3KKWA

Crystal structure of his-tagged form of pa4794 protein
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
178
structure length
166
Chain Sequence
SHHHHHHMQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of His-tagged form of PA4794 protein
rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Transferase
molecule keywords Putative uncharacterized protein
total genus 43
structure length 166
sequence length 178
ec nomenclature
pdb deposition date 2009-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3kkwA01
3K9UA 2EUIA 2J8MA 1MK4A 3TE4A 2B4BA 4KVOE 3G3SA 2IL4A 3JUWA 4KOWA 4K30A 4QC6A 5F49A 1OZPA 1L0CA 4XPDC 2PR1A 1S60A 1IB1E 2FCKA 1QSOA 4MY3A 1XE4A 5J8FA 1Q2CA 3BLNA 2R7HA 3TFYA 3D3SA 1YLEA 4HNYB 3P2FA 1ON0A 4KOYA 3TT2A 3EY5A 1YGHA 3T90A 3PZJA 3N7ZA 1Z9UA 1BO4A 1M1DA 3LODA 4PSXA 3TCVA 4NCZA 1M4IA 1XIXA 4CAXA 2Q4YA 3S6FA 3T9YA 1S7KA 4AVAA 2NMTA 3P2HA 5KTDA 2K5TA 5H86A 5J8CA 1MJ9A 2OZGA 2Z10A 4FD5A 4E2AA 2FE7A 2B5GA 1RO5A 2FT0A 1P0HA 1U6MA 1SQHA 5DWNA 1I12A 4EVYA 1XMTA 4OADA 2BEIA 2CNSA 2VBQA 4J3GA 3H4QA 2P6FA 4MHDA 4KUAA 2PRBA 3V8IA 3QB8A 1QSTA 3F8KA 4UWJA 3GKRA 3VWEA 4XNHB 3R95A 2HQYA 1YVKA 3DNSA 1M44A 5ISVA 2AJ6A 3GYAA 3I3GA 4R87A 1KUYA 1R57A 2PQ8A 4Y49B 2WPXA 1XF8A 1KUVA 1YK3A 1IIDA 3LD2A 2VQYA 2DXQA 5C88A 4R9MA 4DNCA 4KVXA 4KOTA 1BOBA 3R9GA 4R57A 3DR6A 3R96A 1S7LA 3SXNA 1KZFA 2ARHA 4OAEA 2HV2A 5KTAA 2REEA 2JDCA 2Y0MA 3OWCA 4KUBA 2EVNA 4ORFA 2CY2A 4KLVA 4CAVA 2I00A 2FSRA 1WK4A 3NE7A 1IYKA 4M3SA 3FXTA 2P0WA 2Q04A 1S5KA 3JVNA 2ATRA 2C27A 2Q44A 1IYLA 3F5BA 3G8WA 3RYOA 2B3UA 1IICA 4HNWB 3TO6A 4L8AA 1S3ZA 4UA3A 4B5OA 2O28A 2Z11A 3DDDA 1GHEA 4YRHA 5F46A 1VHSA 2OB0A 4B5PA 2Q4VA 3CXQA 3KKWA 1NSLA 5EBVA 2J8RA 2OH1A 1TIQA 4BMHA 3EXNA 4JWPA 2B58A 2GANA 1Q2DA 2G3AA 4H6ZA 2JDDA 4NF1A 3TTHA 4M85A 3CXSA 3PGPA 2G0BA 3EC4A 1B6BA 2B4DA 4F0YA 1YREA 3S6HA 2ZW4A 4AG7A 2VZYA 4LUAA 2FS5A 2OU2A 1MJAA 5GCNA 1PU9A 4GS4A 3R9EA 4MI4A 3C26A 4PK2A 2GE3A 3SXOA 4NEXA 4X5KA 1K4JA 4JXRA 2FIAA 1N71A 4R3LA 4AB7A 3EO4A 4AG9A 1KUXA 4CAWA 3BJ8A 1I1DA 2X7BA 3TO7A 4JD6A 3PP9A 1Q2YA 4QUSA 4FD6A 5IB0A 2G3TA 4PV6A 2OZUA 3CXPA 4OLLA 4L89A 3D2MA 4FD4A 2BUEA 5KTCA 2JLMA 1Y9KA 2FIWA 4U5YA 4H89A 1Z4RA 2QECA 3D8PA 1Y9WA 4XNHC 2B3VA 3I9SA 4IF5A 4NXYA 3ZJ0A 1UFHA 4QB9A 3DSBA 4ZBGA 4MY0A 2QIRA 4UBRA 1V0CA 4RI1A 5HH1A 2CNTA 2OZHA 1LRZA 2ZW7A 4LX9A 2RC4A 4KZTA 4NSQA 1J4JA 3FIXA 3W6SA 4PSWA 5F47A 4Y49C 4QBJA 3SHPA 3E0KA 3VWDA 1CJWA 5IV0A 2PSWA 2D4PA 2R8VA 2H5MA 5E96A 2D4OA 2J8NA 1P4NA 4UWIA 2KCWA 4U9ZA 4JJXA 4RS2A 4QVTA 4CRZB 3IGRA 4AVCA 1NE9A 2JEVA 1VKCA 4II9A 2WPWA 5FVJA 4MJ8A 4KOVA 5JPHA 2ZW5A 3FB3A 3S6KA 4KORA 3R1KA 3DR8A 4FD7A 5DWMA 2Q7BA 4PK3A 2AE6A 4YFJA 2ZPAA 5HMNA 2R1IA 3F0AA 2B4DB 3FNCA 5F48A 2Z0ZA 2F5IA 1I21A 2HUZA 3TOAA 1XEBA 1CM0A 4JXQA 2ZW6A 1YVOA 5CNPA 2GIVA 1NMTA 1QSNA 4HKFA 1YX0A 3WR7A 5C82A 1YR0A 4R3KA 3S6GA 4B5PB 2PR8A 2PC1A 2I79A 3ZZIA 3QAHA 3GY9A 2P6GA 3BJ7A 3UY5A 4XPKA 4AVBA 2VZZA 1RXTA 3IWGA 3TO9A 2PDOA 1QSRA 4KLWA 4MBUA 4ONUA 4H6UA 3TOBA 4JLYA 2FXFA 1MJBA 4CS0B 2FL4A 3R9FA 1FY7A 4I49A 4KOSA 1M4DA 5IX3A 2QMLA 4KOUA 2CNMA 2P6EA 4YGOA 5EC4A 2VEZA 1WWZA 3FRMA 4U9YA 4HNXB 5I0CA 1S7FA 2A4NA 3W6XA 1Y7RA 1S7NA 5JQ4A 2VXKA 4IUSA 4E0AA 3FYNA 3FBUA 3B8GA 2B5GB 4E8OA 4KOXA 4XPDB 2BSWA 3D2PA 4KVME 3MGDA 5H84A 4CRYB 4F6AA 3W91A 1Z4EA 1M4GA 2VI7A 2ZXVA 2BL1A 2Q0YA 2R98A 2REFA 3EFAA 1PUAA 4XPLA 1B87A 1QSMA
chains in the Genus database with same CATH superfamily
1PYTB 2Z3KA 3K9UA 2EUIA 2J8MA 3MRUA 3QAYA 4CYQA 1MK4A 3TE4A 4UCPA 4UCNA 4P4FA 2B4BA 4KVOE 2ZEHA 3SJEA 3B3WA 1CPXA 3G3SA 2POKA 2IL4A 3JUWA 3PB9X 4KOWA 4ZX9A 4K30A 4QC6A 5F49A 2WSAA 1IOFA 3ISZA 1OZPA 3RO0A 2VL1A 1L0CA 1DTDA 4XPDC 2PR1A 3H8EA 5AG5A 1S60A 1IB1E 2FCKA 4MFLA 3NH8A 4X2TA 1QSOA 2C6CA 3BI1A 4MY3A 1XE4A 1XBUA 5J8FA 1Q2CA 3BLNA 2R7HA 3TFYA 3D3SA 4PQAA 1YLEA 1X12A 4HNYB 3P2FA 3IEHA 1ON0A 4KOYA 2XEFA 3TT2A 4AXVA 3EY5A 1YGHA 4LQ6A 3T90A 3PZJA 3N7ZA 1Z9UA 4MMOA 4MHPA 3VATA 4GXHA 1BO4A 3CZXA 1M1DA 4M6GA 1Y0RA 4OC3A 2ZOFA 4UEZA 3S9LA 3LODA 2XEIA 4PSXA 3ISXA 3TCVA 4NCZA 5DS0A 4PXEA 1LAMA 1M4IA 1XIXA 4CAXA 2Q4YA 3S6FA 3T9YA 3PFOA 1S7KA 2Z3OA 3GIUA 1QMUA 3FEEA 4A32A 3NH5A 4AVAA 3B35A 5K8MA 2NMTA 3D66A 3P2HA 5I4MA 2NYQA 5KTDA 2K5TA 2PJ2A 4F8ZA 5H86A 5J8CA 1MJ9A 2JBJA 2OZGA 2Z10A 4FD5A 4NJRA 2FE7A 4E2AA 1CP6A 3WT4A 1ZO0A 4MFPA 2B5GA 5CPAA 1RO5A 3KQXA 2FT0A 3RNZA 2F7VA 1Z8WA 5D29A 1P0HA 1U6MA 3TX8A 3LWUA 4Q7AA 2WUUA 1SQHA 3IC1A 5DWNA 4DJLA 1Z5RA 4P10A 2V8HA 1YQEA 1I12A 3KHZA 4EVYA 1XMTA 4OADA 2BEIA 2CNSA 2GLJA 2PE3A 2VBQA 2V8DA 2P6FA 3H4QA 4J3GA 4MHDA 4KUAA 2GREA 2PRBA 3V8IA 4C7IA 3QB8A 1QSTA 3B2YA 3F8KA 4B10A 4JZ0A 3GKRA 3L2NA 4NFRA 4UWJA 4XNHB 3VWEA 3FVLA 3R95A 2HQYA 1YVKA 3DNSA 1M44A 5ISVA 2AJ6A 3GYAA 3I3GA 4R87A 5AG6A 2PVVA 1ZG8A 3GLJA 1KUYA 1R57A 2PQ8A 4MXUA 2AFOA 4Y49B 2WPXA 3A9LA 1XF8A 5EMIA 4B11A 1KUVA 1M4LA 8CPAA 1YK3A 1IIDA 1F2OA 1IOIA 4P4IA 1YMEA 3LD2A 1VGYA 2AFWA 2IQ6A 3IO1A 2VQYA 3KGQA 2DXQA 3DGVA 1NSAA 5C88A 3D68A 2PVWA 2OR4A 4YU9A 4R9MA 4UEEA 4DNCA 4EWTA 2QJ8A 4NGQA 5HVGA 4KVXA 4KOTA 1BOBA 1KWMA 3R9GA 4TNUA 4R57A 3DR6A 1UWYA 3LMSA 2JBKA 1S7LA 1HDUA 1KZFA 1YSJA 2ARHA 3JRUA 3R96A 3SXNA 4OAEA 2HV2A 5KTAA 2REEA 2JDCA 2Y0MA 3OWCA 4KUBA 2EVNA 4ORFA 2CY2A 4KLVA 4CAVA 2I00A 2FSRA 1WK4A 3D7GA 3NE7A 1IYKA 1LAPA 1CP7A 4M3SA 6CPAA 3FXTA 4DYOA 1XMBA 2P0WA 3NE8A 2Q04A 2WYRA 4A39A 1S5KA 3JVNA 4OMEA 2PJ9A 1ZLHA 4X3RA 2ATRA 4P4DA 2C27A 2Q44A 4PXDA 4B6ZA 3WABA 3HLPA 1IYLA 4H2KA 4PPZA 3F5BA 4ONWA 3G8WA 4OKOA 3RYOA 3WC7A 3CDXA 2B3UA 5G20A 1AUGA 1IICA 3WC5A 2RFHA 4HNWB 3TO6A 4M6IA 3CT9A 4FWUA 1IGBA 1Z8XA 1S3ZA 4L8AA 1BAVA 4UA3A 5G21A 3S9MA 4P4JA 4ZY2A 4A95A 4B5OA 1VHOA 4F0XA 3PB6X 2O28A 3K9TA 2Z11A 3DDDA 2G9DA 1GHEA 3NH4A 4YRHA 4DUKA 5F46A 4W9YA 1VHSA 2OB0A 2DF5A 4UEFA 7CPAA 4B5PA 2Q51A 2Q4VA 3CXQA 3KKWA 1NSLA 5EBVA 2J8RA 2OH1A 5AGEA 3NFZA 4PXBA 3FX6A 1CPSA 1LOKA 2PRQA 3K2KA 4FAIA 3PB8X 1TIQA 4P4EA 3V38A 4BMHA 4MCPA 3EXNA 3WC6A 4JWPA 1XJOA 3SI0A 2B58A 2GANA 1Q2DA 2G3AA 4H6ZA 2JDDA 4NF1A 4NGPA 3TTHA 4M85A 4TWEA 4MFQA 3CXSA 4BD9A 3PGPA 4UFXA 2G0BA 2AFXA 1B6BA 3EC4A 1Q7LA 1IU8A 2AFZA 3KL9A 4NGTA 4G1PA 2EK8A 2B4DA 2IMOA 1TKJA 4F0YA 4XPLA 3QNVA 4FBEA 3SJXA 4C2ZA 5JM6A 4WJBA 1YREA 3KQZA 3S6HA 3KHXA 4BBHA 2QVPA 2ZW4A 4CGNA 5F09A 1JQGA 1CX8A 2Z3PA 2PCUA 4IAVA 2PJCA 5A27A 4A38A 4AG7A 2F8HA 5K8NA 2I3CA 3TC8A 2VZYA 3BXMA 2ZEMA 2HB6A 3CPXA 4LUAA 4ZI6A 2FS5A 4ZY1A 2ABZA 2OU2A 2PJ7A 3KASA 1MJAA 5GCNA 4C2XA 1PU9A 4UIBA 4A2ZA 4A37A 4Q36A 3PEIA 4GS4A 4M6HA 3R9EA 4MI4A 3C26A 4PK2A 1ZG7A 2GE3A 3SXOA 4NEXA 4X5KA 1K4JA 4JXRA 4CGLA 2FIAA 3D7FA 2PJ4A 4JYWA 4ZY0A 1CG2A 2CIJA 1N71A 4R3LA 4AB7A 3EO4A 3SI1A 4AG9A 1KUXA 2FVGA 1ZLIA 4MHYA 4CAWA 4OC4A 1HEEA 3BJ8A 3H8FA 1BPNA 1I1DA 1R3NA 2X7BA 4CYNA 5HXDA 1LANA 3TO7A 4JD6A 3PP9A 5LYIA 4C2YA 3B3SA 3S9NA 1Q2YA 4QUSA 4FD6A 4Q38A 1OBRA 5IB0A 1Z8TA 2EO8A 2G3TA 2PJ8A 3N5FA 1LCPA 2DPTA 2OZUA 4PV6A 2BO9A 3CXPA 4OLLA 4L89A 3D2MA 4FD4A 2NSMA 2BUEA 4IK2A 3IWWA 1FT7A 5KTCA 2EWBA 5J1QA 2JLMA 1Y9KA 4CGPA 4CAEA 2FIWA 2HC9A 2GFQA 4U5YA 2Q4ZA 2J9AA 4H89A 4K3NA 1Z4RA 2QECA 2ZOGA 3D8PA 1Y9WA 2OOTA 2CTBA 4F9UA 2YNCC 4XNHC 2Q7SA 2B3VA 3I9SA 4IF5A 4NXYA 4ZGYB 3ZJ0A 1UFHA 3PRTA 4QB9A 3VARA 3DSBA 4ZBGA 4MY0A 4CGMA 4MCRA 2QIRA 4UBRA 3IU1A 1V0CA 1X10A 2YNDA 4MCSA 4RI1A 5LRJA 5HH1A 4CYOA 5THWA 2CNTA 2OZHA 4X8IA 1LRZA 4P45A 2ZW7A 2PIZA 4R7MA 1ELLP 2RC4A 4LX9A 2ODFA 4KZTA 5G22A 5LYLA 5AG7A 4NSQA 4MFKA 4YWYA 4WWVA 1J4JA 3NA6A 3FIXA 3W6SA 4P6YA 2CTCA 2PJ3A 3FMCA 3SJGA 1BLLE 4PSWA 2C6PA 4FUUA 2GLFA 4UCMA 5F47A 4Y49C 4BINA 4QBJA 3SHPA 3E0KA 3VWDA 2PJAA 1CJWA 1TKHA 5IV0A 3IJ3A 4OC0A 3D7DA 2PSWA 4RUHA 4LQGA 2D4PA 2R8VA 4KS9A 4B12A 2H5MA 5E96A 2D4OA 3H5ZA 3IFEA 4EMEA 2J8NA 3RAMA 5HVFA 2ZEPA 1P4NA 4ZX8A 3FJUA 4UWIA 1VHEA 1YW6A 2V8GA 3KR5A 4C68A 3RBUA 1GYTA 1PCAA 1A2ZA 2KCWA 4NGMA 4U9ZA 2O4HA 4JJXA 4RS2A 3PFEA 4QVTA 3FECA 4MFJA 4CRZB 2O53A 3IGRA 2XEGA 2V77A 4AVCA 1BPMA 4CGOA 1NE9A 4EFDA 1XFOA 2JEVA 1JWQA 2ANPA 4IHMA 1YW4A 2QYVA 1VKCA 3FH4A 3SJFA 4MFZA 4II9A 2YNCA 2WPWA 5FVJA 4MJ8A 1ARLA 4KOVA 5BWAB 5LYFA 2Z3LA 2PJ6A 5JPHA 5ELYA 2ZW5A 3FB3A 1ZG9A 3V7ZA 3S6KA 4KORA 3R1KA 3MN8A 2C6GA 3DR8A 4FD7A 4NGSA 2PJ1A 3SI2A 5DWMA 2Q7BA 4PK3A 2AE6A 3BI0A 2ZPAA 4YFJA 5HMNA 2R1IA 3IWEA 3F0AA 2B4DB 2EBJA 3FNCA 4A31A 4GM5A 1AYEA 5F48A 2Z0ZA 2C1CA 2XEJA 2F5IA 5JH9A 1I21A 3PBEA 4NJQA 1IY7A 2HUZA 1H8LA 3TOAA 1XEBA 1CM0A 2CF4A 1F57A 4JXQA 2ZEGA 1Y7EA 4MCQA 2ZW6A 4R8FA 1YVOA 4MRIA 4UFWA 5CNPA 2GIVA 1YLOA 5A28A 1NMTA 1QSNA 3H8GA 3HUVA 4HKFA 1YX0A 4UF4A 3WR7A 4A33A 4P44A 4Z65A 5C82A 4P4BA 3KI9A 4PXCA 1YR0A 3PBBA 4MHNA 5JGFA 4R3KA 3S6GA 3KR4A 3PB4X 4ZYQA 4B5PB 2PR8A 2PC1A 2ZEDA 2I79A 3PB7X 2ZELA 4R6TA 5LYDA 3ZZIA 3I1UA 3QAHA 4NGRA 3KZWA 2Z3NA 3GY9A 4RN7A 2ZEOA 2GU2A 2ZEEA 4C7HA 2P6GA 3BJ7A 3UY5A 4B13A 5CBMA 2EK9A 2JEWA 4CPAA 3DLJA 4XPKA 3D4UA 4OC2A 3D7HA 4HPSA 3JTKA 4AVBA 4O23A 4UIAA 2VZZA 1LFWA 2Z3MA 1RXTA 3IWGA 3GB0A 3TO9A 2PDOA 3LACA 3B7IA 4KSAA 1QSRA 3BHXA 4UFVA 4R76A 3CPAA 4OC1A 4KLWA 4MBUA 3RZAA 4ONUA 5AG4A 4H6UA 3TOBA 4JLYA 2FXFA 1MJBA 4CS0B 2RB7A 1XOVA 1CBXA 2FL4A 2BOAA 3T8WA 3R9FA 1R43A 4OIWA 1FY7A 1DE4C 2ZEFA 4I49A 4OP4A 3D67A 4KOSA 5D8NA 1ARMA 4CAFA 1M4DA 5IX3A 2QMLA 4B14A 4KOUA 2CNMA 2P6EA 4YGOA 5EC4A 2VEZA 1WWZA 3FRMA 4CYPA 5K8OA 4U9YA 1FNOA 3GUXA 2AFUA 4HNXB 2ZENA 2AFMA 5I0CA 1S7FA 4KSFA 2A4NA 3B3VA 1TKFA 3IU2A 2YNEA 3W6XA 1Y7RA 1S7NA 2IJZA 1XRYA 4OIDA 5IB9A 1AMPA 5JQ4A 2VXKA 1VIXA 1Y0YA 1Z8LA 2PJ5A 4IUSA 4OC5A 4E0AA 3FYNA 1F2PA 3FBUA 2Q43A 3B3CA 3FF3A 3B8GA 2B5GB 4E8OA 4KOXA 2PJBA 4XPDB 4A94A 2BSWA 3B3TA 3D2PA 3IIBA 4KVME 2DPSA 3MGDA 5H84A 4CRYB 4F6AA 4A30A 3W91A 2PJ0A 2V8VA 2YGWA 4MHZA 2BCOA 5G1ZA 5LRGA 2PIYA 1Z4EA 1TF9A 1HDQA 1M4GA 2VI7A 1EE3P 5LRKA 2ZXVA 2WZNA 3FEDA 1Z2LA 3VH9A 5HVHA 5K8PA 1TF8A 1RTQA 2AFSA 2BL1A 2Q0YA 1ELMP 2R98A 2REFA 4KSIA 1QQ9A 3EFAA 4F9VA 4NGNA 2CXAA 1PUAA 1TXRA 2DEAA 1B87A 1QSMA
chains in the Genus database with same CATH topology
2Z3KA 3K9UA 2EUIA 2J8MA 4CYQA 1MK4A 3TE4A 4UCPA 4UCNA 2B4BA 4KVOE 3G3SA 2IL4A 3JUWA 4KOWA 4K30A 4QC6A 5F49A 2WSAA 1OZPA 1L0CA 4XPDC 2PR1A 5AG5A 1S60A 1IB1E 2FCKA 4MFLA 1QSOA 4MY3A 1XE4A 5J8FA 1Q2CA 3BLNA 2R7HA 3TFYA 3D3SA 1YLEA 4HNYB 3P2FA 1ON0A 4KOYA 3TT2A 3EY5A 1YGHA 3T90A 3PZJA 3N7ZA 1Z9UA 1BO4A 1M1DA 3LODA 4PSXA 3TCVA 4NCZA 1M4IA 1XIXA 4CAXA 2Q4YA 3S6FA 3T9YA 1S7KA 2Z3OA 4A32A 4AVAA 2NMTA 3P2HA 5KTDA 2K5TA 5H86A 5J8CA 1MJ9A 2OZGA 2Z10A 4FD5A 4E2AA 2FE7A 1ZO0A 4MFPA 2B5GA 1RO5A 2FT0A 1P0HA 1U6MA 2WUUA 1SQHA 5DWNA 1I12A 4EVYA 1XMTA 4OADA 2BEIA 2CNSA 2VBQA 4J3GA 3H4QA 2P6FA 4MHDA 4KUAA 2PRBA 3V8IA 4C7IA 3QB8A 1QSTA 3F8KA 4B10A 4UWJA 3GKRA 3VWEA 4XNHB 3R95A 2HQYA 1YVKA 3DNSA 1M44A 5ISVA 2AJ6A 3GYAA 3I3GA 4R87A 5AG6A 1KUYA 1R57A 2PQ8A 4Y49B 4B11A 2WPXA 3A9LA 1XF8A 1KUVA 1YK3A 1IIDA 3LD2A 2VQYA 2DXQA 5C88A 4R9MA 4DNCA 4KVXA 4KOTA 1BOBA 3R9GA 4R57A 3DR6A 3R96A 1S7LA 3SXNA 1KZFA 2ARHA 4OAEA 2HV2A 5KTAA 2REEA 2JDCA 2Y0MA 3OWCA 4KUBA 2EVNA 4ORFA 2CY2A 4KLVA 4CAVA 2I00A 2FSRA 1WK4A 3NE7A 1IYKA 4M3SA 3FXTA 2P0WA 2Q04A 1S5KA 3JVNA 2ATRA 2C27A 2Q44A 1IYLA 3F5BA 3G8WA 3RYOA 2B3UA 5G20A 1IICA 4HNWB 3TO6A 4L8AA 1S3ZA 4UA3A 5G21A 4A95A 4B5OA 4F0XA 2O28A 2Z11A 3DDDA 1GHEA 4YRHA 5F46A 1VHSA 2OB0A 4B5PA 2Q4VA 3CXQA 3KKWA 1NSLA 5EBVA 2J8RA 2OH1A 5AGEA 1TIQA 4BMHA 3EXNA 4JWPA 2B58A 2GANA 1Q2DA 2G3AA 4H6ZA 2JDDA 4NF1A 3TTHA 4M85A 4MFQA 3CXSA 3PGPA 4UFXA 2G0BA 3EC4A 1B6BA 2B4DA 4F0YA 4C2ZA 1YREA 3S6HA 4BBHA 4CGNA 2ZW4A 2Z3PA 5A27A 4AG7A 2VZYA 4LUAA 2FS5A 2OU2A 1MJAA 5GCNA 4C2XA 1PU9A 4A2ZA 4Q36A 4GS4A 3R9EA 4MI4A 3C26A 4PK2A 2GE3A 3SXOA 4NEXA 4X5KA 1K4JA 4JXRA 4CGLA 2FIAA 1N71A 4R3LA 4AB7A 3EO4A 4AG9A 1KUXA 4CAWA 3BJ8A 1I1DA 4CYNA 2X7BA 3TO7A 4JD6A 3PP9A 4C2YA 1Q2YA 4QUSA 4FD6A 4Q38A 5IB0A 2G3TA 2DPTA 2OZUA 4PV6A 3CXPA 4OLLA 4L89A 3D2MA 4FD4A 2BUEA 5KTCA 2JLMA 1Y9KA 4CGPA 4CAEA 2FIWA 4U5YA 4H89A 1Z4RA 2QECA 3D8PA 1Y9WA 2YNCC 4XNHC 2B3VA 3I9SA 4IF5A 4NXYA 4ZGYB 3ZJ0A 1UFHA 4QB9A 3DSBA 4ZBGA 4MY0A 4CGMA 2QIRA 4UBRA 3IU1A 1V0CA 2YNDA 4RI1A 5HH1A 4CYOA 2CNTA 2OZHA 1LRZA 2ZW7A 4LX9A 2RC4A 4KZTA 5G22A 5AG7A 4NSQA 4MFKA 1J4JA 3FIXA 3W6SA 4PSWA 4UCMA 5F47A 4Y49C 4QBJA 3SHPA 3E0KA 3VWDA 1CJWA 5IV0A 2PSWA 2D4PA 2R8VA 4KS9A 4B12A 2H5MA 5E96A 2D4OA 3H5ZA 2J8NA 1P4NA 4UWIA 4C68A 2KCWA 4U9ZA 4JJXA 4RS2A 4QVTA 4MFJA 4CRZB 3IGRA 4AVCA 4CGOA 1NE9A 2JEVA 1VKCA 4MFZA 4II9A 2YNCA 2WPWA 5FVJA 4MJ8A 4KOVA 5BWAB 2Z3LA 5JPHA 2ZW5A 3FB3A 3S6KA 4KORA 3R1KA 3DR8A 4FD7A 5DWMA 2Q7BA 4PK3A 2AE6A 4YFJA 2ZPAA 5HMNA 2R1IA 3IWEA 3F0AA 2B4DB 3FNCA 4A31A 5F48A 2Z0ZA 2F5IA 1I21A 2HUZA 3TOAA 1XEBA 1CM0A 4JXQA 2ZW6A 1YVOA 4UFWA 5CNPA 2GIVA 5A28A 1NMTA 1QSNA 4HKFA 4A33A 1YX0A 3WR7A 5C82A 1YR0A 4R3KA 3S6GA 4B5PB 2PR8A 2PC1A 2I79A 3ZZIA 3QAHA 2Z3NA 3GY9A 4C7HA 2P6GA 3BJ7A 3UY5A 4B13A 4XPKA 4AVBA 3JTKA 2VZZA 2Z3MA 1RXTA 3IWGA 3TO9A 2PDOA 4KSAA 1QSRA 4UFVA 4KLWA 4MBUA 4ONUA 5AG4A 4H6UA 3TOBA 4JLYA 2FXFA 1MJBA 4CS0B 2FL4A 3R9FA 1FY7A 4I49A 4KOSA 4CAFA 1M4DA 5IX3A 2QMLA 4B14A 4KOUA 2CNMA 2P6EA 4YGOA 5EC4A 2VEZA 1WWZA 3FRMA 4CYPA 4U9YA 4HNXB 5I0CA 1S7FA 4KSFA 2A4NA 3IU2A 2YNEA 3W6XA 1Y7RA 1S7NA 5JQ4A 2VXKA 4IUSA 4E0AA 3FYNA 3FBUA 3B8GA 2B5GB 4E8OA 4KOXA 4XPDB 2BSWA 3D2PA 4KVME 2DPSA 3MGDA 5H84A 4CRYB 4F6AA 4A30A 3W91A 2YGWA 5G1ZA 1Z4EA 1M4GA 2VI7A 2ZXVA 2BL1A 2Q0YA 2R98A 2REFA 3EFAA 2CXAA 1PUAA 4XPLA 1B87A 1QSMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K9U A;  2EUI A;  2J8M A;  1MK4 A;  3TE4 A;  2B4B A;  4KVO E;  3G3S A;  2IL4 A;  3JUW A;  4KOW A;  4K30 A;  4QC6 A;  5F49 A;  1OZP A;  1L0C A;  4XPD C;  2PR1 A;  1S60 A;  1IB1 E;  2FCK A;  1QSO A;  4MY3 A;  1XE4 A;  5J8F A;  1Q2C A;  3BLN A;  2R7H A;  3TFY A;  3D3S A;  1YLE A;  4HNY B;  3P2F A;  1ON0 A;  4KOY A;  3TT2 A;  3EY5 A;  1YGH A;  3T90 A;  3PZJ A;  3N7Z A;  1Z9U A;  1BO4 A;  1M1D A;  3LOD A;  4PSX A;  3TCV A;  4NCZ A;  1M4I A;  1XIX A;  4CAX A;  2Q4Y A;  3S6F A;  3T9Y A;  1S7K A;  4AVA A;  2NMT A;  3P2H A;  5KTD A;  2K5T A;  5H86 A;  5J8C A;  1MJ9 A;  2OZG A;  2Z10 A;  4FD5 A;  4E2A A;  2FE7 A;  2B5G A;  1RO5 A;  2FT0 A;  1P0H A;  1U6M A;  1SQH A;  5DWN A;  1I12 A;  4EVY A;  1XMT A;  4OAD A;  2BEI A;  2CNS A;  2VBQ A;  4J3G A;  3H4Q A;  2P6F A;  4MHD A;  4KUA A;  2PRB A;  3V8I A;  3QB8 A;  1QST A;  3F8K A;  4UWJ A;  3GKR A;  3VWE A;  4XNH B;  3R95 A;  2HQY A;  1YVK A;  3DNS A;  1M44 A;  5ISV A;  2AJ6 A;  3GYA A;  3I3G A;  4R87 A;  1KUY A;  1R57 A;  2PQ8 A;  4Y49 B;  2WPX A;  1XF8 A;  1KUV A;  1YK3 A;  1IID A;  3LD2 A;  2VQY A;  2DXQ A;  5C88 A;  4R9M A;  4DNC A;  4KVX A;  4KOT A;  1BOB A;  3R9G A;  4R57 A;  3DR6 A;  3R96 A;  1S7L A;  3SXN A;  1KZF A;  2ARH A;  4OAE A;  2HV2 A;  5KTA A;  2REE A;  2JDC A;  2Y0M A;  3OWC A;  4KUB A;  2EVN A;  4ORF A;  2CY2 A;  4KLV A;  4CAV A;  2I00 A;  2FSR A;  1WK4 A;  3NE7 A;  1IYK A;  4M3S A;  3FXT A;  2P0W A;  2Q04 A;  1S5K A;  3JVN A;  2ATR A;  2C27 A;  2Q44 A;  1IYL A;  3F5B A;  3G8W A;  3RYO A;  2B3U A;  1IIC A;  4HNW B;  3TO6 A;  4L8A A;  1S3Z A;  4UA3 A;  4B5O A;  2O28 A;  2Z11 A;  3DDD A;  1GHE A;  4YRH A;  5F46 A;  1VHS A;  2OB0 A;  4B5P A;  2Q4V A;  3CXQ A;  3KKW A;  1NSL A;  5EBV A;  2J8R A;  2OH1 A;  1TIQ A;  4BMH A;  3EXN A;  4JWP A;  2B58 A;  2GAN A;  1Q2D A;  2G3A A;  4H6Z A;  2JDD A;  4NF1 A;  3TTH A;  4M85 A;  3CXS A;  3PGP A;  2G0B A;  3EC4 A;  1B6B A;  2B4D A;  4F0Y A;  1YRE A;  3S6H A;  2ZW4 A;  4AG7 A;  2VZY A;  4LUA A;  2FS5 A;  2OU2 A;  1MJA A;  5GCN A;  1PU9 A;  4GS4 A;  3R9E A;  4MI4 A;  3C26 A;  4PK2 A;  2GE3 A;  3SXO A;  4NEX A;  4X5K A;  1K4J A;  4JXR A;  2FIA A;  1N71 A;  4R3L A;  4AB7 A;  3EO4 A;  4AG9 A;  1KUX A;  4CAW A;  3BJ8 A;  1I1D A;  2X7B A;  3TO7 A;  4JD6 A;  3PP9 A;  1Q2Y A;  4QUS A;  4FD6 A;  5IB0 A;  2G3T A;  4PV6 A;  2OZU A;  3CXP A;  4OLL A;  4L89 A;  3D2M A;  4FD4 A;  2BUE A;  5KTC A;  2JLM A;  1Y9K A;  2FIW A;  4U5Y A;  4H89 A;  1Z4R A;  2QEC A;  3D8P A;  1Y9W A;  4XNH C;  2B3V A;  3I9S A;  4IF5 A;  4NXY A;  3ZJ0 A;  1UFH A;  4QB9 A;  3DSB A;  4ZBG A;  4MY0 A;  2QIR A;  4UBR A;  1V0C A;  4RI1 A;  5HH1 A;  2CNT A;  2OZH A;  1LRZ A;  2ZW7 A;  4LX9 A;  2RC4 A;  4KZT A;  4NSQ A;  1J4J A;  3FIX A;  3W6S A;  4PSW A;  5F47 A;  4Y49 C;  4QBJ A;  3SHP A;  3E0K A;  3VWD A;  1CJW A;  5IV0 A;  2PSW A;  2D4P A;  2R8V A;  2H5M A;  5E96 A;  2D4O A;  2J8N A;  1P4N A;  4UWI A;  2KCW A;  4U9Z A;  4JJX A;  4RS2 A;  4QVT A;  4CRZ B;  3IGR A;  4AVC A;  1NE9 A;  2JEV A;  1VKC A;  4II9 A;  2WPW A;  5FVJ A;  4MJ8 A;  4KOV A;  5JPH A;  2ZW5 A;  3FB3 A;  3S6K A;  4KOR A;  3R1K A;  3DR8 A;  4FD7 A;  5DWM A;  2Q7B A;  4PK3 A;  2AE6 A;  4YFJ A;  2ZPA A;  5HMN A;  2R1I A;  3F0A A;  2B4D B;  3FNC A;  5F48 A;  2Z0Z A;  2F5I A;  1I21 A;  2HUZ A;  3TOA A;  1XEB A;  1CM0 A;  4JXQ A;  2ZW6 A;  1YVO A;  5CNP A;  2GIV A;  1NMT A;  1QSN A;  4HKF A;  1YX0 A;  3WR7 A;  5C82 A;  1YR0 A;  4R3K A;  3S6G A;  4B5P B;  2PR8 A;  2PC1 A;  2I79 A;  3ZZI A;  3QAH A;  3GY9 A;  2P6G A;  3BJ7 A;  3UY5 A;  4XPK A;  4AVB A;  2VZZ A;  1RXT A;  3IWG A;  3TO9 A;  2PDO A;  1QSR A;  4KLW A;  4MBU A;  4ONU A;  4H6U A;  3TOB A;  4JLY A;  2FXF A;  1MJB A;  4CS0 B;  2FL4 A;  3R9F A;  1FY7 A;  4I49 A;  4KOS A;  1M4D A;  5IX3 A;  2QML A;  4KOU A;  2CNM A;  2P6E A;  4YGO A;  5EC4 A;  2VEZ A;  1WWZ A;  3FRM A;  4U9Y A;  4HNX B;  5I0C A;  1S7F A;  2A4N A;  3W6X A;  1Y7R A;  1S7N A;  5JQ4 A;  2VXK A;  4IUS A;  4E0A A;  3FYN A;  3FBU A;  3B8G A;  2B5G B;  4E8O A;  4KOX A;  4XPD B;  2BSW A;  3D2P A;  4KVM E;  3MGD A;  5H84 A;  4CRY B;  4F6A A;  3W91 A;  1Z4E A;  1M4G A;  2VI7 A;  2ZXV A;  2BL1 A;  2Q0Y A;  2R98 A;  2REF A;  3EFA A;  1PUA A;  4XPL A;  1B87 A;  1QSM A; 
#chains in the Genus database with same CATH topology
 1PYT B;  2Z3K A;  3K9U A;  2EUI A;  2J8M A;  3MRU A;  3QAY A;  4CYQ A;  1MK4 A;  3TE4 A;  4UCP A;  4UCN A;  4P4F A;  2B4B A;  4KVO E;  2ZEH A;  3SJE A;  3B3W A;  1CPX A;  3G3S A;  2POK A;  2IL4 A;  3JUW A;  3PB9 X;  4KOW A;  4ZX9 A;  4K30 A;  4QC6 A;  5F49 A;  2WSA A;  1IOF A;  3ISZ A;  1OZP A;  3RO0 A;  2VL1 A;  1L0C A;  1DTD A;  4XPD C;  2PR1 A;  3H8E A;  5AG5 A;  1S60 A;  1IB1 E;  2FCK A;  4MFL A;  3NH8 A;  4X2T A;  1QSO A;  2C6C A;  3BI1 A;  4MY3 A;  1XE4 A;  1XBU A;  5J8F A;  1Q2C A;  3BLN A;  2R7H A;  3TFY A;  3D3S A;  4PQA A;  1YLE A;  1X12 A;  4HNY B;  3P2F A;  3IEH A;  1ON0 A;  4KOY A;  2XEF A;  3TT2 A;  4AXV A;  3EY5 A;  1YGH A;  4LQ6 A;  3T90 A;  3PZJ A;  3N7Z A;  1Z9U A;  4MMO A;  4MHP A;  3VAT A;  4GXH A;  1BO4 A;  3CZX A;  1M1D A;  4M6G A;  1Y0R A;  4OC3 A;  2ZOF A;  4UEZ A;  3S9L A;  3LOD A;  2XEI A;  4PSX A;  3ISX A;  3TCV A;  4NCZ A;  5DS0 A;  4PXE A;  1LAM A;  1M4I A;  1XIX A;  4CAX A;  2Q4Y A;  3S6F A;  3T9Y A;  3PFO A;  1S7K A;  2Z3O A;  3GIU A;  1QMU A;  3FEE A;  4A32 A;  3NH5 A;  4AVA A;  3B35 A;  5K8M A;  2NMT A;  3D66 A;  3P2H A;  5I4M A;  2NYQ A;  5KTD A;  2K5T A;  2PJ2 A;  4F8Z A;  5H86 A;  5J8C A;  1MJ9 A;  2JBJ A;  2OZG A;  2Z10 A;  4FD5 A;  4NJR A;  2FE7 A;  4E2A A;  1CP6 A;  3WT4 A;  1ZO0 A;  4MFP A;  2B5G A;  5CPA A;  1RO5 A;  3KQX A;  2FT0 A;  3RNZ A;  2F7V A;  1Z8W A;  5D29 A;  1P0H A;  1U6M A;  3TX8 A;  3LWU A;  4Q7A A;  2WUU A;  1SQH A;  3IC1 A;  5DWN A;  4DJL A;  1Z5R A;  4P10 A;  2V8H A;  1YQE A;  1I12 A;  3KHZ A;  4EVY A;  1XMT A;  4OAD A;  2BEI A;  2CNS A;  2GLJ A;  2PE3 A;  2VBQ A;  2V8D A;  2P6F A;  3H4Q A;  4J3G A;  4MHD A;  4KUA A;  2GRE A;  2PRB A;  3V8I A;  4C7I A;  3QB8 A;  1QST A;  3B2Y A;  3F8K A;  4B10 A;  4JZ0 A;  3GKR A;  3L2N A;  4NFR A;  4UWJ A;  4XNH B;  3VWE A;  3FVL A;  3R95 A;  2HQY A;  1YVK A;  3DNS A;  1M44 A;  5ISV A;  2AJ6 A;  3GYA A;  3I3G A;  4R87 A;  5AG6 A;  2PVV A;  1ZG8 A;  3GLJ A;  1KUY A;  1R57 A;  2PQ8 A;  4MXU A;  2AFO A;  4Y49 B;  2WPX A;  3A9L A;  1XF8 A;  5EMI A;  4B11 A;  1KUV A;  1M4L A;  8CPA A;  1YK3 A;  1IID A;  1F2O A;  1IOI A;  4P4I A;  1YME A;  3LD2 A;  1VGY A;  2AFW A;  2IQ6 A;  3IO1 A;  2VQY A;  3KGQ A;  2DXQ A;  3DGV A;  1NSA A;  5C88 A;  3D68 A;  2PVW A;  2OR4 A;  4YU9 A;  4R9M A;  4UEE A;  4DNC A;  4EWT A;  2QJ8 A;  4NGQ A;  5HVG A;  4KVX A;  4KOT A;  1BOB A;  1KWM A;  3R9G A;  4TNU A;  4R57 A;  3DR6 A;  1UWY A;  3LMS A;  2JBK A;  1S7L A;  1HDU A;  1KZF A;  1YSJ A;  2ARH A;  3JRU A;  3R96 A;  3SXN A;  4OAE A;  2HV2 A;  5KTA A;  2REE A;  2JDC A;  2Y0M A;  3OWC A;  4KUB A;  2EVN A;  4ORF A;  2CY2 A;  4KLV A;  4CAV A;  2I00 A;  2FSR A;  1WK4 A;  3D7G A;  3NE7 A;  1IYK A;  1LAP A;  1CP7 A;  4M3S A;  6CPA A;  3FXT A;  4DYO A;  1XMB A;  2P0W A;  3NE8 A;  2Q04 A;  2WYR A;  4A39 A;  1S5K A;  3JVN A;  4OME A;  2PJ9 A;  1ZLH A;  4X3R A;  2ATR A;  4P4D A;  2C27 A;  2Q44 A;  4PXD A;  4B6Z A;  3WAB A;  3HLP A;  1IYL A;  4H2K A;  4PPZ A;  3F5B A;  4ONW A;  3G8W A;  4OKO A;  3RYO A;  3WC7 A;  3CDX A;  2B3U A;  5G20 A;  1AUG A;  1IIC A;  3WC5 A;  2RFH A;  4HNW B;  3TO6 A;  4M6I A;  3CT9 A;  4FWU A;  1IGB A;  1Z8X A;  1S3Z A;  4L8A A;  1BAV A;  4UA3 A;  5G21 A;  3S9M A;  4P4J A;  4ZY2 A;  4A95 A;  4B5O A;  1VHO A;  4F0X A;  3PB6 X;  2O28 A;  3K9T A;  2Z11 A;  3DDD A;  2G9D A;  1GHE A;  3NH4 A;  4YRH A;  4DUK A;  5F46 A;  4W9Y A;  1VHS A;  2OB0 A;  2DF5 A;  4UEF A;  7CPA A;  4B5P A;  2Q51 A;  2Q4V A;  3CXQ A;  3KKW A;  1NSL A;  5EBV A;  2J8R A;  2OH1 A;  5AGE A;  3NFZ A;  4PXB A;  3FX6 A;  1CPS A;  1LOK A;  2PRQ A;  3K2K A;  4FAI A;  3PB8 X;  1TIQ A;  4P4E A;  3V38 A;  4BMH A;  4MCP A;  3EXN A;  3WC6 A;  4JWP A;  1XJO A;  3SI0 A;  2B58 A;  2GAN A;  1Q2D A;  2G3A A;  4H6Z A;  2JDD A;  4NF1 A;  4NGP A;  3TTH A;  4M85 A;  4TWE A;  4MFQ A;  3CXS A;  4BD9 A;  3PGP A;  4UFX A;  2G0B A;  2AFX A;  1B6B A;  3EC4 A;  1Q7L A;  1IU8 A;  2AFZ A;  3KL9 A;  4NGT A;  4G1P A;  2EK8 A;  2B4D A;  2IMO A;  1TKJ A;  4F0Y A;  4XPL A;  3QNV A;  4FBE A;  3SJX A;  4C2Z A;  5JM6 A;  4WJB A;  1YRE A;  3KQZ A;  3S6H A;  3KHX A;  4BBH A;  2QVP A;  2ZW4 A;  4CGN A;  5F09 A;  1JQG A;  1CX8 A;  2Z3P A;  2PCU A;  4IAV A;  2PJC A;  5A27 A;  4A38 A;  4AG7 A;  2F8H A;  5K8N A;  2I3C A;  3TC8 A;  2VZY A;  3BXM A;  2ZEM A;  2HB6 A;  3CPX A;  4LUA A;  4ZI6 A;  2FS5 A;  4ZY1 A;  2ABZ A;  2OU2 A;  2PJ7 A;  3KAS A;  1MJA A;  5GCN A;  4C2X A;  1PU9 A;  4UIB A;  4A2Z A;  4A37 A;  4Q36 A;  3PEI A;  4GS4 A;  4M6H A;  3R9E A;  4MI4 A;  3C26 A;  4PK2 A;  1ZG7 A;  2GE3 A;  3SXO A;  4NEX A;  4X5K A;  1K4J A;  4JXR A;  4CGL A;  2FIA A;  3D7F A;  2PJ4 A;  4JYW A;  4ZY0 A;  1CG2 A;  2CIJ A;  1N71 A;  4R3L A;  4AB7 A;  3EO4 A;  3SI1 A;  4AG9 A;  1KUX A;  2FVG A;  1ZLI A;  4MHY A;  4CAW A;  4OC4 A;  1HEE A;  3BJ8 A;  3H8F A;  1BPN A;  1I1D A;  1R3N A;  2X7B A;  4CYN A;  5HXD A;  1LAN A;  3TO7 A;  4JD6 A;  3PP9 A;  5LYI A;  4C2Y A;  3B3S A;  3S9N A;  1Q2Y A;  4QUS A;  4FD6 A;  4Q38 A;  1OBR A;  5IB0 A;  1Z8T A;  2EO8 A;  2G3T A;  2PJ8 A;  3N5F A;  1LCP A;  2DPT A;  2OZU A;  4PV6 A;  2BO9 A;  3CXP A;  4OLL A;  4L89 A;  3D2M A;  4FD4 A;  2NSM A;  2BUE A;  4IK2 A;  3IWW A;  1FT7 A;  5KTC A;  2EWB A;  5J1Q A;  2JLM A;  1Y9K A;  4CGP A;  4CAE A;  2FIW A;  2HC9 A;  2GFQ A;  4U5Y A;  2Q4Z A;  2J9A A;  4H89 A;  4K3N A;  1Z4R A;  2QEC A;  2ZOG A;  3D8P A;  1Y9W A;  2OOT A;  2CTB A;  4F9U A;  2YNC C;  4XNH C;  2Q7S A;  2B3V A;  3I9S A;  4IF5 A;  4NXY A;  4ZGY B;  3ZJ0 A;  1UFH A;  3PRT A;  4QB9 A;  3VAR A;  3DSB A;  4ZBG A;  4MY0 A;  4CGM A;  4MCR A;  2QIR A;  4UBR A;  3IU1 A;  1V0C A;  1X10 A;  2YND A;  4MCS A;  4RI1 A;  5LRJ A;  5HH1 A;  4CYO A;  5THW A;  2CNT A;  2OZH A;  4X8I A;  1LRZ A;  4P45 A;  2ZW7 A;  2PIZ A;  4R7M A;  1ELL P;  2RC4 A;  4LX9 A;  2ODF A;  4KZT A;  5G22 A;  5LYL A;  5AG7 A;  4NSQ A;  4MFK A;  4YWY A;  4WWV A;  1J4J A;  3NA6 A;  3FIX A;  3W6S A;  4P6Y A;  2CTC A;  2PJ3 A;  3FMC A;  3SJG A;  1BLL E;  4PSW A;  2C6P A;  4FUU A;  2GLF A;  4UCM A;  5F47 A;  4Y49 C;  4BIN A;  4QBJ A;  3SHP A;  3E0K A;  3VWD A;  2PJA A;  1CJW A;  1TKH A;  5IV0 A;  3IJ3 A;  4OC0 A;  3D7D A;  2PSW A;  4RUH A;  4LQG A;  2D4P A;  2R8V A;  4KS9 A;  4B12 A;  2H5M A;  5E96 A;  2D4O A;  3H5Z A;  3IFE A;  4EME A;  2J8N A;  3RAM A;  5HVF A;  2ZEP A;  1P4N A;  4ZX8 A;  3FJU A;  4UWI A;  1VHE A;  1YW6 A;  2V8G A;  3KR5 A;  4C68 A;  3RBU A;  1GYT A;  1PCA A;  1A2Z A;  2KCW A;  4NGM A;  4U9Z A;  2O4H A;  4JJX A;  4RS2 A;  3PFE A;  4QVT A;  3FEC A;  4MFJ A;  4CRZ B;  2O53 A;  3IGR A;  2XEG A;  2V77 A;  4AVC A;  1BPM A;  4CGO A;  1NE9 A;  4EFD A;  1XFO A;  2JEV A;  1JWQ A;  2ANP A;  4IHM A;  1YW4 A;  2QYV A;  1VKC A;  3FH4 A;  3SJF A;  4MFZ A;  4II9 A;  2YNC A;  2WPW A;  5FVJ A;  4MJ8 A;  1ARL A;  4KOV A;  5BWA B;  5LYF A;  2Z3L A;  2PJ6 A;  5JPH A;  5ELY A;  2ZW5 A;  3FB3 A;  1ZG9 A;  3V7Z A;  3S6K A;  4KOR A;  3R1K A;  3MN8 A;  2C6G A;  3DR8 A;  4FD7 A;  4NGS A;  2PJ1 A;  3SI2 A;  5DWM A;  2Q7B A;  4PK3 A;  2AE6 A;  3BI0 A;  2ZPA A;  4YFJ A;  5HMN A;  2R1I A;  3IWE A;  3F0A A;  2B4D B;  2EBJ A;  3FNC A;  4A31 A;  4GM5 A;  1AYE A;  5F48 A;  2Z0Z A;  2C1C A;  2XEJ A;  2F5I A;  5JH9 A;  1I21 A;  3PBE A;  4NJQ A;  1IY7 A;  2HUZ A;  1H8L A;  3TOA A;  1XEB A;  1CM0 A;  2CF4 A;  1F57 A;  4JXQ A;  2ZEG A;  1Y7E A;  4MCQ A;  2ZW6 A;  4R8F A;  1YVO A;  4MRI A;  4UFW A;  5CNP A;  2GIV A;  1YLO A;  5A28 A;  1NMT A;  1QSN A;  3H8G A;  3HUV A;  4HKF A;  1YX0 A;  4UF4 A;  3WR7 A;  4A33 A;  4P44 A;  4Z65 A;  5C82 A;  4P4B A;  3KI9 A;  4PXC A;  1YR0 A;  3PBB A;  4MHN A;  5JGF A;  4R3K A;  3S6G A;  3KR4 A;  3PB4 X;  4ZYQ A;  4B5P B;  2PR8 A;  2PC1 A;  2ZED A;  2I79 A;  3PB7 X;  2ZEL A;  4R6T A;  5LYD A;  3ZZI A;  3I1U A;  3QAH A;  4NGR A;  3KZW A;  2Z3N A;  3GY9 A;  4RN7 A;  2ZEO A;  2GU2 A;  2ZEE A;  4C7H A;  2P6G A;  3BJ7 A;  3UY5 A;  4B13 A;  5CBM A;  2EK9 A;  2JEW A;  4CPA A;  3DLJ A;  4XPK A;  3D4U A;  4OC2 A;  3D7H A;  4HPS A;  3JTK A;  4AVB A;  4O23 A;  4UIA A;  2VZZ A;  1LFW A;  2Z3M A;  1RXT A;  3IWG A;  3GB0 A;  3TO9 A;  2PDO A;  3LAC A;  3B7I A;  4KSA A;  1QSR A;  3BHX A;  4UFV A;  4R76 A;  3CPA A;  4OC1 A;  4KLW A;  4MBU A;  3RZA A;  4ONU A;  5AG4 A;  4H6U A;  3TOB A;  4JLY A;  2FXF A;  1MJB A;  4CS0 B;  2RB7 A;  1XOV A;  1CBX A;  2FL4 A;  2BOA A;  3T8W A;  3R9F A;  1R43 A;  4OIW A;  1FY7 A;  1DE4 C;  2ZEF A;  4I49 A;  4OP4 A;  3D67 A;  4KOS A;  5D8N A;  1ARM A;  4CAF A;  1M4D A;  5IX3 A;  2QML A;  4B14 A;  4KOU A;  2CNM A;  2P6E A;  4YGO A;  5EC4 A;  2VEZ A;  1WWZ A;  3FRM A;  4CYP A;  5K8O A;  4U9Y A;  1FNO A;  3GUX A;  2AFU A;  4HNX B;  2ZEN A;  2AFM A;  5I0C A;  1S7F A;  4KSF A;  2A4N A;  3B3V A;  1TKF A;  3IU2 A;  2YNE A;  3W6X A;  1Y7R A;  1S7N A;  2IJZ A;  1XRY A;  4OID A;  5IB9 A;  1AMP A;  5JQ4 A;  2VXK A;  1VIX A;  1Y0Y A;  1Z8L A;  2PJ5 A;  4IUS A;  4OC5 A;  4E0A A;  3FYN A;  1F2P A;  3FBU A;  2Q43 A;  3B3C A;  3FF3 A;  3B8G A;  2B5G B;  4E8O A;  4KOX A;  2PJB A;  4XPD B;  4A94 A;  2BSW A;  3B3T A;  3D2P A;  3IIB A;  4KVM E;  2DPS A;  3MGD A;  5H84 A;  4CRY B;  4F6A A;  4A30 A;  3W91 A;  2PJ0 A;  2V8V A;  2YGW A;  4MHZ A;  2BCO A;  5G1Z A;  5LRG A;  2PIY A;  1Z4E A;  1TF9 A;  1HDQ A;  1M4G A;  2VI7 A;  1EE3 P;  5LRK A;  2ZXV A;  2WZN A;  3FED A;  1Z2L A;  3VH9 A;  5HVH A;  5K8P A;  1TF8 A;  1RTQ A;  2AFS A;  2BL1 A;  2Q0Y A;  1ELM P;  2R98 A;  2REF A;  4KSI A;  1QQ9 A;  3EFA A;  4F9V A;  4NGN A;  2CXA A;  1PUA A;  1TXR A;  2DEA A;  1B87 A;  1QSM A; 
#chains in the Genus database with same CATH homology
 2Z3K A;  3K9U A;  2EUI A;  2J8M A;  4CYQ A;  1MK4 A;  3TE4 A;  4UCP A;  4UCN A;  2B4B A;  4KVO E;  3G3S A;  2IL4 A;  3JUW A;  4KOW A;  4K30 A;  4QC6 A;  5F49 A;  2WSA A;  1OZP A;  1L0C A;  4XPD C;  2PR1 A;  5AG5 A;  1S60 A;  1IB1 E;  2FCK A;  4MFL A;  1QSO A;  4MY3 A;  1XE4 A;  5J8F A;  1Q2C A;  3BLN A;  2R7H A;  3TFY A;  3D3S A;  1YLE A;  4HNY B;  3P2F A;  1ON0 A;  4KOY A;  3TT2 A;  3EY5 A;  1YGH A;  3T90 A;  3PZJ A;  3N7Z A;  1Z9U A;  1BO4 A;  1M1D A;  3LOD A;  4PSX A;  3TCV A;  4NCZ A;  1M4I A;  1XIX A;  4CAX A;  2Q4Y A;  3S6F A;  3T9Y A;  1S7K A;  2Z3O A;  4A32 A;  4AVA A;  2NMT A;  3P2H A;  5KTD A;  2K5T A;  5H86 A;  5J8C A;  1MJ9 A;  2OZG A;  2Z10 A;  4FD5 A;  4E2A A;  2FE7 A;  1ZO0 A;  4MFP A;  2B5G A;  1RO5 A;  2FT0 A;  1P0H A;  1U6M A;  2WUU A;  1SQH A;  5DWN A;  1I12 A;  4EVY A;  1XMT A;  4OAD A;  2BEI A;  2CNS A;  2VBQ A;  4J3G A;  3H4Q A;  2P6F A;  4MHD A;  4KUA A;  2PRB A;  3V8I A;  4C7I A;  3QB8 A;  1QST A;  3F8K A;  4B10 A;  4UWJ A;  3GKR A;  3VWE A;  4XNH B;  3R95 A;  2HQY A;  1YVK A;  3DNS A;  1M44 A;  5ISV A;  2AJ6 A;  3GYA A;  3I3G A;  4R87 A;  5AG6 A;  1KUY A;  1R57 A;  2PQ8 A;  4Y49 B;  4B11 A;  2WPX A;  3A9L A;  1XF8 A;  1KUV A;  1YK3 A;  1IID A;  3LD2 A;  2VQY A;  2DXQ A;  5C88 A;  4R9M A;  4DNC A;  4KVX A;  4KOT A;  1BOB A;  3R9G A;  4R57 A;  3DR6 A;  3R96 A;  1S7L A;  3SXN A;  1KZF A;  2ARH A;  4OAE A;  2HV2 A;  5KTA A;  2REE A;  2JDC A;  2Y0M A;  3OWC A;  4KUB A;  2EVN A;  4ORF A;  2CY2 A;  4KLV A;  4CAV A;  2I00 A;  2FSR A;  1WK4 A;  3NE7 A;  1IYK A;  4M3S A;  3FXT A;  2P0W A;  2Q04 A;  1S5K A;  3JVN A;  2ATR A;  2C27 A;  2Q44 A;  1IYL A;  3F5B A;  3G8W A;  3RYO A;  2B3U A;  5G20 A;  1IIC A;  4HNW B;  3TO6 A;  4L8A A;  1S3Z A;  4UA3 A;  5G21 A;  4A95 A;  4B5O A;  4F0X A;  2O28 A;  2Z11 A;  3DDD A;  1GHE A;  4YRH A;  5F46 A;  1VHS A;  2OB0 A;  4B5P A;  2Q4V A;  3CXQ A;  3KKW A;  1NSL A;  5EBV A;  2J8R A;  2OH1 A;  5AGE A;  1TIQ A;  4BMH A;  3EXN A;  4JWP A;  2B58 A;  2GAN A;  1Q2D A;  2G3A A;  4H6Z A;  2JDD A;  4NF1 A;  3TTH A;  4M85 A;  4MFQ A;  3CXS A;  3PGP A;  4UFX A;  2G0B A;  3EC4 A;  1B6B A;  2B4D A;  4F0Y A;  4C2Z A;  1YRE A;  3S6H A;  4BBH A;  4CGN A;  2ZW4 A;  2Z3P A;  5A27 A;  4AG7 A;  2VZY A;  4LUA A;  2FS5 A;  2OU2 A;  1MJA A;  5GCN A;  4C2X A;  1PU9 A;  4A2Z A;  4Q36 A;  4GS4 A;  3R9E A;  4MI4 A;  3C26 A;  4PK2 A;  2GE3 A;  3SXO A;  4NEX A;  4X5K A;  1K4J A;  4JXR A;  4CGL A;  2FIA A;  1N71 A;  4R3L A;  4AB7 A;  3EO4 A;  4AG9 A;  1KUX A;  4CAW A;  3BJ8 A;  1I1D A;  4CYN A;  2X7B A;  3TO7 A;  4JD6 A;  3PP9 A;  4C2Y A;  1Q2Y A;  4QUS A;  4FD6 A;  4Q38 A;  5IB0 A;  2G3T A;  2DPT A;  2OZU A;  4PV6 A;  3CXP A;  4OLL A;  4L89 A;  3D2M A;  4FD4 A;  2BUE A;  5KTC A;  2JLM A;  1Y9K A;  4CGP A;  4CAE A;  2FIW A;  4U5Y A;  4H89 A;  1Z4R A;  2QEC A;  3D8P A;  1Y9W A;  2YNC C;  4XNH C;  2B3V A;  3I9S A;  4IF5 A;  4NXY A;  4ZGY B;  3ZJ0 A;  1UFH A;  4QB9 A;  3DSB A;  4ZBG A;  4MY0 A;  4CGM A;  2QIR A;  4UBR A;  3IU1 A;  1V0C A;  2YND A;  4RI1 A;  5HH1 A;  4CYO A;  2CNT A;  2OZH A;  1LRZ A;  2ZW7 A;  4LX9 A;  2RC4 A;  4KZT A;  5G22 A;  5AG7 A;  4NSQ A;  4MFK A;  1J4J A;  3FIX A;  3W6S A;  4PSW A;  4UCM A;  5F47 A;  4Y49 C;  4QBJ A;  3SHP A;  3E0K A;  3VWD A;  1CJW A;  5IV0 A;  2PSW A;  2D4P A;  2R8V A;  4KS9 A;  4B12 A;  2H5M A;  5E96 A;  2D4O A;  3H5Z A;  2J8N A;  1P4N A;  4UWI A;  4C68 A;  2KCW A;  4U9Z A;  4JJX A;  4RS2 A;  4QVT A;  4MFJ A;  4CRZ B;  3IGR A;  4AVC A;  4CGO A;  1NE9 A;  2JEV A;  1VKC A;  4MFZ A;  4II9 A;  2YNC A;  2WPW A;  5FVJ A;  4MJ8 A;  4KOV A;  5BWA B;  2Z3L A;  5JPH A;  2ZW5 A;  3FB3 A;  3S6K A;  4KOR A;  3R1K A;  3DR8 A;  4FD7 A;  5DWM A;  2Q7B A;  4PK3 A;  2AE6 A;  4YFJ A;  2ZPA A;  5HMN A;  2R1I A;  3IWE A;  3F0A A;  2B4D B;  3FNC A;  4A31 A;  5F48 A;  2Z0Z A;  2F5I A;  1I21 A;  2HUZ A;  3TOA A;  1XEB A;  1CM0 A;  4JXQ A;  2ZW6 A;  1YVO A;  4UFW A;  5CNP A;  2GIV A;  5A28 A;  1NMT A;  1QSN A;  4HKF A;  4A33 A;  1YX0 A;  3WR7 A;  5C82 A;  1YR0 A;  4R3K A;  3S6G A;  4B5P B;  2PR8 A;  2PC1 A;  2I79 A;  3ZZI A;  3QAH A;  2Z3N A;  3GY9 A;  4C7H A;  2P6G A;  3BJ7 A;  3UY5 A;  4B13 A;  4XPK A;  4AVB A;  3JTK A;  2VZZ A;  2Z3M A;  1RXT A;  3IWG A;  3TO9 A;  2PDO A;  4KSA A;  1QSR A;  4UFV A;  4KLW A;  4MBU A;  4ONU A;  5AG4 A;  4H6U A;  3TOB A;  4JLY A;  2FXF A;  1MJB A;  4CS0 B;  2FL4 A;  3R9F A;  1FY7 A;  4I49 A;  4KOS A;  4CAF A;  1M4D A;  5IX3 A;  2QML A;  4B14 A;  4KOU A;  2CNM A;  2P6E A;  4YGO A;  5EC4 A;  2VEZ A;  1WWZ A;  3FRM A;  4CYP A;  4U9Y A;  4HNX B;  5I0C A;  1S7F A;  4KSF A;  2A4N A;  3IU2 A;  2YNE A;  3W6X A;  1Y7R A;  1S7N A;  5JQ4 A;  2VXK A;  4IUS A;  4E0A A;  3FYN A;  3FBU A;  3B8G A;  2B5G B;  4E8O A;  4KOX A;  4XPD B;  2BSW A;  3D2P A;  4KVM E;  2DPS A;  3MGD A;  5H84 A;  4CRY B;  4F6A A;  4A30 A;  3W91 A;  2YGW A;  5G1Z A;  1Z4E A;  1M4G A;  2VI7 A;  2ZXV A;  2BL1 A;  2Q0Y A;  2R98 A;  2REF A;  3EFA A;  2CXA A;  1PUA A;  4XPL A;  1B87 A;  1QSM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...