1NSAA

Three-dimensional structure of porcine procarboxypeptidase b: a structural basis of its inactivity
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
395
structure length
395
Chain Sequence
FEGEKVFRVNVEDENDISELHELASTRQIDFWKPDSVTQIKPHSTVDFRVKAEDILAVEDFLEQNELQYEVLINNLRSVLEAQFDSVSRTTGHSYEKYNNWETIEAWTEQVTSKNPDLISRSAIGTTFDGDNIYLLKVGKPGSNKPAIFMDCGFHAREWISQAFCQWFVRDAVRTYGYEAHMTEFLDNLDFYVLPVLNIDGYIYTWTKNRMWRKTRSTNAGSSCTGTDPNRNFNAGWCTVGASVNPCNETYCGSAAESEKETKALADFIRNNLSSIKAYLTIHSYSQMILYPYSYDYKLPENDAELNSLAKGAVKELASLYGTSYSYGPGSTTIYPAAGGSDDWAYNQGIKYSFTFELRDKGRFGFVLPESQIQATCQETMLAVKYVTNYTLEHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROCARBOXYPEPTIDASE B
publication title Three-dimensional structure of porcine procarboxypeptidase B: a structural basis of its inactivity.
pubmed rcsb
molecule tags Serine protease
total genus 143
structure length 395
sequence length 395
ec nomenclature ec 3.4.17.2: Carboxypeptidase B.
pdb deposition date 1997-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
A PF02244 Propep_M14 Carboxypeptidase activation peptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.340 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Metallocarboxypeptidase-like 1nsaA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1nsaA02
2ABZA 4MCQA 2Q4ZA 1AMPA 1PBAA 4PXBA 2NYQA 5HXDA 1BAVA 1CP6A 2ZOFA 4UEFA 3DLJA 3B2YA 2IQ6A 5LYIA 2BO9A 4A39A 2ZEGA 1ZG9A 1ZG8A 5K8OA 1F2PA 1H8LA 4MMOA 2ZENA 4OIWA 1GYTA 5K8PA 1Y0YA 5JM6A 4JZ0A 3SJGA 1PYTB 4OMEA 2WYRA 2C6GA 2PJAA 4ZY1A 4IK2A 1O6XA 3NH4A 2ZEDA 6CPAA 1BPNA 2HB6A 5LYDA 4FWUA 3FMCA 3KI9A 3PEIA 4P6YA 4ONWA 1DTDA 3IWWA 3PBEA 3GUXA 3S9LA 1NSAA 2C1CA 2F7VA 2IMOA 1JQGA 4NGNA 1LAPA 3PB4X 4P4EA 3FF3A 3N5FA 4OC2A 4W9YA 4UEEA 1UWYA 3T8WA 1LAMA 4B6ZA 5CPAA 1FNOA 2EWBA 4P4IA 2C6PA 4Q7AA 2OOTA 4F9UA 2GLJA 2ZEOA 1AYEA 4NGRA 2V8GA 1HEEA 2BCOA 2I3CA 4YWYA 3B3CA 3GB0A 2JBJA 3KL9A 3H8FA 3BI1A 2PJ1A 3SI2A 4MCRA 1HDQA 3S9MA 3FECA 3D7GA 3LWUA 2PCUA 1CG2A 3CPAA 2PJ4A 2QYVA 1LANA 2ZEMA 3WC5A 4H2KA 5LRKA 3KZWA 1VHOA 3CDXA 2RB7A 1PYTA 3IO1A 1Q7LA 4EFDA 1VIXA 4R8FA 4OIDA 4IHMA 1Y0RA 4YU9A 3PB8X 3WC7A 4RUHA 3KQZA 3KR4A 3NH8A 3B3VA 4O23A 3NFZA 2GLFA 1YW6A 3SJXA 1IY7A 4IAVA 2BOAA 5LYLA 1XRYA 1Y7EA 3VH9A 3FX6A 1VGYA 1ZG7A 2GREA 3IIBA 1ELLP 3WABA 4MCPA 2V8HA 3IJ3A 3PB6X 1F57A 2QVPA 4FAIA 4A38A 4WJBA 4EMEA 2EK8A 4OC5A 3KHZA 1F2OA 1Z2LA 2ZEFA 4PXCA 4X2TA 5JGFA 2ZEPA 3ISZA 2ZEEA 2PE3A 1ZLHA 4P4BA 2JEWA 4P10A 3PBBA 2J9AA 5I4MA 1PCAA 3GLJA 1YW4A 4X8IA 3TX8A 3HUVA 4WWVA 4MHNA 2Q51A 3VATA 2PJ8A 1LOKA 3DGVA 3BHXA 3PFEA 4BD9A 3SI1A 4NJRA 3D7HA 4K3NA 2XEIA 2GU2A 1FT7A 2EK9A 3KQXA 2XEFA 3B3SA 3D7DA 4UIAA 4NGMA 1Z8LA 4DUKA 4P4DA 3MRUA 4P4FA 2PVVA 2PJ7A 1CPXA 5LRJA 5HVFA 4MHYA 4TNUA 2ANPA 3S9NA 3PRTA 1XMBA 5HVHA 4LQGA 4MHPA 4A94A 4Z65A 2V8VA 1EE3P 2PJ6A 3D68A 1CPSA 3IC1A 3NA6A 4TWEA 3D67A 2PIYA 1QQ9A 2PIZA 2CIJA 3D66A 1TF9A 1TKFA 1ZLIA 5D29A 1R3NA 3HLPA 3PB7X 5K8NA 5IB9A 2ZOGA 4ZY2A 4OP4A 3B3TA 3FEDA 4CPAA 4KSIA 2AFOA 1TKJA 1RTQA 2PJ5A 3K2KA 4PXEA 4MHZA 3KR5A 5LRGA 4PXDA 2Q43A 2FVGA 2XEJA 3SI0A 1XBUA 2XEGA 2AFWA 3B3WA 3VARA 3D7FA 3PFOA 2WZNA 2PJCA 1CP7A 1M4LA 4GM5A 3V7ZA 2O53A 3SJEA 3L2NA 3CT9A 4X3RA 2AFSA 5HVGA 4OC1A 3FH4A 3KGQA 3NH5A 1CX8A 4FBEA 2OR4A 3LMSA 4OC3A 3RZAA 2JBKA 2PJ3A 4MXUA 4ZYQA 3TC8A 2RFHA 3CPXA 1BLLE 4NFRA 4ZX8A 1QMUA 3JRUA 3FVLA 4UEZA 4F9VA 5DS0A 2PJ0A 4MRIA 3BI0A 3ISXA 1R43A 1Z5RA 3H8EA 4OKOA 4P4JA 1KWMA 2PRQA 2PVWA 2F8HA 2VL1A 2HC9A 3IFEA 1TKHA 3MN8A 5THWA 4DYOA 3IEHA 3SJFA 4ZI6A 1ARLA 3FJUA 2GJFA 2PJBA 2AFMA 2V8DA 5D8NA 3FEEA 4NJQA 5J1QA 4UIBA 2V77A 4EWTA 4G1PA 4NGSA 1YMEA 1LCPA 4PPZA 2ZELA 2G9DA 3K9TA 1TXRA 2POKA 4NGQA 3RBUA 3I1UA 1CBXA 1VJQA 3KASA 4F8ZA 1HDUA 2CTBA 4R7MA 1OBRA 3PB9X 5K8MA 2O4HA 4ZX9A 4OC4A 4MCSA 2IJZA 2NSMA 1VHEA 4NGPA 2ZEHA 3WC6A 4R6TA 4UF4A 3WT4A 2DEAA 4P45A 2AFXA 4R76A 1YSJA 5F09A 3B7IA 4NGTA 5ELYA 4A37A 1XJOA 4PQAA 5CBMA 3B35A 2AFUA 3H8GA 8CPAA 5JH9A 2CF4A 2C6CA 5LYFA 2QJ8A 1DE4C 3KHXA 3RAMA 2CTCA 1ARMA 4AXVA 1LFWA 2PJ2A 3D4UA 1YLOA 3V38A 4OC0A 4P44A 1TF8A 7CPAA 1XFOA 1IGBA 2AFZA 3BXMA 4FUUA 4DJLA 1ELMP 4JYWA 4ZY0A 3QNVA 1BPMA 2PJ9A
chains in the Genus database with same CATH superfamily
1JNRB 2D1CA 1S1XB 3TUJC 5IT9Y 2AT1B 2Q4ZA 4DPUA 1IBLJ 4PXBA 2JJ4D 2QA1A 2AMCB 1WKKA 2FLPA 1CP6A 3PYFA 4B9LA 1QM9A 1TUGB 1TZ0A 3QNWB 3BBCA 3M30B 3KTQA 1YITS 2OEJA 2JDJA 2HQIA 4AT1B 1T9VA 1YRUA 5HMXA 2VC1A 4OMEA 5KTAA 3B4DA 3AA9A 6CPAA 4P2XA 1N5YB 4MFJA 2V6AA 4DV0J 1WSRA 1LWCB 1R31A 2REEA 4RR5A 8ATCB 2C1CA 2UUWA 4PWDB 1YK9A 3J81j 5HJXA 4B6ZA 1KN6A 3DI6B 4IKAA 2LEPA 4J37A 1S1XA 2ZW7A 3CCES 3DMJA 2FLOA 5HO4A 1B70B 4QQBA 2COLA 2G3TA 2DNKA 5DG8A 2X1AA 2PC6A 1G6BA 5KT3A 1IKXB 2LYVA 4MCRA 5DDRC 3AHPA 2JX2A 1RTDB 3MAAB 3JSRA 3M30A 4NLOA 3FBFA 2E9TA 2DNHA 5I42B 4X4NA 3T6BA 4X2BA 3N28A 4NEZA 4J5OA 2E1RA 1VIXA 3V2UC 4RUHA 3EJMA 4FYXB 1HNXJ 2LQ9A 2ZVIA 3D6MB 1RJJA 3TT2A 1FRMA 1XRYA 2ZNZA 4DV2J 2YNGB 3VH9A 3BPDA 3L7OA 2HSEB 4IFVB 1M4GA 4PWDA 1CULA 2CQCA 4DV6J 1Z8TA 3DI6A 2CPDA 3CVKA 4M5GA 2UXBF 1VK3A 3G8SA 3EVMA 4PAAA 4ZMMA 4J9LA 1KR4A 2YQ0A 1H2VZ 2V8HA 4FZVA 2FCKA 3HCXA 1GFWB 2XMMA 2ZE2A 3R27A 4A38A 2ZW5A 5ETLA 1UWBB 4X65J 5JGFA 3KLVA 1IKXA 3ISZA 3G3SA 2WOMB 2Z3MA 2YKPA 2Y1LB 3OXLA 4UWJA 2DTJA 3BQ1A 5AG6A 2H4WB 4GKJJ 1RTDA 1RT6B 2EFNA 3MAAA 4QBUA 4RW7B 3W60A 3RAQA 5I42A 2CJKA 5AE1A 1QY7A 4KYZA 2CJYB 2AYMA 1NJIT 3KJFB 1Q78A 3I9V9 4BD9A 4TVAB 2CNLB 4KQZA 5B0AA 2GJIA 1DRZA 2GU2A 1PYSB 4ZIVA 3KQXA 2WUUA 2E5IA 2A2DA 5A6WA 5BWAB 2ASJA 1XTZA 4JI8J 1QSRA 2VFTA 4CH7A 2YNGA 1FRIA 4ECXA 5DM6Q 4I49A 3BGLA 4UY85 1IKWB 3PHTA 2PA3A 2PVVA 4CLYA 2DY1A 1J5OB 2OUGA 3BKUA 2CDQA 4RPFA 2VBXA 3BPSP 4OX8A 4ZVSB 1S5KA 4TWEA 2Z0ZA 1W26A 2PSWA 2W7PA 2E29A 2WOMA 3O5TB 2BYCA 3FSIA 2B4VA 2O01C 3PY8A 3TARA 1RT6A 1Z8XA 1W2BR 4RW7A 2C2OB 2R7WA 2QGFB 1GMWA 3N6NA 4A8KA 4WZMA 1RTJB 2AFWA 2OFHX 5J1EB 1KUXA 2WBRA 2LA4A 2WBMA 4A30A 2CPJA 1R8PA 4OZ3A 1UJ6A 4U67Q 3R95A 5HANA 2ZHOA 3L95X 4KGZB 5HVGA 4J91A 4OC1A 4OI3A 2JLFA 4YFUA 2N3OA 1IKWA 4JV0A 3NH5A 2HAIA 3RYLA 1J5OA 3LMSA 4ZVPB 5GADI 2PFFB 3KLFB 4NLYA 4TU7A 3W64A 4B5OA 5KFDA 3EZ5A 4AG9A 3LP2B 3AA8A 1QMUA 1H2UX 4V19X 3R5AA 3PJ9A 1U49A 1ZTTA 3F8KA 3D9BA 5C24B 1KWMA 4CGPA 2MSTA 4DV0F 2K8GA 4YB7A 1UEVA 3P45B 2N7CA 5CXTA 3I6PA 3HHDA 3IFEA 1B4SA 1S6QB 1RZMA 2FE7A 3BKTA 2KG0A 4K4XA 1RTJA 1HKAA 5LJ5Y 2WONB 4ZPVR 2PEBA 4RJVA 2V2KA 4MFKA 4XPDB 5A8KB 2WSEC 2N82B 5HLFB 2A10A 3KASA 1B0PA 4CAEA 2H5EA 2AP6A 5U47A 1YX2A 2Z2ZA 5J2NB 2FZKB 1VCTA 3KLFA 1F60B 1H2TZ 2A18A 4C8YA 3WZ0A 3LP2A 2G2YA 2XMWA 2R7UA 4FYVB 4JI1J 2ZEJA 1XNRJ 5A76A 1Q79A 5F09A 2ZH7A 5ELYA 1HNXF 5CBMA 4NCAA 2XC9A 1V3SA 1ZZFA 3GWCA 2AFUA 8CPAA 4E0AA 2W24A 1HPZA 3FCWA 5E3CA 2VQFJ 1VC5A 1FXRA 2WONA 3PW7A 3V38A 1TF8A 7CPAA 1VBKA 4L74A 4MY3A 4IDKB 3TAMB 1S6PB 4RUAA 5A8KA 3WC2A 3BEGB 4UFXA 3CCVS 1VK8A 1M4DA 4IR9A 5HLFA 1X60A 1JLCA 3PXGa 3PKYA 4X65F 1AMPA 3I9SA 1NMTA 3BV8A 3MTJA 4GKJF 4M3SA 2ROPA 5J2NA 1Q2DA 5CH7B 2LVWA 1N88A 2WVFA 4R0JA 3IR5B 4LRBA 4J9VA 1W7WA 2GA7A 3SJGA 2O3DA 1PYTB 4HKQA 2NXCA 2P6EA 5FDLA 3PV8A 4JI8F 4DQPA 3FXTA 3PBEA 3IM9A 3GONA 1FWKA 3NGRA 3PB4X 2ROGA 1IOFA 1S6PA 2HVDA 4TN2A 1UWYA 2CAJA 1KHVA 3G96A 2YNCA 3QAHA 1WF0A 2JC0A 3EPIA 2X7IA 4B3MJ 1K8AT 3CMAS 4WXOA 4EK2A 5KG1A 2J8MA 4HL9A 3N0VA 2QLFB 4M5IA 4S0MA 2XLIA 1HQEB 3KJQB 3MMAB 2MY7A 3DRSB 5FLXU 2JRSA 2RKIB 1P1LA 2OAUA 2H3EB 2D3UA 2ILYA 4DR6F 4MIBA 2FJVA 1KLMB 4TNOA 1PYTA 3GILA 2XYPB 3K0JA 1RKIA 2RF2B 1SB6A 2DKOB 3PB8X 1WHWA 3OTCA 2C28A 1WC6A 1NJZA 1HBOB 4O23A 1RT2B 3DN9A 4U95A 3NFZA 2MJUA 3IXQA 3SCKE 2BKPA 3CCLS 2J6TA 3B8HA 5LYLA 3PTWA 1M1KT 2B9WA 3C26A 1FJGJ 3IIBA 8AT1B 1LOUA 1VI7A 2VA2A 2PQ8A 4DR3F 4U9YA 2HBZB 5L8RC 1URNA 2VIHA 4OI6A 3KUGA 3K5MA 3C3LA 3IBFB 5EN1A 1R0AB 1HQEA 3MMAA 1YJ7A 2GC8A 3DRSA 1U1OA 2RKIA 4CH1A 1VDHA 3UDEA 1H7WA 1X5OA 4P10A 2KT5A 4RWWA 1VRTB 5AE2A 3GLJA 3E8OA 5LXRA 1KLMA 2MSSA 1I94J 5GADU 2DRAA 1GTHA 2RF2A 3UDLA 3SBMA 1Y5LB 4OLLA 3SI1A 2EO8A 2DNYA 1HHSA 1RT2A 1DURA 2C42A 4ONUA 2P9GA 4KUBA 1WC3A 2NR0A 3DOKB 4UIAA 2RS8A 2BUEA 4WU2A 1T03B 4XPEA 1EKRA 1NPPA 2A1BA 3RRKA 1P4NA 2ANPA 2YPZA 1BY9A 3GJQB 4JI1F 3O2IA 2AJ1A 1XNRF 2PDOA 1VBXA 1B7FA 3FMWA 4TKTA 1R0AA 4MJ8A 2G4BA 1FXLA 2PIZA 4P9SA 5D29A 3HLPA 4KSIA 2X1GA 1VRTA 1RT3B 2RRBA 2VQFF 3KWMA 4OLPA 4RNHA 2DK2A 1XIXA 4USJC 2FVGA 2BJ9A 2MMYA 3I5BA 1RWMB 4NZ6A 4M5KA 2RQKA 2ZBPA 3OTEA 3TVKA 1C1CB 3DOKA 2O53A 1VRQC 5GCNA 3MEDB 3GU0A 3HHLD 1T03A 3M8PB 2R7HA 3MCSA 4PG4A 5E2QA 3ZTQA 2CJAA 4RBUA 2EFPA 3FYNA 2IVMA 1U6BA 3CPXA 4ICLB 1R8BA 4I64A 4YY3J 4Q5VA 2M5YA 1ZAVA 1S0VA 2IA0A 2J6UA 5LL6d 4OIXA 2ZNYA 1HQ2A 4X84A 4P4JA 4HHJA 4J9PA 1QAXA 2MDAA 3D6FB 4LR9A 2LXIA 9RUBA 3CCWA 4NMXA 4J90A 4A33A 4DYOA 1DLOB 1KFSA 3ETOA 4BLGA 3I0RB 3CCJS 2Z2MA 3H4QA 2ZH6A 1UZDA 1U25A 2R1IA 3FEEA 2HEKA 2IHR1 2ZBCA 4ZCMA 5KT5A 3OSNA 2BM0A 1OSDA 4CAVA 4NCGB 5K8MA 4MK8A 4ZX9A 2LEAA 1WG1A 4NOHA 4ZLNA 4GMKA 1VHEA 2OB0A 1WI6A 1RKJA 4ICLA 2XYHB 4CO0A 2J8AA 5F8GA 4ED6A 3KNAA 3GG0A 2WZ1A 2R8IA 1QVFR 1NK5A 1TUVA 1AUGA 2H1YA 4KOUA 4F26A 5I3UA 2XB2D 3M2VB 1M5KC 2L48A 2CNOB 4LBPA 4C0BA 5KT4A 4A8FA 3B35A 4B14A 4ZP8A 2YX1A 5F8JA 2GAGC 2C6CA 1SC4B 3OVBA 3KDNA 3DLBA 1DLOA 3KMQA 3I0RA 1Z2ZA 2ZC4A 3KKWA 1YZ6A 4X62J 3D2WA 4Q8FA 1JX4A 2A6OA 1YJWS 1ELMP 2YKAA 2ZD1B 2XI2A 4ELTA 3RRGA 2DEJA 1NBEB 4DX7A 5D0HA 1PBAA 2KRBA 3CC4S 2DISA 4NCGA 1BMQB 5HXDA 3PW2A 1RA7A 1U6MA 2AKWB 2VFVA 4NA1A 5CZXA 4A8QA 2K3KA 2NPIA 8RUCA 4DI6A 3AQOA 1YRXA 2ASYA 1RLCL 4K4SA 3QJJA 3VCDA 5A8WA 1I94F 5IV4A 3QRPA 5A8RA 2I0XA 2R7TA 3FEZA 3J7YI 2E5LJ 4G1QA 5IT0A 5E5NA 1HD1A 1PSDA 3M2VA 2HHUA 3PYEA 4E2AA 1RACB 4X64F 1WK4A 3H2VE 4EYIB 2CDRB 3IN5A 3U1NA 3MCOA 4LMZA 4XO0A 2Q66A 1TAUA 3PHEA 2F7VA 1UA1A 2DF5A 3DLGA 1UPPA 1TU0B 4Q2MA 2ACYA 1KS2A 2IM1A 2CA9A 3FQKA 1U1NA 2ZD1A 4R0EA 3PW4A 3FFIB 3WX8A 3S01A 4J3GA 3SXNA 2C6PA 2ZEOA 1AYEA 5EHHA 1HMVB 3G6YA 2QX0A 4MKAA 3HFKA 2FSRA 3JQMA 1L3KA 4U5YA 1HI0P 3S9MA 1NHKL 1UJ4A 2EBJA 4UOHA 2PCUA 2JLEA 5H9FK 2QYVA 5F3ZA 4L76A 3KKFA 4NEXA 1V5IB 4CIOA 4R25A 3G6ES 2W9AA 4B11A 3KK1B 3CNQP 5CQGA 1Q2YA 1R57A 4M5JA 2VEZA 5F8LA 3NCPA 3B3VA 1TP7A 1S7NA 1B64A 2UUBF 4QB9A 1RTHB 2DXFA 2EBGA 2D41A 3M9OB 1YR0A 5DGBA 3H4DA 4XDCA 2X1FA 1IIDA 4EO6A 4KPCA 1EETB 2NZ4A 1S9GA 4GC6A 1EP4A 1HMVA 2M70A 2EFVA 3OTBA 2NMTA 4KY3A 5DS7A 2DITA 3HSGA 3EGVA 2HHPA 2YQ1A 4RU9A 1ZLHA 2D7SA 2DR9A 2W2MP 5I4MA 5K14B 3TX8A 4M6IA 3MMCB 2R2TA 3H8YA 1SJRA 3KK1A 4ZVTB 2BQRA 3Q23A 5E3RA 1JIHA 4NJRA 2OIHA 3A3NB 4RUBA 5BYQA 1D0EA 1RWOB 3MR3A 2EK9A 5CYQB 4AVBA 4O3QA 1RTHA 4LJMA 2NXJA 3QWPA 5AJ3J 3IWEA 2B0GA 2PJ7A 1NXIA 1UVIA 4ZOSA 2FYXA 3D3BJ 4WWSA 2B5GB 1EETA 3HT3A 2YKNB 3HF5A 3FMBA 5F49A 2N3LA 2OPPB 1GMWD 3D1HA 3EDRB 1T3OA 4Y2KA 2DHAA 3HDSA 2RILA 4UW2A 4B12A 1BD6A 2ZH2A 2PJ5A 5SUHA 1QAJA 2CPYA 1UVJA 1Q1KA 4PXDA 4X62F 3G8QA 3MMCA 2CNTA 3RR7A 3HT0A 4B9UA 1S76D 3W8PA 3QT6A 3DOLB 2MLYA 2JFDA 1AFIA 3C16B 4Z7CA 4JOUA 2D9PA 2REFA 4KHRA 3HLUA 2PE8A 3VV2B 5C82A 2WVBA 3EVOA 2MKHA 1GEHA 1TMMA 3RZAA 1NB2A 4IRDA 4ES1A 5DZ7A 1NK8A 4M5HA 1ICEB 2E5LF 4ZJQA 5I3QA 2OPPA 2P8IA 3BI0A 5L46A 3JUWA 2FY1A 3VZHA 5DQGA 1HNWJ 3V81B 1CBKA 5A2QU 3QGPA 2PVWA 4IOBA 4PCQA 1O51A 4ECQA 1VIOA 5DLFA 3K89A 4TQSA 1SJ3P 3QQCD 5CD4A 2I9SA 4CYUB 4HI1A 1Q8LA 1H3DA 4BBYA 4F4WA 3DOLA 3CCSS 5FVJA 3C16A 4EWTA 3J7YU 3BBBA 2F4VJ 3QGHA 4X4PA 2PN6A 2W2NP 2Z58B 4ILMA 1TL1B 4C3MA 2ZM6J 1U1RA 1TELA 1XNQJ 4LFBJ 1RHRB 4MCSA 4CO3A 2VQYA 2Y3YA 3HI9A 2YGWA 4NGPA 1BQNB 2KVQE 1T9XA 4Y2AA 2H5MA 2DEAA 4MK7A 3OD2A 4R76A 1DHMA 2FQQB 4YB1P 1VYAA 3V81A 4R57A 5DRKA 3X3UA 4YR3A 3LO3A 4AXJA 1WWZA 4RNFA 2G1HA 2CQ4A 2X3GA 4LF8J 1RAHB 3HVTB 2IBKA 1CJTB 2E9RX 3OW2R 3VVTA 2MKKA 4LBHA 3GCWP 2JC1A 4CYUA 2DR7A 5ETVA 2ZBRA 1IGBA 2XO7A 3MEGB 1WELA 2UUTA 2UUCJ 1ELOA 4RI1A 1C1BA 4DCPB 4U9ZA 1TL1A 1SUQB 1FI4A 3IGVA 3CZXA 3LALA 1RP5A 1FKOB 3V6DB 2Z2LA 4A39A 4HDGA 1K0TA 1UJ5A 2HFSA 1X12A 2ZEGA 2FIAA 1BQNA 5BYSA 1C0UA 4O3OA 1CVJA 4DCJB 5BXIA 2FIUA 1MU2B 2G0BA 3VF0B 4U8VA 2R2SA 2ZHAA 1N34F 3DOMB 2WYRA 2ZZNA 4WKYA 3W5XA 4AXIA 4A46A 1RSCA 3VAKA 2HB6A 1RISA 3GIKA 3HVTA 3FMCA 3KI9A 5AJ3F 1LW0A 3CJ0A 4QBJA 4OJ3A 3MEGA 1YVOA 1BC6A 1C2PA 4NLQA 3FBCA 2DNZA 1KTVA 3VAJA 3T9YA 2EWBA 3SV4A 4F9UA 3OFFA 3OHAA 1SUQA 1CM0A 1U0SA 2KT3A 4NLPA 3HJFA 4F67A 2CQHA 3V6DA 1QTMA 4F0MA 3D0IE 1HDQA 4KORA 1JLAB 3AH6A 2DY9A 4PK3A 1Z8WA 2A6MA 1SQHA 3ILLA 3BF4A 3RB3A 2WB1D 4KC5A 1VISA 4QVTA 2QLWA 3N6MA 2W1BA 3DOMA 4P2MA 4RUCA 4K4UA 1Q5VA 1APSA 4KB7A 3VQTA 1XBWA 5DDPC 5KFYA 3R1KA 3EE3A 4TXSA 4NI2B 2YKOA 3M2UB 3EVWA 1IY7A 4DN9A 2JL9A 2O1PA 1R8HA 3CGIA 1XMOJ 3QYYA 3FNCA 1ZAXA 4IH6A 1JLGB 1FJEB 4UTGA 4MT1A 3NS6A 3EXNA 1VQLS 4UOCA 2RAQA 1J2VA 2DNQA 4M5LA 1FHTA 3HSDA 4DUYJ 4OC5A 1Z2LA 1LWEA 1JLAA 2VZZA 1F5AA 2J9EA 4P4BA 3D54A 4CLPA 3R9GA 1GXTA 4ES2A 3CCZA 3LQVA 3PZJA 1MWYA 4F4AA 4K4ZA 1OY8A 1TQLA 3M2UA 2I2YA 9ATCB 3EX7B 3R6GB 2ZM6F 1XERA 5D4PA 1WKJA 4EI2A 2FPHX 3D1OA 1JLGA 4BMHA 3UY5A 2B9YA 2P6SA 1CPXA 3GIIA 3BSOA 3OR1B 3BJ8A 2V8PA 4N7TA 4CLUA 4Z65A 3L3CA 5E41A 2AEJA 4HI2A 1WOSA 1QQ9A 4CYOA 1PJ5A 4Y2MA 2NS1B 4AUKA 4CRZB 3VTIA 4LF8F 3PB7X 3S6FA 3LANA 4RZRA 4C8LA 2AFOA 5C25B 3GJRB 4DJBA 1RAFB 3SI0A 3IWXA 2XGQA 2UUCF 2GIQA 4F04B 2C1EB 4OHXA 4DR4J 2OGUA 5CCLA 3NNHA 3CSKA 2MKIA 2RDDA 4ZPBA 2OJ3A 2P6GA 4AL6A 1WG5A 2MQOA 3QT8A 4DMZA 2R2UA 2HHVA 3FH4A 2Z3LA 3TI0A 2OD6A 5FJ4A 3A8KA 4USHA 3EGWB 2MKYA 4AQYF 2HRTA 4F50A 4DL5A 3BDPA 2RE1A 3TC8A 4YDXA 2F8EX 2LU2A 4IH7A 3JRUA 5IM0B 5KT2A 1U48A 4USKA 5DS0A 2OO4A 3H8EA 4PYAA 5B0EA 3IWLA 4Y34A 4FF1A 3T9NA 3DRRA 2KM8B 4A4JA 4DQIA 1UA0A 4FNIA 3I87A 3P5BP 1NPKA 1Y7PA 4IUSA 1REGX 1XEBA 4WK1A 3W5ZA 1PIEA 1M1DA 2Y1JA 4KR0B 3MR6A 2LQ5A 3QB8A 1D09B 4USTA 3L7PA 1IWAA 3LPYA 4NGSA 5KOWA 4KFBB 3SCJE 4NGQA 1HDUA 4UWIA 4AD6A 2O4HA 3R5JB 3ITHA 2KFNA 3T1YJ 1DTTA 4RBTA 3OXGA 1HNVB 3AJDA 1L5UA 3EGZA 5IM0A 2E5HA 4DL2A 2LEBA 4CM2A 1X4BA 3V4MA 2RDJA 1X4EA 5F47A 1IR1A 2SXLA 5IQQA 4LQ3A 3H5ZA 3LTOA 3KFWX 1YI2S 5D0RA 3KUHA 1WC0A 1P8GA 3AXKA 1XMOF 2FGOA 2LA6A 5KFGA 5DG9A 3OHBA 2J7KA 2HVHA 2KM8C 1M5OC 1YLOA 4OC0A 4P44A 4IFYB 2XNRA 4OYBA 3MD1A 1OZPA 2CWKA 2H9ZA 3NWRA 4MFBA 4DUYF 2EVZA 3LPEA 4KFBA 1GXUA 3ETMA 2JEJA 4FBUA 2JH3A 3W91A 4KBIA 4UQTA 5HMWA 3MFHA 1IB1E 1T9WA 3EXCX 4DG1B 5F48A 1F3FA 1K44A 1HNVA 2DGOA 4ZKAA 2QT7A 2MLXA 1U6FA 3B82A 1RUSA 2XSJB 4CLSA 1Y0YA 1T3NA 1U45A 4I2PB 3U02A 3NWGA 1S48A 5KFCA 3P49B 1QAYA 3BSCA 4TU8A 1T7PA 2J0QD 1UZHA 2BRLA 2KL8A 2CPIA 3U1MA 3R1HA 3KHGA 3BKFA 3FF3A 3QT7A 2XY7A 4LRDA 1MJAA 1YBTA 1LAMA 3KUEA 4EU0A 4URGA 5CPAA 1Q8IA 4Z37A 3UCZP 1SI9A 4UZCA 4Y2IA 4E8UA 1HEEA 2Z10A 4DG1A 1SPBP 3EWGA 4LF6F 3W9HA 3Q8YA 4OHYA 3O1LA 5L1KA 4L89A 1UW4A 3ZJ0A 1NJXA 2R8HA 4NZ0A 2XSJA 4I56A 3FBBA 2JZ5A 3M8WA 2XULA 3S1TA 2C2EA 1M5HA 2HG4A 4JJXA 4X4SA 2PA8D 3CDAA 2AE6A 2C3OA 4CAXA 2KYZA 1X4AA 3OFEA 2R7VA 3HZEA 4PV6A 4DSFA 1T9TA 3C6UB 1WNEA 1UETA 3KLHB 2BJ8A 1S12A 4L8AA 3GCXP 4CO5A 4P73A 1VGYA 2C2MB 4ED4A 3VGSA 4EFAC 2D4PA 1FDDA 1SL2A 5L1LA 4PG6A 3K59A 2DBBA 2G9OA 4O3SA 3C8YA 2CNKB 1A6LA 3AD8C 1JKHB 1VQNS 3ULHA 1N36J 4PXCA 5IC6B 1XF8A 3P8BB 2QLXA 3H25A 5HATA 4H4KA 4QIFA 2DVIA 1R27B 3EGNA 4DWIA 2CQDA 1S99A 3ZTOA 4LF4J 5LSOA 2EC2A 4XTTA 4PZVA 1SC3B 3MTKA 4P52A 3PVXA 1N33J 4JI4F 2XEFA 1VOMA 3D7DA 5JQ4A 4ZPCA 4JI6F 3C6UA 3KLHA 3FBEA 3TANA 3FDSA 4IF5A 3T1YF 3SMZA 4ANEA 4BDPA 1RXTA 2RHQB 1I5OB 1TUWA 4U7UD 1GMVA 1V5VA 3S9NA 3PRTA 1XMBA 1FFGB 5HVHA 3D3CJ 1RDRA 4OX7A 4NLSA 3IC1A 4K2JA 1JKHA 3D67A 2C22A 2AX1A 1TKFA 2G2OA 2VJUA 5IB9A 3B3TA 2N4CA 3A13A 5IT9U 3EM1A 2LXFA 5EGYA 2ZDPA 2GVZB 2CNSA 3NL0A 4U7CA 2HFVA 3OXFA 2IDLA 3VARA 2BW7A 2WZNA 2OPRB 5LM7E 2Y0BB 5M2PA 3B8GA 4H54A 3SXLA 2DJWA 2D3O1 3H20A 3J81Y 1YJTA 2ERRA 2Y0SD 2DPJA 3MAHA 3ZTRA 3ZTSA 3TO7A 2PI4A 3HVAA 4ERDA 3PR4A 2UXDF 3RTVA 2VKZG 2HHSA 4KGXB 1LK5A 3GYXB 3QAUA 4M94A 3CJ8A 3R5DA 2ZW4A 2J7WA 4OMFG 1S6UA 1Q2CA 2B4BA 2PC1A 1BQMB 2MKJA 1MWZA 4X4UA 2PRQA 3TJ8A 1IBKJ 1S59A 1TKHA 4I1TA 3IWGA 4MBUA 2A0FB 1MN7A 1M90T 4R87A 4ID8A 1MN9A 4Q0BA 2CQ1A 2OPRA 4CYNA 3TOQA 4KO0B 2NXEA 4QIEA 1MJBA 3GFYA 3JSMA 3EY5A 4KOYA 1VC0A 2BM1A 5CYJA 2RS2A 1HBUB 3JVNA 1FWLA 1LNQA 1Q82T 3C46A 2ASDA 4U9RA 1NK4A 4CO4A 3VR1A 4DQSA 5KOXA 1JWWA 1WUUA 1BQMA 2FIWA 2C27A 1U8SA 4NX9A 1NDCA 1FJ7A 1V0CA 2XO6A 2NXUA 4YDDB 3BO4A 1DBDA 2QL7B 3FCHA 2R8GA 1Z4UA 2EK6A 2KXNB 4FUUA 5KFOA 1IVZA 3SQGB 1DJ0A 5HQ8A 1C4AA 3DXBA 3HPOA 5FD1A 4QPTA 3Q8PB 1N36F 1FTRA 1RA6A 3FRMA 1OWXA 4FKYA 4ED1A 1TIQA 1WTBA 3NKYA 1ZM4A 5IV3A 5DQIA 3Q0AA 3MM9B 1CQMA 1LEOA 3C66A 4KGKA 4B5PB 3NG8A 1TR0A 4MMOA 2ZUGA 4ZVFA 4CNYA 2CFXA 3W2VB 1U0HB 2AGQA 4PSXA 2DNNA 1N33F 2KRRA 1K0VA 3LWMA 1BPNA 1GX5A 3IAM9 2Z3NA 3BGFA 3R8YA 3FRZA 2HGLA 3PEIA 4JI2J 3SEOA 5HROB 3R7BB 1OS5A 2HRUA 3ENVA 3BJYA 3SQGA 3JQJA 2F63A 2JDCA 5F46A 3CXCR 1U24A 3L9ZA 4ALZA 2E44A 3B78A 2I3CA 1NH7A 3KL9A 4RNMA 3MM9A 2CWXA 3TX0A 1NKCA 4D3HA 4DV1J 4B5PA 2BANA 3CD7A 1BGXT 3W2VA 3MAQA 1U0HA 5EX0A 5LRKA 2QE5A 1EIYB 4C7QA 1N56A 2YWFA 3RBXA 4LF9J 4MKYA 3NP5A 4ECRA 1Z4RA 1G4CA 2D69A 2QYGA 4QIWD 4K7QA 4K0KJ 4ZVHA 2K7KA 2LMIA 5KG0A 4WP3A 1G2EA 1LKZA 4EBCA 4JI0J 3HM9A 4DU8A 3CDEA 2APOA 3TZZA 4U7UK 4H89A 2BJ3A 2XS7A 1IBKF 1UVNA 2YTCA 1TKDA 4DSLA 2M3DA 4PQUB 1AUSL 4WE1B 3H59A 4DPTA 4MHNA 1GT8A 2PJ8A 4UQGA 4UT4A 4IRKA 2GQQA 5ETRA 3D7HA 4GXHA 4FXWA 2VPZB 2BZ2A 2QLBB 3IS9B 5G0RB 3PGPA 4DR1J 4M5DB 3I32A 1LFPA 4CI0B 4CLTA 3A9LA 4MHYA 3Q8SB 3N9UC 4WPAA 4OI0A 2HURA 3BR9A 2OZUA 1YG0A 2CADA 1YVKA 4A32A 1GAOA 4Y49B 4X66J 5D6GA 2CIJA 2MEWA 3R6LB 4ZY2A 2B4PA 1UFLA 3CMQA 1W25A 3G82B 1KKHA 1EARA 4ZHRB 4PQUA 4WE1A 2Q43A 2BXJA 4QR2A 2VOPA 2CXAA 3V6JA 2FC8A 1J5EF 3MUTP 2C2ZB 2AZ3A 1RBOB 5G0RA 3DRXA 4M5DA 2WVEA 4A8SA 5KG6A 3FEYB 2DPSA 1FKPA 2FVSA 1BUXA 1Y5NB 1N4LA 1TL3B 2F5GA 4E2FB 3MMBB 3V6HA 5ETSA 2IRYA 1I3OB 1Z5RA 3A3OB 1IOIA 2QJ3A 4DPYA 3PW0A 1F2GA 3W62A 2W9BA 1Y0HA 1X8DA 1EB0A 1MWQA 2U1AA 3MPVA 1KSPA 1YWXA 4ZHRA 3G82A 1FK9B 4YEAA 3T19A 4ZCIA 3BBFA 1NEEA 3UCUP 2DPIA 1JXEA 4DLEA 4F3OA 3ZNJ1 3OV7A 4DHVA 3DRYA 4C7IA 3UNGC 2DNPA 4OYIA 3OR2B 3EPGA 2X1BA 4LSZB 2CQIA 4XNHC 2R9LA 3RB0A 2PD1A 3WQPA 4Q36A 1S1TB 2B9EA 4DV1F 5D3GB 4F4XA 1HNZJ 4JWPA 2NSMA 2IC3A 2YQ3A 2I5JB 1TL3A 4GVBB 2X7BA 3ILJA 2CJXB 3MMBA 1S1UB 4RW4A 1YIJS 1FA0A 3GYAA 3R9FA 3POTB 3PZPA 4B3OA 2HMIB 4NLGA 3M05A 3M8ZA 2HKEA 5F8IA 2XWYA 1FK9A 2MHEA 2Y9HA 2RDIA 4JD6A 1ARMA 4AXVA 4OZNA 4OI2A 1OQ3A 4JI0F 2DR8A 3ZTPA 4QC6A 2AFZA 4IYQA 4CH0S 1KVJA 3L09A 3SFGA 2L41A 3WIVA 1M0SA 3MPDA 1T05B 3OR2A 3QZ8A 5HAOA 1R0BG 4ZY0A 4MCQA 4DBQA 1VQ8S 3CCTA 3HHKA 1VQ4S 3C2PA 1I21A 2B4DA 1CJWA 4OHWA 1S1TA 5B0FA 3EZUA 1K1SA 4I6YA 1BAVA 3R9EA 3A1YG 4CGNA 2BE2B 5G1ZA 1BLUA 2CRLA 3MUMP 3TUZC 4GVBA 1UVMA 1S1UA 5KFLA 5D8HB 1NH8A 2YKMB 4AVAA 4ELUA 5EUHA 4KSFA 3CJTA 3AB2B 1KQSR 4U96A 5HP1B 4IO9Q 3LAMA 2NSBA 4DSKA 2QTWA 1LV5A 1O6XA 3CULA 1NU4A 2CQPA 1SJ1A 2P6FA 3GV5B 1HR0J 3PJXA 4OL8A 3M8SA 4NRTA 1DTDA 1PAEX 2NZCA 2E1MC 3P3DA 1P6TA 1HHQA 4ITSA 2QLJB 2YNIB 1KOOA 3H2UB 4NGNA 3VHQA 3SSRA 1R6VA 1T94A 2D74B 5ETQA 4W9YA 1EHWA 1T05A 5DQHA 2BSWA 2R7QA 3T8WA 2RVJA 3I56S 2XBPA 3MI7X 4FS2A 4X66F 3W65A 2OMOA 4LX9A 3BN7A 5KFBA 2BE2A 1UTAA 1SQGA 1MMLA 3FECA 1TFYA 3G86A 2GFQA 2KH9A 2DCUB 2YKMA 1PO6A 1LANA 2FB0A 4FYWB 4F02A 2GFFA 3HSJA 5HP1A 3CDXA 3ZNUA 2AYEA 4I2QA 3FB3A 4NLVA 1Y0RA 5F8HA 3M6VA 3KR4A 2M8DB 4ECZA 3IU1A 1IN0A 2VG5A 3UW1A 3CUNA 3HP6A 1S4FA 2ODFA 4C0HA 2HWHA 2B7BB 1WEXA 1YKWA 3CTRA 1ELLP 4C11B 2M2BA 4CNZA 2RUGA 4I6AA 4CS0B 4EMDA 4XPLA 3RUBL 1TV6A 4ZA1A 5L9NA 2ZH4A 4A8WA 3IG1B 4PYDA 2ZEPA 2EKNA 4B9SA 4IOAQ 4TLRA 5KTQA 5LSLA 3HX9A 4A95A 1KVKA 2UVVA 3CIZA 3HHLC 4R5PA 2FXFA 3BQ2A 4PG8A 2X3DA 3BDEA 1MSWD 3PRBA 5K20B 5H9FJ 2HS0A 3DDIA 4DX8H 2LCWA 3K58A 4X4OA 3FBUA 1RAEB 1S10A 1HNZF 3CMES 3CB4A 1VRUA 3UCGA 5KG3A 4DZDA 1GMUA 4C11A 4WFXA 3S7RA 3W63A 2BKOA 5CZVA 5B7WA 2VI7A 4ELVA 2AJ0A 2ARHA 1Y10A 2XZDB 1EE3P 4FD5A 1CPSA 4CYQA 1WF1A 1B0VA 3IG1A 3DYAA 3L7UA 2PIYA 1F6TA 2QEXS 2HV2A 5AGEA 3NXZA 3GMGA 1TKJA 3NS5A 3SDEA 3KLGA 4MHZA 1FJCA 2NYHA 2DH8A 3SYZA 2J9CA 5C7PA 4USMA 5KG7A 1XBUA 3Q8VA 2FD2A 4L72B 1SC1B 2R42A 3FQLA 1HLWA 3IBWA 3LACA 4AE5A 3QIPA 1N48A 2HQCA 1SKUB 2G0CA 5SZTA 1AW0A 3ISND 4ZBGA 2HWTA 5DGAA 2B4UA 5L1IA 2G13A 4OYOA 2Q7SA 4LR8A 2R8KA 3DMJB 5AE3A 1S3ZA 1S4EA 4ZN1A 5IV0A 5EX3A 4UEZA 2RQCA 3GKRA 3D4JA 1R43A 3E51A 2MZJA 4O4GB 1HR0F 2QC3A 1MK4A 3MCMA 1U2CA 4N56A 2RHSB 1NK0A 4Q45A 2HHWA 1RTZA 3GY9A 1KONA 2VL1A 2R7OA 3IAS9 2AWZA 1RWPB 1Q16B 2J0WA 2O5DA 2PMWA 1D1UA 2V67A 5THWA 4ECTA 1OPIA 1QSLA 3ZC4A 1FCAA 1M5PC 4OZ1A 1YK3A 2PJBA 4ZITA 2AFMA 3MOJB 1N6QB 5JPHA 1S7IA 1OQ6A 4A47A 2BE7D 1LCPA 4YS2A 3K9UA 4TU9A 1TXRA 2Z30B 1TL7B 1CBXA 3K57A 1XEZA 2UVRA 1CULB 1LK7A 2YWEA 2GO9A 1K73T 3QBCA 5E3QA 4UCNA 1FDNA 2ZE2B 1QSMA 3OTOJ 3K8VA 2RSQA 1SJQA 1D9FA 3V6KA 2GS8A 4KUAA 1RWVB 1KNZA 3DRPB 4O4GA 1RAGB 1IM4A 2ZPAA 3TO9A 2B9XA 2OPSB 1XJOA 3VALA 3NY0A 4HHHA 1LQ9A 4MYTA 3G4SS 1N5SA 2CTCA 5KFJA 5L1JA 3AAWB 1LFWA 2PJ2A 1PKUA 2F5IA 3M8QA 1N6QA 3QO9A 3DXSX 1EJ7L 3CPWR 3CW2C 1FRLA 1YLEA 3FK4A 2JVOA 1Q7YT 1TL7A 2AJ4A 1HWJA 1X9MA 5KG5A 4RKUC 3V8IA 3FC9A 3KMSA 5J1NA 1V6HA 2XYGB 4K4YA 5C5JA 2DD8S 2WTFA 4A8YA 4FPRA 1Z4EA 2B3TB 1SKWA 4AL5A 2IPOB 3H98A 3DRPA 3UVJA 1CEZA 1HA1A 2OPSA 5D78A 4Y65A 1S7HA 3QSYB 3NH4A 2HNDB 4PPDA 4KJIA 1WSVA 2W7OA 4JI7F 3NAHA 4L73A 2EG1A 2QO3A 2JSXA 1S0OA 2QA4G 2RQMA 3G8TA 5GMEA 2ZOMA 3N5FA 3MURP 2LLZA 3KDOA 1S79A 4HR2A 1ZM9A 3F41A 2C3PA 1HWIA 1RT1B 1HWLA 1XR7A 4YUDA 4CYPA 4WP9A 2PIIA 3P5TL 2B3UA 4FVCA 2BJ1A 1T02A 3SI2A 4CT9A 3BO3A 1A9NB 4FD6A 2EFQA 1Y4ZB 1DQ8A 1TK5A 1T9UA 4OYWA 1WHXA 1T8EA 4PEOA 3G87A 4MTPA 1F9FA 1NKEA 3WC7A 2HNDA 2FHOB 2MQLA 3M2RB 4II9A 4WZQA 4DR6J 2VB6A 1YW6A 4IAVA 2XCPA 3RW7A 1CPZA 3I3GA 1WD6A 2ILZA 3G71S 4OLOA 4KVOE 1UEUA 4RNNA 2ROEA 1Y9WA 1QDUB 1U1PA 3PIOQ 5BJRA 5B0DA 3WABA 2HZAA 4LIRA 3QRRA 1RT1A 2H48B 4HT7A 1A2ZA 4WJBA 2DB1A 4EMEA 3KHZA 5KAKA 2ATRA 1U26A 4ES3A 5B0GA 1WWHA 2Y8YA 2GX8A 3SV3A 5AXKA 4C2ZA 2ZZMA 4DR3J 4FYYB 1ZETA 1S7FA 2ZJQQ 1CJKA 2ZWOA 2FVRA 2V4QA 4FNHA 4QZVB 1LOKA 3VZIA 4KSEB 1H72C 4O0NA 3M2RA 1AXQA 1HPZB 1T95A 3AJ1A 3KNGA 1FT7A 5H86A 5ADZA 2LKZA 2WVCA 1TL5A 2CPEA 5A2QY 5JXSA 4DUKA 1U47A 5CYMB 3I9ZA 3N01A 2IVFB 2P5VA 2WRMA 3OTOF 1JLCB 2OELA 3E0KA 2FJDB 4JI5F 2FJEB 1FRXA 2MPUA 5MLCV 3D68A 3LA0A 1NZAA 2W8LA 4USIA 4Q8EA 3D66A 2A4NA 3AT1B 1X0PA 1WDDA 4LQ9A 4DFMA 2DIVA 3KG1A 2XQCA 3LGMA 3KHLA 3GPAA 1S0NA 1GX6A 3T1AA 5IC4B 3PRVA 1CQNA 5FDLB 2RMLA 2DHXA 4RW9B 1D8ZA 1YZ7A 2HHXA 4V1Ak 2RH3A 1NAQA 5LT5A 2JWNA 1YREA 3QMQA 5CYMA 3LWLA 2KJVA 2JBKA 2PJ3A 4MXUA 2KZZA 4H6UA 4XPDC 1UWAA 3GFXA 4PG7A 1KP6A 2B7CB 4OX9F 1KTQA 3NGUA 2JEVA 4DOZA 3DLLQ 2AJ6A 3H40A 3CJSA 3ZZOA 2XCAA 4EEYA 3BR8A 2ZITA 2AEFA 2R7XA 2GMJA 1X5PA 2MQNA 2B4OA 2L9NA 4ENOA 2VG7B 4RW9A 3DDNA 5CD4H 4J9QA 3VAGA 4I0WA 2R7SA 2Y8WA 1YMEA 2FZGB 3TO6A 4MKVA 3I5CA 4UFWA 1VJQA 4K30A 4USWA 5H1SV 3NMAA 3CC7S 2LDIA 4GVLA 5F41A 2ZEHA 4M63A 3BH6B 1JWQA 3FVYA 2YNCC 1FE0A 3B6BA 5B0CA 3FZBA 2KCWA 1YSJA 3M9MB 3R5BA 1FDBA 2DNOA 4K2XA 1AT1B 2BX6A 4PQAA 2P9EA 4R3KA 4ZLLA 1F9HA 4IO1A 2ZZTA 5LYFA 3GIMA 1IR2A 3KHXA 1FFSB 2ZXVA 1IU8A 4R8UB 3MGDA 2VG7A 5HMYA 4C3KA 1IUJA 5HL7Q 4YFJA 4KOVA 2RU9A 1Q0NA 2VD3A 4KAIA 4ID5B 4RW6B 5KFUA 4ZP7A 4J7CA 2YY3A 4UY8T 3IRWP 3I4PA 3NLCA 2IQ6A 3UR3C 1YHQS 2JLMA 1C0TA 1EKSA 2MZ1A 2KFYA 2QMXA 2YVSA 2OSQA 2J6SA 4OYXA 5HN0A 4X5KA 1OO0B 2BJ7A 5KFHA 2ZH9A 4K59A 4OYZA 2RD5C 2HFZA 2C6GA 3GR1A 4IK2A 2ZEDA 3A4TA 4RX6A 3HD2A 3RRHA 1Y3KA 2Z0GA 5B0BA 4DL6A 3ZZUA 4NLRA 2XTJP 3IR6B 2CPHA 2PSZA 4RO0A 4R8UA 1JLBB 1I6JA 3FJ2A 4AG7A 2CQ0A 4GO5X 1LAPA 2MHNA 4A31A 1AROP 2UU9J 4OC2A 3MMJA 4X64J 1HYSB 3GZ7A 4CAFA 2GLJA 4ID5A 2P0WA 4RW6A 4X4TA 3I5AA 4MFQA 4OQJA 1UFWA 1TMJA 4WFBQ 3RW6A 4P72A 4EO8A 2LP4A 1FD2A 2KFZA 5KT7A 4FF3A 4LUBA 4KVME 2GV1A 4J9KA 1WI8A 6AT1B 4QYZK 1YGYA 3RB4A 2WPXA 2RB7A 4M6HA 5E3PA 2CG4A 2NYIA 4KV8B 1X5SA 3MF5A 2YNHB 3NEKA 1JLFB 2F8MA 2V5HG 1RWKB 2Z4PA 2C2RA 3SJXA 2OLWA 4ZDNA 4OYMA 3QJLA 3DLEB 1Y7EA 1JLBA 1YJNS 3HJVA 4RLEA 2GREA 2VV5A 4Q44A 3CO0P 2XZTB 2YX4A 4C8MA 3Q22A 5A6PA 1N5VA 1HYSA 1VHSA 3GSIA 3HHNB 2UUBJ 4WTYA 5KG2A 2EVNA 2JHEA 2HZVA 1J27A 2QVPA 3AQPA 3KK2A 4C8NA 3VVUA 4B3RJ 2Q79A 2ZEFA 1KDNA 1CC8A 4ZK7M 4X4QA 3RB6A 2PE3A 2FY8A 4P7TA 3MM5A 3IR7B 2JEWA 4P75A 3DDDA 3BB5A 2J9AA 1HWKA 4DR5F 2VBQA 4LRCA 4DS4A 5I3UB 2W9CA 4CP5A 1XN9A 4KV8A 3NCRA 1SV5A 1ZM3A 2YNHA 4YR0A 1R89A 1JLFA 2W25A 1PG5B 2EPIA 4DDFA 2BDPA 4FD7A 2AGOA 3WIUA 4DFKA 3DLEA 2ZJRQ 4CGMA 2AIRB 5KFZA 3V4IB 1RO5A 2EG2A 3UNYA 3S6HA 4OV6A 3PO4A 2OZHA 1PBUA 4GRSA 4JXQA 1GH8A 4QJVA 2XZWA 4ZPAA 3T1HF 3CJQA 2HQGA 3QGGA 2CZ9A 2R8VA 2WW4A 3TEHB 3I0SB 1RWWB 5A8WB 5GMDA 2ZOGA 4OP4A 5A8RB 5EMIA 2V63A 5CABA 1V9OA 2QIRA 4JLYA 4YHHJ 1HW8A 4G1QB 3W3SA 2OFGX 1FRHA 4N8OA 3NMRA 3KR5A 1LXNA 3W7BA 1FY7A 3W66A 4CRJA 2XEGA 4KIAA 4KGMA 3D7FA 4NCZA 2C2DA 4ETZA 2MTLA 1M4LA 3OTDA 3TTHA 2CYYA 1WHYA 4H6ZA 3L2NA 2YXLA 2VU5A 3DLGB 1B0TA 4WFNQ 2B8QA 3V4IA 4OC3A 1KC8T 4J9OA 2VPWB 4ZYQA 3GIRA 4WFYA 4MJKA 1U09A 4MFZA 2HBQB 1WOPA 4L6V3 2VHGA 2XY5A 2NSCA 4EVYA 3J7AN 1QVGR 3I0SA 4C48A 4C4WA 1PC5A 2RUSA 1S97A 2GANA 3ICLA 3CXQA 1LWFB 4ZLPA 3J80Y 3BSAA 3IEHA 2UU9F 3FJUA 1HI8A 3LUYA 3RJMB 4G6VB 3GV8B 2BBEA 1SBRA 1NM2A 4DNCA 3W5YA 3HMJG 1RAOA 1S1WA 3PJWA 2FLNA 3GFHA 2ZBIA 1RWNB 2FDNA 2PO4A 4LUAA 4F8ZA 2B6AB 4FBTA 5KTDA 2A3JA 2J9DE 1S9GB 3IP0A 4F0KA 3MM8A 2IJZA 3R1LA 5I0CA 2Q7BA 1EP4B 2GMHA 3K2YA 2JDDA 2HS3A 1RYRA 1MJ9A 3LGNA 2XMTA 2YH0A 3DC2A 4KSAA 4N76A 5DDQC 2QSFA 4KH0B 1LWFA 4PWUA 5HQMA 3E2EA 1IQTA 3NNCA 3TE4A 4UFVA 4FF2A 3D4UA 1Q81T 1GTEA 3OFHA 4ZGYB 1OY9A 1SQFA 5RUBA 2DGXA 5JVHQ 4ZVEA 1CLFA 3O8WA 5KTCA 4LRAA 4LRFA 1S7KA 1U6ZA 1TK8A 3GR0A 1NO8A 1X31C 4B3RF 1MMNA 1PJ7A 2EEYA 4O0IA 2B6AA 1QSNA 2ADBA 2G1DA 4A8XA 2ZW6A 5LYIA 3X1LB 2BO9A 2HYIB 3ENQA 4HVZA 1F3VA 5G21A 1OPZA 3TVYA 2P6TA 2Y0MA 1DQ9A 1PUAA 4IH5A 4LFCJ 1GYTA 1RXOB 1FDAA 3FRYA 3W6SA 3C15A 4MY0A 2AJFE 2DNMA 1R0CB 2WSFC 1VBZA 3OJUA 4KHPJ 5J1PA 1D8YA 2AJQA 1NHUA 5IWAJ 4KOSA 2LQJA 2RJZA 1AFJA 5HH1A 1N34J 3DLHA 2O67A 3QT5A 3ET6A 1TK0A 2C2KB 4PUOB 2GE3A 4N41A 3H90A 2V8GA 3RO0A 2HGMA 3GIJA 5ETTA 2EFGA 4QWBA 1RK8A 2I00A 4YHHF 5EWEA 3MD3A 3T5JA 2K5TA 1VQ9S 2DGWA 2PJ4A 2BV3A 4H2KA 4UZBA 1X9SA 2XGPA 3NCQA 2EW9A 3Q8UA 1VQOS 4YU9A 2KXFA 1WTFA 1YGHA 1RQ0A 4CLFA 2HVZA 4DR7J 2HZCA 5H9EJ 3JTKA 1WC5A 3LW5C 3LGHA 2ZHBA 2R98A 2BOAA 4RBVA 3ENAA 4ECVA 5LOQA 2VOOA 1E6VA 3ZFVA 4UUXA 3MPYA 4I7FA 1L0CA 3TZXA 4MCPA 4PUOA 3TOAA 3IRXA 2E7XA 1QJHA 3EC4A 4DPOA 1KUYA 4OZ2A 1P27B 2K06A 1N8RT 1R8CA 3DCAA 2LU1A 4CQ1A 1NJWA 3PBBA 3CDBA 1G1XA 4JV1A 3BLNA 5E7OB 4OJ1A 2Q51A 1S0MA 3GYNA 3VATA 5DJBA 4EZ9A 4DUTA 2H65B 3BHXA 3RYOA 3SCIE 3TJ9A 3CO9A 4WYLA 1XOVA 5C2GA 1IR0A 1RT4A 3B3SA 2MY8A 4WCEQ 4YGOA 3P6YC 1RE1B 3P2HA 2CVIA 1C1BB 5LRJA 3DNSA 4K50A 1NDPA 3JB9k 3K5NA 2PJ6A 3OWCA 2HQ3A 2HNZB 2KU7A 2I1RA 2W2OP 4CM0A 1WG4A 3UFCX 4JYAF 2I79A 2J7UA 5HI7A 2PMHA 3ILOA 4QWEA 4NPOA 3AOCA 1C0UB 5AT1B 2M52A 3D1QA 2L3MA 4FN5A 1YVFA 4FD4A 1N5YA 3AFGA 1URRA 2AW0A 4ECYA 2FJAB 1LWCA 4CGLA 2N7YA 2QIFA 4C2MA 3HXMA 4F6AA 2B56A 3TQEA 2MZRA 5KFEA 4C68A 5M2RA 1HW9A 1LW0B 2OHDA 3NRBA 4Z2XA 3V7ZA 4YR2A 2DEIA 3SJEA 1NE9A 2MYFA 1Z1ZA 2YWHA 2Z57B 1X0FA 3HK2A 3MGJA 3Q24A 3PACA 4QPXA 4F8RA 1EZZB 4F2SA 4LFCF 4NF1A 2FS5A 4ZVUB 2JLGA 2D9OA 1GK8A 3DR8A 2HNZA 2KJWA 1DAXA 2NLWA 3M8RA 1KEKA 2BA9A 3U1LA 1JK9B 4MRIA 1ULRA 1X4DA 3S6EA 3H5SA 2VONA 4KHPF 3W2WB 4AQYJ 2QV6A 2XNQA 1VBYA 2NPFA 5IWAF 4GS4A 2O66A 4QW8A 4NLDA 2DRDA 1X4GA 4HH1A 4GO7X 3D7SB 1CSJA 4ZI6A 2ZWPA 2DXDA 4W98A 2LXUA 3TUPA 5ETMA 4NJQA 5J1QA 4IFVA 2MZSA 1DARA 4G1PA 1W2IA 1WJ9A 3BGUA 4URSA 4C6AA 3K5LA 4MI4A 5DZ6A 4UOGA 1Q4RA 3MCNA 1HWUA 4I67A 2HHQA 4HEA9 4L3NA 3CIMA 2Q44A 4OC4A 4DV3J 3CJKB 3THTA 1UWBA 1IICA 3WHIA 4KT0C 3KXDA 1EQMA 2XI3A 1LWEB 2FTRA 1YTYA 1O8BA 4IQMA 5JUMA 2FC9A 3W2WA 2BJEA 2E9ZA 4DR7F 3BH7B 2I6WA 2XLKA 1WACA 2DT9A 4H4OB 1RADB 1BWEA 1RHUB 3JAMU 1IBLF 3TVZA 2HHTA 3E01B 1H0HB 1XFOA 2QECA 3CD5A 5KFSA 3BQ0A 1L3TA 3KOAA 5CAAA 4JYWA 1L3VA 3MEEB 4J9UE 4ANDA 3VAIA 4ZCKA 3F5BA 3IGRA 1Y5IB 4PKDB 2DRBA 6FD1A 1OIAA 2QYCA 4HPSA 5EDWA 3H5UA 2Q3PA 3G6VA 2EFOA 2ZOFA 3CJKA 4PK2A 1VQ6S 3MR5A 4M1KA 4OZ0A 2FHKA 3BGOP 2QFJA 2GHVC 3UD5A 5C2CA 1ZBTA 4OIWA 3UN5A 1NLKL 5JM6A 1ZTWA 2H4YB 5F0UA 2PJAA 3KG0A 4TYBA 3C19A 5JMNA 4FF4A 1QE1B 4FWUA 5GAEI 5J1EA 3HHEA 4H4OA 3PCOB 3K5OA 3FCVA 3BS9A 4LQ6A 4NSQA 1UEKA 3UDCA 3E01A 2IMWP 1JQGA 3PYGA 4AL7A 3MECB 1F5CA 4KPYA 4DL0C 2Z3KA 2Z3PA 4DX6A 3MEEA 5DM7Q 3OSPA 2VBYA 1L3UA 3QFHA 2HVIA 3M6XA 2JOQA 4OAEA 5LJ3Y 3B3CA 2DYAA 2I8EA 2PJ1A 2DGTA 1D9DA 4WK3A 5C24A 2EC0A 3L4BC 2ATLA 2HQFA 1KFDA 3KZWA 1S6QA 1VHOA 1YJRA 4LVNP 1ZPVA 4DV2F 3HZGA 2M0GB 3DRRB 4EFDA 4OIDA 4LF6J 1FE4A 3Q8QB 1M5VC 1QE1A 2BEIA 4DV6F 4MAKA 3LH2S 1O0PA 4KVXA 1RCXB 3DM2B 3NGKA 2KO1A 3FX6A 4LSLB 3MECA 2B8PA 4P71A 1K4JA 2DH9A 3Q2TC 1MLAA 2H51B 2AQ4A 1SH0A 4MKBA 2V69A 1PILA 3ZXWA 2BR0A 3C14B 3ITHB 1J4JA 2EK8A 1IBCB 1DTTB 2HFUA 3PW5A 1JJ2R 2GO8A 2MKSA 2OEMA 4NMLA 1S72S 5D4LA 2VXKA 2C3MA 2K3IA 3QWUA 1QAIA 4IRCA 3ZZIA 1FEHA 2Q4VA 1Y00A 2CPFA 4L3KA 4K5SA 2W4CA 2BABA 1FX2A 1T0TV 1RAIB 3US5A 4IDKA 3TAMA 1WORA 1X7VA 2J0XA 4LBIA 3DM2A 2AHOB 1IJEB 4LSLA 1S7LA 4DV3F 4P4DA 4QUSA 1RTIB 1SC6A 5HMNA 5ETKA 4IUFA 4MFBB 1QD1A 4JI4J 5T14A 4DR2J 2D3ZA 4C97A 2V8VA 4JI6J 4QIGA 2FL4A 3C14A 2FT0A 3ZZTA 3NA6A 2QN6B 4YP3A 2HAFA 1RT5B 3RBZA 4NA3A 5I3PA 1R3NA 5DG7A 3M6WA 2VFUA 4CPAA 2BL1A 1UVKA 2VUGA 1PU9A 5D0EA 3D3SA 1KOHA 2IYIA 5KT6A 2YPYA 2E1PA 1HFEL 1SCJB 1VLOA 4IQXA 1VQKS 3RGIA 4DSEA 1CS4B 1IJFB 1GQEA 1WHVA 2ZJPQ 3IM8A 3HVRA 2HWIA 2AFSA 4KLWA 4C98A 3IMQJ 1NSPA 2KG1A 1RTIA 2BACA 4BWJA 2C2NA 1ZYQA 3KGQA 2VPYB 2XY6A 1RHQB 3CD6S 3CE8A 2FJWA 1VQ5S 1BXNA 4R3LA 4NFRA 1BLLE 2UP1A 2OMLA 3FVLA 1WOOA 2HHHJ 1RT5A 2E66A 1XMTA 3TQ1A 3R3TA 4C8OA 4C0OC 3PO5A 4F4YA 2J8NA 2VDHA 1YBAA 2UXDJ 4KHMA 2HC9A 1XE4A 2AX0A 2IM2A 1HBOA 4A8OA 4CTAB 3CXSA 4IR1A 3TNVA 2FJXA 1KD1T 3P4UB 4NA2A 1WC4A 4NLWA 4UBRA 1U2RA 1SXLA 5H84A 1CS4A 3CD0A 3AD7C 3NNAA 2ZELA 2VICA 1R7IA 3NAIA 1S49A 2E7VA 3I1UA 1JMTA 2IJRA 1HHTP 2QRRA 5GAEU 4OI1A 1VMBA 3WC6A 1KVIA 5T41A 2K7JA 4ED2A 1FT8A 3M9NB 4ZVGA 1S77D 4HLBA 2J5AA 3DGPB 3OJSA 2CF4A 5JH9A 2DO4A 3PKMA 2WB4A 4CTAA 4B9NA 2V2QA 1I51B 5DLGA 4PABA 5F8NA 2AD9A 4C2YA 4N77A 3CXPA 4CRYB 2DXEA 1LRZA 3TFYA 3KLIB 4DJLA 2Y1IA 2VC0A 1RAJA 2K1RB 1BPMA 2DGSA 3TA0A 1KBRA 3VWDA 1RHMB 4R9MA 3TEGA 2QL5B 2W4PA 3PYDA 4TQRA 2Z3OA 2QMUB 3EDQB 5D15A 5ISVA 3B2YA 3QJPA 3N7ZA 3CDWA 2HPUA 4DLGA 2UXCJ 1TAQA 2MQPA 1D3WA 4TY8B 1JJCB 1F2PA 2ZKTA 4ZVRB 1AA1B 1RT3A 2XHCA 5J2PB 3Q86A 2QL9B 2V34A 2CY2A 2CQBA 1U1LA 2RC4A 1GXLA 2IAJB 3WR7A 5F0WA 4WIIA 2VZYA 3PX6A 3DGPA 2DIUA 4H4KC 3MUVP 4B3MF 4C3LA 2UV8G 1C1CA 1NSAA 2Q1LA 4O3PA 2GJ2A 2FVPA 1M44A 2IMOA 3MEDA 4DR2F 2DCLA 5KFPA 3LAKA 3KLIA 2G3AA 4UEEA 3O44A 3M8PA 2K1RA 3TR5A 4ZJOA 4P4IA 4E8OA 1JJ4A 4X4RA 1JLQB 1YJVA 3MM7B 2CJBA 3UN2A 5DWNA 4NL5A 1K9MT 5L9XA 2BE9B 4C2XA 3D7GA 4BCAA 3LWUA 2FGCA 3TA2A 4BWMA 3JYTB 4TY8A 2DH7A 1SQEA 2PGCA 2CNNB 4BS2A 5J2PA 2OI2A 2ZEMA 2IY5B 3H5XA 4DPXA 2C3UA 1DZ5A 1FJGF 1ZM2A 2IAJA 4DX5A 1JXVA 4W90B 1VFJA 4JP8A 4BBHA 2ZBQA 1HIYA 3QZ7A 3AB4B 4NASA 2IRXA 1NSLA 4DU7A 4Q0BB 4B02A 1VHFA 2Q6BA 1ZG7A 1XMQJ 4DS5A 2KKHA 2OKQA 3JSMB 4QWCA 1SIZA 1DFDA 3DR6A 2VDIA 2HHHF 2XMUA 4YN3B 1JLQA 3MM7A 4JV5J 3UR0A 1DY3A 4Q38A 3ZO7A 2ZEEA 1UMJA 1M5SA 4G1IA 3JYTA 1H6KX 2ADCA 4QWAA 2QMWA 3GV7B 3T6JA 4WYWA 3ISNC 2VF3A 4UA3A 2M88A 2GW8A 1R8AA 5LMUJ 2PRBA 3O6QA 2XLJA 5ETPA 1EAYC 5GAGI 4NGMA 4B08A 3ILIA 1DQAA 4F3MA 3CF5Q 4LFAJ 2DPTA 4P6QA 5D4NA 4NXNJ 3TJAA 4P74A 2FHMA 4B3TJ 3NGTA 1SL0A 4LT6A 2Q04A 3EICA 4UCMA 3QLHB 4FKXA 1TKXB 4E0DA 2BRKA 2R7RA 3UO0A 2VFRA 1N32J 5F3TA 3LP1B 4DL4A 1B99A 5KFWA 4PXEA 2VODA 2YKQA 1H73A 2XEJA 5KFRA 2HIYA 1ACMB 3VGUA 4K4WA 3ZZRA 2HVEA 3MPUB 1FTCA 1U7LA 2OTJS 2PJCA 1CP7A 3THVA 4C8ZA 4DXLA 2YNDA 1VHIA 4YY3F 3BN4A 4ZCLA 3FFIA 3PNIA 3MDFA 1X4FA 2RRNA 5AG7A 2UXCF 2R4FA 3MHYA 4F36A 7AT1B 2HBYB 3H0PA 5JJBA 1J5EJ 5M2UA 2XG8A 1BOBA 2UVUA 2MJNA 3QLHA 1TKXA 4USVA 5J2QB 2OZGA 2ZKUA 3ISXA 2Y1RI 2LECA 2BANB 3LP1A 2AZ1A 1OY6A 2DNGA 4KOTA 2ZH8A 4W4MA 2FUG9 3SQOP 4ZJLA 2EKYA 2C3YA 3TRGA 2G0JA 4DSJA 1U1KA 4HNXB 3V5RA 4DV7J 4HKFA 4RU2A 3N79A 1VQSA 3RBUA 5J8FA 2LQ8A 3H2LA 4Y0FA 3SFUA 1N5QA 5IS2A 1OBRA 4HHUA 3ENWA 3GYGA 1MNEA 2VH7A 3A8JA 2FHJA 1WDTA 5J2QA 4B13A 4UF4A 1FRKA 4P45A 2AFXA 5K14A 5GMKa 1U2FA 2QG9B 3PRDA 2B5JB 4NGTA 3J7A1 1NMEB 1ZO0A 1YJUA 2HNYB 1X5TA 3K8WA 3PEHA 4NXMJ 4XK8C 3QGIA 5IB0A 2QJ8A 1OSCA 3LODA 3FKBA 5CYQA 1XMQF 1XWLA 3WC0A 3OUYB 2Z2YB 2DXQA 4ILRA 4K4VA 3IBCB 3D6HB 3QNVA 2EWHA 5F9LA 2PJ9A 4NLUA 2B5GA 1QSOA 4JV5F 1N5TA 3ZZZA 2YKNA 3FSYA 4NXYA 1A7GE 4F4KA 1X4HA 5KFMA 2J8SA 2RQ4A 3J7ZT 1ZG9A 5K8OA 4O4RA 4Y28C 1H8LA 1ZPWX 4I68A 3Q83A 5LMUF 3OPKA 2XMJA 3AD9C 1BHNA 4N8NA 2JEGA 2B5JA 3DFEA 3G9CA 3CJ3A 4DF8A 4HACB 2HNYA 1UAWA 1RHKB 1N71A 2FVCA 2V94A 4P6YA 4ONWA 1T9YA 3GUXA 4LFAF 4OJHA 3HKWA 1NDKA 4NXNF 3OUYA 1HI1A 3W9IA 3LP0B 4P4EA 2CZ4A 4GC7A 4B3TF 4CO1A 1RU1A 2R3VA 3QATA 1FNOA 2OOTA 4DV5J 4NGRA 4L75A 1N32F 1FKPB 2XMAA 3BM7A 2JBJA 3BI1A 2DR5A 2EK1A 4NRUA 2XHWA 1FFWB 5GAGU 4KRWA 2GHWA 1EQ0A 2ZVSA 1TKZB 2I38A 4HNWB 4K8RA 2W9BB 1G3OA 3FGVA 1YJ9S 3IO1A 3HFVA 4IHMA 1NZ8A 2PEHA 3GE9A 4HACA 1OYDA 3OL6A 4B9MA 3IA0A 2HK3A 2DNRA 4F0HA 5IQ6A 1Y7RA 2ACMA 4D3GA 2PT0A 3EYZA 2ZH3A 2Q0YA 1RBAA 2CJ9A 3LP0A 1GHEA 2HK2A 3G8WA 5KFKA 4LF7J 2KDOA 2HFOA 2IBOA 3PB6X 1FERA 4PG5A 4HDHA 4CWBA 4ZPWR 2IC3B 2AEMA 1K47A 1UP1A 1WC1A 4RW4B 1TKZA 4LF1A 2CIMA 4UUWA 2J76E 3RR8A 4X8IA 4B3OB 4TLQA 1UFHA 1NUEA 4WWVA 1CJTA 1KZFA 4EGLA 3DGVA 4Y49C 4F2RA 1KQKA 4DV7F 1KHWA 2OP5A 1QTNB 3DLKB 2WCXA 2OPQB 5AXNA 4N47A 4K3NA 4ANCA 1KRPA 5FIIA 2B58A 4QYZJ 1CJUB 5G4DA 4CLKA 2DGUA 4YB6A 1I1GA 3CCUS 4Q2LA 1FKOA 4LR7A 1ZAWA 3TCVA 2B4DB 5IOLA 2HFNA 1NKBA 4KGVB 3KLEB 1Y9KA 2B43A 1FF2A 5G20A 1MU2A 3OL9A 4OADA 4ECUA 3R5GA 5A28A 2GVDB 4NXMF 2BW2A 2BQUA 3A8IA 1O5JA 3KHRA 3JTNA 1BQXA 4WP8A 3I31A 4O3RA 1XJWB 1F1BB 2GQ2A 4FPIA 2RT3A 3EUNA 2PMZD 1XR5A 4KE5A 2Z56B 4OFZA 3MFIA 3DLKA 1N0UA 1YBUA 2OPQA 5FLXY 3HVWA 1F5BA 1S5ZA 1CJUA 3K7RA 5KFTA 3SSSA 3QRQA 4ZLJA 3O3LA 3CCRS 4FBEA 1HNWF 1FRJA 4ER8A 2OTLS 2CQ2A 4OHZA 1FNMA 2V4RA 5HMZA 2KYXA 4HH0A 3KLEA 3LF0A 2QZ8A 3TP2A 3I82A 1NPRA 4QOTA 4ED5A 2GVDA 4AYBD 3FIXA 2E1CA 4OV1A 4FP9A 3UWTA 2R2RA 4PWWA 1S9EB 2GMLA 1E6YB 4MFLA 2F4VF 4I2QB 4CLZA 3QFWA 5J8CA 3SJFA 4NI2A 4M95A 4TY9A 3G2XA 1XNQF 2V8DA 2L08A 4LFBF 5IFMA 3R96A 2VG5B 5EWGA 2VA3A 1HL6A 4DV5F 1QUVA 1V3ZA 4GKKJ 3W8GA 1NSQA 1Q8KA 1KQFB 4XPKA 2POKA 3MR7A 3PB9X 3H42A 2V4JB 3N5BA 5A27A 4M5NA 2WVDA 4HTJA 4A2ZA 1UKUA 3VWEA 3Q89A 3SI8A 4MFPA 1TV6B 1K1QA 1YX0A 3WT4A 4ED8A 2FVQA 5HJYA 5D77A 2KB2A 2J9DA 4EBDA 4A37A 1KQGB 3BSNA 5AG4A 4Y6IA 1S9EA 4FDFA 5KG4A 1E6YA 4NEYA 3HKZD 4R5PB 3KK3B 3RAMA 2FZCB 2F9JA 2NXNA 2IA6A 3BXMA 2M8HA 2PI5A 4LF7F 4OHVA 2HLUA 5AXLA 3T41A 2RU3A 4NZ7A 3OR1A 2XS5A 1VRUB 2QMLA 2V4JA 4LF2A 3KHHA 3M1VB 3RBDA 2ZDOA 4B9VA 4O3NA 3VQSA 1ZG8A 2XM3A 3MXHP 3DYAB 3OFGA 1XC9A 2ZENA 1RWUA 1Q7LB 5C25A 4WXWA 3SDEB 5C42B 1VR6A 1XIQA 3KLGB 5DO2A 2PR1A 3OVAA 2B3VA 3KK3A 4I6WA 4YOEA 4WIQA 2PFDA 2AGPA 2H5IB 2J0SD 5DDOC 3QIPB 2F1FA 2XMKA 2NUUG 4J9MA 2F3JA 1AZSB 4KZTA 4JI7J 2GQCA 3I96A 1JNZB 1TVRB 2CPXA 3QSIA 1B3TA 2BCOA 1NNDA 2WHOA 3M1VA 3H8FA 4MYUA 4P2SA 3M6UA 5ETOA 3D2PA 4H4MB 4AVCA 4URQU 2MQMA 5K9FA 5LMNJ 1NK6A 2E5JA 2BJDA 3D2MA 3F0AA 3HULA 3WC5A 1Q7LA 2NUHA 5AG5A 1RCOB 1BO4A 5C42A 1ZH5A 4J9NA 4ED3A 1VKCA 2IIHA 3T3FA 1TFWA 2DR6A 4EZ6A 5E96A 3VGVA 5ETNA 5HBMB 3VAFA 2HLTA 3D6TB 1AZSA 4DUZJ 2XS2A 1OJ4A 1TVRA 1FESA 3J80U 3T5HA 3IJ3A 4QU7A 1F57A 3BYPA 3RBEA 3VAHA 5EC4A 4A48A 4K5RA 4X2TA 4CAWA 1S1VB 1Q86T 4LF5J 3NBPB 4H4MA 1VJWA 5KFFA 2V0NA 3QAYA 3PX4A 3UD3P 2H54B 4F3QA 1P9QC 3B4MA 4XDDA 4GKKF 4IFYA 3IGNA 4U6PA 1FWPA 4F25A 4J9SA 1VQPS 5E3AA 3M8QB 5L39A 3W1YC 1Z8LA 2W4DA 3K17A 3QO9B 2HW3A 1C4CA 3W6XA 5HBMA 5ITHA 3PM9A 1IM6A 3R2CJ 4P4FA 4RNOA 1NK9A 4OI4A 3UI3A 4LQGA 1QSTA 1D9AA 3GTYX 3BYRA 4CZCA 1IKVB 4MK9A 1S1VA 1A0OB 1ZLIA 4DR4F 3NBPA 1SJ4P 3FEDA 2H5JB 4QYRA 1REVB 4JI5J 4I2PA 1MG7A 1UW9A 3K2KA 3UVJB 2MXYA 5LRGA 4DCOB 2BOPA 3WDOA 1NB7A 4I69A 4JBCA 1QSSA 3B3WA 4Q43A 3GQCA 2GIVA 3OVSA 1XK8A 2CQGA 4NWBA 3WX4A 2M7SA 1M1HA 3C6TB 1UFKA 2BKNA 3R9LA 2OR4A 2VBWA 1TTHB 2W2QP 1YDLA 1XQIA 3T9ZA 3PEJA 3TO8A 1PC4A 2F40A 1S6OA 2UZAA 4PRFA 1IYLA 2PJ0A 4WKRA 1IKVA 1IWGA 3ONQA 4WBFA 1FD8A 2OEKA 4C9DA 1FKAF 3FUYA 1LXJA 2U2FA 1PGZA 3VWSA 2V9KA 1REVA 2CVEA 2VG6B 3RU0A 3CJ4A 4Y3CA 1U8WA 2M4MA 5CNPA 4KLVA 3MN8A 2IM0A 4XIUA 1JJHA 2MLZA 1ARLA 1NDLA 4LVOP 4OX9J 1ZOTA 3F44A 3EO4A 2GZOA 3CJ2A 3T90A 3H4BA 4UIBA 3ELHA 4B3SJ 1VQ7S 2FHJD 4XAKA 1YRTA 4RWXA 2WPWA 3FEXB 3J7Z5 1FNXH 2KI2A 4ZVOB 3C6TA 3NE8A 3JTOA 4WF9Q 2IJFA 4DL7A 2HIQA 2HRYA 5LMNF 5B08A 3IU2A 2MQQA 3SZ2A 2CZVC 1PJ6A 1VLYA 1YLXA 3CCQS 4WFAQ 1RBLA 2HQYA 4KTQA 4CO2A 3BO2A 1HBNB 2L9WA 1ON0A 3CCMS 3GIUA 3B7IA 3OLAA 1P0HA 2HBRB 1PYOB 2VG6A 1SL1A 2WAQD 2QSWA 1CJKB 3GSDA 1VQYA 4ECWA 1FVSA 3SSQA 4ZVQB 1Q53A 4CCHA 4OZ5A 4RS2A 4DUZF 2NREA 2JVRA 1H74A 5G22A 2CJQA 2F65A 2UVWA 2HGNA 4W92B 4NCBA 2IDEA 4LSNB 3OL7A 3D8PA 4LF5F 4M6GA 1B7YB 3W61A 3W9JA 1RYSA 2MZQA 4UEFA 3OLBA 2BMBA 1QLNA 4AB7A 2VFSA 4OZJA 4UOFA 1Z9UA 4UCPA 2M9KA 1F2HA 1HBNA 2GGPB 2WK4A 4ECSA 3OL8A 3T5KA 2R8JA 1H7XA 4JZ0A 2KHDA 3KJVB 3CJRA 4QIVA 2GVZA 2BQ3A 4CDIA 2E1AA 4BHQA 3MPWA 3EMTA 4NE9C 5LSRA 2JNJA 5CHCB 4IG0B 3H5YA 3QIDA 4OZLA 4P7VA 4ZIWA 1SIWB 2HS4A 1BE4A 1M4IA 2JEFA 5KFIA 3K5PA 4B10A 3HFZB 3EFAA 2P9CA 2V2VA 2XSFA 3D5MA 3MWBA 2EXUA 4LSNA 1ITPA 4NYPA 1B6BA 2NCKL 4YQWA 4Q7AA 4MIWA 2L9DA 1RAAB 3UQSA 4KS9A 2VBZA 3GB0A 3HSZA 1VS3A 3DKDA 3OBIA 2F9DA 1CG2A 2YWWA 2ZH5A 1RHJB 2GGPA 3SCLE 3P2FA 3KJVA 4R8FA 2Q4YA 3T5LA 4DQQA 2ASLA 4NYZA 5T7LB 3NH8A 5F8MA 2ALYB 5IX3A 4FXDA 4TYAA 2GLFA 4IG0A 2KT2A 3M32B 4KO0A 1AB8A 4EYHB 2W7AA 2IRUA 3EZOA 2VJVA 1S60A 2YWGA 3LOUA 4N5SA 5IT4A 1MMDA 1NHVA 1MW7A 2DHSA 1KLNA 3E3XA 3R7SB 1HBUA 4ZS6A 2PR8A 5KFAA 1ZZNA 3TAPA 2QA4S 5GAHI 4YMEA 1T11A 4FVMA 4MIAA 5H9EK 1F2OA 4LF4F 1NCLA 4WTOB 5L38A 2UUAJ 4P2FA 4HYKA 3WBZA 4F7VA 3NE7A 5HQLA 3HUVA 3CJ5A 1TL4A 4M5MA 2O28A 1S57A 4QW9A 2ZFHA 1MROB 3GJSB 1L3SA 4B3SF 5T7LA 1ZA2B 3N4WA 2XEIA 2DO0A 5LXYA 3M32A 4DR5J 3TWZA 1IXKA 3PX0A 1SKSA 4HNYB 2AYBA 2GNKA 3PG9A 3S8SA 5HVFA 1RT7B 4MHPA 2ZC3A 4A94A 2EBEA 2VPXB 2GHPA 5KFNA 1PAUB 2CG8A 3THPA 3MZIA 1VQMS 2AF6A 3I4HX 3NOGA 2V2ZA 1TF9A 1C0TB 2G0IA 3GP9A 4EBEA 1VC6A 1Y3JA 2V50A 2AYGA 3F0NA 4DPWA 2GAHC 5BR8J 5F9NA 3GFZA 2AU0A 2G2ZA 4KOWA 2DHGA 3B54A 3T1HJ 2HUZA 2XWXA 3EXYA 1MROA 2VASA 4CLLA 1GNKA 5EWFA 3CWJA 3NGDA 5HROA 1KUVA 3PFOA 3MOZA 2KHCA 1M1GA 4OJGA 3SIPB 3RG6A 3CT9A 4X3RA 2Q6CA 4O44B 1U02A 4DV4J 3MEKA 5HK4A 3UD4P 3JXOA 4NLXA 3NS7B 2IM3A 1DTQB 2AV5A 3DHWC 1RT7A 3JAMY 1CC7A 4KOXA 3VGTA 4LIWA 2VZ9A 2DNLA 3ADAC 2JFKA 4OKOA 2YH1A 2IL4A 2N4DA 2F8HA 3IWNC 4MHDA 1UVLA 4WFZA 1RLDA 4IOCQ 1LWXA 4G3IA 3ZZ0A 4CT8A 2OH2A 1X10A 2OH1A 3PR5B 4RW8B 3VAMA 4XPCA 3R5CA 2BVZA 4OX6A 4WU3A 2V77A 1RGVA 3MR2A 3GJTB 1I1DA 1NRKA 4PPZA 4O44A 2G9DA 1JB0C 3AY0A 4BC9A 4KKOB 5CA5A 3ZZYA 2CTBA 2VQEJ 4R7MA 3R7NB 5KFXA 1DTQA 3JSBA 5KFVA 3U27A 4G65A 4ZPDA 1EX8A 3F56A 2RRAA 4K4TA 2GIRA 2X51A 2Z8QA 3KK2B 4DL3A 3HO1A 4ED0A 2WSCC 4B17A 1OMSA 2FJBB 4USUA 1SJFA 4KH1B 1Q95G 3MM5B 2YNEA 3U7JA 3KYLA 1RWXB 3TYTA 3PDNA 4QWDA 3H8GA 4XNHB 4HTIA 3S6KA 2W9CB 4AFFA 2XMVA 4DSIA 2AJ2A 1SV5B 3IS9A 2WW8A 4RW8A 3G6XA 2ALZA 1WEZA 3D28A 2KTQA 4M85A 1XR6A 4QR1A 4JUZA 1SH3A 3NOCA 4ED7A 1HNIB 4OYAA 3N6LA 1UPMB 4QR0A 1NSKL 2CQ3A 1SVDA 4KKOA 2ABZA 1IKYB 1S9FA 3SXOA 1Y9OA 5E0OA 2NYQA 2UUAF 3KJNB 3CC2S 3DLJA 5K5MA 5A0YB 3TOBA 5JVGQ 1ZA1B 5MAOA 4JI2F 1HBMB 5K8PA 1I12A 6FDRA 2RIJA 2YWKA 3JSYA 4ZY1A 5GAHU 5LYDA 3RAXA 4BINA 4A8MP 1U1MA 3IWWA 2V68A 3AOAA 3NGSA 3QPIA 5B09A 3S9LA 5KFQA 2IYGA 2W8KA 1QSYA 1NK7A 3DSBA 4F0XA 1Q8BA 1FEEA 1HNIA 2F4FA 4ZP9A 1ROFA 1OYEA 2J8RA 1IKYA 3QAEA 1RI7A 1QUPA 5E33A 2W01A 2IVYA 4YWYA 5D4OA 3H7HB 1RB0A 5BR8F 1R6YA 4QU6A 3A8EA 3R2DJ 5A0YA 3DU5A 1IQZA 4LF9F 4FS1A 3CPAA 1LW2B 2HQDA 1HBMA 3R97A 4DN0A 3OQ2A 4K0KF 3TUIC 3Q2SC 4JI3J 5IZHA 2YX7A 1B87A 1N54B 3KQZA 1YQHA 1JLEB 4LREA 3LD2A 4DV4F 2EUIA 3M4XA 1N0VC 3JS9A 7FDRA 1HARA 1IBMJ 4ZP6A 2ZH1A 1S1WB 4DFPA 2V9WA 3TA1A 4U8YA 1V3RA 5D3GA 1FO1A 4NLTA 3FNNA 4ORFA 2I5JA 3DU6A 4FAIA 2DHHA 4MH8A 3MM8B 4DEZA 2NQPA 2ABYA 1F9EB 3DHXA 1HQUB 1HD0A 3POTA 2HMIA 5HSPA 1LW2A 1F0XA 2MB0B 1PCAA 3FZ2A 2YBVA 1YW4A 3SHPA 3BGRB 3DNCA 3BJ7A 3AXMA 4DR1F 2MZTA 2VKRA 3D0GE 1JXLA 4Y00A 1X9WA 3PFEA 1H98A 5DETA 1JLEA 2MGZB 3P96A 2ZUAA 4OYPA 2CPZA 2GIFA 4V19J 4IG3B 3M7VA 4E98A 2VQEF 4ETXA 2DGQA 2KXHA 2D3OR 1RU2A 2QFIA 4B9TA 2OU2A 2KZMA 3MRUA 4FYDA 5D0GA 2E7WA 4CGOA 2BEFA 4TNUA 3BZQA 1Q5YA 1WEYA 2P2CB 5EBVA 3ZZPA 3A3PB 4ZPTR 2MQ8A 3HHLB 1CJVB 4I4BA 3RNZA 2JEIA 2RNEA 3TW0A 1WKLA 3UE2A 2E5GA 1HQUA 2CNMA 5K8NA 3DDKA 5AXMA 3UPFA 1RABB 4RL1A 2KVIA 1RTQA 2GCFA 3BGRA 3A12A 2LFVA 3S6GA 3C15B 4CLWA 3PIPQ 4JYAJ 2XEXA 3PP9A 4Z7YA 1X4CA 3D0HE 4ATNA 2YNIA 2MKCA 2MGZA 4GM5A 2K2PA 4IG3A 2A2CA 3KG4A 2OSRA 3HD1A 5DWMA 4F0YA 3ET6B 1IYKA 4JB8B 1CX8A 2CUYA 2OD4A 4ILLA 1ZS6A 4YRHA 4JV2A 2LDYA 2RFHA 4JXRA 4ZX8A 3JTPA 2PDAA 3HHLA 4F9VA 1CJVA 5J2MB 2UXBJ 2D4OA 1WF2A 2EI5A 3F73A 7FD1A 1Y11A 2KN4A 1FX4A 4DQRA 1H38A 1G7CB 3CEDA 3BREA 3M8YA 3GG1A 3MM6B 1TKTB 2CXEA 2IFXA 4C7HA 1UL3A 4DFJA 1SH2A 2GJFA 4C8KA 1AUDA 5D8NA 4NYOA 4Y2CA 2CKWA 1YQEA 2YNFB 2IJNA 3UDVA 3TZYA 3FSXA 3JQKA 3K9TA 4RN7A 4PSWA 5C88A 1E6VB 1BWVA 4I7FB 4EUVA 4DZ6A 1P1TA 2ATCB 4ZN3A 3IRXB 4FXVA 4R6TA 1P9YA 5BYRA 2LQBA 3UN3A 5J2MA 1U1QA 2QA2A 4HT5A 5CCMA 4F4ZA 4JI3F 4X4VA 4PR6A 4QCLA 2DGVA 3TZWA 1FVQA 1FXDA 3J81U 4M8LA 1N52B 4BC7A 3MM6A 3CDUA 1TKTA 1SKRA 1DE4C 3AODA 5GVQA 1NJYA 2B51A 3AJ2A 1IBMF