CJKA 4KYZA 1FNXH 3PEIA 4CLPA 2I8EA 2ROGA 2OIHA 2PI4A 2W2NP 3GJQB 5HVGA 1WSVA 1TVRA 1VBZA 4ZPVR 1B0TA 3MHYA 5J2PB 4ZJQA 3RBDA 5D8HB 4BBYA 1Y00A 4DPXA 1R0AA 2ABYA 4AXVA 1RT3A 3PYDA 2G9DA 1DQ8A 2W2OP 2UUBJ 2VFUA 4DV3F 2QLBB 3QBCA 1SV5A 3CJ0A 2DHSA 4O0NA 2IBKA 4RW7A 3R2CJ 1JNZB 1WKLA 3S9LA 3WX8A 1HNVB 1VLYA 3NGUA 1FKOB 1Y0RA 1WC4A 1WEZA 4EEYA 2R7XA 2EFOA 3JSYA 3SXOA 2PR8A 4YR3A 3VVTA 2U1AA 3QPIA 2JX2A 1Y5IB 1HQUB 4DYOA 2KYZA 3ET6B 4NL5A 2OH1A 4J9SA 1WOSA 1NH7A 4O23A 4MY3A 1ZM2A 2H65B 2UV8A 2VQYA 3GCWP 4YB5A 3NL0A 1U47A 4FN5A 2FS5A 1W25A 3BB5A 4P4DA 2Z3MA 5IQ6A 1IBMJ 4X2TA 2U2FA 3ZZUA 4G1IA 1S9GA 2WVCA 3PNIA 1JJ2R 1RXOB 1T94A 4MRIA 1NHVA 4UEZA 3SSRA 2AZ3A 4KH0B 5DQIA 1KVJA 3CJ8A 2FHJA 1AROP 4AUKA 2H1YA 4QR2A 3LP1A 4UBRA 2FYXA 1JWQA 3NP5A 4O44B 4DR5F 1H3DA 3W91A 3H42A 5CH7B 1UJ5A 3W9IA 5FDLB 1HI1A 1OO0B 2BO9A 4KOUA 3KLHA 4HACA 3FBEA 3M8RA 3L3CA 4BC9A 4IOAQ 2VOOA 3MCOA 3C19A 5IQQA 2X1FA 1HBMA 2BJ1A 5GMEA 1RTQA 3GP9A 4ECZA 5JH9A 4J9MA 2HAFA 4MCRA 2HHVA 4CTAB 1U0HA 1WHYA 1XNRF 3ICLA 3TA2A 3FXTA 1FWPA 4XPEA 2FJWA 2AP6A 1RAJA 4HT5A 2E1AA 3PYGA 1FKAF 3MEEB 1XN9A 3B3VA 4U96A 3IS9B 3D2WA 2W2QP 4ICLB 3LD2A 1TL4A 3BDEA 4MYTA 5HLFB 5T7LB 5HMXA 5F49A 2OHDA 2QT7A 2ZH2A 2YBVA 1AXQA 2GJFA 1U2RA 2G9OA 4CQ1A 3A12A 2ZC3A 3DR6A 4I7FA 1T3NA 4RW6A 1NBEB 5L39A 4X65F 1P1TA 3VAKA 4QBJA 1FO1A 3RR8A 4QU6A 2E5LF 3T9NA 2ZE2A 2REEA 1S1UB 1YJNS 1XNQJ 2KM8B 2HMIB 1F5AA 5KG2A 2OJ3A 4UFVA 4ED4A 1SJQA 3FNNA 5K8OA 4YGOA 1X5PA 2V8GA 2BACA 3V4IB 2D3UA 2HVEA 3VF0B 2VUGA 4X66J 2AD9A 1HNWJ 3FDSA 4H4KC 3PBBA 2NS1B 5KT6A 1U6MA 1DAXA 2JLEA 2HBQB 3SXLA 3S9NA 3NE7A 2C2ZB 2NLWA 5IM0A 4KY3A 3Q8PB 3KASA 2UUCJ 3MTKA 2C3UA 4UW2A 3VWEA 1Q8BA 4OYMA 1TKXB 1S79A 4YQWA 3R95A 2XTJP 1URRA 3FFIA 1RWUA 2G1DA 2QYCA 3Q8YA 2FVPA 5F41A 1YJTA 1XEBA 2C42A 3KHLA 2QECA 3HVTB 2A18A 2IIHA 3F56A 1FE4A 3JTKA 3PB7X 2J7UA 1FXDA 1QMUA 3CCES 1BMQB 2KL8A 2NZCA 2VBXA 1NKCA 1GXLA 4F04B 3VGTA 4WK1A 4CT8A 1PC5A 1OQ6A 4H54A 3G6VA 2WOMA 1EP4A 2GVDB 1F9HA 3ELHA 4DSFA 1VQNS 4F2SA 4M1KA 2YH0A 4L89A 1Y7PA 4QWCA 5EWGA 1GTEA 4FYXB 2CDQA 4H4OB 3I5AA 4OMEA 5HMZA 5E5NA 1IB1E 1ZM9A 2KTQA 2G0BA 5F8JA 1K73T 3RO0A 1F2HA 2QVPA 4F4ZA 2VG6A 4XPCA 4J3GA 3T5KA 3DM2A 2E7XA 1IBKF 3B54A 3LOUA 2OAUA 2AYBA 2IYGA 1TFWA 4JBCA 3P45B 3R3TA 2VD3A 3ITHB 3QGGA 1F2PA 3V38A 4R25A 1WDTA 4Z37A 3B3SA 4KKOA 3MI7X 2G0JA 4I2QB 3FSYA 1M4GA 3QYYA 4FYWB 2HBRB 3ISZA 1FFGB 1S1TA 4IR1A 2LU2A 1X5TA 1I12A 1RT5B 3TWZA 3S01A 4ZVRB 4PG6A 3GSDA 1KBRA 3IR7B 3E0KA 4LR9A 1SJ4P 4FD6A 3N6LA 4X62J 4DL3A 3JYTA 1UFHA 4XTTA 5F3TA 2F8HA 3E01B 1AW0A 2FLNA 4O3PA 3HPOA 1YQHA 4A2ZA 2GLJA 2CPEA 4EMDA 2ZD1B 4F3MA 4PCQA 4EYHB 1MN7A 1N32F 5KT3A 2QO3A 2V94A 1V3RA 3FMBA 4KOXA 4M5GA 1LOUA 3FEEA 1EETA 4OC5A 2JDCA 3EVMA 2EBEA 3M1VB 1VK8A 4RUBA 1HMVB 1IBLJ 1VMBA 2YNCA 1NNDA 4IUSA 3T3FA 1Q79A 6CPAA 2WAQD 4ZPDA 1CM0A 3ENVA 4LF7J 4KUBA 1KQKA 3C2PA 2ZM6F 1Q95G 5A8RB 1RU1A 1F3VA 1ZBTA 2VQFJ 5LSLA 5FLXU 5IFMA 1SH0A 2WSCC 4NLYA 4CLKA 2IDLA 1M90T 1BGXT 3N28A 3C14B 2PJ9A 4DBQA 2HLTA 3O8WA 1SC4B 2WW8A 4C8NA 2IAJA 3KHXA 1CPSA 1Z8LA 2RHSB 3JQKA 4A4JA 1S1VB 1VQMS 4PK3A 3DDKA 3HFVA 4H89A 1KN6A 4EGLA 4IFVB 3HZEA 3BN7A 1FKPA 1Q0NA 4UZCA 3T1HJ 3EPIA 2CQGA 4DCPB 4J37A 2ATCB 3NRBA 3V2UC 5LYFA 3F73A 4AG7A 3G6XA 2MQQA 1CC8A 1SUQA 4LRFA 3SI8A 2XQCA 3OTBA 3ZZZA 5ETRA 3NY0A 1F6TA 4B3TJ 2HWIA 2UV8G 2DR8A 1LXNA 2GMJA 4KORA 2ARHA 2H5JB 3VATA 3K5NA 5AXLA 2EVNA 1GHEA 2BEFA 2BCOA 3UQSA 1SIZA 1YZ7A 3BH6B 2Y3YA 2PR1A 1ZA1B 1BAVA 3FEZA 5EWFA 1W7WA 3VV2B 2HG4A 3AD9C 4P4IA 3WIVA 2UVWA 1GEHA 4LSNB 4CH1A 4DV5F 2RS2A 5J2QB 2FQQB 3S6KA 3A4TA 3FJUA 4HKFA 2EK6A 4UUXA 1WI8A 1VRUA 1E6YA 5DDPC 5A28A 2PJ5A 3V6JA 1QTMA 2YKMB 3O1LA 1TK8A 1R89A 2B9WA 2XSJA 3CO9A 4AVAA 1S1WB 3H7HB 4X64F 1DTQA 3ILLA 4N5SA 3GY9A 3EGWB 2LXIA 4AFFA 3HHLD 5KG7A 2EI5A 4FYYB 1RTJB 1X5OA 4ZVEA 3ZZIA 1B99A 2AF6A 2LFVA 2MZJA 4TXSA 3DDDA 4TQRA 4KLVA 2VF3A 3W5ZA 5H1SV