1NSAA

Three-dimensional structure of porcine procarboxypeptidase b: a structural basis of its inactivity
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
395
structure length
395
Chain Sequence
FEGEKVFRVNVEDENDISELHELASTRQIDFWKPDSVTQIKPHSTVDFRVKAEDILAVEDFLEQNELQYEVLINNLRSVLEAQFDSVSRTTGHSYEKYNNWETIEAWTEQVTSKNPDLISRSAIGTTFDGDNIYLLKVGKPGSNKPAIFMDCGFHAREWISQAFCQWFVRDAVRTYGYEAHMTEFLDNLDFYVLPVLNIDGYIYTWTKNRMWRKTRSTNAGSSCTGTDPNRNFNAGWCTVGASVNPCNETYCGSAAESEKETKALADFIRNNLSSIKAYLTIHSYSQMILYPYSYDYKLPENDAELNSLAKGAVKELASLYGTSYSYGPGSTTIYPAAGGSDDWAYNQGIKYSFTFELRDKGRFGFVLPESQIQATCQETMLAVKYVTNYTLEHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROCARBOXYPEPTIDASE B
publication title Three-dimensional structure of porcine procarboxypeptidase B: a structural basis of its inactivity.
pubmed rcsb
molecule tags Serine protease
total genus 143
structure length 395
sequence length 395
ec nomenclature ec 3.4.17.2: Carboxypeptidase B.
pdb deposition date 1997-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
A PF02244 Propep_M14 Carboxypeptidase activation peptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.340 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Metallocarboxypeptidase-like 1nsaA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1nsaA02
5J1QA 5K8NA 2EWBA 1UWYA 2JBJA 4JZ0A 1XFOA 4KSIA 2PIYA 3PRTA 4G1PA 3D68A 2FVGA 1IY7A 3B2YA 2C6CA 3PB6X 4P4JA 3PFEA 3KQZA 2ZEEA 3NH5A 3KASA 4X8IA 5K8PA 2EK8A 3DLJA 2PJ0A 4GM5A 2PCUA 1ZG8A 4YWYA 3B35A 4OMEA 4ZX9A 2BOAA 1PYTB 3GB0A 2HB6A 4OC3A 2VL1A 2PJ4A 2BO9A 4PXBA 3PB8X 4MMOA 2AFSA 2F7VA 2O4HA 3KHXA 5JM6A 1IGBA 1CG2A 3PB7X 1TKFA 1Z2LA 1NSAA 3VARA 1Y0YA 2CF4A 1AMPA 2PIZA 3D7GA 4ZY2A 3I1UA 4X3RA 1ELLP 4B6ZA 1ZLIA 4AXVA 3KR4A 3VATA 2ZEPA 1LANA 2CTCA 2PJ3A 2NSMA 4UEZA 3FVLA 3SJXA 3KGQA 2C6GA 1LFWA 2RFHA 2PJ2A 3PBEA 5IB9A 4R7MA 3H8FA 2PJ9A 2PJ6A 4ZY0A 4P4BA 2ZEMA 3RBUA 2ZOFA 5DS0A 5CPAA 3KZWA 3B3CA 1HDQA 4MHZA 5THWA 4NGPA 1F2OA 4TWEA 3IJ3A 4A39A 1KWMA 3B3SA 4ZI6A 2BCOA 3RZAA 1Q7LA 2V8GA 4A38A 2PVVA 5HXDA 5LYIA 3NH4A 4P4EA 3SJFA 3FH4A 2F8HA 3GLJA 4PXCA 4H2KA 4OC2A 1BAVA 1XMBA 4FUUA 3SI1A 4NGSA 4PXEA 2ZEFA 3TX8A 3MN8A 5ELYA 3ISZA 3DGVA 4P4IA 4OP4A 2XEGA 3FEEA 3LMSA 4NGRA 1CPSA 1QQ9A 1TXRA 1VHOA 2PJCA 3PB4X 2G9DA 2ZELA 2C1CA 4OKOA 2PJAA 1FNOA 5D29A 4F9UA 3WT4A 4MHNA 3PB9X 2PJ1A 2CTBA 4DYOA 2ZEGA 5LYLA 1ZG7A 4R8FA 2DEAA 4ZYQA 4K3NA 5F09A 2V8HA 3D67A 5D8NA 1M4LA 5LYDA 2Q4ZA 1VHEA 2POKA 3S9NA 7CPAA 2HC9A 3D4UA 3V38A 3IC1A 3K2KA 1H8LA 1EE3P 2J9AA 3QNVA 3JRUA 1R43A 3D7HA 4OC1A 5JH9A 5K8MA 1TKHA 3FECA 2V8DA 4MHPA 4P10A 1YLOA 3H8EA 4ZY1A 4NJRA 3SJGA 3KI9A 1OBRA 1ZLHA 2GLFA 3SI2A 4IAVA 3B3TA 2ZENA 5K8OA 4MXUA 4WWVA 3IIBA 4P45A 3WC7A 1PCAA 3FX6A 1VGYA 2PVWA 3FF3A 4OC0A 1HDUA 4OC5A 2WYRA 2QYVA 3BXMA 1CPXA 1XRYA 3KQXA 4EMEA 4A94A 3H8GA 4O23A 3SI0A 1O6XA 3WABA 2QVPA 2PRQA 2PJ7A 4BD9A 2GLJA 1Z8LA 4F8ZA 4CPAA 5JGFA 2NYQA 1CP7A 5HVFA 1CX8A 3GUXA 3T8WA 4IK2A 3WC5A 1YSJA 3IWWA 4NGQA 2AFWA 4R6TA 2GREA 4OC4A 3SJEA 3D7DA 2Q51A 3IEHA 2PJ8A 3BHXA 1TF9A 3NFZA 2XEFA 3NH8A 4W9YA 1TF8A 1VJQA 2JBKA 1ELMP 1ARLA 1JQGA 1ZG9A 4YU9A 4NGTA 4ONWA 1TKJA 4NFRA 4A37A 3B7IA 4IHMA 4ZX8A 3PFOA 1Y7EA 2AFXA 5LRGA 3HUVA 3IO1A 4LQGA 3KL9A 3KHZA 2AFZA 3CPXA 3KR5A 4UEFA 4MRIA 4MCRA 2PE3A 2PJ5A 4X2TA 2XEIA 1Z5RA 4MCPA 4MCQA 4RUHA 3PEIA 2V77A 3CDXA 1GYTA 2ZEOA 2ANPA 3PBBA 2AFOA 1R3NA 3IFEA 4DJLA 5HVHA 4DUKA 3TC8A 5LYFA 1AYEA 4P4DA 4NGMA 2ZEDA 2Q43A 2WZNA 4JYWA 1F57A 4FBEA 5I4MA 3ISXA 4UF4A 1LAMA 2IQ6A 2C6PA 4MCSA 4TNUA 3D7FA 4PPZA 2GU2A 1YMEA 4UIAA 2CIJA 3BI1A 1RTQA 3L2NA 4PQAA 3BI0A 3FMCA 3NA6A 2ZOGA 4P44A 3B3VA 3N5FA 3V7ZA 4Z65A 2O53A 2PJBA 1FT7A 4NJQA 1LCPA 1XBUA 2IJZA 3S9LA 3LWUA 3S9MA 2OR4A 2OOTA 4P6YA 1LOKA 1CBXA 3D66A 1BPMA 4P4FA 3B3WA 2AFUA 2XEJA 4R76A 1CP6A 3K9TA 4NGNA 4MHYA 4FAIA 1HEEA 1QMUA 1DTDA 1PBAA 2IMOA 5HVGA 2ZEHA 3FJUA 4F9VA 1YW4A 1LAPA 1YW6A 1Y0RA 3HLPA 2V8VA 2JEWA 3MRUA 1VIXA 1ARMA 4UEEA 4EFDA 1BPNA 2I3CA 3FEDA 1XJOA 2GJFA 3VH9A 5LRKA 4WJBA 3CT9A 5CBMA 4EWTA 3RAMA 1DE4C 4OIWA 8CPAA 4UIBA 3WC6A 2QJ8A 4Q7AA 4FWUA 5LRJA 2ABZA 6CPAA 2EK9A 1PYTA 1F2PA 4OIDA 2AFMA 4PXDA 2RB7A 3CPAA 1BLLE
chains in the Genus database with same CATH superfamily
3V4MA 3X1LB 1Y11A 3NMRA 2KT3A 1T02A 2R2UA 4KSIA 1WKLA 2DGWA 4MH8A 3D4JA 2AGPA 1FJCA 4C2XA 4NI2A 5GAGU 3PHEA 3G2XA 2B7CB 3OVBA 3B35A 2C3MA 1Z4UA 2HG4A 4DN9A 4M5KA 2M2BA 2PJ4A 2BO9A 1TUWA 2P6GA 3FC9A 4P72A 1B7YB 4USWA 3OSPA 3T90A 1OPZA 1S0MA 1K9MT 5BXIA 3OUYA 1KNZA 4KV8A 3FRMA 4KLWA 2E5HA 2KU7A 3TVKA 4OZ5A 2C6GA 3W7BA 4NOHA 4R3KA 3E8OA 5KTQA 2DNRA 2PJ6A 4WF9Q 3ZZPA 1XK8A 2P0WA 2RU9A 4ECSA 4GVLA 4WKYA 4MHZA 4FYDA 2QFJA 3T1HJ 1VMBA 2C3PA 5IWAJ 5G1ZA 1Q95G 4I6WA 3A12A 2C2KB 2R7OA 2F9DA 4P4EA 4QWEA 2F8HA 3GLJA 1IKWA 1PIEA 3R5DA 4OC2A 4KSEB 4QYZJ 4E98A 1ZETA 4WBFA 4B3OB 4DI6A 2O66A 2XEGA 1CPSA 3G4SS 4ERDA 2VFUA 1YRTA 4X65J 2MGZA 1QAYA 2Q6CA 4G6VB 2BACA 1CM0A 1F6TA 5AE2A 2R2SA 4IYQA 1F5AA 3UQSA 2VEZA 3ITHA 4OYIA 4YB5A 5G0RA 5CH7B 5HLFB 1BD6A 4FD4A 1KSPA 4DV3J 1RBAA 5BYRA 3O1LA 3NNAA 1VOMA 4NL5A 2HHHJ 2BR0A 4K5RA 3DM2B 3PO5A 2GAHC 3V38A 5I42A 2KVQE 3QNVA 3AOCA 2LP4A 3MM8B 2CVIA 2OPRA 4USTA 1PILA 1ZAXA 5D0RA 4WIQA 2EVNA 3HJVA 4XDDA 2I6WA 4YB7A 2MTLA 4A2ZA 3MMBA 3UPFA 5KFIA 1Q82T 4UOFA 2XO7A 3DXBA 2Y8WA 3PGPA 1R0CB 3N0VA 5KFKA 1SCJB 3MTJA 4HHUA 4JI5J 2DNNA 3D54A 1VQNS 4ZGYB 2W9CA 2AU0A 1XMQJ 1JX4A 2BEFA 4F8ZA 4DR2F 1GT8A 5KG6A 3R5GA 2ZD1B 3T8WA 2R98A 2PC1A 3C14B 2NPFA 2UUBF 2QJ3A 3C8YA 4AVBA 3SJEA 2EG2A 2EK1A 4LBIA 2AW0A 3W1YC 1KOOA 2BEIA 2VG7B 1RACB 1A9NB 1YHQS 1H2TZ 5F8NA 2YKPA 1VJQA 5AJ3J 2YKNA 3MM5A 4DOZA 1XEZA 3SCKE 1ELMP 5KFXA 3UDLA 3AQPA 3Q8UA 2NCKL 2HNYA 4AE5A 4CGLA 3CC4S 1OPIA 3ZTPA 1VQYA 4R0JA 2FY1A 3D3BJ 3L9ZA 2D9OA 2KG1A 2AFZA 3TUIC 4URQU 3SV3A 3M6UA 4O3PA 3DLKA 3NOCA 3GJRB 2AFOA 3TJAA 5F9LA 3VHQA 3BQ0A 3RBEA 1HHTP 5LYFA 3DRRB 2WZNA 2VFSA 1S1UA 3M2RB 4PABA 4ZCIA 4ZJOA 3I32A 4PG5A 1VC5A 2GHPA 3MCNA 5J1EA 1VQKS 3VQTA 3U1NA 3N5FA 1KUXA 3HX9A 3VGUA 1ROFA 1FT7A 4XTTA 3WC2A 1X0FA 1UFHA 1S60A 3IR6B 1VBKA 4BWJA 2Z57B 2VASA 4OV6A 1CJKB 3G8WA 2W2QP 3M2UA 3UD4P 5H84A 4MIWA 3CDEA 4XK8C 3QJPA 3K9TA 2RIJA 4BMHA 1LQ9A 4QQBA 1DTDA 5HSPA 4IUFA 2WAQD 4F9VA 5KG0A 4FVMA 2CDRB 2ZW4A 1RT7A 4IRDA 4CLSA 4DDFA 3G3SA 5D4PA 1S10A 1FTRA 4Y2CA 1WELA 5CYQB 5HATA 5LRKA 3UDEA 4DNCA 1CC7A 1S0NA 2HHXA 4ICLA 4LBHA 1IVZA 3IWXA 4PSWA 1UZHA 3PDNA 4HTIA 3QMQA 2ACYA 3NGDA 2Q0YA 2D4OA 4OIDA 2HYIB 3R1KA 3QRQA 1RTJA 4N8NA 5K8NA 4GKKF 2V0NA 2YWHA 3TZXA 5CD4H 1XFOA 2OFGX 3FDSA 3LAKA 2CVEA 3I96A 1URNA 3KKFA 3B2YA 4R8UB 1SJ1A 1S6OA 5LSRA 5ETLA 4OYPA 3HO1A 3DOKB 5KFEA 4DPTA 1Z9UA 1TUGB 3Q8RB 3MPVA 3LUYA 4L89A 3IA0A 3TP2A 1R6YA 4GO7X 4QPTA 2MHNA 3O2IA 4HVZA 1SQGA 4NRTA 1AUDA 3BH7B 5JPHA 1WHVA 5JM6A 2W9BB 2HGMA 2H1YA 1QE1B 4DU7A 4RW8B 3HI9A 4ES3A 1VQ5S 1DTQB 3I1UA 3E3XA 4CLYA 3NCPA 1ZLIA 5HMNA 3I5AA 2CTCA 4KFBA 3WHIA 2B6AA 3MAQA 3QSYB 1B87A 1BHNA 3E51A 4ENOA 4YY3J 1Y5IB 4M6HA 2Z56B 2YKAA 3W8PA 1M1HA 4DV7F 2OELA 1B0VA 2KHCA 4OHZA 5THWA 7FD1A 2K1RB 1VQ4S 1T9XA 1EJ7L 4KOTA 4O44B 2DNQA 2QT7A 4DXLA 2HEKA 2CNOB 2HBYB 2Q7BA 3NH4A 2G0JA 5LM7E 3FQKA 2MZSA 3M8ZA 2WVCA 3L7UA 2B0GA 1X31C 2XWYA 2QECA 4NXMF 3EMTA 3ISZA 4A8QA 4G3IA 4OP4A 4EFAC 4RW7A 1RAIB 4OYOA 4B9UA 2H5MA 4DSEA 2VC1A 2X7IA 2E9TA 1QVFR 2YGWA 2HHVA 4QBUA 2CTBA 1S3ZA 1ZTTA 1DJ0A 5LYLA 3CC7S 1WNEA 4R8FA 4DPOA 4KKOB 2MJUA 4WYLA 1OY9A 4MKYA 3JAMU 4K3NA 2GA7A 5HAOA 1N33F 2FLNA 7CPAA 3D4UA 4EBCA 2R1IA 1QM9A 2M3DA 3KTQA 3D0GE 4ID5B 5KG3A 4ES1A 1JB0C 1R43A 3KJNB 1BQNB 5C82A 3HSZA 1XR6A 2IYIA 1HWKA 1LKZA 4ED4A 5IT0A 3UI3A 1TK5A 4A4JA 4B3RF 4Q0BB 3BGLA 3WR7A 3TEGA 1SKUB 1AB8A 2Y1JA 4U9YA 1HDUA 1RT1B 3EGNA 4LFCJ 2XYPB 1I12A 1ZAWA 1IN0A 4LF8J 5KT2A 1RLCL 1MNEA 4CS0B 2EEYA 4LR9A 5AXLA 1YGYA 4WE1A 4J9LA 3NGRA 4PG8A 1CX8A 1NCLA 4F0MA 3KMSA 4OZ3A 3D28A 5D4OA 4YOEA 2M5YA 1SUQB 1I1DA 2CQBA 4L3KA 5DRKA 4JI4F 3IEHA 4UUXA 2H5EA 1YZ7A 1HYSB 3MEEB 3DDNA 4RUBA 5KT4A 3TAMB 3C16A 4KH1B 2DRDA 4OX7A 1E6VA 3AH6A 5A2QY 3OL9A 1AUGA 3W65A 1TL7B 2HWTA 4J91A 1JQGA 2YNIB 1REVB 4MTPA 1VQ8S 3LPYA 5C88A 4IHMA 2G13A 1PG5B 3PX6A 1YDLA 2OEJA 4OZ0A 2ZH9A 4CAFA 2E7XA 3VWSA 4USHA 1G2EA 2CAJA 3TJ9A 4DQSA 2PE3A 1Q79A 4WP8A 1D0EA 4TU8A 3IGRA 4RUCA 4NLPA 2FGOA 1S7IA 3BN4A 4QZVB 4WWSA 4DJLA 1S1VB 4LF7J 2X1AA 3JSYA 2G2ZA 4NLOA 2EK6A 3WDOA 1J5OA 2UU9F 4Y2AA 2ZM6F 1OSDA 3MM9B 4MFPA 2R42A 4WU2A 1TTHB 4CH0S 1I5OB 4AFFA 2QG9B 1OMSA 4P44A 2OPSB 3V7ZA 4IQMA 4F2SA 3RB3A 1S77D 2PJBA 2NLWA 2REFA 1Q8LA 2YWWA 3LQVA 4PG6A 4OJ1A 3B3WA 3DNCA 4HNXB 4ZPWR 1YWXA 3H42A 1MK4A 4KJIA 2KO1A 3KG4A 3B82A 4DG1A 1ZA1B 1UTAA 1X9MA 4F0YA 2FJEB 2JLEA 3VAMA 1HNWJ 2E5LJ 1YREA 4GS4A 2ZNYA 2REEA 3CJKB 4IDKB 5D3GA 4EO8A 2MKYA 3V81B 1JKHB 4FXWA 1BPNA 1LW0A 4DLGA 4KE5A 2LQ5A 2H4YB 4QW8A 1NKBA 4ZVTB 1BQMB 1SC6A 2NSBA 1RXTA 2OP5A 4FWUA 2VPXB 1HARA 2W7OA 4DBQA 1JXLA 1YVFA 4DV4F 2V34A 2IJNA 4IG0B 4LMZA 1QDUB 3HXMA 3NLCA 3QBCA 2EWBA 2VQFJ 4U9RA 2QGFB 4QWCA 2DNGA 3OFEA 4ED8A 1S1WA 4B3TF 1RKJA 4TYAA 5D77A 3J81j 1Q2YA 4CLUA 1LWFB 4WP9A 4DPUA 3GB0A 2Q66A 4ZPTR 2DNYA 2ZXVA 3DXSX 3AD7C 4C7IA 3J81Y 2AFSA 4JV5F 3CCRS 3Q2TC 2W24A 3KLVA 1LRZA 4J9VA 2C1EB 3W8GA 5F8LA 4CGPA 4DSJA 1S9EA 3UN3A 2DTJA 2I5JB 5A0YA 3CCTA 4Q38A 3BLNA 4QWDA 2ZE2A 1NSQA 2R7VA 5KFFA 4YDDB 5L1JA 4PQUA 3NBPA 4X4NA 2JDCA 2R7HA 3IGNA 4CRYB 3OUYB 3R9FA 3S6GA 4KV8B 4CO3A 2GIFA 4TN2A 3KOAA 5C24B 2MZQA 2EXUA 5SUHA 1M44A 2ZEFA 4P7TA 3E01A 4P4IA 2QO3A 4CAXA 1SC4B 4F4ZA 2HQGA 2NS1B 4P75A 1HWLA 3W5XA 5IOLA 2PJAA 3H4QA 1RWUA 2BRLA 1B6BA 4PZVA 1CJWA 2JNJA 4ZIVA 1TP7A 2C2EA 2PE8A 1W7WA 1JLQA 4H89A 1ZG7A 4C48A 1N71A 1IKWB 5AG5A 4BBHA 3EM1A 4QIFA 4ITSA 2JWNA 3SCIE 1Y3JA 2J6TA 3HVWA 2LECA 1VISA 3K2KA 1EE3P 1MN9A 3I4HX 5K14A 4GRSA 5E3CA 2XTJP 2I79A 2XO6A 4KOWA 3NS7B 2DHAA 4XAKA 3ITHB 1UWBA 3VAJA 3FEZA 2FTRA 1U7LA 1UCNA 5G0RB 1ZLHA 4QR2A 4CH7A 1U6BA 3R7NB 3MAHA 3SQGB 1BC6A 3CVKA 4OX9J 2OI2A 2CPHA 1Y5NB 5I42B 2JLMA 3ZTSA 2AEMA 2KM8B 3THTA 3OXFA 2NYQA 2MMYA 4TQSA 3LP1A 1OYEA 4DR1F 5HVFA 2EC0A 3FCWA 1R6VA 2F40A 2OEKA 1KKHA 2X7BA 4LF6F 4ZVQB 5IV0A 1YBUA 2YXLA 3H5XA 4ZJLA 4Z7CA 2BQRA 5DDPC 3F41A 1UFKA 3FBEA 2XEFA 4J9NA 2W9CB 2GVDA 1FF2A 1SIZA 2MLXA 2DVIA 1V5VA 3W3SA 1VLOA 2MQOA 2HHQA 1T9UA 4LFAJ 1GK8A 2LEBA 4C68A 2HHWA 2EFPA 2W4CA 1KVKA 2KZMA 4ZX8A 2XSFA 2FGCA 2AFXA 3P6YC 4RZRA 4DCOB 2L41A 4LSLA 4ILMA 3RB0A 2KZZA 4J90A 4P7VA 3GFZA 5KT5A 4ONUA 1WEXA 4DR6J 3O8WA 4XPCA 1NHUA 1IM6A 3T9ZA 3P4UB 1SJ3P 3IAS9 2YKNB 1BMQB 5HVHA 2V68A 1AYEA 4FNHA 2ZEDA 3TI0A 1BWEA 2KHDA 3W5YA 4ZPBA 3LOUA 1U1OA 5ETSA 2QEXS 4DR5J 3UWTA 5KFWA 1DFDA 4PQAA 3FRYA 4DUZF 4DR3F 2A10A 4PRFA 3DLKB 4DX8H 1BGXT 3AXKA 1D9AA 2L48A 2OSRA 3LWUA 1L3TA 4KT0C 3FKBA 3QJJA 5HQLA 1PAEX 5ADZA 5E0OA 2ABYA 1L0CA 2AFUA 2JH3A 5FLXU 3OVSA 2QIRA 1HFEL 1S1UB 3P5BP 2ADCA 1UKUA 4ZVUB 1HEEA 3SCLE 4IFYA 1WORA 2IA6A 1YW4A 4ZDNA 4E8OA 3ENWA 3IMQJ 4PR6A 4E0AA 2FLPA 3EZ5A 1FX4A 2ALZA 1WACA 1EB0A 4L73A 1P6TA 3LF0A 2GJFA 3M2UB 1ZAVA 4Y3CA 5LJ5Y 3GG0A 2HRYA 1H3DA 1XIQA 3N7ZA 4J3GA 3B78A 2HGNA 4N5SA 4DQRA 4IR9A 4DF4A 1EX8A 3TUJC 2DNLA 2P6EA 6CPAA 3OTCA 2JRSA 1QY7A 1ZM4A 4CYUA 2IVMA 4KGZB 5F8MA 1RT7B 4I69A 2W25A 2PIYA 2VONA 2G1DA 3NOGA 3D68A 5B0BA 3EWGA 5C2GA 1RCOB 4ICLB 4N41A 2OMLA 2QLBB 2NQPA 2XC9A 1CVJA 2J8AA 4FF2A 2BOAA 1SB6A 2MLYA 1X9SA 1YJ7A 5ETRA 2DITA 4X64J 4ZITA 1KRPA 2NR0A 1LXNA 4LVNP 3PB8X 3N6NA 2PRBA 4WTYA 5M2RA 5JVHQ 3Q8VA 4HDGA 2B43A 2YWEA 2OGUA 4GMKA 1UVLA 1FJGJ 1S1TA 3T41A 2PIZA 3ZZYA 4NE9C 5LSOA 5LMUJ 1LEOA 3TR5A 4Q43A 1SJ4P 3HULA 2QA1A 2DBBA 1LFWA 2RUGA 1V3ZA 4DV0F 3PBEA 2OB0A 1IR2A 1GTHA 4FD6A 1SVDA 3DGPA 2CJKA 1GMVA 5KT6A 2HHTA 1Q86T 1SH2A 1C0UB 2YX7A 4ZVPB 1TAQA 2QL9B 4DL4A 3DHXA 5HMXA 1DARA 3OT9A 3PKMA 3SJFA 4PXCA 1FD2A 4MK8A 3G6VA 2R8HA 3TX8A 2KDOA 3P49B 1PKUA 3CB4A 3P2FA 1WOSA 4DV3F 2VJUA 2FJDB 4DSLA 1F5BA 3HLUA 2RRBA 1FO1A 4HHHA 4DYOA 3IGVA 5BJRA 3J80Y 3Q8YA 4KO0B 4J9PA 3EUNA 3CE8A 2BOPA 4DV1F 5DGAA 2J5AA 3M32A 3PM9A 4H4MB 1RSCA 4NZ0A 4BS2A 4DL5A 1WG5A 4YEAA 2DPIA 3NAIA 1VRQC 3MFIA 3W2WA 3IS9A 2Z0ZA 2CA9A 1W26A 2BANB 1LXJA 4QOTA 1PSDA 4FF4A 2LU1A 3FECA 1HR0J 3GSDA 2WW4A 3G6ES 1RWXB 1WEYA 3M30A 1Q7YT 5J1NA 1XMQF 2FE7A 3GFHA 2P8IA 3HZEA 1PCAA 4QB9A 2RDJA 1F3FA 2PMZD 2BE2A 1FRIA 1SL0A 3PR4A 3CCES 4A94A 1VR6A 2OPQA 4RU9A 4B5OA 1FRXA 2QVPA 3MECA 3VTIA 3PY8A 3CMES 2VPZB 1FDBA 2BJ9A 4HEA9 3SFGA 5AJ3F 1S48A 2KJVA 1SKWA 1J4JA 3DNSA 1S76D 1TK0A 4C8OA 1U26A 3NNHA 4RU2A 4A8FA 4F25A 3GIJA 3TARA 4KBIA 1NNDA 4Y2KA 3AY0A 3HT0A 4FN5A 3M6VA 4WE1B 3QJLA 2D74B 3CW2C 4K0KF 1IU8A 5L46A 2CNNB 2ASLA 1HHSA 2ZNZA 2NYIA 2G3TA 3SEOA 1Y7EA 1I21A 3D1OA 4DQQA 3HUVA 5F0WA 2QMLA 1YGHA 4RWWA 4J9SA 3KL9A 4U8YA 4LF5J 1RAAB 3EICA 5I3UA 1U1NA 2E1MC 1ZM9A 1YITS 1W2BR 4OLOA 3C16B 4DUTA 1D1UA 5B0FA 2DHXA 1IR1A 3CUNA 1DBDA 4OMFG 4C7HA 2GGPA 3KMQA 2Q43A 3CJQA 5J8CA 3D7FA 2EUIA 3BBFA 2M52A 3B3VA 1U8SA 5KFLA 2KYXA 5ETPA 3HSDA 4C3LA 3QAYA 4B14A 1FKAF 2UUTA 1J5OB 1CBXA 3CIMA 1GMWA 4IO9Q 4PEOA 3QGIA 2AJ6A 2WSCC 2RAQA 4Q2LA 2HLUA 1QTNB 2K5TA 4X4TA 3EZUA 3AJDA 2PIIA 3GY9A 1WOOA 1PYSB 1R7IA 2XMUA 4A8MP 3FZ2A 1FERA 1YVOA 4LBPA 4ID8A 4UEEA 4NASA 4F4KA 3AJ1A 4O3RA 1XJWB 5ETNA 4J7CA 2HVIA 1JNZB 4OIWA 1M5SA 2JEGA 4U95A 3TZYA 4FBUA 4DG1B 4PPDA 1NPPA 3MMAA 2GIVA 2RILA 1KLMA 3GONA 1D09B 2DJWA 1EKRA 2HK3A 2CG4A 2JVOA 4F3OA 1X12A 2M7SA 3AXMA 2CFXA 2RVJA 4BBYA 5D3GB 4B12A 4BLGA 5MAOA 3NP5A 1KLNA 2FB0A 4E2AA 3NE7A 3S7RA 5D8HB 4WCEQ 3WZ0A 4CLWA 2GAGC 3KQZA 3DI6A 3VVTA 4PAAA 3M4XA 2V67A 3UO0A 1RWMB 4JI0F 3PO4A 2HS0A 3LP0A 2Q1LA 4GM5A 1FXLA 2KFNA 1T9WA 2DXEA 4G65A 1H7XA 1SQFA 1ZZFA 2C2OB 2IVYA 3TUZC 2GMLA 1RAEB 3QFHA 2XZWA 3I5CA 4F2RA 3UR0A 4JI1F 3T6BA 2XI3A 2DGSA 3KXDA 1WK4A 2OAUA 3FMBA 4CM2A 2EW9A 5KFBA 1R31A 3D3SA 3KR4A 4A31A 4UZCA 1SKSA 2HK2A 2I9SA 5KFPA 4DCJB 2Q04A 1F9EB 5HJXA 5IB0A 5M2UA 1RT5A 4JP8A 2P6FA 3GSIA 4Y34A 5CPAA 2OH2A 1NH8A 2EWHA 3K5PA 4NGPA 4JI3F 2OU2A 2IA0A 2ODFA 2BCOA 4A38A 2PVVA 1S9EB 1BQXA 1RTHA 5A0YB 2LDIA 4NGSA 4DWIA 1HD0A 1U6MA 5L1KA 1B70B 2XMMA 4LF4F 1Q2DA 3AQOA 3M8RA 2UUBJ 5KFSA 1JLGA 2C1CA 4PQUB 4OI3A 1JJ4A 1RZMA 3NBPB 3W64A 4RNHA 2J9CA 5EHHA 3POTA 4I2PA 4K4VA 1RT6A 4NYZA 2A18A 1B64A 4DSFA 3OHAA 3NNCA 2GVZA 2DGTA 3IR5B 4UFVA 1V0CA 2JEVA 2BUNA 2JVRA 2Q4ZA 3E01B 4X4UA 5A8WA 3OL6A 1T03A 5LMNF 3R9GA 2JFKA 3CDAA 2PO4A 2Q79A 4LFCF 5D4NA 3I9ZA 1A2ZA 1JLQB 1LWEA 3HHEA 2GLFA 3SI2A 2CG8A 5CZVA 3TRGA 1SI9A 5L38A 3HK2A 3CCVS 2QYVA 3FIXA 2YH1A 1VQPS 3MR5A 3I9V9 2CADA 5D15A 5K14B 3EJMA 3WABA 1GXUA 2PRQA 5A8KB 4MY3A 4JLYA 1AA1B 4DJBA 3GR0A 3OTEA 1UWBB 2XNQA 3GIIA 1D8YA 1Y7RA 2NREA 3BKUA 2LCWA 1NAQA 1YSJA 3IWWA 3HHLA 2DCUB 4R6TA 2R7WA 5ETOA 3KUHA 1FD8A 4MJKA 3IBWA 2Q51A 2JDDA 4KGKA 2HBRB 1UEKA 2HIQA 1TKXA 3PYGA 3W62A 2QLXA 2BV3A 4CYOA 1UA0A 1FRLA 2GMJA 4PK2A 4ES2A 2ROEA 2D7SA 2Q4VA 5KFRA 3G82A 5AG4A 1CC8A 1NU4A 2F1FA 2EBJA 4UEFA 1DLOA 2V2VA 2UVVA 1NK0A 2IC3A 2CNTA 2KFZA 3KNGA 5KFMA 2CJBA 4RNFA 2DYAA 1X10A 1Z5RA 1XR5A 2VFTA 3MI7X 2O28A 1QSSA 1MMLA 4K8RA 3OFGA 4QU7A 3EC4A 3ZZRA 1CPZA 2B4BA 5G4DA 3H40A 2UP1A 1QLNA 1APSA 3I9SA 3BKFA 3H90A 2DF5A 2WSEC 1HI0P 3ISXA 2AF6A 3MMJA 3EVWA 2BKNA 1I6JA 2DIVA 3BI1A 4CGNA 2F65A 4K2JA 3F73A 2ZBIA 1IR0A 3AODA 4ILRA 1Z4RA 4HHJA 5IS2A 2NZCA 1XTZA 2AX1A 3C15A 2HVDA 2E5LF 5DGBA 3NL0A 3FK4A 2G0CA 2CWKA 3HHLC 1RDRA 2ZC4A 3DLGA 1CP6A 2IPOB 2KTQA 4N8OA 2HFSA 3M8PA 2GJIA 2CZVC 3RTVA 4K4YA 1FNMA 3KG1A 5J8FA 2LEAA 3DDIA 1BWVA 3CWJA 4OAEA 4OI4A 4JB8B 4OX8A 2PD1A 4M5DB 2BVZA 5CYMA 2M4MA 3VH9A 4F67A 2YPZA 4K4ZA 2VQFF 2OSQA 3JQMA 3SSQA 1Y5LB 4DV7J 1Q4RA 4CM0A 3T1YJ 2R7XA 2L9DA 4KQZA 1UJ6A 2H54B 1TKDA 5MLCV 1X60A 1Z4EA 2K7KA 2YX4A 1K1SA 2JBJA 3EVMA 3VWDA 1HIYA 2Y0BB 4DX7A 3PIOQ 4NXMJ 3LANA 1OY8A 4DFPA 5IQQA 2AYMA 1RA6A 4V1Ak 4X8IA 1SKRA 3ZTOA 1T3OA 2BM0A 3LA0A 2FJXA 4UWIA 1IXKA 1CSJA 4DR4J 1KBRA 4DPXA 5T14A 1LK5A 1NK6A 1WF1A 4YR3A 3BH6B 1VKCA 2J0QD 4WFNQ 4EYHB 8AT1B 1GMWD 5DM6Q 3ILOA 4IOAQ 1HQUB 4F02A 5KFZA 1H2VZ 5F0UA 1MSWD 4DR7J 4JUZA 1LK7A 1U1PA 1FKOB 4C97A 1HI8A 2BE7D 1YQHA 2E1PA 1H6KX 1M1DA 5DS0A 4B3RJ 2DXFA 1XEBA 3Q83A 4O4GB 3ZZZA 1F3VA 4H6ZA 2WRMA 3T3FA 4KOUA 2V8GA 2FVSA 4UY8T 1S1TB 3Q89A 4GKJF 5B0GA 2RQMA 4H2KA 1S1XA 4AG9A 2W4DA 2B4VA 3MN8A 1S59A 2FZGB 2HFOA 3H25A 3DGPB 2PJCA 5DQHA 1FWPA 1HLWA 3G87A 4X62J 4FNIA 3Q23A 1REGX 3HD2A 2C2ZB 4FKYA 2X51A 2XMKA 2HRUA 3UR3C 4IRKA 1U02A 3K59A 2IDEA 2GC8A 2ZBCA 4X4RA 2FJBB 2HC9A 2DT9A 3IC1A 4ZP6A 1JJCB 3CJ4A 1H8LA 4C3MA 3CXCR 5KG1A 2WK4A 4AVAA 2WUUA 4I0WA 3O6QA 1IQTA 1I94F 1UWAA 3KK3A 4YGOA 3KLHA 3A13A 1RYRA 2VD3A 1L3UA 4MXUA 2I00A 3VCDA 5RUBA 2O01C 4RW9A 4GC6A 1NJYA 4R9MA 2FHJD 2KL8A 5GAHI 3M32B 3DYAB 4C8LA 1S12A 2OKQA 2ZM6J 3BXMA 1CQNA 4LIWA 2QTWA 2MKIA 2DR7A 3CJSA 3IS9B 4EI2A 1JJHA 2BE9B 2FVCA 1YX2A 2J9EA 1NDPA 1D8ZA 3BM7A 5JGFA 1YBTA 3SV4A 1QD1A 2O67A 3UY5A 1U48A 2AFWA 4YHHF 3VAIA 2E66A 3D7DA 4U6PA 2D3OR 1Q5YA 2JJ4D 4IQXA 2XGPA 2OZHA 1MJAA 4W9YA 2JEFA 1J5EF 1RE1B 2DIUA 1VI7A 2QA2A 4WP3A 3MECB 1EETA 3B4MA 2BJEA 3KUGA 1ARLA 4LX9A 2K2PA 1ZG9A 1IM4A 4LQ6A 5IQ6A 4DR6F 4PSXA 4P2XA 4ZVHA 3CPXA 4B5PA 3VAKA 3W66A 4DR5F 8ATCB 4Q2MA 4AXIA 3ZZ0A 4ZLPA 2Z3KA 1W25A 1HNXJ 2BQUA 3CJ2A 4DV4J 1AW0A 3CXQA 1IBLF 3QSIA 5A28A 1LAMA 2IQ6A 4PPZA 4LR7A 2GU2A 4UIAA 4YUDA 9ATCB 1FWKA 1YVKA 3IR7B 2Z3LA 3FMCA 2MZTA 2O53A 3BJ8A 1LCPA 4WZMA 2IJZA 3K5NA 1Z8WA 5KTAA 2P2CB 3MUVP 4RW6A 2XCAA 3HHDA 3D66A 3I6PA 4E8UA 3DLBA 1DAXA 3JYTA 1SJRA 4UA3A 3HHLD 3SFUA 3BO4A 4IUSA 2J8MA 1X4EA 3OXGA 2A1BA 2GJ2A 1Y0HA 1S72S 3I4PA 2VPWB 4WFZA 4ZJQA 1RHQB 2JFDA 4CYQA 4WU3A 4DHVA 3R96A 1NPRA 3LAMA 2BMBA 3HFZB 4RW4A 2ZVSA 2D9PA 2JDJA 1DE4C 2ZHOA 4QVTA 3DRSA 3M2VB 4ZKAA 1T3NA 4Q8EA 1OJ4A 3MEKA 5EGYA 2GIQA 3KK2A 2HQYA 1UWYA 2C42A 4TY8A 1YQEA 4S0MA 4ZPAA 2VU5A 3UNGC 4K50A 2MKCA 1FEHA 4IG3A 3NRBA 4X64F 3NH5A 4UW2A 3AOAA 3L7OA 2L08A 2HQFA 3MMAB 1C4AA 3JTKA 1KLMB 3BYPA 1FJGF 6FD1A 2PT0A 1NXIA 4OC3A 5LMUF 4DL7A 1EIYB 1VQOS 4B11A 3JTPA 1UEUA 3A4TA 5GMEA 3W2VA 4IFVB 1CG2A 2GQ2A 1SPBP 3RBZA 3DI6B 2LEPA 1VRTA 3VARA 2DGOA 1R0AA 3NS6A 3JQJA 5EDWA 1S57A 1RISA 4A8SA 3BJ7A 1SJQA 5A2QU 1GFWB 5KT7A 1LANA 3KG0A 3CZXA 5L1IA 4CI0B 4JI2F 1O51A 3AFGA 4ZY0A 4KGXB 4EEYA 1JLFA 1UVNA 4HR2A 3TE4A 1SIWB 4M5LA 2QSFA 2UXDF 2A2DA 4B17A 5J2MA 3H4DA 2ALYB 4BWMA 2V50A 2A3JA 1GX6A 5GAHU 5EMIA 1VYAA 4DR1J 3FEEA 2H9ZA 1KP6A 2G2YA 3OR1A 4LF6J 1WWHA 2Z2MA 4IR1A 3OSNA 5K5MA 1I1GA 3RRHA 2PJ1A 3QT7A 3VV2B 4G1QA 2MQNA 2BZ2A 3QRRA 2JC1A 3F44A 5KFHA 1YJTA 1RTHB 2XSJA 2Y3YA 5DWMA 3NXZA 3GIMA 3T5HA 5LYDA 4TYBA 3TZWA 3KWMA 2HSEB 4NLVA 4NLTA 5D6GA 4F4AA 1HHQA 1N6QA 1RT4A 3TOBA 1NK9A 3MWBA 2FCKA 2VA3A 1M4DA 1T0TV 3POTB 4I2PB 1XQIA 4KIAA 1RT6B 3VF0B 3SJGA 4ZVRB 4WPAA 2GVZB 1FFGB 1WHXA 2RQCA 3IIBA 5KG5A 1AXQA 3ZTQA 2HFNA 1XC9A 2FSRA 3MGDA 3CJ8A 2QSWA 3B8GA 5A8WB 1T03B 3EGVA 2KVIA 5DDOC 1O6XA 5F46A 5HMWA 2CPEA 3UFCX 4BC9A 4J5OA 1LWEB 3HFVA 1RTIA 1XOVA 3CNQP 1XERA 3G6YA 1MMDA 1X8DA 4OC4A 3D0IE 1YJRA 4ZCLA 1S6QB 3S1TA 4BINA 4NLUA 4O0NA 1TF8A 1U2CA 2W7PA 5DG7A 3I82A 1FCAA 4LF5F 4KYZA 1W2IA 3OBIA 2D3O1 2OJ3A 4WXWA 3U7JA 2Q3PA 2QV6A 4K59A 3F56A 1LOUA 2CRLA 1CJVB 3J81U 1Q78A 5LRGA 3HHLB 1QUPA 2MLZA 1NE9A 3KHZA 2HAFA 2B58A 1RHKB 3NMAA 2HUZA 1TKXB 2Q44A 3LW5C 2ZEOA 1TELA 3PBBA 3MCSA 2AWZA 3VGVA 1WC6A 4J9RA 3V6DA 2VQYA 2VZZA 4DUKA 1ACMB 3VVUA 4FDFA 2R8VA 4LF2A 1WKJA 5U47A 2NXUA 3G82B 1FNXH 5IM0B 1NMEB 4F8RA 1DLOB 4I56A 3OTOF 4C8YA 1DZ5A 1JLEA 3BI0A 4Y0FA 2UXBJ 4WYWA 3MGJA 3BO3A 1AFJA 4NA2A 2MKKA 4IO1A 1YJ9S 3PYDA 2DY9A 1EAYC 1MWQA 5E5NA 1X5TA 3EDQB 3RAXA 2AGQA 2HQIA 2RNEA 2RHQB 2D69A 3CXPA 4MHYA 4HLBA 3HSGA 5KOXA 1EARA 1K47A 4M63A 1B7FA 2ZZTA 3K5OA 1YJVA 2LDYA 1UW9A 1VIXA 5CZXA 4ECRA 4FKXA 1DQ8A 2WVDA 3C15B 1NK7A 3TAQA 1KFSA 3MD1A 3IWNC 1JLAA 1RWVB 4DV0J 2D3ZA 5J1PA 3PW4A 2PQ8A 1KR4A 3PYEA 3ZTRA 2RS2A 3ZC4A 1RTZA 1CJUA 3M8PB 3GFYA 2FZKB 2KXFA 2ZW7A 2ABZA 4CP5A 3AD8C 3LALA 3QAUA 1D3WA 3JSBA 1JWWA 3NEKA 3QGHA 4XPEA 4TXSA 5CYMB 3H20A 4DUYJ 4FYWB 3UCZP 2LA4A 1JWQA 4B9TA 4QR0A 2UUCJ 1YR0A 3EO4A 4DFKA 4B3SJ 4M5JA 3BB5A 2ASYA 5HQ8A 2NZ4A 2OH1A 2NMTA 4ECUA 4DV1J 1RAFB 2VB6A 3BQ1A 2Z10A 5IV4A 2VFVA 4UBRA 2COLA 1GNKA 2XWXA 1YRUA 2QLFB 1VHFA 5B0DA 5LJ3Y 4CO4A 3F0AA 2QE5A 4FPRA 2AYBA 5B09A 1ELLP 2GMHA 4L72B 3BSNA 2H4WB 3GTYX 1KQFB 4V19J 3ZXWA 3FVLA 3SJXA 3MCOA 1WWZA 1Q8BA 5I0CA 2CJYB 3H8FA 2PJ9A 2EKYA 4M1KA 2DCLA 2HLTA 1RHJB 4EGLA 1M5OC 2B9YA 1RHMB 5L39A 3IXQA 1GQEA 3KUEA 2RE1A 1S7HA 3B3SA 4DEZA 3V4IB 5A27A 2YVSA 4R5PA 2QLWA 5LYIA 1X0PA 4Y49B 2M8DB 2IM0A 4H4KA 3CCMS 2MZRA 3KHLA 2UUAF 5KT3A 3ZZUA 5ELYA 2P6TA 1H98A 4KOYA 2HWIA 2RF2A 3PB4X 2HURA 2PC6A 5KAKA 3P8BB 4ZVGA 1Y9OA 4MKAA 3JSMA 1QVGR 2VBXA 5F41A 2F4FA 2QA4G 2R9LA 3BDEA 4KOVA 5F48A 1S1XB 1RB0A 2BDPA 3MOZA 5F09A 1TL5A 2RJZA 3SBMA 4K0KJ 4HT5A 4ZP7A 2XS5A 1K8AT 2KXHA 2POKA 3S9NA 2DNPA 2KM8C 1Z2ZA 3SQOP 4X4QA 1HNVB 3J7YI 1KUYA 2QL5B 2EFVA 4EYIB 2V2KA 2KT5A 2B5GA 4ED3A 3D7HA 2PSZA 3QWUA 2Q6BA 4MHPA 2BJ7A 4P10A 2A2CA 4NJRA 2UVUA 4C0OC 4FYYB 1Q53A 1KUVA 2OZUA 1QAXA 5C25A 5H9FJ 3ULHA 3TA1A 3BGRA 3ZNJ1 4MYUA 4JI8J 2AT1B 2ASDA 4MFQA 3GJTB 3PV8A 4O23A 3T9NA 3I0SA 2GLJA 3TO7A 3IM8A 4Y00A 1CS4A 5KFGA 3GZ7A 4PCQA 1S99A 3KLHB 3TTHA 2EFQA 1EZZB 3NGUA 3LTOA 4NGQA 2CPFA 3MM7B 4RW9B 4ZBGA 1WSVA 4C98A 5ETQA 4RX6A 1YKWA 3RBXA 2ERRA 2DO0A 1RQ0A 3DM2A 4NRUA 2KI2A 3N4WA 2YTCA 4CLZA 2Q7SA 3ICLA 3MM8A 2NUHA 4NGTA 2CJXB 4N47A 1R8CA 1ZYQA 2LQ9A 3TVYA 2J9DA 3EFAA 3C19A 1EQMA 4TNOA 4GVBA 4F0XA 5EX0A 5EWEA 3W9IA 2F3JA 4P73A 4ZVEA 1GYTA 2DRBA 1YJWS 3R2DJ 1FI4A 4OI0A 1TL4A 1EETB 2HBQB 3FSXA 1FY7A 4QBJA 2CIMA 1L3KA 1CULA 3D6HB 2FLLA 1HBOA 5CAAA 2C6PA 5T7LA 4MCSA 5GADI 3C46A 1CQMA 4B5PB 1KN6A 4MJ8A 1VQSA 4LVOP 2DXDA 2LFVA 4USJC 4JI0J 4Z65A 2B4OA 3ELHA 1V6HA 1WG1A 1UVIA 3CMAS 2FL4A 3G8TA 2V94A 2OR4A 2HBZB 2OOTA 3V6KA 2J6UA 5KFYA 3ET6A 2HQDA 1JMTA 4TVAB 1R0BG 4JI1J 2N82B 4WFAQ 2FJWA 1PYOB 5J2NA 1S7LA 3BF4A 1CJTA 1XN9A 3WQPA 3J80U 2HVHA 4YB6A 2VH7A 3HJFA 3JUWA 4NEYA 4DCPB 2XY6A 2PFFB 2KKHA 1F2GA 1KOHA 3T1YF 2R2RA 1PGZA 2PDAA 2WVFA 3M7VA 4YB1P 4RW6B 3VAGA 4B9MA 3JYTB 3RAMA 2B5JA 1WEZA 1UJ4A 3K8VA 2DHSA 2QJ8A 5H9EK 1GX5A 3US5A 1SBRA 3IWGA 4CGMA 3BKTA 4JI3J 4RBVA 2XGQA 5KFQA 2M70A 1PAUB 4DLEA 2BXJA 4AL6A 4DS4A 5J1QA 1MG7A 2FPHX 3CD0A 3GKRA 1KD1T 4ED7A 3CO9A 1RWPB 3M9OB 1Q1KA 1FE4A 2VFRA 5E96A 4DR4F 4LRAA 3FVYA 1IY7A 3D9BA 2ZH1A 2C6CA 4NEXA 3BR8A 3F5BA 4LF4J 4MFZA 4C7QA 4A30A 4R3LA 2RDDA 2IFXA 4M5GA 4U9ZA 3DRSB 4JD6A 3JTOA 3P2HA 1RT2A 2NSCA 1ZG8A 2E1CA 4I49A 4Z37A 2CNSA 3TFYA 2YNCA 3KK2B 1WUUA 4DR7F 2ROPA 1LWXA 2WTFA 2VOPA 1FVSA 1RWKB 5D0EA 2AJQA 4TY8B 2JEJA 1GHEA 3SYZA 3PACA 3QZ7A 4JBCA 1IBMJ 3RJMB 3GQCA 3MMCB 2RUSA 3UD3P 1Z2LA 5LMNJ 1ZA2B 2CF4A 5CYQA 4AXVA 2G0BA 2LU2A 2PJ3A 4EZ6A 2AKWB 5DDRC 5D78A 4HH1A 3DMJB 3CXSA 4CO0A 2ZEMA 1ZPVA 1XMOF 2BJ3A 2KG0A 4H4OA 4N7TA 3GPAA 1MROA 3J7YU 4URSA 3KHHA 3MFHA 2C22A 3W2VB 4ZI6A 1XBWA 2CNMA 1QUVA 1VRTB 3C6UB 1R0AB 4C3KA 5HXDA 1WC4A 2C2NA 2VDHA 4X62F 2W2MP 4ZMMA 4B10A 4DFJA 4M6IA 5AG7A 2FVPA 1X4AA 2QYGA 1L5UA 1TXRA 1JLFB 4YS2A 4OKOA 2BM1A 1HD1A 1FNOA 2ZJRQ 5D29A 1NZAA 4EUVA 2DXQA 3PB9X 2WCXA 2AYGA 5DG9A 2HFZA 3R5JB 1Z8TA 1UFLA 3OTDA 4MK7A 3S8SA 4I2QA 4DV5J 1DTQA 5C42B 4PG7A 2RT3A 3M1VA 3K57A 1TIQA 1YRXA 2J9DE 5CQGA 2FT0A 3R5CA 4ECXA 2AX0A 1F2HA 4AD6A 4UY85 5K8MA 1P9QC 3IU1A 2P6SA 1BY9A 1WC3A 3J7ZT 2APOA 4G1QB 2K1RA 2EKNA 2VPYB 4AL5A 3D3CJ 5K8OA 4WWVA 2XSJB 4OLPA 4NYOA 4NLGA 4P52A 1FTCA 1T8EA 4C6AA 4OC5A 3DLHA 2XS7A 2FVQA 4DV2J 1CPXA 2UXCF 1PBUA 3FBCA 3SI0A 4M5NA 2ROGA 2VQEJ 1Z8LA 1WI8A 1N0UA 4Y2IA 2I0XA 4IRCA 1N34F 1XF8A 1VDHA 1TQLA 4O3QA 2E29A 1DQAA 3TNVA 1OIAA 4FD7A 3F8KA 5GADU 1WF2A 3I31A 5KTCA 1NKCA 1U2RA 2G4BA 2FIUA 2QFIA 3MPWA 3KK1A 1RBLA 4WTOB 2BKOA 3DKDA 1C1CB 1J27A 3EY5A 3UVJA 2B9WA 1VHSA 4ID5A 1FHTA 1X5OA 1WTFA 2ACMA 5IT4A 1TKJA 3HVAA 2R2TA 1WC5A 1BQNA 1RAHB 1S49A 1RTIB 3H8YA 5GAEI 1U47A 4MIBA 3BN7A 5ITHA 1HNXF 2BL1A 1RLDA 1TKTB 2JL9A 3D0HE 2AJ0A 3QYYA 3PEIA 3ADAC 4OI1A 4RKUC 1A7GE 4O3NA 2YY3A 3X3UA 2P9CA 2HNZB 1R8AA 3SXNA 2XMWA 4OADA 4I64A 4RNMA 2RMLA 3MD3A 4KVME 2FD2A 2VJVA 3FCVA 2DH8A 1M90T 3HKWA 4TU9A 4FYVB 2DH9A 3R3TA 1XNQJ 2LMIA 1TR0A 2CIJA 1I3OB 2YH0A 1KVIA 3DRYA 4P71A 1SUQA 2WOMA 1O8BA 2QLJB 1M5KC 2XQCA 2BJ8A 3OLAA 3PRBA 4FXVA 3M9NB 2B7BB 2AJ4A 4ZLLA 2W2OP 2E5GA 2C3OA 5JJBA 4NI2B 2FLOA 2F8MA 5B0EA 4X66J 3EPIA 1QJHA 4OJHA 5AXNA 2XLIA 4B9VA 2V2ZA 1VQ9S 1N0VC 4W90B 2W1BA 1JLEB 3BO2A 3CC2S 1VK3A 4YQWA 2W2NP 4X4OA 4HYKA 1RABB 2OHDA 2AYEA 3PP9A 2UUWA 3PX4A 1NO8A 3SIPB 2KCWA 2I3CA 2DR8A 1YBAA 3FEDA 4MAKA 3L7PA 1S1VA 2WPWA 4FXDA 2IRXA 1QSRA 3B54A 3HDSA 4ZCKA 4J9OA 4A48A 3K2YA 2FYXA 3R9EA 1XR7A 3R97A 5F8HA 3MM9A 1F2PA 3CPAA 1LW2A 3PEHA 4GKJJ 3H5ZA 1WD6A 2RRNA 2ZW6A 2OPSA 3MTKA 1P4NA 4KHPF 4QJVA 4LF1A 3Q8PB 4P4JA 3EDRB 3OJSA 3VAFA 1N36J 2C2RA 1FA0A 4O4RA 4FBTA 3NCRA 3OPKA 4K5SA 4LF9F 1WTBA 1CJUB 1AT1B 3TT2A 3DLJA 2YNDA 1HNIA 3CMQA 1SJFA 2YNEA 1YK9A 2VICA 1FE0A 4LJMA 2GQQA 5DDQC 2MGZB 3A3NB 4CQ1A 2E1RA 4C0BA 3D2WA 4MMOA 2YWFA 2CJQA 2DNOA 3EXCX 2Z2ZA 2Y9HA 4ED6A 4CO1A 4NCGA 4X3RA 3SDEA 3FXTA 2BJ1A 3KDOA 1M1KT 1JNRB 2ZEPA 1IYKA 2B4PA 2B3UA 3KKWA 1JXVA 1I94J 2RFHA 5CYJA 1U1RA 3K17A 4R7MA 2ZKTA 2OPRB 1PJ7A 2ZZNA 3HHKA 5HO4A 3CGIA 3NE8A 2YNGA 2QMUB 3NKYA 3N79A 3MMBB 1S97A 4TWEA 3DRXA 4ZIWA 1VBXA 2U2FA 3C26A 2MB0B 3M8QA 2JEIA 5EWFA 2ZITA 1N52B 3F0NA 1F0XA 1NLKL 3GYGA 3GYAA 4R87A 3R1LA 3CF5Q 3DGVA 4QPXA 4ZP8A 4NGRA 1N88A 2H5JB 2ZELA 4YHHJ 4U7UK 4YRHA 1D9DA 3H2VE 4EBDA 1TU0B 3SSRA 3RYOA 3OR2A 1V5IB 4JWPA 2DK2A 3FEYB 4R5PB 3QT5A 1QTMA 3TUPA 2FHKA 4OQJA 2EPIA 3RB6A 1J5EJ 1RJJA 2IBKA 1TL1A 3KLFA 1PJ6A 3W60A 2V8PA 2V8HA 3M05A 3ZZTA 2ZH6A 1XIXA 1UPPA 5D8NA 1FX2A 2I5JA 4I4BA 3ENVA 1QSYA 2K06A 2J9AA 3MM5B 2HQCA 2RC4A 2RF2B 3DDDA 2DRAA 5HN0A 2OTLS 2UVRA 3JSMB 4P2MA 4HNYB 4YR0A 4OC1A 2DY1A 4OZLA 5JH9A 3IRXA 1WHYA 1UMJA 3DSBA 2CXEA 2HNYB 3CCJS 3R7BB 1WC1A 1Q16B 4JV1A 1KTQA 5B0CA 2P9EA 2ZENA 1Q8IA 4RWXA 3LH2S 5GAEU 4MI4A 5D0HA 5KG4A 4OFZA 5HANA 1X5PA 4FYXB 1IBLJ 2AJ1A 4QIVA 3BDPA 3K9UA 3LPEA 5C24A 1MJBA 4OIXA 4C2MA 5CXTA 2FHOB 2XEXA 1KTVA 2ZJQQ 5IT9Y 2B5GB 4J9QA 2PMHA 4F7VA 1IKXA 1H73A 4QU6A 3D8PA 1NH7A 3AHPA 5C25B 2IYGA 3OFFA 5J1EB 4ELVA 1RWNB 1O0PA 3CJ3A 3BGRB 2K8GA 4K4TA 1BO4A 7AT1B 2Z8QA 3BHXA 1Y00A 1V3SA 1LV5A 2G9OA 2PMWA 1UVMA 3AD9C 3I0SB 3SZ2A 5I3QA 1RT3A 2KRRA 1RKIA 1CS4B 3QIPA 5LXYA 3D2PA 4NCBA 3T9YA 4DL0C 4U7UD 4HH0A 4KPYA 4JXQA 5E3AA 3QB8A 2MQLA 4URGA 4CDIA 3UDVA 1JLBA 1M5HA 2GIRA 4NXYA 3V5RA 5L1LA 4LREA 1EQ0A 3QATA 4NSQA 2WSAA 3SQGA 1LWCA 2DO4A 3NGTA 1O5JA 2ANPA 1PC4A 3PVXA 2SXLA 5HQMA 1NBEB 1IICA 1SL2A 4KC5A 2UXBF 4QWBA 4B13A 3HPOA 4AL7A 1Q5VA 1ON0A 3BBCA 4GVBB 4EK2A 5CABA 3HF5A 5J2PA 2R8GA 2EI5A 4O3OA 2K3KA 1EHWA 1RTJB 1M4IA 3CCZA 4ZPDA 2OFHX 1FFSB 4JI7F 4HACA 1T9YA 5AT1B 1HPZA 2YNFA 3S9LA 2XY7A 3CJ5A 4RR5A 4L6V3 4PK3A 4A46A 4D3HA 1OSCA 1U1LA 4M3SA 5AG6A 3HVRA 1CULB 4R76A 1F5CA 1HBOB 2LQ8A 3HZGA 5T7LB 4ZN1A 5E41A 4MY0A 4V19X 2OLWA 2ASJA 3PZPA 1QMUA 1F60B 3AA9A 3AB4B 3A3OB 2ZEHA 1S7KA 2J8SA 1RU2A 4AVCA 5EN1A 2AMCB 1YW6A 1YLEA 2JX2A 2ZVIA 4NX9A 3MRUA 2A6MA 2B56A 2KXNB 2X3DA 1RHRB 1S9FA 4EFDA 2E5IA 1NDLA 3BGOP 4JI2J 3DR8A 1BXNA 3ET6B 5L8RC 4WJBA 2MQQA 1Z1ZA 3SSSA 1HWJA 4OYWA 4UT4A 2IHR1 4O0IA 1BUXA 1KQGB 4KTQA 4W92B 4UIBA 8CPAA 1P8GA 4KFBB 1S7FA 2B6AB 2EBGA 4ED2A 2UXDJ 5J2NB 5GCNA 2FXFA 4OZ1A 1CJTB 1X7VA 3KHRA 4DUYF 3S6HA 1PYTA 3O3LA 4PXDA 2AFMA 2UUCF 2IIHA 1JXEA 4B3SF 3LACA 2JSXA 4ZK7M 4G1PA 1ZOTA 2XHCA 4ATNA 3TAPA 3BSAA 4C8NA 4NYPA 2AHOB 1ULRA 2B5JB 4EU0A 4I6AA 1S4EA 2BUEA 1IKYA 2CQ2A 2FIWA 4UFXA 2EK8A 5GVQA 3S6FA 4CAVA 5F8JA 1U4BA 4NZ7A 4RW7B 3D7SB 4WXOA 4L3NA 3GU0A 1U45A 2DNHA 4R0EA 3V6HA 2VG5A 5BR8F 5DLGA 3MUTP 1NSAA 1Y0YA 3CCQS 1N32J 3HHNB 4B6ZA 2RKIA 4JV2A 1R27B 1RT2B 3ETMA 4CLFA 2J8RA 2C27A 1AZSA 3EXNA 4ETXA 3H4BA 3EYZA 4WZQA 5IB9A 4OHVA 5HJYA 4J37A 4P4BA 5E33A 3C3LA 4DZ6A 3VZHA 4CIOA 4FS2A 3FJ2A 1X4FA 2F5GA 4HI1A 3IJ3A 1UL3A 4XPKA 1IWGA 1ZM2A 4TQRA 2CQ0A 4QIEA 3KLIA 1LNQA 1BAVA 4FUUA 1IIDA 3P96A 4PXEA 1VQLS 2MQMA 3DFEA 3KDNA 3CDUA 4NLDA 3FSYA 4OI2A 1N54B 3CD7A 4H4OB 1NSPA 1MROB 3W61A 3WT4A 4LRDA 1IBKF 3DDKA 5JMNA 1ZH5A 2ZEGA 2DGXA 3PRVA 2JC0A 5DM7Q 4EVYA 4AUKA 5G20A 1IJFB 1VHEA 1G6BA 4NWBA 4M94A 3W9HA 1E6VB 3M9MB 3EZOA 4DQIA 2N7YA 2V69A 1BE4A 1TKHA 4JI8F 2V4JA 4ZY1A 1C0UA 1D9FA 5A6PA 2HHUA 1WDDA 4I2QB 1UW4A 1FDAA 2HFUA 1FWLA 3G6XA 2PVWA 3M1VB 3K58A 4N77A 4ZLNA 2WYRA 2IY5B 2FDNA 4N56A 1KDNA 1DURA 1HKAA 1KC8T 4RNOA 2XY5A 3QQCD 2AGOA 4DS5A 3GCWP 3MR2A 3OTOJ 2Y0MA 3GYXB 4MHDA 4CPAA 3D2MA 4DL6A 1KZFA 3KNAA 2WBRA 3K89A 1MN7A 5IV3A 4C11A 1WI6A 2J0SD 4FPIA 3P3DA 4B3MF 1GMUA 4KO0A 2IL4A 4UOHA 4ZVOB 2DPTA 2VDIA 1ITPA 2JLGA 2DEIA 4DQPA 2M8HA 2G0IA 4AQYF 2AE6A 4H4MA 3D5MA 4NLRA 1S0VA 2X1GA 3TJ8A 4F3MA 3OW2R 4MFBA 3FB3A 4F0KA 1HNZF 3A8JA 2Y1IA 2BANA 1MU2A 5F8IA 4ONWA 4NCAA 1AFIA 3R5BA 4LRCA 4LQGA 2LA6A 1TL3A 1XE4A 1XNRJ 1N5YA 4ELTA 3O5TB 3D1QA 1H38A 5E2QA 3RAQA 1RAOA 2VG6A 3KK1B 2DGQA 3HMJG 3IRWP 4RUHA 4ECYA 3THVA 1LW0B 4DL3A 2QX0A 2GO8A 2GW8A 1WSRA 4ZHRA 3UVJB 2RD5C 3IFEA 3P5TL 1S7NA 4FP9A 3B6BA 4PWWA 2DD8S 1RO5A 3K5MA 3OJUA 4UF4A 4NLXA 3HCXA 2L9WA 2V4QA 1CEZA 3O44A 1KQKA 2B8QA 5DLFA 2ZDOA 3KFWX 2B4UA 2ZOGA 1J2VA 2JLFA 1IQZA 1TMMA 5M2PA 3TO6A 1IUJA 4RPFA 3AAWB 4TU7A 1S1WB 1HA1A 1JK9B 5LT5A 2MSTA 3EXYA 3LGHA 3AA8A 4QUSA 2HZVA 5E3RA 1KFDA 1X4CA 1Q81T 1B0PA 1NPKA 1YLXA 1OQ6A 2WOMB 1FFWB 7FDRA 2CPZA 3B8HA 4FVCA 2ZEJA 1FRHA 4PYAA 1NJIT 3Q22A 1VBZA 2WSFC 2Z4PA 1C0TA 2MQ8A 2ATLA 5CBMA 1UAWA 3I3GA 3CJ0A 3PJXA 4ZVSB 1SV5A 5CA5A 5K20B 3QAHA 1L3VA 2ZE2B 4WFXA 4KZTA 2MYFA 3CIZA 1U24A 2BRKA 3PXGa 3MHYA 2PGCA 4N76A 2K7JA 2YKMA 1DRZA 4JZ0A 1X4BA 2UUAJ 2YNHA 2ILYA 3RGIA 2MY8A 2F4VJ 4ILLA 4LUBA 3R27A 3T5JA 4WK3A 5K8PA 2M9KA 4CWBA 4J9UE 5DG8A 1VS3A 1IBMF 1GH8A 3R1HA 1XMTA 4YWYA 4LUAA 3DN9A 2HIYA 4FF3A 4QR1A 2LXUA 4PWUA 1LW2B 4NXNJ 2HB6A 2XHWA 4XIUA 1SXLA 1T9TA 5AXKA 4M5IA 2AJ2A 4PUOA 4WK1A 2E7WA 2WPXA 3OVAA 3R95A 1WOPA 2GCFA 2EO8A 3CJRA 4NMXA 4OHWA 1HNIB 3LGNA 2C2MB 4QYZK 2DGVA 4ECVA 4CTAA 4JI6J 1IKVA 4OZJA 2PJ2A 3TO9A 4UCNA 2R8KA 3RBUA 5JQ4A 4ZVFA 2Z3MA 3KZWA 2B9XA 4MK9A 4ANCA 3R7SB 3I87A 1UPMB 1RP5A 4MFKA 4HI2A 4A95A 4NCGB 5EC4A 3SDEB 2PDOA 2Y8YA 2J7UA 3UNYA 3CEDA 1XMBA 1GXTA 1JLCA 3MDFA 5A8RA 2CYYA 3PTWA 1GXLA 4U96A 4DV5F 4MFLA 5HP1A 5ISVA 2IMWP 1U0SA 2XMJA 4F9UA 4NA3A 3LP1B 2YNGB 2QZ8A 4MHNA 2FZCB 4E0DA 3M8WA 4OYMA 1NK5A 4CYPA 3M8QB 2AZ1A 1R8PA 4CGOA 2N4CA 1TMJA 3EPGA 4KPCA 5L9NA 1YK3A 3D67A 2MKJA 5B7WA 1M4LA 1TKZA 2IVFB 5ETVA 2GVDB 1JIHA 4USVA 4BC7A 4H6UA 2YWKA 4I67A 3OWCA 4RO0A 2W8KA 3HT3A 2V5HG 3VAHA 3OR2B 4DV2F 1OBRA 1AROP 3N28A 4C8ZA 3B3TA 4LSLB 2VQEF 1TL1B 5AGEA 1R8BA 3KLFB 3TA2A 2CXAA 3EX7B 3CCSS 3W9JA 2HHSA 4C8MA 3FF3A 3ZZIA 1Y10A 1VJWA 2PA3A 4Q8FA 2RHSB 2FC8A 2ZFHA 4OZNA 6AT1B 1XRYA 1KHVA 3DC2A 4HT7A 4EMEA 4FS1A 2M0GB 1G3OA 5GMDA 2R4FA 3ZZOA 3IRXB 1HMVA 3VQSA 2RH3A 1OO0B 3DR6A 2FS5A 3FFIA 1IOFA 4CAWA 3BREA 4XO0A 3WC0A 3U02A 3ZJ0A 5DJBA 2AJFE 4USKA 2PJ8A 2CQDA 3HVTA 2YWGA 4WKRA 3NH8A 2I8EA 3J7Z5 4GC7A 2IAJA 3S6EA 2EFNA 1F9FA 4K2XA 4MKBA 2Z0GA 4P6QA 1IKXB 1FDNA 3JSRA 3JXOA 4HTJA 5A76A 4F0HA 1RWWB 4IFYB 1HBMA 1ZBTA 3AT1B 3WIUA 3D6MB 3V2UC 4C9DA 1A0OB 2C28A 3KR5A 1Q2CA 5H9FK 4IOCQ 3HD1A 4CNZA 2XMTA 5KG7A 4RS2A 2X1BA 1XNQF 2KRBA 2ARHA 3QGGA 1RT3B 4I7FA 5F8GA 2VIHA 5CHCB 3QIPB 3N5BA 2CWXA 5HBMA 5A8KA 5I4MA 1FJEB 4ZP9A 3DRPA 4OHXA 4LFBJ 1JLBB 4C2YA 3IBFB 4ZCMA 2ZBRA 2GHVC 3VGSA 4JYAF 1U8WA 4CYUB 4X66F 1M5VC 3GR1A 1LWCB 5FDLA 2PN6A 2GNKA 3PEJA 1T05A 3LGMA 2C3YA 4LSZB 2ZHBA 3Q0AA 2F5IA 2KJWA 2CJ9A 3T5KA 1K4JA 2J7KA 2H5IB 3NG8A 2BX6A 5J2PB 4K4UA 4FAIA 2R7UA 1PBAA 1N48A 5HVGA 3DHWC 2KFYA 1K1QA 5DQGA 5KFUA 1Y0RA 4KRWA 2JEWA 2W8LA 1TK8A 4HACB 5T41A 2WHOA 2GS8A 1K0TA 1HPZB 3FCHA 2YNFB 4M5MA 1TV6A 3TZZA 1GAOA 2J6SA 2HNDA 1RCXB 1XJOA 2FVRA 1XMOJ 2MPUA 2MZ1A 4M6GA 4IF5A 3A3PB 2RSQA 2BABA 2J0WA 2E5JA 1N36F 2BJDA 2CDQA 3DLEA 5LSLA 1BLLE 1TVRA 3W63A 4YDXA 4I1TA 2DR9A 3KJVA 1RI7A 3ZFVA 3EVOA 2H3EB 2HVEA 2ZBQA 2OO4A 4DSIA 3PFEA 5KOWA 1YJNS 1RAJA 3H7HB 4RJVA 2ZEEA 3HSJA 2Z2LA 5KFAA 3KASA 3DOMA 3QGPA 2XI2A 3PW2A 2HHPA 4OMEA 3K8WA 1PYTB 4YMEA 4KAIA 4ETZA 5IX3A 3GV7B 5G22A 2N7CA 4DV6J 2IM2A 5HROA 1R89A 2AD9A 4AXJA 2JZ5A 3PG9A 5KFVA 5BWAB 1EP4A 2L3MA 3DU6A 2F7VA 2O4HA 2KYZA 3KHXA 4DX6A 1U1QA 4Y49C 4M5DA 1C1BA 1FRMA 2IM1A 2D1CA 1TZ0A 2PEHA 1IKYB 2DR6A 2WONA 3ONQA 3SMZA 4UEZA 3LODA 2NSMA 2NXJA 4OLLA 3W2WB 3FMWA 2DB1A 3I0RA 5HMYA 4A8XA 3QLHA 3FYNA 2VG5B 2HGLA 2ZH5A 4OZ2A 1VQMS 1F2OA 2UZAA 4OI6A 1HBNA 3M30B 4DSKA 4F50A 3RZAA 1Q7LA 3MPDA 1ZPWX 2UXCJ 1E6YA 2QA4S 3FH4A 2RKIB 4Y2MA 4ECTA 2VBWA 2BE2B 3SI1A 1AZSB 1N34J 3I55S 2OPQB 3FZBA 3LMSA 1FESA 4X4SA 1VRUA 1VHOA 2OD6A 2VUGA 4QYRA 2D41A 2CUYA 4Y28C 4M8LA 4GO5X 1U09A 2KH9A 2A4NA 4I6YA 2RQKA 1JJ2R 1HQUA 3KLIB 3KYLA 5JVGQ 3A8EA 1U0HA 4OYXA 4B08A 3PR5B 3LWLA 3M6WA 4OYAA 1FKOA 1X5SA 4ANDA 3R2CJ 3PKYA 3GV5B 1WDTA 4QWAA 4F6AA 4J9KA 4UOGA 3ILLA 2ZWPA 1X4GA 4RNNA 2CQ4A 4IKAA 2VZYA 4O4GA 4M5HA 1V9OA 4CCHA 3BGFA 1Y9WA 4LIRA 3IP0A 3PJWA 2RDIA 2GQCA 2W4PA 2V63A 5I3UB 2G2OA 4JV0A 4NLWA 2FJVA 2BSWA 1FRJA 1F9HA 5CD4A 1P1LA 3GIUA 2IJFA 1N5TA 1U1MA 4NLSA 4F36A 3T1HF 5IWAF 4FF1A 4W4MA 2MKSA 3H8GA 2GGPB 1S6PA 2C3UA 1SQEA 1HI1A 2VV5A 2FIAA 5JXSA 4BD9A 4CYNA 3HFKA 3MF5A 2DNMA 2NXCA 4MBUA 2V4JB 1DY3A 2B9EA 2OEMA 1NK8A 3Q8SB 3QZ8A 4CLPA 4KB7A 2MY7A 4X65F 4OX6A 1Y3KA 3TW0A 2YX1A 1Y4ZB 3NFZA 5FIIA 2F9JA 2CPYA 3BV8A 3UD5A 3KHGA 4XNHC 2ZBPA 4KLVA 5BYSA 3P45B 4NPOA 2JBKA 4W98A 2Z3PA 1HL6A 5FD1A 2HHHF 3N6LA 2ATCB 4C11B 1P9YA 5EBVA 2A6OA 3LP2A 3PFOA 3ENAA 1M0SA 4HNWB 3QO9A 3NGKA 5C2CA 2MDAA 4Q5VA 2CQGA 4MRIA 2XBPA 3CCLS 2ADBA 3SCJE 3T19A 2R7TA 3PIPQ 2OMOA 2R7QA 2QN6B 3BSOA 4E2FB 3DYAA 3A8KA 5KFCA 3QT8A 2ATRA 3HP6A 4MFBB 1MWYA 3TC8A 1MU2B 4FBEA 5K9FA 3RUBL 3T5LA 1A6LA 4JI5F 4OJ3A 3R8YA 2P5VA 1TFWA 4TNUA 4KHPJ 1TL3B 1YMEA 1N5YB 3L2NA 5ETMA 1T94A 2RRAA 1H74A 4C2ZA 2VG6B 1VHIA 1IWAA 1WC0A 4LF9J 1XBUA 4ZHRB 2VBYA 5KFTA 3K0JA 3JAMY 1NRKA 1XWLA 1LOKA 2E7VA 4Y65A 3LP0B 1VK8A 3S6KA 2VBZA 4LR8A 3VR1A 3MOJB 3HKZD 1UZDA 3FJUA 2W9AA 2E1AA 2PR8A 4ED1A 3V6JA 3HLPA 4FD5A 5SZTA 1FKPA 2GE3A 3CULA 2ZH7A 1FRKA 3PW7A 4CLKA 4KS9A 4K7QA 4CO2A 1N4LA 2XMVA 3M6XA 4KH0B 4ED0A 3BGUA 3KLEA 3VZIA 4HKFA 1WJ9A 4EWTA 3A9LA 4KR0B 3DOLA 2V9KA 2E9RX 4P9SA 3GP9A 1RT5B 2WW8A 4Q44A 3N6MA 1S9GA 3LD2A 3MPYA 3PW5A 4CNYA 3I56S 4WFBQ 3MEGA 2V9WA 2YPYA 2XS2A 3ENQA 4JXRA 1N5QA 1C4CA 2BBEA 3PRTA 3H5YA 2AZ3A 4HL9A 3IG1A 1C0TB 4A8OA 1SC3B 2CJAA 3GWCA 3JQKA 4KY3A 3CCWA 5DZ7A 1C2PA 1SV5B 5H9EJ 1Q0NA 2GV1A 4RN7A 2HRTA 5B0AA 1YTYA 4ZX9A 1SH3A 1HW8A 2I38A 1N32F 1JLGB 5L9XA 5EWGA 1M5PC 2PI4A 2YKMB 2IJRA 3SXOA 4PXBA 3SI8A 2B8PA 3GIKA 1ZO0A 2YNHB 4Y6IA 1IB1E 3K7RA 1IGBA 1HBUA 4UQGA 1YIJS 1K73T 3PB7X 5J2QA 3PZJA 1IYLA 2Q4YA 2XMAA 4R57A 4U67Q 3VATA 3G8QA 4HKQA 4JJXA 4UQTA 4X84A 2XZTB 2RU3A 5AE3A 4RL1A 3KLGA 3M2VA 1NMTA 5F49A 1PO6A 2ZHAA 2QMXA 2O1PA 2IBOA 1FEEA 4PUOB 1U6FA 1UVJA 1NB7A 1FVQA 4QIWD 4A39A 2B4DA 5FVJA 3FQLA 3R5AA 3OV7A 4PKDB 8RUCA 2ILZA 2MEWA 2OPPA 4CTAB 1IKVB 4OL8A 2CQIA 5FJ4A 1WG4A 4U8VA 3RYLA 1QQ9A 1T11A 5BYQA 1UA1A 1NHKL 4ZOSA 3CO0P 3IWEA 5H86A 2NXNA 1QAJA 4UZBA 1UEVA 5HK4A 2HWHA 4WFYA 3VWEA 2ZH2A 3H5SA 1R57A 3QAEA 1DTTA 1HQEA 2DEAA 4IFVA 3OXLA 1UJ5A 1U6ZA 3L4BC 4ZYQA 3TCVA 3QNWB 2E9ZA 4ANEA 4HPSA 4F4XA 1JLCB 1DHMA 2QL7B 4A8WA 4AB7A 5A8RB 4AG7A 4F26A 2ZOMA 5HP1B 3JRUA 4ORFA 4AT1B 1MW7A 4CZCA 1YLOA 4K4WA 1NSKL 3FNCA 3PNIA 3KI9A 4UCPA 5ETTA 3ILJA 3THPA 1QSTA 4YY3F 4IAVA 2IC3B 4CRJA 4P45A 1PJ5A 5DZ6A 3WC7A 5HMZA 3TVZA 2HKEA 1KVJA 1S5KA 1WF0A 5HI7A 3FX6A 2W7AA 4XPDC 4MYTA 1TKZB 1SQHA 1NSLA 4OC0A 3H0PA 3MZIA 3Q86A 2EG1A 2FHJA 3G9CA 1G7CB 1VLYA 1ZZNA 1MJ9A 3C6TA 3IM9A 3TOQA 1M1GA 5D0GA 4JI7J 1BOBA 3GUXA 2J76E 4IK2A 1FK9A 2Z3OA 4KHMA 3OFHA 1OYDA 2HMIA 2KN4A 3H2LA 2HW3A 4UWJA 1DQ9A 2R8IA 2ZJPQ 4A8KA 4DR2J 2J8NA 3MCMA 4IH6A 2MHEA 4Q45A 3MM6A 5GMKa 1XNRF 1U2FA 2H51B 5CNPA 3PRDA 1P27B 4F4WA 1HMVB 1VC6A 1RWOB 3DLGB 2OUGA 1NZ8A 4UUWA 4LQ3A 3FFIB 4L74A 2GFQA 3IO1A 4RBUA 4JOUA 2KT2A 3TEHB 2NXEA 5DWNA 1FXRA 4KSAA 2HZCA 4D3GA 3HVTB 5DETA 2AV5A 1UETA 2UV8G 4ED5A 3WBZA 1FDDA 1YX0A 2IAJB 3CCUS 1OZPA 5CCMA 4L75A 3GG1A 4BHQA 1ELOA 1UFWA 2XCPA 3DCAA 3WX4A 1NK4A 2D3UA 4KHRA 1HBMB 3RG6A 2R7RA 4NA1A 4LF8F 3MEDA 4LT6A 1NKEA 4KVXA 3BZQA 1URRA 1RTDA 3EGZA 1G4CA 2AEJA 4NF1A 4PWDA 5JUMA 3RRKA 3UN2A 4IOBA 4ZA1A 1L3SA 4DZDA 1S6QA 2J7WA 4EZ9A 2YQ1A 4I7FB 3MAAA 3VALA 5HBMB 4DX5A 4P4FA 2HS3A 4Z7YA 3PYFA 4GXHA 3DRPB 4LRBA 4NGNA 4G1IA 1MMNA 5BR8J 1CJVA 3ISNC 2HV2A 2VBQA 3C66A 3M8SA 5FDLB 5AXMA 4LSNA 1T05B 1S0OA 1ARMA 4USIA 1U25A 1RAGB 4KUBA 2OTJS 4ZPCA 2ZZMA 4NMLA 2B3TB 2MQPA 1F1BB 5E7OB 2XULA 3UCUP 3BSCA 5ETKA 2LXIA 5IM0A 2F4VF 5F3TA 2PSWA 3HM9A 4LF7F 4KGMA 2PEBA 2VHGA 4U7CA 3L09A 5C7PA 1TV6B 2F8EX 3AB2B 2HNDB 2B3VA 2FVGA 1I51B 2HVZA 4NXNF 2CQHA 1K0VA 1OS5A 1HWIA 3BBBA 2HAIA 2VKRA 5IT9U 1NDKA 4GKKJ 1VCTA 1IBKJ 2PCUA 4AYBD 4KVOE 3MPUB 3FGVA 3A1YG 3DLEB 4RLEA 1N5SA 3RU0A 2CPDA 1TVRB 2F63A 3NY0A 4L8AA 1S79A 3KJVB 4ECWA 4F4YA 1NJXA 4A32A 3PW0A 2O3DA 2VI7A 4JI6F 3QPIA 2DEJA 5C5JA 1HNWF 1AMPA 4UCMA 4ZY2A 4A33A 2DGUA 3DOMB 2WB1D 4H54A 1VBYA 3G71S 1AUSL 2HQ3A 1NJWA 3BR9A 4B3OA 2W2PP 2VODA 5IC4B 3FBFA 1IBCB 2IRUA 2BW7A 3IN5A 2CZ4A 5HROB 3GMGA 4ZLJA 4DL2A 2C2DA 3EGWB 4EO6A 1EP4B 2AIRB 2DH7A 3IU2A 4KGVB 1HDQA 1RADB 3CD5A 3KK3B 2X3GA 2Y0SD 3CDBA 3J7AN 3Q24A 4H4KC 4MKVA 4XPLA 3FBUA 1C1BB 2CPIA 2AP6A 4DN0A 5HLFA 3UN5A 1KHWA 2GZOA 2WONB 3RR8A 3VGTA 2M88A 4B3MJ 1RUSA 3NWGA 3I0RB 2CNKB 3QLHB 5LL6d 4Q36A 5FLXY 3CPWR 4QW9A 3JTNA 3CJTA 2VKZG 1H7WA 1HBNB 3BQ2A 3J7A1 4AQYJ 1Q7LB 3E2EA 3KJQB 2KB2A 1E6YB 4J9MA 3H59A 4X4VA 4PV6A 4CRZB 5KTDA 1HNZJ 2O5DA 1Z8XA 4QIGA 2ZH8A 2LQBA 1VRUB 2XYHB 2IRYA 4B9SA 3OLBA 2VC0A 4ER8A 1U49A 5H1SV 4XNHB 3AJ2A 2DNKA 1UVKA 1MWZA 4OHYA 2R7SA 2V8DA 1N33J 3GFXA 1N5VA 4QC6A 3BPDA 1QAIA 2PR1A 4YFJA 2ZD1A 2FJAB 3W5ZA 3MUMP 3V4IA 3C14A 2HPUA 2XNRA 3BPSP 4CT9A 1U0HB 1B0TA 2CQCA 5EUHA 4NCZA 5KFNA 1CBKA 1Q8KA 1NDCA 2XB2D 2VG7A 3W6XA 4YP3A 1SL1A 2HFVA 4MFJA 5LXRA 2G3AA 3JS9A 2ZC3A 3NCQA 2E44A 1CP7A 3GV8B 4YFUA 3W91A 2MSSA 2N3OA 3WC5A 2LQJA 2GREA 3CTRA 5D4LA 4CH1A 4A8YA 2CKWA 3OD2A 1ICEB 3N9UC 4TY9A 1HQ2A 4RUAA 3GJQB 1S6PB 1MLAA 5DO2A 1M4GA 5DQIA 1HNVA 4ALZA 4DU8A 3A8IA 3OL7A 3DRRA 2FUG9 4YU9A 4NLQA 2OZGA 4PYDA 4Z2XA 4JI4J 4A37A 3PHTA 2MZJA 4I68A 1NB2A 3M2RA 1RK8A 2VXKA 5LOQA 1X4DA 3TO8A 3SHPA 4MCRA 3FBBA 1VQ7S 2PJ5A 2XEIA 4MCQA 4LFBF 2H48B 2HZAA 4ECZA 1R3NA 2AEFA 1B99A 3H5UA 4RW4B 4TLQA 2UV8A 1CJKA 2EFGA 4IH7A 4P4DA 4NGMA 4JYWA 1F57A 1OQ3A 2GANA 4OX9F 3S01A 1B4SA 2Y1LB 4CLTA 4X4PA 3LP2B 1P1TA 2BQ3A 2DPJA 3QO9B 2Z2YB 2ZUGA 3TANA 2FC9A 5IC6B 1RTQA 4DF8A 4P2SA 4HDHA 3MR3A 3MM7A 4DFMA 1S6UA 2CPXA 1U1KA 2UU9J 3U27A 2WVEA 3FUYA 1NJZA 1WKKA 4IG3B 5CCLA 4M85A 1WHWA 3RR7A 2H65B 3JB9k 1BPMA 3ZO7A 2YQ0A 3TWZA 2XEJA 4C8KA 2B51A 2BYCA 9RUBA 4K30A 4F3QA 3TX0A 2YKQA 2XLJA 3IAM9 2QIFA 2IMOA 4DMZA 1BLUA 3ISND 4LFAF 2ZH4A 4B9LA 5HH1A 2RS8A 2V8VA 2LXFA 4OV1A 3ZNUA 5DS7A 2R3VA 1IJEB 2CQPA 3C2PA 2PI5A 2EFOA 1Y9KA 2RQ4A 4MT1A 3OL8A 2ZWOA 4EMDA 4R8UA 2AQ4A 3CT9A 1KEKA 2V6AA 3M8YA 3DOKA 3UE2A 3H98A 1QSLA 1EKSA 4K4XA 2VOOA 2K3IA 2EK9A 1KS2A 1PUAA 2RB7A 2WZ1A 3Q2SC 1FKPB 1KONA 2BKPA 4LRFA 5J2MB 4KUAA 1RGVA 3IWLA 4XDCA 3KLEB 2W9BA 3PB6X 2BA9A 4FZVA 2DNZA 4DV6F 1RBOB 1QE1A 4RW8A 2P9GA 2YKOA 3U1MA 1SH0A 5F9NA 2PFDA 2YNCC 2EC2A 1HWUA 1X9WA 3DOLB 2ZW5A 3KJFB 2PJ0A 2CPJA 3MR7A 3U1LA 5AE1A 1RHUB 3N01A 3RO0A 4KSFA 2CQ1A 3OR1B 1S9GB 1S4FA 2Z3NA 3ILIA 3BJYA 5KFOA 4B3TJ 2VL1A 4NZ6A 3MEGB 3R6GB 1T9VA 1FT8A 2Z11A 4KOXA 2YBVA 5IZHA 3BEGB 4OYZA 1YI2S 2NUUG 3D6FB 5KFDA 3NGSA 3NWRA 4O44A 4K4SA 3IG1B 4NLYA 1TKFA 3CDWA 3D7GA 5F3ZA 1QSMA 3TQEA 1T7PA 5B08A 3KGQA 3GYNA 2X1FA 1NUEA 2J0XA 4JV5J 2U1AA 4II9A 4CT8A 1RXOB 2GFFA 4ZS6A 3OTBA 1N6QB 2ZH3A 4OYBA 1RT4B 2ZOFA 4B9NA 1T95A 2PA8D 2JHEA 3FEXB 1H72C 3B3CA 2Y1RI 1HBUB 1H0HB 1KWMA 4ZPVR 3RW7A 3JVNA 1NM2A 2QMWA 3D6TB 4L76A 1YG0A 1N56A 1PC5A 4KKOA 5J2QB 5GAGI 3GIRA 4C4WA 4UTGA 1RYSA 1TAUA 2UVWA 5EX3A 2JOQA 2NPIA 3EE3A 3KLGB 3LWMA 4XPDB 4YR2A 3FNNA 3Q8QB 1YJUA 2OIHA 2IM3A 2HS4A 2QRRA 2G9DA 2LLZA 2CQ3A 2WVBA 3K5LA 5F47A 1UP1A 2DISA 2B4DB 3E0KA 4CAEA 3TA0A 1V3RA 3MXHP 3WIVA 3G8SA 1R8HA 1ZS6A 1NEEA 1VIOA 3MMCA 1TFYA 4X5KA 3GJSB 4Q0BA 2LKZA 4DPYA 2OPPB 1X4HA 6FDRA 2EBEA 4RI1A 1RT1A 2Z58B 4ZN3A 3TQ1A 2VZ9A 2V2QA 4C0HA 5KFJA 1NHVA 2NYHA 3DMJA 2D4PA 2I2YA 2GX8A 1RA7A 3QRPA 5IXUA 4LQ9A 1VQ6S 5A6WA 4KORA 3H8EA 5E3PA 4A47A 2MKHA 1DTTB 1HQEB 2I1RA 4PG4A 4CO5A 2R8JA 3SXLA 2XM3A 3TOAA 3C6UA 3PJ9A 2ZUAA 3GCXP 4ECQA 4QCLA 1VGYA 2DR5A 2YQ3A 3UDCA 2FHMA 4KOSA 2BW2A 1RU1A 2LVWA 1H2UX 1OY6A 3CD6S 1HYSA 3MEEA 4R25A 1YZ6A 3V6DB 3QIDA 3TAMA 3FSIA 3KQXA 3RW6A 3PX0A 2CZ9A 2PJ7A 3GILA 3BS9A 1ZTWA 3IBCB 4JYAJ 1TL7A 2CY2A 1OWXA 2YNIA 2OD4A 1REVA 3RRGA 4RBTA 4P74A 4DPWA 2DHHA 3DU5A 4BCAA 5KG2A 3RB4A 4P2FA 4WIIA 2EVZA 1FJ7A 3T1AA 3G86A 2DPSA 3PCOB 3W6SA 3CSKA 5C42A 2WBMA 2XLKA 2GHWA 1TF9A 1QSOA 4EBEA 4TLRA 3D1HA 2LYVA 3GE9A 3QFWA 2G1HA 3I5BA 2ZDPA 2DHGA 3C6TB 1VFJA 1VC0A 1Y7PA 3H2UB 2MJNA 4NFRA 4UFWA 2QC3A 1FK9B 1P0HA 3B7IA 1G1XA 2HMIB 1FXDA 4IH5A 3DLLQ 4TKTA 1HW9A 4X2TA 1HR0F 4MCPA 4B02A 2V77A 3CDXA 3TYTA 3MM6B 4F04B 2VA2A 1K44A 3L3CA 3QT6A 3NAHA 1JLAB 2N3LA 2XYGB 3RNZA 2L9NA 1GTEA 4M95A 5IFMA 2Z30B 3L95X 3T6JA 1S5ZA 4YN3B 2CNLB 1ZM3A 2V4RA 3ETOA 3RBDA 1B3TA 1PU9A 2XZDB 3LO3A 3NA6A 2XG8A 4BDPA 3CJKA 4MIAA 2WB4A 4IDKA 1QSNA 3V81A 4NJQA 3B4DA 3BYRA 2FY8A 1JKHA 3G96A 1CLFA 3S9MA 1C1CA 1TUVA 2IDLA 3UCGA 4P6YA 2ZKUA 3AOBA 4DUZJ 4DR3J 3QWPA 3FRZA 4NEZA 1BQMA 3V8IA 3R6LB 1GEHA 4U5YA 2QYCA 4O3SA 3MEDB 4USMA 4X2BA 3OQ2A 4ELUA 1LAPA 1RTDB 1N8RT 3NS5A 1TKTA 2N4DA 4IG0A 1IOIA 4PWDB 3MR6A 4CLLA 5HL7Q 3MURP 2A0FB 4USUA 2W01A 3UW1A 1SC1B 2GO9A 3MAAB 2HNZA 2FQQB