1NSAA

Three-dimensional structure of porcine procarboxypeptidase b: a structural basis of its inactivity
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
395
structure length
395
Chain Sequence
FEGEKVFRVNVEDENDISELHELASTRQIDFWKPDSVTQIKPHSTVDFRVKAEDILAVEDFLEQNELQYEVLINNLRSVLEAQFDSVSRTTGHSYEKYNNWETIEAWTEQVTSKNPDLISRSAIGTTFDGDNIYLLKVGKPGSNKPAIFMDCGFHAREWISQAFCQWFVRDAVRTYGYEAHMTEFLDNLDFYVLPVLNIDGYIYTWTKNRMWRKTRSTNAGSSCTGTDPNRNFNAGWCTVGASVNPCNETYCGSAAESEKETKALADFIRNNLSSIKAYLTIHSYSQMILYPYSYDYKLPENDAELNSLAKGAVKELASLYGTSYSYGPGSTTIYPAAGGSDDWAYNQGIKYSFTFELRDKGRFGFVLPESQIQATCQETMLAVKYVTNYTLEHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of porcine procarboxypeptidase B: a structural basis of its inactivity.
pubmed rcsb
molecule tags Serine protease
molecule keywords PROCARBOXYPEPTIDASE B
total genus 143
structure length 395
sequence length 395
ec nomenclature ec 3.4.17.2: Carboxypeptidase B.
pdb deposition date 1997-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
A PF02244 Propep_M14 Carboxypeptidase activation peptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.340 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Metallocarboxypeptidase-like 1nsaA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1nsaA02
2AFMA 3D7FA 3T8WA 5D8NA 8CPAA 3WC7A 3BXMA 3FF3A 3D4UA 1LCPA 2POKA 2V8GA 3IJ3A 5LYLA 3S9MA 5HVGA 1IGBA 2HC9A 4UEEA 5HVFA 3PFEA 1Q7LA 2G9DA 1PCAA 4UIAA 1YW6A 4YU9A 1QMUA 2ZEEA 3WT4A 3CT9A 1BLLE 2JBKA 2V8VA 3PB8X 3D7HA 1VGYA 3B3VA 4W9YA 2EWBA 1JQGA 2GU2A 1F2PA 4UEFA 4MHNA 4MRIA 4MMOA 4NGQA 3NFZA 3PB6X 4TWEA 1F57A 7CPAA 3FEDA 3BHXA 1PYTA 1YSJA 2O4HA 4OIWA 3H8GA 1Y0YA 1O6XA 3HLPA 2C6GA 3K2KA 1R43A 1Z8LA 4FAIA 4GM5A 4P4JA 2PJ2A 2IQ6A 3FJUA 3DLJA 1Y7EA 4FWUA 1CP6A 2ZEFA 4R8FA 4F8ZA 1TXRA 4R6TA 2Q43A 4OC3A 1ZG7A 2C6PA 1DE4C 4A39A 4NGTA 2V8HA 2PJBA 1ARLA 3SI1A 4OIDA 1LFWA 2BOAA 2QVPA 2I3CA 3SJGA 2QYVA 1PYTB 4P4BA 1YMEA 1XRYA 4A37A 4FBEA 3L2NA 2ZOFA 3KR4A 3N5FA 3SJFA 5DS0A 3NH5A 4F9UA 2NYQA 4ZYQA 4IAVA 4ZX8A 2PJ6A 4PQAA 5HXDA 4OMEA 4ONWA 1VIXA 3B3TA 2EK9A 2CTBA 4NGMA 2AFSA 2HB6A 2DEAA 2PIYA 4NGSA 4NGPA 4EMEA 2CIJA 4ZI6A 4F9VA 2AFUA 4MHZA 1DTDA 2XEIA 4WJBA 4OC5A 2ZEDA 4PXBA 2F8HA 5F09A 1HEEA 1CX8A 4FUUA 4PXCA 2ZEPA 1QQ9A 2PVVA 1ZLIA 2NSMA 4RUHA 3D7GA 1VHOA 1PBAA 4Z65A 3IEHA 4MHYA 3B3CA 3FVLA 4YWYA 3IO1A 3PB7X 3PB4X 3D67A 2PJ0A 2PJ8A 1ARMA 1IY7A 4DUKA 1GYTA 2IJZA 5D29A 3ISXA 4LQGA 3FEEA 6CPAA 1EE3P 4UF4A 3VATA 3IC1A 2PVWA 3K9TA 3KASA 4H2KA 1HDQA 3RZAA 2WZNA 1CPXA 1TF8A 3VARA 4P44A 4P4DA 3SJXA 4OC2A 2BO9A 5JGFA 4OC4A 2CTCA 2ZEGA 4IK2A 1AYEA 3CDXA 5THWA 3FX6A 2EK8A 5LRGA 1AMPA 4MXUA 3PRTA 4PXDA 3FH4A 4OC1A 1FT7A 2GREA 4P10A 3LWUA 4UIBA 4NJRA 5LYDA 4JYWA 4TNUA 4A38A 2CF4A 4ZY0A 4MCPA 1ZLHA 3BI0A 3NA6A 3IWWA 2PE3A 3SJEA 5HVHA 4EWTA 1BPNA 5LRJA 2OR4A 5I4MA 1UWYA 3PB9X 2JBJA 5K8PA 4DYOA 5LYIA 2PJ9A 3BI1A 2PCUA 3KQXA 2J9AA 2RFHA 3S9LA 3D66A 3H8FA 5CPAA 3B2YA 4ZY1A 1VJQA 3MN8A 1TKFA 4PPZA 3SI2A 4IHMA 2AFZA 3PFOA 1ELLP 2V77A 2ANPA 3PBEA 2V8DA 5IB9A 3KI9A 2WYRA 3H8EA 3GLJA 5J1QA 1BPMA 4P4EA 3I1UA 3V7ZA 2F7VA 4MCQA 4NGNA 3PEIA 3KHZA 3WC5A 1R3NA 4G1PA 3B7IA 5ELYA 3DGVA 1LAPA 4CPAA 3CPXA 2O53A 1XBUA 4UEZA 2JEWA 2Q4ZA 1LOKA 4Q7AA 2PJAA 3B3SA 4P45A 1CP7A 3IIBA 2IMOA 1LAMA 3KZWA 3RBUA 4WWVA 4NJQA 5JM6A 4K3NA 1XMBA 2PRQA 2GLJA 1VHEA 3B3WA 1BAVA 2PJ3A 2PJ4A 2ZEOA 3S9NA 4X3RA 3VH9A 3FECA 4OP4A 3D68A 2ZENA 1M4LA 5K8MA 3GUXA 2ZELA 4R76A 4NFRA 1KWMA 3NH4A 1NSAA 2C1CA 4P4FA 3IFEA 4KSIA 2QJ8A 5CBMA 2C6CA 2FVGA 2GJFA 1FNOA 5LYFA 2ZOGA 4OKOA 3HUVA 1Z2LA 2AFWA 3JRUA 2PIZA 2Q51A 3GB0A 4A94A 2GLFA 1YLOA 3TC8A 2PJ5A 3PBBA 1TKHA 2XEFA 4O23A 1Y0RA 3B35A 1ZG8A 2ZEHA 3FMCA 1HDUA 3KGQA 2VL1A 4MHPA 1OBRA 3KHXA 1Z5RA 1XFOA 2OOTA 1F2OA 3SI0A 1CG2A 1TKJA 5K8OA 3KQZA 3RAMA 5LRKA 4NGRA 3LMSA 2PJ7A 1CBXA 2PJCA 5JH9A 3CPAA 3KR5A 4ZY2A 3KL9A 2ZEMA 4JZ0A 4R7MA 2BCOA 3QNVA 4MCSA 2AFOA 1LANA 2XEJA 3D7DA 4EFDA 4BD9A 1ZG9A 2ABZA 1ELMP 2PJ1A 2XEGA 1TF9A 4DJLA 2AFXA 4P4IA 3TX8A 1CPSA 3WC6A 4ZX9A 3V38A 4AXVA 4PXEA 4P6YA 1XJOA 4MCRA 3ISZA 3WABA 5K8NA 3NH8A 1H8LA 3MRUA 1YW4A 2RB7A 1RTQA 4B6ZA 4OC0A 4X2TA 4X8IA
chains in the Genus database with same CATH superfamily
3LAKA 2XZDB 4EBDA 4CLYA 1T9WA 1W2BR 2R2RA 4UQGA 3KJFB 2F8EX 2DGVA 1Z4RA 1I21A 3QRQA 1L0CA 4J9KA 1SL2A 4DR4F 1HNIB 3O5TB 4RW4A 2ZXVA 1YJUA 1FKPA 3CW2C 1IKYA 2IYGA 4NLRA 1Q7YT 2G3TA 3ZO7A 3M30B 2CJXB 1FDAA 4ED0A 1WEXA 1WWZA 1YJVA 3HKWA 5DM6Q 3U1LA 2ZHAA 1R31A 4KVOE 2Q79A 4I1TA 3PB6X 4TWEA 1Y5IB 2H9ZA 4RNOA 3NOCA 5A27A 4H89A 4M1KA 4C4WA 4OHXA 4YGOA 2DNMA 4WYLA 4M5DB 2XMAA 4CH1A 1U7LA 2GHVC 3GKRA 3M9NB 3C6TB 2RVJA 4USKA 1F9FA 3DLJA 2ZH5A 3BZQA 4IG3A 3UCUP 3CCRS 2LQJA 4F6AA 2CA9A 4RUBA 4P9SA 4QPTA 4H6UA 1I51B 4WKRA 3P8BB 1WHXA 2E9TA 3OR2A 2ROEA 2AJ1A 3N5FA 1VQOS 1JXEA 4DU8A 5AE1A 5HANA 5IC4B 4IAVA 4PQAA 4OMEA 1FRLA 2YPYA 3LPEA 2EPIA 2JSXA 2QX0A 2ILZA 4ICLA 1HYSB 3NGTA 4WP8A 4X4PA 4Z7CA 3BGLA 3QT8A 4NPOA 3R1KA 4A30A 5J1NA 2HFSA 3L3CA 4DV2F 4NLWA 5AXLA 2F8HA 3JB9k 4B14A 1KP6A 1LK5A 4Y28C 3C3LA 3JQMA 1YBUA 3R9GA 5AXKA 3W60A 3GSDA 3GSIA 3BGRA 3C6TA 3V6HA 3EZUA 3BPDA 2Z3KA 2QMWA 1NK5A 1T9VA 2PJ8A 3Q8RB 3RBZA 2IJZA 4UUWA 3MCSA 1MJ9A 2L41A 4ZHRA 1XMTA 3CPWR 3UVJB 2G2OA 4N7TA 3OFHA 1ZBTA 4EYHB 4X4NA 3J81U 5IWAJ 2R7SA 2FVSA 2VA2A 2QSFA 1FRHA 2VBYA 4XDDA 5H9FJ 2YNEA 1VBZA 3S01A 2WTFA 4DR3F 4NLTA 2X7IA 5C25B 1ZA1B 5LYDA 2R7QA 1SIWB 3JYTA 3NA6A 4LF6F 2C3OA 3CTRA 1UFLA 4QBJA 1HBNB 2V69A 3BR9A 4O44B 3NMAA 2OH1A 3AQOA 2R7TA 3C19A 4HR2A 3ITHA 3SI2A 3QAYA 2NZ4A 3FUYA 2HGLA 1J5OA 4LFBJ 1A0OB 3BF4A 2H54B 1MW7A 3DGVA 3EPGA 3W66A 4UY8T 5A8WB 4KQZA 3H2VE 2J9EA 3UDEA 4Q7AA 5M2UA 3CCJS 1M1KT 5L1KA 1LAMA 3NE8A 3C46A 1RB0A 2I9SA 5E3QA 1B7FA 2QJ3A 4CO4A 2QRRA 1EAYC 2NS1B 4KOXA 3OTEA 2OPRB 4NX9A 4RS2A 3S9NA 3AH6A 5DJBA 3PVXA 2B5GA 3SFGA 2QMXA 3IWXA 1GMVA 5KFOA 4EMDA 5MLCV 1IIDA 1H3DA 1YQEA 4F3MA 1S1WA 1FDBA 4R76A 4XNHC 2DY1A 3CXPA 3R2CJ 1F5CA 3H25A 4N41A 4P4FA 1JKHA 3PGPA 3WHIA 5DGBA 2ZUGA 1YQHA 3M2RB 2V68A 2AFWA 4OJ1A 1L3UA 3E51A 1U4BA 1XJWB 1WTFA 5KG6A 5G21A 3KLGB 1N33F 3TRGA 2XEFA 4ZVRB 5EX3A 3DGPA 2XHWA 4HI2A 4LRAA 2J6TA 2BKNA 5H9FK 3DR8A 2GE3A 3LP2A 2PRBA 3SHPA 2OJ3A 3MR6A 2AYEA 2VJUA 4MFBA 3PYGA 1J5EF 5A8WA 1R89A 5CH7B 2ZZTA 5J2NB 3LGHA 3KQZA 1C0TA 4R25A 1UJ4A 5ETLA 1KLMA 4LR7A 4DV7F 4F3QA 2AFOA 3CDEA 2CPFA 4EFDA 3NS6A 2ABZA 1Y7RA 5B0DA 4E0DA 1QDUB 1YX2A 1VFJA 3TX8A 2AGQA 1YK3A 1J27A 2EG2A 1A6LA 1XTZA 1RE1B 4P6YA 2Y1LB 3HPOA 3ET6B 5IT9U 2W8LA 3DXBA 4DSLA 2C2EA 2BYCA 4WXWA 2QECA 3RJMB 4IQXA 3CNQP 5D4PA 4FDFA 2J9DE 3W62A 2ZBPA 2UV8A 4JWPA 4UEEA 3K2YA 3W2WA 3P4UB 4FYVB 4Q36A 4YU9A 4DQSA 4I2QB 2V67A 3J80U 4CGLA 2HHUA 1KLMB 2IA6A 3KK2B 1VGYA 2GU2A 1FRJA 4C11B 2LVWA 1X4AA 4QIVA 2WONA 1F57A 2W9BA 3MR5A 2LA6A 2HBZB 2YGWA 5JPHA 2BACA 2CNKB 5B0GA 1RSCA 4OLOA 4DUTA 3TZXA 1WSRA 3K5MA 2W9BB 2K1RA 4AL6A 4FD7A 1S6UA 4WE1A 3DOMB 4ZCIA 1TXRA 2V0NA 3C14A 2BJ1A 4USWA 2DHSA 2ZUAA 4A8FA 1Y3KA 2ZH9A 4OX7A 3DLHA 1XIXA 2CPHA 3NP5A 2BE2B 4KOSA 1ZH5A 3QWUA 4JUZA 3HD2A 4B9UA 2ZDPA 2VFSA 3TOAA 3Q89A 5D78A 4B5PB 4IOBA 4FS1A 3HSZA 3GIMA 5B0BA 2B4DA 1FESA 3B54A 1HD1A 5D4OA 5F8HA 2VPWB 4X2BA 3KKFA 2QIFA 4MJKA 1ULRA 4NGPA 1EARA 2QFIA 3C26A 1N32F 1FRXA 1TKDA 2GO9A 1EETB 2CQDA 3CUNA 2LYVA 2ZEDA 2OLWA 1AA1B 2H48B 2J5AA 1N8RT 4C8NA 2WVBA 3A3PB 3MMAB 2ZW4A 2O01C 2EBEA 1YLXA 2AGOA 2K1RB 4DHVA 4FF1A 2AX0A 4UWJA 4B9MA 4OJHA 3FFIA 2V9WA 3CJQA 1V9OA 2B4BA 4F0HA 2B3UA 3CO9A 2DHHA 4DX7A 2GMJA 1L3KA 5HQ8A 1PYSB 3FFIB 2HBYB 1Q8BA 2CIMA 4P4DA 3MHYA 1REVB 1H2TZ 2LFVA 3KHLA 1OWXA 3M1VA 5KG4A 2UVUA 4I2PA 1X60A 4CAFA 2JLGA 4WXOA 3IU2A 3PW0A 3I0RB 4MY3A 2OZGA 2HNYA 1NMEB 4M8LA 1FJEB 5HMYA 1S3ZA 3FBUA 4LSLA 2PE3A 4QZVB 3UVJA 4DV0J 3PB9X 1D8ZA 3DRPA 1RTDA 2PJ9A 5A8RA 1U1PA 1JLGA 4KO0B 1RU2A 4P2MA 3VCDA 1PO6A 2DF5A 2UUWA 4QIEA 1PG5B 4XAKA 2NPIA 4IRKA 1ELLP 2WBRA 3VALA 5AE2A 1SC6A 4KRWA 3NGSA 4E98A 4K4YA 3AD9C 2VB6A 2ZH1A 1R7IA 3H42A 1OY9A 4MCQA 3OXGA 1RT6A 1CC7A 5KFUA 4ZIWA 2O28A 4DF4A 1K73T 3B4MA 5IT4A 3BQ1A 2REEA 4ZITA 4DR5J 1FJCA 2ZC3A 3DLGA 4UFXA 2HYIB 1TR0A 4C8YA 2FIUA 2ALYB 3BYRA 3BSAA 2GLJA 1VHEA 2MKJA 2ADCA 2ATRA 2GV1A 1RGVA 2KYZA 2F4VF 4X3RA 3HP6A 1RABB 4QWCA 1PC5A 5K8MA 4C97A 1UTAA 4DN9A 4I4BA 1U1NA 1PC4A 1NM2A 1IKWA 1N5TA 2YKMB 5LYFA 2ASJA 3MOJB 1PYOB 1RACB 4B3MJ 3NCQA 2JH3A 1SC3B 1OSCA 3M8YA 1ZS6A 5SUHA 1LXJA 3NLCA 2WB4A 1CLFA 1N33J 1R8PA 1X5TA 2YQ1A 5CCMA 3KGQA 3M8RA 1C0TB 2VG7B 2LDYA 1GFWB 2ZH8A 1O51A 3HXMA 1FD8A 3R1LA 1XNQF 4N76A 2B5JA 3I31A 2RJZA 5K8OA 1R57A 5GADU 1NMTA 3OPKA 4U9YA 3SCJE 1KHWA 2VG6B 3CPAA 3GP9A 3KL9A 1ZYQA 2DGOA 2J9DA 4F3OA 1LANA 3TO8A 4MJ8A 5K14B 4HPSA 4YEAA 4AVAA 1ZG9A 3RO0A 3A12A 3DDIA 1ELMP 1Y3JA 2IVYA 5KOXA 4DSEA 1ICEB 2WUUA 1J5OB 1L3SA 4LF6J 1YW4A 2CRLA 4DR6F 3CJRA 2QYCA 3SSSA 2BEFA 3SXOA 2Q7BA 4LT6A 1PSDA 2AJ0A 1S5KA 4K4VA 4NCGB 3RB4A 1LCPA 2I79A 4U7UK 1SVDA 1RAJA 3ZTQA 1IBMJ 4U9ZA 1IGBA 1UEKA 1S9GB 4B5OA 5ETMA 5HVFA 3G96A 2AYMA 5GAEI 3EZOA 5CYJA 3GYAA 2GNKA 2MQOA 2ZEEA 4K4ZA 4HI1A 3UI3A 3PB8X 1MN9A 3LH2S 1SV5B 4K4SA 4LQ3A 4C0HA 2W2OP 1CJTB 4FXWA 2R8KA 4MHNA 3TFYA 3TARA 3JQJA 4YFUA 3SCKE 3IWLA 2DO4A 2WVDA 3S6HA 1AZSB 3GR0A 4J7CA 2FJWA 3Q2SC 2VASA 3Q2TC 1P6TA 1YDLA 4O3QA 1XNRF 2R8GA 1G7CB 1YX0A 2VZZA 3W6SA 2XS5A 1N5QA 1QSYA 1NJWA 1S72S 3BSNA 4OYOA 4MFBB 2ZVSA 1IBCB 1SC1B 4OC3A 1KQGB 2B56A 2VG5A 3QJPA 2E7VA 1HFEL 1HHSA 1TFWA 4FF4A 4CAWA 3T19A 4KH0B 1GXTA 4N8NA 4ZKAA 3MEGA 3WX8A 2B9YA 5KG1A 1KKHA 5L38A 4AD6A 1RTZA 1ZOTA 4B3RF 1NB7A 4OJ3A 4NSQA 3I5CA 3G4SS 1EETA 1FERA 2HWTA 3C8YA 3RBEA 1S7IA 4ECTA 3W2VB 1IR0A 2XMMA 2AEJA 2YWFA 3M32A 2HGNA 3L4BC 5DETA 4G6VB 4ZLPA 4OC5A 1FY7A 5EHHA 3SEOA 3MM6B 5KFAA 4BDPA 3MPYA 2HHHF 2BJDA 3R5DA 2J6SA 1TL4A 5F9LA 4OHVA 4ZGYB 1DY3A 1RHUB 4NLSA 4C3LA 3IG1B 1S1XA 2EFQA 2KRRA 2V6AA 3K9UA 2ATCB 2ZH3A 1CS4B 6CPAA 3VWSA 2A2CA 2VICA 1YG0A 1YZ7A 2WVCA 3EYZA 1Y9OA 1JWQA 1HPZA 2GJIA 4F50A 3IG1A 3KHRA 1JXLA 1KOOA 5L39A 3G3SA 1N34F 4O0IA 4NMLA 5E2QA 1IBKF 2MXYA 1AUGA 3CJ8A 2QN6B 3ICLA 1Q81T 3F8KA 1NSQA 4ZPVR 3JXOA 4DL2A 4CLTA 2DISA 4IR9A 3W5YA 2FQQB 4A38A 4DX6A 1NJXA 3GCXP 3CGIA 4RNNA 3AODA 3CE8A 1NKBA 1T95A 1BWVA 1J4JA 1ZPVA 2ZJQQ 4UCPA 4RBVA 1S6QA 3RNZA 5EGYA 5KFCA 4KE5A 2YNHB 1WEZA 2HQFA 4X62J 4J9OA 4JB8B 2J9CA 2WPXA 4OYZA 5KFWA 3KK2A 1QD1A 3PRVA 2MTLA 2E1PA 2NXCA 2QLWA 5DWMA 2XY5A 4OYWA 2Z0ZA 2EFVA 1RCOB 1UWBB 1SQFA 1XR5A 3I1UA 2G2YA 4X66J 4F25A 1TL7A 3J7YU 4ALZA 2ZM6F 3OLBA 4AQYJ 4DV6F 3MPVA 4LQ9A 3TOQA 1V5VA 2A6MA 3MM8A 4O3NA 4U95A 1Q79A 2J0SD 2EKNA 3AOBA 2ASLA 4S0MA 4U6PA 3TX0A 1FX4A 1MK4A 4Y0FA 4K3NA 2G0IA 4KS9A 2ATLA 2E1RA 2L3MA 4IG3B 2RMLA 1D09B 4ED2A 3VH9A 3RB6A 1BQNB 2DGQA 2OZHA 2N4DA 3CJ4A 5D0HA 1PJ5A 1RAOA 2PDAA 3LALA 4ZOSA 3GONA 3BKFA 1TV6B 2Z3OA 1KVJA 5J8FA 5H1SV 5T7LA 2KJWA 4DV6J 2JDJA 4CAEA 1LWEA 1RT1A 5DQGA 4NZ7A 4FBTA 2FJDB 3UQSA 3QNWB 3FCHA 2F5GA 3CSKA 1HBNA 3F56A 4I2PB 1WHWA 1TV6A 1TKXB 2OFHX 1DHMA 2V63A 4MYTA 2WVEA 4OZNA 4XO0A 2H65B 1R6VA 3V8IA 3JAMY 1RJJA 1YVOA 5E3AA 4UFVA 3NGRA 1PAEX 4TVAB 1UAWA 2PJ7A 1EJ7L 3GG0A 3R6GB 4RW7B 1H7XA 4JZ0A 2QSWA 1FKOA 1JNZB 1D0EA 3CMES 5A8RB 1VJWA 2V34A 5KTDA 4MFLA 5GCNA 5LJ5Y 3LA0A 3NCPA 2Z2MA 1TF9A 4G1QA 5IXUA 3SI8A 4DXLA 1VQ7S 1Y0HA 3BLNA 2RNEA 1ZZFA 3D7FA 4JBCA 3TEGA 5HROA 5D8NA 4YQWA 1RXTA 1FT8A 1ZM9A 3AOAA 2HZCA 5I3UB 1IB1E 5EWFA 3BBFA 3ZJ0A 3D54A 2AYGA 1N0UA 4UZBA 1S6OA 2VDIA 2JJ4D 4F2SA 4UIAA 4NOHA 3UN3A 1U8SA 2RU9A 3Q0AA 3CT9A 1K9MT 2WPWA 4WFAQ 3QIDA 2RDIA 3PX6A 4HDGA 1YJ7A 3MWBA 3EWGA 2W7AA 3HVWA 5EBVA 1S7NA 1YSJA 2E5LF 3T1HF 2HQDA 1HW9A 1LWCB 3VGUA 4OI0A 3O6QA 3O3LA 4RBUA 4UOGA 3GTYX 2B6AB 2RH3A 1YLEA 3QLHB 1PAUB 3FBEA 2Z2YB 1SC4B 5HROB 1SPBP 4TQRA 2BQRA 1QSLA 3A8EA 4NA1A 2CNOB 3KDOA 3NGDA 2OPRA 1I94J 4KOVA 3H98A 4PG8A 1HLWA 1N5SA 2CDRB 2XLJA 1WHYA 3GYXB 1JJCB 1Z8XA 1VQ8S 2CPZA 4QW9A 2B4VA 2UXCJ 1KUVA 2ZFHA 3OV7A 1TQLA 2VQFF 1QAYA 1UKUA 4ELVA 4NCZA 4ZX8A 3R95A 5CZXA 3G6YA 4ILMA 2AFSA 2HB6A 2P8IA 3MCMA 3PHEA 3KLGA 3S6EA 2O5DA 4DL7A 2G0BA 4X4SA 3EC4A 2MJNA 1R8HA 4M5HA 2XEIA 2HHWA 1NUEA 3MFIA 2AEMA 3W9HA 2DR7A 1X31C 2XLKA 4B3TJ 4K5SA 4NLUA 4CM0A 5J2NA 4C2ZA 2D9PA 5FDLA 1G1XA 2HPUA 2V94A 3BJ7A 3DMJB 1AB8A 3P96A 3H40A 4KY3A 4R0EA 2HHPA 3N5BA 4ONUA 3F41A 3R7BB 3GILA 4F4AA 3W2VA 1QAXA 5LOQA 3PR4A 4FF3A 2C2DA 3FYNA 3RRGA 1K0VA 3HMJG 1UW9A 3J7AN 4IOAQ 4NE9C 1SL1A 1MWYA 3ZNJ1 4OC2A 3PYEA 4DSFA 3HHNB 3W8GA 2W9AA 2X3DA 3MURP 2F65A 4PABA 1AMPA 2RQMA 3PRTA 1Y9WA 3DLBA 4P10A 4ZCKA 2Z3MA 1S6QB 2NXEA 1F3FA 2FLOA 4ZY0A 3A8JA 2D3OR 4ED7A 5L9XA 3H20A 4L74A 1SH2A 1RHKB 1X4EA 4IUFA 2IYIA 1Z4UA 2JEFA 3H8FA 3IWEA 1BE4A 2PSWA 3B2YA 1TUWA 3Q8PB 3X1LB 4IH5A 4ZPTR 1SV5A 1Y5NB 3ZZZA 3SCIE 3C6UB 1GMWA 2BBEA 1NK0A 4X4UA 3BSOA 4RW6A 3MM8B 2XMWA 3OFGA 1IBKJ 3BM7A 4CS0B 4P4EA 3V7ZA 4GC6A 1FTCA 2PN6A 3KHZA 1XBUA 2PJAA 4ECSA 4LRCA 4KHMA 3M32B 3T6BA 2K2PA 4WWVA 4EVYA 5C7PA 5LT5A 1M1GA 3TUPA 1BAVA 4M85A 2VG5B 1HNXF 4GKKF 4Z37A 1QLNA 1GEHA 1KWMA 2DXFA 1U1RA 3D28A 4K4UA 4LVNP 1QAJA 3ISNC 4USJC 4CM2A 5IQQA 1NJYA 1URNA 2BZ2A 4MKBA 2VPXB 2EO8A 2W1BA 4DG1B 2UVRA 3MPDA 2B51A 3I5BA 1XF8A 1WOOA 4HTIA 2EVZA 1QUVA 3MM7B 2P6SA 2UU9J 4O23A 2MGZB 2LQ5A 3TAMA 3HJVA 3DR6A 3CMAS 1T0TV 2K8GA 4CLZA 2M4MA 4YY3J 3D9BA 3FSYA 1LOUA 1AUSL 1CJUA 3LMSA 1U09A 2E5GA 1BMQB 2ZDOA 1X4HA 3I87A 3NXZA 4B5PA 3GCWP 4K59A 4KH1B 2XEJA 2FC9A 1WNEA 5JXSA 4ZVTB 3D1QA 4KUAA 2JEGA 3PG9A 2KB2A 4PSXA 1YVFA 2CJYB 2FVRA 1GNKA 4ANEA 4HH0A 4JV1A 2CPYA 5E3PA 4DR3J 4BINA 3IGRA 3L7OA 2X1GA 4ORFA 3N4WA 2FVPA 3IAS9 3M8ZA 8CPAA 3KLEB 3SZ2A 3CDAA 2CQGA 2W24A 2DTJA 3TJ9A 5H9EJ 4ZN1A 1TZ0A 4NXNJ 2CADA 2LMIA 4F67A 2UZAA 2JL9A 4CO3A 1R6YA 4Y00A 4UW2A 4CDIA 1PCAA 4Q2LA 2FGOA 5F0WA 3TA1A 3BEGB 1RHMB 1JLGB 1EHWA 2Z2LA 2V5HG 3MEEA 2FVQA 1BLLE 1U6MA 4KGKA 1F2PA 3JTKA 5KFJA 3KK3B 3MEDA 4CGNA 2MHEA 2MZSA 1VHFA 4GVBA 5HATA 4ES1A 4Y49B 1S0MA 2P9GA 2COLA 5IQ6A 5F8MA 3H2UB 3T90A 2OSRA 4YMEA 2CQ3A 2C6GA 4LF9J 4K50A 5SZTA 1JX4A 2JFKA 4F4YA 2LA4A 2FJEB 4K2XA 1FA0A 4C8KA 2E5JA 3WDOA 4A4JA 3S8SA 1H2VZ 2HSEB 2QLBB 3SBMA 1WF2A 4Y49C 2XQCA 1SQHA 4M63A 4R0JA 2OKQA 4PG6A 1WK4A 2V8HA 4D3GA 2DHAA 1I94F 4NLOA 3Q8SB 2QVPA 1N48A 1HKAA 2I3CA 3K5OA 4R8UB 5KT6A 1BLUA 4FBEA 3CDUA 3MMCB 4C68A 4DL3A 3SJFA 4KVME 5DS0A 4LFCJ 1UPPA 1R8CA 3EE3A 5LSRA 3AY0A 2WW4A 4LJMA 4Y2IA 4WFXA 2KM8B 1S49A 3QAHA 2DNHA 2LEBA 1SJ3P 5KFBA 4GVBB 2AFUA 1IR2A 2DNYA 2EXUA 3P3DA 4TYAA 4CLUA 1LFPA 4XPDB 2HVEA 1SI9A 1TL1B 3R9EA 2IY5B 4B3TF 2ZEPA 4LUAA 5KT5A 2B4OA 2XI3A 5GVQA 4JJXA 2ROGA 3BN7A 1K1QA 2X3GA 4IFYA 2B9WA 3RW6A 2K3KA 3KXDA 2HFVA 1CPXA 3VARA 4E8UA 4QPXA 4MYUA 4X65F 5CCLA 3PR5B 4ZLLA 5F8IA 1X0PA 3JAMU 1KUXA 1EB0A 2J76E 5B09A 9ATCB 1XEZA 3ETOA 4IK2A 1AYEA 4J9MA 4I2QA 2W4PA 4MXUA 5F46A 2HK2A 1VQ4S 2C2OB 2B4PA 3IA0A 4JI1J 3N6NA 3W65A 1JJ4A 3DRYA 1RT5A 4G1IA 4AL5A 3O8WA 3GV7B 2KT2A 2UV8G 2FD2A 4ECXA 3S1TA 3QPIA 2DD8S 5DDOC 3FCVA 5KFIA 4HNWB 3S9LA 2YNCA 3PJ9A 3G86A 4TU8A 1VRTB 4G65A 3DCAA 3BSCA 4DCPB 1VLYA 4URGA 1RTHB 4EUVA 2Z4PA 2KU7A 4PPZA 4IHMA 2W8KA 3U1NA 2YKNA 3KJVA 3SV3A 1VCTA 3OD2A 2GVDA 1U1MA 4QR0A 3R7NB 1YBTA 4M94A 1BPMA 4USTA 1NZAA 2CPJA 1NO8A 3KNAA 2CNSA 3S7RA 4MY0A 3OTOJ 2X7BA 5KTAA 4PRFA 2KG1A 3DDNA 4ZCMA 3ELHA 4MIWA 1S9GA 3NOGA 4LF5J 4RN7A 5CD4H 3DU5A 4LRFA 2E1AA 2QEXS 4JI5F 5F47A 3D68A 1SKSA 1DTTA 5J8CA 3M8QB 1KSPA 4GKKJ 1EX8A 2D3UA 3MMJA 1S0OA 1TU0B 1H72C 1KHVA 2DXDA 1WDTA 4FNIA 5I3QA 1GH8A 2H4WB 2C6CA 2FVGA 4OKOA 4AXJA 1NBEB 2VDHA 1JLAA 2LQBA 1ZAXA 2GLFA 4DR2F 3I82A 4ZDNA 4OADA 4QWDA 1NK8A 1HMVA 3TOBA 4DEZA 1QSRA 1B7YB 1FXRA 1GHEA 5CXTA 1CJUB 4BC9A 1LWFB 4PKDB 3OJSA 3T41A 1FE4A 4NZ6A 1F2OA 2ALZA 3JSMB 1HMVB 2R7VA 3MM6A 4LF2A 1LXNA 3OFFA 2F4FA 2UXDJ 2DRAA 4NXYA 4N77A 3K5NA 2RE1A 4CO1A 3RAQA 3G6XA 4IR1A 3QNVA 4ZK7M 1RISA 3SSRA 1C1CA 4TU9A 1PUAA 1X5OA 2RC4A 1U49A 5K5MA 2ZE2A 4P4IA 3DRPB 4AXVA 1MU2A 3ISND 2RB7A 3UDCA 2HS0A 1JNRB 3ZZTA 3G8TA 3Q86A 2BRKA 2A18A 1NSKL 3T8WA 3E3XA 2MMYA 2B58A 3CJ0A 3BXMA 1Q7LB 2PD1A 3VHQA 3AA8A 4DN0A 3D6TB 4DR1J 5F48A 1P9QC 4F0MA 4WZQA 2FTRA 4NCAA 4X64J 1Q7LA 4C11A 4IH6A 2V2QA 3HULA 2E9ZA 1XWLA 3OL9A 3BJYA 1QMUA 2RF2A 4Y2KA 2U2FA 2H5JB 3QZ7A 9RUBA 4P71A 3D4JA 1W26A 3TE4A 5ETPA 4JI6J 5D0RA 2FLNA 2AJFE 1RP5A 1B0VA 3H8GA 1O6XA 4KGVB 3CJKB 4RW7A 1R43A 4L8AA 4EFAC 1FX2A 4NF1A 4NASA 3UWTA 2R7OA 4ZJOA 3AT1B 1CP6A 4ILLA 2NYIA 3WR7A 4R6TA 4IYQA 1SKWA 5BR8F 1ARLA 5KFDA 4F4KA 3D6MB 1P9YA 2JOQA 2PDOA 4TLRA 1S5ZA 1Q4RA 2HMIB 2NYQA 1JLBB 4DV5J 1TMJA 1CM0A 3ZZRA 2D4PA 1F2HA 5E3RA 2E29A 2EFGA 2CNLB 4RJVA 3I0RA 3IAM9 4NLGA 3G9CA 3EXYA 2QC3A 1U24A 1PIEA 4UWIA 4DNCA 2K7JA 3IM9A 4M5KA 4EYIB 4MHZA 3G6VA 4II9A 2R8HA 2YH1A 3VGVA 2PR8A 2JLFA 3BO3A 3DNSA 3JSYA 4USMA 4U7UD 4FUUA 1EQMA 1VQPS 1PJ6A 5D77A 1ZM4A 4IFVA 3D7GA 4G3IA 1NKEA 3MR2A 3HLUA 3IEHA 1L3VA 4OMFG 4MHYA 1BQMA 2RRNA 3NY0A 3D67A 3QAUA 2BX6A 1GYTA 3AAWB 2UUCJ 2BJ3A 5DLGA 5D29A 2BRLA 2WAQD 3VVUA 3VATA 4LIWA 1CPZA 2IRUA 3UDLA 3MEEB 2ZW5A 3RZAA 3ZZOA 1LWEB 4OAEA 3KK3A 2KYXA 2CTCA 5THWA 3BO4A 4A8KA 1RT5B 2GZOA 4B3OA 3PYFA 4A31A 4ECVA 2EVNA 4P72A 4U67Q 5IB0A 2CF4A 4J9LA 4ZVPB 5BYQA 3SQOP 4DI6A 2HK3A 4O44A 1ITPA 1JLCB 1HWIA 3LW5C 1UWYA 5HQMA 5IOLA 4QUSA 5C5JA 4LRBA 2QLFB 5CPAA 3JVNA 2BW2A 1U26A 1VS3A 5KFMA 2KXNB 2BMBA 2CVIA 2ILYA 4CNZA 4JV5J 1TTHB 3TNVA 1W25A 5E3CA 2RS8A 2N7CA 3HX9A 4NGNA 2A6OA 4BBHA 3OR1A 3CVKA 5FD1A 4PPDA 1IOFA 2JEWA 4OX6A 2M70A 2B5JB 1DTQA 5KOWA 1T03A 1WI6A 2K5TA 2C42A 5KFKA 3UR0A 3D0HE 5JM6A 4C2MA 2PRQA 1KVKA 1Q2YA 3UD4P 1TVRB 3HZEA 4DV4F 3FQKA 4LF5F 1HBUB 4JI5J 2BR0A 1OPZA 1NSAA 4QJVA 4RX6A 5CBMA 4ZJQA 4F7VA 2EW9A 2Z30B 2RQ4A 4CO5A 1SKRA 1VQLS 1IWGA 4X4VA 3S6GA 3GB0A 4UOCA 2VV5A 1YLOA 3TZYA 3WIUA 3A9LA 2EK6A 1Y11A 3T1AA 1NDCA 2QMUB 3H5ZA 2I00A 3MECB 2UXCF 3M8QA 1KOHA 3DHWC 4HVZA 4CLPA 2VG6A 3WIVA 1Z5RA 1JMTA 4BLGA 3NMRA 1LW0A 1IJEB 3AJ1A 4TU7A 4HHJA 4H54A 4RW6B 5G22A 1VRQC 3V4IA 1F5AA 3CC4S 1TUGB 3POTB 3T9ZA 1S59A 2DGTA 1Z1ZA 2EK1A 4IFYB 1K4JA 3M8SA 4JLYA 3BGFA 5F49A 1T94A 1VRTA 1QE1B 3W7BA 2PJ1A 3DYAA 4ZVQB 1R8BA 2VU5A 1CPSA 2HHTA 3KJVB 1E6VB 4DU7A 3F5BA 3QAEA 5DLFA 4ED6A 1QE1A 4DR7F 4ED5A 1T3OA 3UO0A 4C7QA 5DG9A 5J2MA 2LDIA 3B82A 3KG0A 3LOUA 4J9SA 4H4OB 3MF5A 5A2QY 2CPXA 4I6AA 5H86A 1S7HA 2J0QD 1MN7A 1GX5A 5J2MB 2HUZA 3DDKA 1NEEA 1O8BA 1RKJA 3TA0A 2FVCA 4ZPCA 3FRZA 3F44A 4PZVA 2VFVA 4FYWB 2VOOA 2CNNB 4MMOA 8RUCA 3LGMA 1UZHA 3JTOA 2GS8A 2FJAB 2XY7A 1WKJA 4CO2A 2J7WA 3RG6A 4M5NA 3TYTA 1UFWA 1YI2S 3ENWA 3RUBL 3BJ8A 3TO9A 1HI1A 4DR1F 4KGZB 2WSFC 2HBRB 1FRMA 5KT2A 3H5SA 2PA3A 2E7XA 4EBEA 1F9EB 3MEGB 1Q0NA 1YRXA 3JTPA 2R8IA 2Q43A 3JSMA 4RL1A 3NL0A 1CS4A 2HMIA 4M6HA 4X66F 1WJ9A 1LFWA 5H84A 3SJGA 1YMEA 2PC1A 1TKXA 4OYMA 4YR0A 1H73A 5KFZA 2QL7B 3I0SA 2Q4YA 4KT0C 2OAUA 4DX5A 2ODFA 1RKIA 1KC8T 4LIRA 1LWXA 2HHVA 2CTBA 3OBIA 2YTCA 4RO0A 1PGZA 4X4OA 2PIYA 4Q38A 3HFKA 2CIJA 2Y9HA 1JWWA 2Q6BA 4H4KA 5E33A 2DNNA 2Z0GA 3CDWA 4C0BA 2ZBCA 4LFAF 3N28A 2MQMA 3D3CJ 1YGYA 3UW1A 3AA9A 2YNHA 4PYDA 2BQ3A 1U25A 2AX1A 2B4DB 1TKTB 3QZ8A 1NHUA 2D74B 1UCNA 5HAOA 1RAGB 2MZ1A 3TJAA 3T3FA 3FEEA 5F8JA 5I0CA 3FSIA 4EU0A 3H5UA 3TQEA 1P1TA 1TL5A 4Y3CA 2BA9A 2ZOMA 4DG1A 3IBCB 1NK6A 2E9RX 2J8RA 4R5PB 4P44A 1MLAA 2NPFA 1H6KX 3DFEA 2ZEGA 2MGZA 3ONQA 2IRYA 3PEHA 2EK8A 2LEAA 1NKCA 4NLDA 3FQLA 1VBYA 5B0CA 3HSDA 4ID5B 4DOZA 1HD0A 1FT7A 4B9NA 5DM7Q 1B4SA 2XSJB 5B0FA 5IV4A 2MQLA 3IWWA 2Z10A 1FEEA 1HHQA 4O3RA 2OR4A 4FYYB 4HACB 3OVBA 3MD1A 2M3DA 1K8AT 1QSOA 4NXMJ 4UCNA 2M88A 1HYSA 1KUYA 1UWBA 1RU1A 2WRMA 2CVEA 2KHDA 5LXRA 2AV5A 2PA8D 4M5IA 2WVFA 2XYPB 2HURA 2QA1A 2YX4A 5HL7Q 1RXOB 1OIAA 5LMUJ 3RBDA 2K06A 2DJWA 3EVWA 2WYRA 3OQ2A 1QSMA 4B12A 2F3JA 3G8WA 2R7XA 4LSLB 3LP0A 3VAFA 3HM9A 5ELYA 1X8DA 3PW2A 5AJ3J 1Y00A 2CYYA 4PYAA 2AEFA 7FD1A 2X51A 3BGUA 3SFUA 1CP7A 1DARA 1NE9A 1NXIA 4KUBA 4KO0A 3KZWA 5A76A 2KH9A 4ZHRB 3M6WA 1GTEA 3B3WA 4DV5F 1WOPA 2IMWP 2GHPA 4OP4A 3BGOP 4BC7A 3LWMA 3V6DA 3T1HJ 3NH4A 2CJBA 4CYPA 1RT1B 3JTNA 3R97A 4V19X 4DQPA 4KSIA 3TI0A 1XMQF 7AT1B 1JLBA 4ETZA 4EZ6A 4L75A 2Q51A 1M1DA 3Q8YA 4J9NA 1MJBA 2DRDA 3HVTA 4CO0A 2N3LA 2BL1A 3A13A 2VFTA 3TCVA 2E5HA 2R42A 3QGHA 5ITHA 1WF1A 2VL1A 4A8MP 3ZZ0A 2WCXA 4TKTA 2HRTA 4WZMA 5HMNA 2VZYA 2B8PA 3FRYA 2OO4A 5A28A 1S99A 2JWNA 5EC4A 3RYLA 4MHDA 2CWXA 5CAAA 3CCVS 1RWXB 4MCSA 4X84A 1E6VA 2IJNA 5A0YA 4TNOA 2VOPA 4FZVA 2MPUA 1Q82T 1N36F 2FGCA 3U7JA 1LK7A 5D0EA 1H98A 3B8HA 3GZ7A 3NWRA 1XR6A 3DLEA 2DK2A 2RAQA 2M8HA 3L9ZA 4RW9B 1OYEA 2KDOA 1X9MA 4NCGA 3B6BA 3HI9A 5JJBA 3D5MA 4B3OB 1APSA 1D9FA 2W2MP 1BXNA 4AVCA 2IBOA 2NQPA 3DRRB 2YNDA 1N5YA 2V8GA 4ITSA 4HNYB 1IOIA 2DNQA 4LBHA 3IS9B 4IQMA 3RBXA 1FWKA 2I8EA 3BDEA 4JI2F 1UVMA 3R5CA 3P5BP 5A8KA 3WT4A 3VWEA 2Z11A 4JI7J 1FI4A 1HQ2A 1NDKA 5GAHU 2ZH2A 1LWFA 1T3NA 3VWDA 4KJIA 2DPTA 1VLOA 5KAKA 1Y9KA 4JP8A 2ZNZA 4DV3J 3IRWP 2UVWA 2V4JA 3QT7A 1XBWA 2WK4A 4YR3A 1Y0YA 2C27A 1T9UA 4DL4A 1KQFB 4OX9F 4CYNA 2PR1A 2GA7A 1T03B 4J9UE 1MG7A 3MECA 2LCWA 3FJUA 4CRZB 2X1BA 4FNHA 4DZ6A 4R8FA 1GMUA 3IGNA 4J9VA 1D9AA 4P52A 1TELA 5KFHA 4NGTA 3I56S 4HHHA 1HR0J 4PV6A 2PSZA 4MI4A 5AXMA 3FMBA 2DXQA 1Q8LA 2ZOFA 3TQ1A 4YOEA 4B9LA 3H5YA 3NH5A 2KXFA 5A8KB 2XNQA 3DOLB 2UU9F 2GANA 1RCXB 3B3TA 3M2UA 2FLPA 2EK9A 5DWNA 4MFKA 3KUHA 1T8EA 2IHR1 4PAAA 4RW8A 4UCMA 3N7ZA 5FDLB 3ZTSA 2YPZA 1RAAB 2GFQA 2PFFB 1VMBA 5M2RA 2L9DA 2Y0SD 4RW8B 4ELUA 5J2QA 5HBMB 5KFQA 4A46A 1VHOA 1WC5A 3IO1A 5H9EK 3PB7X 3PB4X 1IY7A 3GMGA 3W5ZA 1CJVB 3BN4A 3ISXA 2MLXA 4B17A 1R27B 3MI7X 4CTAB 1U0SA 3IC1A 3FZ2A 3PW5A 1LKZA 5I42A 2ZVIA 1Y5LB 5HJYA 1BGXT 1VQNS 4KKOA 3LQVA 2EBJA 2XGPA 1GAOA 5A2QU 3C14B 4OYAA 2IPOB 3J7YI 3QATA 5E7OB 5IT9Y 2FLLA 3O2IA 1SQEA 4J90A 1AFJA 2YNFB 4H4MA 2ROPA 4KVXA 4A8QA 4UOFA 2ZHBA 3MEDB 2XULA 4ES3A 5BR8J 2R9LA 4B02A 1X9WA 4GKJF 1HPZB 4WFBQ 3NNHA 4QYZJ 4FYDA 3D66A 1ELOA 3QGIA 4NXMF 2W2NP 4YDDB 3K57A 2DGWA 4XNHB 2IVMA 2FHJA 2G1HA 4JI4J 3BYPA 3PBEA 2V8DA 3MM7A 3R2DJ 2I0XA 2KRBA 4E0AA 3H2LA 2CZVC 1VBXA 4OV6A 4G1PA 5HN0A 4CAVA 1KLNA 1FF2A 4DLGA 2Q4ZA 3DN9A 2HQ3A 4KZTA 5C2CA 4U7CA 4FKYA 4CGMA 3QSIA 4IKAA 4DL0C 1Q5YA 2R8VA 2CNTA 2GFFA 2LKZA 1U8WA 3H90A 3VGTA 4Y6IA 4O4RA 1Q5VA 4NYPA 4LFCF 4KPCA 5K9FA 2Q04A 3HFZB 2ZC4A 2IRXA 2GJFA 4HHUA 4E8OA 1ACMB 3ZXWA 3JRUA 1FWPA 3TVZA 2FJVA 3K8WA 1N0VC 2FHOB 3R9LA 4Y65A 4ELTA 2PJ5A 2HVZA 2ZHOA 1UPMB 3KK1B 3BB5A 3TVYA 2AKWB 5GAEU 1VRUA 1Y0RA 2BE7D 3AB4B 4F26A 1BO4A 2ZWOA 2D9OA 2UUAF 4TXSA 4P2XA 2VJVA 2DNOA 2R1IA 4DL6A 4RUCA 4PUOB 3EMTA 1TKJA 2G1DA 3GR1A 4J5OA 1M4IA 2YWGA 3GFXA 3M8PB 4P6QA 3OVAA 3KR5A 2XHCA 2ZD1B 5HLFA 1XMQJ 3CIMA 2AD9A 5BJRA 1YJNS 2J8MA 4BD9A 3CJTA 1WACA 1IM6A 2IJFA 2QA4S 3WQPA 3FK4A 3WC6A 2KHCA 3WABA 1FK9B 4DQIA 1M0SA 2BUEA 5HSPA 4ERDA 5KFGA 4OC0A 1VK3A 3J81j 2FYXA 3LP0B 1JK9B 1VQKS 4B3SF 5DG7A 3ITHB 3FF3A 1MWZA 1DURA 2JDDA 4UT4A 1FKOB 2OEJA 4ID8A 4ZA1A 2BXJA 4EK2A 2CNMA 2P6TA 1URRA 1RLCL 3S9MA 2CG4A 2C2ZB 4LF9F 4XPKA 3GJSB 4FXVA 1UVLA 1JIHA 1WDDA 3VAJA 4MFPA 4PUOA 4JI2J 1NLKL 3HO1A 2M9KA 5E0OA 3V6DB 2C3PA 3RR8A 3TUJC 2EWBA 1JQGA 2AIRB 1U1QA 4OYIA 3K17A 2ZD1A 3KFWX 4ZVSB 4DMZA 5HLFB 2MDAA 1K1SA 1S7FA 2JVRA 3CCES 2IDEA 1WC0A 4TLQA 1Z8WA 3G82A 5D8HB 3B4DA 4K5RA 1DTTB 3DI6B 3QLHA 1HQEA 3V81A 2QO3A 2OI2A 3NGKA 3D0GE 3SQGA 5JUMA 2AGPA 2W7OA 3HHLC 4BCAA 2C2NA 3QO9B 1H0HB 4OI3A 2BUNA 2GMHA 4R8UA 1JLCA 4RI1A 3GIJA 1SB6A 3T5HA 3MM9B 3W3SA 1U6ZA 2CQPA 2G0JA 3A8IA 1F60B 4JI8J 1XNRJ 1FJGF 1ZETA 3QGGA 1M5HA 4BBYA 2NLWA 1TIQA 1N6QA 2EG1A 3QRPA 4OIDA 2MLZA 3H59A 2L9NA 4ZVFA 2CUYA 4AXIA 4JV2A 2GQQA 4H4KC 4F9UA 2B6AA 2ADBA 3S6KA 5AG7A 1N6QB 4RU9A 3AD7C 2VFUA 2AHOB 2RS2A 2AU0A 3CULA 3CCMS 3P2HA 4NGMA 4RZRA 5RUBA 2CDQA 2CQIA 3NBPB 4LF7F 4NGSA 4ZI6A 2GX8A 2RSQA 1C1CB 4CLFA 2O67A 3D2MA 3FIXA 2DEJA 3VGSA 3CDBA 3NBPA 2X1AA 2P6EA 1LW0B 1SH3A 3HZGA 4LMZA 1PBAA 2C28A 2ZKTA 2FSRA 4YWYA 3K7RA 4PG5A 2PJ0A 1ARMA 2GO8A 3IBWA 1G6BA 3ZNUA 2PGCA 2GCFA 2QMLA 1EE3P 2GVDB 1SUQA 1E6YB 5ETRA 1YBAA 4U96A 4Z2XA 2LXFA 3D2PA 3I4PA 5F8NA 4BMHA 4YB6A 2EBGA 2VUGA 4RW9A 3HFVA 2LP4A 1XE4A 3P5TL 4OZJA 1SKUB 1HIYA 4MTPA 3BH6B 2GQ2A 3P2FA 1U2CA 4A8YA 4CP5A 4ER8A 3S6FA 4QIWD 4E2FB 1M5PC 1N32J 5HVHA 2XB2D 3N01A 1WC6A 1RTHA 3POTA 4AYBD 2DY9A 5LYIA 1GTHA 2VI7A 3AFGA 4LR9A 4GKJJ 2OPSA 2PCUA 2B8QA 2J9AA 4RNFA 2R2UA 1SBRA 1HQUA 5DS7A 4ZP8A 3HT3A 3FGVA 3MR7A 5G0RB 5DDRC 2B43A 2GQCA 4F8RA 2DB1A 2AZ1A 1M4DA 4M5GA 3TVKA 1T9TA 1N56A 5CYQA 4J9QA 4CLLA 1Q95G 3PEIA 5EX0A 1HNIA 2LU2A 1ZTWA 1LAPA 3M2UB 4OLPA 1XR7A 2OEKA 2GJ2A 2DR5A 2FXFA 1VDHA 3THVA 2VXKA 1LOKA 2KTQA 4NL5A 3GYGA 2FT0A 1QTNB 2HLUA 4MKAA 1SL0A 4DUYF 1VQ5S 2P6GA 7FDRA 3IR6B 3TANA 5ISVA 3L7UA 2FPHX 3FECA 2JC1A 2CY2A 3KLFA 2WHOA 4RU2A 4FPRA 3TZWA 4M5DA 3I0SB 1YREA 1UA0A 3MPUB 2VQEF 3TW0A 2D3ZA 1FNOA 1F3VA 2F63A 1FFGB 3BH7B 4QB9A 2PMWA 1FVQA 3TAMB 4DV1J 3TC8A 1C4AA 4OL8A 2YWHA 3TA2A 3IBFB 2BDPA 3IR5B 3GG1A 1IQTA 2ZEHA 3FMCA 3NKYA 4DLEA 4MHPA 3M8PA 2PEHA 1X4DA 2C2MB 1U02A 1UW4A 5HP1A 2KFZA 4QIFA 1Z8TA 4YB7A 5IS2A 4Q43A 4WWSA 2R98A 2RT3A 5LRKA 3QIPB 1VBKA 3VZHA 3EM1A 2VBQA 4YRHA 4LF8F 2H4YB 1MU2B 2MKCA 5B0EA 2OMOA 2F4VJ 1P8GA 4PWDB 2KT3A 3LF0A 1BUXA 4LFAJ 1FDNA 3TJ8A 3N0VA 2ERRA 1S4FA 4FVMA 1H8LA 2VC0A 2XMJA 3PKMA 2CJKA 4PQUB 1CVJA 2E5IA 2G2ZA 1Y4ZB 1S1UB 4M5LA 3KHHA 4PEOA 2YNFA 2DNKA 1KZFA 1ZA2B 1FNXH 4AB7A 2UUBJ 3J7Z5 3PJWA 3QYYA 1WSVA 2RF2B 4PK2A 4P74A 3UE2A 3VZIA 5HVGA 1DLOA 4ZVEA 2VBXA 1VQSA 1HWUA 3HVTB 4C3MA 1S79A 5KFEA 2RUSA 2OD6A 3GQCA 1AXQA 3IU1A 4TQSA 2JDCA 3DC2A 2WSAA 2RRBA 1HQEB 4USIA 3I55S 3CXSA 3FJ2A 1GXLA 5HMZA 4BS2A 4MRIA 5KFPA 1A7GE 2RIJA 3W8PA 8AT1B 3PIOQ 3MGDA 1PYTA 1KR4A 2CQ2A 3CC7S 1NPRA 1WG4A 4LVOP 2V4QA 4NLYA 5F3TA 3R5BA 2NSBA 1VHIA 4FF2A 2YWWA 4C8MA 1YR0A 2XSJA 1VRUB 4CH0S 1FHTA 2A4NA 3V6KA 2DT9A 2ASDA 2QIRA 1HNZJ 3M9MB 5J2PA 1F0XA 4HACA 4DDFA 2RRAA 4GO7X 4CLSA 3CZXA 5LMUF 4QR2A 1KD1T 3BV8A 3IWNC 5AG4A 2RHSB 3RB3A 3FMWA 5J2PB 3C15A 1K44A 3N79A 3QJJA 3QB8A 2Q44A 2U1AA 2DR9A 5DO2A 2VFRA 3KR4A 3JQKA 4HYKA 3I5AA 3GE9A 2FDNA 5JVHQ 4NI2B 3QGPA 1RAHB 2KKHA 2R7HA 3CD0A 2IDLA 3VVTA 1KQSR 2GVZA 2VQFJ 1VC5A 1W7WA 1RTJA 2OUGA 3PTWA 2JC0A 5K14A 4FN5A 2XTJP 1UEVA 3OL6A 4NYOA 3PDNA 2RKIA 1J5EJ 5DQIA 3MMCA 4PXBA 1O0PA 1OS5A 3F0NA 1HA1A 1G3OA 4JI8F 4J3GA 1YJ9S 1UVIA 1VIOA 3SCLE 4FS2A 3MMBA 4JI7F 4LR8A 4NLXA 3FVLA 3LAMA 2FY8A 4NCBA 2XSFA 4L72B 1V3ZA 1KONA 5LMNJ 2ZH7A 4JXRA 1FD2A 1QM9A 4L6V3 4B3SJ 5KFNA 4H2KA 2HAFA 5KG0A 1EP4A 1UFKA 3D0IE 4C8ZA 1AT1B 2MY8A 3I4HX 3AB2B 3D1HA 1FK9A 3SJXA 4QIGA 2Z56B 5B08A 4LX9A 1HARA 4J37A 4OZLA 1RWNB 4B9VA 3Q22A 2GREA 1IU8A 2R7RA 3OSPA 2O1PA 4WCEQ 4NJRA 1TVRA 1I12A 2EFPA 3BI0A 3H0PA 1N5YB 3HVRA 4OHYA 1KEKA 2B7BB 2PE8A 1NPPA 5L1LA 1OY6A 1X5SA 3D2WA 3ET6A 4DWIA 4ANCA 2Q66A 4YHHJ 3TO6A 2J6UA 1ZM2A 1AFIA 1AUDA 4KSFA 4NYZA 2DHGA 4I49A 1SJQA 3NS5A 2IJRA 3R5GA 3DLEB 4MT1A 2LXIA 3KI9A 3GLJA 2FL4A 1DTQB 2MQQA 5HBMA 2XWXA 1IUJA 1BWEA 2H5IB 1VK8A 1NHVA 6AT1B 4C3KA 5GAHI 2MLYA 4UEZA 2DBBA 3OFEA 4OI6A 3FEYB 2OPSB 4V19J 3KYLA 3DRRA 2I38A 3T6JA 3T9NA 1V0CA 3BBCA 2C3MA 1XMBA 1B0PA 3MD3A 4NRUA 3OTOF 4K0KF 2MZJA 1TAUA 1M1HA 2MKHA 4RNMA 2HZAA 1M4LA 1GK8A 2HHQA 5KG7A 3T1YJ 4Q0BA 1S57A 3I32A 2E44A 4K2JA 4MK8A 2CPIA 4NLQA 4TYBA 2RUGA 4CLWA 1Z2LA 5B0AA 3UCZP 2MSSA 3DDDA 4QYZK 1MROB 3JSBA 2BSWA 2DO0A 3KG1A 1FKPB 1RT4B 2W4DA 4KPYA 3PBBA 1UFHA 1EZZB 1G2EA 1WC4A 3MFHA 1ZG8A 3M30A 3VAGA 4H4OA 3HF5A 1MROA 1WI8A 2HNZA 3DM2B 1F6TA 1XFOA 2OOTA 3OHBA 2E1CA 4KLVA 3VAIA 1X4BA 4DR7J 2HHHJ 1I5OB 1KS2A 4QWBA 4KLWA 4F0XA 2ZITA 1RI7A 4R87A 3DLLQ 1JLAB 1Q8KA 1CBXA 2Q1LA 1FNMA 3QJLA 4QOTA 4R7MA 4CGOA 1IQZA 3NAIA 4DSIA 1S97A 1OMSA 2Q3PA 3UD5A 1Q1KA 1GT8A 1X7VA 3PJXA 3EGZA 4B9TA 4GRSA 2E7WA 1TMMA 2P9EA 4ZX9A 4PXEA 3ISZA 1DZ5A 3NH8A 3UD3P 2DNLA 2MQ8A 4ECUA 4HKFA 2MHNA 2D1CA 1JLQB 4X2TA 1LNQA 2IVFB 2GIQA 1GX6A 1AROP 3A3NB 3SV4A 3GIRA 3H8YA 1RYSA 2UUBF 3QQCD 1YZ6A 5MAOA 3HKZD 3KUGA 2W7PA 3AJ2A 4XIUA 3MTJA 2XYGB 1CJVA 2DNGA 3W9JA 4O3SA 2XO6A 4PCQA 1FWLA 2DIVA 5I42B 1KDNA 4K7QA 4MIBA 4LF4J 2SXLA 4HL9A 4W9YA 3ZTOA 5AGEA 1HBOB 1RT3B 1H7WA 1NSLA 4ECRA 3IN5A 2QZ8A 5L1JA 5D0GA 2NCKL 2OSQA 2HQCA 3IGVA 3HLPA 4DFMA 2MY7A 4HDHA 4FAIA 3PEJA 4A8SA 4P4JA 4DUZF 2PJ2A 5FJ4A 1S1TB 3FCWA 3MZIA 2CJQA 2HIQA 3HDSA 1Y7EA 2W01A 2ZEFA 3QT6A 5EWGA 3J7A1 8ATCB 2PEBA 2PJBA 3RB0A 2AWZA 4IH7A 1Q2DA 3SI1A 2BOAA 3WC2A 2C3UA 5L8RC 1I6JA 3L2NA 5CYMA 3BKTA 5C25A 3DHXA 1WEYA 4URSA 2JLMA 2OGUA 3GFHA 2GGPB 3GIKA 1B3TA 2J8NA 4PWDA 5HXDA 4NA3A 1KFSA 3V2UC 1RAFB 5G1ZA 1P27B 5ETQA 3C2PA 2BV3A 5CYMB 1KBRA 4LRDA 3IRXA 4Y2AA 2KFNA 1R0CB 2VH7A 1CSJA 2GW8A 1HNZF 2YY3A 5FLXY 3CCLS 4L3NA 5AXNA 1TKTA 4WJBA 3JSRA 1BQMB 4ZLJA 2A2DA 4G1QB 4LQ6A 3IRXB 4JV0A 3TZZA 3OLAA 3NNAA 1DQAA 2B0GA 1X12A 4CQ1A 1VOMA 2DXEA 2FC8A 2HKEA 3V81B 1WC3A 4XDCA 1JLFA 1N36J 4LQGA 2AJQA 4WFNQ 5I3UA 4EZ9A 3UFCX 4KV8A 2QE5A 3GYNA 2VHGA 3D3BJ 4JOUA 4QU7A 3US5A 1B0TA 4ID5A 4KYZA 1NK4A 4OZ2A 2Z3NA 4DR5F 1XIQA 3PYDA 3ZZIA 4WP3A 3CB4A 4DR6J 3CDXA 2PMZD 4IFVB 1S1UA 1LV5A 1QVGR 4OC1A 2L08A 5F0UA 2DR6A 3LWUA 4ZCLA 1FJGJ 3HK2A 2ZZNA 3M2RA 3DSBA 3E0KA 1N4LA 2ABYA 3SJEA 3RW7A 3ILLA 4I56A 1KTVA 5GMKa 4LSNB 3E01B 2J0WA 1X5PA 1OQ3A 4JI1F 1U1LA 4IG0A 1Y10A 2AE6A 2VEZA 2UXBJ 3R5AA 4QW8A 3G8SA 1HNVA 4KSEB 3SIPB 1VISA 4C8LA 1PJ7A 2N4CA 5FLXU 1IYKA 3LD2A 3OR1B 5IFMA 3PFOA 2VBZA 3PACA 1X4FA 4WU3A 4CCHA 2OIHA 4TY8A 2A10A 4Q8FA 3UCGA 2LQ9A 4OX9J 1NCLA 1R0BG 3R27A 1M90T 3SQGB 1VYAA 5ETVA 1RLDA 2EFNA 2RD5C 1S12A 4CZCA 2AYBA 3QO9A 5T41A 2F8MA 3CCZA 3DOLA 2HHSA 3HT0A 3EY5A 5C2GA 4O3OA 4M6GA 5CQGA 3KLIB 2DH8A 1WELA 2QT7A 6FDRA 3N6LA 4ZN3A 4K0KJ 3QMQA 4NRTA 1U2RA 2GMLA 4OHWA 3TAPA 1NH8A 4OI1A 3OSNA 1WOSA 1DQ8A 1RTIB 4RR5A 1QUPA 2CWKA 3E8OA 3KJNB 3DOKA 3HUVA 5G4DA 3I9SA 3L09A 1FXLA 2B3TB 4R57A 3DRSA 1NU4A 3PX0A 1LRZA 1RWVB 5BXIA 3G6ES 1HDUA 4CTAA 2JNJA 1T11A 4USUA 3CIZA 3JUWA 3FVYA 4DX8H 2PFDA 3RU0A 2D41A 1HBMA 1Q78A 3AD8C 2V4RA 3DYAB 2CZ9A 4I64A 1NDPA 1Q8IA 2KT5A 4ZVUB 2HFNA 2DITA 4OHZA 4GVLA 1YWXA 1QAIA 3IWGA 2HNZB 3DM2A 5AG6A 2XYHB 3KKWA 3FNCA 3PY8A 1N34J 3MUMP 2HVIA 2F40A 2R7WA 3V4IB 3KG4A 1U0HB 3D3SA 4DS5A 4BHQA 3MM5A 3MAAA 4K4WA 2UVVA 2E66A 3HHLD 4N5SA 3NRBA 2HRUA 1RWMB 2CXEA 5KTCA 4P75A 3LODA 2QYGA 3WC0A 1RA7A 5FVJA 4A8OA 4KOTA 5HJXA 2YKQA 2EWHA 4K4XA 1IICA 2G9DA 2VQEJ 2Z57B 2FCKA 2YX1A 1RO5A 5U47A 1OQ6A 1HBMB 1YW6A 4O4GA 1RWOB 3RRHA 1ZAVA 4UY85 1E6YA 1M5KC 1M5SA 3ULHA 4BWJA 2HBQB 2HNDA 2ZJPQ 1RWWB 2OB0A 4CNYA 1MMLA 2DCUB 1S48A 1SH0A 3MMAA 2CQ0A 3LANA 2OPPB 4ILRA 4CYOA 2CQ1A 2OPQB 3NFZA 3CD7A 3R1HA 1UP1A 2Z58B 2FIAA 5JMNA 4DFJA 4CIOA 4F4WA 4P2FA 5J2QB 4JI6F 1DFDA 2IQ6A 3UR3C 4U8VA 3ETMA 3BPSP 1REVA 2RDJA 1ZG7A 1FRIA 2GIFA 4JI3J 1RBOB 3VF0B 4DCOB 1TL7B 4DQRA 4GO5X 3GIIA 5D6GA 4KGMA 2I5JA 2MZQA 2ZWPA 4EGLA 3VAHA 3NS7B 1KVIA 4ZVHA 2NR0A 4ZYQA 2FZCB 2MEWA 1QJHA 1BY9A 1VIXA 4JD6A 1NJZA 2DHXA 4WFYA 1NK7A 3CMQA 3A4TA 4I6WA 3T5LA 2RDDA 2W25A 4BWMA 4WKYA 2OPPA 1RK8A 1VQMS 1BQNA 2DEAA 1X4GA 1JJHA 2OPQA 2D4OA 2MZRA 1NAQA 3Q8UA 2LU1A 2G0CA 4FKXA 4KOWA 1VQ9S 3IM8A 4KIAA 2K7KA 4YY3F 1NRKA 1T9XA 2V9KA 4LBIA 3B8GA 3GU0A 2GGPA 2FHMA 5T7LB 4RUHA 1XMOJ 4DV1F 2FUG9 3OL7A 4UOHA 4CI0B 2FE7A 3EDQB 3TP2A 5IT0A 3M6VA 2R3VA 2WB1D 4KKOB 3CJKA 3Q8QB 3BGRB 1YJRA 2PO4A 5L9NA 4F36A 5CA5A 1T7PA 5ETKA 2WZNA 3MPWA 4B13A 4B3MF 2Y8YA 4AQYF 1P0HA 3P6YC 1RT2B 2BO9A 4OC4A 4ZIVA 4N8OA 2OEMA 2KCWA 2M5YA 5LRGA 3TWZA 1Q86T 4PXDA 4EO8A 3MEKA 3C15B 4L3KA 4DJBA 3NG8A 2BABA 1JLFB 3PX4A 1XNQJ 3FB3A 2G3AA 2JEJA 5CABA 1OZPA 2Z3LA 1PKUA 5LRJA 1HNVB 2Z8QA 1RQ0A 2N7YA 2HIYA 3O44A 3TTHA 3R3TA 3DU6A 3KLVA 1RTJB 3HSGA 4ZPAA 3UPFA 1IR1A 2GIVA 2HHXA 2ZBQA 1YRTA 5EWEA 1RT3A 1S60A 1ZPWX 3M2VA 5ADZA 4DBQA 1TKZB 4J91A 4PQUA 2KO1A 2ZKUA 2XMUA 2AMCB 5CD4A 2O53A 4NWBA 3R7SB 4M3SA 2X1FA 2FJXA 2DR8A 1KNZA 2JVOA 3B3SA 5EMIA 4Y34A 3MXHP 1WUUA 1YTYA 3Q23A 5EUHA 2PJ4A 4I7FA 2DIUA 1V3RA 2R8JA 1X4CA 2B9XA 2KL8A 3W91A 4H6ZA 2WZ1A 4KOUA 2BQUA 3KK1A 1YRUA 4OZ1A 3SDEB 4F0YA 3CD5A 2C2KB 2HVHA 1MWQA 1D1UA 4YDXA 3IR7B 1FDDA 3MDFA 1S6PA 5F9NA 2A3JA 3I9ZA 2GVZB 2FS5A 1RYRA 3VAKA 3ILIA 3PP9A 5DDPC 2BM1A 4OQJA 3H4DA 2LQ8A 1CJTA 2UP1A 3HD1A 4WK3A 2C1EB 5GAGU 2RKIB 5IV3A 3SI0A 5D4NA 3ZZYA 3I3GA 1RTIA 1S1VA 5ETNA 1DAXA 1O5JA 2G4BA 4KGXB 2W9CA 4KBIA 1V6HA 1H74A 2C2RA 2PJCA 2R7UA 1MMNA 4ZY2A 2VKZG 1UVNA 3OHAA 2XG8A 1TUVA 3ENAA 4RWWA 4P2SA 3LTOA 3D7DA 3GFZA 1EKSA 3VR1A 3CXCR 4KV8B 2W9CB 4EBCA 3V6JA 2J8SA 4IF5A 2P5VA 3FXTA 3O1LA 3UY5A 1C0UB 4JV5F 4MFQA 1M44A 3V38A 1XJOA 1CJWA 1CBKA 3MRUA 5EDWA 1HBUA 2XO7A 1IWAA 4HT5A 5BWAB 1R8AA 4F0KA 3WC7A 5IZHA 1S6PB 1XQIA 4URQU 3K59A 1OPIA 4AG9A 3FBCA 4KOYA 3W6XA 4DCJB 5IM0A 3MMBB 2NUHA 4I68A 3PFEA 2KZZA 1NHKL 5CZVA 3KNGA 2Y0BB 3CEDA 1S1VB 1WORA 3K0JA 1D3WA 2ARHA 3PV8A 2MSTA 1TK5A 3DI6A 1JXVA 3B3VA 4M6IA 3QWPA 2IAJB 3PZJA 4ED8A 4NLVA 1M5OC 2Y1RI 4I67A 2VBWA 1IBLF 2QGFB 1Z9UA 1VI7A 2ZJRQ 3BKUA 3CCUS 3KJQB 4OYPA 1CJKA 3OXFA 4KHRA 7CPAA 3BHXA 3K5LA 3G71S 4WU2A 1NDLA 1HW8A 3BBBA 3K2KA 1Z8LA 5KFLA 1S9EB 1AW0A 2QG9B 4DV3F 4RBTA 5KFVA 1WKKA 2V8PA 3RGIA 2I5JB 4UUXA 1HNWJ 1F1BB 2JRSA 5B7WA 5K20B 1SXLA 4FXDA 4OFZA 2IBKA 1FKAF 2YWEA 1DE4C 4PSWA 2MYFA 1IN0A 4XPLA 3L7PA 2EUIA 3W63A 4JI3F 1SUQB 2CFXA 1V5IB 4KAIA 2QYVA 4A37A 3DOMA 4FP9A 1H2UX 2Y8WA 2MZTA 4NZ0A 4RW4B 1TK8A 2XS2A 4NEXA 3EGWB 1JB0C 1MMDA 3C16A 4HKQA 4X4TA 1RT7B 2H5EA 1S76D 1IKXB 1L5UA 3FEZA 1P4NA 4DUYJ 3KOAA 1YVKA 4USHA 2ZM6J 5LXYA 4U5YA 1YITS 2W4CA 3LP1A 3GPAA 1CJKB 3C16B 4YFJA 1XEBA 3T1YF 5HH1A 2IM3A 5F8GA 2YQ3A 3NGUA 2M2BA 1R0AA 5IX3A 4NA2A 3I9V9 2KJVA 1HEEA 2HQYA 4L89A 3EVMA 2GIRA 2JHEA 1P1LA 2G9OA 1ROFA 4RPFA 3ZZPA 2RQCA 1IYLA 5L46A 2YNGA 4JXQA 4ECYA 3J80Y 2QL9B 4O4GB 2M52A 1S1TA 4AE5A 1G4CA 3W1YC 2OZUA 2YXLA 2Z3PA 5FIIA 3WZ0A 3CJ2A 1NZ8A 2MKYA 3AQPA 3I6PA 4ZP6A 3KWMA 2K3IA 2NXJA 2F1FA 1IKXA 3FX6A 1WKLA 2CXAA 2AP6A 2N3OA 2KI2A 1BOBA 2VPYB 4ZBGA 4ECZA 4DPYA 5HO4A 4JYWA 4TNUA 3MTKA 4W90B 3SXLA 4Q8EA 2VKRA 2XLIA 4MCPA 1ZLHA 5C24B 2OHDA 4Q2MA 5G0RA 4EWTA 4PR6A 1ZZNA 3OXLA 4X64F 4DYOA 3PRBA 3DLKA 4M5JA 3KQXA 2IC3B 4CGPA 3DLGB 1U48A 3BS9A 1FJ7A 3SSQA 1FRKA 3BDPA 1XERA 4MH8A 2UUAJ 4CYUB 2AFZA 5AE3A 3TO7A 4JI0F 2V77A 1OY8A 5BYRA 3CF5Q 4PG4A 4R3LA 1SJ1A 2EC2A 2IL4A 2IM0A 4DSJA 2YKOA 2XM3A 1N52B 3ZZUA 3M8WA 4JI4F 2R2TA 1T02A 1UVJA 2FHKA 2BANA 1FFWB 2HW3A 3R5JB 4C48A 2YKPA 4P45A 1ZO0A 2B3VA 2IM1A 2QL5B 2HV2A 2V2KA 4NJQA 3UN2A 4ZP7A 5DZ7A 2PJ3A 2ZEOA 3RYOA 4PWUA 1EIYB 4CH7A 3LGNA 3K89A 3HHKA 3UDVA 2PI4A 2XC9A 1WTBA 2BJEA 3SDEA 5J1EA 2CQBA 3KHGA 2E1MC 3GUXA 2ZELA 2ZW7A 4OYXA 4UA3A 3EPIA 2VZ9A 4U9RA 1I3OB 5KG5A 3PNIA 5M2PA 2MKSA 3ILJA 1U6FA 4DV2J 2C1CA 2M8DB 2D3O1 4ED4A 5J1EB 3OTBA 3I96A 2YQ0A 3PXGa 2I6WA 3HHLB 1TKHA 2EEYA 5IV0A 2KG0A 4WK1A 3B35A 4USVA 3EJMA 2EI5A 4HLBA 2VODA 2C22A 3QIPA 3T5JA 3K8VA 4ETXA 1DLOB 3TUIC 4FBUA 2IM2A 5HQLA 1EP4B 3KHXA 4TY9A 4EEYA 3KDNA 3LPYA 5IWAF 1HI8A 2YKAA 3AOCA 2QA4G 4TY8B 3G8QA 1TAQA 3RAMA 4A2ZA 1HWJA 5JH9A 4MK7A 1OSDA 2OH2A 2UUCF 2B5GB 1QTMA 2HS4A 3M05A 2B7CB 4HTJA 2WW8A 1U47A 1YJTA 1S77D 2XZTB 2AFXA 4OI4A 3R8YA 4R3KA 1RT2A 4A48A 4LUBA 2HFOA 4C0OC 5K8NA 3CXQA 1U1OA 4HT7A 3ENVA 4KB7A 5L1IA 1IJFB 2AFMA 2W2QP 4XPDC 4MBUA 1IBMF 3K58A 2F9JA 4Z7YA 3D8PA 4J9PA 2J7UA 3GJTB 4LREA 2MQNA 3SYZA 4MKYA 3D4UA 2C3YA 2O3DA 2NREA 2IFXA 3DOKB 3THTA 3IJ3A 5LYLA 2HQGA 4WP9A 3ADAC 4DF8A 1RHRB 2BJ9A 1REGX 2GAHC 2AJ2A 2V8VA 2E5LJ 2YBVA 5C88A 2HWHA 4MKVA 1F9HA 3Q8VA 4UBRA 3R6LB 3D6FB 3PCOB 4AUKA 3TAQA 3GV8B 5IM0B 3FEDA 2O4HA 1WG1A 2ACMA 4OIWA 3FSXA 1CEZA 1TL3B 1WG5A 2BOPA 3VQTA 2DCLA 2OTLS 4IRCA 1SIZA 5A0YB 2CKWA 4FWUA 3TT2A 4GXHA 2P9CA 2YKNB 4R9MA 1JLEB 2XMVA 1HWKA 2F9DA 3KLIA 1S7KA 2OU2A 2FY1A 2VQYA 4NI2A 3UNGC 1QVFR 3DKDA 3VTIA 2HEKA 2M7SA 3W2WB 4ZPWR 1S9EA 2KVIA 2WOMA 2VIHA 2W2PP 1RAEB 3OL8A 4IRDA 2HRYA 2KVQE 2DH9A 4RUAA 2YNIA 3P49B 5D4LA 2NXNA 4F9VA 1DTDA 4W4MA 2J8AA 4WYWA 1FO1A 2REFA 4LF7J 5ETTA 2WSCC 1RDRA 2NSMA 2JEIA 1RWUA 1RT7A 4FYXB 3B3CA 2J0XA 2V4JB 3MGJA 3VV2B 3FNNA 3W5XA 1QY7A 2ASYA 1PBUA 3CCTA 1IKYB 4UF4A 3QT5A 1ON0A 3AJDA 2XCPA 4YP3A 4DS4A 1TF8A 4C8OA 3EFAA 1S1XB 2IAJA 1BC6A 4DR4J 1RUSA 4N56A 2WOMB 1UWAA 2D7SA 1FCAA 4ZP9A 3CWJA 3R96A 1OO0B 1GMWD 4CT9A 2HWIA 4CWBA 2IIHA 2XMKA 3EVOA 5DGAA 3X3UA 2PC6A 3MM5B 4J9RA 4ED1A 4WIQA 3D7SB 4B3RJ 4X62F 1IVZA 1Y7PA 5I4MA 1B64A 1YKWA 2Y3YA 4OV1A 2JBJA 5K8PA 5IC6B 5HI7A 4LBPA 1GQEA 1XC9A 1HHTP 1NB2A 1RAIB 1HR0F 3GWCA 5HMXA 4ZY1A 1T9YA 4KFBB 4XPEA 4MFZA 1X9SA 1VJQA 3J7ZT 4FD6A 3GFYA 2EKYA 3BQ0A 3DNCA 3OR2B 2CQHA 1RT4A 2BANB 1TK0A 2RILA 5IB9A 3ILOA 4C7IA 1SJRA 4KSAA 1HNWF 5F8LA 2ZH6A 1RHQB 2CAJA 4DQQA 3CPXA 1VHSA 3PO4A 3DXSX 2BE9B 4LF8J 3H4QA 4B10A 1D9DA 4XPCA 3NEKA 1Z4EA 1Q53A 1UJ5A 3HCXA 1B70B 1EQ0A 2JEVA 5KFYA 4ZVOB 3KLFB 3W64A 2DYAA 4M5MA 2B9EA 4CYUA 2ZBRA 3C66A 3QSYB 2ZBIA 2P6FA 5LSLA 5G20A 4N47A 4I69A 3MCNA 4DFPA 2ZENA 5CYQB 2FHJD 4PWWA 3GJQB 4NFRA 2JLEA 3NNCA 5DG8A 4KTQA 2OD4A 3KLEA 4ED3A 1RTDB 1VKCA 4X4QA 4AT1B 2KFYA 2ZOGA 3WBZA 2VONA 3L95X 4A94A 2AW0A 5C42B 3H7HB 4KC5A 4ICLB 2EC0A 1NH7A 5KT3A 1H38A 5GMDA 3N9UC 1WHVA 4OZ0A 1OBRA 2HFZA 3NWGA 5AJ3F 3PKYA 4NMXA 3LUYA 4IDKA 3MR3A 4RLEA 2VC1A 5C24A 1TKZA 1NK9A 4NGRA 3CCSS 3CJ3A 2PMHA 3P45B 1GXUA 2N82B 2BCOA 2R2SA 4AVBA 3W9IA 3OJUA 3T5KA 3ZTRA 2MKIA 2XNRA 3T9YA 2MQPA 1FFSB 3OUYA 3H5XA 5ETSA 5E41A 3GY9A 4DJLA 4K8RA 4KR0B 3OW2R 1M4GA 3PO5A 4ATNA 3AHPA 3LACA 1VQ6S 4MCRA 5HP1B 4KHPF 4O3PA 3RAXA 3FRMA 4X8IA 4XK8C 2XY6A 4QWAA 1KRPA 4Q5VA 5DRKA 4RWXA 4NLPA 2DNZA 4FD4A 2CQCA 2YX7A 2POKA 4ZJLA 1LW2B 1XN9A 4OX8A 3GV5B 5KFTA 4F4XA 4GMKA 2I1RA 5F41A 2HC9A 4IDKB 4DUZJ 4OIXA 1HBOA 3EO4A 2GHWA 1X10A 4NEZA 4DSKA 1UJ6A 1DJ0A 1LW2A 1V3SA 1B99A 2JBKA 3D7HA 3THPA 4X65J 4C2XA 4UEFA 5ETOA 4ZPBA 1FE0A 4NGQA 3W61A 2KN4A 3V4MA 1DQ9A 4ES2A 4ZS6A 4V1Ak 1BD6A 4A33A 1NPKA 4KORA 4GM5A 1YK9A 4WF9Q 4L73A 2XBPA 2AT1B 5LJ3Y 3QRRA 1VC0A 5KG2A 1Z2ZA 4F8ZA 5J1PA 1N71A 2YVSA 4F4ZA 2XWYA 2H5MA 2C6PA 1HWLA 2V2VA 4A39A 3MAQA 1RT6B 2F5IA 5F3ZA 3OWCA 4UZCA 2NXUA 4MK9A 1PYTB 1XRYA 4PK3A 1ZM3A 1LQ9A 1CC8A 2D69A 3Q24A 3EX7B 3IMQJ 1S9FA 1Q16B 2HZVA 3JYTB 4UQTA 2PJ6A 2OP5A 1TP7A 1KQKA 4OZ5A 1EKRA 1U1KA 4GS4A 1JLEA 2FIWA 1LEOA 2DVIA 5KT4A 2HAIA 1S0VA 4JYAF 2HQIA 4CAXA 4PG7A 2DEIA 2XGQA 3EUNA 1D8YA 3E01A 1CX8A 4WIIA 5DQHA 1MNEA 1QQ9A 2PVVA 3NE7A 5LM7E 3G82B 3A1YG 2I2YA 5AT1B 3GIUA 4DUKA 1RWKB 1B6BA 2PVWA 3K9TA 1S7LA 3EXNA 3HVAA 4DPUA 2Q6CA 2NSCA 3IS9A 2P0WA 2YWKA 2QLJB 1C0UA 3MM9A 4QQBA 4K4TA 5D3GB 4JYAJ 5JGFA 4F02A 2GAGC 1RZMA 2PI5A 2HG4A 2JX2A 2OTJS 4YUDA 1UA1A 1WC1A 3M4XA 3M6XA 2DRBA 3BR8A 1UMJA 3FH4A 4OZ3A 4IG0B 3CC2S 4DV4J 1DBDA 1T05A 5GMEA 1BPNA 2UXDF 2Q7SA 4WPAA 2OELA 2RFHA 2EFOA 4HNXB 2OFGX 4OJGA 2DGUA 3LP1B 1UETA 2XZWA 1T05B 2QV6A 4IO1A 4WBFA 4IO9Q 3MN8A 3H4BA 3AXMA 2XI2A 2ANPA 3CCQS 5KFFA 4AG7A 4I6YA 2PT0A 5J1QA 1OJ4A 3MAHA 5KTQA 1CQNA 1R3NA 2NZCA 2ZZMA 2ZW6A 4CPAA 4P73A 3PW7A 1Q2CA 1TL3A 3OTDA 4A47A 5A6PA 4A95A 1IXKA 2IMOA 3VAMA 4WE1B 5CHCB 4Q0BB 1VQYA 1F5BA 4A32A 1VR6A 4Y2CA 2ZEJA 4UTGA 1AZSA 3CO0P 2BE2A 4L76A 1C4CA 4OI2A 4YS2A 1S4EA 1FTRA 4CT8A 3CJSA 2BEIA 2QJ8A 2Y1IA 1NNDA 2M0GB 2VF3A 4QYRA 2HVDA 2A1BA 2DNPA 5LL6d 1SJFA 1WWHA 2WSEC 2FB0A 2BM0A 4MAKA 3V5RA 2CJ9A 2DGXA 1U0HA 4QWEA 2QLXA 5KFXA 5E96A 3M1VB 5JQ4A 3U1MA 2LEPA 1U2FA 1HQUB 4LF4F 3M6UA 3EZ5A 1L3TA 1UZDA 1BQXA 1HI0P 3FEXB 1XMOF 1R0AB 3IP0A 4CYQA 4ZMMA 2JZ5A 2P2CB 1CG2A 1MJAA 2HS3A 1YIJS 1U45A 2JFDA 4LF1A 3EGVA 1FVSA 2HNDB 4ZPDA 5C42A 3NAHA 4IOCQ 5HMWA 3NCRA 4H4MB 4C9DA 3HHDA 2DPIA 3OTCA 3FBFA 3U27A 3KTQA 3EDRB 3OVSA 3UN5A 5C82A 2PIIA 1IM4A 4C98A 4DZDA 4P7TA 4DV0F 1HNXJ 4WFZA 1XOVA 4B6ZA 4OLLA 2HFUA 3SMZA 4F04B 2BJ7A 1FEHA 2APOA 2VA3A 2ACYA 2B4UA 1PU9A 4RNHA 3FBBA 4RKUC 2UUTA 5KT7A 4R5PA 3OUYB 2YNCC 5GADI 3M7VA 3Q83A 4UFWA 1F2GA 4Q45A 2Q4VA 3DLKB 3HHLA 6FD1A 1QSTA 1RADB 4DPWA 2IC3A 1M5VC 4AFFA 2FJBB 1S0NA 1RBAA 4KFBA 2WBMA 3SXNA 2BKOA 1RWPB 2QTWA 1JLQA 2H3EB 3OT9A 1KN6A 1YGHA 1YJWS 4F2RA 4C2YA 3A3OB 4KHPJ 5A6WA 4DL5A 2GC8A 2YKMA 3QFWA 2AJ4A 4QC6A 1CULB 2ZH4A 2V50A 1MSWD 2ZPAA 2MB0B 1RBLA 2XCAA 1RHJB 1KTQA 1DRZA 4TN2A 2PQ8A 4Q44A 2MKKA 4B08A 2R4FA 2NYHA 1CULA 5AG5A 2RU3A 2QFJA 2Q0YA 2CQ4A 4AL7A 4M95A 1I1DA 2NUUG 3AXKA 3GJRB 4JI0J 2VG7A 3CD6S 2AF6A 4QR1A 1SCJB 4ZLNA 4YB1P 3BREA 2DPSA 2CPDA 3U02A 4QVTA 2J7KA 4IUSA 3EXCX 1S1WB 4P4BA 1JJ2R 2XS7A 1NSPA 2HNYB 2VPZB 3N6MA 3G87A 1TL1A 2KZMA 4EO6A 1C2PA 1UVKA 3HSJA 4HH1A 3KLHA 2FZKB 1A9NB 4ONWA 3PZPA 2LLZA 4NXNF 1A2ZA 5CNPA 2BVZA 3TUZC 4ECQA 2QA2A 1HL6A 1N88A 3FDSA 4EMEA 4QU6A 4YB5A 2O66A 3KUEA 4NEYA 3MOZA 4YR2A 1LWCA 3MCOA 3FC9A 3J81Y 5F09A 2G13A 4OYBA 4EI2A 2KM8C 4PXCA 1UEUA 3LWLA 3M9OB 4E2AA 4ANDA 1N5VA 1XK8A 4W98A 4U8YA 3BO2A 1VC6A 3F0AA 1ZLIA 3CCWA 2MJUA 2BKPA 4Z65A 3MUTP 2OMLA 2KXHA 1BHNA 3F73A 4CLKA 2BJ8A 2VD3A 3LO3A 2Y0MA 2AJ6A 1K0TA 3M2VB 5D3GA 4C6AA 3PM9A 4Y2MA 3KASA 3DMJA 1HDQA 4FVCA 5E5NA 3PHTA 4C7HA 4DV7J 4A8WA 4YN3B 3ENQA 2CZ4A 3DGPB 4A8XA 3KLHB 3KMSA 1N54B 1X0FA 1CQMA 4DPOA 3RTVA 1KFDA 2Z2ZA 5JVGQ 1IKWB 4CRJA 4LSNA 2CPEA 4ECWA 3FZBA 4UIBA 2DKOB 1UL3A 2RQKA 2H51B 4FPIA 5KFRA 5GAGI 1K47A 4WTOB 3K5PA 3ZC4A 3ZFVA 5D15A 3QFHA 3BI1A 2AZ3A 3PW4A 1RA6A 3RRKA 5HK4A 2YNIB 4X4RA 4HEA9 4DPXA 4WTYA 3CJ5A 3G2XA 2YH0A 1IBLJ 3HHEA 1TKFA 1I1GA 4LFBF 5DDQC 2ZNYA 2L48A 2LXUA 4K30A 2UXBF 4QCLA 3H8EA 4YHHF 2WONB 2F7VA 5BYSA 3VQSA 3WC5A 4XTTA 5I3PA 3B7IA 3E2EA 2AQ4A 3C6UA 4ENOA 4QBUA 4I7FB 3EICA 2XMTA 3IIBA 2NMTA 2DNRA 4W92B 3RBUA 4ZVGA 3ZTPA 1SQGA 4MIAA 2IA0A 1QSNA 4MFJA 3PIPQ 3WX4A 3IXQA 2FZGB 1WF0A 3LP2B 2V2ZA 4LSZB 3PRDA 3TR5A 5EN1A 3MUVP 3D6HB 4DR2J 1U6BA 1NJIT 5LMNF 3D1OA 3DRSB 3IFEA 2DPJA 1PILA 2Y1JA 1S10A 1FXDA 4GC7A 2HLTA 1WD6A 3DRXA 2DGSA 4DPTA 2PIZA 2H1YA 1JKHB 3HJFA 1YHQS 2YNGB 3FKBA 3RR7A 5LSOA 2CJAA 3KMQA 4FD5A 2L9WA 2DH7A 3BQ2A 1QSSA 1C1BB 2BW7A 4D3HA 2CG8A 2A0FB 2XEXA 4O0NA 5KFSA 3A8KA 1IKVA 1OYDA 1TFYA 1B87A 3UNYA 3JS9A 3TEHB 1SJ4P 4X5KA 2ZEMA 1C1BA 4B11A 4B9SA 4P7VA 3B78A 5T14A 5DZ6A