3KKWA

Crystal structure of his-tagged form of pa4794 protein
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
178
structure length
166
Chain Sequence
b'SHHHHHHMQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Crystal structure of His-tagged form of PA4794 protein
rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Transferase
total genus 43
structure length 166
sequence length 178
ec nomenclature
pdb deposition date 2009-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3kkwA01
1PU9A 3F5BA 1OZPA 3FBUA 4KZTA 2VXKA 4YGOA 2B3UA 4I49A 2CNMA 4IUSA 3B8GA 3GY9A 4JWPA 5JQ4A 2R8VA 4PSXA 4CAWA 2FS5A 2FIAA 4NCZA 4XNHC 4AG9A 2PR8A 2P6FA 4YFJA 3WR7A 2FCKA 1MK4A 1M4IA 2I00A 2PC1A 3QAHA 4R9MA 2VZZA 3G3SA 4UA3A 4HNWB 2FXFA 2Z11A 2ZW4A 1YVOA 2JDDA 3BJ7A 4CAVA 1IICA 1I12A 4B5PA 3DR6A 3SXNA 1YK3A 3F8KA 2DXQA 2ZW5A 2JEVA 5GCNA 3S6KA 1YX0A 3TT2A 3FNCA 2REEA 2P0WA 5DWMA 1IB1E 2B58A 2Y0MA 4H6UA 2QECA 2EVNA 1S7NA 4R87A 1R57A 3R95A 1RXTA 1S7FA 1XF8A 4ORFA 4KLVA 4IF5A 3BJ8A 5CNPA 3TO6A 1SQHA 3QB8A 3UY5A 1YREA 4JXQA 4CRYB 4K30A 1J4JA 4R3KA 1Y7RA 4PSWA 4RI1A 1YR0A 2QIRA 3IWGA 3R9GA 3EY5A 3FRMA 4QB9A 4HNYB 4KOXA 1CM0A 4H6ZA 1V0CA 3KKWA 4B5PB 1IYKA 3DSBA 2P6GA 3K9UA 4HKFA 1IYLA 4KVOE 3C26A 3W91A 4KOYA 4L89A 3VWEA 2QMLA 3I3GA 3MGDA 3P2FA 3TE4A 1I1DA 3EO4A 1NE9A 4OLLA 4ZBGA 3R9EA 2Q4YA 3I9SA 2Q4VA 1NMTA 1B87A 2VI7A 1YVKA 2VZYA 4Y49C 1Q2CA 3PP9A 2VEZA 4B5OA 4KOUA 2Q04A 4XPKA 4KUBA 5ISVA 4AVCA 2Z0ZA 2Z10A 4JXRA 2G3TA 3P2HA 2BEIA 2PSWA 3TOBA 3IGRA 2FT0A 1VKCA 5KTCA 2CNTA 4R57A 3RYOA 2ARHA 3PZJA 1WK4A 3E0KA 4LUAA 4E8OA 4OAEA 3D8PA 2B4DB 3G8WA 4MI4A 3EXNA 3FB3A 4CRZB 2B5GB 5HMNA 4M85A 4EVYA 2JLMA 3LODA 2CNSA 2B3VA 2B4BA 3D2MA 1KUXA 4RS2A 4AB7A 3N7ZA 2J8RA 1YGHA 3W6SA 2J8MA 2FIWA 2OZUA 3TOAA 2GIVA 4ONUA 1Q2YA 1Z4EA 4QC6A 2GE3A 4YRHA 3DNSA 4KOVA 4X5KA 2G0BA 4NF1A 1IIDA 1KUVA 3R1KA 1KUYA 3SHPA 1S7LA 4JJXA 3VWDA 2VQYA 1MJAA 5C88A 4AVAA 1P4NA 1XMTA 1RO5A 5IB0A 3R96A 2FL4A 3NE7A 2Q44A 4CS0B 3TTHA 1XE4A 1U6MA 4Y49B 3D2PA 4AVBA 3T9YA 1WWZA 1Z4RA 1L0CA 3EC4A 2BSWA 1Y9KA 2HQYA 1K4JA 2G3AA 1BOBA 1Y9WA 1LRZA 1QSTA 2NMTA 4H89A 4PV6A 4KOWA 1PUAA 2KCWA 2B4DA 3ZZIA 2REFA 3JUWA 3TO9A 2B5GA 2PR1A 1P0HA 3DDDA 2R1IA 3CXSA 3EFAA 2PRBA 2OU2A 2H5MA 2D4OA 5I0CA 4MJ8A 4FD6A 3FIXA 1BO4A 2OB0A 4KLWA 5H84A 2R7HA 3CXQA 4QVTA 1S3ZA 5EBVA 2PDOA 3T90A 5F46A 1I21A 1S5KA 2P6EA 3S6FA 4DNCA 4QUSA 1QSOA 2CY2A 1Z9UA 3GYAA 1YLEA 3V8IA 2GANA 1S60A 4II9A 4U5YA 1QSMA 4UWJA 4E0AA 3H4QA 4UBRA 2BL1A 4LX9A 5H86A 2ZW6A 5J8CA 2HUZA 4U9YA 4NSQA 5DWNA 1KZFA 4KUAA 1ON0A 1B6BA 5FVJA 4OADA 4FD5A 3R9FA 4JD6A 2ZXVA 2PQ8A 3FYNA 4PK2A 5JPHA 1UFHA 1TIQA 4HNXB 5EC4A 5F47A 3FXTA 3LD2A 1CJWA 2I79A 4L8AA 4UWIA 5F49A 1MJBA 2IL4A 2OH1A 4GS4A 2WPXA 3JVNA 1M1DA 4U9ZA 5HH1A 4KVME 4PK3A 2BUEA 2J8NA 2WPWA 4FD7A 2K5TA 4MY3A 3TCVA 4KOSA 2AE6A 4CAXA 4BMHA 2AJ6A 4MY0A 4NEXA 5E96A 4MHDA 2OZGA 1NSLA 1XEBA 2Q0YA 2ATRA 1GHEA 3GKRA 2VBQA 1Q2DA 4F6AA 1M44A 1VHSA 1QSNA 4MBUA 4JLYA 4XPDB 3W6XA 3D3SA 2FSRA 5J8FA 4E2AA 1M4DA 2ZW7A 1MJ9A 2A4NA 3S6GA 2EUIA 2ZPAA 4F0YA 4XPLA 3PGPA 4FD4A 4KOTA 5KTDA 4M3SA 4KVXA 2FE7A 2R98A 1S7KA 1QSRA 2C27A 1M4GA 2Q7BA 3TO7A 4AG7A 1N71A 3CXPA 3OWCA 2RC4A 4NXYA 4QBJA 5IV0A 2D4PA 3SXOA 5F48A 1FY7A 4KORA 2JDCA 2X7BA 3DR8A 4XNHB 4XPDC 5C82A 3BLNA 4R3LA 2O28A 3ZJ0A 2OZHA 4J3GA 5KTAA 5IX3A 2HV2A 3F0AA 3TFYA 3S6HA 1XIXA 2F5IA
chains in the Genus database with same CATH superfamily
1PU9A 2PE3A 3F5BA 3B35A 4MFZA 1OZPA 4W9YA 3FBUA 3H8FA 4KZTA 4UFWA 2VXKA 4WJBA 4FBEA 4YGOA 4A95A 4X3RA 2B3UA 4CYPA 2PRQA 4IAVA 4I49A 2CNMA 4IUSA 3B8GA 4P4BA 3GY9A 2Z3MA 3FEDA 2DF5A 3QAYA 4JWPA 5JQ4A 2R8VA 4PSXA 4CAWA 3PRTA 4ZI6A 4CGOA 4UCPA 4CGNA 1X12A 2FS5A 2FIAA 2ZENA 4NCZA 1HEEA 4XNHC 5HXDA 2QJ8A 3K2KA 2CIJA 4AG9A 2PR8A 4MCQA 3B3VA 5LRJA 2NSMA 2P6FA 3NH8A 4YFJA 3D7GA 2Z3PA 3WR7A 3CPAA 3B3WA 4UEEA 2FCKA 2HC9A 1HDQA 3SJXA 4UEZA 1MK4A 4A94A 2PCUA 1M4IA 4MFLA 2I00A 4BINA 3KHZA 4FUUA 2PC1A 1XFOA 1IOFA 4A33A 3D4UA 3QAHA 4R9MA 2VZZA 1YLOA 3G3SA 4UA3A 3V7ZA 3VATA 1AMPA 2AFXA 4UCMA 5A28A 4HNWB 3PB7X 2FXFA 2Z11A 2ZW4A 1YVOA 2JDDA 2AFMA 3BJ7A 4A32A 1LANA 4CAVA 3H5ZA 1Y0YA 3FX6A 4NJQA 1IICA 1I12A 4B5PA 5BWAB 3DR6A 3SXNA 4B12A 4ONWA 1PCAA 1YK3A 3B3SA 3FJUA 4MFQA 3WC6A 2DPSA 3F8KA 4PXEA 2DXQA 3PBBA 1NSAA 2ZW5A 4P6YA 2JEVA 2RB7A 2AFSA 1PYTB 5GCNA 3S6KA 1YX0A 3TT2A 3S9MA 3PB6X 2EO8A 2REEA 2P0WA 2ZEDA 1IB1E 2B58A 3FNCA 2Y0MA 3B7IA 4M6GA 4Z65A 1XOVA 4B10A 4H6UA 3BI0A 2PJ9A 4TWEA 2QECA 2EVNA 3IEHA 4X2TA 3SJFA 2BO9A 2Q7SA 4EWTA 1S7NA 2XEIA 4R87A 1R57A 3R95A 1RXTA 1S7FA 1XF8A 2FVGA 4ORFA 2JEWA 4MCRA 4OC5A 5CPAA 4B6ZA 2OR4A 4KLVA 3SJEA 1ELMP 4IF5A 2GLJA 3T8WA 3BJ8A 4UEFA 5CNPA 4CGPA 2DPTA 3TO6A 1SQHA 3QB8A 3UY5A 1YREA 3FH4A 4JXQA 4CRYB 4K30A 2EWBA 4YU9A 1J4JA 4R3KA 3BXMA 1Y7RA 2PJ0A 3IWEA 3KGQA 4PSWA 3D7FA 4P4IA 4RI1A 1YR0A 2QIRA 3HLPA 3IWGA 2JBKA 3EY5A 3R9GA 3FRMA 4OC0A 4QB9A 4HNYB 1Z2LA 4KOXA 1CM0A 4H6ZA 1V0CA 3KKWA 4B5PB 5DS0A 1ARMA 1IYKA 3DSBA 2P6GA 4IHMA 4OMEA 3K9UA 5HVHA 3H8EA 2F8HA 4H2KA 4HKFA 1IYLA 1Q7LA 2O53A 4KVOE 5LYDA 2VL1A 1BAVA 3C26A 1IOIA 5AG4A 3W91A 1Z8TA 2WUUA 1R43A 5A27A 4KOYA 3S9NA 4L89A 4A39A 3VWEA 2QMLA 3I3GA 4R7MA 2I3CA 3CPXA 2G9DA 3MGDA 2WZNA 3JRUA 4MHPA 1F57A 3P2FA 3NFZA 3TE4A 1I1DA 2ZEFA 3EO4A 4ZY2A 4C7HA 4ZYQA 3NA6A 1NE9A 2ZEEA 4OLLA 4ZBGA 3R9EA 2Q4YA 3I9SA 2PIZA 2Q4VA 4CGLA 1TF8A 5DWMA 2ZEOA 1NMTA 1B87A 2AFUA 2VI7A 1YVKA 3WABA 4CYQA 3IO1A 3RZAA 2VZYA 4BBHA 1FT7A 4NGSA 4Y49C 1Q2CA 3PP9A 1M4LA 3LACA 5G1ZA 5HVFA 1YW4A 1ZLIA 3GB0A 1AYEA 2VEZA 4B5OA 1IGBA 4NGQA 4BD9A 5LYIA 4KOUA 2Q04A 2Q51A 4XPKA 4KUBA 4P4DA 3WC7A 2Z3OA 4AVCA 2PVVA 3L2NA 4EFDA 5ISVA 2PJCA 2Z0ZA 3K9TA 2Z10A 4UF4A 4ZX9A 5AG7A 1YQEA 2DEAA 2PJ4A 4B14A 4F0XA 3JTKA 4JXRA 5HVGA 2G3TA 2BEIA 3P2HA 2PSWA 3TOBA 3IGRA 2FT0A 3VH9A 1ARLA 1VKCA 3KZWA 5KTCA 2CNTA 4K3NA 4MXUA 4R57A 1ZG8A 2IQ6A 4RN7A 2C6GA 1XBUA 3RYOA 3KR5A 2ARHA 3IIBA 5AG6A 2Z3NA 3PZJA 1WK4A 3E0KA 2WYRA 4LUAA 4E8OA 2QVPA 4OAEA 4B11A 3D8PA 2B4DB 2GREA 3G8WA 4HPSA 1TXRA 4MI4A 3EXNA 3FB3A 4UFVA 4CRZB 1Y7EA 2B5GB 3KL9A 5HMNA 1EE3P 4M85A 4EVYA 5LRKA 2JLMA 4MMOA 3LODA 5LYLA 1ZO0A 2JBJA 2CNSA 1TKHA 2B3VA 3NH5A 1AUGA 2B4BA 3D2MA 1KUXA 4RUHA 5K8NA 2AFWA 4ZY0A 4OC2A 1IU8A 4RS2A 3I1UA 2V8DA 4AB7A 2Z3LA 2V8VA 3N7ZA 2J8RA 1YGHA 2YNDA 1QQ9A 4NGNA 3IC1A 3W6SA 4LQGA 3TX8A 2J8MA 2ANPA 2FIWA 2OZUA 3TOAA 1LAPA 3FMCA 2PIYA 2GIVA 4ONUA 1Q2YA 1Z4EA 2EK8A 2ODFA 4QC6A 3LWUA 4Q7AA 2GE3A 4YRHA 1DTDA 2YGWA 3DNSA 4KOVA 3IJ3A 4OIWA 2G0BA 4X5KA 4NF1A 1IIDA 3D7DA 1F2PA 1KUVA 3R1KA 1KUYA 3SHPA 1S7LA 4JJXA 4CGMA 1Z8LA 4C2XA 3VARA 3VWDA 4AXVA 4MCPA 5LRGA 2VQYA 1MJAA 5C88A 4P44A 3SI1A 3GLJA 2ZEMA 2J9AA 4AVAA 3PB8X 1P4NA 1XMBA 3A9LA 3PB9X 4GM5A 4A38A 4X8IA 3TC8A 1XMTA 1RO5A 4R8FA 5IB0A 5G22A 4P4FA 3R96A 2FL4A 3NE7A 5D8NA 3CDXA 4C2YA 2Q44A 4CS0B 3TTHA 4DYOA 6CPAA 1XE4A 1U6MA 3FECA 4Y49B 2YNEA 1ZLHA 3KR4A 3D2PA 4AVBA 3T9YA 3PBEA 1WWZA 1TKJA 1Z4RA 4P45A 1L0CA 3EC4A 1RTQA 4KSAA 1OBRA 2BSWA 4PXDA 4A37A 4FWUA 5IB9A 1Y9KA 2PVWA 4OC1A 2HQYA 3DLJA 3D68A 2GFQA 2PJ3A 4OC3A 4P4EA 1K4JA 2G3AA 1BOBA 1Y9WA 1LRZA 4UFXA 1KWMA 1QSTA 4C2ZA 2POKA 1BPNA 2PJ1A 2NMTA 5AG5A 2RFHA 4H89A 4PV6A 5G20A 4KSIA 4KOWA 4UCNA 1PUAA 2KCWA 4KSFA 3D7HA 4CPAA 4R76A 3QNVA 2PJ7A 3KQXA 1CBXA 2B4DA 4MHNA 3ZZIA 1H8LA 2REFA 3JUWA 2BOAA 5D29A 3TO9A 2B5GA 2PR1A 1P0HA 3NH4A 4CAEA 3N5FA 4UIBA 1UWYA 2V8HA 1A2ZA 1Y0RA 3DDDA 2R1IA 3CXSA 3EFAA 4MHYA 4M6IA 2PRBA 4B13A 3KHXA 2CTBA 1R3NA 2OU2A 2XEFA 1CP7A 2H5MA 2D4OA 5I0CA 1Z8WA 4MJ8A 3SI0A 4FD6A 4A31A 3FIXA 4R6TA 1IY7A 4PXBA 2OOTA 1BO4A 2OB0A 4KLWA 4ZY1A 1YMEA 5H84A 4ZGYB 2R7HA 3CXQA 4NFRA 3H8GA 2QYVA 4QVTA 1S3ZA 2XEJA 3GIUA 1LFWA 1VHOA 2CF4A 4MCSA 3PEIA 5EBVA 3V38A 2PDOA 4GXHA 2C6CA 3RO0A 3FF3A 4FAIA 5EMIA 3B2YA 3T90A 5F46A 2C6PA 4CYOA 2YNCC 3RAMA 1I21A 4NGPA 3DGVA 4C68A 1VGYA 5K8MA 1S5KA 2P6EA 4UIAA 3RBUA 3S6FA 4DNCA 4PQAA 5G21A 4QUSA 1QSOA 2CY2A 4KS9A 2ZOFA 2PJ6A 4DJLA 4MRIA 1LAMA 1Z9UA 3GYAA 1YLEA 4O23A 1XRYA 2GANA 2PJ2A 3V8IA 1S60A 4II9A 1BPMA 4OP4A 4U5YA 1QSMA 2IMOA 4UWJA 4E0AA 3H4QA 1JWQA 4UBRA 2BL1A 4LQ6A 2IJZA 4LX9A 1JQGA 5H86A 2ZW6A 2F7VA 5J8CA 3MN8A 4PPZA 4F9UA 4G1PA 2HUZA 4U9YA 4NSQA 3ISZA 5K8OA 1TKFA 4NGTA 5DWNA 1KZFA 3CZXA 4MFJA 4KUAA 1ON0A 1B6BA 1TF9A 5FVJA 4OADA 5J1QA 2Z3KA 2NYQA 4FD5A 2ZEHA 3B3TA 1GYTA 4MFPA 3R9FA 4JD6A 2ZXVA 2PQ8A 3FYNA 3IU1A 3PFEA 4OIDA 4PK2A 5JPHA 1UFHA 1TIQA 1DE4C 1LOKA 2CXAA 3KI9A 4HNXB 3GUXA 4A30A 5EC4A 5F47A 2V77A 3FXTA 8CPAA 5JM6A 3IU2A 1CJWA 3LD2A 2I79A 4L8AA 1VIXA 3ISXA 4M6HA 5I4MA 4UWIA 5F49A 3D66A 1MJBA 3BI1A 2IL4A 2OH1A 4GS4A 5JGFA 2HB6A 2YNCA 4JYWA 3WT4A 2WPXA 3JVNA 4NJRA 3KASA 1M1DA 4U9ZA 5HH1A 1LCPA 4KVME 4PK3A 3SJGA 2BUEA 2J8NA 3S9LA 2ABZA 4F8ZA 2WPWA 2O4HA 3FEEA 2K5TA 2WSAA 4FD7A 4MY3A 5ELYA 3TCVA 2EBJA 4KOSA 4JZ0A 1ELLP 2AE6A 2BCOA 4CAXA 4BMHA 1X10A 2AJ6A 4MY0A 7CPAA 4PXCA 4NEXA 3B3CA 5E96A 4NGRA 4NGMA 4MHDA 2OZGA 1NSLA 1XJOA 2AFZA 5CBMA 4Q38A 1XEBA 2Q0YA 2ATRA 1GHEA 3NE8A 3GKRA 2VBQA 3IWWA 1Q2DA 2PJAA 2V8GA 3CT9A 4F6AA 2PJ5A 3KQZA 3PB4X 3FVLA 1M44A 4ZX8A 1VHSA 5K8PA 1QSNA 2Q43A 1FNOA 4MBUA 4JLYA 2Q4ZA 4XPDB 4Q36A 3W6XA 3D3SA 1YW6A 2FSRA 5J8FA 4E2AA 1M4DA 1ZG9A 4WWVA 3RNZA 4CYNA 1F2OA 2ZW7A 1MJ9A 2A4NA 3BHXA 3S6GA 4P10A 2EUIA 2ZPAA 4YWYA 5THWA 4F0YA 4XPLA 3LMSA 3PGPA 2GLFA 4FD4A 3D67A 4KOTA 5KTDA 4M3SA 4KVXA 4OC4A 2FE7A 2R98A 1S7KA 3HUVA 2ZELA 4MFKA 4DUKA 4CAFA 1QSRA 2AFOA 2C27A 1HDUA 1M4GA 4IK2A 2Q7BA 3TO7A 4P4JA 1N71A 3IFEA 3CXPA 1BLLE 4AG7A 3OWCA 4C7IA 5F09A 2RC4A 2ZOGA 4NXYA 4QBJA 2ZEGA 2C1CA 5IV0A 2D4PA 3SI2A 3SXOA 1QMUA 1CP6A 2PJBA 3PFOA 5F48A 1FY7A 4KORA 2PJ8A 2ZEPA 2JDCA 2XEGA 2X7BA 1VHEA 3DR8A 4XNHB 4XPDC 5C82A 3BLNA 1CPSA 1Z5RA 4R3LA 2O28A 3ZJ0A 1CX8A 2OZHA 4J3GA 4F9VA 2EK9A 5KTAA 1CG2A 1CPXA 2HV2A 5IX3A 5LYFA 5JH9A 2GU2A 4TNUA 3F0AA 3MRUA 4OKOA 4MHZA 1YSJA 3TFYA 3WC5A 3S6HA 4A2ZA 1XIXA 1ZG7A 1Z8XA 4EMEA 2F5IA 2CTCA 5AGEA
chains in the Genus database with same CATH topology
1PU9A 3F5BA 4MFZA 1OZPA 3FBUA 4UFWA 4KZTA 2VXKA 4YGOA 4A95A 2B3UA 4CYPA 4I49A 2CNMA 4IUSA 3B8GA 3GY9A 2Z3MA 4JWPA 5JQ4A 2R8VA 4PSXA 4CAWA 4CGOA 4UCPA 4CGNA 2FS5A 2FIAA 4NCZA 4XNHC 4AG9A 2PR8A 2P6FA 4YFJA 2Z3PA 3WR7A 2FCKA 1MK4A 1M4IA 4MFLA 2I00A 2PC1A 4A33A 3QAHA 4R9MA 2VZZA 3G3SA 4UA3A 4UCMA 5A28A 4HNWB 2FXFA 2Z11A 2ZW4A 1YVOA 2JDDA 3BJ7A 4A32A 4CAVA 3H5ZA 5BWAB 1IICA 1I12A 4B5PA 3DR6A 3SXNA 4B12A 1YK3A 4MFQA 2DPSA 3F8KA 2DXQA 2ZW5A 2JEVA 5GCNA 3S6KA 1YX0A 3TT2A 3FNCA 2REEA 2P0WA 5DWMA 1IB1E 2B58A 2Y0MA 4B10A 4H6UA 2QECA 2EVNA 1S7NA 4R87A 1R57A 3R95A 1RXTA 1S7FA 1XF8A 4ORFA 4KLVA 4IF5A 3BJ8A 5CNPA 4CGPA 2DPTA 3TO6A 1SQHA 3QB8A 3UY5A 1YREA 4JXQA 4CRYB 4K30A 1J4JA 4R3KA 1Y7RA 3IWEA 4PSWA 4RI1A 1YR0A 2QIRA 3IWGA 3R9GA 3EY5A 3FRMA 4QB9A 4HNYB 4KOXA 1CM0A 4H6ZA 1V0CA 3KKWA 4B5PB 1IYKA 3DSBA 2P6GA 3K9UA 4HKFA 1IYLA 4KVOE 3C26A 5AG4A 3W91A 2WUUA 5A27A 4KOYA 4L89A 3VWEA 2QMLA 3I3GA 3MGDA 3P2FA 3TE4A 1I1DA 3EO4A 4C7HA 1NE9A 4OLLA 4ZBGA 3R9EA 2Q4YA 3I9SA 2Q4VA 4CGLA 1NMTA 1B87A 2VI7A 1YVKA 4CYQA 2VZYA 4BBHA 4Y49C 1Q2CA 3PP9A 5G1ZA 2VEZA 4B5OA 4KOUA 2Q04A 4XPKA 4KUBA 5ISVA 2Z3OA 4AVCA 2Z0ZA 2Z10A 5AG7A 4B14A 4F0XA 3JTKA 4JXRA 2G3TA 3P2HA 2BEIA 2PSWA 3TOBA 3IGRA 2FT0A 1VKCA 5KTCA 2CNTA 4R57A 3RYOA 2ARHA 5AG6A 2Z3NA 3PZJA 1WK4A 3E0KA 4LUAA 4E8OA 4OAEA 4B11A 3D8PA 2B4DB 3G8WA 4MI4A 3EXNA 3FB3A 4UFVA 4CRZB 2B5GB 5HMNA 4M85A 4EVYA 2JLMA 3LODA 1ZO0A 2CNSA 2B3VA 2B4BA 3D2MA 1KUXA 4RS2A 4AB7A 2Z3LA 3N7ZA 2J8RA 1YGHA 2YNDA 3W6SA 2J8MA 2FIWA 2OZUA 3TOAA 2GIVA 4ONUA 1Q2YA 1Z4EA 4QC6A 2GE3A 4YRHA 2YGWA 3DNSA 4KOVA 4X5KA 2G0BA 4NF1A 1IIDA 1KUVA 3R1KA 1KUYA 3SHPA 1S7LA 4JJXA 4CGMA 4C2XA 3VWDA 2VQYA 1MJAA 5C88A 4AVAA 1P4NA 3A9LA 1XMTA 1RO5A 5IB0A 5G22A 3R96A 2FL4A 3NE7A 4C2YA 2Q44A 4CS0B 3TTHA 1XE4A 1U6MA 4Y49B 2YNEA 3D2PA 4AVBA 3T9YA 1WWZA 1Z4RA 1L0CA 3EC4A 4KSAA 2BSWA 1Y9KA 2HQYA 1K4JA 2G3AA 1BOBA 1Y9WA 1LRZA 4UFXA 1QSTA 4C2ZA 2NMTA 5AG5A 4H89A 4PV6A 5G20A 4KOWA 4UCNA 1PUAA 2KCWA 4KSFA 2B4DA 3ZZIA 2REFA 3JUWA 3TO9A 2B5GA 2PR1A 1P0HA 4CAEA 3DDDA 2R1IA 3CXSA 3EFAA 2PRBA 4B13A 2OU2A 2H5MA 2D4OA 5I0CA 4MJ8A 4FD6A 4A31A 3FIXA 1BO4A 2OB0A 4KLWA 5H84A 4ZGYB 2R7HA 3CXQA 4QVTA 1S3ZA 5EBVA 2PDOA 3T90A 5F46A 4CYOA 2YNCC 1I21A 4C68A 1S5KA 2P6EA 3S6FA 4DNCA 5G21A 4QUSA 1QSOA 2CY2A 4KS9A 1Z9UA 3GYAA 1YLEA 3V8IA 2GANA 1S60A 4II9A 4U5YA 1QSMA 4UWJA 4E0AA 3H4QA 4UBRA 2BL1A 4LX9A 5H86A 2ZW6A 5J8CA 2HUZA 4U9YA 4NSQA 5DWNA 1KZFA 4MFJA 4KUAA 1ON0A 1B6BA 5FVJA 4OADA 2Z3KA 4FD5A 3R9FA 4MFPA 4JD6A 2ZXVA 2PQ8A 3FYNA 3IU1A 4PK2A 5JPHA 1UFHA 1TIQA 2CXAA 4HNXB 4A30A 5EC4A 5F47A 3FXTA 3IU2A 1CJWA 3LD2A 2I79A 4L8AA 4UWIA 5F49A 1MJBA 2IL4A 2OH1A 4GS4A 2YNCA 2WPXA 3JVNA 1M1DA 4U9ZA 5HH1A 4KVME 4PK3A 2BUEA 2J8NA 2WPWA 4FD7A 2K5TA 2WSAA 4MY3A 3TCVA 4KOSA 2AE6A 4CAXA 4BMHA 2AJ6A 4MY0A 4NEXA 5E96A 4MHDA 2OZGA 1NSLA 4Q38A 1XEBA 2Q0YA 2ATRA 1GHEA 3GKRA 2VBQA 1Q2DA 4F6AA 1M44A 1VHSA 1QSNA 4MBUA 4JLYA 4XPDB 4Q36A 3W6XA 3D3SA 2FSRA 5J8FA 4E2AA 1M4DA 4CYNA 2ZW7A 1MJ9A 2A4NA 3S6GA 2EUIA 2ZPAA 4F0YA 4XPLA 3PGPA 4FD4A 4KOTA 5KTDA 4M3SA 4KVXA 2FE7A 2R98A 1S7KA 4MFKA 4CAFA 1QSRA 2C27A 1M4GA 2Q7BA 3TO7A 4AG7A 1N71A 3CXPA 4C7IA 3OWCA 2RC4A 4NXYA 4QBJA 5IV0A 2D4PA 3SXOA 5F48A 1FY7A 4KORA 2JDCA 2X7BA 3DR8A 4XNHB 4XPDC 5C82A 3BLNA 4R3LA 2O28A 3ZJ0A 2OZHA 4J3GA 5KTAA 5IX3A 2HV2A 3F0AA 3TFYA 3S6HA 4A2ZA 1XIXA 2F5IA 5AGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PU9 A;  3F5B A;  1OZP A;  3FBU A;  4KZT A;  2VXK A;  4YGO A;  2B3U A;  4I49 A;  2CNM A;  4IUS A;  3B8G A;  3GY9 A;  4JWP A;  5JQ4 A;  2R8V A;  4PSX A;  4CAW A;  2FS5 A;  2FIA A;  4NCZ A;  4XNH C;  4AG9 A;  2PR8 A;  2P6F A;  4YFJ A;  3WR7 A;  2FCK A;  1MK4 A;  1M4I A;  2I00 A;  2PC1 A;  3QAH A;  4R9M A;  2VZZ A;  3G3S A;  4UA3 A;  4HNW B;  2FXF A;  2Z11 A;  2ZW4 A;  1YVO A;  2JDD A;  3BJ7 A;  4CAV A;  1IIC A;  1I12 A;  4B5P A;  3DR6 A;  3SXN A;  1YK3 A;  3F8K A;  2DXQ A;  2ZW5 A;  2JEV A;  5GCN A;  3S6K A;  1YX0 A;  3TT2 A;  3FNC A;  2REE A;  2P0W A;  5DWM A;  1IB1 E;  2B58 A;  2Y0M A;  4H6U A;  2QEC A;  2EVN A;  1S7N A;  4R87 A;  1R57 A;  3R95 A;  1RXT A;  1S7F A;  1XF8 A;  4ORF A;  4KLV A;  4IF5 A;  3BJ8 A;  5CNP A;  3TO6 A;  1SQH A;  3QB8 A;  3UY5 A;  1YRE A;  4JXQ A;  4CRY B;  4K30 A;  1J4J A;  4R3K A;  1Y7R A;  4PSW A;  4RI1 A;  1YR0 A;  2QIR A;  3IWG A;  3R9G A;  3EY5 A;  3FRM A;  4QB9 A;  4HNY B;  4KOX A;  1CM0 A;  4H6Z A;  1V0C A;  3KKW A;  4B5P B;  1IYK A;  3DSB A;  2P6G A;  3K9U A;  4HKF A;  1IYL A;  4KVO E;  3C26 A;  3W91 A;  4KOY A;  4L89 A;  3VWE A;  2QML A;  3I3G A;  3MGD A;  3P2F A;  3TE4 A;  1I1D A;  3EO4 A;  1NE9 A;  4OLL A;  4ZBG A;  3R9E A;  2Q4Y A;  3I9S A;  2Q4V A;  1NMT A;  1B87 A;  2VI7 A;  1YVK A;  2VZY A;  4Y49 C;  1Q2C A;  3PP9 A;  2VEZ A;  4B5O A;  4KOU A;  2Q04 A;  4XPK A;  4KUB A;  5ISV A;  4AVC A;  2Z0Z A;  2Z10 A;  4JXR A;  2G3T A;  3P2H A;  2BEI A;  2PSW A;  3TOB A;  3IGR A;  2FT0 A;  1VKC A;  5KTC A;  2CNT A;  4R57 A;  3RYO A;  2ARH A;  3PZJ A;  1WK4 A;  3E0K A;  4LUA A;  4E8O A;  4OAE A;  3D8P A;  2B4D B;  3G8W A;  4MI4 A;  3EXN A;  3FB3 A;  4CRZ B;  2B5G B;  5HMN A;  4M85 A;  4EVY A;  2JLM A;  3LOD A;  2CNS A;  2B3V A;  2B4B A;  3D2M A;  1KUX A;  4RS2 A;  4AB7 A;  3N7Z A;  2J8R A;  1YGH A;  3W6S A;  2J8M A;  2FIW A;  2OZU A;  3TOA A;  2GIV A;  4ONU A;  1Q2Y A;  1Z4E A;  4QC6 A;  2GE3 A;  4YRH A;  3DNS A;  4KOV A;  4X5K A;  2G0B A;  4NF1 A;  1IID A;  1KUV A;  3R1K A;  1KUY A;  3SHP A;  1S7L A;  4JJX A;  3VWD A;  2VQY A;  1MJA A;  5C88 A;  4AVA A;  1P4N A;  1XMT A;  1RO5 A;  5IB0 A;  3R96 A;  2FL4 A;  3NE7 A;  2Q44 A;  4CS0 B;  3TTH A;  1XE4 A;  1U6M A;  4Y49 B;  3D2P A;  4AVB A;  3T9Y A;  1WWZ A;  1Z4R A;  1L0C A;  3EC4 A;  2BSW A;  1Y9K A;  2HQY A;  1K4J A;  2G3A A;  1BOB A;  1Y9W A;  1LRZ A;  1QST A;  2NMT A;  4H89 A;  4PV6 A;  4KOW A;  1PUA A;  2KCW A;  2B4D A;  3ZZI A;  2REF A;  3JUW A;  3TO9 A;  2B5G A;  2PR1 A;  1P0H A;  3DDD A;  2R1I A;  3CXS A;  3EFA A;  2PRB A;  2OU2 A;  2H5M A;  2D4O A;  5I0C A;  4MJ8 A;  4FD6 A;  3FIX A;  1BO4 A;  2OB0 A;  4KLW A;  5H84 A;  2R7H A;  3CXQ A;  4QVT A;  1S3Z A;  5EBV A;  2PDO A;  3T90 A;  5F46 A;  1I21 A;  1S5K A;  2P6E A;  3S6F A;  4DNC A;  4QUS A;  1QSO A;  2CY2 A;  1Z9U A;  3GYA A;  1YLE A;  3V8I A;  2GAN A;  1S60 A;  4II9 A;  4U5Y A;  1QSM A;  4UWJ A;  4E0A A;  3H4Q A;  4UBR A;  2BL1 A;  4LX9 A;  5H86 A;  2ZW6 A;  5J8C A;  2HUZ A;  4U9Y A;  4NSQ A;  5DWN A;  1KZF A;  4KUA A;  1ON0 A;  1B6B A;  5FVJ A;  4OAD A;  4FD5 A;  3R9F A;  4JD6 A;  2ZXV A;  2PQ8 A;  3FYN A;  4PK2 A;  5JPH A;  1UFH A;  1TIQ A;  4HNX B;  5EC4 A;  5F47 A;  3FXT A;  3LD2 A;  1CJW A;  2I79 A;  4L8A A;  4UWI A;  5F49 A;  1MJB A;  2IL4 A;  2OH1 A;  4GS4 A;  2WPX A;  3JVN A;  1M1D A;  4U9Z A;  5HH1 A;  4KVM E;  4PK3 A;  2BUE A;  2J8N A;  2WPW A;  4FD7 A;  2K5T A;  4MY3 A;  3TCV A;  4KOS A;  2AE6 A;  4CAX A;  4BMH A;  2AJ6 A;  4MY0 A;  4NEX A;  5E96 A;  4MHD A;  2OZG A;  1NSL A;  1XEB A;  2Q0Y A;  2ATR A;  1GHE A;  3GKR A;  2VBQ A;  1Q2D A;  4F6A A;  1M44 A;  1VHS A;  1QSN A;  4MBU A;  4JLY A;  4XPD B;  3W6X A;  3D3S A;  2FSR A;  5J8F A;  4E2A A;  1M4D A;  2ZW7 A;  1MJ9 A;  2A4N A;  3S6G A;  2EUI A;  2ZPA A;  4F0Y A;  4XPL A;  3PGP A;  4FD4 A;  4KOT A;  5KTD A;  4M3S A;  4KVX A;  2FE7 A;  2R98 A;  1S7K A;  1QSR A;  2C27 A;  1M4G A;  2Q7B A;  3TO7 A;  4AG7 A;  1N71 A;  3CXP A;  3OWC A;  2RC4 A;  4NXY A;  4QBJ A;  5IV0 A;  2D4P A;  3SXO A;  5F48 A;  1FY7 A;  4KOR A;  2JDC A;  2X7B A;  3DR8 A;  4XNH B;  4XPD C;  5C82 A;  3BLN A;  4R3L A;  2O28 A;  3ZJ0 A;  2OZH A;  4J3G A;  5KTA A;  5IX3 A;  2HV2 A;  3F0A A;  3TFY A;  3S6H A;  1XIX A;  2F5I A; 
#chains in the Genus database with same CATH topology
 1PU9 A;  2PE3 A;  3F5B A;  3B35 A;  4MFZ A;  1OZP A;  4W9Y A;  3FBU A;  3H8F A;  4KZT A;  4UFW A;  2VXK A;  4WJB A;  4FBE A;  4YGO A;  4A95 A;  4X3R A;  2B3U A;  4CYP A;  2PRQ A;  4IAV A;  4I49 A;  2CNM A;  4IUS A;  3B8G A;  4P4B A;  3GY9 A;  2Z3M A;  3FED A;  2DF5 A;  3QAY A;  4JWP A;  5JQ4 A;  2R8V A;  4PSX A;  4CAW A;  3PRT A;  4ZI6 A;  4CGO A;  4UCP A;  4CGN A;  1X12 A;  2FS5 A;  2FIA A;  2ZEN A;  4NCZ A;  1HEE A;  4XNH C;  5HXD A;  2QJ8 A;  3K2K A;  2CIJ A;  4AG9 A;  2PR8 A;  4MCQ A;  3B3V A;  5LRJ A;  2NSM A;  2P6F A;  3NH8 A;  4YFJ A;  3D7G A;  2Z3P A;  3WR7 A;  3CPA A;  3B3W A;  4UEE A;  2FCK A;  2HC9 A;  1HDQ A;  3SJX A;  4UEZ A;  1MK4 A;  4A94 A;  2PCU A;  1M4I A;  4MFL A;  2I00 A;  4BIN A;  3KHZ A;  4FUU A;  2PC1 A;  1XFO A;  1IOF A;  4A33 A;  3D4U A;  3QAH A;  4R9M A;  2VZZ A;  1YLO A;  3G3S A;  4UA3 A;  3V7Z A;  3VAT A;  1AMP A;  2AFX A;  4UCM A;  5A28 A;  4HNW B;  3PB7 X;  2FXF A;  2Z11 A;  2ZW4 A;  1YVO A;  2JDD A;  2AFM A;  3BJ7 A;  4A32 A;  1LAN A;  4CAV A;  3H5Z A;  1Y0Y A;  3FX6 A;  4NJQ A;  1IIC A;  1I12 A;  4B5P A;  5BWA B;  3DR6 A;  3SXN A;  4B12 A;  4ONW A;  1PCA A;  1YK3 A;  3B3S A;  3FJU A;  4MFQ A;  3WC6 A;  2DPS A;  3F8K A;  4PXE A;  2DXQ A;  3PBB A;  1NSA A;  2ZW5 A;  4P6Y A;  2JEV A;  2RB7 A;  2AFS A;  1PYT B;  5GCN A;  3S6K A;  1YX0 A;  3TT2 A;  3S9M A;  3PB6 X;  2EO8 A;  2REE A;  2P0W A;  2ZED A;  1IB1 E;  2B58 A;  3FNC A;  2Y0M A;  3B7I A;  4M6G A;  4Z65 A;  1XOV A;  4B10 A;  4H6U A;  3BI0 A;  2PJ9 A;  4TWE A;  2QEC A;  2EVN A;  3IEH A;  4X2T A;  3SJF A;  2BO9 A;  2Q7S A;  4EWT A;  1S7N A;  2XEI A;  4R87 A;  1R57 A;  3R95 A;  1RXT A;  1S7F A;  1XF8 A;  2FVG A;  4ORF A;  2JEW A;  4MCR A;  4OC5 A;  5CPA A;  4B6Z A;  2OR4 A;  4KLV A;  3SJE A;  1ELM P;  4IF5 A;  2GLJ A;  3T8W A;  3BJ8 A;  4UEF A;  5CNP A;  4CGP A;  2DPT A;  3TO6 A;  1SQH A;  3QB8 A;  3UY5 A;  1YRE A;  3FH4 A;  4JXQ A;  4CRY B;  4K30 A;  2EWB A;  4YU9 A;  1J4J A;  4R3K A;  3BXM A;  1Y7R A;  2PJ0 A;  3IWE A;  3KGQ A;  4PSW A;  3D7F A;  4P4I A;  4RI1 A;  1YR0 A;  2QIR A;  3HLP A;  3IWG A;  2JBK A;  3EY5 A;  3R9G A;  3FRM A;  4OC0 A;  4QB9 A;  4HNY B;  1Z2L A;  4KOX A;  1CM0 A;  4H6Z A;  1V0C A;  3KKW A;  4B5P B;  5DS0 A;  1ARM A;  1IYK A;  3DSB A;  2P6G A;  4IHM A;  4OME A;  3K9U A;  5HVH A;  3H8E A;  2F8H A;  4H2K A;  4HKF A;  1IYL A;  1Q7L A;  2O53 A;  4KVO E;  5LYD A;  2VL1 A;  1BAV A;  3C26 A;  1IOI A;  5AG4 A;  3W91 A;  1Z8T A;  2WUU A;  1R43 A;  5A27 A;  4KOY A;  3S9N A;  4L89 A;  4A39 A;  3VWE A;  2QML A;  3I3G A;  4R7M A;  2I3C A;  3CPX A;  2G9D A;  3MGD A;  2WZN A;  3JRU A;  4MHP A;  1F57 A;  3P2F A;  3NFZ A;  3TE4 A;  1I1D A;  2ZEF A;  3EO4 A;  4ZY2 A;  4C7H A;  4ZYQ A;  3NA6 A;  1NE9 A;  2ZEE A;  4OLL A;  4ZBG A;  3R9E A;  2Q4Y A;  3I9S A;  2PIZ A;  2Q4V A;  4CGL A;  1TF8 A;  5DWM A;  2ZEO A;  1NMT A;  1B87 A;  2AFU A;  2VI7 A;  1YVK A;  3WAB A;  4CYQ A;  3IO1 A;  3RZA A;  2VZY A;  4BBH A;  1FT7 A;  4NGS A;  4Y49 C;  1Q2C A;  3PP9 A;  1M4L A;  3LAC A;  5G1Z A;  5HVF A;  1YW4 A;  1ZLI A;  3GB0 A;  1AYE A;  2VEZ A;  4B5O A;  1IGB A;  4NGQ A;  4BD9 A;  5LYI A;  4KOU A;  2Q04 A;  2Q51 A;  4XPK A;  4KUB A;  4P4D A;  3WC7 A;  2Z3O A;  4AVC A;  2PVV A;  3L2N A;  4EFD A;  5ISV A;  2PJC A;  2Z0Z A;  3K9T A;  2Z10 A;  4UF4 A;  4ZX9 A;  5AG7 A;  1YQE A;  2DEA A;  2PJ4 A;  4B14 A;  4F0X A;  3JTK A;  4JXR A;  5HVG A;  2G3T A;  2BEI A;  3P2H A;  2PSW A;  3TOB A;  3IGR A;  2FT0 A;  3VH9 A;  1ARL A;  1VKC A;  3KZW A;  5KTC A;  2CNT A;  4K3N A;  4MXU A;  4R57 A;  1ZG8 A;  2IQ6 A;  4RN7 A;  2C6G A;  1XBU A;  3RYO A;  3KR5 A;  2ARH A;  3IIB A;  5AG6 A;  2Z3N A;  3PZJ A;  1WK4 A;  3E0K A;  2WYR A;  4LUA A;  4E8O A;  2QVP A;  4OAE A;  4B11 A;  3D8P A;  2B4D B;  2GRE A;  3G8W A;  4HPS A;  1TXR A;  4MI4 A;  3EXN A;  3FB3 A;  4UFV A;  4CRZ B;  1Y7E A;  2B5G B;  3KL9 A;  5HMN A;  1EE3 P;  4M85 A;  4EVY A;  5LRK A;  2JLM A;  4MMO A;  3LOD A;  5LYL A;  1ZO0 A;  2JBJ A;  2CNS A;  1TKH A;  2B3V A;  3NH5 A;  1AUG A;  2B4B A;  3D2M A;  1KUX A;  4RUH A;  5K8N A;  2AFW A;  4ZY0 A;  4OC2 A;  1IU8 A;  4RS2 A;  3I1U A;  2V8D A;  4AB7 A;  2Z3L A;  2V8V A;  3N7Z A;  2J8R A;  1YGH A;  2YND A;  1QQ9 A;  4NGN A;  3IC1 A;  3W6S A;  4LQG A;  3TX8 A;  2J8M A;  2ANP A;  2FIW A;  2OZU A;  3TOA A;  1LAP A;  3FMC A;  2PIY A;  2GIV A;  4ONU A;  1Q2Y A;  1Z4E A;  2EK8 A;  2ODF A;  4QC6 A;  3LWU A;  4Q7A A;  2GE3 A;  4YRH A;  1DTD A;  2YGW A;  3DNS A;  4KOV A;  3IJ3 A;  4OIW A;  2G0B A;  4X5K A;  4NF1 A;  1IID A;  3D7D A;  1F2P A;  1KUV A;  3R1K A;  1KUY A;  3SHP A;  1S7L A;  4JJX A;  4CGM A;  1Z8L A;  4C2X A;  3VAR A;  3VWD A;  4AXV A;  4MCP A;  5LRG A;  2VQY A;  1MJA A;  5C88 A;  4P44 A;  3SI1 A;  3GLJ A;  2ZEM A;  2J9A A;  4AVA A;  3PB8 X;  1P4N A;  1XMB A;  3A9L A;  3PB9 X;  4GM5 A;  4A38 A;  4X8I A;  3TC8 A;  1XMT A;  1RO5 A;  4R8F A;  5IB0 A;  5G22 A;  4P4F A;  3R96 A;  2FL4 A;  3NE7 A;  5D8N A;  3CDX A;  4C2Y A;  2Q44 A;  4CS0 B;  3TTH A;  4DYO A;  6CPA A;  1XE4 A;  1U6M A;  3FEC A;  4Y49 B;  2YNE A;  1ZLH A;  3KR4 A;  3D2P A;  4AVB A;  3T9Y A;  3PBE A;  1WWZ A;  1TKJ A;  1Z4R A;  4P45 A;  1L0C A;  3EC4 A;  1RTQ A;  4KSA A;  1OBR A;  2BSW A;  4PXD A;  4A37 A;  4FWU A;  5IB9 A;  1Y9K A;  2PVW A;  4OC1 A;  2HQY A;  3DLJ A;  3D68 A;  2GFQ A;  2PJ3 A;  4OC3 A;  4P4E A;  1K4J A;  2G3A A;  1BOB A;  1Y9W A;  1LRZ A;  4UFX A;  1KWM A;  1QST A;  4C2Z A;  2POK A;  1BPN A;  2PJ1 A;  2NMT A;  5AG5 A;  2RFH A;  4H89 A;  4PV6 A;  5G20 A;  4KSI A;  4KOW A;  4UCN A;  1PUA A;  2KCW A;  4KSF A;  3D7H A;  4CPA A;  4R76 A;  3QNV A;  2PJ7 A;  3KQX A;  1CBX A;  2B4D A;  4MHN A;  3ZZI A;  1H8L A;  2REF A;  3JUW A;  2BOA A;  5D29 A;  3TO9 A;  2B5G A;  2PR1 A;  1P0H A;  3NH4 A;  4CAE A;  3N5F A;  4UIB A;  1UWY A;  2V8H A;  1A2Z A;  1Y0R A;  3DDD A;  2R1I A;  3CXS A;  3EFA A;  4MHY A;  4M6I A;  2PRB A;  4B13 A;  3KHX A;  2CTB A;  1R3N A;  2OU2 A;  2XEF A;  1CP7 A;  2H5M A;  2D4O A;  5I0C A;  1Z8W A;  4MJ8 A;  3SI0 A;  4FD6 A;  4A31 A;  3FIX A;  4R6T A;  1IY7 A;  4PXB A;  2OOT A;  1BO4 A;  2OB0 A;  4KLW A;  4ZY1 A;  1YME A;  5H84 A;  4ZGY B;  2R7H A;  3CXQ A;  4NFR A;  3H8G A;  2QYV A;  4QVT A;  1S3Z A;  2XEJ A;  3GIU A;  1LFW A;  1VHO A;  2CF4 A;  4MCS A;  3PEI A;  5EBV A;  3V38 A;  2PDO A;  4GXH A;  2C6C A;  3RO0 A;  3FF3 A;  4FAI A;  5EMI A;  3B2Y A;  3T90 A;  5F46 A;  2C6P A;  4CYO A;  2YNC C;  3RAM A;  1I21 A;  4NGP A;  3DGV A;  4C68 A;  1VGY A;  5K8M A;  1S5K A;  2P6E A;  4UIA A;  3RBU A;  3S6F A;  4DNC A;  4PQA A;  5G21 A;  4QUS A;  1QSO A;  2CY2 A;  4KS9 A;  2ZOF A;  2PJ6 A;  4DJL A;  4MRI A;  1LAM A;  1Z9U A;  3GYA A;  1YLE A;  4O23 A;  1XRY A;  2GAN A;  2PJ2 A;  3V8I A;  1S60 A;  4II9 A;  1BPM A;  4OP4 A;  4U5Y A;  1QSM A;  2IMO A;  4UWJ A;  4E0A A;  3H4Q A;  1JWQ A;  4UBR A;  2BL1 A;  4LQ6 A;  2IJZ A;  4LX9 A;  1JQG A;  5H86 A;  2ZW6 A;  2F7V A;  5J8C A;  3MN8 A;  4PPZ A;  4F9U A;  4G1P A;  2HUZ A;  4U9Y A;  4NSQ A;  3ISZ A;  5K8O A;  1TKF A;  4NGT A;  5DWN A;  1KZF A;  3CZX A;  4MFJ A;  4KUA A;  1ON0 A;  1B6B A;  1TF9 A;  5FVJ A;  4OAD A;  5J1Q A;  2Z3K A;  2NYQ A;  4FD5 A;  2ZEH A;  3B3T A;  1GYT A;  4MFP A;  3R9F A;  4JD6 A;  2ZXV A;  2PQ8 A;  3FYN A;  3IU1 A;  3PFE A;  4OID A;  4PK2 A;  5JPH A;  1UFH A;  1TIQ A;  1DE4 C;  1LOK A;  2CXA A;  3KI9 A;  4HNX B;  3GUX A;  4A30 A;  5EC4 A;  5F47 A;  2V77 A;  3FXT A;  8CPA A;  5JM6 A;  3IU2 A;  1CJW A;  3LD2 A;  2I79 A;  4L8A A;  1VIX A;  3ISX A;  4M6H A;  5I4M A;  4UWI A;  5F49 A;  3D66 A;  1MJB A;  3BI1 A;  2IL4 A;  2OH1 A;  4GS4 A;  5JGF A;  2HB6 A;  2YNC A;  4JYW A;  3WT4 A;  2WPX A;  3JVN A;  4NJR A;  3KAS A;  1M1D A;  4U9Z A;  5HH1 A;  1LCP A;  4KVM E;  4PK3 A;  3SJG A;  2BUE A;  2J8N A;  3S9L A;  2ABZ A;  4F8Z A;  2WPW A;  2O4H A;  3FEE A;  2K5T A;  2WSA A;  4FD7 A;  4MY3 A;  5ELY A;  3TCV A;  2EBJ A;  4KOS A;  4JZ0 A;  1ELL P;  2AE6 A;  2BCO A;  4CAX A;  4BMH A;  1X10 A;  2AJ6 A;  4MY0 A;  7CPA A;  4PXC A;  4NEX A;  3B3C A;  5E96 A;  4NGR A;  4NGM A;  4MHD A;  2OZG A;  1NSL A;  1XJO A;  2AFZ A;  5CBM A;  4Q38 A;  1XEB A;  2Q0Y A;  2ATR A;  1GHE A;  3NE8 A;  3GKR A;  2VBQ A;  3IWW A;  1Q2D A;  2PJA A;  2V8G A;  3CT9 A;  4F6A A;  2PJ5 A;  3KQZ A;  3PB4 X;  3FVL A;  1M44 A;  4ZX8 A;  1VHS A;  5K8P A;  1QSN A;  2Q43 A;  1FNO A;  4MBU A;  4JLY A;  2Q4Z A;  4XPD B;  4Q36 A;  3W6X A;  3D3S A;  1YW6 A;  2FSR A;  5J8F A;  4E2A A;  1M4D A;  1ZG9 A;  4WWV A;  3RNZ A;  4CYN A;  1F2O A;  2ZW7 A;  1MJ9 A;  2A4N A;  3BHX A;  3S6G A;  4P10 A;  2EUI A;  2ZPA A;  4YWY A;  5THW A;  4F0Y A;  4XPL A;  3LMS A;  3PGP A;  2GLF A;  4FD4 A;  3D67 A;  4KOT A;  5KTD A;  4M3S A;  4KVX A;  4OC4 A;  2FE7 A;  2R98 A;  1S7K A;  3HUV A;  2ZEL A;  4MFK A;  4DUK A;  4CAF A;  1QSR A;  2AFO A;  2C27 A;  1HDU A;  1M4G A;  4IK2 A;  2Q7B A;  3TO7 A;  4P4J A;  1N71 A;  3IFE A;  3CXP A;  1BLL E;  4AG7 A;  3OWC A;  4C7I A;  5F09 A;  2RC4 A;  2ZOG A;  4NXY A;  4QBJ A;  2ZEG A;  2C1C A;  5IV0 A;  2D4P A;  3SI2 A;  3SXO A;  1QMU A;  1CP6 A;  2PJB A;  3PFO A;  5F48 A;  1FY7 A;  4KOR A;  2PJ8 A;  2ZEP A;  2JDC A;  2XEG A;  2X7B A;  1VHE A;  3DR8 A;  4XNH B;  4XPD C;  5C82 A;  3BLN A;  1CPS A;  1Z5R A;  4R3L A;  2O28 A;  3ZJ0 A;  1CX8 A;  2OZH A;  4J3G A;  4F9V A;  2EK9 A;  5KTA A;  1CG2 A;  1CPX A;  2HV2 A;  5IX3 A;  5LYF A;  5JH9 A;  2GU2 A;  4TNU A;  3F0A A;  3MRU A;  4OKO A;  4MHZ A;  1YSJ A;  3TFY A;  3WC5 A;  3S6H A;  4A2Z A;  1XIX A;  1ZG7 A;  1Z8X A;  4EME A;  2F5I A;  2CTC A;  5AGE A; 
#chains in the Genus database with same CATH homology
 1PU9 A;  3F5B A;  4MFZ A;  1OZP A;  3FBU A;  4UFW A;  4KZT A;  2VXK A;  4YGO A;  4A95 A;  2B3U A;  4CYP A;  4I49 A;  2CNM A;  4IUS A;  3B8G A;  3GY9 A;  2Z3M A;  4JWP A;  5JQ4 A;  2R8V A;  4PSX A;  4CAW A;  4CGO A;  4UCP A;  4CGN A;  2FS5 A;  2FIA A;  4NCZ A;  4XNH C;  4AG9 A;  2PR8 A;  2P6F A;  4YFJ A;  2Z3P A;  3WR7 A;  2FCK A;  1MK4 A;  1M4I A;  4MFL A;  2I00 A;  2PC1 A;  4A33 A;  3QAH A;  4R9M A;  2VZZ A;  3G3S A;  4UA3 A;  4UCM A;  5A28 A;  4HNW B;  2FXF A;  2Z11 A;  2ZW4 A;  1YVO A;  2JDD A;  3BJ7 A;  4A32 A;  4CAV A;  3H5Z A;  5BWA B;  1IIC A;  1I12 A;  4B5P A;  3DR6 A;  3SXN A;  4B12 A;  1YK3 A;  4MFQ A;  2DPS A;  3F8K A;  2DXQ A;  2ZW5 A;  2JEV A;  5GCN A;  3S6K A;  1YX0 A;  3TT2 A;  3FNC A;  2REE A;  2P0W A;  5DWM A;  1IB1 E;  2B58 A;  2Y0M A;  4B10 A;  4H6U A;  2QEC A;  2EVN A;  1S7N A;  4R87 A;  1R57 A;  3R95 A;  1RXT A;  1S7F A;  1XF8 A;  4ORF A;  4KLV A;  4IF5 A;  3BJ8 A;  5CNP A;  4CGP A;  2DPT A;  3TO6 A;  1SQH A;  3QB8 A;  3UY5 A;  1YRE A;  4JXQ A;  4CRY B;  4K30 A;  1J4J A;  4R3K A;  1Y7R A;  3IWE A;  4PSW A;  4RI1 A;  1YR0 A;  2QIR A;  3IWG A;  3R9G A;  3EY5 A;  3FRM A;  4QB9 A;  4HNY B;  4KOX A;  1CM0 A;  4H6Z A;  1V0C A;  3KKW A;  4B5P B;  1IYK A;  3DSB A;  2P6G A;  3K9U A;  4HKF A;  1IYL A;  4KVO E;  3C26 A;  5AG4 A;  3W91 A;  2WUU A;  5A27 A;  4KOY A;  4L89 A;  3VWE A;  2QML A;  3I3G A;  3MGD A;  3P2F A;  3TE4 A;  1I1D A;  3EO4 A;  4C7H A;  1NE9 A;  4OLL A;  4ZBG A;  3R9E A;  2Q4Y A;  3I9S A;  2Q4V A;  4CGL A;  1NMT A;  1B87 A;  2VI7 A;  1YVK A;  4CYQ A;  2VZY A;  4BBH A;  4Y49 C;  1Q2C A;  3PP9 A;  5G1Z A;  2VEZ A;  4B5O A;  4KOU A;  2Q04 A;  4XPK A;  4KUB A;  5ISV A;  2Z3O A;  4AVC A;  2Z0Z A;  2Z10 A;  5AG7 A;  4B14 A;  4F0X A;  3JTK A;  4JXR A;  2G3T A;  3P2H A;  2BEI A;  2PSW A;  3TOB A;  3IGR A;  2FT0 A;  1VKC A;  5KTC A;  2CNT A;  4R57 A;  3RYO A;  2ARH A;  5AG6 A;  2Z3N A;  3PZJ A;  1WK4 A;  3E0K A;  4LUA A;  4E8O A;  4OAE A;  4B11 A;  3D8P A;  2B4D B;  3G8W A;  4MI4 A;  3EXN A;  3FB3 A;  4UFV A;  4CRZ B;  2B5G B;  5HMN A;  4M85 A;  4EVY A;  2JLM A;  3LOD A;  1ZO0 A;  2CNS A;  2B3V A;  2B4B A;  3D2M A;  1KUX A;  4RS2 A;  4AB7 A;  2Z3L A;  3N7Z A;  2J8R A;  1YGH A;  2YND A;  3W6S A;  2J8M A;  2FIW A;  2OZU A;  3TOA A;  2GIV A;  4ONU A;  1Q2Y A;  1Z4E A;  4QC6 A;  2GE3 A;  4YRH A;  2YGW A;  3DNS A;  4KOV A;  4X5K A;  2G0B A;  4NF1 A;  1IID A;  1KUV A;  3R1K A;  1KUY A;  3SHP A;  1S7L A;  4JJX A;  4CGM A;  4C2X A;  3VWD A;  2VQY A;  1MJA A;  5C88 A;  4AVA A;  1P4N A;  3A9L A;  1XMT A;  1RO5 A;  5IB0 A;  5G22 A;  3R96 A;  2FL4 A;  3NE7 A;  4C2Y A;  2Q44 A;  4CS0 B;  3TTH A;  1XE4 A;  1U6M A;  4Y49 B;  2YNE A;  3D2P A;  4AVB A;  3T9Y A;  1WWZ A;  1Z4R A;  1L0C A;  3EC4 A;  4KSA A;  2BSW A;  1Y9K A;  2HQY A;  1K4J A;  2G3A A;  1BOB A;  1Y9W A;  1LRZ A;  4UFX A;  1QST A;  4C2Z A;  2NMT A;  5AG5 A;  4H89 A;  4PV6 A;  5G20 A;  4KOW A;  4UCN A;  1PUA A;  2KCW A;  4KSF A;  2B4D A;  3ZZI A;  2REF A;  3JUW A;  3TO9 A;  2B5G A;  2PR1 A;  1P0H A;  4CAE A;  3DDD A;  2R1I A;  3CXS A;  3EFA A;  2PRB A;  4B13 A;  2OU2 A;  2H5M A;  2D4O A;  5I0C A;  4MJ8 A;  4FD6 A;  4A31 A;  3FIX A;  1BO4 A;  2OB0 A;  4KLW A;  5H84 A;  4ZGY B;  2R7H A;  3CXQ A;  4QVT A;  1S3Z A;  5EBV A;  2PDO A;  3T90 A;  5F46 A;  4CYO A;  2YNC C;  1I21 A;  4C68 A;  1S5K A;  2P6E A;  3S6F A;  4DNC A;  5G21 A;  4QUS A;  1QSO A;  2CY2 A;  4KS9 A;  1Z9U A;  3GYA A;  1YLE A;  3V8I A;  2GAN A;  1S60 A;  4II9 A;  4U5Y A;  1QSM A;  4UWJ A;  4E0A A;  3H4Q A;  4UBR A;  2BL1 A;  4LX9 A;  5H86 A;  2ZW6 A;  5J8C A;  2HUZ A;  4U9Y A;  4NSQ A;  5DWN A;  1KZF A;  4MFJ A;  4KUA A;  1ON0 A;  1B6B A;  5FVJ A;  4OAD A;  2Z3K A;  4FD5 A;  3R9F A;  4MFP A;  4JD6 A;  2ZXV A;  2PQ8 A;  3FYN A;  3IU1 A;  4PK2 A;  5JPH A;  1UFH A;  1TIQ A;  2CXA A;  4HNX B;  4A30 A;  5EC4 A;  5F47 A;  3FXT A;  3IU2 A;  1CJW A;  3LD2 A;  2I79 A;  4L8A A;  4UWI A;  5F49 A;  1MJB A;  2IL4 A;  2OH1 A;  4GS4 A;  2YNC A;  2WPX A;  3JVN A;  1M1D A;  4U9Z A;  5HH1 A;  4KVM E;  4PK3 A;  2BUE A;  2J8N A;  2WPW A;  4FD7 A;  2K5T A;  2WSA A;  4MY3 A;  3TCV A;  4KOS A;  2AE6 A;  4CAX A;  4BMH A;  2AJ6 A;  4MY0 A;  4NEX A;  5E96 A;  4MHD A;  2OZG A;  1NSL A;  4Q38 A;  1XEB A;  2Q0Y A;  2ATR A;  1GHE A;  3GKR A;  2VBQ A;  1Q2D A;  4F6A A;  1M44 A;  1VHS A;  1QSN A;  4MBU A;  4JLY A;  4XPD B;  4Q36 A;  3W6X A;  3D3S A;  2FSR A;  5J8F A;  4E2A A;  1M4D A;  4CYN A;  2ZW7 A;  1MJ9 A;  2A4N A;  3S6G A;  2EUI A;  2ZPA A;  4F0Y A;  4XPL A;  3PGP A;  4FD4 A;  4KOT A;  5KTD A;  4M3S A;  4KVX A;  2FE7 A;  2R98 A;  1S7K A;  4MFK A;  4CAF A;  1QSR A;  2C27 A;  1M4G A;  2Q7B A;  3TO7 A;  4AG7 A;  1N71 A;  3CXP A;  4C7I A;  3OWC A;  2RC4 A;  4NXY A;  4QBJ A;  5IV0 A;  2D4P A;  3SXO A;  5F48 A;  1FY7 A;  4KOR A;  2JDC A;  2X7B A;  3DR8 A;  4XNH B;  4XPD C;  5C82 A;  3BLN A;  4R3L A;  2O28 A;  3ZJ0 A;  2OZH A;  4J3G A;  5KTA A;  5IX3 A;  2HV2 A;  3F0A A;  3TFY A;  3S6H A;  4A2Z A;  1XIX A;  2F5I A;  5AGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...