3KKWA

Crystal structure of his-tagged form of pa4794 protein
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
178
structure length
166
Chain Sequence
SHHHHHHMQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of His-tagged form of PA4794 protein
rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Transferase
molecule keywords Putative uncharacterized protein
total genus 43
structure length 166
sequence length 178
ec nomenclature
pdb deposition date 2009-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3kkwA01
1Y9KA 4ORFA 4PK3A 2Q04A 3TO7A 3C26A 2CNTA 2R98A 4KORA 2GANA 4R3LA 4EVYA 5I0CA 1NMTA 4KVOE 1XEBA 2FE7A 1M44A 2PR1A 5KTAA 5IX3A 3DR8A 1TIQA 3JVNA 4I49A 3PZJA 1U6MA 2FL4A 2P0WA 2P6GA 2REFA 3EY5A 4II9A 2I00A 2O28A 2RC4A 1YR0A 5JPHA 1P4NA 4KOYA 4KOTA 4IF5A 2PQ8A 2Q7BA 3T90A 3LODA 5DWMA 1L0CA 4H89A 2FT0A 1Z4RA 4QB9A 4MI4A 4IUSA 3B8GA 3DR6A 4YRHA 1KUVA 3G3SA 1XIXA 2G3TA 1S7NA 4JD6A 4AG7A 2F5IA 3RYOA 2JEVA 3SXOA 4AVAA 4MHDA 1IYKA 2PRBA 2OU2A 4KOWA 5F48A 3GKRA 1KUXA 3CXPA 1MK4A 4CS0B 1WK4A 2J8RA 2VZZA 1S7KA 1SQHA 2B5GA 5H86A 3R95A 5J8CA 4YGOA 2VQYA 4M85A 2JDDA 3EC4A 3H4QA 3CXQA 1YVOA 4PV6A 4UBRA 2QECA 4H6UA 3PP9A 4QBJA 3KKWA 5EC4A 2PR8A 5F46A 3FYNA 4OAEA 3R9EA 1B6BA 4JJXA 2FS5A 3R1KA 2CNMA 3EO4A 4AVBA 4NEXA 2WPWA 4XNHB 4J3GA 1CM0A 3I3GA 1YX0A 4KVXA 1S7FA 1IYLA 2AE6A 2AJ6A 2EUIA 2H5MA 1M4GA 4DNCA 2Z11A 4NXYA 3IGRA 4ONUA 4XPKA 4ZBGA 4NCZA 4XPDC 1Q2DA 2JLMA 1P0HA 5H84A 1I1DA 2VBQA 5DWNA 2VEZA 1MJ9A 1IIDA 1XMTA 5F47A 2HQYA 3P2HA 4KZTA 2B3UA 2FSRA 3I9SA 3F0AA 2OZUA 1J4JA 3EFAA 1Y7RA 3SXNA 5JQ4A 1B87A 3GY9A 2DXQA 2VZYA 1YREA 3CXSA 3WR7A 4L8AA 3QAHA 2B58A 4XNHC 3R96A 3V8IA 1PU9A 1IB1E 2HV2A 4HNYB 2B4BA 1MJBA 1OZPA 1S7LA 2QMLA 5EBVA 3D2MA 1BOBA 1R57A 3ZZIA 1VHSA 3E0KA 4E2AA 3S6FA 4PSWA 3DDDA 4B5PA 2ZW7A 5KTDA 5HMNA 2Q4YA 1YLEA 1FY7A 5ISVA 2FXFA 5F49A 4FD5A 1K4JA 2K5TA 2JDCA 3TFYA 3P2FA 4PSXA 2OZHA 1YGHA 3IWGA 2OH1A 2ARHA 4XPDB 4YFJA 1UFHA 5FVJA 1ON0A 1I12A 3TTHA 4XPLA 2Z0ZA 4MY0A 4KLWA 4B5OA 4U5YA 2Z10A 4AVCA 4NSQA 2IL4A 2PDOA 4KLVA 3S6GA 3QB8A 3R9FA 2ZXVA 2BEIA 1N71A 4X5KA 3EXNA 3TOBA 2B4DA 3W91A 3SHPA 4K30A 1RO5A 4KUBA 4KVME 1Z9UA 4JXQA 4BMHA 4OADA 4KUAA 2G3AA 2ATRA 5IV0A 3D8PA 4LUAA 4CRYB 4RS2A 2I79A 5KTCA 1XE4A 1YK3A 4CRZB 1QSNA 2QIRA 4L89A 5IB0A 2FIAA 4U9ZA 5E96A 3BLNA 1KUYA 3DNSA 3F8KA 4R3KA 1Q2YA 1I21A 4U9YA 5C88A 2D4OA 2B4DB 3W6SA 1BO4A 4NF1A 3FNCA 2Y0MA 2D4PA 3K9UA 1M4DA 1NE9A 2J8NA 1Y9WA 4KOVA 2BL1A 3R9GA 3PGPA 4R57A 5J8FA 2OZGA 3S6HA 4JXRA 2ZW6A 3OWCA 5GCNA 1NSLA 3TCVA 3VWEA 3TT2A 2ZPAA 2OB0A 4MBUA 3UY5A 1WWZA 5C82A 1VKCA 2REEA 3FXTA 4MY3A 1V0CA 3G8WA 5CNPA 1Z4EA 4JLYA 3TO6A 3JUWA 4UWJA 2VXKA 1M1DA 1XF8A 3N7ZA 1KZFA 4CAVA 1YVKA 2Q0YA 4KOSA 4R87A 3DSBA 2PC1A 2ZW4A 4F0YA 1M4IA 2EVNA 2CY2A 3BJ7A 1RXTA 4MJ8A 4H6ZA 2A4NA 4HNXB 4CAXA 4QC6A 1PUAA 2PSWA 2CNSA 4AB7A 3VWDA 4PK2A 2P6FA 4M3SA 4QVTA 4FD4A 3FBUA 2J8MA 4Y49B 4RI1A 3TE4A 2HUZA 1IICA 4E8OA 2WPXA 4JWPA 2FCKA 1GHEA 4HKFA 1QSTA 3GYAA 3FIXA 4AG9A 4F6AA 4E0AA 3NE7A 4LX9A 1LRZA 1QSMA 1Q2CA 1QSRA 2KCWA 4FD7A 3F5BA 4UWIA 1S5KA 3LD2A 3D2PA 1CJWA 2VI7A 4HNWB 4GS4A 2G0BA 4OLLA 2R7HA 2X7BA 1S3ZA 3BJ8A 1QSOA 3ZJ0A 2FIWA 2R8VA 1S60A 2Q4VA 4KOUA 2C27A 2NMTA 4FD6A 3FRMA 4KOXA 3T9YA 2Q44A 4QUSA 2R1IA 2GE3A 4Y49C 3MGDA 2BSWA 5HH1A 2ZW5A 4UA3A 3D3SA 3TO9A 3TOAA 3W6XA 2B5GB 2GIVA 4R9MA 2BUEA 2P6EA 4B5PB 1MJAA 3S6KA 2B3VA 4CAWA 3FB3A
chains in the Genus database with same CATH superfamily
1IY7A 1FT7A 1Y9KA 1AYEA 4ORFA 5CBMA 4PK3A 4ZX8A 2Q04A 3TO7A 3C26A 2CNTA 2CTCA 2R98A 4EMEA 4KORA 2GANA 4R3LA 4EVYA 4A95A 3D7GA 5I0CA 1NMTA 4KVOE 3FH4A 2GFQA 2QYVA 4C7IA 4F8ZA 1NSAA 1XEBA 2Z3OA 1H8LA 2FE7A 3JRUA 2AFOA 1M44A 1ZLHA 2C6GA 2PR1A 3PRTA 5IX3A 5KTAA 1XJOA 2HB6A 4JZ0A 3DR8A 4UCMA 2PJ6A 4M6GA 1TIQA 3JVNA 4I49A 3SJGA 1YQEA 3PZJA 1U6MA 2FL4A 2P0WA 2XEFA 2OOTA 3SI0A 4P4FA 2CIJA 2P6GA 1A2ZA 2REFA 2WUUA 3EY5A 2I00A 2O28A 2RC4A 2ZEEA 5D8NA 3SI1A 1YR0A 3IFEA 4JYWA 1P4NA 1JQGA 5JPHA 8CPAA 4KOYA 3VATA 3B3CA 4KOTA 4IF5A 2PQ8A 2V8HA 2Q7BA 3T90A 4P4BA 2F7VA 2JBKA 3LODA 4RN7A 5DWMA 1L0CA 3HLPA 4H89A 3D7FA 2FT0A 1Z4RA 3B3SA 4WJBA 4QB9A 4MI4A 3IEHA 4NJRA 4A94A 4IUSA 1AMPA 1BLLE 3B8GA 1IU8A 2PJ3A 3DR6A 4YRHA 4EFDA 1KUVA 3G3SA 1XIXA 2Q43A 2G3TA 3D66A 2ZENA 3H8EA 1S7NA 1ZG9A 4JD6A 7CPAA 3WC6A 4AG7A 4CGOA 2F5IA 4OC5A 3RYOA 3CPAA 2JEVA 3SXOA 4CAEA 4RUHA 4ZY0A 5AG4A 4ZI6A 5LRKA 4CYQA 2PVVA 5LRGA 1R3NA 4AVAA 4MHDA 5IV0A 1ZO0A 3LMSA 1IYKA 3S9NA 2NYQA 2PRBA 1LAPA 1GYTA 4UIAA 5JH9A 2OU2A 4NGNA 4KOWA 5F48A 5IB9A 3GKRA 2RFHA 1Z8LA 5LYDA 4OIWA 1KUXA 3CXPA 1MK4A 4CS0B 3PB8X 1WK4A 2Z3PA 3IWWA 4TNUA 2J8RA 2VZZA 1S7KA 3D7HA 4LQGA 5K8OA 5K8PA 2Z3NA 1BAVA 1SQHA 4WWVA 4UEEA 2B5GA 5H86A 3R95A 5J8CA 4MHYA 4YGOA 2VQYA 3DGVA 4ZYQA 4M85A 2POKA 2V8GA 2JDDA 3B3TA 3EC4A 4B11A 2O53A 3H4QA 3CPXA 3CXQA 1LCPA 1YVOA 4CGNA 3N5FA 4ZY1A 1Y0YA 2PJ5A 4PV6A 1R43A 4H2KA 2QECA 4UBRA 4G1PA 4H6UA 5AGEA 2ZEHA 3PP9A 1VHEA 1TF9A 3B3VA 4QBJA 3KKWA 4P44A 2PR8A 5EC4A 3FYNA 4OAEA 4B12A 2PJ0A 3R9EA 1B6BA 3KQZA 2FS5A 2CNMA 3GLJA 3L2NA 3JTKA 3R1KA 4JJXA 3EO4A 2YNCA 4UFVA 2BOAA 4AVBA 4NEXA 1ZG7A 2WPWA 3SJXA 4MFQA 4NFRA 4XNHB 2ZEDA 3CDXA 4J3GA 3PB9X 4A33A 1CM0A 3I3GA 1YX0A 4DYOA 2AFUA 4KVXA 2Z3MA 1S7FA 1IYLA 2AE6A 3S9MA 2AJ6A 2EUIA 1XOVA 2H5MA 4M6IA 1M4GA 4DNCA 2QVPA 3D4UA 2ZOGA 4B13A 2Z11A 1IOFA 2EBJA 4NXYA 3IGRA 4ONUA 3BI0A 4UCPA 4XPKA 4ZBGA 3IWEA 4NCZA 4XPDC 2PJBA 3CZXA 1Q2DA 1YLOA 4BD9A 2JLMA 5G20A 1P0HA 5H84A 1I1DA 2VBQA 5DWNA 1VIXA 4R6TA 2VEZA 4YU9A 2V77A 1MJ9A 1LAMA 1IIDA 1XMTA 4MFKA 5F47A 4CPAA 4B14A 4ZX9A 2HQYA 3P2HA 2ODFA 4MHZA 3TC8A 5F46A 3RZAA 4KZTA 1Q7LA 2B3UA 4GM5A 2FSRA 3I9SA 5A28A 1DE4C 3F0AA 2OZUA 1J4JA 1LFWA 4NGQA 4PPZA 4OKOA 3EFAA 3BXMA 4MCPA 2WZNA 3KL9A 4UFXA 1YW4A 1Y7RA 4P4DA 4W9YA 2NSMA 3SXNA 5JQ4A 1B87A 3GY9A 4OC3A 2DXQA 2VZYA 4F0XA 1YREA 2JBJA 3MN8A 3QNVA 5ELYA 3CXSA 3WR7A 4L8AA 1Z2LA 3QAHA 2B58A 2PVWA 4XNHC 3GUXA 5AG5A 3R96A 3V8IA 4OMEA 4CAFA 2PJAA 1PCAA 1PU9A 1IB1E 3KHXA 4A30A 2HV2A 4HNYB 2B4BA 4UEFA 1MJBA 1OZPA 1TKFA 1S7LA 2EK8A 2Q4ZA 2QMLA 4MFPA 5EBVA 5F09A 3S9LA 2GLFA 3PBBA 5EMIA 1DTDA 1XRYA 3SJFA 4A32A 3D2MA 1BOBA 2PJCA 4ZY2A 2DF5A 1R57A 3ZZIA 4PXDA 1VHSA 3E0KA 4E2AA 3S6FA 4PSWA 1RTQA 1QMUA 1QQ9A 3DDDA 4C7HA 2I3CA 3LACA 4B5PA 4EWTA 2GREA 2ZW7A 4BINA 2DEAA 4MHNA 5KTDA 1KWMA 2EO8A 1Y0RA 3PB6X 4A37A 1Z8WA 5HMNA 2Q4YA 1YLEA 2XEGA 4IK2A 3FF3A 3QAYA 1OBRA 4KSFA 1FY7A 3KHZA 1PYTB 1XMBA 5ISVA 2FXFA 5F49A 2Z3KA 4FD5A 1K4JA 2K5TA 3PBEA 4OIDA 4OC2A 2JDCA 4FBEA 3TFYA 3KASA 3FMCA 3P2FA 4PSXA 2OZHA 4P10A 1YSJA 2ANPA 1YGHA 3VARA 3IWGA 2OH1A 2GU2A 3K2KA 1ARMA 2ARHA 2BCOA 4IAVA 3KGQA 2DPSA 1HDQA 4XPDB 4OP4A 3FEDA 4YFJA 1UFHA 2C1CA 1F2PA 4Q38A 5FVJA 4PXCA 1ON0A 1I12A 3TTHA 4XPLA 4MCQA 3RAMA 2Z0ZA 3B3WA 4MY0A 4KLWA 4B5OA 4BBHA 4U5YA 2Z10A 3KQXA 4MMOA 4AVCA 4NGPA 4NSQA 2IL4A 2PDOA 4KLVA 4OC4A 3S6GA 3QB8A 4MHPA 3R9FA 1VGYA 2ZXVA 2BEIA 1N71A 1ZG8A 4X5KA 2V8DA 1TKHA 1CP7A 2IQ6A 1LANA 3EXNA 1YW6A 2EWBA 4MFLA 3A9LA 3IO1A 5BWAB 1BPNA 3TOBA 4OC0A 4KSIA 2B4DA 4Q7AA 2V8VA 4X8IA 3W91A 3SHPA 5CPAA 3BI1A 2QJ8A 4K30A 5AG7A 1RO5A 3NH4A 3KI9A 3D7DA 3FX6A 3NH8A 3NH5A 2C6CA 4KUBA 4NGMA 4KVME 3D68A 1Z9UA 2Q51A 2G9DA 4FUUA 4JXQA 4BMHA 4OADA 4KUAA 2G3AA 2ATRA 1TKJA 1LOKA 3D8PA 4LUAA 3WABA 4TWEA 4CRYB 4RS2A 2I79A 5AG6A 2PJ7A 3WT4A 3I1UA 1ELMP 5KTCA 4MCRA 1XE4A 1YK3A 3D67A 4CRZB 3FJUA 1QSNA 2QIRA 2YNDA 3K9TA 4L89A 5IB0A 1ARLA 4X3RA 2FIAA 4A31A 4P4JA 4MFJA 2EK9A 4U9ZA 5E96A 3BLNA 1TF8A 1KUYA 3DNSA 3F8KA 1X12A 5G22A 2AFXA 2XEIA 4C2XA 2Q7SA 3H8FA 4R3KA 4MXUA 5G1ZA 1Q2YA 1I21A 2PJ1A 4U9YA 4B6ZA 5C88A 4X2TA 6CPAA 4O23A 2D4OA 2B4DB 3W6SA 1ZLIA 1BO4A 4C2ZA 4NF1A 4CYNA 3FNCA 2Y0MA 4AXVA 2AFWA 3KR4A 3NA6A 2D4PA 3K9UA 4ONWA 3VH9A 2PJ9A 2VL1A 4A38A 1M4DA 3B2YA 1NE9A 2J8NA 1Y9WA 2AFMA 2Z3LA 3ISXA 4KOVA 2BL1A 3R9GA 1CBXA 3KZWA 3PB7X 3PGPA 4MFZA 4R57A 5J8FA 2OZGA 1XFOA 3S6HA 4JXRA 2CXAA 1EE3P 2ZW6A 3OWCA 4UFWA 5GCNA 1NSLA 2ZEFA 3HUVA 3TCVA 3WC5A 1HEEA 1XBUA 3VWEA 4R7MA 1BPMA 3PFOA 1Z8TA 2ABZA 1IOIA 1AUGA 2PJ8A 2WSAA 4FAIA 2OR4A 3TT2A 2J9AA 2ZPAA 2OB0A 4MBUA 5HVHA 3T8WA 3UY5A 1F57A 1WWZA 2PCUA 5G21A 5C82A 1VKCA 2PJ4A 4F9VA 2REEA 3FXTA 4MY3A 1TXRA 1V0CA 3G8WA 4Q36A 3BHXA 3H5ZA 1Z4EA 5CNPA 4JLYA 3SI2A 2XEJA 3TO6A 1VHOA 2DPTA 2ZELA 3JUWA 4UWJA 2BO9A 2VXKA 1M1DA 1XF8A 3N7ZA 3RBUA 1KZFA 4CAVA 1YVKA 2FVGA 2Q0YA 4NJQA 4KOSA 4R87A 2ZOFA 4CYPA 2HC9A 5LRJA 2C6PA 2IJZA 3DSBA 4C68A 2PIZA 4M6HA 4GXHA 2PC1A 3GIUA 5LYIA 4DUKA 2ZW4A 2IMOA 3GB0A 5D29A 1Z5RA 4F0YA 1M4IA 2EVNA 4LQ6A 2CY2A 3BJ7A 4P4IA 3V7ZA 2AFZA 1RXTA 4MJ8A 4P6YA 4H6ZA 2A4NA 4HNXB 4CGMA 4CAXA 3PFEA 4QC6A 1PUAA 3FVLA 2PSWA 3IC1A 5LYLA 2CNSA 3RO0A 4AB7A 3VWDA 4PK2A 2P6FA 4M3SA 4CGLA 3ISZA 4QVTA 1CX8A 4FD4A 3FBUA 4P45A 4ZGYB 2J8MA 1JWQA 4RI1A 4Y49B 3TE4A 2HUZA 1IICA 4C2YA 2YNEA 1HDUA 5DS0A 4E8OA 5LYFA 2WPXA 4JWPA 2FCKA 4FWUA 5K8MA 2JEWA 1GHEA 2ZEMA 2PRQA 1QSTA 4HKFA 4MRIA 3GYAA 4IHMA 3FIXA 1CG2A 4R8FA 3WC7A 4AG9A 4UIBA 4YWYA 1CP6A 4NGTA 4F6AA 5J1QA 4II9A 4CYOA 4E0AA 3NE7A 3SJEA 1LRZA 4LX9A 1QSMA 1Q2CA 4K3NA 3H8GA 1IGBA 1QSRA 2KCWA 4FD7A 3F5BA 4OC1A 4UWIA 3IJ3A 2YNCC 1S5KA 1Y7EA 1FNOA 3IU2A 4UCNA 4KS9A 3LD2A 3D2PA 4A2ZA 1YMEA 4NGRA 4KSAA 1CJWA 4Z65A 5HVGA 1M4LA 4B10A 4F9UA 5JGFA 2VI7A 3NE8A 5A27A 3DLJA 1UWYA 4HNWB 3B35A 4GS4A 2G0BA 4OLLA 1X10A 2YGWA 5I4MA 2R7HA 3LWUA 3IIBA 2X7BA 1S3ZA 1Z8XA 3BJ8A 3PEIA 4MCSA 3RNZA 1QSOA 2AFSA 5HVFA 5K8NA 3MRUA 3ZJ0A 3TX8A 3NFZA 2FIWA 2R8VA 1S60A 2Q4VA 4KOUA 3KR5A 4A39A 4CGPA 3B7IA 2C27A 2PE3A 4P4EA 3V38A 2NMTA 4FD6A 3FRMA 2PJ2A 4KOXA 3T9YA 2GLJA 2RB7A 5THWA 4R76A 2Q44A 4QUSA 2R1IA 2WYRA 2GE3A 4Y49C 3MGDA 4UEZA 2BSWA 2F8HA 5JM6A 3CT9A 1CPSA 4UF4A 1F2OA 4NGSA 5HH1A 4PXBA 2ZW5A 4UA3A 3D3SA 2ZEPA 3TO9A 2PIYA 2CTBA 2CF4A 3TOAA 3W6XA 4DJLA 2B5GB 2O4HA 2GIVA 4PQAA 4R9MA 2BUEA 2P6EA 4B5PB 1ELLP 1MJAA 3S6KA 5HXDA 4PXEA 2B3VA 4CAWA 3FECA 1CPXA 3PB4X 2ZEGA 3FEEA 2ZEOA 4HPSA 3IU1A 3FB3A
chains in the Genus database with same CATH topology
1Y9KA 4ORFA 4PK3A 2Q04A 3TO7A 3C26A 2CNTA 2R98A 4KORA 2GANA 4R3LA 4EVYA 4A95A 5I0CA 1NMTA 4KVOE 4C7IA 1XEBA 2Z3OA 2FE7A 1M44A 2PR1A 5KTAA 5IX3A 3DR8A 4UCMA 1TIQA 3JVNA 4I49A 3PZJA 1U6MA 2FL4A 2P0WA 2P6GA 2REFA 2WUUA 3EY5A 4II9A 2I00A 2O28A 2RC4A 1YR0A 5JPHA 1P4NA 4KOYA 4KOTA 4IF5A 2PQ8A 2Q7BA 3T90A 3LODA 5DWMA 1L0CA 4H89A 2FT0A 1Z4RA 4QB9A 4MI4A 4IUSA 3B8GA 3DR6A 4YRHA 1KUVA 3G3SA 1XIXA 2G3TA 1S7NA 4JD6A 4AG7A 4CGOA 2F5IA 3RYOA 2JEVA 3SXOA 4CAEA 5AG4A 4CYQA 4AVAA 4MHDA 1ZO0A 1IYKA 2PRBA 2OU2A 4KOWA 5F48A 3GKRA 1KUXA 3CXPA 1MK4A 4CS0B 1WK4A 2Z3PA 2J8RA 2VZZA 1S7KA 2Z3NA 1SQHA 2B5GA 5H86A 3R95A 5J8CA 4YGOA 2VQYA 4M85A 2JDDA 3EC4A 4B11A 3H4QA 3CXQA 1YVOA 4CGNA 4PV6A 4UBRA 2QECA 4H6UA 5AGEA 3PP9A 4QBJA 3KKWA 5EC4A 2PR8A 4B12A 3FYNA 4OAEA 5F46A 3R9EA 1B6BA 4JJXA 2FS5A 3R1KA 2CNMA 3JTKA 4UFVA 3EO4A 2YNCA 4AVBA 4NEXA 2WPWA 4MFQA 4XNHB 4A33A 4J3GA 1CM0A 3I3GA 1YX0A 4KVXA 2Z3MA 1S7FA 1IYLA 2AE6A 2AJ6A 2EUIA 2H5MA 1M4GA 4DNCA 4B13A 2Z11A 4NXYA 3IGRA 4ONUA 4UCPA 4XPKA 4ZBGA 3IWEA 4NCZA 4XPDC 1Q2DA 2JLMA 5G20A 1P0HA 5H84A 1I1DA 2VBQA 5DWNA 2VEZA 1MJ9A 1IIDA 1XMTA 4MFKA 5F47A 4B14A 2HQYA 3P2HA 4KZTA 2B3UA 2FSRA 3I9SA 5A28A 3F0AA 2OZUA 1J4JA 3EFAA 4UFXA 1Y7RA 3SXNA 5JQ4A 1B87A 3GY9A 2DXQA 2VZYA 4F0XA 1YREA 3CXSA 3WR7A 4L8AA 3QAHA 2B58A 4XNHC 5AG5A 3R96A 3V8IA 4CAFA 1PU9A 4A30A 1IB1E 2HV2A 4HNYB 2B4BA 1MJBA 1OZPA 1S7LA 2QMLA 4MFPA 5EBVA 4A32A 3D2MA 1BOBA 1R57A 3ZZIA 1VHSA 3E0KA 4E2AA 3S6FA 4PSWA 3DDDA 4C7HA 4B5PA 2ZW7A 5KTDA 5HMNA 2Q4YA 1YLEA 4KSFA 1FY7A 5ISVA 2FXFA 5F49A 2Z3KA 4FD5A 1K4JA 2K5TA 2JDCA 3TFYA 3P2FA 4PSXA 2OZHA 1YGHA 3IWGA 2OH1A 2ARHA 2DPSA 4XPDB 4YFJA 1UFHA 5FVJA 4Q38A 1ON0A 1I12A 3TTHA 4XPLA 2Z0ZA 4MY0A 4KLWA 4B5OA 4BBHA 4U5YA 2Z10A 4AVCA 4NSQA 2IL4A 2PDOA 4KLVA 3S6GA 3QB8A 3R9FA 2ZXVA 2BEIA 1N71A 4X5KA 3EXNA 4MFLA 3A9LA 5BWAB 3TOBA 2B4DA 3W91A 3SHPA 4K30A 5AG7A 1RO5A 4KUBA 4KVME 1Z9UA 4JXQA 4BMHA 4OADA 4KUAA 2G3AA 2ATRA 5IV0A 3D8PA 4LUAA 4CRYB 4RS2A 2I79A 5AG6A 5KTCA 1XE4A 1YK3A 4CRZB 1QSNA 2QIRA 2YNDA 4L89A 5IB0A 2FIAA 4A31A 4MFJA 4U9ZA 5E96A 3BLNA 1KUYA 3DNSA 3F8KA 5G22A 4C2XA 4R3KA 5G1ZA 1Q2YA 1I21A 4U9YA 5C88A 2D4OA 2B4DB 3W6SA 4C2ZA 1BO4A 4NF1A 4CYNA 3FNCA 2Y0MA 2D4PA 3K9UA 1M4DA 1NE9A 2J8NA 1Y9WA 2Z3LA 4KOVA 2BL1A 3R9GA 3PGPA 4MFZA 4R57A 5J8FA 2OZGA 3S6HA 4JXRA 2CXAA 2ZW6A 3OWCA 4UFWA 5GCNA 1NSLA 3TCVA 3VWEA 2WSAA 3TT2A 2ZPAA 2OB0A 4MBUA 3UY5A 1WWZA 5G21A 5C82A 1VKCA 2REEA 3FXTA 4MY3A 1V0CA 3G8WA 4Q36A 3H5ZA 1Z4EA 5CNPA 4JLYA 3TO6A 2DPTA 3JUWA 4UWJA 2VXKA 1M1DA 1XF8A 3N7ZA 1KZFA 4CAVA 1YVKA 2Q0YA 4KOSA 4R87A 4CYPA 3DSBA 4C68A 2PC1A 2ZW4A 4F0YA 1M4IA 2EVNA 2CY2A 3BJ7A 1RXTA 4MJ8A 4H6ZA 2A4NA 4HNXB 4CGMA 4CAXA 4QC6A 1PUAA 2PSWA 2CNSA 4AB7A 3VWDA 4PK2A 2P6FA 4M3SA 4CGLA 4QVTA 4FD4A 3FBUA 4ZGYB 2J8MA 4Y49B 4RI1A 3TE4A 2HUZA 1IICA 4C2YA 2YNEA 4E8OA 2WPXA 4JWPA 2FCKA 1GHEA 4HKFA 1QSTA 3GYAA 3FIXA 4AG9A 4F6AA 4CYOA 4E0AA 3NE7A 4LX9A 1LRZA 1QSMA 1Q2CA 1QSRA 2KCWA 4FD7A 3F5BA 4UWIA 2YNCC 1S5KA 3IU2A 4UCNA 4KS9A 3LD2A 3D2PA 4A2ZA 4KSAA 1CJWA 4B10A 2VI7A 5A27A 4HNWB 4GS4A 2G0BA 4OLLA 2YGWA 2R7HA 2X7BA 1S3ZA 3BJ8A 1QSOA 3ZJ0A 2FIWA 2R8VA 1S60A 2Q4VA 4KOUA 4CGPA 2C27A 2NMTA 4FD6A 3FRMA 4KOXA 3T9YA 2Q44A 4QUSA 2R1IA 2GE3A 4Y49C 3MGDA 2BSWA 5HH1A 2ZW5A 4UA3A 3D3SA 3TO9A 3TOAA 3W6XA 2B5GB 2GIVA 4R9MA 2BUEA 2P6EA 4B5PB 1MJAA 3S6KA 2B3VA 4CAWA 3IU1A 3FB3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y9K A;  4ORF A;  4PK3 A;  2Q04 A;  3TO7 A;  3C26 A;  2CNT A;  2R98 A;  4KOR A;  2GAN A;  4R3L A;  4EVY A;  5I0C A;  1NMT A;  4KVO E;  1XEB A;  2FE7 A;  1M44 A;  2PR1 A;  5KTA A;  5IX3 A;  3DR8 A;  1TIQ A;  3JVN A;  4I49 A;  3PZJ A;  1U6M A;  2FL4 A;  2P0W A;  2P6G A;  2REF A;  3EY5 A;  4II9 A;  2I00 A;  2O28 A;  2RC4 A;  1YR0 A;  5JPH A;  1P4N A;  4KOY A;  4KOT A;  4IF5 A;  2PQ8 A;  2Q7B A;  3T90 A;  3LOD A;  5DWM A;  1L0C A;  4H89 A;  2FT0 A;  1Z4R A;  4QB9 A;  4MI4 A;  4IUS A;  3B8G A;  3DR6 A;  4YRH A;  1KUV A;  3G3S A;  1XIX A;  2G3T A;  1S7N A;  4JD6 A;  4AG7 A;  2F5I A;  3RYO A;  2JEV A;  3SXO A;  4AVA A;  4MHD A;  1IYK A;  2PRB A;  2OU2 A;  4KOW A;  5F48 A;  3GKR A;  1KUX A;  3CXP A;  1MK4 A;  4CS0 B;  1WK4 A;  2J8R A;  2VZZ A;  1S7K A;  1SQH A;  2B5G A;  5H86 A;  3R95 A;  5J8C A;  4YGO A;  2VQY A;  4M85 A;  2JDD A;  3EC4 A;  3H4Q A;  3CXQ A;  1YVO A;  4PV6 A;  4UBR A;  2QEC A;  4H6U A;  3PP9 A;  4QBJ A;  3KKW A;  5EC4 A;  2PR8 A;  5F46 A;  3FYN A;  4OAE A;  3R9E A;  1B6B A;  4JJX A;  2FS5 A;  3R1K A;  2CNM A;  3EO4 A;  4AVB A;  4NEX A;  2WPW A;  4XNH B;  4J3G A;  1CM0 A;  3I3G A;  1YX0 A;  4KVX A;  1S7F A;  1IYL A;  2AE6 A;  2AJ6 A;  2EUI A;  2H5M A;  1M4G A;  4DNC A;  2Z11 A;  4NXY A;  3IGR A;  4ONU A;  4XPK A;  4ZBG A;  4NCZ A;  4XPD C;  1Q2D A;  2JLM A;  1P0H A;  5H84 A;  1I1D A;  2VBQ A;  5DWN A;  2VEZ A;  1MJ9 A;  1IID A;  1XMT A;  5F47 A;  2HQY A;  3P2H A;  4KZT A;  2B3U A;  2FSR A;  3I9S A;  3F0A A;  2OZU A;  1J4J A;  3EFA A;  1Y7R A;  3SXN A;  5JQ4 A;  1B87 A;  3GY9 A;  2DXQ A;  2VZY A;  1YRE A;  3CXS A;  3WR7 A;  4L8A A;  3QAH A;  2B58 A;  4XNH C;  3R96 A;  3V8I A;  1PU9 A;  1IB1 E;  2HV2 A;  4HNY B;  2B4B A;  1MJB A;  1OZP A;  1S7L A;  2QML A;  5EBV A;  3D2M A;  1BOB A;  1R57 A;  3ZZI A;  1VHS A;  3E0K A;  4E2A A;  3S6F A;  4PSW A;  3DDD A;  4B5P A;  2ZW7 A;  5KTD A;  5HMN A;  2Q4Y A;  1YLE A;  1FY7 A;  5ISV A;  2FXF A;  5F49 A;  4FD5 A;  1K4J A;  2K5T A;  2JDC A;  3TFY A;  3P2F A;  4PSX A;  2OZH A;  1YGH A;  3IWG A;  2OH1 A;  2ARH A;  4XPD B;  4YFJ A;  1UFH A;  5FVJ A;  1ON0 A;  1I12 A;  3TTH A;  4XPL A;  2Z0Z A;  4MY0 A;  4KLW A;  4B5O A;  4U5Y A;  2Z10 A;  4AVC A;  4NSQ A;  2IL4 A;  2PDO A;  4KLV A;  3S6G A;  3QB8 A;  3R9F A;  2ZXV A;  2BEI A;  1N71 A;  4X5K A;  3EXN A;  3TOB A;  2B4D A;  3W91 A;  3SHP A;  4K30 A;  1RO5 A;  4KUB A;  4KVM E;  1Z9U A;  4JXQ A;  4BMH A;  4OAD A;  4KUA A;  2G3A A;  2ATR A;  5IV0 A;  3D8P A;  4LUA A;  4CRY B;  4RS2 A;  2I79 A;  5KTC A;  1XE4 A;  1YK3 A;  4CRZ B;  1QSN A;  2QIR A;  4L89 A;  5IB0 A;  2FIA A;  4U9Z A;  5E96 A;  3BLN A;  1KUY A;  3DNS A;  3F8K A;  4R3K A;  1Q2Y A;  1I21 A;  4U9Y A;  5C88 A;  2D4O A;  2B4D B;  3W6S A;  1BO4 A;  4NF1 A;  3FNC A;  2Y0M A;  2D4P A;  3K9U A;  1M4D A;  1NE9 A;  2J8N A;  1Y9W A;  4KOV A;  2BL1 A;  3R9G A;  3PGP A;  4R57 A;  5J8F A;  2OZG A;  3S6H A;  4JXR A;  2ZW6 A;  3OWC A;  5GCN A;  1NSL A;  3TCV A;  3VWE A;  3TT2 A;  2ZPA A;  2OB0 A;  4MBU A;  3UY5 A;  1WWZ A;  5C82 A;  1VKC A;  2REE A;  3FXT A;  4MY3 A;  1V0C A;  3G8W A;  5CNP A;  1Z4E A;  4JLY A;  3TO6 A;  3JUW A;  4UWJ A;  2VXK A;  1M1D A;  1XF8 A;  3N7Z A;  1KZF A;  4CAV A;  1YVK A;  2Q0Y A;  4KOS A;  4R87 A;  3DSB A;  2PC1 A;  2ZW4 A;  4F0Y A;  1M4I A;  2EVN A;  2CY2 A;  3BJ7 A;  1RXT A;  4MJ8 A;  4H6Z A;  2A4N A;  4HNX B;  4CAX A;  4QC6 A;  1PUA A;  2PSW A;  2CNS A;  4AB7 A;  3VWD A;  4PK2 A;  2P6F A;  4M3S A;  4QVT A;  4FD4 A;  3FBU A;  2J8M A;  4Y49 B;  4RI1 A;  3TE4 A;  2HUZ A;  1IIC A;  4E8O A;  2WPX A;  4JWP A;  2FCK A;  1GHE A;  4HKF A;  1QST A;  3GYA A;  3FIX A;  4AG9 A;  4F6A A;  4E0A A;  3NE7 A;  4LX9 A;  1LRZ A;  1QSM A;  1Q2C A;  1QSR A;  2KCW A;  4FD7 A;  3F5B A;  4UWI A;  1S5K A;  3LD2 A;  3D2P A;  1CJW A;  2VI7 A;  4HNW B;  4GS4 A;  2G0B A;  4OLL A;  2R7H A;  2X7B A;  1S3Z A;  3BJ8 A;  1QSO A;  3ZJ0 A;  2FIW A;  2R8V A;  1S60 A;  2Q4V A;  4KOU A;  2C27 A;  2NMT A;  4FD6 A;  3FRM A;  4KOX A;  3T9Y A;  2Q44 A;  4QUS A;  2R1I A;  2GE3 A;  4Y49 C;  3MGD A;  2BSW A;  5HH1 A;  2ZW5 A;  4UA3 A;  3D3S A;  3TO9 A;  3TOA A;  3W6X A;  2B5G B;  2GIV A;  4R9M A;  2BUE A;  2P6E A;  4B5P B;  1MJA A;  3S6K A;  2B3V A;  4CAW A;  3FB3 A; 
#chains in the Genus database with same CATH topology
 1IY7 A;  1FT7 A;  1Y9K A;  1AYE A;  4ORF A;  5CBM A;  4PK3 A;  4ZX8 A;  2Q04 A;  3TO7 A;  3C26 A;  2CNT A;  2CTC A;  2R98 A;  4EME A;  4KOR A;  2GAN A;  4R3L A;  4EVY A;  4A95 A;  3D7G A;  5I0C A;  1NMT A;  4KVO E;  3FH4 A;  2GFQ A;  2QYV A;  4C7I A;  4F8Z A;  1NSA A;  1XEB A;  2Z3O A;  1H8L A;  2FE7 A;  3JRU A;  2AFO A;  1M44 A;  1ZLH A;  2C6G A;  2PR1 A;  3PRT A;  5IX3 A;  5KTA A;  1XJO A;  2HB6 A;  4JZ0 A;  3DR8 A;  4UCM A;  2PJ6 A;  4M6G A;  1TIQ A;  3JVN A;  4I49 A;  3SJG A;  1YQE A;  3PZJ A;  1U6M A;  2FL4 A;  2P0W A;  2XEF A;  2OOT A;  3SI0 A;  4P4F A;  2CIJ A;  2P6G A;  1A2Z A;  2REF A;  2WUU A;  3EY5 A;  2I00 A;  2O28 A;  2RC4 A;  2ZEE A;  5D8N A;  3SI1 A;  1YR0 A;  3IFE A;  4JYW A;  1P4N A;  1JQG A;  5JPH A;  8CPA A;  4KOY A;  3VAT A;  3B3C A;  4KOT A;  4IF5 A;  2PQ8 A;  2V8H A;  2Q7B A;  3T90 A;  4P4B A;  2F7V A;  2JBK A;  3LOD A;  4RN7 A;  5DWM A;  1L0C A;  3HLP A;  4H89 A;  3D7F A;  2FT0 A;  1Z4R A;  3B3S A;  4WJB A;  4QB9 A;  4MI4 A;  3IEH A;  4NJR A;  4A94 A;  4IUS A;  1AMP A;  1BLL E;  3B8G A;  1IU8 A;  2PJ3 A;  3DR6 A;  4YRH A;  4EFD A;  1KUV A;  3G3S A;  1XIX A;  2Q43 A;  2G3T A;  3D66 A;  2ZEN A;  3H8E A;  1S7N A;  1ZG9 A;  4JD6 A;  7CPA A;  3WC6 A;  4AG7 A;  4CGO A;  2F5I A;  4OC5 A;  3RYO A;  3CPA A;  2JEV A;  3SXO A;  4CAE A;  4RUH A;  4ZY0 A;  5AG4 A;  4ZI6 A;  5LRK A;  4CYQ A;  2PVV A;  5LRG A;  1R3N A;  4AVA A;  4MHD A;  5IV0 A;  1ZO0 A;  3LMS A;  1IYK A;  3S9N A;  2NYQ A;  2PRB A;  1LAP A;  1GYT A;  4UIA A;  5JH9 A;  2OU2 A;  4NGN A;  4KOW A;  5F48 A;  5IB9 A;  3GKR A;  2RFH A;  1Z8L A;  5LYD A;  4OIW A;  1KUX A;  3CXP A;  1MK4 A;  4CS0 B;  3PB8 X;  1WK4 A;  2Z3P A;  3IWW A;  4TNU A;  2J8R A;  2VZZ A;  1S7K A;  3D7H A;  4LQG A;  5K8O A;  5K8P A;  2Z3N A;  1BAV A;  1SQH A;  4WWV A;  4UEE A;  2B5G A;  5H86 A;  3R95 A;  5J8C A;  4MHY A;  4YGO A;  2VQY A;  3DGV A;  4ZYQ A;  4M85 A;  2POK A;  2V8G A;  2JDD A;  3B3T A;  3EC4 A;  4B11 A;  2O53 A;  3H4Q A;  3CPX A;  3CXQ A;  1LCP A;  1YVO A;  4CGN A;  3N5F A;  4ZY1 A;  1Y0Y A;  2PJ5 A;  4PV6 A;  1R43 A;  4H2K A;  2QEC A;  4UBR A;  4G1P A;  4H6U A;  5AGE A;  2ZEH A;  3PP9 A;  1VHE A;  1TF9 A;  3B3V A;  4QBJ A;  3KKW A;  4P44 A;  2PR8 A;  5EC4 A;  3FYN A;  4OAE A;  4B12 A;  2PJ0 A;  3R9E A;  1B6B A;  3KQZ A;  2FS5 A;  2CNM A;  3GLJ A;  3L2N A;  3JTK A;  3R1K A;  4JJX A;  3EO4 A;  2YNC A;  4UFV A;  2BOA A;  4AVB A;  4NEX A;  1ZG7 A;  2WPW A;  3SJX A;  4MFQ A;  4NFR A;  4XNH B;  2ZED A;  3CDX A;  4J3G A;  3PB9 X;  4A33 A;  1CM0 A;  3I3G A;  1YX0 A;  4DYO A;  2AFU A;  4KVX A;  2Z3M A;  1S7F A;  1IYL A;  2AE6 A;  3S9M A;  2AJ6 A;  2EUI A;  1XOV A;  2H5M A;  4M6I A;  1M4G A;  4DNC A;  2QVP A;  3D4U A;  2ZOG A;  4B13 A;  2Z11 A;  1IOF A;  2EBJ A;  4NXY A;  3IGR A;  4ONU A;  3BI0 A;  4UCP A;  4XPK A;  4ZBG A;  3IWE A;  4NCZ A;  4XPD C;  2PJB A;  3CZX A;  1Q2D A;  1YLO A;  4BD9 A;  2JLM A;  5G20 A;  1P0H A;  5H84 A;  1I1D A;  2VBQ A;  5DWN A;  1VIX A;  4R6T A;  2VEZ A;  4YU9 A;  2V77 A;  1MJ9 A;  1LAM A;  1IID A;  1XMT A;  4MFK A;  5F47 A;  4CPA A;  4B14 A;  4ZX9 A;  2HQY A;  3P2H A;  2ODF A;  4MHZ A;  3TC8 A;  5F46 A;  3RZA A;  4KZT A;  1Q7L A;  2B3U A;  4GM5 A;  2FSR A;  3I9S A;  5A28 A;  1DE4 C;  3F0A A;  2OZU A;  1J4J A;  1LFW A;  4NGQ A;  4PPZ A;  4OKO A;  3EFA A;  3BXM A;  4MCP A;  2WZN A;  3KL9 A;  4UFX A;  1YW4 A;  1Y7R A;  4P4D A;  4W9Y A;  2NSM A;  3SXN A;  5JQ4 A;  1B87 A;  3GY9 A;  4OC3 A;  2DXQ A;  2VZY A;  4F0X A;  1YRE A;  2JBJ A;  3MN8 A;  3QNV A;  5ELY A;  3CXS A;  3WR7 A;  4L8A A;  1Z2L A;  3QAH A;  2B58 A;  2PVW A;  4XNH C;  3GUX A;  5AG5 A;  3R96 A;  3V8I A;  4OME A;  4CAF A;  2PJA A;  1PCA A;  1PU9 A;  1IB1 E;  3KHX A;  4A30 A;  2HV2 A;  4HNY B;  2B4B A;  4UEF A;  1MJB A;  1OZP A;  1TKF A;  1S7L A;  2EK8 A;  2Q4Z A;  2QML A;  4MFP A;  5EBV A;  5F09 A;  3S9L A;  2GLF A;  3PBB A;  5EMI A;  1DTD A;  1XRY A;  3SJF A;  4A32 A;  3D2M A;  1BOB A;  2PJC A;  4ZY2 A;  2DF5 A;  1R57 A;  3ZZI A;  4PXD A;  1VHS A;  3E0K A;  4E2A A;  3S6F A;  4PSW A;  1RTQ A;  1QMU A;  1QQ9 A;  3DDD A;  4C7H A;  2I3C A;  3LAC A;  4B5P A;  4EWT A;  2GRE A;  2ZW7 A;  4BIN A;  2DEA A;  4MHN A;  5KTD A;  1KWM A;  2EO8 A;  1Y0R A;  3PB6 X;  4A37 A;  1Z8W A;  5HMN A;  2Q4Y A;  1YLE A;  2XEG A;  4IK2 A;  3FF3 A;  3QAY A;  1OBR A;  4KSF A;  1FY7 A;  3KHZ A;  1PYT B;  1XMB A;  5ISV A;  2FXF A;  5F49 A;  2Z3K A;  4FD5 A;  1K4J A;  2K5T A;  3PBE A;  4OID A;  4OC2 A;  2JDC A;  4FBE A;  3TFY A;  3KAS A;  3FMC A;  3P2F A;  4PSX A;  2OZH A;  4P10 A;  1YSJ A;  2ANP A;  1YGH A;  3VAR A;  3IWG A;  2OH1 A;  2GU2 A;  3K2K A;  1ARM A;  2ARH A;  2BCO A;  4IAV A;  3KGQ A;  2DPS A;  1HDQ A;  4XPD B;  4OP4 A;  3FED A;  4YFJ A;  1UFH A;  2C1C A;  1F2P A;  4Q38 A;  5FVJ A;  4PXC A;  1ON0 A;  1I12 A;  3TTH A;  4XPL A;  4MCQ A;  3RAM A;  2Z0Z A;  3B3W A;  4MY0 A;  4KLW A;  4B5O A;  4BBH A;  4U5Y A;  2Z10 A;  3KQX A;  4MMO A;  4AVC A;  4NGP A;  4NSQ A;  2IL4 A;  2PDO A;  4KLV A;  4OC4 A;  3S6G A;  3QB8 A;  4MHP A;  3R9F A;  1VGY A;  2ZXV A;  2BEI A;  1N71 A;  1ZG8 A;  4X5K A;  2V8D A;  1TKH A;  1CP7 A;  2IQ6 A;  1LAN A;  3EXN A;  1YW6 A;  2EWB A;  4MFL A;  3A9L A;  3IO1 A;  5BWA B;  1BPN A;  3TOB A;  4OC0 A;  4KSI A;  2B4D A;  4Q7A A;  2V8V A;  4X8I A;  3W91 A;  3SHP A;  5CPA A;  3BI1 A;  2QJ8 A;  4K30 A;  5AG7 A;  1RO5 A;  3NH4 A;  3KI9 A;  3D7D A;  3FX6 A;  3NH8 A;  3NH5 A;  2C6C A;  4KUB A;  4NGM A;  4KVM E;  3D68 A;  1Z9U A;  2Q51 A;  2G9D A;  4FUU A;  4JXQ A;  4BMH A;  4OAD A;  4KUA A;  2G3A A;  2ATR A;  1TKJ A;  1LOK A;  3D8P A;  4LUA A;  3WAB A;  4TWE A;  4CRY B;  4RS2 A;  2I79 A;  5AG6 A;  2PJ7 A;  3WT4 A;  3I1U A;  1ELM P;  5KTC A;  4MCR A;  1XE4 A;  1YK3 A;  3D67 A;  4CRZ B;  3FJU A;  1QSN A;  2QIR A;  2YND A;  3K9T A;  4L89 A;  5IB0 A;  1ARL A;  4X3R A;  2FIA A;  4A31 A;  4P4J A;  4MFJ A;  2EK9 A;  4U9Z A;  5E96 A;  3BLN A;  1TF8 A;  1KUY A;  3DNS A;  3F8K A;  1X12 A;  5G22 A;  2AFX A;  2XEI A;  4C2X A;  2Q7S A;  3H8F A;  4R3K A;  4MXU A;  5G1Z A;  1Q2Y A;  1I21 A;  2PJ1 A;  4U9Y A;  4B6Z A;  5C88 A;  4X2T A;  6CPA A;  4O23 A;  2D4O A;  2B4D B;  3W6S A;  1ZLI A;  1BO4 A;  4C2Z A;  4NF1 A;  4CYN A;  3FNC A;  2Y0M A;  4AXV A;  2AFW A;  3KR4 A;  3NA6 A;  2D4P A;  3K9U A;  4ONW A;  3VH9 A;  2PJ9 A;  2VL1 A;  4A38 A;  1M4D A;  3B2Y A;  1NE9 A;  2J8N A;  1Y9W A;  2AFM A;  2Z3L A;  3ISX A;  4KOV A;  2BL1 A;  3R9G A;  1CBX A;  3KZW A;  3PB7 X;  3PGP A;  4MFZ A;  4R57 A;  5J8F A;  2OZG A;  1XFO A;  3S6H A;  4JXR A;  2CXA A;  1EE3 P;  2ZW6 A;  3OWC A;  4UFW A;  5GCN A;  1NSL A;  2ZEF A;  3HUV A;  3TCV A;  3WC5 A;  1HEE A;  1XBU A;  3VWE A;  4R7M A;  1BPM A;  3PFO A;  1Z8T A;  2ABZ A;  1IOI A;  1AUG A;  2PJ8 A;  2WSA A;  4FAI A;  2OR4 A;  3TT2 A;  2J9A A;  2ZPA A;  2OB0 A;  4MBU A;  5HVH A;  3T8W A;  3UY5 A;  1F57 A;  1WWZ A;  2PCU A;  5G21 A;  5C82 A;  1VKC A;  2PJ4 A;  4F9V A;  2REE A;  3FXT A;  4MY3 A;  1TXR A;  1V0C A;  3G8W A;  4Q36 A;  3BHX A;  3H5Z A;  1Z4E A;  5CNP A;  4JLY A;  3SI2 A;  2XEJ A;  3TO6 A;  1VHO A;  2DPT A;  2ZEL A;  3JUW A;  4UWJ A;  2BO9 A;  2VXK A;  1M1D A;  1XF8 A;  3N7Z A;  3RBU A;  1KZF A;  4CAV A;  1YVK A;  2FVG A;  2Q0Y A;  4NJQ A;  4KOS A;  4R87 A;  2ZOF A;  4CYP A;  2HC9 A;  5LRJ A;  2C6P A;  2IJZ A;  3DSB A;  4C68 A;  2PIZ A;  4M6H A;  4GXH A;  2PC1 A;  3GIU A;  5LYI A;  4DUK A;  2ZW4 A;  2IMO A;  3GB0 A;  5D29 A;  1Z5R A;  4F0Y A;  1M4I A;  2EVN A;  4LQ6 A;  2CY2 A;  3BJ7 A;  4P4I A;  3V7Z A;  2AFZ A;  1RXT A;  4MJ8 A;  4P6Y A;  4H6Z A;  2A4N A;  4HNX B;  4CGM A;  4CAX A;  3PFE A;  4QC6 A;  1PUA A;  3FVL A;  2PSW A;  3IC1 A;  5LYL A;  2CNS A;  3RO0 A;  4AB7 A;  3VWD A;  4PK2 A;  2P6F A;  4M3S A;  4CGL A;  3ISZ A;  4QVT A;  1CX8 A;  4FD4 A;  3FBU A;  4P45 A;  4ZGY B;  2J8M A;  1JWQ A;  4RI1 A;  4Y49 B;  3TE4 A;  2HUZ A;  1IIC A;  4C2Y A;  2YNE A;  1HDU A;  5DS0 A;  4E8O A;  5LYF A;  2WPX A;  4JWP A;  2FCK A;  4FWU A;  5K8M A;  2JEW A;  1GHE A;  2ZEM A;  2PRQ A;  1QST A;  4HKF A;  4MRI A;  3GYA A;  4IHM A;  3FIX A;  1CG2 A;  4R8F A;  3WC7 A;  4AG9 A;  4UIB A;  4YWY A;  1CP6 A;  4NGT A;  4F6A A;  5J1Q A;  4II9 A;  4CYO A;  4E0A A;  3NE7 A;  3SJE A;  1LRZ A;  4LX9 A;  1QSM A;  1Q2C A;  4K3N A;  3H8G A;  1IGB A;  1QSR A;  2KCW A;  4FD7 A;  3F5B A;  4OC1 A;  4UWI A;  3IJ3 A;  2YNC C;  1S5K A;  1Y7E A;  1FNO A;  3IU2 A;  4UCN A;  4KS9 A;  3LD2 A;  3D2P A;  4A2Z A;  1YME A;  4NGR A;  4KSA A;  1CJW A;  4Z65 A;  5HVG A;  1M4L A;  4B10 A;  4F9U A;  5JGF A;  2VI7 A;  3NE8 A;  5A27 A;  3DLJ A;  1UWY A;  4HNW B;  3B35 A;  4GS4 A;  2G0B A;  4OLL A;  1X10 A;  2YGW A;  5I4M A;  2R7H A;  3LWU A;  3IIB A;  2X7B A;  1S3Z A;  1Z8X A;  3BJ8 A;  3PEI A;  4MCS A;  3RNZ A;  1QSO A;  2AFS A;  5HVF A;  5K8N A;  3MRU A;  3ZJ0 A;  3TX8 A;  3NFZ A;  2FIW A;  2R8V A;  1S60 A;  2Q4V A;  4KOU A;  3KR5 A;  4A39 A;  4CGP A;  3B7I A;  2C27 A;  2PE3 A;  4P4E A;  3V38 A;  2NMT A;  4FD6 A;  3FRM A;  2PJ2 A;  4KOX A;  3T9Y A;  2GLJ A;  2RB7 A;  5THW A;  4R76 A;  2Q44 A;  4QUS A;  2R1I A;  2WYR A;  2GE3 A;  4Y49 C;  3MGD A;  4UEZ A;  2BSW A;  2F8H A;  5JM6 A;  3CT9 A;  1CPS A;  4UF4 A;  1F2O A;  4NGS A;  5HH1 A;  4PXB A;  2ZW5 A;  4UA3 A;  3D3S A;  2ZEP A;  3TO9 A;  2PIY A;  2CTB A;  2CF4 A;  3TOA A;  3W6X A;  4DJL A;  2B5G B;  2O4H A;  2GIV A;  4PQA A;  4R9M A;  2BUE A;  2P6E A;  4B5P B;  1ELL P;  1MJA A;  3S6K A;  5HXD A;  4PXE A;  2B3V A;  4CAW A;  3FEC A;  1CPX A;  3PB4 X;  2ZEG A;  3FEE A;  2ZEO A;  4HPS A;  3IU1 A;  3FB3 A; 
#chains in the Genus database with same CATH homology
 1Y9K A;  4ORF A;  4PK3 A;  2Q04 A;  3TO7 A;  3C26 A;  2CNT A;  2R98 A;  4KOR A;  2GAN A;  4R3L A;  4EVY A;  4A95 A;  5I0C A;  1NMT A;  4KVO E;  4C7I A;  1XEB A;  2Z3O A;  2FE7 A;  1M44 A;  2PR1 A;  5KTA A;  5IX3 A;  3DR8 A;  4UCM A;  1TIQ A;  3JVN A;  4I49 A;  3PZJ A;  1U6M A;  2FL4 A;  2P0W A;  2P6G A;  2REF A;  2WUU A;  3EY5 A;  4II9 A;  2I00 A;  2O28 A;  2RC4 A;  1YR0 A;  5JPH A;  1P4N A;  4KOY A;  4KOT A;  4IF5 A;  2PQ8 A;  2Q7B A;  3T90 A;  3LOD A;  5DWM A;  1L0C A;  4H89 A;  2FT0 A;  1Z4R A;  4QB9 A;  4MI4 A;  4IUS A;  3B8G A;  3DR6 A;  4YRH A;  1KUV A;  3G3S A;  1XIX A;  2G3T A;  1S7N A;  4JD6 A;  4AG7 A;  4CGO A;  2F5I A;  3RYO A;  2JEV A;  3SXO A;  4CAE A;  5AG4 A;  4CYQ A;  4AVA A;  4MHD A;  1ZO0 A;  1IYK A;  2PRB A;  2OU2 A;  4KOW A;  5F48 A;  3GKR A;  1KUX A;  3CXP A;  1MK4 A;  4CS0 B;  1WK4 A;  2Z3P A;  2J8R A;  2VZZ A;  1S7K A;  2Z3N A;  1SQH A;  2B5G A;  5H86 A;  3R95 A;  5J8C A;  4YGO A;  2VQY A;  4M85 A;  2JDD A;  3EC4 A;  4B11 A;  3H4Q A;  3CXQ A;  1YVO A;  4CGN A;  4PV6 A;  4UBR A;  2QEC A;  4H6U A;  5AGE A;  3PP9 A;  4QBJ A;  3KKW A;  5EC4 A;  2PR8 A;  4B12 A;  3FYN A;  4OAE A;  5F46 A;  3R9E A;  1B6B A;  4JJX A;  2FS5 A;  3R1K A;  2CNM A;  3JTK A;  4UFV A;  3EO4 A;  2YNC A;  4AVB A;  4NEX A;  2WPW A;  4MFQ A;  4XNH B;  4A33 A;  4J3G A;  1CM0 A;  3I3G A;  1YX0 A;  4KVX A;  2Z3M A;  1S7F A;  1IYL A;  2AE6 A;  2AJ6 A;  2EUI A;  2H5M A;  1M4G A;  4DNC A;  4B13 A;  2Z11 A;  4NXY A;  3IGR A;  4ONU A;  4UCP A;  4XPK A;  4ZBG A;  3IWE A;  4NCZ A;  4XPD C;  1Q2D A;  2JLM A;  5G20 A;  1P0H A;  5H84 A;  1I1D A;  2VBQ A;  5DWN A;  2VEZ A;  1MJ9 A;  1IID A;  1XMT A;  4MFK A;  5F47 A;  4B14 A;  2HQY A;  3P2H A;  4KZT A;  2B3U A;  2FSR A;  3I9S A;  5A28 A;  3F0A A;  2OZU A;  1J4J A;  3EFA A;  4UFX A;  1Y7R A;  3SXN A;  5JQ4 A;  1B87 A;  3GY9 A;  2DXQ A;  2VZY A;  4F0X A;  1YRE A;  3CXS A;  3WR7 A;  4L8A A;  3QAH A;  2B58 A;  4XNH C;  5AG5 A;  3R96 A;  3V8I A;  4CAF A;  1PU9 A;  4A30 A;  1IB1 E;  2HV2 A;  4HNY B;  2B4B A;  1MJB A;  1OZP A;  1S7L A;  2QML A;  4MFP A;  5EBV A;  4A32 A;  3D2M A;  1BOB A;  1R57 A;  3ZZI A;  1VHS A;  3E0K A;  4E2A A;  3S6F A;  4PSW A;  3DDD A;  4C7H A;  4B5P A;  2ZW7 A;  5KTD A;  5HMN A;  2Q4Y A;  1YLE A;  4KSF A;  1FY7 A;  5ISV A;  2FXF A;  5F49 A;  2Z3K A;  4FD5 A;  1K4J A;  2K5T A;  2JDC A;  3TFY A;  3P2F A;  4PSX A;  2OZH A;  1YGH A;  3IWG A;  2OH1 A;  2ARH A;  2DPS A;  4XPD B;  4YFJ A;  1UFH A;  5FVJ A;  4Q38 A;  1ON0 A;  1I12 A;  3TTH A;  4XPL A;  2Z0Z A;  4MY0 A;  4KLW A;  4B5O A;  4BBH A;  4U5Y A;  2Z10 A;  4AVC A;  4NSQ A;  2IL4 A;  2PDO A;  4KLV A;  3S6G A;  3QB8 A;  3R9F A;  2ZXV A;  2BEI A;  1N71 A;  4X5K A;  3EXN A;  4MFL A;  3A9L A;  5BWA B;  3TOB A;  2B4D A;  3W91 A;  3SHP A;  4K30 A;  5AG7 A;  1RO5 A;  4KUB A;  4KVM E;  1Z9U A;  4JXQ A;  4BMH A;  4OAD A;  4KUA A;  2G3A A;  2ATR A;  5IV0 A;  3D8P A;  4LUA A;  4CRY B;  4RS2 A;  2I79 A;  5AG6 A;  5KTC A;  1XE4 A;  1YK3 A;  4CRZ B;  1QSN A;  2QIR A;  2YND A;  4L89 A;  5IB0 A;  2FIA A;  4A31 A;  4MFJ A;  4U9Z A;  5E96 A;  3BLN A;  1KUY A;  3DNS A;  3F8K A;  5G22 A;  4C2X A;  4R3K A;  5G1Z A;  1Q2Y A;  1I21 A;  4U9Y A;  5C88 A;  2D4O A;  2B4D B;  3W6S A;  4C2Z A;  1BO4 A;  4NF1 A;  4CYN A;  3FNC A;  2Y0M A;  2D4P A;  3K9U A;  1M4D A;  1NE9 A;  2J8N A;  1Y9W A;  2Z3L A;  4KOV A;  2BL1 A;  3R9G A;  3PGP A;  4MFZ A;  4R57 A;  5J8F A;  2OZG A;  3S6H A;  4JXR A;  2CXA A;  2ZW6 A;  3OWC A;  4UFW A;  5GCN A;  1NSL A;  3TCV A;  3VWE A;  2WSA A;  3TT2 A;  2ZPA A;  2OB0 A;  4MBU A;  3UY5 A;  1WWZ A;  5G21 A;  5C82 A;  1VKC A;  2REE A;  3FXT A;  4MY3 A;  1V0C A;  3G8W A;  4Q36 A;  3H5Z A;  1Z4E A;  5CNP A;  4JLY A;  3TO6 A;  2DPT A;  3JUW A;  4UWJ A;  2VXK A;  1M1D A;  1XF8 A;  3N7Z A;  1KZF A;  4CAV A;  1YVK A;  2Q0Y A;  4KOS A;  4R87 A;  4CYP A;  3DSB A;  4C68 A;  2PC1 A;  2ZW4 A;  4F0Y A;  1M4I A;  2EVN A;  2CY2 A;  3BJ7 A;  1RXT A;  4MJ8 A;  4H6Z A;  2A4N A;  4HNX B;  4CGM A;  4CAX A;  4QC6 A;  1PUA A;  2PSW A;  2CNS A;  4AB7 A;  3VWD A;  4PK2 A;  2P6F A;  4M3S A;  4CGL A;  4QVT A;  4FD4 A;  3FBU A;  4ZGY B;  2J8M A;  4Y49 B;  4RI1 A;  3TE4 A;  2HUZ A;  1IIC A;  4C2Y A;  2YNE A;  4E8O A;  2WPX A;  4JWP A;  2FCK A;  1GHE A;  4HKF A;  1QST A;  3GYA A;  3FIX A;  4AG9 A;  4F6A A;  4CYO A;  4E0A A;  3NE7 A;  4LX9 A;  1LRZ A;  1QSM A;  1Q2C A;  1QSR A;  2KCW A;  4FD7 A;  3F5B A;  4UWI A;  2YNC C;  1S5K A;  3IU2 A;  4UCN A;  4KS9 A;  3LD2 A;  3D2P A;  4A2Z A;  4KSA A;  1CJW A;  4B10 A;  2VI7 A;  5A27 A;  4HNW B;  4GS4 A;  2G0B A;  4OLL A;  2YGW A;  2R7H A;  2X7B A;  1S3Z A;  3BJ8 A;  1QSO A;  3ZJ0 A;  2FIW A;  2R8V A;  1S60 A;  2Q4V A;  4KOU A;  4CGP A;  2C27 A;  2NMT A;  4FD6 A;  3FRM A;  4KOX A;  3T9Y A;  2Q44 A;  4QUS A;  2R1I A;  2GE3 A;  4Y49 C;  3MGD A;  2BSW A;  5HH1 A;  2ZW5 A;  4UA3 A;  3D3S A;  3TO9 A;  3TOA A;  3W6X A;  2B5G B;  2GIV A;  4R9M A;  2BUE A;  2P6E A;  4B5P B;  1MJA A;  3S6K A;  2B3V A;  4CAW A;  3IU1 A;  3FB3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...