3KKWA

Crystal structure of his-tagged form of pa4794 protein
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
178
structure length
166
Chain Sequence
SHHHHHHMQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative uncharacterized protein
publication title Crystal structure of His-tagged form of PA4794 protein
rcsb
source organism Pseudomonas aeruginosa pao1
total genus 43
structure length 166
sequence length 178
ec nomenclature
pdb deposition date 2009-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3kkwA01
3W6XA 1WWZA 5IB0A 3MGDA 4E8OA 3TT2A 2NMTA 2Z10A 4KLVA 4QBJA 1M4GA 2REEA 5H86A 2G0BA 2AJ6A 4NSQA 4R3KA 4KZTA 1CM0A 1R57A 5E96A 2WPXA 1KZFA 3BLNA 4PV6A 3QB8A 4FD6A 3R9EA 5JPHA 4NF1A 3DR8A 4KOWA 4X5KA 2C27A 3R9GA 3GKRA 2Q7BA 1KUYA 1J4JA 1XEBA 4EVYA 2CNMA 4XPKA 5EBVA 1B6BA 3JVNA 5C88A 3R1KA 3RYOA 3N7ZA 2R7HA 1P4NA 2IL4A 4HNXB 4IF5A 1IICA 2KCWA 3S6KA 3QAHA 4CAXA 5J8CA 1PU9A 1B87A 4JJXA 4JXRA 3FNCA 1IYLA 4UBRA 2PC1A 4XNHB 1VKCA 1VHSA 4ONUA 1I1DA 1MJ9A 3TO9A 4YGOA 1GHEA 3F5BA 4ZBGA 5KTDA 1RO5A 2FCKA 1QSRA 2CNTA 3P2FA 3PP9A 2BEIA 2PR1A 3FIXA 2J8MA 3TO6A 3E0KA 1K4JA 2B4BA 1Z4RA 3EO4A 2JDCA 4UWIA 3VWEA 4Y49C 4OADA 4AVCA 1S7NA 1L0CA 4UA3A 2Q4YA 2PQ8A 4KOTA 1M4DA 2B4DA 4KVXA 2FXFA 1QSTA 2OZGA 1RXTA 2VZZA 4MJ8A 1QSNA 1IIDA 5H84A 3IWGA 1SQHA 2Q04A 4KORA 4UWJA 2EUIA 3WR7A 5KTCA 2CY2A 5HH1A 4IUSA 4AB7A 3I9SA 1WK4A 2JDDA 4PK3A 2J8NA 1XMTA 2VQYA 2ATRA 4MI4A 4H6ZA 5J8FA 1YLEA 2AE6A 2QMLA 4LX9A 3CXPA 3BJ8A 1U6MA 2HV2A 1OZPA 3DSBA 2Y0MA 2B5GA 1I21A 4KLWA 5KTAA 1NMTA 4H89A 4KOVA 3FYNA 3FBUA 3B8GA 2X7BA 1S7LA 4PK2A 1YVKA 2FL4A 2R8VA 2JLMA 2Q4VA 4RS2A 4KOUA 1ON0A 4R9MA 4II9A 2FS5A 1V0CA 2GANA 1KUXA 1YGHA 4J3GA 5ISVA 2Z0ZA 1Y9WA 1LRZA 4KUAA 1QSOA 3D2MA 4YRHA 1YX0A 2VI7A 2WPWA 2QIRA 4JLYA 2OZHA 1XE4A 4JD6A 4M3SA 5DWMA 2P6EA 1MJAA 3TO7A 4Y49B 4JXQA 1S60A 4BMHA 4CS0B 5FVJA 2O28A 4U9ZA 2K5TA 3TFYA 2OU2A 2PR8A 4MBUA 3F0AA 3TE4A 3TTHA 5GCNA 1NSLA 3D8PA 2ZW6A 4B5PB 4E0AA 2HUZA 2VZYA 4CRZB 4CRYB 3H4QA 1FY7A 4M85A 5F47A 5EC4A 3P2HA 4HNWB 1XIXA 4FD4A 3V8IA 3W91A 4L8AA 4JWPA 4AVAA 5HMNA 2R98A 2PDOA 4K30A 5IX3A 4KVME 2BUEA 4DNCA 1KUVA 3NE7A 2Q44A 2ZPAA 2B4DB 3SXOA 2ZXVA 2OB0A 4XPDC 3IGRA 1XF8A 1N71A 2H5MA 3PZJA 3R9FA 2DXQA 2ZW4A 1Q2CA 5F49A 3FXTA 1S3ZA 4HNYB 4NEXA 2REFA 2RC4A 1M4IA 4QB9A 4QC6A 5JQ4A 2OH1A 2OZUA 4PSWA 2D4OA 4QVTA 4F6AA 1YK3A 2P0WA 1UFHA 4FD5A 1NE9A 3TCVA 2ARHA 1BO4A 4U5YA 2BSWA 4ORFA 1M1DA 1YREA 3BJ7A 3T90A 3EXNA 3S6HA 2B3UA 1CJWA 4NXYA 3ZJ0A 3T9YA 3F8KA 2R1IA 4R57A 1S7FA 4PSXA 3FB3A 2Q0YA 4KOSA 5DWNA 2FE7A 4KOXA 2Z11A 4F0YA 3SXNA 1Z4EA 4QUSA 3EC4A 3S6FA 3JUWA 3FRMA 1Y9KA 3SHPA 2F5IA 3C26A 3S6GA 2JEVA 4HKFA 3GY9A 1QSMA 5CNPA 2J8RA 2QECA 4GS4A 4KUBA 4RI1A 4AG9A 3EFAA 3TOAA 1PUAA 3EY5A 2VEZA 3G3SA 3W6SA 3LD2A 2PRBA 3CXSA 1Y7RA 2GE3A 2PSWA 2I79A 2CNSA 2ZW7A 4R3LA 1YVOA 4KVOE 1M44A 3R96A 2FSRA 4MY0A 2FIAA 1MK4A 2FIWA 2EVNA 4I49A 4KOYA 3GYAA 1IB1E 4U9YA 1TIQA 1MJBA 2P6FA 1Q2YA 3DNSA 3KKWA 3DDDA 3K9UA 2G3AA 1Q2DA 3D2PA 4MHDA 4XPDB 2VBQA 1Z9UA 3I3GA 4XPLA 3DR6A 4L89A 2FT0A 5F46A 5I0CA 4B5PA 4OAEA 1S5KA 2D4PA 2BL1A 4FD7A 4XNHC 4R87A 4OLLA 5IV0A 2G3TA 2VXKA 2B58A 3D3SA 4AVBA 2ZW5A 5F48A 3R95A 4E2AA 4LUAA 4MY3A 3VWDA 4B5OA 4CAWA 3CXQA 3G8WA 1BOBA 2P6GA 3LODA 3ZZIA 4CAVA 2A4NA 2GIVA 3TOBA 1S7KA 2I00A 1IYKA 5C82A 2HQYA 3OWCA 1I12A 2B3VA 3UY5A 1YR0A 4YFJA 3PGPA 4AG7A 4NCZA 2B5GB 4H6UA 1P0HA
chains in the Genus database with same CATH superfamily
3W6XA 1WWZA 5HVHA 5IB0A 3MGDA 4E8OA 3IU1A 3GB0A 4UF4A 3VH9A 4A30A 3TT2A 2NMTA 3D68A 3SJXA 2AFSA 2GLJA 2Z10A 4KLVA 2C6CA 3KQZA 1BPMA 1ZG8A 2GFQA 4NGSA 1M4GA 3D7HA 4QBJA 3NFZA 4WWVA 2REEA 4K3NA 5K8NA 2OR4A 5H86A 2G0BA 4P10A 2AJ6A 3SJEA 4NSQA 4O23A 4R3KA 5AGEA 4KZTA 4ZI6A 1CM0A 3FX6A 4IAVA 4B12A 1R57A 3DGVA 4NGQA 5E96A 4ZX9A 2XEIA 1VGYA 4CYNA 3GIUA 2WPXA 2WYRA 3A9LA 4ZY1A 1LANA 1KZFA 2Q7SA 3BLNA 4PV6A 2Q51A 4F9UA 3BHXA 3IWWA 2XEJA 3QB8A 4NGRA 1YLOA 4FD6A 4UIAA 3R9EA 5JPHA 4NF1A 3DR8A 3TX8A 4DJLA 4KOWA 4X5KA 1M4LA 2C27A 3RAMA 3R9GA 4LQ6A 3SI2A 4P4FA 2BCOA 3GKRA 4C7HA 2Q7BA 1KUYA 3IIBA 4NGPA 1J4JA 1XEBA 4G1PA 4EVYA 2O53A 2CNMA 1DE4C 2CTBA 4XPKA 5EBVA 5F47A 1B6BA 1LAMA 2EK8A 3JVNA 3KR4A 5C88A 5K8OA 3R1KA 1R3NA 2C6GA 2PJ9A 1LCPA 2V8GA 2PJ6A 3RYOA 3N7ZA 2R7HA 1P4NA 2IL4A 4HNXB 4IF5A 2ZEDA 3KASA 5LYDA 1IICA 2KCWA 2ZOFA 1HDQA 3QAHA 4MXUA 3S6KA 1ZO0A 1VHEA 2JBKA 2NSMA 2PIYA 5AG7A 4CAXA 2V8VA 5J8CA 1PU9A 1B87A 4JJXA 4JXRA 1LFWA 4A33A 3FNCA 1IYLA 4OC1A 1IU8A 4UBRA 2PC1A 4XNHB 1VKCA 4BD9A 1VHSA 4ONUA 4CAEA 1I1DA 1MJ9A 2PJ2A 4B11A 3TO9A 4P4IA 4FUUA 4RN7A 4YGOA 1GHEA 3F5BA 4ZBGA 5KTDA 1RO5A 5K8PA 3PRTA 3RBUA 1BPNA 3MRUA 4KS9A 2FVGA 2RB7A 4A2ZA 4EMEA 4MFPA 3D66A 2FCKA 1TXRA 1QSRA 2CNTA 3P2FA 2YNCC 4IK2A 4MHYA 3PP9A 4ONWA 2BEIA 2G9DA 3V38A 2PR1A 3FIXA 2J8MA 1FT7A 3HUVA 3TO6A 3E0KA 1K4JA 1PYTB 4MRIA 2B4BA 1Z4RA 2Z3PA 1IOIA 3EO4A 2JDCA 4UWIA 3VWEA 4Y49C 4OADA 4AVCA 2CXAA 2AFXA 4PXEA 4UEEA 2WZNA 1S7NA 4FWUA 1L0CA 3KHZA 4UA3A 3DLJA 5CPAA 2Q4YA 2QJ8A 2PJCA 3CPAA 2PQ8A 4KOTA 1M4DA 2B4DA 5F09A 4KVXA 2ZEEA 4C2YA 3D7DA 4CGPA 2FXFA 1QSTA 2OZGA 4UFVA 4LQGA 1RXTA 2VZZA 4MJ8A 1QSNA 4UCMA 1ARLA 1IIDA 2AFZA 2ZEGA 5H84A 3IWGA 1F2OA 1SQHA 2Q04A 3IO1A 3FEDA 1DTDA 3KZWA 2EUIA 3IJ3A 4KORA 4UWJA 3WR7A 5LYIA 1A2ZA 2PJ8A 2CY2A 5HH1A 5KTCA 4IUSA 4AB7A 2Z3NA 3I9SA 3RNZA 1WK4A 3FMCA 2JDDA 2ZEHA 4PK3A 2J8NA 1XMTA 3PB9X 2VQYA 1YSJA 2ATRA 3PB6X 1Z2LA 1XOVA 4MI4A 4CGOA 4H6ZA 5J8FA 4CYPA 1YLEA 2AE6A 2QMLA 4OC2A 4B10A 3D7FA 4LX9A 3CXPA 3BJ8A 1U6MA 2HV2A 1OZPA 4YWYA 4ZX8A 3DSBA 1TKJA 2Y0MA 2ZOGA 2B5GA 3IWEA 4EFDA 1AMPA 1I21A 2DF5A 5LYFA 4KLWA 4A32A 3WC5A 5JM6A 2HC9A 5KTAA 1IY7A 2QVPA 1NMTA 1QMUA 2AFWA 4CPAA 3NH5A 4H89A 2WSAA 3NH8A 1AUGA 2PJ1A 4KOVA 3FYNA 4Q38A 2PJ7A 3FBUA 3B8GA 2X7BA 4PXCA 2Z3LA 3WC6A 1S7LA 4PK2A 2PJBA 4C2ZA 1YVKA 2AFMA 2FL4A 4HPSA 2R8VA 4MHPA 2JLMA 2Q4VA 4RS2A 5HVGA 3T8WA 3V7ZA 5JGFA 3LWUA 4MFZA 4OP4A 4KOUA 3PEIA 4A94A 3H8FA 3FVLA 1F2PA 4FBEA 4BBHA 2JEWA 4MFQA 1ON0A 4R9MA 4MFJA 4II9A 2FS5A 1V0CA 2GANA 4A95A 4CYQA 1KUXA 1YGHA 4NJQA 3PFOA 4J3GA 6CPAA 1ZLHA 5ISVA 2DPSA 2Z0ZA 4PXBA 1Y9WA 1TF8A 2V77A 3KI9A 1LRZA 4FAIA 1Z8WA 2C6PA 2ODFA 3WABA 2ZEOA 4GXHA 4KUAA 1QSOA 3D2MA 1UWYA 4YRHA 3RO0A 3I1UA 1YX0A 4WJBA 2VI7A 2V8DA 4W9YA 1NSAA 3PFEA 2WPWA 4KSFA 4B6ZA 1XRYA 2QIRA 1H8LA 2OZHA 1XE4A 4JLYA 4UFXA 2EK9A 4JD6A 4M3SA 4OC0A 4X8IA 5DWMA 2YNEA 2ZEPA 2P6EA 1CPXA 3S9LA 5AG4A 7CPAA 1MJAA 3TO7A 4Y49B 4A39A 3K2KA 3H5ZA 2GU2A 4JXQA 1S60A 4BMHA 4CS0B 5FVJA 3KR5A 1FNOA 2ZEMA 4R76A 2O28A 4U9ZA 2J9AA 2K5TA 3TFYA 2OU2A 2PR8A 4MBUA 2CIJA 3F0AA 3CPXA 3TE4A 3TTHA 4ZY2A 3BI1A 4NGTA 5GCNA 1HDUA 1NSLA 3D8PA 4KSIA 4OKOA 4A31A 2ZW6A 4B5PB 4YU9A 4P4EA 3KL9A 4DYOA 4X2TA 5A27A 2AFOA 4E0AA 1VIXA 2HUZA 4DUKA 2VZYA 5AG5A 4CRZB 1TKFA 3MN8A 4CRYB 1TKHA 4MMOA 4NGMA 3H4QA 1FY7A 2IJZA 3FH4A 2BO9A 4M85A 4MCQA 1BLLE 2ZEFA 3P2HA 4P45A 4P6YA 4Q36A 4HNWB 5EC4A 1XIXA 3WC7A 4FD4A 3V8IA 2DEAA 2PJAA 4L8AA 3W91A 1F57A 4JWPA 3NH4A 3D4UA 4AVAA 5HMNA 2R98A 2PDOA 4K30A 5IX3A 1LAPA 4KVME 2BUEA 4CGLA 3TC8A 2YGWA 5JH9A 4DNCA 1KUVA 3NE7A 3FF3A 2Q44A 4P44A 2ZPAA 2B4DB 4MHNA 3PBEA 2XEGA 2ZXVA 3HLPA 4OIDA 3SXOA 3NA6A 1JWQA 8CPAA 3S9NA 2OB0A 4P4JA 4XPDC 4CGMA 3IGRA 1XF8A 2EBJA 4ZGYB 5K8MA 1N71A 2H5MA 2PVVA 4OC4A 4R8FA 4UCNA 2OOTA 2WUUA 3B3SA 3B3TA 3ISZA 3PZJA 3R9FA 1YQEA 2DXQA 5G20A 5LRJA 2ZW4A 1Q2CA 5LRGA 5F49A 2EWBA 3FXTA 1Z5RA 4M6HA 1RTQA 2PJ5A 4UIBA 1S3ZA 4HNYB 1CX8A 1Y7EA 4CYOA 4NEXA 2REFA 4GM5A 2PIZA 5AG6A 2RC4A 1M4IA 4QB9A 4QC6A 5LRKA 2HB6A 5JQ4A 2BOAA 2OH1A 5DS0A 2OZUA 3D67A 4PSWA 2D4OA 2PE3A 4C2XA 2POKA 4QVTA 4F6AA 1YK3A 2P0WA 1UFHA 2QYVA 1NE9A 4FD5A 2DPTA 2ARHA 3TCVA 1BO4A 3CZXA 2ZELA 4U5YA 3JTKA 2BSWA 2Q43A 2Z3MA 3FEEA 1M1DA 1YREA 3B2YA 3BJ7A 3H8GA 4ORFA 3T90A 1XBUA 1ZG9A 3EXNA 5G1ZA 4UEFA 3S6HA 4C7IA 4Z65A 2VL1A 2B3UA 2GLFA 1CJWA 4NXYA 4JYWA 2PJ0A 3ZJ0A 2YNDA 3GLJA 3F8KA 3T9YA 2R1IA 3ISXA 4R57A 1S7FA 2F8HA 4M6GA 1Y0YA 1QQ9A 4PSXA 4R6TA 3FB3A 4NGNA 4OIWA 1ZG7A 2Q0YA 4KOSA 5DWNA 2FE7A 1ZLIA 4P4BA 3S9MA 4KOXA 2PJ4A 5G21A 2Z11A 5HVFA 4F0YA 1PCAA 3IFEA 3SXNA 2CTCA 4H2KA 4C68A 1CP7A 4UFWA 1Z4EA 4QUSA 3EC4A 4PPZA 4TNUA 3JUWA 3FRMA 1ARMA 1IGBA 1Y9KA 3S6FA 3SHPA 2F5IA 3FECA 5J1QA 3D7GA 3C26A 3S6GA 3IU2A 2JEVA 1XJOA 3NE8A 4HKFA 4PXDA 3GY9A 2XEFA 1Z8TA 1QSMA 5CNPA 3N5FA 3CT9A 2J8RA 1XMBA 2QECA 4GS4A 4KUBA 1R43A 3K9TA 1YMEA 4RI1A 4UEZA 5I4MA 3B35A 2JBJA 3EFAA 3SI0A 4AG9A 2Z3OA 3TOAA 1PUAA 3SJGA 3IEHA 3EY5A 2VEZA 3G3SA 2PJ3A 3W6SA 3LD2A 1ELLP 5G22A 4ZY0A 1LOKA 1HEEA 3QNVA 1KWMA 2PRBA 2F7VA 3CXSA 5BWAB 4RUHA 1Y7RA 2GE3A 2PSWA 2I79A 3LACA 5LYLA 4ZYQA 2CNSA 2ZW7A 4MHZA 4R3LA 5HXDA 5THWA 1YVOA 4B14A 3IC1A 4KVOE 5A28A 3B3WA 4NJRA 2YNCA 4MFLA 4X3RA 1M44A 4CAFA 3R96A 2FSRA 2Z3KA 4MY0A 4F8ZA 2FIAA 4AXVA 1CG2A 1MK4A 1YW4A 3H8EA 4OC5A 4BINA 3PBBA 4Q7AA 4MFKA 3SJFA 2FIWA 2EVNA 1CP6A 4I49A 3BXMA 1Z8LA 3L2NA 4KOYA 3GYAA 1IB1E 4U9YA 1TIQA 4EWTA 1X12A 1MJBA 4NFRA 4MCPA 2P6FA 1Q2YA 1BAVA 3DNSA 3KKWA 2ZENA 3LMSA 3DDDA 3K9UA 2G3AA 3SI1A 1Q2DA 1XFOA 5D8NA 3B3VA 3D2PA 1X10A 4MHDA 3PB4X 1ELMP 4XPDB 2VBQA 1Z9UA 3I3GA 4XPLA 2RFHA 4CGNA 1OBRA 4KSAA 3DR6A 4L89A 2FT0A 2O4HA 5F46A 2ANPA 5EMIA 4R7MA 2AFUA 4F0XA 5I0CA 4B5PA 2PVWA 3VARA 4A37A 3B3CA 4OAEA 1EE3P 2PCUA 1S5KA 1TF9A 2I3CA 4F9VA 2D4PA 2BL1A 3KHXA 1VHOA 4FD7A 4XNHC 5ELYA 1CPSA 4R87A 3KQXA 4OLLA 2ABZA 4IHMA 1Z8XA 4M6IA 2EO8A 4B13A 5IV0A 2G3TA 2VXKA 4OMEA 3KGQA 1AYEA 3FJUA 2GREA 2B58A 5CBMA 3D3SA 4P4DA 2ZW5A 5F48A 2NYQA 3R95A 4AVBA 4E2AA 2IQ6A 4LUAA 4MY3A 4OC3A 4PQAA 5D29A 3VWDA 3GUXA 3B7IA 1Q7LA 1YW6A 4B5OA 2PRQA 1IOFA 4CAWA 3CXQA 3G8WA 1BOBA 2IMOA 2P6GA 3LODA 3PB7X 2Q4ZA 4UCPA 3ZZIA 4CAVA 1CBXA 2A4NA 2V8HA 2GIVA 3TOBA 3WT4A 1S7KA 3PB8X 4MCSA 4MCRA 1GYTA 3BI0A 2CF4A 2I00A 1IYKA 5IB9A 5C82A 2HQYA 3OWCA 3QAYA 1I12A 1Y0RA 4A38A 2B3VA 3UY5A 3RZAA 1YR0A 4YFJA 3VATA 2C1CA 3PGPA 4AG7A 3JRUA 1JQGA 4JZ0A 4NCZA 2B5GB 4H6UA 3CDXA 1P0HA 4TWEA
chains in the Genus database with same CATH topology
3W6XA 1WWZA 5IB0A 3MGDA 4E8OA 3IU1A 4A30A 3TT2A 2NMTA 2Z10A 4KLVA 4QBJA 1M4GA 2REEA 5H86A 2G0BA 2AJ6A 4NSQA 4R3KA 5AGEA 4KZTA 1CM0A 4B12A 1R57A 5E96A 4CYNA 2WPXA 3A9LA 1KZFA 3BLNA 4PV6A 3QB8A 4FD6A 3R9EA 5JPHA 4NF1A 3DR8A 4KOWA 4X5KA 2C27A 3R9GA 3GKRA 4C7HA 2Q7BA 1KUYA 1J4JA 1XEBA 4EVYA 2CNMA 4XPKA 5EBVA 1B6BA 3JVNA 5C88A 3R1KA 3RYOA 3N7ZA 2R7HA 1P4NA 2IL4A 4HNXB 4IF5A 1IICA 2KCWA 3S6KA 3QAHA 1ZO0A 5AG7A 4CAXA 5J8CA 1PU9A 1B87A 4JJXA 4JXRA 4A33A 3FNCA 1IYLA 4UBRA 2PC1A 4XNHB 1VKCA 1VHSA 4ONUA 4CAEA 1I1DA 1MJ9A 4B11A 3TO9A 4YGOA 1GHEA 3F5BA 4ZBGA 5KTDA 1RO5A 4A2ZA 4KS9A 4MFPA 2FCKA 1QSRA 2CNTA 3P2FA 2YNCC 3PP9A 2BEIA 2PR1A 3FIXA 2J8MA 3TO6A 3E0KA 1K4JA 2B4BA 1Z4RA 2Z3PA 3EO4A 2JDCA 4UWIA 3VWEA 4Y49C 4OADA 4AVCA 2CXAA 1S7NA 1L0CA 4UA3A 2Q4YA 2PQ8A 4KOTA 1M4DA 2B4DA 4KVXA 4C2YA 4CGPA 2FXFA 1QSTA 2OZGA 4UFVA 1RXTA 2VZZA 4MJ8A 1QSNA 4UCMA 1IIDA 5H84A 3IWGA 1SQHA 2Q04A 4KORA 4UWJA 2EUIA 3WR7A 5KTCA 2CY2A 5HH1A 4IUSA 4AB7A 2Z3NA 3I9SA 1WK4A 2JDDA 4PK3A 2J8NA 1XMTA 2VQYA 2ATRA 4MI4A 4CGOA 4H6ZA 5J8FA 4CYPA 1YLEA 2AE6A 2QMLA 4B10A 4LX9A 3CXPA 3BJ8A 1U6MA 2HV2A 1OZPA 3DSBA 2Y0MA 2B5GA 3IWEA 1I21A 4KLWA 4A32A 5KTAA 1NMTA 4H89A 2WSAA 4KOVA 3FYNA 4Q38A 3FBUA 3B8GA 2X7BA 2Z3LA 1S7LA 4PK2A 4C2ZA 1YVKA 2FL4A 2R8VA 2JLMA 2Q4VA 4RS2A 4MFZA 4KOUA 4BBHA 4MFQA 1ON0A 4R9MA 4MFJA 4II9A 2FS5A 1V0CA 2GANA 4A95A 4CYQA 1KUXA 1YGHA 4J3GA 5ISVA 2DPSA 2Z0ZA 1Y9WA 1LRZA 4KUAA 1QSOA 3D2MA 4YRHA 1YX0A 2VI7A 2WPWA 4KSFA 2QIRA 4JLYA 2OZHA 1XE4A 4UFXA 4JD6A 4M3SA 5DWMA 2YNEA 2P6EA 5AG4A 1MJAA 3TO7A 4Y49B 3H5ZA 4JXQA 1S60A 4BMHA 4CS0B 5FVJA 2O28A 4U9ZA 2K5TA 3TFYA 2OU2A 2PR8A 4MBUA 3F0AA 3TE4A 3TTHA 5GCNA 1NSLA 3D8PA 4A31A 2ZW6A 4B5PB 5A27A 4E0AA 2HUZA 2VZYA 5AG5A 4CRZB 4CRYB 3H4QA 1FY7A 4Q36A 4M85A 5F47A 5EC4A 3P2HA 4HNWB 1XIXA 4FD4A 3V8IA 3W91A 4L8AA 4JWPA 4AVAA 5HMNA 2R98A 2PDOA 4K30A 5IX3A 4KVME 4CGLA 2BUEA 2YGWA 4DNCA 1KUVA 3NE7A 2Q44A 2ZPAA 2B4DB 3SXOA 2ZXVA 2OB0A 4XPDC 4CGMA 3IGRA 1XF8A 4ZGYB 1N71A 2H5MA 2WUUA 3PZJA 3R9FA 2DXQA 5G20A 2ZW4A 1Q2CA 5F49A 3FXTA 1S3ZA 4HNYB 4CYOA 4NEXA 2REFA 5AG6A 2RC4A 1M4IA 4QB9A 4QC6A 5JQ4A 2OH1A 2OZUA 4PSWA 2D4OA 4C2XA 4QVTA 4F6AA 1YK3A 2P0WA 1UFHA 4FD5A 1NE9A 2DPTA 2ARHA 3TCVA 1BO4A 4U5YA 3JTKA 2BSWA 2Z3MA 4ORFA 1M1DA 1YREA 3BJ7A 3T90A 3EXNA 5G1ZA 4C7IA 3S6HA 2B3UA 1CJWA 4NXYA 3ZJ0A 2YNDA 3T9YA 3F8KA 2R1IA 4R57A 1S7FA 4UCNA 4PSXA 3FB3A 2Q0YA 4KOSA 5DWNA 2FE7A 4KOXA 5G21A 2Z11A 4F0YA 3SXNA 4C68A 4UFWA 1Z4EA 4QUSA 3EC4A 3S6FA 3JUWA 3FRMA 1Y9KA 3SHPA 2F5IA 3C26A 3S6GA 3IU2A 2JEVA 4HKFA 3GY9A 1QSMA 5CNPA 2J8RA 2QECA 4GS4A 4KUBA 4RI1A 4AG9A 3EFAA 2Z3OA 3TOAA 1PUAA 3EY5A 2VEZA 3G3SA 3W6SA 3LD2A 5G22A 2PRBA 5BWAB 3CXSA 1Y7RA 2GE3A 2PSWA 2I79A 2CNSA 2ZW7A 4R3LA 1YVOA 4B14A 4KVOE 5A28A 2YNCA 4MFLA 1M44A 4CAFA 3R96A 2FSRA 2Z3KA 4MY0A 2FIAA 1MK4A 4MFKA 2FIWA 2EVNA 4I49A 4KOYA 3GYAA 1IB1E 4U9YA 1TIQA 1MJBA 2P6FA 1Q2YA 3DNSA 3KKWA 3DDDA 3K9UA 2G3AA 1Q2DA 3D2PA 4MHDA 4XPDB 2VBQA 1Z9UA 3I3GA 4XPLA 4CGNA 4KSAA 3DR6A 4L89A 2FT0A 5F46A 5I0CA 4F0XA 4B5PA 4OAEA 1S5KA 2D4PA 2BL1A 4FD7A 4XNHC 4R87A 4OLLA 4B13A 5IV0A 2G3TA 2VXKA 2B58A 3D3SA 4AVBA 2ZW5A 5F48A 3R95A 4E2AA 4LUAA 4MY3A 3VWDA 4B5OA 4CAWA 3CXQA 3G8WA 1BOBA 2P6GA 3LODA 4UCPA 3ZZIA 4CAVA 2A4NA 2GIVA 3TOBA 1S7KA 2I00A 1IYKA 5C82A 2HQYA 3OWCA 1I12A 2B3VA 3UY5A 1YR0A 4YFJA 3PGPA 4AG7A 4NCZA 2B5GB 4H6UA 1P0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W6X A;  1WWZ A;  5IB0 A;  3MGD A;  4E8O A;  3TT2 A;  2NMT A;  2Z10 A;  4KLV A;  4QBJ A;  1M4G A;  2REE A;  5H86 A;  2G0B A;  2AJ6 A;  4NSQ A;  4R3K A;  4KZT A;  1CM0 A;  1R57 A;  5E96 A;  2WPX A;  1KZF A;  3BLN A;  4PV6 A;  3QB8 A;  4FD6 A;  3R9E A;  5JPH A;  4NF1 A;  3DR8 A;  4KOW A;  4X5K A;  2C27 A;  3R9G A;  3GKR A;  2Q7B A;  1KUY A;  1J4J A;  1XEB A;  4EVY A;  2CNM A;  4XPK A;  5EBV A;  1B6B A;  3JVN A;  5C88 A;  3R1K A;  3RYO A;  3N7Z A;  2R7H A;  1P4N A;  2IL4 A;  4HNX B;  4IF5 A;  1IIC A;  2KCW A;  3S6K A;  3QAH A;  4CAX A;  5J8C A;  1PU9 A;  1B87 A;  4JJX A;  4JXR A;  3FNC A;  1IYL A;  4UBR A;  2PC1 A;  4XNH B;  1VKC A;  1VHS A;  4ONU A;  1I1D A;  1MJ9 A;  3TO9 A;  4YGO A;  1GHE A;  3F5B A;  4ZBG A;  5KTD A;  1RO5 A;  2FCK A;  1QSR A;  2CNT A;  3P2F A;  3PP9 A;  2BEI A;  2PR1 A;  3FIX A;  2J8M A;  3TO6 A;  3E0K A;  1K4J A;  2B4B A;  1Z4R A;  3EO4 A;  2JDC A;  4UWI A;  3VWE A;  4Y49 C;  4OAD A;  4AVC A;  1S7N A;  1L0C A;  4UA3 A;  2Q4Y A;  2PQ8 A;  4KOT A;  1M4D A;  2B4D A;  4KVX A;  2FXF A;  1QST A;  2OZG A;  1RXT A;  2VZZ A;  4MJ8 A;  1QSN A;  1IID A;  5H84 A;  3IWG A;  1SQH A;  2Q04 A;  4KOR A;  4UWJ A;  2EUI A;  3WR7 A;  5KTC A;  2CY2 A;  5HH1 A;  4IUS A;  4AB7 A;  3I9S A;  1WK4 A;  2JDD A;  4PK3 A;  2J8N A;  1XMT A;  2VQY A;  2ATR A;  4MI4 A;  4H6Z A;  5J8F A;  1YLE A;  2AE6 A;  2QML A;  4LX9 A;  3CXP A;  3BJ8 A;  1U6M A;  2HV2 A;  1OZP A;  3DSB A;  2Y0M A;  2B5G A;  1I21 A;  4KLW A;  5KTA A;  1NMT A;  4H89 A;  4KOV A;  3FYN A;  3FBU A;  3B8G A;  2X7B A;  1S7L A;  4PK2 A;  1YVK A;  2FL4 A;  2R8V A;  2JLM A;  2Q4V A;  4RS2 A;  4KOU A;  1ON0 A;  4R9M A;  4II9 A;  2FS5 A;  1V0C A;  2GAN A;  1KUX A;  1YGH A;  4J3G A;  5ISV A;  2Z0Z A;  1Y9W A;  1LRZ A;  4KUA A;  1QSO A;  3D2M A;  4YRH A;  1YX0 A;  2VI7 A;  2WPW A;  2QIR A;  4JLY A;  2OZH A;  1XE4 A;  4JD6 A;  4M3S A;  5DWM A;  2P6E A;  1MJA A;  3TO7 A;  4Y49 B;  4JXQ A;  1S60 A;  4BMH A;  4CS0 B;  5FVJ A;  2O28 A;  4U9Z A;  2K5T A;  3TFY A;  2OU2 A;  2PR8 A;  4MBU A;  3F0A A;  3TE4 A;  3TTH A;  5GCN A;  1NSL A;  3D8P A;  2ZW6 A;  4B5P B;  4E0A A;  2HUZ A;  2VZY A;  4CRZ B;  4CRY B;  3H4Q A;  1FY7 A;  4M85 A;  5F47 A;  5EC4 A;  3P2H A;  4HNW B;  1XIX A;  4FD4 A;  3V8I A;  3W91 A;  4L8A A;  4JWP A;  4AVA A;  5HMN A;  2R98 A;  2PDO A;  4K30 A;  5IX3 A;  4KVM E;  2BUE A;  4DNC A;  1KUV A;  3NE7 A;  2Q44 A;  2ZPA A;  2B4D B;  3SXO A;  2ZXV A;  2OB0 A;  4XPD C;  3IGR A;  1XF8 A;  1N71 A;  2H5M A;  3PZJ A;  3R9F A;  2DXQ A;  2ZW4 A;  1Q2C A;  5F49 A;  3FXT A;  1S3Z A;  4HNY B;  4NEX A;  2REF A;  2RC4 A;  1M4I A;  4QB9 A;  4QC6 A;  5JQ4 A;  2OH1 A;  2OZU A;  4PSW A;  2D4O A;  4QVT A;  4F6A A;  1YK3 A;  2P0W A;  1UFH A;  4FD5 A;  1NE9 A;  3TCV A;  2ARH A;  1BO4 A;  4U5Y A;  2BSW A;  4ORF A;  1M1D A;  1YRE A;  3BJ7 A;  3T90 A;  3EXN A;  3S6H A;  2B3U A;  1CJW A;  4NXY A;  3ZJ0 A;  3T9Y A;  3F8K A;  2R1I A;  4R57 A;  1S7F A;  4PSX A;  3FB3 A;  2Q0Y A;  4KOS A;  5DWN A;  2FE7 A;  4KOX A;  2Z11 A;  4F0Y A;  3SXN A;  1Z4E A;  4QUS A;  3EC4 A;  3S6F A;  3JUW A;  3FRM A;  1Y9K A;  3SHP A;  2F5I A;  3C26 A;  3S6G A;  2JEV A;  4HKF A;  3GY9 A;  1QSM A;  5CNP A;  2J8R A;  2QEC A;  4GS4 A;  4KUB A;  4RI1 A;  4AG9 A;  3EFA A;  3TOA A;  1PUA A;  3EY5 A;  2VEZ A;  3G3S A;  3W6S A;  3LD2 A;  2PRB A;  3CXS A;  1Y7R A;  2GE3 A;  2PSW A;  2I79 A;  2CNS A;  2ZW7 A;  4R3L A;  1YVO A;  4KVO E;  1M44 A;  3R96 A;  2FSR A;  4MY0 A;  2FIA A;  1MK4 A;  2FIW A;  2EVN A;  4I49 A;  4KOY A;  3GYA A;  1IB1 E;  4U9Y A;  1TIQ A;  1MJB A;  2P6F A;  1Q2Y A;  3DNS A;  3KKW A;  3DDD A;  3K9U A;  2G3A A;  1Q2D A;  3D2P A;  4MHD A;  4XPD B;  2VBQ A;  1Z9U A;  3I3G A;  4XPL A;  3DR6 A;  4L89 A;  2FT0 A;  5F46 A;  5I0C A;  4B5P A;  4OAE A;  1S5K A;  2D4P A;  2BL1 A;  4FD7 A;  4XNH C;  4R87 A;  4OLL A;  5IV0 A;  2G3T A;  2VXK A;  2B58 A;  3D3S A;  4AVB A;  2ZW5 A;  5F48 A;  3R95 A;  4E2A A;  4LUA A;  4MY3 A;  3VWD A;  4B5O A;  4CAW A;  3CXQ A;  3G8W A;  1BOB A;  2P6G A;  3LOD A;  3ZZI A;  4CAV A;  2A4N A;  2GIV A;  3TOB A;  1S7K A;  2I00 A;  1IYK A;  5C82 A;  2HQY A;  3OWC A;  1I12 A;  2B3V A;  3UY5 A;  1YR0 A;  4YFJ A;  3PGP A;  4AG7 A;  4NCZ A;  2B5G B;  4H6U A;  1P0H A; 
#chains in the Genus database with same CATH topology
 3W6X A;  1WWZ A;  5HVH A;  5IB0 A;  3MGD A;  4E8O A;  3IU1 A;  3GB0 A;  4UF4 A;  3VH9 A;  4A30 A;  3TT2 A;  2NMT A;  3D68 A;  3SJX A;  2AFS A;  2GLJ A;  2Z10 A;  4KLV A;  2C6C A;  3KQZ A;  1BPM A;  1ZG8 A;  2GFQ A;  4NGS A;  1M4G A;  3D7H A;  4QBJ A;  3NFZ A;  4WWV A;  2REE A;  4K3N A;  5K8N A;  2OR4 A;  5H86 A;  2G0B A;  4P10 A;  2AJ6 A;  3SJE A;  4NSQ A;  4O23 A;  4R3K A;  5AGE A;  4KZT A;  4ZI6 A;  1CM0 A;  3FX6 A;  4IAV A;  4B12 A;  1R57 A;  3DGV A;  4NGQ A;  5E96 A;  4ZX9 A;  2XEI A;  1VGY A;  4CYN A;  3GIU A;  2WPX A;  2WYR A;  3A9L A;  4ZY1 A;  1LAN A;  1KZF A;  2Q7S A;  3BLN A;  4PV6 A;  2Q51 A;  4F9U A;  3BHX A;  3IWW A;  2XEJ A;  3QB8 A;  4NGR A;  1YLO A;  4FD6 A;  4UIA A;  3R9E A;  5JPH A;  4NF1 A;  3DR8 A;  3TX8 A;  4DJL A;  4KOW A;  4X5K A;  1M4L A;  2C27 A;  3RAM A;  3R9G A;  4LQ6 A;  3SI2 A;  4P4F A;  2BCO A;  3GKR A;  4C7H A;  2Q7B A;  1KUY A;  3IIB A;  4NGP A;  1J4J A;  1XEB A;  4G1P A;  4EVY A;  2O53 A;  2CNM A;  1DE4 C;  2CTB A;  4XPK A;  5EBV A;  5F47 A;  1B6B A;  1LAM A;  2EK8 A;  3JVN A;  3KR4 A;  5C88 A;  5K8O A;  3R1K A;  1R3N A;  2C6G A;  2PJ9 A;  1LCP A;  2V8G A;  2PJ6 A;  3RYO A;  3N7Z A;  2R7H A;  1P4N A;  2IL4 A;  4HNX B;  4IF5 A;  2ZED A;  3KAS A;  5LYD A;  1IIC A;  2KCW A;  2ZOF A;  1HDQ A;  3QAH A;  4MXU A;  3S6K A;  1ZO0 A;  1VHE A;  2JBK A;  2NSM A;  2PIY A;  5AG7 A;  4CAX A;  2V8V A;  5J8C A;  1PU9 A;  1B87 A;  4JJX A;  4JXR A;  1LFW A;  4A33 A;  3FNC A;  1IYL A;  4OC1 A;  1IU8 A;  4UBR A;  2PC1 A;  4XNH B;  1VKC A;  4BD9 A;  1VHS A;  4ONU A;  4CAE A;  1I1D A;  1MJ9 A;  2PJ2 A;  4B11 A;  3TO9 A;  4P4I A;  4FUU A;  4RN7 A;  4YGO A;  1GHE A;  3F5B A;  4ZBG A;  5KTD A;  1RO5 A;  5K8P A;  3PRT A;  3RBU A;  1BPN A;  3MRU A;  4KS9 A;  2FVG A;  2RB7 A;  4A2Z A;  4EME A;  4MFP A;  3D66 A;  2FCK A;  1TXR A;  1QSR A;  2CNT A;  3P2F A;  2YNC C;  4IK2 A;  4MHY A;  3PP9 A;  4ONW A;  2BEI A;  2G9D A;  3V38 A;  2PR1 A;  3FIX A;  2J8M A;  1FT7 A;  3HUV A;  3TO6 A;  3E0K A;  1K4J A;  1PYT B;  4MRI A;  2B4B A;  1Z4R A;  2Z3P A;  1IOI A;  3EO4 A;  2JDC A;  4UWI A;  3VWE A;  4Y49 C;  4OAD A;  4AVC A;  2CXA A;  2AFX A;  4PXE A;  4UEE A;  2WZN A;  1S7N A;  4FWU A;  1L0C A;  3KHZ A;  4UA3 A;  3DLJ A;  5CPA A;  2Q4Y A;  2QJ8 A;  2PJC A;  3CPA A;  2PQ8 A;  4KOT A;  1M4D A;  2B4D A;  5F09 A;  4KVX A;  2ZEE A;  4C2Y A;  3D7D A;  4CGP A;  2FXF A;  1QST A;  2OZG A;  4UFV A;  4LQG A;  1RXT A;  2VZZ A;  4MJ8 A;  1QSN A;  4UCM A;  1ARL A;  1IID A;  2AFZ A;  2ZEG A;  5H84 A;  3IWG A;  1F2O A;  1SQH A;  2Q04 A;  3IO1 A;  3FED A;  1DTD A;  3KZW A;  2EUI A;  3IJ3 A;  4KOR A;  4UWJ A;  3WR7 A;  5LYI A;  1A2Z A;  2PJ8 A;  2CY2 A;  5HH1 A;  5KTC A;  4IUS A;  4AB7 A;  2Z3N A;  3I9S A;  3RNZ A;  1WK4 A;  3FMC A;  2JDD A;  2ZEH A;  4PK3 A;  2J8N A;  1XMT A;  3PB9 X;  2VQY A;  1YSJ A;  2ATR A;  3PB6 X;  1Z2L A;  1XOV A;  4MI4 A;  4CGO A;  4H6Z A;  5J8F A;  4CYP A;  1YLE A;  2AE6 A;  2QML A;  4OC2 A;  4B10 A;  3D7F A;  4LX9 A;  3CXP A;  3BJ8 A;  1U6M A;  2HV2 A;  1OZP A;  4YWY A;  4ZX8 A;  3DSB A;  1TKJ A;  2Y0M A;  2ZOG A;  2B5G A;  3IWE A;  4EFD A;  1AMP A;  1I21 A;  2DF5 A;  5LYF A;  4KLW A;  4A32 A;  3WC5 A;  5JM6 A;  2HC9 A;  5KTA A;  1IY7 A;  2QVP A;  1NMT A;  1QMU A;  2AFW A;  4CPA A;  3NH5 A;  4H89 A;  2WSA A;  3NH8 A;  1AUG A;  2PJ1 A;  4KOV A;  3FYN A;  4Q38 A;  2PJ7 A;  3FBU A;  3B8G A;  2X7B A;  4PXC A;  2Z3L A;  3WC6 A;  1S7L A;  4PK2 A;  2PJB A;  4C2Z A;  1YVK A;  2AFM A;  2FL4 A;  4HPS A;  2R8V A;  4MHP A;  2JLM A;  2Q4V A;  4RS2 A;  5HVG A;  3T8W A;  3V7Z A;  5JGF A;  3LWU A;  4MFZ A;  4OP4 A;  4KOU A;  3PEI A;  4A94 A;  3H8F A;  3FVL A;  1F2P A;  4FBE A;  4BBH A;  2JEW A;  4MFQ A;  1ON0 A;  4R9M A;  4MFJ A;  4II9 A;  2FS5 A;  1V0C A;  2GAN A;  4A95 A;  4CYQ A;  1KUX A;  1YGH A;  4NJQ A;  3PFO A;  4J3G A;  6CPA A;  1ZLH A;  5ISV A;  2DPS A;  2Z0Z A;  4PXB A;  1Y9W A;  1TF8 A;  2V77 A;  3KI9 A;  1LRZ A;  4FAI A;  1Z8W A;  2C6P A;  2ODF A;  3WAB A;  2ZEO A;  4GXH A;  4KUA A;  1QSO A;  3D2M A;  1UWY A;  4YRH A;  3RO0 A;  3I1U A;  1YX0 A;  4WJB A;  2VI7 A;  2V8D A;  4W9Y A;  1NSA A;  3PFE A;  2WPW A;  4KSF A;  4B6Z A;  1XRY A;  2QIR A;  1H8L A;  2OZH A;  1XE4 A;  4JLY A;  4UFX A;  2EK9 A;  4JD6 A;  4M3S A;  4OC0 A;  4X8I A;  5DWM A;  2YNE A;  2ZEP A;  2P6E A;  1CPX A;  3S9L A;  5AG4 A;  7CPA A;  1MJA A;  3TO7 A;  4Y49 B;  4A39 A;  3K2K A;  3H5Z A;  2GU2 A;  4JXQ A;  1S60 A;  4BMH A;  4CS0 B;  5FVJ A;  3KR5 A;  1FNO A;  2ZEM A;  4R76 A;  2O28 A;  4U9Z A;  2J9A A;  2K5T A;  3TFY A;  2OU2 A;  2PR8 A;  4MBU A;  2CIJ A;  3F0A A;  3CPX A;  3TE4 A;  3TTH A;  4ZY2 A;  3BI1 A;  4NGT A;  5GCN A;  1HDU A;  1NSL A;  3D8P A;  4KSI A;  4OKO A;  4A31 A;  2ZW6 A;  4B5P B;  4YU9 A;  4P4E A;  3KL9 A;  4DYO A;  4X2T A;  5A27 A;  2AFO A;  4E0A A;  1VIX A;  2HUZ A;  4DUK A;  2VZY A;  5AG5 A;  4CRZ B;  1TKF A;  3MN8 A;  4CRY B;  1TKH A;  4MMO A;  4NGM A;  3H4Q A;  1FY7 A;  2IJZ A;  3FH4 A;  2BO9 A;  4M85 A;  4MCQ A;  1BLL E;  2ZEF A;  3P2H A;  4P45 A;  4P6Y A;  4Q36 A;  4HNW B;  5EC4 A;  1XIX A;  3WC7 A;  4FD4 A;  3V8I A;  2DEA A;  2PJA A;  4L8A A;  3W91 A;  1F57 A;  4JWP A;  3NH4 A;  3D4U A;  4AVA A;  5HMN A;  2R98 A;  2PDO A;  4K30 A;  5IX3 A;  1LAP A;  4KVM E;  2BUE A;  4CGL A;  3TC8 A;  2YGW A;  5JH9 A;  4DNC A;  1KUV A;  3NE7 A;  3FF3 A;  2Q44 A;  4P44 A;  2ZPA A;  2B4D B;  4MHN A;  3PBE A;  2XEG A;  2ZXV A;  3HLP A;  4OID A;  3SXO A;  3NA6 A;  1JWQ A;  8CPA A;  3S9N A;  2OB0 A;  4P4J A;  4XPD C;  4CGM A;  3IGR A;  1XF8 A;  2EBJ A;  4ZGY B;  5K8M A;  1N71 A;  2H5M A;  2PVV A;  4OC4 A;  4R8F A;  4UCN A;  2OOT A;  2WUU A;  3B3S A;  3B3T A;  3ISZ A;  3PZJ A;  3R9F A;  1YQE A;  2DXQ A;  5G20 A;  5LRJ A;  2ZW4 A;  1Q2C A;  5LRG A;  5F49 A;  2EWB A;  3FXT A;  1Z5R A;  4M6H A;  1RTQ A;  2PJ5 A;  4UIB A;  1S3Z A;  4HNY B;  1CX8 A;  1Y7E A;  4CYO A;  4NEX A;  2REF A;  4GM5 A;  2PIZ A;  5AG6 A;  2RC4 A;  1M4I A;  4QB9 A;  4QC6 A;  5LRK A;  2HB6 A;  5JQ4 A;  2BOA A;  2OH1 A;  5DS0 A;  2OZU A;  3D67 A;  4PSW A;  2D4O A;  2PE3 A;  4C2X A;  2POK A;  4QVT A;  4F6A A;  1YK3 A;  2P0W A;  1UFH A;  2QYV A;  1NE9 A;  4FD5 A;  2DPT A;  2ARH A;  3TCV A;  1BO4 A;  3CZX A;  2ZEL A;  4U5Y A;  3JTK A;  2BSW A;  2Q43 A;  2Z3M A;  3FEE A;  1M1D A;  1YRE A;  3B2Y A;  3BJ7 A;  3H8G A;  4ORF A;  3T90 A;  1XBU A;  1ZG9 A;  3EXN A;  5G1Z A;  4UEF A;  3S6H A;  4C7I A;  4Z65 A;  2VL1 A;  2B3U A;  2GLF A;  1CJW A;  4NXY A;  4JYW A;  2PJ0 A;  3ZJ0 A;  2YND A;  3GLJ A;  3F8K A;  3T9Y A;  2R1I A;  3ISX A;  4R57 A;  1S7F A;  2F8H A;  4M6G A;  1Y0Y A;  1QQ9 A;  4PSX A;  4R6T A;  3FB3 A;  4NGN A;  4OIW A;  1ZG7 A;  2Q0Y A;  4KOS A;  5DWN A;  2FE7 A;  1ZLI A;  4P4B A;  3S9M A;  4KOX A;  2PJ4 A;  5G21 A;  2Z11 A;  5HVF A;  4F0Y A;  1PCA A;  3IFE A;  3SXN A;  2CTC A;  4H2K A;  4C68 A;  1CP7 A;  4UFW A;  1Z4E A;  4QUS A;  3EC4 A;  4PPZ A;  4TNU A;  3JUW A;  3FRM A;  1ARM A;  1IGB A;  1Y9K A;  3S6F A;  3SHP A;  2F5I A;  3FEC A;  5J1Q A;  3D7G A;  3C26 A;  3S6G A;  3IU2 A;  2JEV A;  1XJO A;  3NE8 A;  4HKF A;  4PXD A;  3GY9 A;  2XEF A;  1Z8T A;  1QSM A;  5CNP A;  3N5F A;  3CT9 A;  2J8R A;  1XMB A;  2QEC A;  4GS4 A;  4KUB A;  1R43 A;  3K9T A;  1YME A;  4RI1 A;  4UEZ A;  5I4M A;  3B35 A;  2JBJ A;  3EFA A;  3SI0 A;  4AG9 A;  2Z3O A;  3TOA A;  1PUA A;  3SJG A;  3IEH A;  3EY5 A;  2VEZ A;  3G3S A;  2PJ3 A;  3W6S A;  3LD2 A;  1ELL P;  5G22 A;  4ZY0 A;  1LOK A;  1HEE A;  3QNV A;  1KWM A;  2PRB A;  2F7V A;  3CXS A;  5BWA B;  4RUH A;  1Y7R A;  2GE3 A;  2PSW A;  2I79 A;  3LAC A;  5LYL A;  4ZYQ A;  2CNS A;  2ZW7 A;  4MHZ A;  4R3L A;  5HXD A;  5THW A;  1YVO A;  4B14 A;  3IC1 A;  4KVO E;  5A28 A;  3B3W A;  4NJR A;  2YNC A;  4MFL A;  4X3R A;  1M44 A;  4CAF A;  3R96 A;  2FSR A;  2Z3K A;  4MY0 A;  4F8Z A;  2FIA A;  4AXV A;  1CG2 A;  1MK4 A;  1YW4 A;  3H8E A;  4OC5 A;  4BIN A;  3PBB A;  4Q7A A;  4MFK A;  3SJF A;  2FIW A;  2EVN A;  1CP6 A;  4I49 A;  3BXM A;  1Z8L A;  3L2N A;  4KOY A;  3GYA A;  1IB1 E;  4U9Y A;  1TIQ A;  4EWT A;  1X12 A;  1MJB A;  4NFR A;  4MCP A;  2P6F A;  1Q2Y A;  1BAV A;  3DNS A;  3KKW A;  2ZEN A;  3LMS A;  3DDD A;  3K9U A;  2G3A A;  3SI1 A;  1Q2D A;  1XFO A;  5D8N A;  3B3V A;  3D2P A;  1X10 A;  4MHD A;  3PB4 X;  1ELM P;  4XPD B;  2VBQ A;  1Z9U A;  3I3G A;  4XPL A;  2RFH A;  4CGN A;  1OBR A;  4KSA A;  3DR6 A;  4L89 A;  2FT0 A;  2O4H A;  5F46 A;  2ANP A;  5EMI A;  4R7M A;  2AFU A;  4F0X A;  5I0C A;  4B5P A;  2PVW A;  3VAR A;  4A37 A;  3B3C A;  4OAE A;  1EE3 P;  2PCU A;  1S5K A;  1TF9 A;  2I3C A;  4F9V A;  2D4P A;  2BL1 A;  3KHX A;  1VHO A;  4FD7 A;  4XNH C;  5ELY A;  1CPS A;  4R87 A;  3KQX A;  4OLL A;  2ABZ A;  4IHM A;  1Z8X A;  4M6I A;  2EO8 A;  4B13 A;  5IV0 A;  2G3T A;  2VXK A;  4OME A;  3KGQ A;  1AYE A;  3FJU A;  2GRE A;  2B58 A;  5CBM A;  3D3S A;  4P4D A;  2ZW5 A;  5F48 A;  2NYQ A;  3R95 A;  4AVB A;  4E2A A;  2IQ6 A;  4LUA A;  4MY3 A;  4OC3 A;  4PQA A;  5D29 A;  3VWD A;  3GUX A;  3B7I A;  1Q7L A;  1YW6 A;  4B5O A;  2PRQ A;  1IOF A;  4CAW A;  3CXQ A;  3G8W A;  1BOB A;  2IMO A;  2P6G A;  3LOD A;  3PB7 X;  2Q4Z A;  4UCP A;  3ZZI A;  4CAV A;  1CBX A;  2A4N A;  2V8H A;  2GIV A;  3TOB A;  3WT4 A;  1S7K A;  3PB8 X;  4MCS A;  4MCR A;  1GYT A;  3BI0 A;  2CF4 A;  2I00 A;  1IYK A;  5IB9 A;  5C82 A;  2HQY A;  3OWC A;  3QAY A;  1I12 A;  1Y0R A;  4A38 A;  2B3V A;  3UY5 A;  3RZA A;  1YR0 A;  4YFJ A;  3VAT A;  2C1C A;  3PGP A;  4AG7 A;  3JRU A;  1JQG A;  4JZ0 A;  4NCZ A;  2B5G B;  4H6U A;  3CDX A;  1P0H A;  4TWE A; 
#chains in the Genus database with same CATH homology
 3W6X A;  1WWZ A;  5IB0 A;  3MGD A;  4E8O A;  3IU1 A;  4A30 A;  3TT2 A;  2NMT A;  2Z10 A;  4KLV A;  4QBJ A;  1M4G A;  2REE A;  5H86 A;  2G0B A;  2AJ6 A;  4NSQ A;  4R3K A;  5AGE A;  4KZT A;  1CM0 A;  4B12 A;  1R57 A;  5E96 A;  4CYN A;  2WPX A;  3A9L A;  1KZF A;  3BLN A;  4PV6 A;  3QB8 A;  4FD6 A;  3R9E A;  5JPH A;  4NF1 A;  3DR8 A;  4KOW A;  4X5K A;  2C27 A;  3R9G A;  3GKR A;  4C7H A;  2Q7B A;  1KUY A;  1J4J A;  1XEB A;  4EVY A;  2CNM A;  4XPK A;  5EBV A;  1B6B A;  3JVN A;  5C88 A;  3R1K A;  3RYO A;  3N7Z A;  2R7H A;  1P4N A;  2IL4 A;  4HNX B;  4IF5 A;  1IIC A;  2KCW A;  3S6K A;  3QAH A;  1ZO0 A;  5AG7 A;  4CAX A;  5J8C A;  1PU9 A;  1B87 A;  4JJX A;  4JXR A;  4A33 A;  3FNC A;  1IYL A;  4UBR A;  2PC1 A;  4XNH B;  1VKC A;  1VHS A;  4ONU A;  4CAE A;  1I1D A;  1MJ9 A;  4B11 A;  3TO9 A;  4YGO A;  1GHE A;  3F5B A;  4ZBG A;  5KTD A;  1RO5 A;  4A2Z A;  4KS9 A;  4MFP A;  2FCK A;  1QSR A;  2CNT A;  3P2F A;  2YNC C;  3PP9 A;  2BEI A;  2PR1 A;  3FIX A;  2J8M A;  3TO6 A;  3E0K A;  1K4J A;  2B4B A;  1Z4R A;  2Z3P A;  3EO4 A;  2JDC A;  4UWI A;  3VWE A;  4Y49 C;  4OAD A;  4AVC A;  2CXA A;  1S7N A;  1L0C A;  4UA3 A;  2Q4Y A;  2PQ8 A;  4KOT A;  1M4D A;  2B4D A;  4KVX A;  4C2Y A;  4CGP A;  2FXF A;  1QST A;  2OZG A;  4UFV A;  1RXT A;  2VZZ A;  4MJ8 A;  1QSN A;  4UCM A;  1IID A;  5H84 A;  3IWG A;  1SQH A;  2Q04 A;  4KOR A;  4UWJ A;  2EUI A;  3WR7 A;  5KTC A;  2CY2 A;  5HH1 A;  4IUS A;  4AB7 A;  2Z3N A;  3I9S A;  1WK4 A;  2JDD A;  4PK3 A;  2J8N A;  1XMT A;  2VQY A;  2ATR A;  4MI4 A;  4CGO A;  4H6Z A;  5J8F A;  4CYP A;  1YLE A;  2AE6 A;  2QML A;  4B10 A;  4LX9 A;  3CXP A;  3BJ8 A;  1U6M A;  2HV2 A;  1OZP A;  3DSB A;  2Y0M A;  2B5G A;  3IWE A;  1I21 A;  4KLW A;  4A32 A;  5KTA A;  1NMT A;  4H89 A;  2WSA A;  4KOV A;  3FYN A;  4Q38 A;  3FBU A;  3B8G A;  2X7B A;  2Z3L A;  1S7L A;  4PK2 A;  4C2Z A;  1YVK A;  2FL4 A;  2R8V A;  2JLM A;  2Q4V A;  4RS2 A;  4MFZ A;  4KOU A;  4BBH A;  4MFQ A;  1ON0 A;  4R9M A;  4MFJ A;  4II9 A;  2FS5 A;  1V0C A;  2GAN A;  4A95 A;  4CYQ A;  1KUX A;  1YGH A;  4J3G A;  5ISV A;  2DPS A;  2Z0Z A;  1Y9W A;  1LRZ A;  4KUA A;  1QSO A;  3D2M A;  4YRH A;  1YX0 A;  2VI7 A;  2WPW A;  4KSF A;  2QIR A;  4JLY A;  2OZH A;  1XE4 A;  4UFX A;  4JD6 A;  4M3S A;  5DWM A;  2YNE A;  2P6E A;  5AG4 A;  1MJA A;  3TO7 A;  4Y49 B;  3H5Z A;  4JXQ A;  1S60 A;  4BMH A;  4CS0 B;  5FVJ A;  2O28 A;  4U9Z A;  2K5T A;  3TFY A;  2OU2 A;  2PR8 A;  4MBU A;  3F0A A;  3TE4 A;  3TTH A;  5GCN A;  1NSL A;  3D8P A;  4A31 A;  2ZW6 A;  4B5P B;  5A27 A;  4E0A A;  2HUZ A;  2VZY A;  5AG5 A;  4CRZ B;  4CRY B;  3H4Q A;  1FY7 A;  4Q36 A;  4M85 A;  5F47 A;  5EC4 A;  3P2H A;  4HNW B;  1XIX A;  4FD4 A;  3V8I A;  3W91 A;  4L8A A;  4JWP A;  4AVA A;  5HMN A;  2R98 A;  2PDO A;  4K30 A;  5IX3 A;  4KVM E;  4CGL A;  2BUE A;  2YGW A;  4DNC A;  1KUV A;  3NE7 A;  2Q44 A;  2ZPA A;  2B4D B;  3SXO A;  2ZXV A;  2OB0 A;  4XPD C;  4CGM A;  3IGR A;  1XF8 A;  4ZGY B;  1N71 A;  2H5M A;  2WUU A;  3PZJ A;  3R9F A;  2DXQ A;  5G20 A;  2ZW4 A;  1Q2C A;  5F49 A;  3FXT A;  1S3Z A;  4HNY B;  4CYO A;  4NEX A;  2REF A;  5AG6 A;  2RC4 A;  1M4I A;  4QB9 A;  4QC6 A;  5JQ4 A;  2OH1 A;  2OZU A;  4PSW A;  2D4O A;  4C2X A;  4QVT A;  4F6A A;  1YK3 A;  2P0W A;  1UFH A;  4FD5 A;  1NE9 A;  2DPT A;  2ARH A;  3TCV A;  1BO4 A;  4U5Y A;  3JTK A;  2BSW A;  2Z3M A;  4ORF A;  1M1D A;  1YRE A;  3BJ7 A;  3T90 A;  3EXN A;  5G1Z A;  4C7I A;  3S6H A;  2B3U A;  1CJW A;  4NXY A;  3ZJ0 A;  2YND A;  3T9Y A;  3F8K A;  2R1I A;  4R57 A;  1S7F A;  4UCN A;  4PSX A;  3FB3 A;  2Q0Y A;  4KOS A;  5DWN A;  2FE7 A;  4KOX A;  5G21 A;  2Z11 A;  4F0Y A;  3SXN A;  4C68 A;  4UFW A;  1Z4E A;  4QUS A;  3EC4 A;  3S6F A;  3JUW A;  3FRM A;  1Y9K A;  3SHP A;  2F5I A;  3C26 A;  3S6G A;  3IU2 A;  2JEV A;  4HKF A;  3GY9 A;  1QSM A;  5CNP A;  2J8R A;  2QEC A;  4GS4 A;  4KUB A;  4RI1 A;  4AG9 A;  3EFA A;  2Z3O A;  3TOA A;  1PUA A;  3EY5 A;  2VEZ A;  3G3S A;  3W6S A;  3LD2 A;  5G22 A;  2PRB A;  5BWA B;  3CXS A;  1Y7R A;  2GE3 A;  2PSW A;  2I79 A;  2CNS A;  2ZW7 A;  4R3L A;  1YVO A;  4B14 A;  4KVO E;  5A28 A;  2YNC A;  4MFL A;  1M44 A;  4CAF A;  3R96 A;  2FSR A;  2Z3K A;  4MY0 A;  2FIA A;  1MK4 A;  4MFK A;  2FIW A;  2EVN A;  4I49 A;  4KOY A;  3GYA A;  1IB1 E;  4U9Y A;  1TIQ A;  1MJB A;  2P6F A;  1Q2Y A;  3DNS A;  3KKW A;  3DDD A;  3K9U A;  2G3A A;  1Q2D A;  3D2P A;  4MHD A;  4XPD B;  2VBQ A;  1Z9U A;  3I3G A;  4XPL A;  4CGN A;  4KSA A;  3DR6 A;  4L89 A;  2FT0 A;  5F46 A;  5I0C A;  4F0X A;  4B5P A;  4OAE A;  1S5K A;  2D4P A;  2BL1 A;  4FD7 A;  4XNH C;  4R87 A;  4OLL A;  4B13 A;  5IV0 A;  2G3T A;  2VXK A;  2B58 A;  3D3S A;  4AVB A;  2ZW5 A;  5F48 A;  3R95 A;  4E2A A;  4LUA A;  4MY3 A;  3VWD A;  4B5O A;  4CAW A;  3CXQ A;  3G8W A;  1BOB A;  2P6G A;  3LOD A;  4UCP A;  3ZZI A;  4CAV A;  2A4N A;  2GIV A;  3TOB A;  1S7K A;  2I00 A;  1IYK A;  5C82 A;  2HQY A;  3OWC A;  1I12 A;  2B3V A;  3UY5 A;  1YR0 A;  4YFJ A;  3PGP A;  4AG7 A;  4NCZ A;  2B5G B;  4H6U A;  1P0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...