3KKWA

Crystal structure of his-tagged form of pa4794 protein
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
178
structure length
166
Chain Sequence
SHHHHHHMQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of His-tagged form of PA4794 protein
rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Transferase
molecule keywords Putative uncharacterized protein
total genus 43
structure length 166
sequence length 178
ec nomenclature
pdb deposition date 2009-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3kkwA01
5F49A 2NMTA 3T90A 3GY9A 4UWJA 4U5YA 3G8WA 2Q44A 4HNYB 1N71A 4OLLA 4B5PA 2B4BA 2F5IA 1XE4A 2PR1A 4MY3A 1KUYA 2CNTA 1P4NA 4KOVA 2B4DA 2P0WA 1XMTA 2X7BA 1MJAA 2WPWA 4PSXA 1IYLA 2I00A 1M1DA 2BL1A 2OB0A 1CJWA 5KTAA 2Y0MA 3D8PA 4UA3A 3FRMA 2R98A 3R9GA 5ISVA 4JXQA 3WR7A 4X5KA 1KZFA 2JDDA 4KOWA 4OAEA 1Q2CA 4MBUA 3W6SA 2PQ8A 2Z10A 1YVKA 1BOBA 3NE7A 4K30A 2R8VA 1XIXA 5J8CA 4HNWB 4EVYA 4XPDC 3TOAA 4AB7A 3DR6A 2ZW4A 2VEZA 4IUSA 4CRZB 2ATRA 2VQYA 2BSWA 3EY5A 2I79A 2CY2A 2D4PA 2HUZA 4CRYB 4KVXA 1Q2YA 3DNSA 4H89A 4CAVA 1MK4A 3S6HA 3R9FA 1S3ZA 3I9SA 4PSWA 4RI1A 5HMNA 2B58A 1GHEA 2J8RA 3I3GA 3QB8A 5DWMA 2CNMA 2ZW7A 2FS5A 1FY7A 2VZZA 1SQHA 1S7NA 4H6ZA 3S6FA 1UFHA 3FBUA 3G3SA 3BJ8A 1CM0A 3FIXA 2QIRA 2B5GB 2P6EA 1S7FA 1WK4A 3K9UA 2FL4A 4XPLA 4QUSA 3TTHA 4HNXB 3TO6A 2ARHA 1WWZA 3W91A 3SXOA 1Z4RA 4R3KA 3R95A 2PRBA 2B3VA 4YGOA 3UY5A 3DR8A 4JXRA 5JPHA 2Q04A 1YREA 4JD6A 1P0HA 4MJ8A 2KCWA 1S5KA 3H4QA 2FIAA 1Y7RA 3S6GA 2BEIA 4ONUA 4GS4A 4II9A 4KUAA 4JWPA 4LX9A 3CXPA 2VBQA 1B87A 4AVCA 3B8GA 4AG9A 2GE3A 2RC4A 3E0KA 2OH1A 2VZYA 1Q2DA 3DDDA 3P2HA 3F0AA 3IWGA 3DSBA 1NSLA 4KZTA 3TCVA 4I49A 4KORA 2FT0A 2DXQA 1Y9KA 1BO4A 1M44A 4KOTA 4JJXA 3D3SA 5EC4A 1M4GA 1IIDA 2PSWA 1YK3A 2Q0YA 4CAXA 4UWIA 1M4IA 4JLYA 3T9YA 3PGPA 4KOSA 2Q4VA 4R57A 4FD5A 4KLVA 3OWCA 3VWDA 2WPXA 2OZHA 2PDOA 2JDCA 1IICA 3GKRA 2Q4YA 1V0CA 1B6BA 1YVOA 2PC1A 2FIWA 3W6XA 5IB0A 1OZPA 4QVTA 1RO5A 5IX3A 3PP9A 2AE6A 5GCNA 3R96A 3F5BA 2VI7A 5KTDA 3TE4A 4QB9A 3FYNA 4XNHB 3FXTA 1PU9A 1ON0A 3SHPA 1QSRA 1KUXA 2Z11A 3BLNA 4QBJA 5F48A 4KOYA 3BJ7A 5F47A 2GIVA 2G0BA 3JVNA 3EC4A 4ORFA 2FXFA 5F46A 1Z9UA 2H5MA 4RS2A 3N7ZA 1J4JA 2REEA 4YFJA 4AVBA 2D4OA 4XNHC 1I21A 4XPKA 2O28A 2OU2A 5C88A 3CXQA 3KKWA 4F0YA 4B5PB 4M85A 1S7LA 4L89A 4NF1A 2GANA 2J8NA 3MGDA 4R3LA 1RXTA 4XPDB 4FD6A 4BMHA 1MJ9A 2J8MA 1NMTA 5EBVA 4NSQA 4U9YA 1XEBA 1YX0A 2CNSA 5HH1A 4MY0A 1K4JA 1TIQA 3RYOA 2JEVA 4L8AA 5CNPA 2OZGA 4HKFA 1M4DA 3LODA 1IYKA 4MHDA 4OADA 2B5GA 1LRZA 3FNCA 3S6KA 3C26A 2R7HA 4H6UA 2IL4A 4DNCA 1MJBA 3D2PA 4E0AA 4ZBGA 2B3UA 1I12A 4CAWA 1L0CA 3TO9A 1Z4EA 4R87A 4QC6A 4KLWA 2FE7A 3R9EA 1QSOA 2AJ6A 2G3TA 2BUEA 4J3GA 2QECA 4E8OA 4UBRA 2Q7BA 3EO4A 3TT2A 3VWEA 4PV6A 4AG7A 1R57A 2A4NA 3R1KA 4KUBA 1PUAA 3SXNA 5H86A 1YR0A 2ZXVA 3GYAA 1S7KA 4B5OA 1KUVA 3EFAA 3LD2A 1VKCA 1NE9A 3P2FA 5DWNA 5FVJA 1Y9WA 1S60A 1QSMA 2Z0ZA 2PR8A 4F6AA 2REFA 4FD7A 4R9MA 1XF8A 1VHSA 2FSRA 5I0CA 3TOBA 2HV2A 5IV0A 5H84A 3CXSA 2HQYA 2FCKA 2JLMA 2QMLA 2ZW5A 3TO7A 4KOXA 1YLEA 2OZUA 2B4DB 3QAHA 4Y49C 4MI4A 2G3AA 1U6MA 2EVNA 1QSNA 1I1DA 4M3SA 2ZPAA 5KTCA 3ZJ0A 4PK3A 3FB3A 3IGRA 1IB1E 2C27A 3TFYA 4NXYA 5J8FA 4IF5A 2R1IA 3D2MA 4AVAA 3F8KA 2P6FA 3PZJA 4YRHA 1YGHA 4LUAA 4KVOE 4PK2A 3V8IA 4U9ZA 4NEXA 4E2AA 1QSTA 4FD4A 4NCZA 2P6GA 4Y49B 2VXKA 4CS0B 2EUIA 5E96A 3JUWA 2K5TA 5JQ4A 2ZW6A 4KVME 5C82A 3ZZIA 4KOUA 3EXNA
chains in the Genus database with same CATH superfamily
2DPSA 4R7MA 5F49A 2NMTA 4NGTA 3T90A 3GY9A 4UWJA 4U5YA 1EE3P 1IOIA 3B3SA 3KR5A 3G8WA 2Q44A 4HNYB 1Y0YA 1N71A 4OLLA 1CPSA 2PJAA 2OR4A 3BI1A 2NYQA 4K3NA 4B5PA 2B4BA 2F5IA 1XMBA 3SI2A 1XE4A 4MRIA 4C2YA 2PR1A 4MY3A 1TXRA 4P4FA 4CGOA 1AMPA 1KUYA 2CNTA 1P4NA 2CIJA 4R6TA 4Z65A 1XJOA 3FEDA 4CYPA 4KOVA 5ELYA 2Q4ZA 1ARMA 1XBUA 2B4DA 2P0WA 1XMTA 2X7BA 1MJAA 2WPWA 3H5ZA 4PSXA 1IYLA 2O4HA 5EMIA 2I00A 1Z8XA 2HB6A 1M1DA 2BL1A 2OB0A 1CJWA 2XEJA 1CP6A 2Y0MA 2XEGA 3D8PA 3FRMA 3H8FA 4UA3A 4CPAA 5KTAA 2R98A 3R9GA 5ISVA 4JXQA 3WR7A 4X5KA 1KZFA 2JDDA 1ELLP 4KOWA 4B11A 4OAEA 1Q2CA 3DLJA 4JZ0A 5LRJA 4MBUA 3W6SA 2PQ8A 4A31A 3B3CA 2PJ8A 2Z10A 2IQ6A 1YVKA 1BOBA 1CX8A 4PPZA 3NE7A 2GREA 4K30A 2R8VA 2CTCA 1XIXA 5J8CA 3RO0A 4MXUA 2Z3NA 4PXCA 1Y7EA 4HNWB 1OBRA 4ZY1A 4EVYA 4XPDC 3D4UA 3TOAA 4AB7A 3DR6A 3S9LA 2DEAA 1PYTB 2GFQA 3PRTA 2ZW4A 2VEZA 2JBJA 2PJ4A 4IUSA 4C7IA 2ATRA 2VQYA 2BSWA 3EY5A 2C6CA 4CRZB 5K8PA 4A30A 4CYOA 1LOKA 2I79A 2CY2A 2D4PA 2HUZA 3ISXA 3CZXA 2YNEA 2POKA 4CRYB 1Q2YA 4KVXA 1XOVA 5HXDA 3DNSA 4H89A 4B6ZA 4B10A 1R3NA 1Z2LA 2WYRA 3HUVA 4CAVA 4UCNA 3ISZA 3KZWA 4CYQA 2CF4A 1DE4C 3KASA 1MK4A 3RZAA 1X12A 3R9FA 3S6HA 4EWTA 1S3ZA 3NH5A 2PJ3A 3I9SA 5HVHA 4FAIA 5LRKA 1R43A 4PSWA 4RI1A 5HMNA 2B58A 1GHEA 2J8RA 3I3GA 4ZX9A 3QB8A 5DWMA 2QVPA 3BXMA 1CBXA 2PE3A 2CNMA 2ZW7A 2CTBA 2FS5A 1YLOA 4DYOA 3KL9A 1FY7A 2ZELA 3KQZA 2VZZA 1SQHA 4TWEA 4KS9A 4OP4A 1S7NA 4H6ZA 4UIBA 3WT4A 3S6FA 1UFHA 2QYVA 3FBUA 4MCQA 4MHYA 3GUXA 3VATA 3G3SA 5LYDA 1YW6A 3BJ8A 1CM0A 3FIXA 4OC2A 2P6EA 2B5GB 2ANPA 1S7FA 2QIRA 1WK4A 3VARA 1LAMA 3K9UA 4IK2A 2FL4A 4XPLA 4OC3A 4QUSA 5G21A 3TTHA 4WJBA 4IAVA 4HNXB 3LWUA 3TO6A 2AFWA 1Z8TA 2ARHA 1ZG9A 2EBJA 2QJ8A 4ZI6A 1WWZA 4LQGA 4P4IA 5CPAA 5D29A 3W91A 3SXOA 1Z4RA 4R3KA 3R95A 2PRBA 2B3VA 4YGOA 3UY5A 3DR8A 4JXRA 2AFZA 5JPHA 1IY7A 5JM6A 2ZEHA 3D7HA 5AG7A 2Q04A 3B2YA 1YREA 4JD6A 3PB6X 4OC5A 4F9VA 3IEHA 1VHEA 2C1CA 1P0HA 4MJ8A 3FX6A 2KCWA 1S5KA 3H4QA 2FIAA 4KSAA 3K9TA 1Y7RA 4PQAA 5AG6A 4CGNA 5AGEA 4UEFA 3S6GA 4EFDA 3GB0A 2BEIA 4A95A 4CGPA 4ONUA 4GS4A 4OC4A 4II9A 2ODFA 1Y0RA 4NJQA 4KUAA 3IWEA 1IGBA 4JWPA 4LX9A 3CXPA 3VH9A 2VBQA 2XEIA 1ELMP 3IWWA 1B87A 4C7HA 2PJ7A 4AVCA 4MCRA 3B8GA 2PJCA 2GE3A 2FVGA 2RC4A 3IJ3A 3E0KA 2OH1A 1YMEA 4AG9A 4NGQA 1AYEA 4P4DA 2Q43A 2BO9A 2VZYA 4OMEA 1LANA 2YNCC 3IFEA 1Q2DA 1HDQA 3DDDA 4F0YA 3P2HA 1TKFA 1XFOA 5LYIA 3CPXA 1FNOA 3F0AA 3IWGA 1IOFA 2C6GA 2JBKA 3DSBA 1NSLA 4KZTA 3TCVA 2PVWA 3PB7X 1BPMA 4I49A 2ZEFA 2Q51A 2FT0A 4KORA 5AG5A 4B13A 3TC8A 5HVFA 2DXQA 1Y9KA 1BO4A 1M44A 3KR4A 1Z5RA 2AFOA 4KOTA 4JJXA 4A38A 4M6IA 3D3SA 4M6HA 5EC4A 1TKJA 1M4GA 3RBUA 2EWBA 4A32A 5LYFA 1IIDA 2PSWA 1RTQA 1YK3A 2Q0YA 4CAXA 1UWYA 2V8DA 4UWIA 1M4IA 4JLYA 1BLLE 2ZEEA 3T9YA 2ZEMA 3PGPA 4KOSA 2Q4VA 4RUHA 5HVGA 4UIAA 4G1PA 4R57A 3JTKA 4FD5A 3D68A 4FWUA 3SI0A 4KLVA 3OWCA 4A33A 3VWDA 2WPXA 3MRUA 4A2ZA 3H8GA 1LAPA 2ZENA 5A27A 1CPXA 5G20A 2OZHA 1F2PA 4C68A 2PDOA 2C6PA 2JDCA 1IICA 3GKRA 1BPNA 5DS0A 2Q4YA 1B6BA 1V0CA 4NGSA 4A37A 1YVOA 4X3RA 4GXHA 1XRYA 4R76A 2PC1A 2FIWA 3W6XA 1JQGA 5IB0A 3FJUA 4KSFA 1OZPA 1RO5A 4QVTA 4W9YA 4YWYA 5IX3A 2V77A 3PP9A 2AE6A 3QNVA 5GCNA 2Z3OA 4MMOA 3R96A 1KWMA 3V38A 3F5BA 2VI7A 5KTDA 4MCSA 3SI1A 2EO8A 3TE4A 4QB9A 4UF4A 4WWVA 5AG4A 3FYNA 2IMOA 3IIBA 4XNHB 3FH4A 3FXTA 2YNDA 3FEEA 2PJBA 3V7ZA 1PU9A 1ON0A 1CP7A 2BCOA 2PJ0A 1AUGA 4UEZA 3N5FA 4KSIA 3SHPA 2ZOGA 4ZYQA 4IHMA 2O53A 4OKOA 1QSRA 4ZGYB 1KUXA 3KHXA 2Z11A 3BLNA 4QBJA 2PRQA 1DTDA 5F48A 1TKHA 3FF3A 4KOYA 3BJ7A 5F09A 2Z3KA 4MFJA 1Z8WA 3I1UA 5F47A 1FT7A 3D7GA 2GIVA 2G0BA 3JVNA 3SJEA 3EC4A 4ORFA 2FXFA 5F46A 1YW4A 2GLJA 2PCUA 4FBEA 5IB9A 1Z9UA 2EK9A 2H5MA 4RS2A 1HEEA 1VIXA 2WZNA 3N7ZA 4Q7AA 4OC0A 3B7IA 3SJGA 3T8WA 1F57A 4BD9A 3BI0A 1J4JA 2REEA 1YQEA 4YFJA 4AVBA 4OC1A 2ZEGA 2Z3PA 2PJ5A 2D4OA 1IU8A 4XNHC 1BAVA 1ARLA 1I21A 2ZEPA 4XPKA 2O28A 2OU2A 2V8HA 3PB9X 3IO1A 4NGNA 4ONWA 5C88A 3CXQA 3KKWA 1TF8A 2F8HA 5D8NA 4B5PB 4B14A 4CAFA 3PB8X 4CGMA 4M85A 1S7LA 1TF9A 4L89A 6CPAA 3PBBA 4TNUA 4NF1A 4JYWA 2PJ9A 2GANA 4HPSA 2I3CA 2J8NA 4P6YA 2JEWA 3MGDA 3FVLA 1YSJA 4M6GA 3TX8A 4O23A 2ABZA 2ZEDA 1A2ZA 4R3LA 4Q38A 3ZZIA 1RXTA 2AFUA 2F7VA 4XPDB 1ZG7A 4FD6A 4BMHA 3B3TA 3RNZA 1MJ9A 1QQ9A 2AFSA 2J8MA 4MFPA 1NMTA 5EBVA 4NSQA 4U9YA 4X8IA 1XEBA 1YX0A 2CNSA 4UFVA 5HH1A 2DF5A 1K4JA 1TIQA 4MY0A 4F9UA 4MHPA 2CXAA 1ZLHA 3RYOA 4P44A 4F8ZA 2G9DA 2JEVA 4L8AA 5CNPA 3NA6A 5G1ZA 4MHZA 2OZGA 4HKFA 1M4DA 5J1QA 3B3WA 3LODA 1IYKA 4OIDA 3B3VA 4MHDA 3WABA 4MFQA 4OADA 4CAEA 3QAYA 2B5GA 2IJZA 1F2OA 1LRZA 3KI9A 5LRGA 1X10A 3FNCA 3SJFA 3S6KA 8CPAA 3C26A 3LACA 2R7HA 4H6UA 2V8GA 2IL4A 2PVVA 4DNCA 4A39A 3IC1A 1MJBA 3D2PA 4E0AA 4NGRA 2Q7SA 4BINA 4ZBGA 2B3UA 2PJ2A 1I12A 3D67A 3PEIA 4CAWA 1L0CA 3TO9A 1Z4EA 3PFOA 4R87A 3GLJA 1ZLIA 4QC6A 4B12A 4NGMA 4KLWA 2FE7A 3LMSA 3R9EA 4PXEA 1QSOA 2AJ6A 4F0XA 2G3TA 2BUEA 3FMCA 2QECA 4J3GA 2BOAA 4E8OA 4UBRA 2DPTA 1ZG8A 2Q7BA 2RB7A 5K8MA 3EO4A 3CDXA 3TT2A 4DJLA 3CPAA 3KHZA 4ZY2A 3VWEA 3NH4A 1Z8LA 4ZY0A 3S9MA 2NSMA 3HLPA 3NH8A 3RAMA 4PV6A 4AG7A 1R57A 4NFRA 2A4NA 3IU2A 3R1KA 4KUBA 2PIYA 4MFZA 1PUAA 2WSAA 4PXDA 4UCPA 2AFMA 5THWA 3SXNA 5H86A 4C2ZA 2ZEOA 1YR0A 2ZXVA 3GYAA 1S7KA 4A94A 4B5OA 1ZO0A 1KUVA 3EFAA 3LD2A 1VKCA 4X2TA 1NE9A 3P2FA 4MFLA 5DWNA 5FVJA 1Y9WA 3K2KA 3WC5A 4P4JA 1S60A 2YGWA 2WUUA 3PBEA 4OIWA 3GIUA 1QSMA 2Z0ZA 4PXBA 2PR8A 4F6AA 2YNCA 2REFA 4RN7A 4FD7A 3D7FA 4R9MA 1XF8A 3L2NA 4UFXA 1VHSA 5I4MA 2FSRA 5I0CA 3TOBA 5A28A 1QMUA 2HV2A 1NSAA 3BHXA 4H2KA 3KGQA 5IV0A 3MN8A 5H84A 4EMEA 3CXSA 2HQYA 2FCKA 4MFKA 2JLMA 2QMLA 3B35A 4DUKA 2ZW5A 3WC7A 2Z3LA 3TO7A 3CT9A 5K8NA 1JWQA 4MHNA 4KOXA 1YLEA 2OZUA 3NFZA 2B4DB 3QAHA 4P10A 3A9LA 4Y49C 2GU2A 7CPAA 2V8VA 2PIZA 4UCMA 4UFWA 4MI4A 2G3AA 1U6MA 2EVNA 1QSNA 1I1DA 2GLFA 4M3SA 2ZPAA 3DGVA 4FUUA 4LQ6A 4MCPA 5K8OA 5KTCA 2EK8A 3ZJ0A 3D7DA 4PK3A 1LFWA 2HC9A 2J9AA 3NE8A 1CG2A 4R8FA 2VL1A 3FB3A 3IGRA 5CBMA 1H8LA 1PCAA 4UEEA 1IB1E 4YU9A 2C27A 2PJ6A 1VGYA 5G22A 4P4BA 2Z3MA 3TFYA 3KQXA 4NXYA 1HDUA 5BWAB 3S9NA 3PFEA 5J8FA 4BBHA 4IF5A 5JH9A 2RFHA 2R1IA 3IU1A 3D2MA 4AVAA 1LCPA 3F8KA 4NJRA 3JRUA 2P6FA 1GYTA 2OOTA 3WC6A 3PZJA 4CGLA 4P45A 4YRHA 4C2XA 5JGFA 1VHOA 1YGHA 4LUAA 4KVOE 4PK2A 3V8IA 3PB4X 4NEXA 3D66A 4U9ZA 1QSTA 4FD4A 4E2AA 5LYLA 3FECA 4NCZA 2P6GA 4P4EA 4Y49B 2VXKA 4CS0B 2EUIA 4GM5A 4Q36A 5E96A 1Q7LA 3JUWA 4ZX8A 2PJ1A 2K5TA 5JQ4A 2ZW6A 2AFXA 2XEFA 2ZOFA 4KVME 1M4LA 4NGPA 3H8EA 4CYNA 5C82A 3SJXA 4AXVA 4KOUA 3EXNA
chains in the Genus database with same CATH topology
2DPSA 5F49A 2NMTA 3T90A 3GY9A 4UWJA 4U5YA 3G8WA 2Q44A 4HNYB 1N71A 4OLLA 4B5PA 2B4BA 2F5IA 1XE4A 4C2YA 2PR1A 4MY3A 4CGOA 1KUYA 2CNTA 1P4NA 4CYPA 4KOVA 2B4DA 2P0WA 1XMTA 2X7BA 1MJAA 2WPWA 3H5ZA 4PSXA 1IYLA 2I00A 1M1DA 2BL1A 2OB0A 1CJWA 5KTAA 2Y0MA 3D8PA 3FRMA 4UA3A 2R98A 3R9GA 5ISVA 4JXQA 3WR7A 4X5KA 1KZFA 2JDDA 4KOWA 4B11A 4OAEA 1Q2CA 4MBUA 3W6SA 2PQ8A 4A31A 2Z10A 1YVKA 1BOBA 3NE7A 4K30A 2R8VA 1XIXA 5J8CA 2Z3NA 4HNWB 4EVYA 4XPDC 3TOAA 4AB7A 3DR6A 2ZW4A 2VEZA 4IUSA 4C7IA 2ATRA 2VQYA 2BSWA 3EY5A 4CRZB 4A30A 4CYOA 2I79A 2CY2A 2D4PA 2HUZA 2YNEA 4CRYB 4KVXA 1Q2YA 3DNSA 4H89A 4CAVA 4B10A 4UCNA 4CYQA 1MK4A 3S6HA 3R9FA 1S3ZA 3I9SA 4PSWA 4RI1A 5HMNA 2B58A 1GHEA 2J8RA 3I3GA 3QB8A 5DWMA 2CNMA 2ZW7A 2FS5A 1FY7A 2VZZA 1SQHA 4KS9A 1S7NA 4H6ZA 3S6FA 1UFHA 3FBUA 3G3SA 3BJ8A 1CM0A 3FIXA 2QIRA 2B5GB 2P6EA 1S7FA 1WK4A 3K9UA 2FL4A 4XPLA 4QUSA 5G21A 3TTHA 4HNXB 3TO6A 2ARHA 1WWZA 3W91A 3SXOA 1Z4RA 4R3KA 3R95A 2PRBA 2B3VA 4YGOA 3UY5A 3DR8A 4JXRA 5JPHA 5AG7A 2Q04A 1YREA 4JD6A 1P0HA 4MJ8A 2KCWA 1S5KA 3H4QA 2FIAA 4KSAA 1Y7RA 5AG6A 4CGNA 5AGEA 3S6GA 2BEIA 4A95A 4CGPA 4ONUA 4GS4A 4II9A 4KUAA 3IWEA 4JWPA 4LX9A 3CXPA 2VBQA 4C7HA 1B87A 4AVCA 3B8GA 4AG9A 2GE3A 2RC4A 3E0KA 2OH1A 2VZYA 2YNCC 1Q2DA 3DDDA 3P2HA 3F0AA 3IWGA 3DSBA 1NSLA 4KZTA 3TCVA 4I49A 4KORA 2FT0A 5AG5A 4B13A 2DXQA 1Y9KA 1BO4A 1M44A 4KOTA 4JJXA 3D3SA 5EC4A 1M4GA 4A32A 1IIDA 2PSWA 1YK3A 2Q0YA 4CAXA 4UWIA 1M4IA 4JLYA 3T9YA 3PGPA 4KOSA 2Q4VA 4R57A 3JTKA 4FD5A 4KLVA 3OWCA 4A33A 3VWDA 2WPXA 4A2ZA 5A27A 5G20A 2OZHA 4C68A 2PDOA 2JDCA 1IICA 3GKRA 2Q4YA 1V0CA 1B6BA 1YVOA 2PC1A 2FIWA 3W6XA 5IB0A 4KSFA 1OZPA 1RO5A 4QVTA 5IX3A 3PP9A 2AE6A 5GCNA 2Z3OA 3R96A 3F5BA 2VI7A 5KTDA 3TE4A 4QB9A 5AG4A 3FYNA 4XNHB 3FXTA 2YNDA 1PU9A 1ON0A 3SHPA 1QSRA 4ZGYB 1KUXA 2Z11A 3BLNA 4QBJA 5F48A 4KOYA 3BJ7A 2Z3KA 4MFJA 5F47A 2GIVA 2G0BA 3JVNA 3EC4A 4ORFA 2FXFA 5F46A 1Z9UA 2H5MA 4RS2A 3N7ZA 1J4JA 2REEA 4YFJA 4AVBA 2Z3PA 2D4OA 4XNHC 1I21A 4XPKA 2O28A 2OU2A 5C88A 3CXQA 3KKWA 4B14A 4F0YA 4B5PB 4CAFA 4CGMA 4M85A 1S7LA 4L89A 4NF1A 2GANA 2J8NA 3MGDA 4R3LA 4Q38A 1RXTA 4XPDB 4FD6A 4BMHA 1MJ9A 2J8MA 4MFPA 1NMTA 5EBVA 4NSQA 4U9YA 1XEBA 1YX0A 2CNSA 4UFVA 5HH1A 4MY0A 1K4JA 1TIQA 2CXAA 3RYOA 2JEVA 4L8AA 5CNPA 5G1ZA 2OZGA 4HKFA 1M4DA 3LODA 1IYKA 4MHDA 4MFQA 4OADA 4CAEA 2B5GA 1LRZA 3FNCA 3S6KA 3C26A 2R7HA 4H6UA 2IL4A 4DNCA 1MJBA 3D2PA 4E0AA 4ZBGA 2B3UA 1I12A 4CAWA 1L0CA 3TO9A 1Z4EA 4R87A 4QC6A 4B12A 4KLWA 2FE7A 3R9EA 1QSOA 2AJ6A 4F0XA 2G3TA 2BUEA 4J3GA 2QECA 4E8OA 4UBRA 2DPTA 2Q7BA 3EO4A 3TT2A 3VWEA 4PV6A 4AG7A 1R57A 2A4NA 3IU2A 3R1KA 4KUBA 4MFZA 1PUAA 2WSAA 4UCPA 3SXNA 5H86A 4C2ZA 1YR0A 2ZXVA 3GYAA 1S7KA 4B5OA 1ZO0A 1KUVA 3EFAA 3LD2A 1VKCA 1NE9A 3P2FA 4MFLA 5DWNA 5FVJA 1Y9WA 1S60A 2YGWA 2WUUA 1QSMA 2Z0ZA 2PR8A 4F6AA 2YNCA 2REFA 4FD7A 4R9MA 1XF8A 4UFXA 1VHSA 2FSRA 5I0CA 3TOBA 5A28A 2HV2A 5IV0A 5H84A 3CXSA 2HQYA 2FCKA 4MFKA 2JLMA 2QMLA 2ZW5A 2Z3LA 3TO7A 4KOXA 1YLEA 2OZUA 2B4DB 3QAHA 3A9LA 4Y49C 4UCMA 4UFWA 4MI4A 2G3AA 1U6MA 2EVNA 1QSNA 1I1DA 4M3SA 2ZPAA 5KTCA 3ZJ0A 4PK3A 3FB3A 3IGRA 1IB1E 2C27A 5G22A 2Z3MA 3TFYA 4NXYA 5BWAB 5J8FA 4BBHA 4IF5A 2R1IA 3IU1A 3D2MA 4AVAA 3F8KA 2P6FA 3PZJA 4CGLA 4YRHA 4C2XA 1YGHA 4LUAA 4KVOE 4PK2A 3V8IA 4U9ZA 4NEXA 4E2AA 1QSTA 4FD4A 4NCZA 2P6GA 4Y49B 2VXKA 4CS0B 2EUIA 4Q36A 5E96A 3JUWA 2K5TA 5JQ4A 2ZW6A 4KVME 5C82A 4CYNA 3ZZIA 4KOUA 3EXNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F49 A;  2NMT A;  3T90 A;  3GY9 A;  4UWJ A;  4U5Y A;  3G8W A;  2Q44 A;  4HNY B;  1N71 A;  4OLL A;  4B5P A;  2B4B A;  2F5I A;  1XE4 A;  2PR1 A;  4MY3 A;  1KUY A;  2CNT A;  1P4N A;  4KOV A;  2B4D A;  2P0W A;  1XMT A;  2X7B A;  1MJA A;  2WPW A;  4PSX A;  1IYL A;  2I00 A;  1M1D A;  2BL1 A;  2OB0 A;  1CJW A;  5KTA A;  2Y0M A;  3D8P A;  4UA3 A;  3FRM A;  2R98 A;  3R9G A;  5ISV A;  4JXQ A;  3WR7 A;  4X5K A;  1KZF A;  2JDD A;  4KOW A;  4OAE A;  1Q2C A;  4MBU A;  3W6S A;  2PQ8 A;  2Z10 A;  1YVK A;  1BOB A;  3NE7 A;  4K30 A;  2R8V A;  1XIX A;  5J8C A;  4HNW B;  4EVY A;  4XPD C;  3TOA A;  4AB7 A;  3DR6 A;  2ZW4 A;  2VEZ A;  4IUS A;  4CRZ B;  2ATR A;  2VQY A;  2BSW A;  3EY5 A;  2I79 A;  2CY2 A;  2D4P A;  2HUZ A;  4CRY B;  4KVX A;  1Q2Y A;  3DNS A;  4H89 A;  4CAV A;  1MK4 A;  3S6H A;  3R9F A;  1S3Z A;  3I9S A;  4PSW A;  4RI1 A;  5HMN A;  2B58 A;  1GHE A;  2J8R A;  3I3G A;  3QB8 A;  5DWM A;  2CNM A;  2ZW7 A;  2FS5 A;  1FY7 A;  2VZZ A;  1SQH A;  1S7N A;  4H6Z A;  3S6F A;  1UFH A;  3FBU A;  3G3S A;  3BJ8 A;  1CM0 A;  3FIX A;  2QIR A;  2B5G B;  2P6E A;  1S7F A;  1WK4 A;  3K9U A;  2FL4 A;  4XPL A;  4QUS A;  3TTH A;  4HNX B;  3TO6 A;  2ARH A;  1WWZ A;  3W91 A;  3SXO A;  1Z4R A;  4R3K A;  3R95 A;  2PRB A;  2B3V A;  4YGO A;  3UY5 A;  3DR8 A;  4JXR A;  5JPH A;  2Q04 A;  1YRE A;  4JD6 A;  1P0H A;  4MJ8 A;  2KCW A;  1S5K A;  3H4Q A;  2FIA A;  1Y7R A;  3S6G A;  2BEI A;  4ONU A;  4GS4 A;  4II9 A;  4KUA A;  4JWP A;  4LX9 A;  3CXP A;  2VBQ A;  1B87 A;  4AVC A;  3B8G A;  4AG9 A;  2GE3 A;  2RC4 A;  3E0K A;  2OH1 A;  2VZY A;  1Q2D A;  3DDD A;  3P2H A;  3F0A A;  3IWG A;  3DSB A;  1NSL A;  4KZT A;  3TCV A;  4I49 A;  4KOR A;  2FT0 A;  2DXQ A;  1Y9K A;  1BO4 A;  1M44 A;  4KOT A;  4JJX A;  3D3S A;  5EC4 A;  1M4G A;  1IID A;  2PSW A;  1YK3 A;  2Q0Y A;  4CAX A;  4UWI A;  1M4I A;  4JLY A;  3T9Y A;  3PGP A;  4KOS A;  2Q4V A;  4R57 A;  4FD5 A;  4KLV A;  3OWC A;  3VWD A;  2WPX A;  2OZH A;  2PDO A;  2JDC A;  1IIC A;  3GKR A;  2Q4Y A;  1V0C A;  1B6B A;  1YVO A;  2PC1 A;  2FIW A;  3W6X A;  5IB0 A;  1OZP A;  4QVT A;  1RO5 A;  5IX3 A;  3PP9 A;  2AE6 A;  5GCN A;  3R96 A;  3F5B A;  2VI7 A;  5KTD A;  3TE4 A;  4QB9 A;  3FYN A;  4XNH B;  3FXT A;  1PU9 A;  1ON0 A;  3SHP A;  1QSR A;  1KUX A;  2Z11 A;  3BLN A;  4QBJ A;  5F48 A;  4KOY A;  3BJ7 A;  5F47 A;  2GIV A;  2G0B A;  3JVN A;  3EC4 A;  4ORF A;  2FXF A;  5F46 A;  1Z9U A;  2H5M A;  4RS2 A;  3N7Z A;  1J4J A;  2REE A;  4YFJ A;  4AVB A;  2D4O A;  4XNH C;  1I21 A;  4XPK A;  2O28 A;  2OU2 A;  5C88 A;  3CXQ A;  3KKW A;  4F0Y A;  4B5P B;  4M85 A;  1S7L A;  4L89 A;  4NF1 A;  2GAN A;  2J8N A;  3MGD A;  4R3L A;  1RXT A;  4XPD B;  4FD6 A;  4BMH A;  1MJ9 A;  2J8M A;  1NMT A;  5EBV A;  4NSQ A;  4U9Y A;  1XEB A;  1YX0 A;  2CNS A;  5HH1 A;  4MY0 A;  1K4J A;  1TIQ A;  3RYO A;  2JEV A;  4L8A A;  5CNP A;  2OZG A;  4HKF A;  1M4D A;  3LOD A;  1IYK A;  4MHD A;  4OAD A;  2B5G A;  1LRZ A;  3FNC A;  3S6K A;  3C26 A;  2R7H A;  4H6U A;  2IL4 A;  4DNC A;  1MJB A;  3D2P A;  4E0A A;  4ZBG A;  2B3U A;  1I12 A;  4CAW A;  1L0C A;  3TO9 A;  1Z4E A;  4R87 A;  4QC6 A;  4KLW A;  2FE7 A;  3R9E A;  1QSO A;  2AJ6 A;  2G3T A;  2BUE A;  4J3G A;  2QEC A;  4E8O A;  4UBR A;  2Q7B A;  3EO4 A;  3TT2 A;  3VWE A;  4PV6 A;  4AG7 A;  1R57 A;  2A4N A;  3R1K A;  4KUB A;  1PUA A;  3SXN A;  5H86 A;  1YR0 A;  2ZXV A;  3GYA A;  1S7K A;  4B5O A;  1KUV A;  3EFA A;  3LD2 A;  1VKC A;  1NE9 A;  3P2F A;  5DWN A;  5FVJ A;  1Y9W A;  1S60 A;  1QSM A;  2Z0Z A;  2PR8 A;  4F6A A;  2REF A;  4FD7 A;  4R9M A;  1XF8 A;  1VHS A;  2FSR A;  5I0C A;  3TOB A;  2HV2 A;  5IV0 A;  5H84 A;  3CXS A;  2HQY A;  2FCK A;  2JLM A;  2QML A;  2ZW5 A;  3TO7 A;  4KOX A;  1YLE A;  2OZU A;  2B4D B;  3QAH A;  4Y49 C;  4MI4 A;  2G3A A;  1U6M A;  2EVN A;  1QSN A;  1I1D A;  4M3S A;  2ZPA A;  5KTC A;  3ZJ0 A;  4PK3 A;  3FB3 A;  3IGR A;  1IB1 E;  2C27 A;  3TFY A;  4NXY A;  5J8F A;  4IF5 A;  2R1I A;  3D2M A;  4AVA A;  3F8K A;  2P6F A;  3PZJ A;  4YRH A;  1YGH A;  4LUA A;  4KVO E;  4PK2 A;  3V8I A;  4U9Z A;  4NEX A;  4E2A A;  1QST A;  4FD4 A;  4NCZ A;  2P6G A;  4Y49 B;  2VXK A;  4CS0 B;  2EUI A;  5E96 A;  3JUW A;  2K5T A;  5JQ4 A;  2ZW6 A;  4KVM E;  5C82 A;  3ZZI A;  4KOU A;  3EXN A; 
#chains in the Genus database with same CATH topology
 2DPS A;  4R7M A;  5F49 A;  2NMT A;  4NGT A;  3T90 A;  3GY9 A;  4UWJ A;  4U5Y A;  1EE3 P;  1IOI A;  3B3S A;  3KR5 A;  3G8W A;  2Q44 A;  4HNY B;  1Y0Y A;  1N71 A;  4OLL A;  1CPS A;  2PJA A;  2OR4 A;  3BI1 A;  2NYQ A;  4K3N A;  4B5P A;  2B4B A;  2F5I A;  1XMB A;  3SI2 A;  1XE4 A;  4MRI A;  4C2Y A;  2PR1 A;  4MY3 A;  1TXR A;  4P4F A;  4CGO A;  1AMP A;  1KUY A;  2CNT A;  1P4N A;  2CIJ A;  4R6T A;  4Z65 A;  1XJO A;  3FED A;  4CYP A;  4KOV A;  5ELY A;  2Q4Z A;  1ARM A;  1XBU A;  2B4D A;  2P0W A;  1XMT A;  2X7B A;  1MJA A;  2WPW A;  3H5Z A;  4PSX A;  1IYL A;  2O4H A;  5EMI A;  2I00 A;  1Z8X A;  2HB6 A;  1M1D A;  2BL1 A;  2OB0 A;  1CJW A;  2XEJ A;  1CP6 A;  2Y0M A;  2XEG A;  3D8P A;  3FRM A;  3H8F A;  4UA3 A;  4CPA A;  5KTA A;  2R98 A;  3R9G A;  5ISV A;  4JXQ A;  3WR7 A;  4X5K A;  1KZF A;  2JDD A;  1ELL P;  4KOW A;  4B11 A;  4OAE A;  1Q2C A;  3DLJ A;  4JZ0 A;  5LRJ A;  4MBU A;  3W6S A;  2PQ8 A;  4A31 A;  3B3C A;  2PJ8 A;  2Z10 A;  2IQ6 A;  1YVK A;  1BOB A;  1CX8 A;  4PPZ A;  3NE7 A;  2GRE A;  4K30 A;  2R8V A;  2CTC A;  1XIX A;  5J8C A;  3RO0 A;  4MXU A;  2Z3N A;  4PXC A;  1Y7E A;  4HNW B;  1OBR A;  4ZY1 A;  4EVY A;  4XPD C;  3D4U A;  3TOA A;  4AB7 A;  3DR6 A;  3S9L A;  2DEA A;  1PYT B;  2GFQ A;  3PRT A;  2ZW4 A;  2VEZ A;  2JBJ A;  2PJ4 A;  4IUS A;  4C7I A;  2ATR A;  2VQY A;  2BSW A;  3EY5 A;  2C6C A;  4CRZ B;  5K8P A;  4A30 A;  4CYO A;  1LOK A;  2I79 A;  2CY2 A;  2D4P A;  2HUZ A;  3ISX A;  3CZX A;  2YNE A;  2POK A;  4CRY B;  1Q2Y A;  4KVX A;  1XOV A;  5HXD A;  3DNS A;  4H89 A;  4B6Z A;  4B10 A;  1R3N A;  1Z2L A;  2WYR A;  3HUV A;  4CAV A;  4UCN A;  3ISZ A;  3KZW A;  4CYQ A;  2CF4 A;  1DE4 C;  3KAS A;  1MK4 A;  3RZA A;  1X12 A;  3R9F A;  3S6H A;  4EWT A;  1S3Z A;  3NH5 A;  2PJ3 A;  3I9S A;  5HVH A;  4FAI A;  5LRK A;  1R43 A;  4PSW A;  4RI1 A;  5HMN A;  2B58 A;  1GHE A;  2J8R A;  3I3G A;  4ZX9 A;  3QB8 A;  5DWM A;  2QVP A;  3BXM A;  1CBX A;  2PE3 A;  2CNM A;  2ZW7 A;  2CTB A;  2FS5 A;  1YLO A;  4DYO A;  3KL9 A;  1FY7 A;  2ZEL A;  3KQZ A;  2VZZ A;  1SQH A;  4TWE A;  4KS9 A;  4OP4 A;  1S7N A;  4H6Z A;  4UIB A;  3WT4 A;  3S6F A;  1UFH A;  2QYV A;  3FBU A;  4MCQ A;  4MHY A;  3GUX A;  3VAT A;  3G3S A;  5LYD A;  1YW6 A;  3BJ8 A;  1CM0 A;  3FIX A;  4OC2 A;  2P6E A;  2B5G B;  2ANP A;  1S7F A;  2QIR A;  1WK4 A;  3VAR A;  1LAM A;  3K9U A;  4IK2 A;  2FL4 A;  4XPL A;  4OC3 A;  4QUS A;  5G21 A;  3TTH A;  4WJB A;  4IAV A;  4HNX B;  3LWU A;  3TO6 A;  2AFW A;  1Z8T A;  2ARH A;  1ZG9 A;  2EBJ A;  2QJ8 A;  4ZI6 A;  1WWZ A;  4LQG A;  4P4I A;  5CPA A;  5D29 A;  3W91 A;  3SXO A;  1Z4R A;  4R3K A;  3R95 A;  2PRB A;  2B3V A;  4YGO A;  3UY5 A;  3DR8 A;  4JXR A;  2AFZ A;  5JPH A;  1IY7 A;  5JM6 A;  2ZEH A;  3D7H A;  5AG7 A;  2Q04 A;  3B2Y A;  1YRE A;  4JD6 A;  3PB6 X;  4OC5 A;  4F9V A;  3IEH A;  1VHE A;  2C1C A;  1P0H A;  4MJ8 A;  3FX6 A;  2KCW A;  1S5K A;  3H4Q A;  2FIA A;  4KSA A;  3K9T A;  1Y7R A;  4PQA A;  5AG6 A;  4CGN A;  5AGE A;  4UEF A;  3S6G A;  4EFD A;  3GB0 A;  2BEI A;  4A95 A;  4CGP A;  4ONU A;  4GS4 A;  4OC4 A;  4II9 A;  2ODF A;  1Y0R A;  4NJQ A;  4KUA A;  3IWE A;  1IGB A;  4JWP A;  4LX9 A;  3CXP A;  3VH9 A;  2VBQ A;  2XEI A;  1ELM P;  3IWW A;  1B87 A;  4C7H A;  2PJ7 A;  4AVC A;  4MCR A;  3B8G A;  2PJC A;  2GE3 A;  2FVG A;  2RC4 A;  3IJ3 A;  3E0K A;  2OH1 A;  1YME A;  4AG9 A;  4NGQ A;  1AYE A;  4P4D A;  2Q43 A;  2BO9 A;  2VZY A;  4OME A;  1LAN A;  2YNC C;  3IFE A;  1Q2D A;  1HDQ A;  3DDD A;  4F0Y A;  3P2H A;  1TKF A;  1XFO A;  5LYI A;  3CPX A;  1FNO A;  3F0A A;  3IWG A;  1IOF A;  2C6G A;  2JBK A;  3DSB A;  1NSL A;  4KZT A;  3TCV A;  2PVW A;  3PB7 X;  1BPM A;  4I49 A;  2ZEF A;  2Q51 A;  2FT0 A;  4KOR A;  5AG5 A;  4B13 A;  3TC8 A;  5HVF A;  2DXQ A;  1Y9K A;  1BO4 A;  1M44 A;  3KR4 A;  1Z5R A;  2AFO A;  4KOT A;  4JJX A;  4A38 A;  4M6I A;  3D3S A;  4M6H A;  5EC4 A;  1TKJ A;  1M4G A;  3RBU A;  2EWB A;  4A32 A;  5LYF A;  1IID A;  2PSW A;  1RTQ A;  1YK3 A;  2Q0Y A;  4CAX A;  1UWY A;  2V8D A;  4UWI A;  1M4I A;  4JLY A;  1BLL E;  2ZEE A;  3T9Y A;  2ZEM A;  3PGP A;  4KOS A;  2Q4V A;  4RUH A;  5HVG A;  4UIA A;  4G1P A;  4R57 A;  3JTK A;  4FD5 A;  3D68 A;  4FWU A;  3SI0 A;  4KLV A;  3OWC A;  4A33 A;  3VWD A;  2WPX A;  3MRU A;  4A2Z A;  3H8G A;  1LAP A;  2ZEN A;  5A27 A;  1CPX A;  5G20 A;  2OZH A;  1F2P A;  4C68 A;  2PDO A;  2C6P A;  2JDC A;  1IIC A;  3GKR A;  1BPN A;  5DS0 A;  2Q4Y A;  1B6B A;  1V0C A;  4NGS A;  4A37 A;  1YVO A;  4X3R A;  4GXH A;  1XRY A;  4R76 A;  2PC1 A;  2FIW A;  3W6X A;  1JQG A;  5IB0 A;  3FJU A;  4KSF A;  1OZP A;  1RO5 A;  4QVT A;  4W9Y A;  4YWY A;  5IX3 A;  2V77 A;  3PP9 A;  2AE6 A;  3QNV A;  5GCN A;  2Z3O A;  4MMO A;  3R96 A;  1KWM A;  3V38 A;  3F5B A;  2VI7 A;  5KTD A;  4MCS A;  3SI1 A;  2EO8 A;  3TE4 A;  4QB9 A;  4UF4 A;  4WWV A;  5AG4 A;  3FYN A;  2IMO A;  3IIB A;  4XNH B;  3FH4 A;  3FXT A;  2YND A;  3FEE A;  2PJB A;  3V7Z A;  1PU9 A;  1ON0 A;  1CP7 A;  2BCO A;  2PJ0 A;  1AUG A;  4UEZ A;  3N5F A;  4KSI A;  3SHP A;  2ZOG A;  4ZYQ A;  4IHM A;  2O53 A;  4OKO A;  1QSR A;  4ZGY B;  1KUX A;  3KHX A;  2Z11 A;  3BLN A;  4QBJ A;  2PRQ A;  1DTD A;  5F48 A;  1TKH A;  3FF3 A;  4KOY A;  3BJ7 A;  5F09 A;  2Z3K A;  4MFJ A;  1Z8W A;  3I1U A;  5F47 A;  1FT7 A;  3D7G A;  2GIV A;  2G0B A;  3JVN A;  3SJE A;  3EC4 A;  4ORF A;  2FXF A;  5F46 A;  1YW4 A;  2GLJ A;  2PCU A;  4FBE A;  5IB9 A;  1Z9U A;  2EK9 A;  2H5M A;  4RS2 A;  1HEE A;  1VIX A;  2WZN A;  3N7Z A;  4Q7A A;  4OC0 A;  3B7I A;  3SJG A;  3T8W A;  1F57 A;  4BD9 A;  3BI0 A;  1J4J A;  2REE A;  1YQE A;  4YFJ A;  4AVB A;  4OC1 A;  2ZEG A;  2Z3P A;  2PJ5 A;  2D4O A;  1IU8 A;  4XNH C;  1BAV A;  1ARL A;  1I21 A;  2ZEP A;  4XPK A;  2O28 A;  2OU2 A;  2V8H A;  3PB9 X;  3IO1 A;  4NGN A;  4ONW A;  5C88 A;  3CXQ A;  3KKW A;  1TF8 A;  2F8H A;  5D8N A;  4B5P B;  4B14 A;  4CAF A;  3PB8 X;  4CGM A;  4M85 A;  1S7L A;  1TF9 A;  4L89 A;  6CPA A;  3PBB A;  4TNU A;  4NF1 A;  4JYW A;  2PJ9 A;  2GAN A;  4HPS A;  2I3C A;  2J8N A;  4P6Y A;  2JEW A;  3MGD A;  3FVL A;  1YSJ A;  4M6G A;  3TX8 A;  4O23 A;  2ABZ A;  2ZED A;  1A2Z A;  4R3L A;  4Q38 A;  3ZZI A;  1RXT A;  2AFU A;  2F7V A;  4XPD B;  1ZG7 A;  4FD6 A;  4BMH A;  3B3T A;  3RNZ A;  1MJ9 A;  1QQ9 A;  2AFS A;  2J8M A;  4MFP A;  1NMT A;  5EBV A;  4NSQ A;  4U9Y A;  4X8I A;  1XEB A;  1YX0 A;  2CNS A;  4UFV A;  5HH1 A;  2DF5 A;  1K4J A;  1TIQ A;  4MY0 A;  4F9U A;  4MHP A;  2CXA A;  1ZLH A;  3RYO A;  4P44 A;  4F8Z A;  2G9D A;  2JEV A;  4L8A A;  5CNP A;  3NA6 A;  5G1Z A;  4MHZ A;  2OZG A;  4HKF A;  1M4D A;  5J1Q A;  3B3W A;  3LOD A;  1IYK A;  4OID A;  3B3V A;  4MHD A;  3WAB A;  4MFQ A;  4OAD A;  4CAE A;  3QAY A;  2B5G A;  2IJZ A;  1F2O A;  1LRZ A;  3KI9 A;  5LRG A;  1X10 A;  3FNC A;  3SJF A;  3S6K A;  8CPA A;  3C26 A;  3LAC A;  2R7H A;  4H6U A;  2V8G A;  2IL4 A;  2PVV A;  4DNC A;  4A39 A;  3IC1 A;  1MJB A;  3D2P A;  4E0A A;  4NGR A;  2Q7S A;  4BIN A;  4ZBG A;  2B3U A;  2PJ2 A;  1I12 A;  3D67 A;  3PEI A;  4CAW A;  1L0C A;  3TO9 A;  1Z4E A;  3PFO A;  4R87 A;  3GLJ A;  1ZLI A;  4QC6 A;  4B12 A;  4NGM A;  4KLW A;  2FE7 A;  3LMS A;  3R9E A;  4PXE A;  1QSO A;  2AJ6 A;  4F0X A;  2G3T A;  2BUE A;  3FMC A;  2QEC A;  4J3G A;  2BOA A;  4E8O A;  4UBR A;  2DPT A;  1ZG8 A;  2Q7B A;  2RB7 A;  5K8M A;  3EO4 A;  3CDX A;  3TT2 A;  4DJL A;  3CPA A;  3KHZ A;  4ZY2 A;  3VWE A;  3NH4 A;  1Z8L A;  4ZY0 A;  3S9M A;  2NSM A;  3HLP A;  3NH8 A;  3RAM A;  4PV6 A;  4AG7 A;  1R57 A;  4NFR A;  2A4N A;  3IU2 A;  3R1K A;  4KUB A;  2PIY A;  4MFZ A;  1PUA A;  2WSA A;  4PXD A;  4UCP A;  2AFM A;  5THW A;  3SXN A;  5H86 A;  4C2Z A;  2ZEO A;  1YR0 A;  2ZXV A;  3GYA A;  1S7K A;  4A94 A;  4B5O A;  1ZO0 A;  1KUV A;  3EFA A;  3LD2 A;  1VKC A;  4X2T A;  1NE9 A;  3P2F A;  4MFL A;  5DWN A;  5FVJ A;  1Y9W A;  3K2K A;  3WC5 A;  4P4J A;  1S60 A;  2YGW A;  2WUU A;  3PBE A;  4OIW A;  3GIU A;  1QSM A;  2Z0Z A;  4PXB A;  2PR8 A;  4F6A A;  2YNC A;  2REF A;  4RN7 A;  4FD7 A;  3D7F A;  4R9M A;  1XF8 A;  3L2N A;  4UFX A;  1VHS A;  5I4M A;  2FSR A;  5I0C A;  3TOB A;  5A28 A;  1QMU A;  2HV2 A;  1NSA A;  3BHX A;  4H2K A;  3KGQ A;  5IV0 A;  3MN8 A;  5H84 A;  4EME A;  3CXS A;  2HQY A;  2FCK A;  4MFK A;  2JLM A;  2QML A;  3B35 A;  4DUK A;  2ZW5 A;  3WC7 A;  2Z3L A;  3TO7 A;  3CT9 A;  5K8N A;  1JWQ A;  4MHN A;  4KOX A;  1YLE A;  2OZU A;  3NFZ A;  2B4D B;  3QAH A;  4P10 A;  3A9L A;  4Y49 C;  2GU2 A;  7CPA A;  2V8V A;  2PIZ A;  4UCM A;  4UFW A;  4MI4 A;  2G3A A;  1U6M A;  2EVN A;  1QSN A;  1I1D A;  2GLF A;  4M3S A;  2ZPA A;  3DGV A;  4FUU A;  4LQ6 A;  4MCP A;  5K8O A;  5KTC A;  2EK8 A;  3ZJ0 A;  3D7D A;  4PK3 A;  1LFW A;  2HC9 A;  2J9A A;  3NE8 A;  1CG2 A;  4R8F A;  2VL1 A;  3FB3 A;  3IGR A;  5CBM A;  1H8L A;  1PCA A;  4UEE A;  1IB1 E;  4YU9 A;  2C27 A;  2PJ6 A;  1VGY A;  5G22 A;  4P4B A;  2Z3M A;  3TFY A;  3KQX A;  4NXY A;  1HDU A;  5BWA B;  3S9N A;  3PFE A;  5J8F A;  4BBH A;  4IF5 A;  5JH9 A;  2RFH A;  2R1I A;  3IU1 A;  3D2M A;  4AVA A;  1LCP A;  3F8K A;  4NJR A;  3JRU A;  2P6F A;  1GYT A;  2OOT A;  3WC6 A;  3PZJ A;  4CGL A;  4P45 A;  4YRH A;  4C2X A;  5JGF A;  1VHO A;  1YGH A;  4LUA A;  4KVO E;  4PK2 A;  3V8I A;  3PB4 X;  4NEX A;  3D66 A;  4U9Z A;  1QST A;  4FD4 A;  4E2A A;  5LYL A;  3FEC A;  4NCZ A;  2P6G A;  4P4E A;  4Y49 B;  2VXK A;  4CS0 B;  2EUI A;  4GM5 A;  4Q36 A;  5E96 A;  1Q7L A;  3JUW A;  4ZX8 A;  2PJ1 A;  2K5T A;  5JQ4 A;  2ZW6 A;  2AFX A;  2XEF A;  2ZOF A;  4KVM E;  1M4L A;  4NGP A;  3H8E A;  4CYN A;  5C82 A;  3SJX A;  4AXV A;  4KOU A;  3EXN A; 
#chains in the Genus database with same CATH homology
 2DPS A;  5F49 A;  2NMT A;  3T90 A;  3GY9 A;  4UWJ A;  4U5Y A;  3G8W A;  2Q44 A;  4HNY B;  1N71 A;  4OLL A;  4B5P A;  2B4B A;  2F5I A;  1XE4 A;  4C2Y A;  2PR1 A;  4MY3 A;  4CGO A;  1KUY A;  2CNT A;  1P4N A;  4CYP A;  4KOV A;  2B4D A;  2P0W A;  1XMT A;  2X7B A;  1MJA A;  2WPW A;  3H5Z A;  4PSX A;  1IYL A;  2I00 A;  1M1D A;  2BL1 A;  2OB0 A;  1CJW A;  5KTA A;  2Y0M A;  3D8P A;  3FRM A;  4UA3 A;  2R98 A;  3R9G A;  5ISV A;  4JXQ A;  3WR7 A;  4X5K A;  1KZF A;  2JDD A;  4KOW A;  4B11 A;  4OAE A;  1Q2C A;  4MBU A;  3W6S A;  2PQ8 A;  4A31 A;  2Z10 A;  1YVK A;  1BOB A;  3NE7 A;  4K30 A;  2R8V A;  1XIX A;  5J8C A;  2Z3N A;  4HNW B;  4EVY A;  4XPD C;  3TOA A;  4AB7 A;  3DR6 A;  2ZW4 A;  2VEZ A;  4IUS A;  4C7I A;  2ATR A;  2VQY A;  2BSW A;  3EY5 A;  4CRZ B;  4A30 A;  4CYO A;  2I79 A;  2CY2 A;  2D4P A;  2HUZ A;  2YNE A;  4CRY B;  4KVX A;  1Q2Y A;  3DNS A;  4H89 A;  4CAV A;  4B10 A;  4UCN A;  4CYQ A;  1MK4 A;  3S6H A;  3R9F A;  1S3Z A;  3I9S A;  4PSW A;  4RI1 A;  5HMN A;  2B58 A;  1GHE A;  2J8R A;  3I3G A;  3QB8 A;  5DWM A;  2CNM A;  2ZW7 A;  2FS5 A;  1FY7 A;  2VZZ A;  1SQH A;  4KS9 A;  1S7N A;  4H6Z A;  3S6F A;  1UFH A;  3FBU A;  3G3S A;  3BJ8 A;  1CM0 A;  3FIX A;  2QIR A;  2B5G B;  2P6E A;  1S7F A;  1WK4 A;  3K9U A;  2FL4 A;  4XPL A;  4QUS A;  5G21 A;  3TTH A;  4HNX B;  3TO6 A;  2ARH A;  1WWZ A;  3W91 A;  3SXO A;  1Z4R A;  4R3K A;  3R95 A;  2PRB A;  2B3V A;  4YGO A;  3UY5 A;  3DR8 A;  4JXR A;  5JPH A;  5AG7 A;  2Q04 A;  1YRE A;  4JD6 A;  1P0H A;  4MJ8 A;  2KCW A;  1S5K A;  3H4Q A;  2FIA A;  4KSA A;  1Y7R A;  5AG6 A;  4CGN A;  5AGE A;  3S6G A;  2BEI A;  4A95 A;  4CGP A;  4ONU A;  4GS4 A;  4II9 A;  4KUA A;  3IWE A;  4JWP A;  4LX9 A;  3CXP A;  2VBQ A;  4C7H A;  1B87 A;  4AVC A;  3B8G A;  4AG9 A;  2GE3 A;  2RC4 A;  3E0K A;  2OH1 A;  2VZY A;  2YNC C;  1Q2D A;  3DDD A;  3P2H A;  3F0A A;  3IWG A;  3DSB A;  1NSL A;  4KZT A;  3TCV A;  4I49 A;  4KOR A;  2FT0 A;  5AG5 A;  4B13 A;  2DXQ A;  1Y9K A;  1BO4 A;  1M44 A;  4KOT A;  4JJX A;  3D3S A;  5EC4 A;  1M4G A;  4A32 A;  1IID A;  2PSW A;  1YK3 A;  2Q0Y A;  4CAX A;  4UWI A;  1M4I A;  4JLY A;  3T9Y A;  3PGP A;  4KOS A;  2Q4V A;  4R57 A;  3JTK A;  4FD5 A;  4KLV A;  3OWC A;  4A33 A;  3VWD A;  2WPX A;  4A2Z A;  5A27 A;  5G20 A;  2OZH A;  4C68 A;  2PDO A;  2JDC A;  1IIC A;  3GKR A;  2Q4Y A;  1V0C A;  1B6B A;  1YVO A;  2PC1 A;  2FIW A;  3W6X A;  5IB0 A;  4KSF A;  1OZP A;  1RO5 A;  4QVT A;  5IX3 A;  3PP9 A;  2AE6 A;  5GCN A;  2Z3O A;  3R96 A;  3F5B A;  2VI7 A;  5KTD A;  3TE4 A;  4QB9 A;  5AG4 A;  3FYN A;  4XNH B;  3FXT A;  2YND A;  1PU9 A;  1ON0 A;  3SHP A;  1QSR A;  4ZGY B;  1KUX A;  2Z11 A;  3BLN A;  4QBJ A;  5F48 A;  4KOY A;  3BJ7 A;  2Z3K A;  4MFJ A;  5F47 A;  2GIV A;  2G0B A;  3JVN A;  3EC4 A;  4ORF A;  2FXF A;  5F46 A;  1Z9U A;  2H5M A;  4RS2 A;  3N7Z A;  1J4J A;  2REE A;  4YFJ A;  4AVB A;  2Z3P A;  2D4O A;  4XNH C;  1I21 A;  4XPK A;  2O28 A;  2OU2 A;  5C88 A;  3CXQ A;  3KKW A;  4B14 A;  4F0Y A;  4B5P B;  4CAF A;  4CGM A;  4M85 A;  1S7L A;  4L89 A;  4NF1 A;  2GAN A;  2J8N A;  3MGD A;  4R3L A;  4Q38 A;  1RXT A;  4XPD B;  4FD6 A;  4BMH A;  1MJ9 A;  2J8M A;  4MFP A;  1NMT A;  5EBV A;  4NSQ A;  4U9Y A;  1XEB A;  1YX0 A;  2CNS A;  4UFV A;  5HH1 A;  4MY0 A;  1K4J A;  1TIQ A;  2CXA A;  3RYO A;  2JEV A;  4L8A A;  5CNP A;  5G1Z A;  2OZG A;  4HKF A;  1M4D A;  3LOD A;  1IYK A;  4MHD A;  4MFQ A;  4OAD A;  4CAE A;  2B5G A;  1LRZ A;  3FNC A;  3S6K A;  3C26 A;  2R7H A;  4H6U A;  2IL4 A;  4DNC A;  1MJB A;  3D2P A;  4E0A A;  4ZBG A;  2B3U A;  1I12 A;  4CAW A;  1L0C A;  3TO9 A;  1Z4E A;  4R87 A;  4QC6 A;  4B12 A;  4KLW A;  2FE7 A;  3R9E A;  1QSO A;  2AJ6 A;  4F0X A;  2G3T A;  2BUE A;  4J3G A;  2QEC A;  4E8O A;  4UBR A;  2DPT A;  2Q7B A;  3EO4 A;  3TT2 A;  3VWE A;  4PV6 A;  4AG7 A;  1R57 A;  2A4N A;  3IU2 A;  3R1K A;  4KUB A;  4MFZ A;  1PUA A;  2WSA A;  4UCP A;  3SXN A;  5H86 A;  4C2Z A;  1YR0 A;  2ZXV A;  3GYA A;  1S7K A;  4B5O A;  1ZO0 A;  1KUV A;  3EFA A;  3LD2 A;  1VKC A;  1NE9 A;  3P2F A;  4MFL A;  5DWN A;  5FVJ A;  1Y9W A;  1S60 A;  2YGW A;  2WUU A;  1QSM A;  2Z0Z A;  2PR8 A;  4F6A A;  2YNC A;  2REF A;  4FD7 A;  4R9M A;  1XF8 A;  4UFX A;  1VHS A;  2FSR A;  5I0C A;  3TOB A;  5A28 A;  2HV2 A;  5IV0 A;  5H84 A;  3CXS A;  2HQY A;  2FCK A;  4MFK A;  2JLM A;  2QML A;  2ZW5 A;  2Z3L A;  3TO7 A;  4KOX A;  1YLE A;  2OZU A;  2B4D B;  3QAH A;  3A9L A;  4Y49 C;  4UCM A;  4UFW A;  4MI4 A;  2G3A A;  1U6M A;  2EVN A;  1QSN A;  1I1D A;  4M3S A;  2ZPA A;  5KTC A;  3ZJ0 A;  4PK3 A;  3FB3 A;  3IGR A;  1IB1 E;  2C27 A;  5G22 A;  2Z3M A;  3TFY A;  4NXY A;  5BWA B;  5J8F A;  4BBH A;  4IF5 A;  2R1I A;  3IU1 A;  3D2M A;  4AVA A;  3F8K A;  2P6F A;  3PZJ A;  4CGL A;  4YRH A;  4C2X A;  1YGH A;  4LUA A;  4KVO E;  4PK2 A;  3V8I A;  4U9Z A;  4NEX A;  4E2A A;  1QST A;  4FD4 A;  4NCZ A;  2P6G A;  4Y49 B;  2VXK A;  4CS0 B;  2EUI A;  4Q36 A;  5E96 A;  3JUW A;  2K5T A;  5JQ4 A;  2ZW6 A;  4KVM E;  5C82 A;  4CYN A;  3ZZI A;  4KOU A;  3EXN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...