1NSAA

Three-dimensional structure of porcine procarboxypeptidase b: a structural basis of its inactivity
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
395
structure length
395
Chain Sequence
FEGEKVFRVNVEDENDISELHELASTRQIDFWKPDSVTQIKPHSTVDFRVKAEDILAVEDFLEQNELQYEVLINNLRSVLEAQFDSVSRTTGHSYEKYNNWETIEAWTEQVTSKNPDLISRSAIGTTFDGDNIYLLKVGKPGSNKPAIFMDCGFHAREWISQAFCQWFVRDAVRTYGYEAHMTEFLDNLDFYVLPVLNIDGYIYTWTKNRMWRKTRSTNAGSSCTGTDPNRNFNAGWCTVGASVNPCNETYCGSAAESEKETKALADFIRNNLSSIKAYLTIHSYSQMILYPYSYDYKLPENDAELNSLAKGAVKELASLYGTSYSYGPGSTTIYPAAGGSDDWAYNQGIKYSFTFELRDKGRFGFVLPESQIQATCQETMLAVKYVTNYTLEHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of porcine procarboxypeptidase B: a structural basis of its inactivity.
pubmed rcsb
molecule tags Serine protease
molecule keywords PROCARBOXYPEPTIDASE B
total genus 143
structure length 395
sequence length 395
ec nomenclature ec 3.4.17.2: Carboxypeptidase B.
pdb deposition date 1997-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
A PF02244 Propep_M14 Carboxypeptidase activation peptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.340 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Metallocarboxypeptidase-like 1nsaA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1nsaA02
3BI0A 4NFRA 1HDUA 2GJFA 3PB7X 4CPAA 3WC5A 5F09A 4NGQA 2AFOA 2PJBA 4PXBA 5THWA 5HVGA 3FMCA 1CPSA 3DGVA 2GLJA 1YMEA 2PIYA 3KL9A 4MCQA 5LRKA 2AFUA 3NH4A 1LOKA 1BPNA 2ZEGA 2C6GA 4JYWA 2V77A 1NSAA 2DEAA 4P4EA 2RB7A 2PJAA 4MXUA 3FH4A 3FEDA 3D7GA 2ZELA 1HDQA 3PRTA 5CPAA 3RAMA 4DUKA 4MHPA 4P4DA 5K8NA 2JBJA 3RBUA 2V8DA 4MHNA 2Q43A 2XEIA 1ZG9A 5HXDA 1ZLIA 4BD9A 4PQAA 5JM6A 3FEEA 4KSIA 3WT4A 2PJ2A 3MN8A 1PCAA 5CBMA 2ZENA 4A94A 2NSMA 3CDXA 4MMOA 4P4JA 5K8MA 3SJGA 2PJ0A 3LMSA 2XEJA 3NH8A 4A39A 4YWYA 4LQGA 2CF4A 3SJEA 2PJ1A 3KR4A 2BCOA 2PJ7A 3PEIA 4OC2A 3IWWA 3DLJA 1ELLP 3KQZA 3L2NA 4MRIA 2V8VA 4OC0A 3VH9A 1LFWA 4OIDA 5JH9A 2PIZA 3PB9X 2PJ5A 3B35A 4OMEA 2ZOFA 3CPAA 4X2TA 2PJ3A 2NYQA 4X3RA 4MCRA 8CPAA 3QNVA 2EK9A 1PBAA 3B2YA 4MCSA 3D7HA 4YU9A 3FECA 3NFZA 4NGRA 3IC1A 4DYOA 2C6PA 1LAMA 4R8FA 1LAPA 4EFDA 1TKHA 4WWVA 3D7FA 4A37A 3MRUA 2JBKA 7CPAA 2PVVA 4AXVA 3VATA 5HVHA 1RTQA 4K3NA 4MCPA 3D4UA 2PVWA 4UEZA 2PJ4A 1DE4C 4FBEA 2PJ9A 3FVLA 4MHZA 1ARLA 4UF4A 2IQ6A 1XJOA 5LYDA 3KASA 1F57A 2G9DA 1TKJA 4F9VA 3D67A 1DTDA 5IB9A 2QJ8A 5I4MA 3VARA 2VL1A 1R43A 4OC3A 2GREA 3IIBA 3PB8X 4P4FA 3SI1A 5HVFA 5LYIA 1H8LA 1YLOA 4R76A 2QYVA 2ZEFA 1JQGA 2ZEOA 3D7DA 1UWYA 3H8EA 4JZ0A 2IJZA 4NJQA 5K8PA 3B3TA 1VJQA 4F8ZA 1M4LA 3S9MA 1CX8A 2OR4A 4P4BA 1XBUA 1Q7LA 2C1CA 4ZX9A 4NGTA 3GLJA 4NGMA 1IGBA 4OC4A 5DS0A 1FNOA 4OC1A 1LCPA 4MHYA 3NH5A 2WYRA 2Q51A 1VHEA 3FX6A 1YW4A 5J1QA 4TWEA 3IO1A 3IEHA 4ZY1A 4WJBA 2OOTA 2GU2A 2HB6A 4IK2A 2ZEMA 4IHMA 2V8GA 3ISXA 5LYFA 4OKOA 3PB6X 2ABZA 3B3WA 2WZNA 2CTBA 1R3NA 4W9YA 4RUHA 2AFZA 4PXEA 3HUVA 1Z5RA 2PJ6A 1CP7A 2FVGA 1CP6A 3T8WA 1EE3P 4H2KA 1ARMA 1ZLHA 3RZAA 1IY7A 2HC9A 4R6TA 3K9TA 1ZG8A 4PXDA 3V7ZA 3SI0A 3V38A 2F7VA 5JGFA 1Z8LA 1CPXA 4UIAA 4UIBA 3CPXA 2O53A 1YSJA 3IJ3A 4ZX8A 4GM5A 4IAVA 3TC8A 1F2PA 4FUUA 3ISZA 2AFWA 5LRJA 4FWUA 1HEEA 1TKFA 1PYTA 1XMBA 3N5FA 4Z65A 3WC6A 2PJ8A 3SJXA 4TNUA 4UEFA 4PPZA 1XFOA 3KHZA 4NGSA 4F9UA 3KQXA 1TF8A 5LRGA 4PXCA 3KZWA 4OC5A 1QMUA 2QVPA 3H8FA 1PYTB 2XEGA 2ZOGA 2JEWA 3SI2A 3JRUA 2ZEHA 3CT9A 2PRQA 4A38A 4ZI6A 1CG2A 4ONWA 1BLLE 5D29A 2BO9A 5K8OA 2AFSA 3WC7A 4UEEA 4OP4A 3PBBA 2ANPA 1BPMA 1TF9A 2ZEEA 3GB0A 2GLFA 3PBEA 3BHXA 3SJFA 2I3CA 4P6YA 3B3VA 4X8IA 2C6CA 6CPAA 2AFMA 2ZEPA 3LWUA 1TXRA 3HLPA 1AMPA 3KI9A 5LYLA 3D68A 2XEFA 1Y0YA 4P44A 2RFHA 1OBRA 4FAIA 1Y7EA 4B6ZA 3B7IA 2J9AA 2PJCA 4EMEA 2CTCA 3PFEA 3BXMA 1ELMP 1QQ9A 2IMOA 4NJRA 3D66A 4NGNA 5D8NA 4G1PA 4P10A 2F8HA 1AYEA 4OIWA 4O23A 1XRYA 1VHOA 4EWTA 3FJUA 3KGQA 4NGPA 4DJLA 2PCUA 4Q7AA 1VIXA 2AFXA 3PFOA 1LANA 3KR5A 4P4IA 3TX8A 1GYTA 1ZG7A 4ZY2A 3GUXA 3H8GA 2EK8A 3B3CA 3I1UA 4ZY0A 2O4HA 3PB4X 2EWBA 3K2KA 4P45A 3NA6A 1O6XA 1KWMA 1Y0RA 4R7MA 3WABA 3S9LA 1F2OA 4ZYQA 2BOAA 1CBXA 2CIJA 2POKA 2PE3A 2V8HA 1FT7A 3IFEA 1VGYA 1YW6A 3FF3A 1BAVA 3S9NA 2Q4ZA 3BI1A 1Z2LA 5ELYA 3KHXA 2ZEDA 3B3SA
chains in the Genus database with same CATH superfamily
2B4VA 4QIVA 4OYPA 2VG7B 3THVA 3WC5A 4MFQA 3V6JA 4NGQA 5F09A 3UI3A 3HVWA 2QL9B 4OAEA 4IG0B 5KFKA 3AXMA 3KK1A 5DZ6A 4ED8A 3P5TL 1UFKA 5F8GA 1XNQF 2ARHA 3HVRA 1HLWA 3DRPA 1R8AA 2JEIA 4BC9A 4MKVA 2BDPA 4IYQA 5D0EA 1P9YA 3D3SA 3RB4A 2LXIA 3O5TB 1JLBB 2L3MA 3KHLA 3TQEA 2JFKA 5DLFA 4RW8A 3ISNC 2PEHA 2EG1A 3I5AA 3ZZUA 1U1NA 5I3UA 5F0WA 4PYDA 5D77A 3CDWA 4WYWA 3J7Z5 1S4EA 2M7SA 3S6GA 4YRHA 3HX9A 1OS5A 3M2VB 4HHHA 4YOEA 4BCAA 1C1CB 3SJEA 1KLNA 3PGPA 1EARA 1KQKA 2HWHA 3QIPA 2Y9HA 2GQCA 1LK5A 1FEHA 3CO9A 3PO4A 5GCNA 3LO3A 5C24B 2PJ3A 2DGXA 1KHVA 1T03A 4WZQA 3N6MA 4C2XA 3V6HA 2W01A 2Y0MA 2MQ8A 2HPUA 2PDOA 5KFIA 1QVGR 4MCSA 1IKYB 4YU9A 3I5CA 2Z2YB 4IG3B 4C8MA 4OI0A 4ID5B 2HURA 2C6PA 4HYKA 3N6NA 4F36A 3HPOA 2PE8A 2ZVIA 4LR8A 3CUNA 3TANA 1VQ6S 5C88A 1VQLS 4Q36A 1YJWS 4IFVA 2QRRA 5D3GB 1Y4ZB 2PVWA 4RW8B 2G0CA 3JSRA 4I56A 2XO6A 4ZVOB 1C4AA 2LU1A 5LYDA 4NLOA 3MEKA 3D67A 1DTQB 1DTTB 5DG7A 3Q22A 2CPZA 3A3OB 2F5IA 2HFOA 4P4FA 5HVFA 1YLOA 2QYVA 3G86A 2ZEOA 1XNQJ 3AOAA 3R9GA 5DGAA 5K8PA 2CPHA 4USKA 2PQ8A 1Q7LA 4EGLA 4ZKAA 3BF4A 2R8KA 1FNOA 3NY0A 4MHYA 4ZN3A 2HFVA 2C2ZB 2BOPA 1UA0A 5E3PA 2BMBA 2JLFA 3HVAA 3EICA 4PG7A 4CO1A 2J7KA 3ISXA 1HBUA 5AXNA 1VIOA 4ID5A 3SSQA 3TTHA 5CA5A 1VR6A 3CXPA 1RT7A 2C2RA 4YP3A 2MPUA 1DZ5A 3NCQA 3AHPA 3T8WA 4DR4F 3A12A 4JI8J 5K14B 5FLXY 4DEZA 1IY7A 3K9TA 3M8QB 1RWKB 2XTJP 2W8LA 3UW1A 3M30B 2F7VA 4DF4A 2WVBA 1VC0A 2CNMA 3ET6A 3H2LA 1RBOB 1YLEA 1GX5A 4MFLA 1I94F 1EZZB 4X4NA 1S1TA 1UW9A 3SCJE 2O53A 4ANEA 3BSAA 1FKOA 2OPPB 2IVMA 4DU8A 2IVYA 1GMUA 3HVTB 2IPOB 3MM8B 5KT7A 4Q2MA 3G82A 4YB6A 1MWZA 3EWGA 3TO8A 1SC1B 2KZMA 4PPZA 3D5MA 1SL2A 3L9ZA 4M6IA 3H4BA 1VS3A 5IM0A 2IRYA 4UQGA 1S6PA 1T05A 3CD7A 3JQMA 1NK6A 4PAAA 4A38A 5GMKa 2REFA 2CUYA 4XNHC 4KFBB 3THTA 3T41A 2OPSB 1LWCA 4UEEA 2UV8G 4YFUA 3FZ2A 3QAEA 1MWQA 2ANPA 1JMTA 1B4SA 2HQDA 2UUAJ 1MG7A 5JMNA 2HQ3A 3MM8A 4RL1A 1TV6A 3IBFB 4OZ2A 3EGVA 4RX6A 1OY9A 4B6ZA 1WNEA 4ZCLA 4QU6A 3MECA 4NCGA 4DBQA 1ELMP 3PRBA 2Z3MA 1J2VA 2D9OA 3LP1A 2CIMA 4UWIA 2VPWB 1Y5NB 4K2JA 2Z11A 4A8OA 1VHOA 4YEAA 2R7RA 4K5SA 3IR6B 4JI7J 4BHQA 3TI0A 2FJBB 1TKXA 3PFOA 1GYTA 2ZJPQ 2ZPAA 3Q8YA 2GAGC 2A6OA 2JJ4D 4OJGA 2PO4A 3DOMA 4UUWA 4EBDA 3CTRA 1S1TB 5H9FJ 1YX0A 2G9OA 1JB0C 2B7CB 2RMLA 3MDFA 3NMAA 2BJDA 3MM5A 3ZZZA 1YJUA 4OHVA 3OXFA 2XY7A 2QIRA 4WXOA 4LRFA 5KFVA 3EDRB 2BUNA 4DR5F 4CPAA 5HBMA 4CTAB 4ZDNA 3MD1A 2PJBA 5ETVA 4F02A 1TL7A 2J8MA 2ZW5A 2V0NA 1MMNA 1N6QB 4A2ZA 1U0HB 1UMJA 1UL3A 2HZAA 1N36F 1A2ZA 1U25A 2FVQA 4QZVB 4NRTA 1U1RA 4DX8H 4Y2MA 1IKVA 4H54A 2BABA 2LQ8A 3LWLA 4AB7A 3UPFA 4KT0C 2YBVA 5K8NA 4I2QB 3GJRB 4JXQA 1N5YB 4JWPA 1NBEB 2B9EA 2SXLA 1RBAA 3UVJB 3EXNA 4FYXB 3C66A 2HZCA 1Q79A 1CLFA 2K7KA 3PJWA 2E5GA 4LX9A 1YBTA 4KGVB 5F3ZA 2MXYA 4PSWA 1VBXA 3A4TA 4JV5F 2E5IA 1YWXA 2Y1RI 3MMBB 3DLEA 4KV8B 2RUGA 1ZS6A 1S7HA 2HFSA 5CYMA 4ES1A 2AJ6A 2FIAA 2NPFA 2FY1A 1Y5IB 3MTJA 2CG8A 3OJSA 2WW4A 3WC2A 3PACA 2KFZA 3TWZA 2C2DA 2VOOA 2F9JA 2HQCA 3JQKA 4B5PB 4IKAA 2NYQA 2F3JA 3FMBA 4C2ZA 1PSDA 3R5CA 3PHEA 3DGPA 3B2YA 2C2MB 2P6EA 4IRKA 2MKHA 3DU6A 3UD5A 3NS7B 3UNYA 2ALYB 5J2NA 4DYOA 3FQKA 2BSWA 1UWBA 1M1DA 2Y0SD 3OSPA 3UD3P 4TVAB 1JIHA 2HFNA 2NYHA 5ETTA 2IM1A 4I64A 1RTDA 1IBMF 4Q5VA 4K3NA 5KFMA 1U1LA 3FFIB 4UT4A 1BD6A 4GKKJ 1SKWA 2XO7A 1RT1B 2PN6A 4OZ0A 3KLGA 1SPBP 2UUCF 5GMDA 1CQMA 1RWUA 3EZOA 1H2UX 4EI2A 2AD9A 4F9VA 4TU7A 1WJ9A 2YKOA 4QIGA 2LXFA 5DM7Q 5LSOA 1GH8A 4A8FA 3BZQA 4YR0A 4MKAA 2ZD1A 3I6PA 1H38A 4C68A 4F3OA 1RYRA 5GAEI 5B0CA 2ZW4A 1ZETA 5CZVA 1YBUA 2PDAA 1Z4UA 2BXJA 2XLIA 1IN0A 4LR7A 1M90T 4H6ZA 2GFFA 2GCFA 3CZXA 2U2FA 4OC4A 1PC4A 5I3UB 2EBEA 4GVLA 3R97A 2WYRA 1XR7A 4C8ZA 4NLRA 4ED5A 2MZRA 3DYAB 3MMCA 4FS2A 2GA7A 1T8EA 2ZEJA 2DGUA 3K5NA 4FYDA 4IDKA 4LR9A 5IB0A 3U1MA 1S1UA 2QYGA 3FCVA 1RT2B 5L1LA 3PXGa 4QIWD 4FKYA 4DL5A 2D74B 4MHDA 3IBCB 1ARMA 2HC9A 4ETZA 3FGVA 2WBRA 1WWZA 5HJYA 2MYFA 2OTLS 1D1UA 3HKWA 3TOAA 4K4UA 4UIAA 2DBBA 2VZYA 3CW2C 2L9NA 4USHA 3BR9A 3OR2B 3G71S 4LUBA 2XSJA 5IT4A 4K0KJ 1RA7A 3IWGA 2HWTA 1WG5A 2ZH9A 2F1FA 1SJ1A 3RYLA 1RBLA 1TKTB 1URRA 2EKNA 4F0KA 2YNFA 2DPTA 4MFBB 1PYTB 4H4MA 3KG4A 2JC1A 2IDLA 2LECA 2VFUA 1WI6A 1DTQA 1REGX 3WC7A 3AFGA 4UCPA 1KVIA 1REVA 1BPMA 3HFVA 1NJWA 4RNMA 3I0SA 4L3NA 3T6JA 4WP8A 4DG1B 3BHXA 3R7SB 4DR1F 2CQGA 4P6YA 3TUIC 1UEUA 4JBCA 3M7VA 1H7XA 3SSSA 2BW2A 1RWWB 4ZPDA 2LXUA 4IF5A 4P44A 3AODA 3C3LA 1FFSB 1KFSA 1XF8A 3A9LA 1NUEA 2PJCA 4NX9A 4YHHF 1QSRA 2IJNA 2H3EB 2GNKA 2CNLB 1YRXA 4NJRA 3FC9A 3UNGC 4G1PA 2ZD1B 3A8JA 4UFWA 5BR8J 4BWJA 1S77D 1EETA 1AYEA 4IQMA 3AJDA 4CYPA 4EWTA 1I12A 4ZJQA 3MAAA 3IMQJ 1DLOA 2XHWA 1FT8A 3F73A 5CZXA 3V5RA 4ZY0A 4ZVUB 3HHDA 4B9VA 3KDOA 1N0VC 1S7IA 1QVFR 3IG1A 5L9NA 3IFEA 4DUZJ 5FIIA 3GJTB 3KLGB 1P6TA 1DAXA 3FB3A 3CJ0A 1T7PA 4OHWA 2ZC4A 4R8UB 3MMAA 5THWA 3DGVA 1YMEA 4FPRA 4Q38A 3MAAB 1ACMB 2YH0A 4JYWA 3PX0A 2WVCA 1QUVA 3VAHA 4Q8FA 2D3ZA 3FEDA 4B5PA 1FTCA 1RABB 2IBKA 1S0NA 5E33A 1NKCA 1DTTA 4EBCA 2WHOA 1YRUA 2W9CB 4C3KA 2YKNB 2XEIA 2LQJA 5J1EB 4ZPCA 5JM6A 1YHQS 1F60B 4KC5A 3FEEA 1T03B 2DHHA 2B3TB 2K06A 1IR2A 1XEZA 4F67A 4RUBA 3P5BP 2R7XA 4XPEA 1NJXA 4P4JA 2QSFA 3RYOA 1HQUB 2RNEA 2CXEA 2KM8C 3SQGA 1FKAF 3RR8A 4WZMA 1WHWA 1VQ9S 1SQFA 4PCQA 4B11A 2NREA 2JLEA 5KFOA 2KYXA 4F0YA 1XN9A 1P9QC 3D6FB 4B14A 4CYQA 4X4RA 4OLPA 4NXNJ 4ZVQB 1M1HA 5LJ5Y 2ZH3A 3PB9X 2VPZB 2LLZA 1X4AA 1KQFB 1I94J 3H98A 5F8MA 2Q79A 2HHHJ 2APOA 1SJRA 3P4UB 4C3LA 3HHNB 2YNHB 1JLEB 4D3HA 1RJJA 4NA1A 4R87A 1PILA 2O3DA 3CJRA 4B12A 5L8RC 1FK9B 3NNHA 2ZUAA 1SB6A 3M8SA 2VUGA 3BLNA 4U5YA 4EZ6A 2JL9A 2YQ0A 2PVVA 1XIQA 4KKOA 2ZH1A 2OFHX 4JV5J 1LV5A 2HIQA 2B4UA 3SCLE 1C0UB 4OYMA 3BH7B 3CPWR 2Z0GA 4USVA 3MAHA 4ZIVA 2YKMA 2IQ6A 4KOWA 3KASA 2B4OA 3TT2A 3BS9A 3CVKA 3NAIA 2K1RA 3K5PA 3UCZP 3QZ8A 3EGWB 3WBZA 2VC1A 3KXDA 1HR0J 1H8LA 2XG8A 1PYOB 2U1AA 2CYYA 4K4WA 3W5ZA 2VG7A 5IX3A 4ZPTR 1WSRA 1RCOB 1TMMA 3LODA 2FC9A 2HGLA 2OB0A 4NLSA 1T94A 3U02A 1CJTB 1M4GA 1HNZJ 3NH5A 3R9FA 1M5SA 3UD4P 4USUA 1FXDA 3PYEA 2KVIA 1X4HA 2OSRA 2YNHA 4UBRA 3UQSA 1BGXT 3M9MB 2N82B 3LA0A 1BC6A 2IM0A 2XY5A 1R0CB 5F8NA 4WU3A 3EE3A 1LWEB 1FWPA 2RU9A 2VG5B 3LACA 2RT3A 2EK1A 2ZZTA 3SCKE 4OZ5A 4RBTA 4KKOB 3R1KA 3UY5A 1TTHB 4KPCA 4IO9Q 2VDIA 3R6LB 1SL1A 4DV3J 1AUDA 4OX9F 5JGFA 2XGPA 3I4HX 3AOBA 2UUBF 4DV1J 3G6ES 4J9MA 3KJNB 1WDTA 5C25A 3HSZA 2ZHBA 3QJLA 2C3PA 4KOUA 1RT5A 4ZJOA 4LMZA 2ASDA 4DV5J 1XNRJ 3MUVP 2HUZA 2UP1A 2R2TA 3ADAC 3MPDA 1XR6A 1XMBA 2PJ8A 3MR2A 3UDEA 3OPKA 2ZM6F 3NGRA 4M8LA 1N71A 2CNTA 2GZOA 1JLBA 3RW6A 2BE2B 3SFGA 2JEWA 4U67Q 3C6TB 4B02A 1JLGA 3VHQA 2BO9A 2ZITA 5K8OA 4TY9A 5EDWA 4QW9A 3PNIA 2W9AA 3BSOA 4X84A 1KQSR 1S1VB 1RI7A 1YBAA 2BUEA 2I3CA 3BKFA 3DR6A 4HNYB 3AT1B 2ZEPA 2A18A 4L75A 1YIJS 1U1PA 2Q66A 3TZXA 4DL2A 2UVRA 1U24A 2LU2A 2DNRA 2O01C 3RB0A 2VG6B 2X3GA 4USMA 5DETA 3DSBA 4BLGA 1Z9UA 3EVMA 5C24A 1U6MA 4NCBA 1U2RA 3CJ5A 3FZBA 3H2VE 1XRYA 1Z4RA 1S59A 3F0NA 2FZCB 2VG5A 4MFJA 3KHHA 2OZUA 1TR0A 2AWZA 4URQU 2IAJB 3SXOA 4P4IA 3H8GA 2RVJA 1QSSA 2HK2A 3JAMU 3B3CA 2HVEA 4P9SA 4B3OB 2DD8S 3CC2S 5AG5A 2BJ1A 4AL5A 4B9TA 4OJHA 1BMQB 2HVDA 3MR7A 4QWCA 2FE7A 2EKYA 1VGYA 2ZBPA 1TFWA 2YNIB 3CB4A 3KHXA 3PB7X 1JXVA 4WTYA 3M6VA 3W91A 3ZNUA 3SFUA 1BQMA 1SQGA 4J9VA 5IT0A 1N8RT 2V50A 3NH4A 1RKJA 1LWFA 4P2XA 3MAQA 2MY7A 4ECWA 4P4EA 2PA3A 4MBUA 3W7BA 2CJAA 1RAOA 2LQ9A 3V4IA 1GQEA 2IC3A 3LGHA 2UVWA 4DR2F 4OZNA 3K57A 1FDDA 1WOPA 3TAMB 2ZE2B 2AU0A 4YDXA 4OZJA 1PIEA 3D6MB 5AXMA 4B9MA 3CDXA 2MZTA 1S9EA 5E3AA 2K7JA 1GMWD 4FDFA 1FVQA 4A39A 1OY6A 2EFQA 1EJ7L 1HPZB 2OZGA 1E6VA 5J2PB 3DLJA 5KFGA 3FJ2A 3DDDA 4RWWA 4C9DA 4DPXA 1CC7A 1S1WA 2Q0YA 2D4PA 4X5KA 3LGNA 4LFBJ 1N5YA 1WKLA 3EO4A 2YX7A 5IV3A 4CLSA 2G2ZA 8CPAA 1H2TZ 2KH9A 5G4DA 1VK8A 2CKWA 2R7WA 1WK4A 2BV3A 1VCTA 2DH7A 4FP9A 3VZHA 3HVTA 1VQPS 3WX8A 5KG2A 4Y34A 2RKIA 4OHZA 5J2MA 2FVRA 2OH1A 1LW0B 2J0SD 2VQEJ 4TLQA 3DDKA 3QFHA 1FFWB 3D2WA 5J1PA 4FF1A 1TKXB 4JJXA 1NCLA 3HHLB 2G0BA 4LSZB 1OYDA 4NLDA 2JEFA 4EZ9A 1T3NA 3LAKA 3PDNA 2QC3A 3OLBA 2QJ8A 1M1GA 5HK4A 1LRZA 2GREA 1R7IA 3M4XA 2Z3NA 2UVVA 5J8FA 2C2KB 2RRAA 4U7UK 4KTQA 2AJ1A 4GRSA 1MU2A 2EW9A 4JZ0A 1SJ4P 2E44A 2PI5A 4C4WA 3B3TA 3F8KA 3OTOF 1DY3A 1IBLF 2DH8A 4WXWA 3QAUA 2PR8A 1N6QA 1M5KC 3NWRA 2AX0A 2VJVA 4RS2A 4U96A 5C5JA 3PP9A 5JVGQ 2J5AA 4WJBA 5LMUF 3TEGA 5DM6Q 2H48B 4FVMA 2CXAA 4IRDA 4DN0A 1MSWD 4E2AA 4CT9A 4YB5A 4PG4A 1FF2A 5DGBA 2G0JA 4H2KA 4RW4A 3B82A 2OFGX 4O0IA 1FRJA 4YY3F 3KLHB 4A8WA 3W6XA 1C4CA 1BLUA 3W5XA 3AD7C 4Z2XA 2DPJA 1N32F 2H4YB 1HWIA 2A1BA 1MJBA 3EJMA 3RW7A 1T9YA 5H9EJ 4GMKA 3N7ZA 2AJFE 3AAWB 3MFIA 1HEEA 3F44A 4Z65A 3DKDA 1R6VA 2Z2ZA 2HHTA 3Q24A 1ZZNA 4NGSA 4DS4A 1F6TA 3PZJA 1TVRB 4TU8A 5LMNF 2LKZA 3RUBL 1I21A 2ZHOA 2G3AA 1S57A 4JD6A 2E7WA 4ZN1A 3R9LA 3VAJA 2AFSA 4KUBA 1NJZA 5D0RA 1U48A 4I4BA 4RW7A 4IR1A 2W8KA 3PBBA 1AUSL 4LF5J 4PWDB 4O3OA 2ZEEA 2W2PP 3BGLA 3GB0A 4AD6A 2GFQA 4DCJB 5E5NA 2XS7A 2QMLA 3LOUA 2HIYA 1TXRA 3KI9A 4B3TF 2JDDA 1LW0A 2A6MA 1RYSA 2RFHA 2RDDA 4FAIA 1X9WA 1URNA 1NEEA 2BA9A 2B3VA 2XNQA 2EWHA 4DPUA 3GYAA 4PEOA 2IMOA 1VQKS 1YDLA 2B8PA 4Y0FA 4JYAF 4DPOA 4O23A 3E0KA 5ITHA 4ECYA 1GMWA 2F9DA 5E41A 4CQ1A 4Y2CA 1UVLA 4IR9A 2QFJA 1NSKL 2CQ2A 4CO5A 3GUXA 3GV7B 4UOHA 3TVKA 2J8RA 3GFZA 5HMYA 3JUWA 2O4HA 1KUXA 2Z4PA 4L89A 2EPIA 3EXYA 5E2QA 5ETRA 2YXLA 3S9LA 1F2OA 4MKBA 1JXLA 4AL6A 3MMJA 3IRXA 1HD0A 1Y11A 5HP1B 3PEJA 1VRUA 1RCXB 5AE3A 2PEBA 3IG1B 5HI7A 5HVGA 3CE8A 4HI1A 2Z57B 1FD2A 4MH8A 3BREA 1YJTA 1K8AT 3M6WA 4EU0A 2DT9A 3KYLA 3N4WA 3DI6A 1RQ0A 4ZLLA 1RT3A 4URGA 4DUKA 9RUBA 4WFNQ 3W8PA 5F48A 3MEEB 4PQAA 1X12A 1NKEA 1JNRB 3MN8A 4NL5A 3LUYA 3ZZTA 2R7SA 4EMDA 1Z4EA 2B51A 5K8MA 1JJHA 1B99A 3DRXA 4LRBA 4LFCJ 4DSKA 4X4QA 3CD6S 2ERRA 4OV1A 2CPEA 2WUUA 3VQSA 1DLOB 5ETMA 3PEIA 5T7LB 4K0KF 1K0TA 4M94A 1NK9A 1RDRA 1N56A 1H74A 2HNZB 2CDQA 2UUWA 4USIA 4OYXA 4OIDA 2J8SA 2J6SA 1RHRB 1N33F 5HO4A 3G82B 2C3UA 3IN5A 3QNVA 1DJ0A 3CIZA 4ZP9A 5B7WA 3V2UC 1G6BA 4UW2A 3OSNA 2AE6A 3GZ7A 4QW8A 1FFGB 2FHJA 3H20A 1FKPA 2FLNA 3T1HJ 4KVXA 2XZWA 2R7HA 4F6AA 4N8OA 1Q1KA 4AQYJ 4RWXA 1U1QA 4EFDA 2C3YA 2CNKB 1RT5B 1OIAA 1IKYA 2FY8A 5D4PA 3SHPA 1H7WA 2YKNA 2FGOA 1XR5A 3QGHA 4LSLA 3JS9A 1RZMA 3MEEA 3M2UB 1U0SA 3HT3A 3R3TA 4H4MB 1B3TA 1QSOA 1HARA 3RBXA 4HDHA 4F04B 4DR7J 3NBPA 1NHVA 4O4GB 5F46A 1HD1A 4MIAA 2M8HA 4KB7A 3W9IA 4XDDA 5KAKA 2UV8A 1RLCL 1VJQA 4O4GA 1FRMA 1WF0A 3FK4A 4ECTA 4GKJJ 1RXOB 2KZZA 2YGWA 1U6ZA 1XMQJ 1CQNA 3V81A 3M2RA 1Q2YA 4C98A 4J9OA 1H73A 2NXNA 5I3QA 3MPVA 3CC7S 2IRUA 2AHOB 2CA9A 4UZCA 4Y65A 4P73A 3AA9A 4J5OA 2FZGB 3L7UA 4OZ1A 2K1RB 5L1IA 2RJZA 3I55S 3A8IA 1UFHA 3HULA 4I2QA 2E9RX 3DLGB 2AFZA 4I7FA 1Y0HA 4U8VA 2MQMA 2ZE2A 1HI0P 3MM9B 4ID8A 4Y3CA 5A8KB 1XQIA 1UW4A 5AG7A 1EKSA 4F7VA 2RE1A 1LNQA 3LANA 4FXDA 3CCRS 4HTIA 4UIBA 5CHCB 1U1MA 3GIIA 1IM6A 1BY9A 2NZ4A 3TC8A 3ISZA 3GR0A 4Q45A 3CXCR 2HBZB 5LRJA 2C2NA 3CDAA 1RHQB 1JLAA 2M2BA 1S0OA 3EGZA 1B0VA 3TUJC 4M5DB 4LF2A 3TAQA 1WACA 4CS0B 3RBZA 1HNIA 2G1HA 1UTAA 3MEGA 1GTHA 2XEGA 4KO0A 4TQRA 2LEPA 1KN6A 2V69A 3ENWA 2CNOB 1FERA 3IBWA 2JNJA 2JC0A 1BLLE 1PUAA 3P49B 3PZPA 1S1XA 4W98A 1YK9A 3QMQA 2HV2A 1U0HA 1VISA 2DNKA 1S7FA 1R31A 1J5EJ 4G1QA 4QYRA 2RHQB 3CC4S 4DQPA 1JX4A 1JLGB 2QMUB 2FVSA 2R2UA 5KTAA 3B3VA 4RW9B 4RUCA 3HLPA 3DLGA 4CYUA 3W2WA 4CLTA 4QPTA 1CJUA 4EMEA 2CDRB 1VKCA 2CPYA 3ZTOA 2DGVA 3OXGA 1S6QB 2ZDPA 4TY8A 1HWKA 1RTDB 1RT7B 1EP4A 2BQRA 3KGQA 4ZLPA 4NGPA 3MECB 1O51A 4WP9A 3ZZRA 2A2DA 2GO9A 4B3RJ 4OI6A 4ED3A 2WOMB 4M3SA 4IUFA 2V94A 6AT1B 3PB4X 4ED2A 3QATA 2V9WA 2VKZG 3DU5A 1FJCA 3JVNA 2BOAA 1KVKA 2CIJA 4YN3B 2RDJA 2V8HA 1FT7A 4NMXA 4PWWA 3M9OB 1NKBA 3S9NA 2ZEDA 1H6KX 5GMEA 1X5TA 2ROGA 5KT4A 4N8NA 3V4IB 1RACB 4M5GA 2PIYA 4QQBA 5LRKA 2V4QA 4JI6J 3D8PA 1WC5A 3R7NB 2J9CA 4F4AA 3NXZA 4M5NA 5F8LA 3B54A 2PR1A 3D7GA 2HHUA 1HDQA 2OSQA 1WTFA 2DEIA 4JV2A 3WQPA 1BQMB 3GU0A 2ADCA 4BINA 1HYSA 1PBUA 4ZVTB 4L74A 2OPPA 4KSIA 2AKWB 1M44A 3DLKA 2D1CA 4LIWA 4UZBA 4ECXA 2FT0A 4CRYB 4KGMA 5F3TA 1Z8WA 1NK7A 3DLKB 4EEYA 1D3WA 4YWYA 5F8HA 4M5LA 4DXLA 3R95A 1Z8XA 2B4PA 4O44B 3ETMA 1XMTA 3OVAA 3G6YA 2CQDA 1ELLP 2EBGA 1HW9A 1ZZFA 2HHSA 1N48A 1YI2S 3JB9k 2FHJD 3WR7A 5J8CA 1SQHA 4BDPA 2KFNA 4FZVA 3CCZA 5M2RA 1KP6A 1ITPA 3J81j 1QAJA 1PYSB 2AJQA 3GYNA 1S4FA 2R4FA 3JTKA 4ED0A 4JOUA 4I0WA 4DX7A 2XY6A 4NGRA 3KMSA 2I0XA 1S72S 2AV5A 5KFFA 4DV0F 1RTJB 4ZGYB 3A3NB 3QGPA 3D4UA 4X62J 1Q5VA 2ATRA 1UVJA 3HT0A 4RU9A 5U47A 8RUCA 3K9UA 3OTBA 3MI7X 1MN7A 3ZTRA 1ZYQA 1XK8A 3OUYB 1TL3A 1DTDA 2H9ZA 2C27A 2DR5A 1TUWA 4E8UA 2ZH5A 1R0AB 3P8BB 4IDKB 3CMAS 1GXUA 1IVZA 4I67A 3ONQA 2WTFA 4ZCKA 4ECRA 2AJ0A 1IYKA 2KL8A 2IVFB 4CLWA 5HQMA 3JQJA 2GHWA 3QPIA 4LBHA 4E2FB 3PX4A 5H86A 4CGPA 1CX8A 3O6QA 3I0SB 2B56A 4DG1A 2J0WA 2XSFA 3QSYB 3PCOB 2EI5A 3FSIA 5DS7A 5DWMA 4NLXA 1ZM4A 4QR1A 3PIPQ 1P4NA 5C82A 1Q8BA 4ZHRB 1RAAB 3SMZA 2GMHA 2R1IA 4RNOA 4A8MP 1HIYA 2D3OR 1X5PA 2BYCA 4DZDA 2Q04A 1KSPA 1U6BA 2WZNA 1OWXA 4GXHA 2VQEF 5JVHQ 1LOUA 3QIPB 2JVOA 5CNPA 3NP5A 3DR8A 2CVEA 2OI2A 1OQ6A 3FRYA 5BYQA 2VFTA 2WK4A 4NEZA 1TKZB 5A8RB 2CNNB 3V7ZA 3L7OA 3Q8RB 1VBZA 1HBOB 5JQ4A 4N7TA 4HR2A 2VKRA 3T5JA 1XIXA 4X65F 3JTNA 2WW8A 2OZHA 1CJKA 4WU2A 3N28A 3R1LA 1G3OA 3OV7A 1FWLA 2GAHC 4P2FA 2MHNA 3MGDA 1RU2A 2JLMA 3I9ZA 2KI2A 4IH5A 2GIVA 1PAUB 1TKFA 4L3KA 4RNFA 4PUOA 1YKWA 3B6BA 1YITS 2ROPA 1IKWB 3BKTA 4X2BA 2F65A 5CQGA 4DSIA 4IOAQ 2QA2A 2M3DA 1IU8A 3PVXA 5IT9U 2R2RA 2I38A 3VZIA 2VFRA 1Y10A 3EZ5A 1QDUB 3SDEB 3VV2B 2N3LA 1RWNB 4KSFA 4ONWA 3LP2B 4O4RA 3HHKA 3C46A 4B17A 2I8EA 4ELTA 4A8KA 2GHPA 2CQBA 3QSIA 4OYBA 5D4LA 1NPRA 1J4JA 5DDOC 3ZZOA 3ULHA 1VBYA 4DCPB 3K8WA 4ECUA 5C25B 3TJAA 1JLEA 2CAJA 3TO6A 1EETB 4C0OC 1S79A 2ZOMA 3NS6A 1JXEA 1NJYA 4WF9Q 3ZNJ1 4Y2IA 2IM3A 4R9MA 4ZOSA 5HATA 4NCAA 1LWXA 2WAQD 4H89A 2YWKA 4XPDB 1WSVA 1OSDA 3CULA 5KG7A 3H42A 2D3O1 2KM8B 1EKRA 2KDOA 3Q8QB 4Y49B 2EWBA 5D15A 4P45A 1TUVA 2EFGA 1S9EB 1HNWJ 1FK9A 4E0DA 2E7XA 1TKTA 2RAQA 3OR1B 1FE4A 4C8OA 2QEXS 4FYWB 5IC6B 4YMEA 3TO9A 2P8IA 2HRTA 2GIFA 3PW7A 1K1QA 3KFWX 4GKJF 1KS2A 3J7A1 3N9UC 2GX8A 4NMLA 3BYPA 4UFXA 2ZZNA 3NL0A 4PWUA 2ZELA 2I6WA 2DNYA 5HN0A 4IFYA 3NE8A 3MFHA 4WWSA 2HEKA 1B0PA 5AE1A 4MHPA 4ZJLA 1WC4A 1L0CA 5B0BA 2HWIA 5ETKA 2XS5A 1Y9OA 1NSLA 3VAIA 3WHIA 2UUCJ 3KDNA 4RR5A 1HBOA 2YTCA 1T11A 1Q7LB 4S0MA 4DMZA 1Z1ZA 2PJ0A 4V1Ak 5D0GA 1LKZA 1K0VA 2QT7A 3GSIA 4HPSA 5LXRA 3AQPA 4GVBB 5M2PA 4ZA1A 3I9V9 3L2NA 2Z30B 5AJ3J 3CCTA 4ECSA 1YQHA 2CQHA 1ZTWA 2DR9A 4NI2A 4ONUA 4H4OA 2NPIA 3SXNA 4NLUA 4M5KA 3W9HA 1X4CA 4KSAA 4X3RA 1U6FA 4NASA 5IQQA 2NXEA 4DV1F 2UUBJ 2EK9A 1MROB 4DV3F 4ZITA 1L5UA 3HXMA 1G1XA 4YB1P 4M6GA 3LGMA 1AT1B 2AT1B 3MEGB 1UJ5A 1DARA 3HD1A 1RAGB 3H4DA 4B3MJ 2X51A 3QT5A 2HQYA 5A6PA 4Z7CA 2MSSA 5KFRA 4C2YA 2H5IB 1WHYA 2JBKA 4AXVA 1N5SA 1VMBA 5KFCA 1U49A 4QU7A 1ZA2B 3E8OA 2AYGA 4IH6A 1FWKA 4N56A 5M2UA 4AG9A 1R0BG 1S1WB 1U45A 4KLVA 3GCXP 3HZGA 1UEVA 3VARA 2BJ3A 4G1IA 3HJFA 2L08A 2J9DE 3K89A 2M52A 2P6FA 3W1YC 3T9NA 4MFPA 5FLXU 1UWYA 1SH2A 1U09A 4QWDA 3P2HA 1KZFA 4NGMA 2OEJA 2MZJA 1HBMA 3MUMP 2OOTA 3AB4B 3ICLA 2DNGA 3Q0AA 4OKOA 3KJVA 1S99A 4LQ6A 2JRSA 2ADBA 2MKIA 5ADZA 3O8WA 3OFFA 4K2XA 4IQXA 1U8SA 3I32A 1MK4A 3HHEA 3PR5B 4EO8A 4PXEA 1F5AA 3KUHA 4FYVB 1EE3P 2AYMA 2DXFA 1FVSA 2VF3A 4UWJA 1FI4A 1V9OA 3TOBA 1WHVA 1RO5A 4WK3A 2GE3A 4Q8EA 1FKPB 2NUUG 3CEDA 4NZ0A 3IRXB 4FS1A 3MPWA 4TY8B 2J0XA 2X3DA 4HHUA 1DQ8A 1IBKJ 3PYGA 2PMZD 3OFGA 4HKQA 4I2PA 1QSMA 3FSXA 2UVUA 2GVDB 3S6EA 5EWFA 3TJ8A 2K3KA 4NSQA 3F5BA 3SBMA 2A4NA 2MLYA 2QA1A 2ZKTA 4QC6A 2WSAA 4ATNA 1TL1B 4PRFA 2CQ0A 5K9FA 6FD1A 3A8EA 4RNHA 3G2XA 1RT6A 2G3TA 2OD4A 4KE5A 1FX4A 1CG2A 2R7UA 2C22A 2ZFHA 4N41A 4DUYJ 5LMNJ 5E3CA 2HVZA 3CCES 3VAGA 3GR1A 3M2VA 2DRBA 3PBEA 1C1CA 3T3FA 1VQOS 1FCAA 3GYGA 2LFVA 2FPHX 1OO0B 2HBYB 3BH6B 5LYLA 3I4PA 1NSQA 2DY1A 4ENOA 2DY9A 3G3SA 3R5DA 2RF2B 2DHXA 3E51A 1NDCA 5T41A 4DL0C 1YZ6A 4M6HA 2PI4A 4NGNA 5HMZA 1QSNA 3BR8A 2AGQA 2CRLA 1T3OA 2BR0A 3QAHA 3TZZA 3TARA 3T9YA 4JI8F 2PCUA 4P7TA 4WBFA 1VIXA 4DWIA 3CJ8A 3F56A 5KTQA 1CS4A 1MU2B 3RO0A 3V81B 2MQLA 5I42A 1S1VA 4QWAA 5FJ4A 2IJFA 2MMYA 5E7OB 4QIFA 5SZTA 4LJMA 2POKA 1ZPVA 2VB6A 1NPPA 4EO6A 3TJ9A 2HBQB 1YW6A 4C11A 2NZCA 3BI0A 1KEKA 2GW8A 2VZ9A 4WFYA 4PXBA 2LQ5A 3FMCA 3OTOJ 4I6YA 1TIQA 4NWBA 4WE1A 2CJYB 3DN9A 2ZBCA 3QBCA 4FD7A 4WKYA 4E98A 5EN1A 3LWMA 3PX6A 4NEYA 4CNZA 2Z3PA 4P4DA 4KGKA 2G2OA 1WG1A 1YJ9S 1FJ7A 3OHBA 3VWSA 4U6PA 4OI3A 1KTQA 4B3SJ 3KK3B 2G4BA 4K4XA 2CNSA 1KC8T 3BSNA 3RRHA 4X4VA 5KTDA 2E7VA 1HHQA 1Q53A 4A47A 4CIOA 5B0EA 1BQNB 3SEOA 4ES2A 4WKRA 2YNCC 2E1PA 1EP4B 2DVIA 3U1LA 2HZVA 3CWJA 4J9PA 4CLFA 3BQ1A 4WE1B 2WZ1A 4YS2A 2BCOA 3VVUA 3IGRA 3ZTPA 5CD4A 2B43A 2H54B 2HAFA 4DN9A 2PIZA 1IKXA 4I6AA 5KFBA 2FB0A 1RWOB 2PC6A 3P2FA 4ZPAA 1HWJA 2IBOA 5I3PA 2JOQA 1T02A 3T1AA 3BYRA 1ZM3A 2F4VJ 1ZA1B 2EXUA 5AJ3F 1VQ5S 5GAHI 3BV8A 2RU3A 4UQTA 3QZ7A 4XIUA 4RLEA 1LAMA 3GV8B 4ZIWA 4WWVA 4R0JA 4MY0A 2Z3KA 4KAIA 3M1VB 1YJNS 4YDDB 2ATLA 2FSRA 4MCPA 4K7QA 3VVTA 2MJUA 2J7UA 1KLMB 3M8RA 4MFZA 2P9GA 4DQSA 4UEZA 2CJ9A 3MWBA 5T7LA 2KT2A 1LQ9A 4MHZA 4LVOP 2C3MA 2O1PA 1BO4A 4R3LA 1AUGA 1M5PC 5LL6d 4FXVA 3SV4A 5HAOA 5I4MA 1YX2A 3I31A 2BACA 3U1NA 3PO5A 3PB8X 2I00A 1RT4B 2VFSA 1WC1A 5GVQA 3OLAA 1UKUA 4XPCA 4KHMA 4P4BA 2ACMA 2EFNA 4O0NA 1J27A 1RWVB 3CJQA 3UCUP 4HNWB 2AIRB 1ZAXA 1V3ZA 2B4DB 3WC0A 3IGVA 2HVIA 2A2CA 2RH3A 2Q51A 4HH0A 4A4JA 1T95A 2CJBA 3W3SA 3KK1B 4IO1A 4LSLB 4NXYA 5ISVA 4IHMA 3MXHP 3W66A 2KKHA 2MTLA 2AJ2A 3TVYA 1BUXA 4AQYF 3POTB 2BBEA 2OGUA 4UOFA 2VQFF 1YVOA 1GX6A 2OH2A 4CGOA 2GMLA 1F9HA 2XB2D 1WUUA 5LOQA 2MEWA 2HW3A 2Y8YA 4RBVA 1KLMA 1YG0A 2VHGA 1VQ7S 2I79A 3BDEA 3KK3A 4KH0B 5HH1A 5E3RA 1N33J 1ZH5A 1HNVA 3IJ3A 3S7RA 2DO0A 1B70B 2YY3A 2KT5A 4IAVA 3GMGA 4NXNF 1MNEA 3LP0A 1QAIA 2DISA 2E1MC 3MCSA 1Q8KA 1PYTA 1SUQA 4KVOE 4H6UA 1KUVA 3JYTA 4PQUB 1VLYA 3HI9A 4OYIA 4CLKA 3KQXA 1FD8A 2VA2A 1TF8A 1VK3A 3MZIA 2GHVC 5LRGA 4Z37A 2V2VA 3DLLQ 1HWUA 1RK8A 4LFCF 3UR0A 2LCWA 4RW7B 5ETSA 1U4BA 1D9FA 2BANA 1Z2ZA 5D4NA 2AGPA 2DRDA 4OX7A 4I69A 4ILLA 1F2HA 2OELA 5AG4A 2KT3A 4B3OA 4IRCA 3OVSA 4R57A 3JAMY 1S97A 4PG5A 3W61A 2AZ3A 1TELA 4ELVA 1SH0A 1S9GA 3C6UA 3R5JB 4WP3A 1UPPA 1L3SA 3ZTQA 3BM7A 3J7YU 3LWUA 2VFVA 3K7RA 2X7IA 4JI6F 3TA2A 1JJ2R 2JDJA 3LALA 4L76A 1TVRA 3RB6A 2QL5B 4YQWA 4K4TA 4A8SA 3JSMA 4UCNA 3TAPA 4ED1A 4MY3A 3IAM9 2VJUA 4QB9A 2R8JA 3NGSA 2K3IA 1HBUB 1ZM9A 4CAVA 3KMQA 1IB1E 4RO0A 3VQTA 2W9CA 2OMOA 3EVWA 4OL8A 5G21A 1S1XB 4WIQA 5F8JA 4J9SA 2GS8A 4BWMA 3K2KA 1H2VZ 1SC4B 3CJ3A 5KFPA 1R6YA 1TL5A 5KFQA 2KJWA 4CLUA 3BGRA 1SQEA 5BR8F 3NGTA 1K44A 4X4SA 3LQVA 1GHEA 1OY8A 2AFOA 4F50A 4C0BA 4FBTA 1NNDA 5KT3A 4MCQA 4PR6A 1KDNA 4ETXA 2VG6A 1NSAA 1NK4A 2UXBJ 3MCNA 1TZ0A 1W2BR 2Y0BB 3A3PB 2B3UA 2CQ1A 3EXCX 3T19A 3PKMA 1S9FA 5CCLA 3V8IA 2B5JA 3WT4A 4CO3A 3CDBA 4P72A 4B5OA 5KG4A 3MOJB 3BGRB 3IU1A 3QLHA 4MMOA 3OL8A 5ETQA 3W8GA 2VODA 1A0OB 4HACA 4PZVA 1IJEB 3A13A 4QR0A 2K5TA 3J7ZT 3ELHA 3Q89A 1RHUB 3FBUA 5D0HA 2NCKL 4NI2B 1RAJA 3OL9A 1IICA 3VCDA 1Y9KA 3IWEA 2Y1JA 3BO4A 3GSDA 2ZHAA 1LEOA 1QSTA 3H5XA 2V8VA 3SQGB 3KG0A 4MAKA 3R5GA 5HQ8A 4CM2A 4DSJA 3EDQB 1RHMB 4OMEA 3KOAA 3Q86A 3RNZA 1DHMA 2IYIA 3MTKA 1C0TA 4L72B 1F9EB 2CZVC 2DIUA 2Z56B 4O3PA 4XO0A 3X1LB 4LT6A 1KHWA 2XMVA 4A30A 1U1KA 2BE2A 5A8KA 3TZYA 3V4MA 2V34A 3VALA 2K2PA 4JI3F 4K50A 2Q3PA 4ZVEA 4EUVA 3KK2B 3CCJS 2DXQA 3OXLA 4R8FA 3M8YA 3D1OA 4NPOA 1EHWA 1MMDA 1V3RA 2DNPA 1NM2A 6FDRA 4IFYB 4IUSA 1RTQA 2QSWA 5D8HB 9ATCB 1FRLA 4N76A 1BHNA 1WELA 4MK9A 2V2KA 5A27A 5KFAA 2HHVA 3I0RB 4Q2LA 1WC6A 3K5OA 1ZPWX 2KCWA 1R43A 3BGOP 2BJEA 3FBEA 1RT6B 4ECZA 2J6UA 3QWUA 1M0SA 2EBJA 4IOBA 3J7YI 1SBRA 4OQJA 3FCHA 1IGBA 1S7KA 4A33A 1X8DA 5IXUA 4CWBA 3DRPB 3GE9A 4DCOB 2D7SA 2BVZA 2B9YA 3IEHA 2HLUA 3D28A 4MJ8A 1NDLA 4HDGA 4J9KA 2ABZA 3R5AA 2B5JB 4CCHA 1R3NA 4B3RF 3I9SA 4X66F 4O3RA 4YR3A 3OQ2A 2ZBQA 4FF4A 3CJSA 1Z5RA 2C2EA 3L95X 3HZEA 4KLWA 4R6TA 2V5HG 1BQXA 3J80Y 1ZG8A 1KKHA 1MW7A 2OPRA 2Z10A 3HSJA 5KT5A 4KVME 2KXHA 3PY8A 3PJXA 3SI8A 5J2QB 2OAUA 3OFHA 2ZDOA 1YVKA 1F3VA 5EC4A 4JI5J 2J0QD 1F2PA 1YLXA 2AFWA 4FWUA 4F0MA 2MKJA 1IUJA 4GC6A 3W2VB 1RXTA 4NLYA 4K4VA 2F4FA 4MK8A 5F9NA 2X1BA 4BMHA 1I3OB 4TNOA 3LF0A 1RTHB 2B7BB 3R8YA 3PIOQ 2IY5B 3H8FA 3BQ2A 3GONA 4MYUA 4NLTA 4H4OB 1L3VA 4MYTA 1SC3B 4JI1J 3D3BJ 2X1FA 4HLBA 3EPIA 2V2ZA 3M6XA 4KOXA 3OVBA 4P71A 2I5JB 4MK7A 4M5MA 2DJWA 1JNZB 3N6LA 1R8BA 2OMLA 4K8RA 1RP5A 2Y8WA 3S6FA 2GIRA 1FDNA 1YQEA 1QLNA 2D9PA 2QMWA 4AVBA 1V6HA 4ZP8A 1ZTTA 4USTA 4TN2A 5B0AA 2XEFA 3ISND 1Y0YA 4MJKA 2BQUA 4B08A 3QQCD 3B7IA 1A6LA 4B10A 2VV5A 1HHSA 3QJPA 1CULB 4NZ6A 3PFEA 3BO3A 1QTNB 3MM9A 1X5OA 4FF2A 3BBBA 3BN4A 2RDIA 1RAHB 2ZH6A 4ICLB 5T14A 5HLFB 4B13A 4OIWA 4RI1A 4X64F 1IKXB 2MLXA 4DJLA 4A48A 5A28A 3M8PB 2VQFJ 1X10A 2E5LF 4FF3A 4CDIA 3CJKB 3TX8A 1QAYA 3DRSA 1ZG7A 4LREA 2HRYA 3GIMA 1B0TA 1S3ZA 5KFDA 2DGQA 2AGOA 2B8QA 3GJQB 4QUSA 3UVJA 2IFXA 3PG9A 3WABA 1O0PA 4ZYQA 5ETLA 4FD6A 1TL7B 1JLCB 3W62A 2LDIA 5IM0B 1OYEA 1IWAA 5L46A 1WDDA 4NFRA 2RRNA 2CZ9A 1WHXA 4M85A 1HNVB 3ENVA 4FNHA 2GLJA 2I5JA 3FXTA 3MR3A 2YKPA 1NRKA 5BXIA 2PJAA 2XULA 1UWBB 7AT1B 3FH4A 4OX8A 1AFIA 1I5OB 2WOMA 4KR0B 1J5OB 2XI2A 3MCOA 3MM7A 2Q43A 4LQ9A 3K2YA 1TK8A 1NMEB 2A0FB 3EUNA 1P1LA 5CBMA 1FRIA 2DNMA 3CCQS 1GFWB 1SIZA 4DFMA 4EK2A 4XNHB 1H98A 4WIIA 4OI4A 1TMJA 2NSMA 4OYOA 4LF8F 2JDCA 4ZCIA 4X62F 3MGJA 3TYTA 4DV0J 1TKZA 5A8RA 3LMSA 3FNNA 2B9XA 4U95A 1JLFB 2Q44A 4ZK7M 1SKUB 1UJ4A 1L3KA 3CMQA 3VAMA 3L09A 1YRTA 4OC2A 3IWWA 4I68A 3DM2B 1LWEA 5GADI 1DRZA 5GAGI 2ZVSA 4II9A 1IBKF 5D6GA 5DLGA 4KORA 2YPYA 1K1SA 1RTIA 1RTHA 4HT5A 4KHRA 2FS5A 1EX8A 2VD3A 2KU7A 3EZUA 4FVCA 1N34F 5KG6A 5HMXA 3D0IE 3K5MA 4F2RA 3TE4A 1DURA 2HKEA 4A8YA 1B6BA 5K20B 4PWDA 3GYXB 1WF1A 2B9WA 2RUSA 2GIQA 3VGSA 2HVHA 1OPIA 1YGYA 4DV4J 1F1BB 2C3OA 4DSEA 2DEJA 1LAPA 3A8KA 1IKVB 3D7FA 1MN9A 2VPYB 1YGHA 4CYNA 1JLAB 3FBCA 3H4QA 1K47A 2B6AA 1NE9A 1UFLA 4UOGA 1T9TA 5F8IA 3IR7B 1S49A 4GS4A 1HA1A 1YJRA 1YJ7A 3W2WB 3PRDA 1FXLA 4CGMA 2H1YA 1JLQA 1DE4C 4LVNP 5GADU 2XCPA 2EFPA 2CJXB 3LP1B 2G9DA 5EWGA 1KRPA 4PPDA 3DOMB 2KJVA 4I49A 4E8OA 3G8QA 5DRKA 2XWYA 2MLZA 4CO2A 2V4JB 3ZJ0A 1R8CA 1L3UA 5LYIA 1HKAA 3DNCA 3GILA 4A46A 2CY2A 4AUKA 4O44A 2OKQA 4ZPWR 3CCLS 4M95A 3BB5A 1VBKA 1XBUA 2XGQA 2Y1IA 3TRGA 4ZX9A 1GNKA 1LXJA 4X4TA 2J9EA 2R7VA 3G8SA 4OC1A 1NJIT 4E0AA 4FBUA 4KSEB 1VHEA 4OMFG 1YW4A 3GPAA 2YNIA 4J7CA 4M5DA 1R27B 1HFEL 1C0UA 3C8YA 2GU2A 3IS9A 4U7UD 1OJ4A 2HB6A 2HS3A 1M1KT 1SC6A 4CT8A 2HHXA 3MM6B 5B08A 1VC5A 2CPIA 4DV4F 2FVGA 5E0OA 4KFBA 2IRXA 2B0GA 4XTTA 3HMJG 4PXDA 2EVZA 1FESA 4C7QA 3V38A 5F0UA 4ZPBA 2HLTA 4PG6A 2DRAA 2FJDB 2NSCA 1CPXA 2VXKA 1ZAWA 3ZZ0A 2E1RA 4ZHRA 3KLHA 2MZ1A 4P7VA 4J9QA 1UFWA 3FEYB 3W9JA 3OHAA 4R5PA 4F26A 1DQAA 5J2PA 1Q2CA 3OTCA 1IWGA 2IA6A 2F5GA 2GC8A 4J9NA 5KG5A 4DU7A 4RBUA 1FHTA 2JVRA 4CLZA 5J1NA 4JI4J 2IDEA 3O44A 4MFKA 8ATCB 4CO4A 5DQIA 4JI4F 3DFEA 5D29A 3KKWA 3MPUB 5K14A 4ECVA 2OJ3A 4WFZA 2W2OP 1CM0A 1QJHA 2ZC3A 3KG1A 2YNCA 3B4MA 4AT1B 5A76A 4EYHB 4FPIA 4RJVA 3R1HA 1TF9A 2PRBA 1RAIB 3CCUS 3D54A 2FJWA 1SUQB 7FD1A 5CD4H 3D68A 1XWLA 1XE4A 2R42A 2WBMA 3PTWA 3TA1A 2ZJQQ 1VRUB 1OQ3A 2DGWA 2GANA 1N0UA 2HNDA 1N52B 1BE4A 1FXRA 4ILRA 1IOIA 3DHWC 4P10A 3HHLA 2ZWOA 4Q43A 4NXMJ 1HQ2A 1U47A 1S12A 3WX4A 4YY3J 4DF8A 1WF2A 1QTMA 1UP1A 4F3QA 5KFTA 3NKYA 3AA8A 2AEFA 2BJ7A 1FX2A 1F5CA 4LF6J 2CPDA 2HQFA 1WTBA 3R9EA 2PSWA 2E5LJ 4USJC 2HGNA 1VHIA 4DV2F 2XMJA 5KFHA 2VA3A 1GXLA 4HVZA 2QIFA 2RC4A 5LXYA 4NLQA 2PIIA 1FNMA 1UVNA 5F49A 5AE2A 5CABA 1HQUA 2D3UA 1XMQF 3M8WA 3QYYA 2KXNB 2OEMA 3QGGA 2AFUA 1WOOA 4QWEA 1LOKA 3DYAA 5JPHA 2DEAA 5IV4A 3LW5C 3VAFA 2NR0A 4C8NA 4PABA 2XHCA 3D2PA 4KY3A 4KHPJ 1RLDA 2LDYA 3M8PA 3HCXA 4XK8C 1GEHA 2YWFA 5HXDA 1GXTA 3B8HA 1MMLA 4AXJA 3CD0A 1UPMB 1NHKL 4U9ZA 1RT3B 4CLYA 4DPTA 2RQKA 1FNXH 1FO1A 2XEJA 2YWEA 3LTOA 4K4SA 2HYIB 3T5LA 4ZVHA 2PJ1A 1JWWA 2DH9A 2WVFA 1K4JA 3G6VA 3LP0B 3FRZA 2XBPA 2XSJB 4QYZJ 1M5VC 2KG1A 4HACB 5HL7Q 3ETOA 3ILLA 3KLFB 4JI5F 4B9NA 3S6KA 3FYNA 2PJ5A 3B35A 4UY85 2V4JA 4JI2J 3CPAA 4AVAA 4X2TA 4WYLA 3H8YA 4HL9A 2KG0A 2P5VA 4C8YA 3WIUA 1YREA 3SDEA 2YKQA 1S7NA 1X9SA 2QE5A 2FJEB 5H1SV 4GO7X 2NLWA 1NH8A 2O28A 4M5IA 4ZP7A 2EFOA 3I82A 3EGNA 1BOBA 2PSZA 3GJSB 3K17A 3RGIA 4QYZK 2VI7A 4X66J 1O5JA 3HO1A 3KUEA 3FUYA 5AXLA 4J9UE 4CYUB 2DR8A 3DLHA 1FRKA 4TKTA 2QV6A 1KOHA 4DR6F 3J80U 1RSCA 2PJ4A 5G1ZA 2VDHA 1F5BA 2B58A 3CNQP 2C2OB 2EEYA 1CPZA 2Q6CA 2YX4A 5FD1A 5IB9A 2HHPA 4DQQA 5DWNA 2DYAA 2D4OA 2ZBIA 3WDOA 2J7WA 3L4BC 4Y2AA 1M4LA 1VQ4S 2HAIA 2OR4A 3Q8VA 4DX5A 4BBHA 3A1YG 3NGUA 4M5HA 3PV8A 2EFVA 1S0VA 2VBQA 2FDNA 4DR7F 4RNNA 2IMWP 1LCPA 1RB0A 3Q8SB 1C1BB 1C0TB 3GIRA 3FX6A 1F9FA 4CAFA 4K4YA 3EYZA 2AEMA 3QO9B 4UY8T 4GKKF 4AE5A 3R2DJ 5G20A 2XLJA 5KFLA 4IK2A 2ZEMA 4F3MA 3DC2A 3G6XA 2CTBA 3AQOA 2XEXA 3N0VA 3T90A 1W25A 5A0YB 2YH1A 3MM7B 3HUVA 4JI3J 2G1DA 1S5ZA 1CS4B 3BO2A 2HK3A 4ERDA 5F9LA 3E01B 3M2UA 2GV1A 3I96A 3SI0A 1Y00A 4C7IA 2DXDA 4OZ3A 5EMIA 1IIDA 4NE9C 2GVDA 2YKMB 5GAEU 4C7HA 3CJ2A 1B7FA 1KR4A 4JXRA 2HNZA 4QPXA 2DNNA 3C15B 4I6WA 1AA1B 3X3UA 1AZSB 4AG7A 4JI0J 1UWAA 5IWAF 1WEYA 4AL7A 3C16B 1AXQA 1B7YB 3HF5A 1X0PA 3AH6A 1XFOA 1BQNA 2QLFB 3MPYA 1DFDA 1HWLA 2NMTA 3FBBA 2QA4S 3FCWA 4MIWA 4DOZA 4AYBD 4OC5A 1I1GA 2EC2A 4C3MA 1E6YA 4J90A 3TP2A 2P0WA 2FD2A 2AMCB 1LK7A 3JRUA 3IU2A 3DM2A 2ZEHA 1TL4A 2F8EX 1HL6A 1PKUA 3OFEA 3P96A 1WG4A 2ZZMA 3D1QA 1W2IA 4KO0B 3TUZC 4O3QA 2ZM6J 4F4YA 3GIUA 1X9MA 3RR7A 4DUTA 4PK3A 3LPEA 2GLFA 3FNCA 2ALZA 7FDRA 4X8IA 2OP5A 1NXIA 1VDHA 2AFMA 1NLKL 5HMWA 2C28A 1Y3JA 2HMIB 3JTOA 3W64A 2BW7A 5HQLA 3H5SA 1S6UA 2MKSA 1N32J 1T9WA 3ILJA 4C11B 2QJ3A 4X65J 5D3GA 1M5HA 2MGZA 5I42B 2DNOA 1NB2A 4LSNA 1Q4RA 3MMBA 5IFMA 4NCGB 2QL7B 2M4MA 2AYBA 2E5HA 1QD1A 3UN5A 1LXNA 1HQEA 4F2SA 4ZY2A 4WFXA 2W25A 3CGIA 3M30A 3GV5B 2Y1LB 2WCXA 3IWNC 3C26A 2RQMA 3LH2S 2EVNA 3NA6A 1Y3KA 4CLLA 2B4DA 2D69A 2CQCA 1X4DA 4WCEQ 2PC1A 3PYFA 3DOKA 1Q86T 1XJWB 2BKPA 1S6PB 1T05B 1Z2LA 1PJ6A 1NU4A 1O8BA 3QRPA 5KFWA 3LAMA 1RTJA 3PW4A 1NDKA 1P27B 4YHHJ 2RQCA 1M4DA 3HFKA 1CPSA 5B0DA 2VQYA 4W4MA 2XQCA 2HRUA 2E1CA 4PG8A 1RWMB 4ED4A 2CADA 3PEHA 3KJVB 3JYTB 4PQUA 3VWDA 3EY5A 3PRTA 1BXNA 2KTQA 4CRJA 2DR6A 1RU1A 2JBJA 3ZFVA 4FXWA 2BEIA 2FYXA 1LWCB 1Q16B 5B0FA 3C15A 2HSEB 3M8ZA 4OI2A 1FRXA 3W6SA 3OWCA 2PJ2A 1CULA 2KHDA 4C0HA 2RF2A 5L1KA 1PCAA 4MIBA 4XPDC 2ZENA 3D0GE 5KTCA 1U26A 2GQ2A 3LD2A 1FDAA 1FRHA 1VQSA 3Q2TC 2FTRA 1LWFB 1V5VA 3T1YF 3VAKA 5IWAJ 5IS2A 1QSLA 4ANDA 3IWXA 1KBRA 1Q7YT 4B3MF 1IJFB 4OZLA 4ILMA 4CGNA 4MRIA 4PYAA 1Z8TA 2IYGA 5B0GA 2ZJRQ 2DCUB 1F3FA 2W1BA 2ZOFA 3MM6A 3PW5A 1GTEA 3NCPA 4MCRA 2CPFA 3FMWA 4LF4F 3H5ZA 3KJFB 2HMIA 1YZ7A 1M4IA 4OADA 5IZHA 4K4ZA 2WONA 3R27A 3FECA 2L9WA 2MDAA 3V6DA 2JEGA 2RILA 1NHUA 1CJWA 3TNVA 1TKHA 5A6WA 3UN2A 7CPAA 2V63A 3VATA 1A7GE 1GAOA 1NO8A 1VC6A 1OSCA 3QRRA 4HNXB 2PFDA 2VEZA 2L41A 5HSPA 3RU0A 1I6JA 4FBEA 1N88A 2J9DA 1ARLA 2OUGA 3C2PA 2UXCF 2H4WB 2O5DA 1VRTB 1HI1A 3IM8A 4KYZA 3B8GA 2W2QP 3SIPB 4HKFA 1FJGF 4DR2J 1FY7A 4KQZA 3GFXA 5HJXA 3SSRA 1IBLJ 5EBVA 4OC3A 2HFZA 2Q4YA 1CJVA 3TFYA 4A32A 3TZWA 3ZO7A 2ZH8A 4NJQA 3MUTP 1R0AA 2QN6B 4ZLJA 2MQOA 4TYAA 3UE2A 1G4CA 3ILOA 4F4KA 4N77A 3T6BA 2P9EA 4O3SA 2W9BB 1U1OA 1Q5YA 4FYYB 4C8KA 5DS0A 2DCLA 2W2MP 4CH0S 2L48A 3GKRA 4BS2A 3IO1A 2W7PA 1VOMA 3CCVS 2DNHA 1SCJB 1UA1A 2V8GA 4EFAC 5BJRA 1S48A 4MT1A 2KXFA 3SQOP 3ZZIA 4KZTA 3B3WA 2Z2MA 3OL6A 2OIHA 4NYOA 2UZAA 4RUHA 2X1GA 3MHYA 2X1AA 1RTIB 1SJFA 2MZSA 4M5JA 5HANA 2JFDA 2E9TA 2Z0ZA 3NRBA 2LEBA 3OTDA 2DGOA 4ER8A 3RZAA 4M63A 2FLLA 3H0PA 2F4VF 2AZ1A 1SJQA 2BJ9A 3HP6A 5DJBA 4J91A 1D0EA 1ICEB 2HGMA 4MKYA 2AW0A 4NLVA 2IIHA 3RRKA 4OJ1A 2C42A 3S8SA 5BWAB 3TAMA 4F8RA 2E5JA 4NOHA 3D1HA 3GG1A 4JP8A 3T9ZA 2IA0A 3G87A 2R3VA 1LFPA 2XM3A 2V68A 3QNWB 1VJWA 4F4WA 2CVIA 2YNEA 3NNAA 4DR1J 3WC6A 4NEXA 2L9DA 2E9ZA 3F41A 3SJXA 4TNUA 3TUPA 4F9UA 4IFVB 4A95A 5BYRA 3KZWA 2DHAA 3HKZD 5CCMA 1S0MA 4LF9J 2BE7D 3IRWP 1QMUA 3NOGA 2WSEC 2WSFC 1R8HA 3EX7B 3SI2A 3NEKA 4JB8B 4CAWA 3S1TA 2DITA 2WPWA 2QTWA 2HBRB 4ZI6A 3KUGA 4LF9F 4B3SF 1OPZA 2HS4A 5DQGA 2B6AB 2GQQA 4LF7J 3O3LA 1Q8IA 1X4FA 1D09B 1Q82T 3BJYA 3SJFA 2R8HA 4F0XA 3K0JA 6CPAA 2FVCA 1OBRA 2XZDB 2BEFA 3K59A 2CJQA 3UDVA 4CM0A 3OL7A 3RAXA 4YGOA 2OLWA 2WPXA 5FDLB 1QQ9A 1MJAA 2AQ4A 4N47A 3TR5A 1NDPA 2CWKA 2N7YA 3QO9A 2E1AA 3QB8A 4DPYA 2KHCA 2ZWPA 3KLVA 3FJUA 2BM0A 3CDEA 1S60A 5L38A 4DX6A 1BWEA 4K30A 3VGVA 2UU9J 3JSYA 1RT4A 2MZQA 5L1JA 4KRWA 3ENQA 1TK5A 1CJVB 1V5IB 4XDCA 2GJ2A 3TCVA 2BRKA 2DGTA 2WB4A 4DV6J 3MR5A 3CXQA 4JI7F 1CBXA 2OD6A 5KFJA 5RUBA 2ATCB 2ABYA 1IR1A 2ASJA 1HNZF 3FF3A 2OU2A 4TLRA 1SIWB 3M32A 5ELYA 1HDUA 1QY7A 2CPJA 2GJFA 3AD8C 4TYBA 3D3CJ 2WSCC 1U2CA 4N5SA 2EO8A 2FHOB 4F0HA 3DMJB 1Y7PA 3GQCA 1UVKA 4B3TJ 4PSXA 1K73T 5DDPC 4ALZA 2FVPA 2DO4A 3CJ4A 2E29A 3PKYA 1WOSA 1RAEB 4QBJA 4H4KC 2ODFA 2DNQA 1ZG9A 3M9NB 3RB3A 2B5GB 1ZLIA 2YNGA 3WZ0A 1ZBTA 5CH7B 5KG0A 3I0RA 3AOCA 4OFZA 3RG6A 1PU9A 3TQ1A 1NPKA 4A8QA 1VLOA 1VRQC 2FHMA 1VFJA 2ILYA 2MB0B 3EFAA 3MF5A 4LQGA 3DOKB 1XMOJ 1HHTP 1UAWA 4MTPA 4OI1A 2ZNYA 2FQQB 1N5TA 2HFUA 5IV0A 3BJ7A 2P6SA 3GIKA 5CXTA 4KOVA 4LF4J 1KFDA 1SH3A 1REVB 2QMXA 4EBEA 2BL1A 2XYGB 2HHHF 4CGLA 3GY9A 2G2YA 2W4DA 1WEZA 4PKDB 3KNGA 4YFJA 2K8GA 3ENAA 4I1TA 5IOLA 1TQLA 3QAYA 4ED7A 1LW2A 1QUPA 2Z8QA 1TL1A 4DSFA 2CQ3A 2NUHA 3NS5A 1EQMA 2XI3A 3T1YJ 4OX6A 4OLLA 2H5EA 2WVEA 2MKCA 3NGKA 3FIXA 1IQTA 3FDSA 1PO6A 5DG9A 1IM4A 1JWQA 2LA4A 1KD1T 1YVFA 3MM5B 1GT8A 5A2QU 4U9YA 1CVJA 3QT6A 3R96A 2OPQA 4A31A 2ASYA 2VPXB 2R2SA 4R3KA 1QE1B 1E6YB 5KFEA 3IIBA 1CSJA 3VF0B 1SKRA 3J81Y 3BBCA 2Z3OA 4FD5A 3S9MA 2WVDA 3RBDA 4C2MA 5A2QY 3PW2A 2C1CA 1RWPB 1HBMB 2VBXA 1UVMA 5KFXA 2VZZA 4ITSA 5GAGU 1YR0A 4KOSA 2P6TA 1MWYA 3AB2B 2ZW6A 1HMVB 4G1QB 3CIMA 3D2MA 1Q81T 2IL4A 1X7VA 4YB7A 4HH1A 3IR5B 3PB6X 4WFAQ 2KRRA 2CQPA 1H72C 3DRYA 2V2QA 4D3GA 4J3GA 2PMWA 5IC4B 1X5SA 4ZVRB 3MEDB 1CP7A 1Q2DA 2NSBA 2O66A 1ZO0A 5E96A 1WKJA 4ZBGA 4IG3A 2M88A 2V4RA 1N34J 2GVZA 4I2PB 4GVBA 5G22A 3HSDA 2I1RA 3FQLA 3W65A 4DL3A 1JLFA 3HJVA 1B64A 2M8DB 2HNYA 3W63A 4NLPA 4RU2A 1RAFB 2VIHA 3KJQB 5CYMB 4UA3A 1QM9A 1G7CB 2BRLA 3MOZA 5JXSA 4LBIA 2YWHA 2QG9B 1VI7A 3HFZB 5MAOA 5H84A 2H51B 4UEFA 4FN5A 2UXDF 1J5EF 4TXSA 1XTZA 1XMOF 3JTPA 4PXCA 2M5YA 3UDLA 1P1TA 4DUYF 2BJ8A 2VBZA 2XMTA 1AROP 2QGFB 3U27A 3LPYA 3ZZPA 4O3NA 1VHFA 1HYSB 3KLEB 4QCLA 5L9XA 4OP4A 3JXOA 2AX1A 1VQMS 2ZXVA 1P0HA 1NB7A 1U02A 3PHTA 5HROA 4NLGA 2DNLA 3KWMA 1ZOTA 5KFNA 2W2NP 1UETA 4C8LA 1N5QA 4TU9A 3GCWP 4UCMA 3MMAB 3OR2A 3VGUA 3D4JA 5L39A 2R7OA 2PD1A 2F8HA 3MURP 5BYSA 4P6QA 1EB0A 2XYHB 4QJVA 2P2CB 4Y2KA 1RE1B 2J8NA 2EG2A 5JUMA 1S6QA 4ICLA 4Y28C 1E6VB 3I1UA 1WC3A 1VQ8S 1F0XA 3L3CA 1O6XA 5LMUJ 2UUTA 2Q6BA 5KT2A 1HQEB 4X64J 4J9LA 2YQ3A 3G4SS 3BKUA 3DCAA 2KRBA 4ZS6A 3BI1A 2OPQB 3H59A 3PR4A 4Q0BA 1IBCB 4J9RA 4JUZA 3H5UA 3TW0A 4TQSA 3KL9A 4DPWA 2V77A 2RKIB 2JZ5A 3D7SB 4MXUA 4ECQA 1TAQA 2RHSB 4ZVPB 1SJ3P 2R8VA 1PJ5A 1X31C 4WTOB 1PAEX 3RBUA 3KTQA 4LF7F 4BD9A 2FIWA 1FTRA 3NOCA 5KG1A 5E3QA 4P75A 3NE7A 1CJKB 4JI1F 4A94A 4OLOA 4DNCA 5EGYA 4DR6J 3DXBA 3OW2R 3IP0A 1EQ0A 1TFYA 3SJGA 3N5BA 3NH8A 5C42B 3HHLD 3KR4A 3CJKA 4C97A 3DRSB 1R57A 3M1VA 2M9KA 3KQZA 2DKOB 2QECA 3H2UB 3EVOA 5C42A 4DV5F 4ED6A 3Q23A 4LSNB 3V6KA 3RRGA 5D4OA 1JKHA 2HQGA 2IC3B 2MKKA 1VYAA 1XOVA 3JSMB 4DFPA 2DIVA 4B9LA 5JJBA 5G0RB 1TL3B 3GWCA 4OX9J 1PBAA 2V8PA 3EMTA 2FL4A 5CYQB 2VOPA 2JH3A 1DQ9A 3ZTSA 2XYPB 3BPDA 3TO7A 1YJVA 2XMMA 3IC1A 5G0RA 2XMWA 1X4BA 5IQ6A 2DHGA 4XPLA 2CPXA 3QLHB 1NSPA 4A37A 3K58A 3MRUA 4CYOA 1T9XA 4L8AA 1CBKA 5CYQA 5HLFA 5HVHA 4V19J 4Y00A 1J5OA 3BN7A 2RQ4A 3H25A 3DXSX 2HHQA 1UCNA 2IHR1 5J2MB 1W26A 2QFIA 2Q7SA 3US5A 3DOLA 5H9FK 2MGZB 4DL6A 3FFIA 3OTEA 1ELOA 1X4GA 2XMUA 4X4OA 2VL1A 4FD4A 2N7CA 3NMRA 4RW6B 1K9MT 3SI1A 4PUOB 4R76A 1S10A 1IXKA 4K59A 5D78A 4CAEA 1JQGA 4GC7A 4ZMMA 2F63A 5J2NB 2G13A 5AT1B 3H8EA 2GJIA 2AF6A 3QJJA 5LT5A 1A9NB 3TX0A 3HM9A 3F0AA 4HHJA 4KS9A 2MY8A 2Q4VA 1FEEA 2BQ3A 2PMHA 2NXUA 2OEKA 3QIDA 4P2SA 2PT0A 1KNZA 3KLIA 4ZY1A 2RS2A 2HQIA 1HNWF 4Y49C 4KGZB 4LRAA 4Q0BB 1IBMJ 2DHSA 2KVQE 3DI6B 4DL7A 5F47A 2O67A 4DV7F 3ZXWA 2V9KA 3K5LA 4LIRA 5KT6A 1CP6A 4W90B 3Q8PB 3QGIA 2ACYA 3GTYX 2FZKB 1VQNS 3DHXA 1S1UB 2VONA 2VH7A 3ITHB 5A8WA 3TEHB 2JEJA 1T9UA 4BC7A 4U8YA 1QSYA 5CYJA 3GP9A 1KUYA 5AGEA 3CPXA 3G8TA 5H9EK 4KGXB 4P74A 4JLYA 3HHLC 4EVYA 3M6UA 2EC0A 3FSYA 4XPKA 2N4DA 3N5FA 4R8UA 1F2GA 2MSTA 3J81U 5ETNA 3KLFA 3KHZA 5C7PA 5EX3A 4LF5F 1IYLA 1SI9A 4MI4A 2XS2A 3FVYA 2W24A 2R98A 2V67A 2F40A 2QVPA 1KTVA 4QOTA 2FLOA 1OMSA 3NLCA 3CO0P 2OO4A 2XC9A 4LRCA 3CT9A 2PRQA 4YUDA 4CO0A 1B87A 3PRVA 1SV5A 1RA6A 1RISA 2GGPB 1G2EA 3J7AN 4MFBA 2GMJA 2I9SA 2UXDJ 1HBNB 4DLEA 3SYZA 3AXKA 2DR7A 3BBFA 2VC0A 3P3DA 1XNRF 2JX2A 2UXBF 3CXSA 2DGSA 5HMNA 3SXLA 3E3XA 3EM1A 3JSBA 3IWLA 1UZHA 2HG4A 3CF5Q 2J9AA 1ZAVA 3RBEA 1U2FA 2J76E 1SVDA 4ANCA 1IQZA 4G65A 1YTYA 4DR5J 1S7LA 1XEBA 1WD6A 3W5YA 3HK2A 4IOCQ 3LP2A 3POTA 3TOQA 2QLWA 2FUG9 3DGPB 1Q78A 3ILIA 5LSLA 5KOWA 3G96A 4B9UA 2FJVA 4ZLNA 1KVJA 4OYZA 1PGZA 1P8GA 3ITHA 5A8WB 2ZNZA 2FC8A 4CH1A 3AJ2A 2YNGB 1QE1A 1X4EA 1Y0RA 4NA2A 1I51B 1TK0A 3DLEB 4NCZA 2LVWA 3OBIA 4NA3A 2BX6A 5EUHA 3NNCA 1MROA 3B3SA 2MQNA 3FKBA 3O1LA 5DDRC 3OJUA 4V19X 3PYDA 3FEXB 1XERA 1D8ZA 2DK2A 1I1DA 2Y3YA 4ORFA 4EYIB 2YWGA 2CFXA 4QVTA 3C16A 1NZAA 4I7FB 4OJ3A 2WB1D 2UUAF 4NRUA 3PJ9A 4QWBA 2RSQA 2GGPA 2BKOA 2DNZA 2W9BA 4K5RA 4QBUA 3V6DB 2BE9B 3R7BB 4RPFA 3DRRA 2W7AA 4ZVFA 1U8WA 1IR0A 3SV3A 1EIYB 3OT9A 3MR6A 3E01A 1NK5A 4OV6A 3HSGA 2CF4A 3WIVA 4JV1A 3RJMB 8AT1B 4UFVA 1UEKA 4B9SA 3AY0A 3G8WA 1T9VA 2IM2A 2KN4A 1CEZA 2ZH7A 4DHVA 1LFWA 2FCKA 3HD2A 5KFSA 4OIXA 2FLPA 3SCIE 1UZDA 2CZ4A 2H5MA 2Z3LA 1S6OA 3GFHA 4CP5A 2JWNA 3IM9A 4CLPA 3NAHA 4OHXA 2MHEA 4IH7A 1RTZA 3D6TB 1Q95G 1WI8A 1YK3A 4R25A 2ILZA 3UFCX 2NQPA 2B4BA 4DR4J 3IA0A 4ZVGA 4CNYA 3H40A 5A0YA 5F41A 3C6UB 1ZM2A 3UN3A 2ASLA 2R7TA 3OR1A 1TAUA 1ULRA 3T5HA 3KHGA 3NCRA 1LW2B 4C6AA 4WPAA 1W7WA 3THPA 2CQ4A 4KV8A 3NGDA 4FKXA 2CWXA 2EUIA 1RGVA 2P9CA 3N01A 4H4KA 2PJ9A 5GAHU 3FVLA 2XMAA 1X0FA 3HDSA 4Q44A 4Z7YA 1F57A 3DRRB 2BKNA 1TKJA 4LFAJ 1HNIB 1SV5B 3BDPA 1Y9WA 1Y5LB 4U9RA 1RUSA 2Q7BA 3GFYA 4USWA 4DDFA 4PK2A 2ZEFA 3MEDA 3D7DA 1GMVA 4FNIA 3SZ2A 2DXEA 4F8ZA 3H7HB 4ZPVR 3RAQA 2KO1A 1FJGJ 3TA0A 2MQPA 4LFAF 1IOFA 4NLWA 2LQBA 5C2GA 1ROFA 5KFYA 5J2QA 4WK1A 1FKOB 4RZRA 4TWEA 4DI6A 2VBWA 4DV6F 5LYFA 2R7QA 4UOCA 4KOTA 1C1BA 3VR1A 5DZ7A 3CCMS 4W9YA 3M8QA 2RRBA 3PW0A 2UU9F 2NXJA 2H65B 5IT9Y 3OUYA 2KFYA 2PJ6A 4HI2A 5DG8A 3T1HF 2IAJA 3MCMA 1ZLHA 2YPZA 4OYWA 1VHSA 4RKUC 3Q8UA 5KG3A 3CDUA 3CMES 3EC4A 1D9DA 2M70A 3DDIA 4ZX8A 2COLA 3B78A 2JLGA 3DDNA 5LSRA 1R8PA 4FUUA 1DBDA 3I56S 2FHKA 1R89A 3K8VA 1FDBA 5ETPA 1AW0A 4P52A 2FGCA 2VASA 1MLAA 3CCWA 4HEA9 1UVIA 3BSCA 4YR2A 2BZ2A 2YX1A 1AZSA 3HLUA 2PGCA 2JSXA 2D41A 1T0TV 2W4PA 3BQ0A 4URSA 1RT2A 1TP7A 2W7OA 4X4PA 3FBFA 1MJ9A 3S01A 1WKKA 2OPRB 1NH7A 5LJ3Y 3I3GA 2AEJA 3C14A 4DFJA 4DSLA 3D6HB 3Q2SC 1H0HB 1Q0NA 1HNXF 1JJCB 1CJUB 1RADB 4KPYA 3E2EA 3UDCA 2XWXA 4UTGA 3I5BA 1EAYC 3M2RB 4KOYA 2XMKA 2C1EB 1AMPA 1RWXB 3CSKA 1Y7EA 4M1KA 5AG6A 1N36J 4CI0B 2QO3A 4F4XA 3MD3A 2CTCA 3BGFA 4DQIA 1FA0A 2M0GB 3DMJA 2FIUA 3IAS9 3AD9C 3UR3C 1QAXA 5I0CA 4G6VB 1VRTA 1CC8A 3C6TA 2GVZB 2J6TA 3ET6B 3C19A 3CD5A 4DFKA 3ZC4A 3M05A 1RKIA 1PG5B 4Q7AA 2DPIA 2ZH4A 3NBPB 2ZW7A 2HNYB 2AFXA 3FEZA 4LUAA 3KR5A 1WC0A 1RHJB 2FJAB 1V0CA 1PJ7A 4LF6F 2KB2A 3BPSP 4HTJA 4RW9A 1FJEB 2WONB 3L7PA 1KWMA 3N79A 2ZBRA 1AFJA 2PE3A 2Z58B 4JYAJ 2XZTB 4CAXA 1CJTA 4AXIA 4ELUA 3RTVA 1TKDA 5DO2A 4L73A 3QWPA 1SKSA 1BPNA 2ZEGA 2C6GA 2XLKA 1N5VA 2RB7A 4DL4A 2LA6A 4X4UA 2IJRA 5KFUA 5CPAA 1HR0F 3RAMA 2JEVA 2LMIA 1TV6B 2HS0A 2V8DA 5B09A 4MHNA 2PA8D 1VQYA 4J37A 3DLBA 4KH1B 1AB8A 4Y6IA 2UXCJ 2V6AA 2QLJB 2LEAA 4P2MA 3VGTA 1JLCA 3IGNA 3D9BA 1KQGB 2F8MA 1L3TA 5MLCV 2X7BA 4DQRA 5DQHA 2I2YA 4LRDA 2ZUGA 4F25A 2YNDA 3ZZYA 2GO8A 4DR3F 2PJ7A 1PC5A 2YQ1A 2QYCA 2R8GA 1UJ6A 3W2VA 4OC0A 3VH9A 2XCAA 4KUAA 5JH9A 4F4ZA 2MQQA 2QLBB 3KHRA 1WORA 4NYZA 3D0HE 2HNDB 1M5OC 3KNAA 5HROB 4OHYA 1HBNA 3D7HA 3QRQA 3KLEA 2CQIA 5C2CA 3NFZA 3GG0A 2YVSA 1RT1A 5DDQC 4U7CA 4LQ3A 2LP4A 4ZCMA 1NK8A 3OD2A 3QT7A 4ZVSB 4CTAA 1HMVA 4W92B 1WWHA 4NZ7A 4KJIA 4R5PB 2J8AA 1S76D 2VICA 5EHHA 4UF4A 3KLIB 1XJOA 4CRZB 3UWTA 4NF1A 1TU0B 2R9LA 3B4DA 1NAQA 2NS1B 3UO0A 1D9AA 1KOOA 2R8IA 1FE0A 1ON0A 3I87A 1V3SA 2IJZA 3VWEA 5KOXA 2N3OA 1GK8A 4R0EA 4G3IA 3FRMA 4QIEA 2PFFB 1JJ4A 2B5GA 3R6GB 1S9GB 4L6V3 4NGTA 3GLJA 5LM7E 1JKHB 2EK6A 4CZCA 3GIJA 1HI8A 4DUZF 1JLQB 4DZ6A 5J1QA 2YWWA 3DOLB 3G9CA 2JHEA 4CH7A 2ZKUA 2LYVA 4DS5A 3CCSS 1D8YA 5ETOA 2HHWA 2ZH2A 3M32B 3DNSA 2RS8A 4ZP6A 5CAAA 3BGUA 1RHKB 1U7LA 2A10A 3KKFA 1TUGB 3IS9B 3NG8A 4GO5X 2ROEA 2P6GA 2OPSA 1Y7RA 4OYAA 3AJ1A 2AP6A 2RIJA 2MJNA 4LF1A 2VBYA 3R5BA 2XNRA 1Z8LA 4KIAA 3T5KA 4JI2F 2Q1LA 2Z2LA 5FVJA 4JV0A 3Q83A 2N4CA 1YSJA 4LFBF 4GM5A 3BEGB 1NK0A 1H3DA 5HP1A 5AXKA 2W4CA 4LBPA 2BM1A 2G0IA 4WFBQ 1N54B 4RN7A 4HT7A 5SUHA 1HNXJ 3EPGA 4DR3J 2CG4A 4AVCA 3UCGA 2DPSA 1XBWA 2DTJA 2QX0A 3R2CJ 5EX0A 3VTIA 4RW4B 1APSA 2ZOGA 2REEA 2A3JA 4LF8J 1WEXA 2WRMA 3PM9A 1KONA 3QT8A 4PV6A 1JK9B 5KFZA 3H5YA 5J1EA 2QZ8A 2FXFA 1HW8A 2OHDA 2FJXA 3NWGA 2QA4G 2QLXA 2VU5A 4C48A 3KK2A 4KHPF 2E66A 1N4LA 1SL0A 4JI0F 2C6CA 2DB1A 3P6YC 1HPZA 2AJ4A 4RUAA 2H5JB 2CJKA 1X60A 5HBMB 2MKYA 4BBYA 3BXMA 5K5MA 3W60A 3P45B 2YNFB 3D66A 5D8NA 2BANB 4ES3A 3QFWA 2YKAA 4QR2A 1XC9A 1Q8LA 3CJTA 4DJBA 2AYEA 3U7JA 2KYZA 4A8XA 4UUXA 3H90A 3TVZA 4DV2J 1LANA 1S5KA 4XAKA 4DV7J 1C2PA 2EK8A 4RW6A 3S6HA 1OZPA 5EWEA 2RD5C 1IKWA 3C14B 4DLGA 3O2IA 3MMCB