1NSAA

Three-dimensional structure of porcine procarboxypeptidase b: a structural basis of its inactivity
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
395
structure length
395
Chain Sequence
FEGEKVFRVNVEDENDISELHELASTRQIDFWKPDSVTQIKPHSTVDFRVKAEDILAVEDFLEQNELQYEVLINNLRSVLEAQFDSVSRTTGHSYEKYNNWETIEAWTEQVTSKNPDLISRSAIGTTFDGDNIYLLKVGKPGSNKPAIFMDCGFHAREWISQAFCQWFVRDAVRTYGYEAHMTEFLDNLDFYVLPVLNIDGYIYTWTKNRMWRKTRSTNAGSSCTGTDPNRNFNAGWCTVGASVNPCNETYCGSAAESEKETKALADFIRNNLSSIKAYLTIHSYSQMILYPYSYDYKLPENDAELNSLAKGAVKELASLYGTSYSYGPGSTTIYPAAGGSDDWAYNQGIKYSFTFELRDKGRFGFVLPESQIQATCQETMLAVKYVTNYTLEHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine protease
molecule keywords PROCARBOXYPEPTIDASE B
publication title Three-dimensional structure of porcine procarboxypeptidase B: a structural basis of its inactivity.
pubmed rcsb
total genus 143
structure length 395
sequence length 395
ec nomenclature ec 3.4.17.2: Carboxypeptidase B.
pdb deposition date 1997-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
A PF02244 Propep_M14 Carboxypeptidase activation peptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.340 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Metallocarboxypeptidase-like 1nsaA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1nsaA02
2Q4ZA 4P44A 1ARMA 3KHZA 5ELYA 1HEEA 3SI1A 4BD9A 4P45A 4W9YA 3KL9A 1EE3P 1YW6A 5J1QA 2POKA 4P4FA 4X2TA 2XEFA 4IK2A 3KHXA 4PPZA 1DE4C 2ZEDA 4FBEA 1UWYA 3PBEA 4OIWA 2BCOA 1YLOA 3WC5A 3BXMA 4OC2A 2PCUA 1GYTA 4ONWA 3DLJA 5JM6A 1JQGA 4EMEA 4WJBA 3VARA 5LYDA 4MCPA 2GLFA 3D4UA 2C6CA 1ZG9A 2DEAA 2AFOA 5HVHA 4EWTA 2PE3A 1ELMP 1Y0RA 2EK9A 4X8IA 1F2PA 3IFEA 4JZ0A 1VHOA 2OR4A 2ZEOA 4MHPA 4PQAA 4MXUA 3HLPA 4FUUA 2CIJA 4KSIA 2V8VA 2V77A 1ARLA 1QMUA 4H2KA 1VGYA 2PJ5A 2RB7A 3B3SA 1CP6A 2ZOFA 2PJ0A 4UEEA 1LOKA 4TNUA 1CPXA 1LANA 4P4DA 4MHYA 2BOAA 1CBXA 3FMCA 3VATA 4ZYQA 1ZG8A 2PIYA 3PB8X 3SI2A 4NJRA 5JH9A 3ISZA 4R7MA 1PCAA 2C1CA 4NGSA 4DYOA 5JGFA 2GLJA 1PYTB 3GLJA 3CPAA 4F9UA 2RFHA 3WC6A 4R6TA 2AFSA 3D7FA 5I4MA 3D67A 2O53A 1CX8A 2PIZA 1CG2A 2JBJA 3K9TA 5HVGA 1HDUA 1ZLIA 1TKJA 2NYQA 5CPAA 3IC1A 4NGMA 3D7GA 4PXEA 4RUHA 2PVVA 1FNOA 4NJQA 4O23A 2QYVA 2HC9A 1VHEA 2PJ3A 3PEIA 2F7VA 2ZEEA 2J9AA 4UEFA 2PJ6A 2IQ6A 3MRUA 1KWMA 1F57A 1XFOA 8CPAA 4MHZA 1TKHA 2I3CA 1TKFA 3V38A 5LRGA 1XRYA 3KGQA 3FJUA 1XJOA 3SJEA 2AFWA 1HDQA 2AFUA 3H8EA 1O6XA 2V8HA 3IWWA 4OP4A 2ZEPA 4A37A 5K8OA 1ZLHA 3D7DA 1AYEA 2PJ7A 1PYTA 2CF4A 1DTDA 3BI1A 4EFDA 1ELLP 3H8GA 5THWA 2PJ9A 3PFEA 4R76A 1FT7A 1XMBA 4F8ZA 1LFWA 4P4BA 3GB0A 4P4EA 2PJ2A 3N5FA 1VJQA 2QJ8A 2BO9A 3LWUA 4GM5A 1VIXA 4UIAA 3NH5A 3PB7X 1BLLE 3CDXA 2CTCA 2JBKA 1Z2LA 3FX6A 3KR5A 3WT4A 3VH9A 2QVPA 4ZX9A 4G1PA 1LAMA 3FEEA 4PXCA 1BPMA 1Y0YA 2ZOGA 2G9DA 5F09A 2IMOA 3PBBA 1CPSA 3PFOA 1IGBA 5LYIA 2OOTA 4P6YA 5LRKA 5D8NA 3S9LA 2XEGA 4UIBA 4MHNA 3BHXA 4FAIA 4OMEA 2ZEGA 3KQZA 1R3NA 3GUXA 4OC0A 3D68A 3B7IA 3PB4X 4OC4A 1CP7A 3RAMA 3WABA 3D7HA 3PB6X 2F8HA 3RZAA 4ZI6A 3FECA 1OBRA 2PJAA 3KASA 2O4HA 4P4IA 4ZX8A 1XBUA 1NSAA 2FVGA 3NFZA 2PJ4A 3PB9X 1YW4A 4B6ZA 5IB9A 4CPAA 4NFRA 3KR4A 2ANPA 4MRIA 3H8FA 1TF8A 2CTBA 4A39A 3SJGA 2EK8A 3PRTA 2HB6A 5LYFA 2PJCA 2PJ1A 2GU2A 2V8DA 4OC1A 3D66A 2JEWA 3SJFA 3B3TA 5K8NA 3RBUA 2Q43A 4WWVA 3DGVA 2VL1A 4F9VA 3B2YA 3IO1A 3NH8A 3KI9A 2PJBA 3QNVA 1F2OA 2PVWA 2ZELA 3NA6A 3FF3A 2ZEFA 2WZNA 4PXBA 2C6PA 2PJ8A 4PXDA 3L2NA 4AXVA 2NSMA 5HVFA 3WC7A 1PBAA 1BAVA 5LRJA 1R43A 4Z65A 4OC5A 3JRUA 4NGPA 5D29A 4TWEA 3K2KA 4NGTA 1IY7A 4IAVA 2WYRA 4NGQA 3S9NA 1TF9A 2C6GA 2ZENA 4NGNA 3ISXA 4ZY0A 3FH4A 4ZY1A 3IJ3A 1LCPA 1QQ9A 3LMSA 1Q7LA 2XEJA 4MCRA 4Q7AA 1ZG7A 4FWUA 2EWBA 4K3NA 4OKOA 4LQGA 4DJLA 5LYLA 5K8MA 3B3VA 1TXRA 1RTQA 4UEZA 4JYWA 2GJFA 1Y7EA 4MCQA 2ZEHA 1LAPA 3V7ZA 3FEDA 7CPAA 3SI0A 1Z8LA 1H8LA 4UF4A 2Q51A 4ZY2A 4IHMA 3I1UA 3T8WA 4P4JA 5CBMA 4X3RA 4A38A 4MMOA 1YMEA 5DS0A 1AMPA 5K8PA 3B3CA 3B35A 2IJZA 3B3WA 2ABZA 3CPXA 4A94A 4P10A 3TX8A 2AFXA 3IIBA 3MN8A 1YSJA 4MCSA 1Z5RA 4OC3A 3NH4A 4NGRA 4YWYA 1BPNA 2XEIA 1M4LA 2AFMA 6CPAA 3IEHA 3HUVA 3BI0A 4R8FA 2PRQA 3TC8A 4YU9A 2AFZA 3CT9A 2V8GA 3FVLA 3SJXA 2GREA 5HXDA 3KZWA 4OIDA 2ZEMA 3KQXA 3S9MA 4DUKA
chains in the Genus database with same CATH superfamily
1XE4A 3FRMA 1N5YA 2IAJA 3K2YA 1QM9A 4P52A 4P44A 3Q22A 1HEEA 1YR0A 1NEEA 3U1MA 1WWHA 1EE3P 3KLEB 3K0JA 2HS4A 5EBVA 3KHHA 4A32A 4AQYF 4IUFA 3FCHA 2OMOA 2XMUA 2FXFA 2ZOMA 4YDDB 4WFZA 2OH1A 1IBCB 3AAWB 3E2EA 4NMXA 1S7NA 1HNIB 1Y10A 4C2MA 2HQYA 4CDIA 3GG0A 2HRTA 4FXDA 4LF4J 4C7HA 2BRLA 2MB0B 4XPDC 1J27A 1PUAA 2ZW6A 1RACB 2ROEA 2HQ3A 5HVHA 1RWPB 4B17A 4X8IA 2VQYA 3IFEA 5KFRA 4WFNQ 4Q2LA 4K4VA 4C0HA 3AOCA 4MAKA 2EC0A 5DZ6A 1U2FA 5FIIA 2UUTA 1TKXA 5E3QA 1VGYA 4GKJJ 3PP9A 1SB6A 2AJ6A 5HN0A 4N41A 1FDAA 2V2KA 4LX9A 2WZ1A 4LRBA 1IJFB 1LANA 2E5JA 4DPUA 3FEXB 1CBXA 1B70B 2E1RA 1L3KA 3PX4A 3KKWA 1IYLA 3SYZA 1VQNS 2HFSA 3NMRA 5JH9A 2VEZA 3MFIA 1Q8LA 4FD6A 5CZVA 2HFUA 4PG6A 2F3JA 2YNIA 3K59A 1HI0P 1NK8A 1IKVA 1NK6A 2OGUA 1OSCA 5FLXY 5IT4A 2CJKA 3B4MA 4NGMA 4QQBA 4XPEA 4CYPA 3LP1A 2NSBA 1FNOA 3ZC4A 2RQMA 1SKRA 4ES1A 1Q78A 5KT4A 2N3LA 4DL6A 1SQEA 5JUMA 3MAQA 4YGOA 4OJ3A 2WOMA 8CPAA 4MHZA 3FJUA 2DTJA 3D0IE 4JI0F 4LBPA 1N5QA 1YRUA 1YHQS 2Q3PA 1N6QB 4P7VA 2QRRA 1G2EA 2V8PA 4AE5A 3NOGA 2C3PA 4FVMA 3FEYB 4GVLA 4YP3A 4NEZA 2ABYA 4A8KA 4IQXA 4P4EA 3DOMB 3CC7S 4Y49C 4ZA1A 1Q79A 3PEJA 3QRRA 4DUYF 4GM5A 1WTBA 4ECYA 3MCSA 4DWIA 2OZHA 1VDHA 1J2VA 1S9EA 1BUXA 4ANEA 1GTEA 5E7OB 4PWDA 1RAFB 3FQLA 3BPDA 3PFOA 2HW3A 2RT3A 2E5LJ 5F49A 1NPPA 1UVKA 4E2FB 5M2UA 3CD6S 5F47A 4CGNA 3C6TA 4RW9B 5RUBA 4F36A 4MHNA 3MM6B 2YWGA 1C1CA 3DLHA 1Z8XA 2IBKA 2H3EB 4DFMA 2HNYB 2Z58B 2JLGA 4ALZA 2YNGA 3NGRA 2EXUA 2NCKL 3QB8A 3NGUA 1RU1A 2OPSB 4USKA 2DBBA 3LP0B 4H4MB 2KFZA 2P6GA 3FECA 2YXLA 2IM0A 4EU0A 4CRYB 4QIWD 2HWTA 2DNLA 5HMXA 4UOFA 1IBLF 3EFAA 4C0BA 3MUVP 2MKJA 3J80Y 3AD9C 3GMGA 2BZ2A 1TF8A 2JZ5A 3KLIA 1EKSA 2Z0ZA 3SI8A 1Y5IB 1EARA 2EI5A 2Y1JA 4F9VA 1Q7LB 1R0BG 5ADZA 4LFCJ 3QFWA 5GMDA 3EGVA 3TW0A 1E6YB 5FVJA 4C8MA 2UVRA 2IL4A 1FNMA 4FYWB 4PXDA 5KFEA 2WRMA 3WC7A 1BAVA 2PRBA 1CJKB 4OJ1A 4OC5A 4DNCA 1S6OA 2WCXA 4KOSA 3AY0A 1S3ZA 2DJWA 4B3TF 4DV1F 1JJHA 5HK4A 3UDCA 2JEFA 3UD3P 3U27A 5B0DA 5EWEA 4CM0A 3N79A 3TO9A 1WC1A 5K14B 3CCJS 1DQ8A 3JVNA 1VMBA 4X84A 4MFPA 2ZWOA 4QJVA 5LYLA 2HGNA 3DOLB 4YFUA 1H2VZ 1DLOB 2G0IA 5G4DA 2RKIB 3UCGA 1S7HA 4CLTA 1VIOA 4PK3A 1PSDA 4UF4A 5L9NA 2VG6A 2ZITA 3TJ9A 3CDBA 4MFBA 1TELA 5KFBA 2HVHA 3MN8A 2VQFF 4M8LA 1S1TB 3W63A 4HNYB 2AGOA 2BM1A 2GQ2A 1WC3A 5BYRA 2ZHBA 4R8FA 4YU9A 4WE1B 2KHDA 3U1NA 3R95A 1HNVB 3S6FA 2MQ8A 1N48A 3SFGA 3GV5B 4Y28C 4FZVA 1Y3KA 4I2QB 1RWNB 4BD9A 1UWAA 3OL8A 2ZZMA 4W9YA 2ZUAA 2PSWA 3SSRA 3IR7B 4KKOB 2C2RA 1S1UB 2QEXS 1DTQA 1NNDA 2ZEDA 4KHMA 2L48A 3JQJA 5G0RA 2UU9F 1VQOS 5CQGA 2EK6A 3OD2A 2JDDA 4DDFA 1C4CA 5L38A 2J6SA 4OLPA 4ONWA 4XPLA 2CPZA 3G8SA 1NZ8A 3TWZA 3BM7A 2HIYA 4RN7A 4P71A 2ZPAA 3VARA 5D6GA 3I56S 1ZG9A 4TQRA 3HP6A 2PFDA 4GC6A 1SV5B 3BEGB 3KLEA 1F1BB 1Q8IA 1QVGR 3CE8A 4MHPA 3TEGA 2DO4A 3VAHA 4FUUA 4CO2A 3ZZPA 5C24B 3F56A 1RTHB 1WSRA 3BJYA 1YBAA 2J8AA 4M5KA 4JI6J 5A76A 1HNIA 2W25A 3D6FB 3MGDA 3HJVA 4FKXA 1AFJA 3FZ2A 3FIXA 3EZOA 2LLZA 2W2OP 5GAHU 1Y9WA 5DG9A 2AGQA 4ZP8A 5E96A 4X62F 3FNCA 2IJFA 3SXOA 1U0HB 3ISZA 4R7MA 4F2RA 2PC6A 4QYZK 2DK2A 2CQCA 4YUDA 1W25A 2DISA 3PRDA 2FTRA 1YBUA 1GAOA 1ZAVA 4QYZJ 4AL7A 1UVIA 3D4JA 2UV8G 4AD6A 4UW2A 1S5ZA 2ZJQQ 4NJQA 3TA1A 2QYVA 3H59A 1S1XB 2M5YA 4RW8B 1RXOB 2NXEA 2CPFA 4UEFA 1JLQB 2GIFA 2R9LA 4F8RA 5F41A 3TO7A 3PO4A 2R98A 2C2NA 3RBDA 1NK7A 1RA7A 3IWWA 5KTAA 2WONB 2HQCA 4KJIA 3P96A 4DPWA 3HCXA 4K4SA 2F63A 2FHJD 3CDEA 3DNSA 3U7JA 4DV2J 4EK2A 5A6WA 3TOBA 3IGRA 4YR0A 4USUA 2GMLA 2AKWB 3BQ1A 1P8GA 1X5TA 5DDOC 3VVUA 1RTIB 1UPMB 4LR7A 1Z2LA 1DBDA 1XMQF 4DS5A 2AT1B 4ILMA 3BBBA 2C2EA 1I51B 1Y0YA 4MFLA 3HSJA 3PBBA 2QL7B 3CXSA 1N6QA 3PVXA 1HWLA 2HBYB 1I1GA 4H89A 1X0PA 2ADBA 3RB0A 4CGOA 2EG2A 1T9XA 3W7BA 2ZHAA 4J9SA 3RTVA 3OTOJ 3DOMA 2V69A 3OVBA 5KAKA 2DGTA 4KIAA 2BJ8A 3IM9A 2D4OA 1IIDA 4LF7J 4C6AA 4DFKA 2L9NA 2NYIA 1FDNA 1DTTB 1IR0A 3IGVA 2BJ1A 3NCRA 3MUMP 1SH3A 1K9MT 4NX9A 4RNNA 4NLOA 3OXFA 5FLXU 1VQMS 3SFUA 4EVYA 3GFXA 2R7SA 2ROGA 3SJGA 3W9JA 1FFSB 2HB6A 4OYXA 2QA4G 2KT5A 2J9DA 2RU9A 4Q43A 2Z10A 1W26A 1TMMA 3V2UC 4RW9A 2IBOA 3A12A 4KUAA 3MM6A 2L9WA 4ZVRB 2HNYA 3P5TL 3RW6A 3NE7A 4JI8F 2HEKA 3TTHA 4EO8A 2YKQA 2PVWA 2OPSA 3LP0A 3VGVA 4H4MA 3OUYB 1IKXB 3KTQA 3L9ZA 3PEHA 4OZLA 2D4PA 3GIIA 3GR1A 3WQPA 3QGIA 3JRUA 2FGCA 2DH8A 4OZ1A 1IY7A 1MNEA 1MWQA 4LT6A 1L3UA 1CSJA 1TP7A 3WC2A 1VHIA 1RWVB 4ZOSA 4NLVA 2XLIA 2BRKA 1Q7LA 2KHCA 3LTOA 2XEJA 2CNKB 4KHPF 3T1YJ 4ECZA 3GYAA 3M9MB 1H7XA 4CAXA 1UEKA 1FVSA 2I9SA 1S60A 1C2PA 1E6YA 4NMLA 5K8MA 3BH7B 1RTQA 2QGFB 1HNXJ 2KVIA 3KLHB 2MKIA 3UD4P 1AXQA 3GYNA 4FYYB 5D0HA 1N56A 1LAPA 3OQ2A 4USHA 3BF4A 2VBXA 1CJKA 5A8WB 2PMHA 4AFFA 4ED6A 3VQSA 1R8HA 2GS8A 1SH2A 1T9WA 2AJ2A 3HO1A 1YRXA 4G6VB 1Q95G 2IIHA 3FJ2A 5F8HA 1PO6A 2JLEA 4LFAJ 4UFWA 3B8HA 5L9XA 5HQMA 5K14A 1UW9A 3IEHA 1OZPA 1MSWD 2V8GA 3FVLA 1HNZF 4NA3A 1Q0NA 3KZWA 3DOLA 1REVB 1DLOA 2KB2A 2RKIA 2H1YA 2CVIA 3EO4A 4ORFA 2GIRA 4CO5A 2W4CA 1C0UB 2CPJA 1TIQA 3K57A 5KFUA 4K5RA 3SI1A 4IR9A 2XNRA 1VHFA 1VQKS 1B7YB 4I2PB 2VONA 4IK2A 2C3YA 3CIMA 4WTYA 1S1TA 3ZJ0A 3CGIA 3OLAA 4NLWA 1X0FA 4P2FA 1K0VA 4KSEB 2HNDB 2REEA 2J76E 2H54B 5KFIA 3KK2B 1N33F 4WE1A 2AEFA 3OL7A 3OJUA 1VK3A 4QU6A 1HNVA 4WU2A 2UXBF 4EMEA 2VJUA 2OZUA 2APOA 1PU9A 2GLFA 4I2QA 5EWFA 3I55S 3PW2A 2DEAA 3HK2A 4FF2A 4MK9A 2AYMA 2CADA 3R8YA 4KKOA 2OR4A 3EVOA 3ZTPA 1S1UA 3D2PA 2E1CA 4XDDA 2CNTA 2B4VA 2A18A 3TR5A 5D8HB 1RA6A 3K7RA 5BR8J 3CMAS 3EJMA 3AT1B 2QYGA 2YBVA 5IXUA 2H9ZA 2FUG9 3KK1B 3IR5B 2B56A 1YJ7A 3AFGA 1SKUB 2Q4VA 3FSXA 1S5KA 3SI2A 3CNQP 1OIAA 4B3MF 1RJJA 4GMKA 1SV5A 1FRHA 3O6QA 3U1LA 1ZM4A 3D7FA 1CX8A 1YK3A 2W9BB 2DNKA 5C24A 4PXEA 1RTHA 2IDEA 4U67Q 2FJXA 2FD2A 4DR1F 2GQCA 4WZMA 1YITS 5AG4A 4FN5A 4JI5F 1TKHA 3MCNA 5LRGA 1LNQA 2Q4YA 1VQ6S 1RZMA 1O6XA 2HURA 5ETTA 1U0HA 5EDWA 3QNWB 1VJWA 3QJLA 3T6BA 1EKRA 1AYEA 3AODA 3G71S 5J1EB 4DF4A 4Y2MA 4O3PA 2M88A 3T90A 1EZZB 2ZH4A 2DGSA 5HMWA 1YRTA 2PJ2A 1MJBA 3CJTA 4NEXA 2VZZA 3EVWA 1F5BA 3V6HA 1X4GA 3AH6A 1VIXA 5F9LA 1F9EB 3OVSA 1S1XA 4RW8A 4YDXA 3OV7A 3FBEA 4FS1A 1JLQA 1WJ9A 4UUWA 2QLXA 1U6MA 1JLBB 1AB8A 4OI0A 3FEEA 4GKKF 5L1JA 3RBXA 4M95A 1B6BA 2PC1A 2IMOA 3J81Y 1QAXA 1BOBA 4ILRA 4ED7A 2WONA 4YB7A 5F8LA 5DM7Q 3PKYA 3CO0P 2QV6A 3S7RA 1BD6A 2XEGA 4CO0A 1PJ5A 4JV2A 5KT2A 3DDNA 3T19A 2WVFA 4UOHA 3TEHB 2DPJA 2CQHA 4B12A 3M2RA 4A8MP 2UXDJ 1RTIA 3G86A 1DRZA 2Z3NA 2O4HA 1UKUA 5GAGU 5B0AA 1FKAF 4EO6A 1X4BA 3VAKA 3F8KA 3FUYA 4ECVA 2X1FA 1XMTA 1F2GA 2A6OA 4NFRA 4MRIA 4GC7A 3IR6B 4ZN1A 2W8LA 1K47A 2UV8A 3NXZA 3IRWP 3B3TA 2YNHB 3G6ES 2VFSA 2Q43A 5BYSA 3DGVA 1F60B 4R57A 1RT6A 1FCAA 1H74A 1N5TA 2BOPA 4YEAA 3AJ1A 4NXMJ 1WD6A 2QLJB 4R87A 1TKTB 4XNHC 2RIJA 1U6ZA 3QGHA 1SVDA 1DTTA 2E5IA 2FL4A 3QO9B 4H4KA 3HHLC 2K3KA 4OV6A 2QFJA 2FY8A 2CRLA 4KRWA 4M63A 2MZQA 1KR4A 3BO4A 3GFYA 4X65J 2H5EA 1JWQA 4OHXA 3M6XA 3M1VB 4ZJOA 2VASA 2QX0A 5DDRC 2EVNA 2KZMA 2OEKA 3V4IB 3PW4A 4CP5A 1QAYA 3M30B 4K50A 4O3RA 1EETB 3FBCA 1YG0A 3CDUA 4ITSA 2AJQA 2AMCB 5EGYA 4H54A 2AGPA 1BQMB 2OPQB 1TXRA 1JMTA 3OUYA 1IKXA 1GT8A 2IJRA 4ZPCA 4DSLA 2HLUA 4DR6J 5BXIA 5I42B 2PGCA 4Y00A 1OO0B 3MR3A 1QSYA 1U8SA 2Q51A 1HLWA 2BM0A 3T8WA 3MR7A 4OYZA 4DV1J 4N5SA 1B3TA 2MZSA 3RR8A 2BQ3A 1OYDA 3PV8A 3OVAA 4B10A 6CPAA 3LD2A 5DQHA 3PY8A 3R5CA 3P4UB 2D3O1 4DV6J 3V6KA 3BS9A 3TE4A 2GREA 1U1RA 4URSA 3ITHB 4BCAA 3C6UA 5A8WA 1VC6A 5B7WA 1S49A 1GTHA 3KL9A 2OSRA 3OXGA 2WSCC 2GGPA 4I4BA 1VQYA 4ZP7A 1FTRA 3KHXA 3HD2A 4QWCA 2GX8A 3OFFA 5GVQA 2PMZD 1RWUA 1PILA 2CQ3A 1ZM9A 4F2SA 1TR0A 3UN5A 5LSOA 2H4YB 2CIMA 3CMES 5HMNA 3TZYA 1REVA 1REGX 4HL9A 2HHHJ 1JQGA 1S1WB 2RHSB 3QAUA 4WP3A 2D1CA 3NGDA 3LP2A 1C0UA 1MW7A 4IUSA 3P45B 2G3TA 3L95X 4RO0A 1F2PA 2LA4A 2QA2A 1S7KA 4KOTA 4I2PA 3GV8B 4E98A 1UVLA 2OD4A 3ZZYA 1SPBP 3UDVA 2HBQB 2HNDA 2ROPA 3GR0A 3SCKE 4MKVA 4WXOA 3KK2A 3JYTB 3DM2B 3HFZB 4NCBA 5A6PA 4I7FB 2CJ9A 1P0HA 3QZ7A 4CGLA 4UEEA 2R2RA 1CPXA 4P4DA 2BOAA 3KYLA 4DX6A 2Y1LB 1UVMA 4KO0B 2GA7A 2EPIA 4AXJA 2XMWA 2ZDOA 3D8PA 2P9EA 2HQGA 3HKZD 1WKJA 1KZFA 1ICEB 2LA6A 1DQ9A 3GCXP 4RR5A 3D3BJ 2NXNA 2GW8A 4A8WA 3LAKA 5ETLA 1DFDA 5F9NA 3BREA 3UNYA 5CA5A 4PSWA 1VBKA 3QATA 2H4WB 1XFOA 5IV0A 4PZVA 4DSEA 4IG0B 2L41A 5DG8A 4IH7A 1HDQA 1SJFA 5DWNA 4LRCA 4B3RF 4I6WA 3Q24A 1L3SA 2AHOB 2OEMA 4M5IA 3D28A 4XPDB 1VLOA 5ETVA 3PFEA 2W9BA 3NAIA 4I6AA 1NDLA 1U24A 2HMIB 2I0XA 3ENAA 3HVRA 3W61A 1KOHA 2RD5C 2AJ0A 3CTRA 3FXTA 4JI7J 3WT4A 3ICLA 2E9ZA 1R7IA 1KFSA 5CD4A 2IC3B 1KVKA 1IGBA 4ID8A 4OL8A 4WCEQ 4HHJA 1J5EF 3KDOA 3OR2B 2KT2A 4ZPAA 2QECA 3GTYX 4C8ZA 4UIBA 5J1EA 2DRBA 5IV4A 5L8RC 4U8YA 3QT7A 2M4MA 3WABA 2JVOA 2Z4PA 2YKNB 1VQLS 3R6LB 9RUBA 3CULA 1VRQC 1RLCL 2PE8A 2J0QD 3GE9A 3ZZTA 3KASA 1F9HA 1HHTP 2CPEA 4E8OA 2VFUA 3HHLD 1JLBA 2MTLA 3MR2A 2UVVA 4CPAA 2R7RA 3PRVA 2XC9A 3UQSA 1KUXA 1HWKA 1L5UA 2VI7A 3ULHA 4CYUB 3BKTA 3DXBA 1N36J 2JX2A 3TCVA 2BE2B 3DRXA 4ED8A 1Q82T 3M6WA 4KLWA 1M1HA 3SSSA 4CLLA 4DFJA 2BMBA 4QWBA 3M8SA 4P2SA 1N32F 4F7VA 4YRHA 3L2NA 4C68A 3WX4A 4C8YA 2CQPA 3KFWX 3LOUA 2ZJRQ 3TO8A 1NB2A 5AG5A 3T9ZA 4Y49B 3S6GA 3MTKA 1RQ0A 3CCZA 3TZZA 2KFYA 3ISXA 4RNMA 5DO2A 5I3PA 1WOPA 2YNHA 4CLWA 5KFNA 4WIIA 2HQIA 4HKQA 2OHDA 2UZAA 1HWUA 4IOAQ 3K58A 1RAGB 1KTVA 2YX4A 2CQ4A 1UFKA 3HF5A 4KOXA 1VQPS 2M7SA 4HLBA 1TKTA 1KC8T 3HMJG 3QO9A 1N4LA 2JOQA 4ZP9A 2ZEHA 1SJQA 3UCUP 4ELVA 2RRBA 2BSWA 2LKZA 4DL2A 3FC9A 1P6TA 1D9AA 4DR2J 4EFAC 4MMOA 2QG9B 4PSXA 2AYGA 4OJHA 2DR9A 5M2PA 4USIA 2G2ZA 3IAS9 2I00A 3V4IA 3LODA 3W66A 2BYCA 2PI5A 1EETA 4DV0F 4IKAA 3QWUA 4IDKB 1BQMA 2OPQA 1JJCB 3FVYA 4F26A 4NLRA 5CAAA 1F3FA 5I42A 5JJBA 4CAVA 2OZGA 1U02A 2WBRA 5EWGA 3NNAA 4WU3A 4HDHA 2C28A 3DRRB 3E0KA 2RQCA 4UCMA 4AG7A 5IFMA 3HM9A 5I3QA 3T5KA 2K3IA 3NG8A 3EZ5A 5KOWA 1LXNA 2G1DA 4M94A 4PWUA 1G7CB 2HZVA 5IZHA 3WC5A 3G96A 2VOPA 2HBZB 3GG1A 2J9EA 3I4HX 3ITHA 3NWRA 4MK8A 3Q2TC 2AQ4A 2P6EA 4C4WA 2CJYB 3DR6A 1EIYB 4TLQA 2ZH7A 3ISNC 1VHOA 1NM2A 3FZBA 2ZEOA 1LWFB 2M3DA 1S6QB 4KVOE 1QMUA 1B0TA 5ETRA 3IBCB 4HYKA 4IFYB 2R7VA 2HK3A 2ZFHA 1D8ZA 3ZZZA 4BLGA 1UZDA 5B0GA 7AT1B 1S1WA 4HT5A 1KBRA 1UJ4A 5IWAJ 2UXBJ 2PIYA 1WOSA 4DR5J 4ONUA 3PTWA 3PIOQ 1Z8TA 4LRFA 3T5JA 2HVZA 4ZLLA 3GQCA 4V19J 2AYEA 3D2WA 2JBJA 4J9UE 5LM7E 5KTCA 2BKPA 3VF0B 1SH0A 2PJ3A 2L9DA 3BSAA 1LFPA 3DM2A 3CD5A 3I87A 3HLUA 4I7FA 2HFZA 3V6JA 3BYRA 4KVXA 3LGNA 5GAHI 4USJC 1T7PA 1TKFA 3V38A 3D9BA 1GHEA 4OADA 4A8SA 3P2FA 2DNGA 1M1DA 4X4QA 2AFWA 4KO0A 2RRNA 2PDOA 1U2CA 2F9DA 2ATRA 3EY5A 3I5CA 3CCLS 1RT4B 8ATCB 3BN7A 3K89A 2A10A 2PD1A 3RJMB 4F8ZA 2B4BA 3GSDA 2Z2MA 3C2PA 3DLBA 5B09A 2BO9A 4N8NA 3LWUA 3VALA 1I3OB 3BGRB 3J7YI 1APSA 5HAOA 3IA0A 4ENOA 5HH1A 1JLCB 4W98A 4DR1J 4PEOA 1S0MA 4MI4A 3CCTA 1NKBA 4IG0A 3HXMA 2OO4A 2P9GA 4JI5J 1GXLA 3T9NA 5HBMB 2OOTA 1WHYA 3H5YA 2AD9A 2XNQA 5CNPA 1U1MA 1DQAA 3DFEA 2EBJA 1WDTA 1NBEB 2F40A 4U5YA 2COLA 2B3UA 4B9VA 1RYSA 2MDAA 3PB4X 2N7CA 2RNEA 2HMIA 3H0PA 3CJSA 1NRKA 3RZAA 1R8BA 2MQPA 3MCOA 1KUYA 4ZK7M 1HMVB 5IT9Y 4CNZA 3OJSA 3PB9X 2I79A 1MK4A 1MN7A 1ZZNA 3RYLA 2IC3A 3WIUA 4X4RA 4CO4A 1FT8A 1UMJA 1BQXA 3T9YA 2GU2A 1YLXA 3N28A 3OR2A 4P9SA 4N76A 1UETA 2HYIB 1BY9A 3HHDA 1LWCB 1Q7YT 1BE4A 1ZA2B 2O66A 3BB5A 2MSSA 4B11A 3TZXA 2BJ7A 4DL0C 5IC6B 3UPFA 2R2UA 2YKNA 3S8SA 4F0XA 1F0XA 3QGGA 1UZHA 1RT7B 1RTDB 1YJUA 2OMLA 1HNWJ 2WSEC 4OHWA 1RT1B 3SDEB 1NPRA 2A3JA 4NGPA 4ELTA 5D29A 4G1IA 4NGTA 2NUHA 4A8XA 5CYQB 2C6GA 3QSYB 3GZ7A 4CYUA 4LRDA 2C3UA 5KFQA 5KFYA 3G9CA 2BE2A 2F8EX 2CXEA 1VQ5S 4CLUA 2DGQA 4NASA 4EGLA 1YZ7A 1XIQA 4Y2IA 4OKOA 2ILZA 1N0VC 3NBPB 5GADI 1KLMB 4NLYA 1GMUA 1TL3B 2O5DA 4CGMA 2KCWA 2BKNA 3DLLQ 1WTFA 4AL6A 1WDDA 1TL5A 2X1AA 4LQ6A 2DY9A 1SC4B 2HPUA 1Q16B 3TX8A 3IIBA 1YSJA 1Y4ZB 1G6BA 2Y0SD 1AZSA 3A8KA 3B6BA 4YMEA 2YKPA 2JEGA 4WF9Q 2FHJA 3CJ4A 3EC4A 4UCNA 4JD6A 5HXDA 3DMJB 1R27B 3S9MA 1NCLA 5LXRA 3THTA 2HZAA 5ITHA 2K1RB 3CO9A 1AW0A 5KFDA 1TL7A 4ECSA 1OWXA 1WF0A 5J1QA 1SIZA 4A8YA 1DE4C 2XWYA 2E5LF 1PYSB 4BBHA 1Z1ZA 5AXMA 1QUPA 4OC2A 4IDKA 3D54A 4QWDA 1UJ5A 6FD1A 3R96A 3FFIB 3T3FA 4AG9A 2IHR1 3H42A 3H40A 3LANA 2ZW4A 3MOJB 2IMWP 1VISA 1ULRA 3H98A 3BPSP 1LK7A 1U48A 2HHSA 2BR0A 1URRA 3DRRA 4A8FA 3I0SB 4J9MA 1B64A 4DN0A 5I3UB 2WVCA 1B87A 5KFGA 1OS5A 4WYWA 4USVA 1K8AT 3JSYA 5KOXA 2LQ8A 3R1HA 1NK0A 2MLZA 2PJ5A 2ZVIA 4ZBGA 3P3DA 3TA0A 4KTQA 3R9FA 4RNHA 1JLFB 2FC9A 2A1BA 4LFCF 4F25A 3UN2A 2KDOA 3NGSA 2XI3A 1HIYA 4XK8C 3AXMA 4ZYQA 3R2DJ 4ED5A 1PCAA 4DV4J 3CSKA 2D74B 4DX7A 3IBWA 3PHTA 1PYTB 3ENQA 4QR0A 1V6HA 2DNQA 4ZITA 2VC1A 1CJWA 4DF8A 4CZCA 2VQEF 5KFZA 5F0UA 2B4OA 1LWFA 5EUHA 3K9TA 4DR7F 3ZZUA 2IVMA 4RWWA 3VTIA 1QTNB 1ZAWA 3M8WA 4IFYA 4JI3J 4QB9A 4LSLB 4Q45A 1H2TZ 1X4HA 4MK7A 1NKCA 2XI2A 1R31A 2PJ6A 2V5HG 4LF6J 3G8WA 1KWMA 2X7BA 1DHMA 2ODFA 4ECRA 2GO9A 2UXCJ 2JC0A 2EG1A 3BN4A 1FKPB 1AUSL 3OTBA 1KOOA 3QFHA 5CH7B 2R8VA 2F5IA 1FE4A 4E2AA 2ERRA 1NJWA 2P6FA 1YZ6A 4P4BA 1VJQA 2QJ8A 4ECWA 2EFPA 2CTCA 2XCPA 4J91A 3KR5A 1NSQA 3DNCA 1SC3B 4F0HA 2LEAA 4DN9A 4FF4A 4WKYA 3T5LA 4M5DB 5LRKA 3D3SA 4YY3J 1QJHA 1TQLA 1K73T 4B08A 1RT4A 3HVAA 5IC4B 1TFWA 2YNCC 1VQ9S 3H2UB 3ZNJ1 1R3NA 2CG4A 2VPZB 2J8MA 2K5TA 3PJ9A 3RAMA 4PG8A 2F8HA 3BGRA 3W5ZA 1XIXA 2M9KA 4ZX8A 1ZTTA 1JLCA 4HT7A 1XQIA 2JRSA 2J6UA 4ZVUB 5IB9A 3PJWA 1LV5A 5I0CA 2IJNA 4AL5A 2W9CB 5HBMA 7FD1A 2FVCA 5D4LA 2DNZA 4FBTA 3PW0A 2V8DA 2JNJA 3ENWA 3D7SB 3QT8A 2VODA 4NYPA 2UUWA 2AP6A 2VL1A 3DYAB 3TT2A 2Z8QA 3LH2S 1UJ6A 1FKOB 2ZELA 3QLHB 1GXTA 2PA3A 3C14B 4KY3A 3EPIA 2DPSA 4HNWB 2CNNB 3HSGA 2OUGA 3K17A 3I31A 1HMVA 3THVA 2R7OA 1YGYA 1IUJA 3EDQB 1UFLA 4A47A 1I6JA 2CQGA 2QFIA 3W6XA 2HAIA 4EBCA 4FD7A 4HI2A 4OFZA 2R2TA 2C2ZB 4OZ3A 4RL1A 2HLTA 1F2HA 4MIWA 4OI4A 2QO3A 2LQ5A 4FNIA 3FSIA 4DUTA 1LWCA 2QT7A 2W2QP 4RNFA 3O1LA 1JNRB 3IU2A 2IDLA 3C46A 3H8YA 4AB7A 2HQFA 2DEJA 2C1EB 3I3GA 4FWUA 4H4OB 3L7PA 1Z2ZA 3Q8SB 3CXQA 5CYJA 4C7QA 2VPYB 1N32J 4J9NA 1RT7A 2RQKA 1RTDA 4RX6A 3Q86A 5K9FA 1RT1A 3SDEA 3D3CJ 2YVSA 1QD1A 1S0NA 5L1IA 3H4QA 4F04B 3MGJA 4OYAA 2X1BA 3I1UA 5CYQA 4P4JA 1RTZA 4F3QA 2CDRB 2F4FA 2ABZA 3H5ZA 4A94A 3JSRA 3F73A 2VBYA 5IT9U 4L3KA 1FD2A 3L4BC 1G4CA 4XIUA 1IBKF 3EWGA 3TRGA 4HH0A 4DU7A 5K20B 2O28A 3BI0A 4DV2F 4JLYA 1YLEA 2J8NA 1IB1E 4NZ7A 3NBPA 4CYQA 1NZAA 2JLFA 2B3TB 1Q4RA 1KLMA 1TL3A 3D1OA 3PO5A 3KHZA 1AT1B 2Y0MA 1WHVA 4LREA 3HPOA 4XNHB 4HHUA 2G2YA 3VAFA 4PG7A 2OELA 3S6HA 2YPYA 3QIPB 1QAJA 2O1PA 3HHLB 4P4FA 1FFGB 4FP9A 3ET6B 4CLFA 1S76D 4LR9A 2HFOA 3W3SA 4N77A 4JYAJ 3KOAA 5AGEA 3DLKB 1Q53A 3WZ0A 2HVIA 4DV0J 4RBUA 3TOAA 3DMJA 2QC3A 1PKUA 3A3PB 1V9OA 3CF5Q 3D6HB 4LF7F 4MCPA 4ZCLA 4O44B 2K1RA 2C6CA 3IAM9 2DKOB 2JJ4D 3OWCA 2C2MB 3M2UB 1D09B 1VRTB 4ZVOB 3ZZIA 2MKCA 4I0WA 1BWEA 4ES2A 2MMYA 4PQAA 1YVOA 1CQNA 3US5A 2V77A 1NK9A 3D6TB 4OYMA 4PKDB 2EFNA 4UQTA 3BSCA 1P4NA 3TX0A 2ZBIA 4OX9J 4KOUA 1HL6A 1EAYC 4GO7X 4JJXA 2EBEA 3M9NB 1U1LA 2J0SD 1NDCA 4PYDA 1Q1KA 5JXSA 1HQ2A 4C8KA 2BJDA 2VXKA 4MHYA 3FFIA 3EUNA 3VATA 4ETXA 2KYZA 2XHWA 2FJBB 4NF1A 2NZ4A 3HHNB 4ZS6A 3IWEA 1E6VB 3K8VA 2V2QA 2BX6A 3HD1A 3FYNA 5I3UA 5J2PB 1M90T 2VFTA 4CWBA 2EKNA 2BXJA 4KGXB 1HDUA 2NYHA 4GRSA 3AOBA 4B5OA 4DR3F 1VHEA 5EN1A 1NB7A 4MT1A 1YJRA 4J5OA 3T1YF 1BC6A 4RS2A 1JLFA 3MRUA 1F57A 1N71A 4KBIA 3CCRS 3MEGB 5H9EK 1X9SA 3CPWR 1HW9A 3MHYA 1M4IA 4XAKA 3I9V9 2AFUA 3RRHA 4DL3A 5H9EJ 4MTPA 2Z2LA 3OFHA 1UA1A 4X4OA 1PYTA 2R8HA 1FX4A 3G2XA 2BJ9A 4DI6A 1VC5A 4EFDA 1RI7A 3H8GA 1NO8A 5THWA 4EBDA 1XMBA 3NGTA 3GB0A 3N5FA 1RCXB 1WI8A 2MHNA 1KVIA 3ZZRA 2XZDB 4LFAF 4LSLA 2CDQA 3W9IA 4KE5A 4UOCA 1KUVA 3UY5A 3UD5A 2FJAB 1OMSA 3PYDA 2NSCA 3DRPB 1RB0A 5CXTA 3CJ5A 4OYPA 1WKKA 2RH3A 1ACMB 4C11B 1WF2A 2BVZA 1FKPA 1H98A 4BBYA 1JLEB 1HBOB 3BHXA 1ROFA 3ILLA 1X5PA 1SL0A 4C0OC 1CP7A 1KLNA 4NRTA 4O3QA 4CAWA 3VAMA 1S79A 1CJVA 4C2ZA 4JOUA 1WG5A 2RE1A 1I12A 1OBRA 2G9OA 4EYIB 2ZH1A 4M6GA 2O67A 4MY3A 3KJVB 1M5KC 4FXWA 1FWKA 3H8FA 4KAIA 1IWGA 2N4CA 4M5DA 3F44A 3RU0A 4LJMA 2Y9HA 1HA1A 3MEDB 4CLKA 4DXLA 2ASDA 2QJ3A 2U1AA 2FB0A 1WG4A 1M4GA 3CCMS 1U1KA 2B9WA 2MQMA 3FF3A 3GJQB 1X10A 1R8PA 2X51A 1F5AA 2RS2A 1PBAA 1T3NA 1UFWA 2OD6A 1Y00A 5B0EA 3NE8A 5BR8F 1QTMA 4J9RA 4ZP6A 4PG4A 2W9CA 2CQBA 5LMUJ 3MURP 2VJVA 1D1UA 3BBCA 2DNHA 2DNNA 2V63A 5LJ5Y 1MU2B 3RNZA 4ED3A 3QRQA 1YKWA 3MZIA 5T7LA 5ETPA 3WC0A 4K30A 1P27B 3DYAA 2CNMA 4R0JA 1FRLA 1FKOA 3QLHA 3SXNA 3C14A 2KM8C 4M5LA 1TVRB 2BJ3A 1KKHA 2GJFA 4CYOA 3NWGA 3KDNA 1MWZA 4DU8A 3DLGA 2B9YA 4Z7CA 3BBFA 3KHRA 4ZCIA 3VWEA 1BHNA 2PR8A 4E0AA 3ELHA 4F4KA 2DGVA 2C3OA 1YMEA 2I6WA 1G3OA 3BKUA 4KS9A 4FD5A 3NS5A 4LQ3A 2HRYA 3MFHA 4NYZA 1FK9B 4NGRA 4F02A 2AFMA 3HUVA 2OLWA 4QVTA 2PRQA 3RBZA 4H4OA 1RKJA 2LDIA 2YH1A 2EUIA 4O4GB 3TVZA 3G4SS 2AZ1A 3DOKB 4Y2CA 3B8GA 3D1QA 5LT5A 4UFXA 4M5MA 2WHOA 4JV5J 2VFRA 3F0NA 2E7XA 2IM2A 1Y3JA 2MEWA 1RT3B 1S4FA 4G1QB 1HW8A 3C3LA 2DO0A 1PC4A 3EM1A 2V67A 5KFLA 1T9UA 1YW6A 2POKA 1UVNA 1HBNB 5CZXA 1QSRA 2ASYA 3L7UA 3PJXA 4J3GA 3PBEA 1N52B 2FZGB 2MSTA 2QMWA 3V4MA 2YNEA 3NLCA 3BXMA 4JV0A 4J9VA 5DDPC 1NLKL 3SCLE 1ZOTA 3WDOA 2DGOA 1CLFA 2RAQA 1IICA 2DHXA 2RDIA 2Y3YA 2UXDF 3FKBA 4DQSA 4EWTA 2PE3A 1ELMP 1Y0RA 4IFVB 3QIPA 3HHLA 4IOBA 4WP8A 4MXUA 2BUNA 4MH8A 1ARLA 4B3OB 1RCOB 2I8EA 3DLKA 1BXNA 1N34J 3NY0A 4H2KA 1C1BB 4C2YA 2FLNA 4F4ZA 1CP6A 3N9UC 1TUWA 5KG4A 3HDSA 4KT0C 3F41A 3GJSB 3CW2C 2DNOA 2HHQA 2FLPA 4NXMF 4XTTA 1WOOA 2V4QA 3J7ZT 2R3VA 1RABB 4O44A 4NJRA 3IWLA 4IRCA 4WIQA 2WUUA 2QA1A 3M2UA 1VRTA 5JGFA 3WHIA 1I94J 4KR0B 2NUUG 4B3SJ 3GLJA 1EP4B 3CPAA 2W7AA 4F9UA 4Z37A 2RFHA 3H90A 1QLNA 4X65F 2ZDPA 2ZJPQ 3HHKA 3CJQA 3LA0A 5LSRA 2YX7A 3KG4A 3CB4A 2DR5A 5L46A 4OZ5A 1X12A 3LACA 1T0TV 3PEIA 4DJBA 2ZEEA 2XS2A 4DQIA 3VGSA 3J81j 3DI6B 2Q6CA 1TKDA 2XY5A 2PSZA 3I5AA 4ZJLA 2W01A 2W2NP 4LUBA 1GH8A 1XJOA 2FPHX 2Y1RI 3TO6A 2PA8D 2ZEPA 2ZD1A 1TUGB 4DV3J 2DF5A 2Y1IA 4DR6F 3FMBA 2RHQB 1E6VA 1S4EA 5HQLA 1QSOA 3TQEA 4EBEA 1NHVA 3RGIA 4DPXA 1X9WA 1LFWA 2VQEJ 3GIMA 1NK5A 3Q8QB 1XERA 2OPPB 4F4XA 4UIAA 5A8KB 4DR7J 1J5OB 1PJ6A 4NLXA 3RBEA 2KZZA 5AG7A 4MHDA 1RAAB 2W24A 3MEGA 1SCJB 4J9LA 3F5BA 5F09A 4DV6F 1XNQJ 1X4EA 4NZ6A 3GIKA 1VOMA 3BSOA 1M1GA 1UVJA 1HR0J 3MXHP 1XTZA 3BGFA 3ZZ0A 1L3VA 4OMEA 4ZMMA 4ECUA 3PX0A 2JSXA 4QYRA 4TXSA 3PIPQ 1B7FA 4RNOA 3AQOA 3PB6X 2DHGA 4MKYA 1W7WA 1C4AA 2GZOA 3IMQJ 1RAEB 3WR7A 4KGMA 4ZLNA 1JKHB 1JWWA 2UVWA 1YW4A 2FHMA 2OU2A 2CNOB 3JTKA 3DRPA 4A39A 2V9KA 2DPIA 3PRTA 4F3MA 4Y0FA 2ALZA 4OC1A 2HHHF 2QYCA 1VK8A 4QOTA 4UUXA 1JLEA 2WVDA 1HBOA 4UZCA 1RLDA 1T03B 3KI9A 4F3OA 2GC8A 4Q44A 2ZZTA 4QZVB 4OHYA 1IM6A 1GMWA 2E1AA 4HACA 4O3OA 4ZKAA 1H6KX 1WEXA 3OFEA 2CY2A 1XR7A 5C5JA 5HVFA 1F9FA 2CPHA 3KJVA 4TWEA 3KKFA 3CCSS 3K2KA 4KOVA 2CFXA 3AQPA 4R0EA 2PEHA 3T1AA 2YKOA 3CWJA 3CJ8A 4TYBA 3MEDA 2C42A 4LFBJ 4II9A 4UT4A 5A2QY 3CDWA 1SL1A 4CIOA 1I1DA 1S1VB 3GWCA 4RU9A 1KHVA 4DSJA 2PQ8A 4X4UA 1FEHA 2JHEA 2LQJA 3G6VA 4UY85 1JLAB 2JVRA 1Y9OA 2A0FB 4CM2A 4O3NA 7CPAA 1TV6B 4ZVFA 2EK1A 1LRZA 3H2LA 2B5GB 4QWAA 1AMPA 5D78A 2FHOB 2NMTA 4K0KJ 2DVIA 4FDFA 1UWBB 5SUHA 1MU2A 2HHVA 3R3TA 1F5CA 3NH4A 4CS0B 1TU0B 3N6NA 1IM4A 3TJ8A 3JS9A 5DQIA 1WHWA 4RI1A 2IYIA 1U49A 3DXSX 3QT5A 5HJYA 1H2UX 5KFPA 3BSNA 1TVRA 1JIHA 1XWLA 2EO8A 2JH3A 2AZ3A 3O5TB 4ED0A 3FDSA 1V3RA 3HHEA 4CAEA 5KG0A 5AXLA 1ZO0A 1X4FA 2ZWPA 1O8BA 3JAMY 1FESA 3OFGA 4JI7F 1SQFA 2ZHOA 4U96A 2FC8A 3J7YU 3VHQA 1ZM3A 3GIUA 3IGNA 2BUEA 2J8SA 2W2PP 2CQIA 2HWHA 4TLRA 3CXPA 2Q1LA 2G13A 3R7NB 1I5OB 4IG3B 1UWYA 2KJVA 1FK9A 5IX3A 1FTCA 3L3CA 1IBKJ 1EQ0A 1S9GB 1KHWA 2CJQA 5DGBA 4O4GA 2XY6A 3NL0A 1PBUA 4CQ1A 4LBIA 3C16B 2MZTA 3DOKA 1CJUB 3D6MB 2Z3LA 2VIHA 1X4DA 3D4UA 4OI6A 1FJCA 2R8JA 3GIJA 1FXLA 2AFOA 2QLWA 1RT3A 2F5GA 4G1QA 2GMJA 2VH7A 1XNRJ 4JZ0A 4KGKA 5L39A 3ZO7A 3QWPA 1MJ9A 2GVZB 1HBNA 2MJUA 2LFVA 1QSMA 3CCES 4QW9A 1XOVA 1HBUB 2FQQB 3P8BB 2X7IA 1N36F 1U1OA 3P5BP 3P49B 1P1LA 3N6MA 2FE7A 5D4NA 2B6AB 2Z57B 4FYDA 4MKAA 2OEJA 1RBOB 1YDLA 1TUVA 5ETOA 4ED1A 1NKEA 1Y5NB 4KSFA 3GJTB 5ETMA 2UUCF 2J7WA 4IFVA 3A13A 3SBMA 1VI7A 4WXWA 1RE1B 2ZNZA 2AYBA 3K5LA 2BKOA 3EMTA 2RDJA 2O53A 2WSAA 1UL3A 3I96A 4ECTA 1TKJA 4B3OA 4J9OA 3P2HA 2DHHA 3QAYA 2EFOA 2ZE2B 2DNMA 2HC9A 2BV3A 1QSNA 1C1BA 5LMNF 2QTWA 5A28A 4RWXA 3PR4A 2B43A 3BKFA 1Q2DA 1Q81T 1WK4A 5KFTA 2F1FA 2Z56B 4DV5F 3R2CJ 5KG1A 1HWIA 1NUEA 2UUAF 1CS4B 1V5IB 1FWPA 3R5JB 1RKIA 1EP4A 3NEKA 4TU8A 3KMSA 1ELLP 3HVWA 5GADU 1B0VA 1S12A 4DR2F 2DY1A 1V3ZA 2DR6A 3FRZA 2GVDB 3PB7X 3QJJA 2XSJB 2E7VA 1K1SA 4K4TA 4DR3J 4NYOA 3VH9A 2QVPA 3DI6A 3M8QB 3M05A 1LAMA 4ED4A 3IWGA 2VC0A 5KG5A 3OXLA 3G82B 2V50A 2RF2B 4B9UA 1HPZB 2OJ3A 2G0BA 4C98A 4P6YA 5CCMA 1XMOF 4C8LA 4Y2AA 1S9FA 3EGZA 4Y2KA 3ETOA 3S9LA 2GFFA 4LR8A 4ECXA 4NOHA 2B0GA 3CCQS 4Q2MA 2ZEGA 2A6MA 2VHGA 2R7QA 2HIQA 1FO1A 2G2OA 2OPPA 4DCPB 5A8KA 1J5OA 1FX2A 4URQU 3D1HA 4HDGA 5EHHA 3GIRA 2VPWB 1XBUA 2FVGA 2OSQA 3DU6A 1U47A 2YWEA 3OW2R 4L8AA 4K4YA 3J80U 2HQDA 2UVUA 1CEZA 5KG7A 4CTAB 3D66A 2KG0A 4J7CA 1WI6A 3K5MA 5B08A 1S77D 3ADAC 3B2YA 2CQ1A 3SIPB 2KJWA 1RU2A 2JEJA 1FRIA 2F9JA 3HI9A 3G8TA 3W8GA 3HKWA 1OYEA 1NU4A 3EGWB 3BQ0A 1JKHA 3M6VA 2FT0A 3BJ7A 2LXFA 2Q6BA 3OTDA 2FJDB 1RK8A 2ZUGA 2V2ZA 1UEVA 2WSFC 5KT6A 3HZGA 4EZ9A 3HX9A 2VUGA 4MYTA 2MKKA 5IWAF 1Z4UA 4HTJA 3QAHA 4BC7A 3W65A 4OI3A 4DR5F 1T03A 4OV1A 4Q7AA 2XM3A 1YI2S 1D9DA 1NJXA 3I82A 3C8YA 4DJLA 4W90B 2ADCA 2XMKA 2WK4A 2OTLS 1H73A 2XLJA 2YNDA 2HG4A 2Q44A 5A8RB 4MCQA 2A2CA 4DBQA 3V7ZA 2OI2A 2MQOA 3Q8PB 1DY3A 1IJEB 1R0AB 1UA0A 3ZNUA 1H8LA 2VU5A 5HSPA 4MY0A 1TK5A 5AG6A 4C48A 5MAOA 4P6QA 2XSFA 4BHQA 2VG7B 2X3DA 3BR8A 2LU2A 3QIDA 1SJ3P 4RZRA 2FIWA 2MZJA 4WFAQ 1JLAA 3M8PB 2AFZA 4CLSA 1MMNA 2AJ1A 1D8YA 4FPIA 1S6UA 4Y3CA 4DV7J 1X9MA 4O0NA 2AWZA 4ZJQA 2YH0A 3LWLA 2Q4ZA 2DPTA 1AUDA 1QE1B 3BDEA 1XR6A 4K5SA 2ZBRA 2B5GA 2WVEA 1LQ9A 3KJQB 3KLFB 4DQPA 5DQGA 3C19A 3JQMA 4I64A 4BWJA 1QDUB 1URNA 4ZVSB 1UWBA 4LF5J 1GX5A 3H5XA 3J7AN 5C25B 4IYQA 2GFQA 5JVHQ 2VG6B 3UNGC 2IVFB 3CJKB 4QBUA 4B9SA 5CABA 2XYHB 4GO5X 5A27A 1FE0A 3NRBA 2CWKA 4C97A 3PZPA 2DIUA 1NSKL 1SQGA 5A2QU 3V6DB 5LYDA 3AB4B 3CJ0A 2OP5A 4Y6IA 3U02A 2EK9A 3DHWC 2J7KA 2XZTB 4Y65A 5B0BA 2RSQA 2HHXA 1CJTB 1WEZA 5L1KA 3TYTA 1M5OC 4Q5VA 5H86A 1U6BA 1WKLA 2CAJA 4FNHA 3FCVA 2AJFE 3KUEA 3S6KA 3A8EA 1S9GA 2KN4A 2J0WA 3TOQA 1EHWA 5H1SV 2ZOFA 3C16A 4C8NA 4LVNP 2HK2A 3VV2B 4D3GA 1VRUB 1CJUA 4DX8H 1LOKA 2FSRA 4YS2A 3ETMA 1IN0A 2BE7D 4TU7A 3FMCA 2WPWA 1AA1B 4X64J 1WWZA 2AW0A 4X4PA 3CCVS 2PDAA 4OI1A 4NGSA 4JB8B 1HNWF 3NGKA 4PUOB 2YTCA 2YQ3A 4U95A 3WC6A 1X8DA 2GVZA 5J8FA 3D67A 1R6VA 1VQ4S 3LWMA 4QPTA 1HBUA 1JK9B 3I6PA 3KNAA 3JAMU 1U25A 1CM0A 1YVKA 1N54B 1ZS6A 2FVRA 5AE1A 3D2MA 1PC5A 2B6AA 1Y7RA 2IQ6A 3QAEA 4DUZJ 2RU3A 3ZZOA 3FNNA 4B02A 1CQMA 1T02A 4PR6A 2B9XA 3SJEA 1FWLA 2R4FA 2WB1D 5E33A 3H8EA 2AE6A 4P72A 3JSMB 3BGOP 2KXNB 1ZLHA 1NJYA 3D7DA 2VBQA 2B4UA 1ZPVA 1A7GE 1M5HA 4HVZA 1ZTWA 2FZKB 2DXFA 4DL7A 4DCJB 1HARA 2LMIA 2XMMA 3MUTP 5E0OA 1MN9A 3R97A 3W64A 1YIJS 1RWKB 1OJ4A 2ZE2A 1TAQA 2J7UA 2V6AA 1KQSR 1QY7A 1U1PA 1FFWB 2BDPA 2F4VJ 2EFVA 2ZOGA 4FKYA 2EBGA 4CT8A 3OPKA 2YGWA 1CS4A 1SI9A 2JFKA 3M8ZA 5ISVA 4BDPA 1AUGA 5D4OA 4LMZA 2HGLA 4YN3B 3M4XA 1OPIA 2D3OR 5J1NA 2CKWA 3S6EA 4A48A 1L3TA 5ETQA 2GVDA 4O0IA 2AU0A 3E3XA 2XSJA 4P4IA 2MQNA 1TL4A 4F50A 2JEVA 4ICLB 3M8QA 2GO8A 2ARHA 3G82A 3B4DA 2RF2A 1HPZA 4WFYA 3MMAB 2CTBA 1Q2CA 1N5VA 2EK8A 2KU7A 3N7ZA 2W4DA 1GNKA 3GCWP 1Q5VA 3OTEA 3KLHA 4TQSA 1RAIB 3G3SA 4ZN3A 2E9RX 1FVQA 3NH8A 1HD1A 3H2VE 2PR1A 2B9EA 5U47A 2GAGC 4FS2A 1DAXA 3RRGA 1GMVA 4M6HA 5DGAA 4TVAB 1RHRB 4HTIA 5F8MA 4AXVA 5LRJA 1R43A 2LU1A 2D9OA 5HO4A 2H51B 4A46A 5T14A 4ZVPB 2ZH8A 3MM7B 4NA1A 1TF9A 2ZENA 4CTAA 3IJ3A 3HZEA 1IR2A 1H38A 1ZZFA 4DMZA 1U2RA 4DZDA 1Y7PA 3IP0A 1Z9UA 1I21A 4I1TA 5GCNA 4DV4F 1WHXA 1ZG7A 3TUJC 1XR5A 3EGNA 1UFHA 1SIWB 3W5XA 1M5PC 1S0VA 4U9ZA 1FRXA 2RC4A 4R3LA 4Q8EA 4JI3F 2DNYA 5E5NA 2XS5A 2XZWA 1FI4A 1P9QC 4LF6F 4X3RA 1A6LA 1WC4A 1IOFA 3B3CA 3VWSA 2NXJA 2BBEA 2UXCF 4XO0A 5M2RA 4OC3A 4MFKA 5G21A 2EW9A 2YWWA 3SMZA 2XEIA 1M4LA 3FSYA 4MFZA 1UCNA 3TC8A 2DYAA 1YTYA 4JXRA 3Q8VA 5KFWA 2YNCA 5JQ4A 4A4JA 1VQSA 3I32A 5A8RA 1GX6A 2DXQA 4OAEA 2R7HA 1X31C 1XN9A 4PQUB 5EX3A 1R0AA 1ARMA 2ZC3A 1FXDA 4J9QA 1FDBA 3RB6A 2MXYA 4KUBA 2MYFA 1MG7A 4TY8B 1NMEB 3MCMA 2DIVA 4A31A 1WF1A 3Q0AA 3KK1A 4WFBQ 1SC6A 2VG7A 2FHKA 4DG1B 2Q7SA 2LYVA 3IXQA 5MLCV 3CCWA 4NL5A 4YY3F 4LF9J 1RHUB 2CNSA 2BCOA 3O2IA 2ZH6A 2HS3A 3M8PA 2Z0GA 4J9PA 4ER8A 2DR7A 2BJEA 2FJVA 1R0CB 5F48A 2P0WA 2IA6A 1RGVA 2MKHA 1ZH5A 3S01A 2VICA 5SZTA 1QE1A 3UDLA 3EDRB 3M9OB 3W2VB 2KM8B 2KRBA 3RAQA 4DR4J 4QIEA 3KLFA 4W4MA 3GILA 1N0UA 2E29A 1R57A 2IYGA 4YR2A 2Q0YA 3HLPA 2BEIA 2RDDA 2CIJA 4KSIA 5C25A 4DCOB 3W5YA 4R8UB 5EMIA 3CJKA 5CYMB 4QR2A 3MD1A 2MLYA 3NMAA 4P7TA 3LQVA 4L75A 4DFPA 4IRDA 2XMVA 3SV4A 4I56A 2I2YA 5JPHA 1FERA 3V6DA 4FBUA 5AXNA 1CPZA 2CWXA 3UVJB 1ZAXA 1ZM2A 2GLJA 5LSLA 2V9WA 3B54A 1CJTA 5CHCB 4M5HA 4A8QA 2JDCA 1TTHB 1KFDA 2NYQA 2DB1A 1FDDA 1ZLIA 2ZW7A 1EB0A 5KT5A 2ZKUA 5KFVA 1FJEB 1NHKL 2QA4S 2RRAA 1CC7A 4L6V3 1YK9A 4DL4A 4NSQA 2F7VA 2V34A 1VRUA 2E9TA 1RT2B 3FK4A 4HPSA 3UR0A 2Z11A 1XC9A 3W9HA 2VF3A 2D69A 1BQNB 1MLAA 5FDLB 2B8QA 5BJRA 2YWFA 3VAJA 4PUOA 2UUCJ 1DTDA 3KLGB 4ZCKA 5AJ3J 5GAEI 3SQOP 1IBMJ 2E66A 1QSSA 2W7PA 2MJNA 2PJ9A 1LOUA 3Q23A 3T6JA 2FYXA 3R1KA 3PHEA 4LBHA 3RAXA 4KFBB 4ZPTR 1VQ8S 5LMNJ 2E5HA 2R8KA 2DCLA 1N88A 1BPMA 3TJAA 2CYYA 2YWHA 2VKRA 3J81U 4I49A 4DV5J 2VZ9A 3K9UA 3JSMA 2UUAJ 2LDYA 3EXCX 3WBZA 4NE9C 5DLGA 4CLYA 4I67A 3BGUA 4RBTA 4FXVA 4U7CA 1OSDA 3MPDA 1T95A 3GUXA 4HNXB 2Y0BB 4I69A 3V81B 3OL9A 4L73A 2J6TA 4RJVA 3R5GA 3SZ2A 3ILIA 1VKCA 2C2KB 3AXKA 1ZETA 5DJBA 3EZUA 1IYKA 1OQ6A 2CPYA 3BGLA 3M1VA 3GFZA 5LOQA 4JYAF 5E3AA 3M2VB 1SKSA 1HI1A 4R3KA 3M30A 2ANPA 1CULB 2VG5B 2IVYA 1KVJA 4WYLA 1NPKA 1UW4A 4NA2A 4EYHB 4FF3A 1FNXH 3PM9A 3SXLA 1XMOJ 3P6YC 5ETKA 1WSVA 5HROB 1YREA 6FDRA 4ZVGA 4UA3A 4KB7A 5D0GA 4ZLJA 2ZZNA 1W2IA 4M6IA 4JI1F 2BEFA 3WIVA 2YWKA 1FXRA 2NPFA 4MKBA 4ICLA 4Z65A 5KG2A 4U7UK 4OX9F 2UUBF 3TAMB 5GMEA 5F8NA 4E8UA 4M5JA 2GE3A 3MMAA 2ASLA 1G1XA 2HKEA 2LVWA 3S9NA 4DSFA 3M2RB 2MQLA 3N6LA 3QGPA 5L1LA 4MCRA 2BACA 1WC6A 2J9CA 1JLGB 2IM1A 4X4VA 2DRAA 3FQKA 4LQGA 3MM8B 1U1NA 4ZGYB 3NCQA 1GMWD 2XBPA 1V5VA 3ZTSA 2NXCA 3AB2B 1TK8A 1WNEA 2VBZA 4RKUC 3OBIA 3IBFB 1SQHA 3KJFB 4ATNA 1RT6B 4OHVA 5HMYA 4R9MA 3MM7A 8AT1B 5KFXA 4KPYA 4IHMA 4H6UA 2ILYA 1HQEB 2L3MA 4DPYA 3TZWA 1Z5RA 3T41A 2ZM6J 1QSTA 2ZBPA 3AHPA 3S1TA 3PR5B 3OL6A 2K7JA 2NXUA 3UO0A 2GIVA 4HHHA 1XEBA 2Z3OA 2XHCA 4ZPVR 2FVPA 4IF5A 3EICA 4NXNJ 5ELYA 3LF0A 2ZW5A 3KHGA 4GS4A 3JYTA 2FVSA 3KLVA 4X2TA 4FYVB 4P73A 1S6PB 2DRDA 2DGXA 2HUZA 4OIWA 2DH9A 3VR1A 2RUGA 4JXQA 1T8EA 4LVOP 5HANA 4YFJA 2GJ2A 4LRAA 4R25A 3GFHA 4WWSA 3PXGa 4QU7A 4PQUA 2Q7BA 2MZRA 1IVZA 4G3IA 3H25A 4TY8A 3GY9A 2C2DA 4NXYA 1X4AA 4NLGA 3W62A 3VGTA 2QL9B 3C6UB 4DG1A 3K5NA 1ZA1B 2HGMA 2DT9A 4M1KA 4ZHRB 1VS3A 3I0RB 3CJ2A 4B13A 3LUYA 3SV3A 2CXAA 2P5VA 5EX0A 2GGPB 3AJDA 3H5UA 4OZ2A 5GMKa 4TNUA 1KS2A 1AROP 3Q8YA 2YKAA 3DSBA 3W2VA 4OJGA 4CAFA 3IWXA 4RW4B 3FBUA 2DCUB 1SKWA 2PIZA 3TFYA 4K4WA 2GANA 5A0YB 5LMUF 3N4WA 1CVJA 5CPAA 3LP2B 2QSFA 2VBWA 4R8UA 4KPCA 5CYMA 2J9AA 1RHMB 3IG1B 2J0XA 2XO7A 1JJ4A 3I9SA 4J9KA 2I3CA 4JP8A 4LSNB 3GYXB 3DU5A 2H65B 1WEYA 3PZJA 5J8CA 1RP5A 3UVJA 4OP4A 1KEKA 2E1MC 4F4WA 3NCPA 2XMJA 4F0YA 5D4PA 4F0KA 5D3GB 1YWXA 4Y34A 3K5OA 4USTA 4ETZA 2AV5A 2KFNA 3NH5A 4ZLPA 3OLBA 2HHWA 1MJAA 1YJWS 3NKYA 2XB2D 4UWJA 1AFIA 2B5JB 2QN6B 2XTJP 4IR1A 2K7KA 4LF2A 1RT2A 5BWAB 2GIQA 4AQYJ 2ZKTA 4EI2A 1RWXB 1IWAA 2ACMA 2YQ0A 1BQNA 4JV5F 4TU9A 3N0VA 5FDLA 1KNZA 1YJVA 3ONQA 3KLGA 3UWTA 2EC2A 2LXIA 1S59A 3D68A 2HVEA 2QIFA 1NK4A 2FLLA 4CRZB 1O51A 4ZI6A 2VD3A 2REFA 1WG1A 4KFBA 5C88A 1D3WA 3CC2S 1UEUA 3NFZA 1WORA 2EFGA 3GONA 3R7BB 3VAIA 1S10A 5IT0A 5HQ8A 4IO9Q 2W9AA 4BS2A 2MGZB 3KR4A 5AE3A 2H5IB 3QQCD 1PJ7A 3DDIA 2UP1A 3BR9A 2PJ1A 3IWNC 2PJCA 3MMBB 4E0DA 2JEWA 1T05B 2CQDA 5D15A 3QSIA 4HR2A 2YY3A 3SSQA 4CO3A 2W4PA 3LAMA 3RB4A 1LXJA 1VFJA 3KJNB 3V81A 4K4XA 3UFCX 3PX6A 1JX4A 3T1HF 3ISND 2OB0A 2HV2A 4QIGA 2NSMA 1Y9KA 3M2VA 2XY7A 1N34F 4UFVA 1YJTA 4PABA 3BJ8A 4OZ0A 1CULA 2VG5A 4U9RA 4UCPA 3BLNA 4NGNA 4ZY1A 3HFVA 1S99A 1TZ0A 1SC1B 1TL1B 2OKQA 4WKRA 3CMQA 5HROA 3THPA 2ZBCA 1FRJA 3CDAA 3TA2A 4LF8F 2HAFA 1I94F 2EWBA 4B3SF 5KFOA 4P2MA 1QAIA 4KC5A 4IRKA 4JI0J 2F8MA 5E41A 4UEZA 1X60A 2FLOA 1Y7EA 4JI2F 1SJ4P 4JBCA 3NS7B 1HFEL 3TAMA 2HFVA 2M8HA 5CBMA 2ZH3A 3SQGB 2X3GA 3W2WB 4DUYJ 3IN5A 3GKRA 4WTOB 4WPAA 3M32B 4MJ8A 4MIAA 1NSPA 1S0OA 1JLGA 3TARA 4DV3F 3QJPA 1R89A 3TAQA 4NLPA 5IOLA 4J90A 3MM8A 4NLQA 4USWA 3W8PA 2CJXB 2VPXB 1S6QA 1T94A 2FGOA 2B58A 2PEBA 4P45A 4AYBD 3ZFVA 2XQCA 1HQEA 2GQQA 2V2VA 5KFHA 3PKMA 3DLEB 4AUKA 1XNQF 2XEFA 4NLDA 3R27A 5KFMA 1LW0B 1HR0F 3TI0A 2PMWA 1IOIA 2V94A 1UTAA 1IBLJ 2EVZA 4ERDA 4DSKA 4B9TA 2W8KA 1GYTA 2O3DA 1VC0A 3IU1A 1S57A 3G8QA 2DR8A 1A9NB 4OQJA 2HZCA 3X1LB 2R1IA 1JXEA 2RJZA 1P9YA 1TKZB 3G87A 4PAAA 1HI8A 2JC1A 4N8OA 2QSWA 1JJ2R 3KK3B 3NS6A 2R8IA 1S6PA 1X4CA 1K44A 3R6GB 4MJKA 4I6YA 4OIXA 4YOEA 1S97A 4KQZA 2E1PA 1U8WA 4B3TJ 3B3SA 3JB9k 1QVFR 4O4RA 3ZXWA 3BO2A 2QIRA 2PJ0A 1U09A 2XYPB 1LWXA 1FRMA 1D9FA 5C42B 2HHPA 2ZXVA 1GEHA 4TYAA 1HD0A 4RW7B 2GJIA 4RU2A 3DCAA 4R6TA 3PYEA 5D77A 5EC4A 5HVGA 4WBFA 1GK8A 4CNYA 3TQ1A 4PRFA 4ZHRA 3I0RA 4LFBF 1R6YA 2GMHA 4QUSA 1XK8A 3C26A 2DEIA 1VBYA 3DR8A 1RT5B 5KT7A 4MYUA 1FRKA 2VQFJ 5F46A 4UZBA 2H48B 1PGZA 4KVME 1S7LA 2B4PA 3ZTQA 4A37A 4JUZA 4M5GA 1U7LA 2IRYA 3FBBA 4DEZA 4RW4A 5G20A 1LWEB 3SCIE 2Q66A 3PGPA 3T5HA 5F3ZA 5A0YA 2RS8A 2VV5A 2EEYA 5K5MA 1OY8A 4YB5A 4DZ6A 2P6SA 4K2XA 4EZ6A 4K0KF 2K06A 3M7VA 2WB4A 4OX7A 2JBKA 1U45A 2OAUA 1VQ7S 3IG1A 4CO1A 4UWIA 2AEMA 2J8RA 4PXCA 4LSNA 1DARA 3NAHA 1RISA 4YR3A 2WAQD 3TUZC 2HNZB 4ECQA 1D0EA 4I68A 1C0TB 2HWIA 2UU9J 1KQKA 5E3CA 3VGUA 5D0RA 1NE9A 3EX7B 3QYYA 5D3GA 4OC4A 3MM5B 3D7HA 1L0CA 1WC0A 1NXIA 3AD7C 5DWMA 2AIRB 3D5MA 4DPTA 3HSDA 3BDPA 4C7IA 2Z3KA 2KG1A 2B5JA 3PDNA 4ID5B 3RUBL 2BA9A 4B6ZA 4WK3A 2CPIA 1Q86T 5KFAA 4QW8A 2OFGX 4S0MA 4KSAA 3DRSB 3MI7X 2NS1B 2AX0A 2EWHA 5ETNA 2E5GA 1VR6A 3TVKA 3R5DA 2M8DB 5E3RA 1NDKA 3BZQA 4ZPWR 1HWJA 3QNVA 3A8IA 1XNRF 4XPCA 2YQ1A 4DQRA 4USMA 2ZEFA 3CJRA 4X62J 2WZNA 4PXBA 3LALA 4RW6B 3R7SB 4ZIVA 5DS7A 3Q2SC 3DGPB 3JTPA 2BE9B 2ATCB 4J37A 2MGZA 2G4BA 4NGQA 4CRJA 4KOYA 1V3SA 3MMBA 1T05A 4JWPA 3LMSA 1F3VA 4Z7YA 1Q2YA 1KN6A 4BC9A 5AE2A 2XWXA 2D9PA 1N5SA 3UR3C 4FD4A 3HVTB 1VLYA 4A33A 4A95A 1RWOB 1FA0A 2P6TA 3B3VA 2I38A 4UQGA 3AA9A 2NR0A 2I5JB 4JI1J 1RTJB 1RHQB 1U6FA 3RO0A 4URGA 3AOAA 2NREA 1XF8A 4YB1P 3QRPA 2UUBJ 5IV3A 2F65A 4U8VA 4N47A 5FD1A 2B7CB 4KOWA 4C2XA 4GXHA 3CPXA 1TL1A 2P9CA 2MHEA 1DZ5A 3MMCB 1ELOA 1T9TA 1YBTA 2W7OA 1XMQJ 3EXYA 4EEYA 2CZ4A 1BPNA 3MR5A 4JI4F 4LSZB 3D0HE 2MY7A 3IRXB 4TY9A 2FCKA 4B9MA 5D0EA 4DL5A 1YJ9S 4OIDA 3POTB 3I0SA 4NPOA 5H9FK 2CNLB 3MPVA 4N7TA 1SXLA 1H72C 4ZVHA 4YHHF 4N56A 2Q04A 4IO1A 2YX1A 5H9FJ 6AT1B 4C3LA 2K2PA 1GQEA 3SQGA 5DETA 2ZH9A 4NCZA 3W2WA 2DNRA 1NMTA 4PPZA 3M32A 3VAGA 5J1PA 1M4DA 4LIRA 5HL7Q 3MM9B 2N7YA 1IU8A 4ZCMA 4ILLA 1YLOA 4AVBA 1MMDA 1T3OA 5CCLA 1ON0A 2JEIA 2PCUA 3ZTOA 4U6PA 2JDJA 1X5SA 4OHZA 1RO5A 1IQZA 3DLJA 2BQUA 4DS4A 2RQ4A 3CVKA 4ZVTB 3R5AA 1AZSB 3F0AA 3CC4S 1T11A 4K7QA 1WELA 2CZ9A 3KG0A 5F8IA 1LKZA 4JI8J 1HYSB 2YNFB 2GNKA 4K59A 2PN6A 3DLEA 5F8JA 2JFDA 2KXFA 2SXLA 4WZQA 2V8VA 2KH9A 4OLOA 1LW0A 3LGMA 4C9DA 4ANDA 5C82A 1TL7B 1MROB 2VA2A 1JXLA 1QUVA 2Z3PA 3E01B 1Z4RA 2BL1A 4WP9A 2MPUA 3EVMA 2C27A 2R7TA 4OZNA 2BABA 3E51A 2M0GB 3HSZA 3GP9A 5F8GA 4KHPJ 4AT1B 5ETSA 1TKZA 3LPEA 3OHAA 2C1CA 2MQQA 2C3MA 4DYOA 2XGPA 1RWWB 3KK3A 1U26A 1DJ0A 1KDNA 3RG6A 5T41A 1KSPA 1T9YA 1FJGF 3IC1A 2KL8A 1Z4EA 4DX5A 4NWBA 4CT9A 2PVVA 5AT1B 1M5SA 3TVYA 2CPDA 1FJ7A 2B4DB 4HI1A 2AJ4A 1BLUA 1N8RT 2YKMB 3QMQA 4CI0B 3TAPA 1KRPA 2D7SA 1XRYA 3PCOB 5FJ4A 3IM8A 4A30A 5C42A 2ZBQA 3H5SA 3FB3A 2V4RA 5KTDA 5K8OA 5JVGQ 4RW7A 2CF4A 2G1HA 2OFHX 3BI1A 4RUCA 1HNZJ 4QCLA 2XYGB 3JSBA 4K4UA 3KHLA 4X5KA 1IKWB 3MMJA 4OX8A 3JTNA 3KUGA 4NLTA 1LEOA 2KVQE 5IM0B 2AEJA 3R9EA 5C2CA 4AVCA 3L7OA 1LW2B 1CBKA 3M8RA 1MMLA 3N5BA 3L09A 2M70A 1IR1A 3PRBA 1RT5A 5IB0A 5J2QB 3SEOA 1CPSA 3O44A 3LPYA 4F4AA 4QWEA 4DV7F 5JMNA 1N33J 4FAIA 1LWEA 3OSPA 4ZVQB 3KQZA 1PAEX 4OC0A 4DHVA 4B5PB 2KTQA 1WACA 1YQHA 2FJEB 4QBJA 4CLZA 4C8OA 2R7XA 1HHQA 2G0JA 4LF5F 5CD4H 4L3NA 4V1Ak 2Q79A 1XEZA 4W92B 1S7IA 2FZCB 4NCAA 5J2MB 3MECB 3MOZA 2HNZA 3DN9A 4DSIA 2CG8A 2LXUA 5LYFA 1C0TA 1S72S 5K8NA 4FPRA 4OYIA 4KGZB 3A3NB 3UI3A 4IH6A 4WWVA 1TK0A 5DZ7A 2DITA 4EUVA 4X4SA 5DLFA 1NHUA 2PJBA 2CJAA 2Z2YB 1F2OA 4RBVA 3MM5A 3NA6A 2GHVC 1U1QA 4X66F 2O01C 3TNVA 2E7WA 2XLKA 4B3MJ 3CEDA 2PT0A 2G0CA 3IS9B 4ID5A 2PFFB 2I1RA 1B0PA 2RILA 4Q8FA 4JV1A 4PV6A 5LL6d 3HFKA 4IAVA 2WYRA 1SUQB 3DRSA 3UDEA 4AXIA 3FH4A 3MPYA 3BQ2A 2HRUA 2IPOB 1QQ9A 3A1YG 1EJ7L 1KQGB 4X64F 4MFJA 4BWMA 2ZEJA 4EMDA 2CPXA 4P74A 3A4TA 2QLFB 4LUAA 4MBUA 2BANB 5DRKA 1F6TA 2KYXA 2W1BA 4UTGA 2JL9A 4CH7A 4ES3A 4RW6A 4JYWA 3JUWA 3T1HJ 3VVTA 3ET6A 3DGPA 3DHXA 3FEDA 4F6AA 5HLFB 2V4JB 3SI0A 2XGQA 4UOGA 4DUZF 4A38A 3FMWA 5K8PA 4L74A 2IJZA 4KORA 4PCQA 4ELUA 3Q83A 4CCHA 4YWYA 4GKKJ 3VQTA 4NRUA 1KP6A 3HVTA 3TANA 4LF4F 4LF8J 4OX6A 3SJXA 3EXNA 3NNCA 1FEEA 3W1YC 4K4ZA 4R5PB 2ZEMA 2C22A 1UP1A 3DC2A 1Q5YA 2D3ZA 2I5JA 3W60A 2IRUA 1RTJA 1SL2A 5GAEU 3MTJA 4L89A 4JI2J 3C15B 2XMAA 1VHSA 4C3MA 1QSLA 3CUNA 2F4VF 5KT3A 1SBRA 3WX8A 3KMQA 2L08A 4KH0B 3MMCA 1UAWA 3OSNA 1KONA 4HH1A 2B7BB 1R8AA 4GKJF 2QLBB 3V5RA 4P2XA 2RUSA 2WW4A 2LQBA 1M44A 3IRXA 4GVBB 3POTA 5JM6A 4Z2XA 1Y5LB 2HBRB 4TKTA 5J2PA 4WJBA 3C66A 4Q0BB 4QIVA 3X3UA 3EYZA 3MEEB 5J2NB 5LJ3Y 3DRYA 3MWBA 2MZ1A 5KFKA 1FF2A 2IM3A 1Y11A 1SJRA 1HQUB 3G6YA 2MY8A 2VZYA 3NOCA 8RUCA 3W91A 4XDCA 2OPRB 3RYOA 2FS5A 3MM9A 3UE2A 2FY1A 4IH5A 2WPXA 1FY7A 2RB7A 1J4JA 2QMLA 2HVDA 1BWVA 5IS2A 5LXYA 4RUAA 2MKYA 2B51A 2ZH2A 1A0OB 2QE5A 4KLVA 4A8OA 1JB0C 3PB8X 1RADB 1OQ3A 5C7PA 1RHJB 3MAAB 1PAUB 3EE3A 2DHSA 1HYSA 2YNFA 4H6ZA 4WFXA 4V19X 4NEYA 2R7WA 2AFSA 4H4KC 4IQMA 3PYGA 2AX1A 3A9LA 3QBCA 2CA9A 3D7GA 2XO6A 4RUHA 4OZJA 4O23A 4C11A 1MROA 3H7HB 3LGHA 1BGXT 3E01A 1CC8A 2XMTA 4M3SA 2EFQA 1X5OA 4IOCQ 3KGQA 2IFXA 2V8HA 1IKYB 3B78A 1FHTA 2HFNA 2R8GA 4O3SA 2A4NA 3BV8A 1VYAA 1B99A 4F0MA 4R76A 1FT7A 1JNZB 2OIHA 4FYXB 2ZC4A 3KNGA 5F0WA 1RHKB 4ED2A 5KFFA 3CJ3A 3E8OA 1Z8WA 1VCTA 1BLLE 3CDXA 3B82A 5IQQA 2B4DA 2VKZG 3FX6A 5F3TA 3VZHA 4DPOA 2V68A 1M1KT 2YKMA 4NLUA 3KXDA 2XEXA 5DG7A 4ZPBA 3CIZA 1HBMB 1RWMB 2DD8S 3PW7A 3UW1A 4F67A 3MDFA 5C2GA 1K1QA 2HHUA 4UBRA 1K4JA 2DH7A 3TUIC 5IQ6A 4M85A 3V8IA 1YQEA 1Q8KA 1KQFB 1S7FA 3LW5C 1NH8A 1IKWA 4X2BA 2NPIA 1U0SA 3RB3A 5IM0A 3EPGA 4NI2B 2HHTA 1RXTA 1LW2A 1NSAA 1XJWB 4CH1A 2PJ4A 4L76A 2WBMA 4LF9F 5HP1B 1NSLA 1KTQA 4B14A 3DKDA 4U9YA 5AXKA 5J2QA 2VFVA 4XPKA 4BINA 2CUYA 3ZTRA 2HSEB 4NCGB 3SJFA 3RBUA 2B8PA 3Q89A 4B9NA 1B4SA 4A2ZA 2GHWA 5HMZA 3UCZP 4B5PA 3R9LA 2GHPA 1GXUA 4DR4F 3OT9A 3OR1B 4KV8B 3LO3A 3N01A 3JXOA 2PIIA 4OLLA 2C6PA 1IXKA 4PYAA 2MKSA 2Y8WA 5J2MA 2BW7A 1YX2A 3MR6A 3MECA 1ITPA 3M8YA 1TMJA 2Z3MA 2FIUA 1UPPA 3O8WA 2W2MP 1CJVB 2DXEA 2LP4A 2GV1A 1ZYQA 4PK2A 2CQ2A 2LEBA 1LCPA 4HKFA 2RVJA 5B0CA 2P8IA 2N3OA 2J5AA 4ZDNA 1YJNS 2B3VA 4K3NA 1Y0HA 1BMQB 2ALYB 4RUBA 2CZVC 3GYGA 2KRRA 2GAHC 3D0GE 3H20A 4B3RJ 1RBAA 2LEPA 3IS9A 2VB6A 4FVCA 1N5YB 2IAJB 2DGUA 4PWWA 1Z8LA 4YQWA 2ZVSA 4K8RA 4CLPA 2LCWA 2NZCA 4ZY2A 1SUQA 2Z30B 3FRYA 4F4YA 4C3KA 1OY6A 1WC5A 3B3WA 1RDRA 1VBZA 3I9ZA 4P10A 2AFXA 2H5MA 1YVFA 3HT0A 1IQTA 2DXDA 5KG3A 5DDQC 4OI2A 1V0CA 1RBLA 2JWNA 4KHRA 3CD7A 3PW5A 1TFYA 3SCJE 1KD1T 2Y8YA 5AJ3F 2BANA 2DNPA 5KG6A 1IBMF 3SHPA 1NH7A 5E2QA 3KQXA 1J5EJ 1M5VC 3HJFA 1OY9A 4DUKA 1NAQA 5T7LB 2FJWA 4KGVB 4OYBA 3A8JA 5HLFA 2V4JA 2WVBA 2M52A 5GAGI 2IA0A 2VOOA 1RUSA 3PACA 4DLGA 3DLGB 4FBEA 2EKYA 2GCFA 1NJZA 1SJ1A 4JI6F 1TKXB 3CCUS 2XS7A 4K2JA 1RAJA 4JI4J 4U7UD 3R5BA 3AJ2A 1NJIT 2VA3A 3CD0A 4R5PA 2FVQA 3VWDA 2RMLA 1H7WA 2M2BA 2P2CB 3CZXA 3C15A 2IRXA 3GPAA 4YHHJ 1PYOB 2R7UA 2KXHA 2DHAA 3PYFA 1X7VA 2YNIB 1XBWA 1TAUA 1IKVB 2XG8A 4G65A 3OTCA 3VZIA 1BO4A 3Q8RB 2Z2ZA 2NLWA 1O5JA 4X4NA 2JLMA 3LP1B 2H5JB 4UY8T 2CQ0A 4MFQA 4X4TA 2N82B 3DDDA 4GVBA 2KI2A 1O0PA 3JQKA 2WOMB 2CJBA 1MWYA 2A2DA 3HULA 4TNOA 2C2OB 3MPUB 1ZG8A 4Q0BA 1H3DA 5HI7A 3J7A1 1HHSA 3MEEA 1K0TA 5J2NA 3UN3A 1EQMA 3K8WA 4QIFA 3NNHA 5B0FA 2PI4A 3KWMA 5I4MA 1HQUA 5KFCA 4AVAA 1CG2A 1YGHA 2LQ9A 2VDHA 2OPRA 3GJRB 2KKHA 3TP2A 3FEZA 1OPZA 3I5BA 3QZ8A 2OH2A 2QL5B 4L72B 5KFSA 5G22A 3AD8C 5G1ZA 3MF5A 2D41A 5E3PA 4CH0S 1S9EB 4YB6A 4ZVEA 4BMHA 4PWDB 4RPFA 1U4BA 3AA8A 4DOZA 4D3HA 3KG1A 3MAAA 4DQQA 3FCWA 2IY5B 3PG9A 2PJ7A 3C6TB 4OYWA 1RYRA 1C1CB 1WUUA 3OTOF 3PNIA 2YNGB 3R1LA 1P1TA 3R9GA 1ZBTA 1FJGJ 2ZNYA 3G6XA 3VCDA 2G3AA 2QMXA 2ZH5A 2ZM6F 1Q8BA 4KYZA 4ZX9A 1RSCA 4G1PA 3RRKA 2NQPA 4B9LA 1VBXA 2KO1A 4Q38A 3O3LA 1T9VA 2HS0A 2G9DA 4FF1A 4NZ0A 5LYIA 1LK5A 1IKYA 2XCAA 1ZPWX 2PO4A 2N4DA 3KLIB 5D8NA 3FBFA 1DURA 3MAHA 4WK1A 2FDNA 1HKAA 3M6UA 1M0SA 4OYOA 4NXNF 2R42A 4OMFG 2WTFA 2X1GA 3B7IA 3H4BA 3GU0A 4KH1B 3QPIA 2ATLA 2ZD1B 4Q36A 3JTOA 9ATCB 2PJAA 4MIBA 5H84A 1PG5B 4ZIWA 3QT6A 2QZ8A 5HJXA 3OHBA 4LQ9A 1S1VA 2KT3A 4LF1A 4TN2A 3A3OB 1FD8A 1HBMA 2BQRA 2CVEA 2VDIA 5KTQA 3BO3A 1EX8A 3GSIA 3IO1A 7FDRA 1TV6A 3MD3A 3MPWA 2FIAA 2E44A 4M5NA 1HNXF 1YX0A 2V0NA 1S48A 2K8GA 2OTJS 4KZTA 4NI2A 2PJ8A 3ILJA 3MEKA 5HP1A 5BYQA 2J9DE 2D3UA 3RR7A 3K5PA 5KFJA 3ENVA 4QC6A 2DGWA 3Q8UA 4ZY0A 4MFBB 4NCGA 4CGPA 5HATA 5DM6Q 4PPDA 2AF6A 4NLSA 4QPXA 3H4DA 4P75A 4LIWA 2YPZA 4ANCA 3CXCR 3OR1A 2R2SA 4KV8A 3HT3A 3ILOA 1RAOA 2BW2A 1A2ZA 2U2FA 4X66J 3W6SA 1RAHB 2QMUB 1R8CA 1JXVA 3FGVA 1GFWB 4IG3A 3I4PA 2LECA 3J7Z5 4HEA9 3NP5A 4HACB 5DS0A 4CYNA 4PG5A 3B35A 4ZPDA 3BH6B 2WW8A 4QR1A 2XULA