4UFVA

Plasmodium vivax n-myristoyltransferase in complex with a pyridyl inhibitor (compound 18)
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
385
structure length
385
Chain Sequence
MDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Discovery of Pyridyl-Based Inhibitors of Plasmodium Falciparum N-Myristoyltransferase
pubmed doi rcsb
source organism Plasmodium vivax
total genus 121
structure length 385
sequence length 385
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ufvA00
4UCMA 5AG6A 4CYQA 4CYPA 4A30A 4B13A 3H5ZA 4A2ZA 4UCPA 2YNEA 4C68A 4A33A 4CAEA 5A27A 4UFVA 5AG7A 4CYOA 4A32A 2YNDA 4C2YA 2YNCA 4B14A 4A95A 4C2ZA 4B10A 4CAFA 4CYNA 4C7IA 5G1ZA 4UFXA 4C2XA 4BBHA 4A31A 4CGMA 4UFWA 3IWEA 3IU2A 3JTKA 5AG5A 5G20A 4B11A 3IU1A 2YNCC 2WSAA 2WUUA 5G22A 4CGPA 4CGOA 5AG4A 5A28A 4UCNA 5G21A 4B12A 4CGNA 5AGEA 4C7HA 4CGLA
chains in the Genus database with same CATH superfamily
4PK3A 1IICA 1M1DA 2ZW4A 4A33A 5F09A 3PB6X 1M4IA 3D2MA 1F57A 5CNPA 1NSAA 1XJOA 1N71A 4MBUA 4UWJA 1ZG9A 3FX6A 5JQ4A 2FE7A 3CPXA 3KASA 2R7HA 2VZYA 4U9YA 2PR8A 5AG5A 4UWIA 3A9LA 2JBJA 4B11A 1S60A 2ATRA 3I1UA 3PFOA 3SJFA 4F8ZA 3TCVA 3BJ8A 4CGOA 2FVGA 3B3VA 3LD2A 3PB8X 2IL4A 2CF4A 3W91A 4NJRA 1Z8TA 3F0AA 1CPXA 1OBRA 1U6MA 2R1IA 4IF5A 4JLYA 4UEEA 4JYWA 4X8IA 4ZY0A 3KQZA 4LQGA 2FL4A 4XPDB 3S9LA 1YSJA 5KTDA 4FD4A 3R96A 3IIBA 4I49A 4OIWA 4H6UA 1S7NA 2PJBA 3T8WA 3BJ7A 4OC1A 2Z11A 2R8VA 2ZOGA 3EXNA 4Q36A 2DXQA 2C1CA 4EVYA 2DEAA 3CXSA 1LFWA 4KSIA 4XNHB 2IJZA 5K8PA 1JQGA 3FECA 1KZFA 2V8GA 4NEXA 1I12A 2C6CA 1Q7LA 3BLNA 4OIDA 3DNSA 3TO7A 1RTQA 2XEGA 4AVAA 1A2ZA 1CBXA 4OC3A 1BOBA 1TIQA 5D29A 4AG9A 2O53A 2PJAA 1ZG7A 3F8KA 3PGPA 3VWEA 1L0CA 3GYAA 1LRZA 1Q2YA 5AG7A 2AFZA 3VH9A 5F46A 2Z3OA 4C2ZA 1S7KA 3BHXA 2F8HA 4KVOE 3IFEA 4KORA 4R76A 1LOKA 4Z65A 4KUAA 3ISZA 2AE6A 4MFQA 2H5MA 5DS0A 4NCZA 2QVPA 3BI0A 2FXFA 2JDDA 2ZW7A 2ZEEA 4HPSA 3PB7X 5THWA 3LACA 2OH1A 3QNVA 3TX8A 4H6ZA 5H86A 1TKJA 4WJBA 1IOFA 4CGPA 1XEBA 2B5GB 2PJ0A 4HNXB 7CPAA 1ELLP 4FWUA 4CGNA 1BPMA 2WPXA 2Q51A 1FT7A 3PP9A 4UCMA 2J8RA 3KGQA 3LMSA 4NGRA 1P4NA 3H8FA 2G3AA 4MHDA 2AFWA 1XIXA 3S6KA 3DLJA 1QSMA 2O4HA 2OZUA 1Y9WA 4KLVA 1LAPA 4KOSA 4CAFA 3V7ZA 3B8GA 2Q04A 1NMTA 1XMTA 2D4PA 3FBUA 5JPHA 5K8NA 2QJ8A 3RZAA 3DSBA 2ODFA 1RXTA 4O23A 3TO6A 2HUZA 4YGOA 1Z8XA 4UCNA 1CPSA 1XOVA 5HMNA 4R9MA 2CNMA 4KZTA 3ZJ0A 2FIAA 2AJ6A 4XPDC 2HB6A 3JVNA 4G1PA 3SHPA 2CXAA 1OZPA 5CPAA 2ZXVA 1QMUA 2ANPA 1XFOA 4MHPA 1QQ9A 1NSLA 2PJ5A 2V8DA 1BPNA 1F2OA 4PPZA 2PDOA 4QB9A 1AYEA 4NFRA 2IQ6A 1YW6A 3G8WA 4R8FA 4XNHC 5BWAB 2AFMA 4FD6A 3K9UA 2ZEOA 4IUSA 3JRUA 1ZLHA 4PXCA 3GY9A 4UFXA 4ZGYB 2Q43A 3SXOA 4MMOA 3D68A 4B5PB 1QSOA 3WC6A 3IU2A 3JTKA 2P6GA 2I3CA 2V8VA 2ZEMA 3FEEA 4MFPA 3R9FA 3S9MA 2CY2A 5J8FA 5JM6A 3EC4A 2GE3A 4W9YA 2JBKA 3D66A 1RO5A 2Q4YA 2P6EA 2PJ3A 1AUGA 3D67A 4ONUA 1M4GA 3GB0A 4CYQA 2BEIA 4E2AA 4JXQA 4A2ZA 3IC1A 4J3GA 3BI1A 2B4DB 4X3RA 4GM5A 2PJ6A 2ZPAA 2GU2A 4P4BA 4BINA 5E96A 2QYVA 5GCNA 4P6YA 2PQ8A 5EMIA 2ZEFA 4KOWA 2REFA 4MHZA 2FIWA 2Q7BA 5ELYA 2PJ7A 4CS0B 4MY3A 2DPTA 1I1DA 2NMTA 1HDQA 2BL1A 4F0YA 2RFHA 2Q44A 3KHXA 3LODA 5IV0A 2BSWA 2FS5A 5EC4A 4M6IA 1Y7EA 2HC9A 3TE4A 2WSAA 2AFUA 3W6SA 3D8PA 5AG4A 4JXRA 5JGFA 5K8OA 4UF4A 1ZLIA 1VHOA 2P0WA 3KR5A 1PU9A 1KUXA 3FMCA 2PJ9A 2WZNA 4WWVA 2CTCA 1Z9UA 2Z10A 1YREA 1GYTA 2B5GA 2ZEGA 3R1KA 3RO0A 4MCPA 3B2YA 4UEFA 2ZEHA 1QSNA 3H8GA 4GXHA 2RC4A 3CXQA 4A95A 2FCKA 4CYNA 3B3WA 4MFKA 4AXVA 2ZOFA 4MCRA 3LWUA 3FVLA 1M4LA 4C2XA 4UA3A 2FSRA 4UFWA 3GKRA 3HUVA 4KSFA 4BD9A 5C82A 1Z4RA 1UWYA 4JWPA 2V77A 4LX9A 2J9AA 3H8EA 3FYNA 3P2HA 2Y0MA 4CRYB 4Y49B 3NE7A 2AFSA 1Y0YA 2CNTA 3TTHA 3FJUA 1Z8WA 3W6XA 3CPAA 3WC7A 2CNSA 3WC5A 4PSWA 5LYFA 2QMLA 3PRTA 3WR7A 4DYOA 2A4NA 5AGEA 3TC8A 5K8MA 4H89A 1S7FA 4RUHA 2Q7SA 3PEIA 3CT9A 3N7ZA 4MHNA 4DNCA 3WABA 4OC4A 4OLLA 5I0CA 4R87A 3V38A 8CPAA 4RS2A 4P45A 1CX8A 1YK3A 2B58A 3TOBA 4R6TA 3B3CA 1XF8A 2Z3KA 3H4QA 2NSMA 3ISXA 4M85A 5G1ZA 4E8OA 1JWQA 4RN7A 1Z4EA 3GIUA 1J4JA 2V8HA 1DE4C 4AVBA 3SJGA 3IWEA 5C88A 1ELMP 3SJXA 1TXRA 3SI2A 1YQEA 2VQYA 5IB9A 1IY7A 1QSTA 2PC1A 4F9VA 4PK2A 2XEJA 2VI7A 3NH5A 2D4OA 4B12A 4P10A 4B5PA 4FUUA 4QVTA 1VKCA 4A94A 3CDXA 4MHYA 4ZBGA 3TFYA 1IYLA 1CG2A 2Z3LA 4YRHA 3RNZA 2YNEA 4CAEA 2Z3NA 4KOXA 4DJLA 3D7GA 3CXPA 3MRUA 2AFOA 4A32A 3VARA 3GLJA 3R9EA 3R95A 2YNDA 1CP7A 2Z3PA 4YFJA 2Q4VA 4PQAA 1KUVA 4X2TA 4YU9A 3CZXA 2B4DA 3QB8A 4KS9A 4EFDA 1IIDA 4UBRA 4PXDA 1DTDA 4P4DA 3IWGA 1FNOA 3S6FA 5EBVA 1YVOA 2PJ2A 3VATA 1XMBA 2KCWA 2FT0A 4MJ8A 2WPWA 1YX0A 4YWYA 5I4MA 3V8IA 4OAEA 5AG6A 2ZEPA 5DWNA 4ZY1A 4B13A 4FAIA 1M44A 3TO9A 2J8MA 3KHZA 1PCAA 2DPSA 2ZEDA 1YLOA 2R98A 3B3TA 3PZJA 4AG7A 3NA6A 4ZX9A 4OKOA 4UIAA 4A39A 4C7IA 3MN8A 3KR4A 4GS4A 2PRQA 3PBEA 4KOVA 4FD5A 3QAYA 4Y49C 1S3ZA 3FH4A 2G0BA 3PFEA 2PJ4A 2Q0YA 1YMEA 4NF1A 4CPAA 2F5IA 2RB7A 2OZGA 2OR4A 3DR8A 2B4BA 3ZZIA 4CGLA 2DF5A 1VGYA 3K9TA 2BUEA 2CTBA 4TNUA 4NGQA 2XEFA 5LRGA 2PVVA 4NGTA 3SJEA 2REEA 2ZENA 4CYOA 4ZY2A 2X7BA 1Y7RA 2VZZA 4X5KA 1VIXA 2NYQA 2PE3A 2GREA 2PCUA 4CAXA 2ZW6A 1Z5RA 1MJAA 4H2KA 2I00A 2JEWA 3SI1A 4K30A 4KUBA 4QUSA 3T9YA 4QC6A 3KL9A 1Z8LA 3KKWA 1H8LA 2ZW5A 1I21A 3IWWA 3E0KA 5J8CA 3B7IA 1QSRA 4P4EA 4TWEA 4KOTA 4OC5A 4M3SA 5F47A 4F9UA 2OB0A 1YGHA 3KI9A 4JZ0A 4NXYA 2C6GA 2G3TA 4M6HA 2OU2A 1ARMA 3I3GA 1XE4A 2CIJA 5LYIA 1M4DA 5FVJA 4CAVA 3D7HA 3I9SA 4F0XA 2EO8A 3N5FA 4IHMA 2B3VA 2OOTA 3FB3A 4UFVA 3EFAA 2VXKA 1NE9A 4K3NA 5JH9A 4MCSA 1P0HA 2PR1A 4HNWB 4R7MA 2AFXA 1R57A 4P4FA 2PJ8A 1WK4A 4AVCA 4KVXA 3FRMA 1B6BA 2QECA 2VEZA 3DR6A 3MGDA 4PV6A 4PXEA 3B35A 4IAVA 4A31A 4EWTA 1S5KA 4CGMA 1X12A 4MFJA 3PB4X 3JUWA 5KTCA 2EUIA 4NGMA 1CM0A 3TOAA 3EO4A 5IX3A 1EE3P 4BMHA 5G21A 4KSAA 5LYLA 4MY0A 4HNYB 2IMOA 1SQHA 3FXTA 3H5ZA 2EWBA 1XRYA 2GLFA 2J8NA 1WWZA 3FNCA 4UEZA 1TF9A 2K5TA 4XPLA 2GFQA 3FF3A 1FY7A 4ONWA 4QBJA 2EBJA 3FEDA 4JJXA 3D4UA 3EY5A 5F49A 2BO9A 3IJ3A 1VHEA 3NFZA 4MI4A 1LAMA 4B14A 4LUAA 5HXDA 4MFLA 3C26A 1IGBA 4NSQA 2WYRA 4EMEA 4MFZA 4E0AA 2F7VA 1KWMA 3NH4A 1ARLA 4IK2A 4OP4A 3SXNA 6CPAA 2EK8A 5LRJA 3G3SA 5G20A 4F6AA 2VBQA 4PXBA 2WUUA 3RYOA 1ZG8A 4CRZB 5LYDA 5A28A 1BO4A 4JD6A 3D2PA 3DGVA 1Y9KA 4NGPA 4A37A 2JLMA 2Z0ZA 4FBEA 4CYPA 1MK4A 3D7DA 4B5OA 2EK9A 3FIXA 1R3NA 2XEIA 2YGWA 4FD7A 2JDCA 1Z2LA 2BOAA 1AMPA 1KUYA 1R43A 4P4JA 1UFHA 2PJCA 3QAHA 4KVME 1XBUA 2BCOA 1CP6A 4ZI6A 3B3SA 3NE8A 1YR0A 3BXMA 4MXUA 5D8NA 2PRBA 1BLLE 1YLEA 1V0CA 1X10A 3IGRA 1TKFA 4KLWA 4LQ6A 4NGSA 3IEHA 1ZO0A 5ISVA 4NJQA 1Y0RA 3OWCA 2GIVA 1HDUA 4L89A 3D7FA 2PIYA 4MRIA 4L8AA 4MCQA 2ABZA 4OC2A 1IU8A 4OMEA 3RAMA 1Q2CA 1YVKA 1TKHA 1VHSA 2QIRA 4A38A 4CAWA 2HV2A 3D3SA 5HVHA 3GUXA 4M6GA 4U9ZA 4R3KA 2PSWA 2O28A 2POKA 3L2NA 5F48A 2GLJA 2Z3MA 2C6PA 2PIZA 4OADA 4B6ZA 1PYTB 2G9DA 1ON0A 4PSXA 4RI1A 4ZX8A 3HLPA 4UIBA 2I79A 1LCPA 3S6HA 4U5YA 4II9A 3TT2A 2EVNA 1GHEA 5DWMA 3IU1A 3PB9X 2YNCC 3UY5A 2PJ1A 5G22A 3SI0A 3DDDA 4OC0A 1YW4A 4R57A 5HH1A 4NGNA 1HEEA 1LANA 1MJ9A 3S6GA 4C2YA 2ZELA 3KZWA 4R3LA 3IO1A 3VWDA 3S9NA 4P44A 2JEVA 4A30A 3NH8A 3T90A 1F2PA 1IB1E 4UCPA 4DUKA 4C68A 2VL1A 5J1QA 3F5BA 1TF8A 3R9GA 1IYKA 3WT4A 2B3UA 1Q2DA 2YNCA 4KOUA 4AB7A 4ZYQA 5IB0A 3P2FA 4B10A 5KTAA 5LRKA 2OZHA 1B87A 1PUAA 4ORFA 1IOIA 3PBBA 5HVFA 3KQXA 4BBHA 1MJBA 5HVGA 4KOYA 5H84A 2ARHA 5CBMA 2P6FA 4HKFA 1BAVA 4P4IA 2HQYA 2PVWA 1CJWA 4Q7AA 3RBUA 2Q4ZA 1S7LA 2GANA 1K4JA 4Q38A 3K2KA 5A27A 2C27A 4C7HA 4XPKA
chains in the Genus database with same CATH topology
4PK3A 1IICA 1M1DA 2ZW4A 4A33A 1M4IA 3D2MA 5CNPA 1N71A 4MBUA 4UWJA 5JQ4A 2FE7A 2R7HA 2VZYA 4U9YA 2PR8A 5AG5A 4UWIA 3A9LA 4B11A 1S60A 2ATRA 3TCVA 3BJ8A 4CGOA 3LD2A 2IL4A 3W91A 3F0AA 1U6MA 4JLYA 2R1IA 4IF5A 2FL4A 4XPDB 5KTDA 4FD4A 3R96A 4I49A 4H6UA 1S7NA 3BJ7A 2Z11A 2R8VA 3EXNA 4Q36A 2DXQA 4EVYA 3CXSA 4XNHB 1KZFA 1I12A 3BLNA 3DNSA 3TO7A 4AVAA 1BOBA 1TIQA 4AG9A 3F8KA 3PGPA 3VWEA 1L0CA 3GYAA 1LRZA 1Q2YA 5AG7A 5F46A 2Z3OA 4C2ZA 1S7KA 4KVOE 4KORA 4KUAA 2AE6A 4MFQA 2H5MA 4NCZA 2FXFA 2JDDA 2ZW7A 2OH1A 4H6ZA 5H86A 4CGPA 1XEBA 2B5GB 4HNXB 4CGNA 2WPXA 3PP9A 4UCMA 2J8RA 1P4NA 2G3AA 4MHDA 1XIXA 3S6KA 1QSMA 2OZUA 1Y9WA 4KLVA 4KOSA 4CAFA 3B8GA 2Q04A 1NMTA 1XMTA 2D4PA 3FBUA 5JPHA 3DSBA 1RXTA 3TO6A 2HUZA 4YGOA 4UCNA 5HMNA 4R9MA 2CNMA 4KZTA 3ZJ0A 2FIAA 2AJ6A 4XPDC 3JVNA 3SHPA 2CXAA 1OZPA 2ZXVA 1NSLA 2PDOA 4QB9A 3G8WA 4XNHC 5BWAB 4FD6A 3K9UA 4IUSA 4ZGYB 4UFXA 3GY9A 3SXOA 4B5PB 1QSOA 3IU2A 3JTKA 2P6GA 3R9FA 5J8FA 4MFPA 2CY2A 3EC4A 2GE3A 1RO5A 2Q4YA 2P6EA 4ONUA 1M4GA 4CYQA 2BEIA 4E2AA 4JXQA 4A2ZA 4J3GA 2B4DB 2ZPAA 5E96A 5GCNA 2PQ8A 4KOWA 2REFA 2FIWA 2Q7BA 4CS0B 4MY3A 2DPTA 1I1DA 2NMTA 2BL1A 4F0YA 2Q44A 3LODA 5IV0A 2BSWA 2FS5A 5EC4A 3TE4A 2WSAA 3W6SA 3D8PA 5AG4A 4JXRA 2P0WA 1PU9A 1KUXA 1Z9UA 2Z10A 1YREA 2B5GA 3R1KA 1QSNA 2RC4A 3CXQA 4A95A 2FCKA 4CYNA 4MFKA 4C2XA 4UA3A 2FSRA 4UFWA 3GKRA 4KSFA 5C82A 1Z4RA 4JWPA 4LX9A 4CRYB 3FYNA 3P2HA 2Y0MA 4Y49B 3NE7A 3TTHA 3W6XA 2CNTA 2CNSA 4PSWA 2QMLA 3WR7A 2A4NA 5AGEA 4H89A 1S7FA 3N7ZA 4DNCA 4OLLA 5I0CA 4R87A 4RS2A 1YK3A 2B58A 3TOBA 1XF8A 2Z3KA 3H4QA 5G1ZA 4M85A 4E8OA 1Z4EA 1J4JA 4AVBA 5C88A 3IWEA 2VQYA 1QSTA 2PC1A 4PK2A 2VI7A 4B12A 2D4OA 4B5PA 4QVTA 1VKCA 4ZBGA 3TFYA 1IYLA 2Z3LA 4YRHA 2YNEA 4CAEA 2Z3NA 4KOXA 3CXPA 4A32A 3R9EA 3R95A 2YNDA 2Z3PA 4YFJA 2Q4VA 1KUVA 2B4DA 3QB8A 4KS9A 1IIDA 4UBRA 3IWGA 3S6FA 5EBVA 1YVOA 2KCWA 2FT0A 4MJ8A 2WPWA 1YX0A 3V8IA 4OAEA 5AG6A 5DWNA 4B13A 1M44A 3TO9A 2J8MA 2DPSA 2R98A 3PZJA 4AG7A 4C7IA 4GS4A 4KOVA 4FD5A 4Y49C 1S3ZA 2G0BA 2Q0YA 4NF1A 2F5IA 2OZGA 3DR8A 2B4BA 3ZZIA 4CGLA 2BUEA 2REEA 4CYOA 2X7BA 1Y7RA 2VZZA 4X5KA 4CAXA 2ZW6A 1MJAA 2I00A 4K30A 4KUBA 4QUSA 3T9YA 4QC6A 3KKWA 2ZW5A 1I21A 3E0KA 5J8CA 1QSRA 4KOTA 4M3SA 5F47A 2OB0A 1YGHA 4NXYA 2G3TA 2OU2A 3I3GA 1XE4A 1M4DA 5FVJA 4CAVA 3I9SA 4F0XA 2B3VA 3FB3A 4UFVA 3EFAA 2VXKA 1NE9A 1P0HA 2PR1A 4HNWB 1R57A 4AVCA 1WK4A 4KVXA 3FRMA 1B6BA 2QECA 2VEZA 3DR6A 3MGDA 4PV6A 4A31A 1S5KA 4CGMA 4MFJA 3JUWA 5KTCA 2EUIA 1CM0A 3TOAA 3EO4A 5IX3A 4BMHA 5G21A 4KSAA 4MY0A 4HNYB 1SQHA 3FXTA 3H5ZA 2J8NA 1WWZA 3FNCA 2K5TA 4XPLA 4QBJA 1FY7A 4JJXA 3EY5A 4B14A 5F49A 4MI4A 4LUAA 4MFLA 3C26A 4NSQA 4MFZA 4E0AA 3SXNA 3G3SA 5G20A 4F6AA 2VBQA 2WUUA 3RYOA 4CRZB 5A28A 1BO4A 4JD6A 3D2PA 1Y9KA 2JLMA 2Z0ZA 4CYPA 1MK4A 4B5OA 3FIXA 2YGWA 4FD7A 2JDCA 1KUYA 1UFHA 3QAHA 4KVME 1YR0A 2PRBA 1YLEA 1V0CA 3IGRA 4KLWA 1ZO0A 5ISVA 3OWCA 2GIVA 4L89A 4L8AA 1Q2CA 1YVKA 1VHSA 2QIRA 4CAWA 2HV2A 3D3SA 4U9ZA 4R3KA 2PSWA 2O28A 5F48A 2Z3MA 4OADA 4PSXA 4RI1A 1ON0A 2I79A 3S6HA 4U5YA 4II9A 3TT2A 2EVNA 1GHEA 5DWMA 3IU1A 2YNCC 3UY5A 5G22A 3DDDA 4R57A 3S6GA 5HH1A 1MJ9A 4C2YA 3VWDA 4R3LA 2JEVA 4A30A 3T90A 4UCPA 1IB1E 4C68A 3F5BA 3R9GA 1IYKA 2B3UA 1Q2DA 2YNCA 4KOUA 4AB7A 5IB0A 5KTAA 3P2FA 4B10A 2OZHA 1B87A 1PUAA 4ORFA 4BBHA 1MJBA 4KOYA 5H84A 2ARHA 2P6FA 4HKFA 2HQYA 1CJWA 1S7LA 2GANA 1K4JA 4Q38A 4NEXA 5A27A 2C27A 4C7HA 4XPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UCM A;  5AG6 A;  4CYQ A;  4CYP A;  4A30 A;  4B13 A;  3H5Z A;  4A2Z A;  4UCP A;  2YNE A;  4C68 A;  4A33 A;  4CAE A;  5A27 A;  4UFV A;  5AG7 A;  4CYO A;  4A32 A;  2YND A;  4C2Y A;  2YNC A;  4B14 A;  4A95 A;  4C2Z A;  4B10 A;  4CAF A;  4CYN A;  4C7I A;  5G1Z A;  4UFX A;  4C2X A;  4BBH A;  4A31 A;  4CGM A;  4UFW A;  3IWE A;  3IU2 A;  3JTK A;  5AG5 A;  5G20 A;  4B11 A;  3IU1 A;  2YNC C;  2WSA A;  2WUU A;  5G22 A;  4CGP A;  4CGO A;  5AG4 A;  5A28 A;  4UCN A;  5G21 A;  4B12 A;  4CGN A;  5AGE A;  4C7H A;  4CGL A; 
#chains in the Genus database with same CATH topology
 4PK3 A;  1IIC A;  1M1D A;  2ZW4 A;  4A33 A;  5F09 A;  3PB6 X;  1M4I A;  3D2M A;  1F57 A;  5CNP A;  1NSA A;  1XJO A;  1N71 A;  4MBU A;  4UWJ A;  1ZG9 A;  3FX6 A;  5JQ4 A;  2FE7 A;  3CPX A;  3KAS A;  2R7H A;  2VZY A;  4U9Y A;  2PR8 A;  5AG5 A;  4UWI A;  3A9L A;  2JBJ A;  4B11 A;  1S60 A;  2ATR A;  3I1U A;  3PFO A;  3SJF A;  4F8Z A;  3TCV A;  3BJ8 A;  4CGO A;  2FVG A;  3B3V A;  3LD2 A;  3PB8 X;  2IL4 A;  2CF4 A;  3W91 A;  4NJR A;  1Z8T A;  3F0A A;  1CPX A;  1OBR A;  1U6M A;  2R1I A;  4IF5 A;  4JLY A;  4UEE A;  4JYW A;  4X8I A;  4ZY0 A;  3KQZ A;  4LQG A;  2FL4 A;  4XPD B;  3S9L A;  1YSJ A;  5KTD A;  4FD4 A;  3R96 A;  3IIB A;  4I49 A;  4OIW A;  4H6U A;  1S7N A;  2PJB A;  3T8W A;  3BJ7 A;  4OC1 A;  2Z11 A;  2R8V A;  2ZOG A;  3EXN A;  4Q36 A;  2DXQ A;  2C1C A;  4EVY A;  2DEA A;  3CXS A;  1LFW A;  4KSI A;  4XNH B;  2IJZ A;  5K8P A;  1JQG A;  3FEC A;  1KZF A;  2V8G A;  4NEX A;  1I12 A;  2C6C A;  1Q7L A;  3BLN A;  4OID A;  3DNS A;  3TO7 A;  1RTQ A;  2XEG A;  4AVA A;  1A2Z A;  1CBX A;  4OC3 A;  1BOB A;  1TIQ A;  5D29 A;  4AG9 A;  2O53 A;  2PJA A;  1ZG7 A;  3F8K A;  3PGP A;  3VWE A;  1L0C A;  3GYA A;  1LRZ A;  1Q2Y A;  5AG7 A;  2AFZ A;  3VH9 A;  5F46 A;  2Z3O A;  4C2Z A;  1S7K A;  3BHX A;  2F8H A;  4KVO E;  3IFE A;  4KOR A;  4R76 A;  1LOK A;  4Z65 A;  4KUA A;  3ISZ A;  2AE6 A;  4MFQ A;  2H5M A;  5DS0 A;  4NCZ A;  2QVP A;  3BI0 A;  2FXF A;  2JDD A;  2ZW7 A;  2ZEE A;  4HPS A;  3PB7 X;  5THW A;  3LAC A;  2OH1 A;  3QNV A;  3TX8 A;  4H6Z A;  5H86 A;  1TKJ A;  4WJB A;  1IOF A;  4CGP A;  1XEB A;  2B5G B;  2PJ0 A;  4HNX B;  7CPA A;  1ELL P;  4FWU A;  4CGN A;  1BPM A;  2WPX A;  2Q51 A;  1FT7 A;  3PP9 A;  4UCM A;  2J8R A;  3KGQ A;  3LMS A;  4NGR A;  1P4N A;  3H8F A;  2G3A A;  4MHD A;  2AFW A;  1XIX A;  3S6K A;  3DLJ A;  1QSM A;  2O4H A;  2OZU A;  1Y9W A;  4KLV A;  1LAP A;  4KOS A;  4CAF A;  3V7Z A;  3B8G A;  2Q04 A;  1NMT A;  1XMT A;  2D4P A;  3FBU A;  5JPH A;  5K8N A;  2QJ8 A;  3RZA A;  3DSB A;  2ODF A;  1RXT A;  4O23 A;  3TO6 A;  2HUZ A;  4YGO A;  1Z8X A;  4UCN A;  1CPS A;  1XOV A;  5HMN A;  4R9M A;  2CNM A;  4KZT A;  3ZJ0 A;  2FIA A;  2AJ6 A;  4XPD C;  2HB6 A;  3JVN A;  4G1P A;  3SHP A;  2CXA A;  1OZP A;  5CPA A;  2ZXV A;  1QMU A;  2ANP A;  1XFO A;  4MHP A;  1QQ9 A;  1NSL A;  2PJ5 A;  2V8D A;  1BPN A;  1F2O A;  4PPZ A;  2PDO A;  4QB9 A;  1AYE A;  4NFR A;  2IQ6 A;  1YW6 A;  3G8W A;  4R8F A;  4XNH C;  5BWA B;  2AFM A;  4FD6 A;  3K9U A;  2ZEO A;  4IUS A;  3JRU A;  1ZLH A;  4PXC A;  3GY9 A;  4UFX A;  4ZGY B;  2Q43 A;  3SXO A;  4MMO A;  3D68 A;  4B5P B;  1QSO A;  3WC6 A;  3IU2 A;  3JTK A;  2P6G A;  2I3C A;  2V8V A;  2ZEM A;  3FEE A;  4MFP A;  3R9F A;  3S9M A;  2CY2 A;  5J8F A;  5JM6 A;  3EC4 A;  2GE3 A;  4W9Y A;  2JBK A;  3D66 A;  1RO5 A;  2Q4Y A;  2P6E A;  2PJ3 A;  1AUG A;  3D67 A;  4ONU A;  1M4G A;  3GB0 A;  4CYQ A;  2BEI A;  4E2A A;  4JXQ A;  4A2Z A;  3IC1 A;  4J3G A;  3BI1 A;  2B4D B;  4X3R A;  4GM5 A;  2PJ6 A;  2ZPA A;  2GU2 A;  4P4B A;  4BIN A;  5E96 A;  2QYV A;  5GCN A;  4P6Y A;  2PQ8 A;  5EMI A;  2ZEF A;  4KOW A;  2REF A;  4MHZ A;  2FIW A;  2Q7B A;  5ELY A;  2PJ7 A;  4CS0 B;  4MY3 A;  2DPT A;  1I1D A;  2NMT A;  1HDQ A;  2BL1 A;  4F0Y A;  2RFH A;  2Q44 A;  3KHX A;  3LOD A;  5IV0 A;  2BSW A;  2FS5 A;  5EC4 A;  4M6I A;  1Y7E A;  2HC9 A;  3TE4 A;  2WSA A;  2AFU A;  3W6S A;  3D8P A;  5AG4 A;  4JXR A;  5JGF A;  5K8O A;  4UF4 A;  1ZLI A;  1VHO A;  2P0W A;  3KR5 A;  1PU9 A;  1KUX A;  3FMC A;  2PJ9 A;  2WZN A;  4WWV A;  2CTC A;  1Z9U A;  2Z10 A;  1YRE A;  1GYT A;  2B5G A;  2ZEG A;  3R1K A;  3RO0 A;  4MCP A;  3B2Y A;  4UEF A;  2ZEH A;  1QSN A;  3H8G A;  4GXH A;  2RC4 A;  3CXQ A;  4A95 A;  2FCK A;  4CYN A;  3B3W A;  4MFK A;  4AXV A;  2ZOF A;  4MCR A;  3LWU A;  3FVL A;  1M4L A;  4C2X A;  4UA3 A;  2FSR A;  4UFW A;  3GKR A;  3HUV A;  4KSF A;  4BD9 A;  5C82 A;  1Z4R A;  1UWY A;  4JWP A;  2V77 A;  4LX9 A;  2J9A A;  3H8E A;  3FYN A;  3P2H A;  2Y0M A;  4CRY B;  4Y49 B;  3NE7 A;  2AFS A;  1Y0Y A;  2CNT A;  3TTH A;  3FJU A;  1Z8W A;  3W6X A;  3CPA A;  3WC7 A;  2CNS A;  3WC5 A;  4PSW A;  5LYF A;  2QML A;  3PRT A;  3WR7 A;  4DYO A;  2A4N A;  5AGE A;  3TC8 A;  5K8M A;  4H89 A;  1S7F A;  4RUH A;  2Q7S A;  3PEI A;  3CT9 A;  3N7Z A;  4MHN A;  4DNC A;  3WAB A;  4OC4 A;  4OLL A;  5I0C A;  4R87 A;  3V38 A;  8CPA A;  4RS2 A;  4P45 A;  1CX8 A;  1YK3 A;  2B58 A;  3TOB A;  4R6T A;  3B3C A;  1XF8 A;  2Z3K A;  3H4Q A;  2NSM A;  3ISX A;  4M85 A;  5G1Z A;  4E8O A;  1JWQ A;  4RN7 A;  1Z4E A;  3GIU A;  1J4J A;  2V8H A;  1DE4 C;  4AVB A;  3SJG A;  3IWE A;  5C88 A;  1ELM P;  3SJX A;  1TXR A;  3SI2 A;  1YQE A;  2VQY A;  5IB9 A;  1IY7 A;  1QST A;  2PC1 A;  4F9V A;  4PK2 A;  2XEJ A;  2VI7 A;  3NH5 A;  2D4O A;  4B12 A;  4P10 A;  4B5P A;  4FUU A;  4QVT A;  1VKC A;  4A94 A;  3CDX A;  4MHY A;  4ZBG A;  3TFY A;  1IYL A;  1CG2 A;  2Z3L A;  4YRH A;  3RNZ A;  2YNE A;  4CAE A;  2Z3N A;  4KOX A;  4DJL A;  3D7G A;  3CXP A;  3MRU A;  2AFO A;  4A32 A;  3VAR A;  3GLJ A;  3R9E A;  3R95 A;  2YND A;  1CP7 A;  2Z3P A;  4YFJ A;  2Q4V A;  4PQA A;  1KUV A;  4X2T A;  4YU9 A;  3CZX A;  2B4D A;  3QB8 A;  4KS9 A;  4EFD A;  1IID A;  4UBR A;  4PXD A;  1DTD A;  4P4D A;  3IWG A;  1FNO A;  3S6F A;  5EBV A;  1YVO A;  2PJ2 A;  3VAT A;  1XMB A;  2KCW A;  2FT0 A;  4MJ8 A;  2WPW A;  1YX0 A;  4YWY A;  5I4M A;  3V8I A;  4OAE A;  5AG6 A;  2ZEP A;  5DWN A;  4ZY1 A;  4B13 A;  4FAI A;  1M44 A;  3TO9 A;  2J8M A;  3KHZ A;  1PCA A;  2DPS A;  2ZED A;  1YLO A;  2R98 A;  3B3T A;  3PZJ A;  4AG7 A;  3NA6 A;  4ZX9 A;  4OKO A;  4UIA A;  4A39 A;  4C7I A;  3MN8 A;  3KR4 A;  4GS4 A;  2PRQ A;  3PBE A;  4KOV A;  4FD5 A;  3QAY A;  4Y49 C;  1S3Z A;  3FH4 A;  2G0B A;  3PFE A;  2PJ4 A;  2Q0Y A;  1YME A;  4NF1 A;  4CPA A;  2F5I A;  2RB7 A;  2OZG A;  2OR4 A;  3DR8 A;  2B4B A;  3ZZI A;  4CGL A;  2DF5 A;  1VGY A;  3K9T A;  2BUE A;  2CTB A;  4TNU A;  4NGQ A;  2XEF A;  5LRG A;  2PVV A;  4NGT A;  3SJE A;  2REE A;  2ZEN A;  4CYO A;  4ZY2 A;  2X7B A;  1Y7R A;  2VZZ A;  4X5K A;  1VIX A;  2NYQ A;  2PE3 A;  2GRE A;  2PCU A;  4CAX A;  2ZW6 A;  1Z5R A;  1MJA A;  4H2K A;  2I00 A;  2JEW A;  3SI1 A;  4K30 A;  4KUB A;  4QUS A;  3T9Y A;  4QC6 A;  3KL9 A;  1Z8L A;  3KKW A;  1H8L A;  2ZW5 A;  1I21 A;  3IWW A;  3E0K A;  5J8C A;  3B7I A;  1QSR A;  4P4E A;  4TWE A;  4KOT A;  4OC5 A;  4M3S A;  5F47 A;  4F9U A;  2OB0 A;  1YGH A;  3KI9 A;  4JZ0 A;  4NXY A;  2C6G A;  2G3T A;  4M6H A;  2OU2 A;  1ARM A;  3I3G A;  1XE4 A;  2CIJ A;  5LYI A;  1M4D A;  5FVJ A;  4CAV A;  3D7H A;  3I9S A;  4F0X A;  2EO8 A;  3N5F A;  4IHM A;  2B3V A;  2OOT A;  3FB3 A;  4UFV A;  3EFA A;  2VXK A;  1NE9 A;  4K3N A;  5JH9 A;  4MCS A;  1P0H A;  2PR1 A;  4HNW B;  4R7M A;  2AFX A;  1R57 A;  4P4F A;  2PJ8 A;  1WK4 A;  4AVC A;  4KVX A;  3FRM A;  1B6B A;  2QEC A;  2VEZ A;  3DR6 A;  3MGD A;  4PV6 A;  4PXE A;  3B35 A;  4IAV A;  4A31 A;  4EWT A;  1S5K A;  4CGM A;  1X12 A;  4MFJ A;  3PB4 X;  3JUW A;  5KTC A;  2EUI A;  4NGM A;  1CM0 A;  3TOA A;  3EO4 A;  5IX3 A;  1EE3 P;  4BMH A;  5G21 A;  4KSA A;  5LYL A;  4MY0 A;  4HNY B;  2IMO A;  1SQH A;  3FXT A;  3H5Z A;  2EWB A;  1XRY A;  2GLF A;  2J8N A;  1WWZ A;  3FNC A;  4UEZ A;  1TF9 A;  2K5T A;  4XPL A;  2GFQ A;  3FF3 A;  1FY7 A;  4ONW A;  4QBJ A;  2EBJ A;  3FED A;  4JJX A;  3D4U A;  3EY5 A;  5F49 A;  2BO9 A;  3IJ3 A;  1VHE A;  3NFZ A;  4MI4 A;  1LAM A;  4B14 A;  4LUA A;  5HXD A;  4MFL A;  3C26 A;  1IGB A;  4NSQ A;  2WYR A;  4EME A;  4MFZ A;  4E0A A;  2F7V A;  1KWM A;  3NH4 A;  1ARL A;  4IK2 A;  4OP4 A;  3SXN A;  6CPA A;  2EK8 A;  5LRJ A;  3G3S A;  5G20 A;  4F6A A;  2VBQ A;  4PXB A;  2WUU A;  3RYO A;  1ZG8 A;  4CRZ B;  5LYD A;  5A28 A;  1BO4 A;  4JD6 A;  3D2P A;  3DGV A;  1Y9K A;  4NGP A;  4A37 A;  2JLM A;  2Z0Z A;  4FBE A;  4CYP A;  1MK4 A;  3D7D A;  4B5O A;  2EK9 A;  3FIX A;  1R3N A;  2XEI A;  2YGW A;  4FD7 A;  2JDC A;  1Z2L A;  2BOA A;  1AMP A;  1KUY A;  1R43 A;  4P4J A;  1UFH A;  2PJC A;  3QAH A;  4KVM E;  1XBU A;  2BCO A;  1CP6 A;  4ZI6 A;  3B3S A;  3NE8 A;  1YR0 A;  3BXM A;  4MXU A;  5D8N A;  2PRB A;  1BLL E;  1YLE A;  1V0C A;  1X10 A;  3IGR A;  1TKF A;  4KLW A;  4LQ6 A;  4NGS A;  3IEH A;  1ZO0 A;  5ISV A;  4NJQ A;  1Y0R A;  3OWC A;  2GIV A;  1HDU A;  4L89 A;  3D7F A;  2PIY A;  4MRI A;  4L8A A;  4MCQ A;  2ABZ A;  4OC2 A;  1IU8 A;  4OME A;  3RAM A;  1Q2C A;  1YVK A;  1TKH A;  1VHS A;  2QIR A;  4A38 A;  4CAW A;  2HV2 A;  3D3S A;  5HVH A;  3GUX A;  4M6G A;  4U9Z A;  4R3K A;  2PSW A;  2O28 A;  2POK A;  3L2N A;  5F48 A;  2GLJ A;  2Z3M A;  2C6P A;  2PIZ A;  4OAD A;  4B6Z A;  1PYT B;  2G9D A;  1ON0 A;  4PSX A;  4RI1 A;  4ZX8 A;  3HLP A;  4UIB A;  2I79 A;  1LCP A;  3S6H A;  4U5Y A;  4II9 A;  3TT2 A;  2EVN A;  1GHE A;  5DWM A;  3IU1 A;  3PB9 X;  2YNC C;  3UY5 A;  2PJ1 A;  5G22 A;  3SI0 A;  3DDD A;  4OC0 A;  1YW4 A;  4R57 A;  5HH1 A;  4NGN A;  1HEE A;  1LAN A;  1MJ9 A;  3S6G A;  4C2Y A;  2ZEL A;  3KZW A;  4R3L A;  3IO1 A;  3VWD A;  3S9N A;  4P44 A;  2JEV A;  4A30 A;  3NH8 A;  3T90 A;  1F2P A;  1IB1 E;  4UCP A;  4DUK A;  4C68 A;  2VL1 A;  5J1Q A;  3F5B A;  1TF8 A;  3R9G A;  1IYK A;  3WT4 A;  2B3U A;  1Q2D A;  2YNC A;  4KOU A;  4AB7 A;  4ZYQ A;  5IB0 A;  3P2F A;  4B10 A;  5KTA A;  5LRK A;  2OZH A;  1B87 A;  1PUA A;  4ORF A;  1IOI A;  3PBB A;  5HVF A;  3KQX A;  4BBH A;  1MJB A;  5HVG A;  4KOY A;  5H84 A;  2ARH A;  5CBM A;  2P6F A;  4HKF A;  1BAV A;  4P4I A;  2HQY A;  2PVW A;  1CJW A;  4Q7A A;  3RBU A;  2Q4Z A;  1S7L A;  2GAN A;  1K4J A;  4Q38 A;  3K2K A;  5A27 A;  2C27 A;  4C7H A;  4XPK A; 
#chains in the Genus database with same CATH homology
 4PK3 A;  1IIC A;  1M1D A;  2ZW4 A;  4A33 A;  1M4I A;  3D2M A;  5CNP A;  1N71 A;  4MBU A;  4UWJ A;  5JQ4 A;  2FE7 A;  2R7H A;  2VZY A;  4U9Y A;  2PR8 A;  5AG5 A;  4UWI A;  3A9L A;  4B11 A;  1S60 A;  2ATR A;  3TCV A;  3BJ8 A;  4CGO A;  3LD2 A;  2IL4 A;  3W91 A;  3F0A A;  1U6M A;  4JLY A;  2R1I A;  4IF5 A;  2FL4 A;  4XPD B;  5KTD A;  4FD4 A;  3R96 A;  4I49 A;  4H6U A;  1S7N A;  3BJ7 A;  2Z11 A;  2R8V A;  3EXN A;  4Q36 A;  2DXQ A;  4EVY A;  3CXS A;  4XNH B;  1KZF A;  1I12 A;  3BLN A;  3DNS A;  3TO7 A;  4AVA A;  1BOB A;  1TIQ A;  4AG9 A;  3F8K A;  3PGP A;  3VWE A;  1L0C A;  3GYA A;  1LRZ A;  1Q2Y A;  5AG7 A;  5F46 A;  2Z3O A;  4C2Z A;  1S7K A;  4KVO E;  4KOR A;  4KUA A;  2AE6 A;  4MFQ A;  2H5M A;  4NCZ A;  2FXF A;  2JDD A;  2ZW7 A;  2OH1 A;  4H6Z A;  5H86 A;  4CGP A;  1XEB A;  2B5G B;  4HNX B;  4CGN A;  2WPX A;  3PP9 A;  4UCM A;  2J8R A;  1P4N A;  2G3A A;  4MHD A;  1XIX A;  3S6K A;  1QSM A;  2OZU A;  1Y9W A;  4KLV A;  4KOS A;  4CAF A;  3B8G A;  2Q04 A;  1NMT A;  1XMT A;  2D4P A;  3FBU A;  5JPH A;  3DSB A;  1RXT A;  3TO6 A;  2HUZ A;  4YGO A;  4UCN A;  5HMN A;  4R9M A;  2CNM A;  4KZT A;  3ZJ0 A;  2FIA A;  2AJ6 A;  4XPD C;  3JVN A;  3SHP A;  2CXA A;  1OZP A;  2ZXV A;  1NSL A;  2PDO A;  4QB9 A;  3G8W A;  4XNH C;  5BWA B;  4FD6 A;  3K9U A;  4IUS A;  4ZGY B;  4UFX A;  3GY9 A;  3SXO A;  4B5P B;  1QSO A;  3IU2 A;  3JTK A;  2P6G A;  3R9F A;  5J8F A;  4MFP A;  2CY2 A;  3EC4 A;  2GE3 A;  1RO5 A;  2Q4Y A;  2P6E A;  4ONU A;  1M4G A;  4CYQ A;  2BEI A;  4E2A A;  4JXQ A;  4A2Z A;  4J3G A;  2B4D B;  2ZPA A;  5E96 A;  5GCN A;  2PQ8 A;  4KOW A;  2REF A;  2FIW A;  2Q7B A;  4CS0 B;  4MY3 A;  2DPT A;  1I1D A;  2NMT A;  2BL1 A;  4F0Y A;  2Q44 A;  3LOD A;  5IV0 A;  2BSW A;  2FS5 A;  5EC4 A;  3TE4 A;  2WSA A;  3W6S A;  3D8P A;  5AG4 A;  4JXR A;  2P0W A;  1PU9 A;  1KUX A;  1Z9U A;  2Z10 A;  1YRE A;  2B5G A;  3R1K A;  1QSN A;  2RC4 A;  3CXQ A;  4A95 A;  2FCK A;  4CYN A;  4MFK A;  4C2X A;  4UA3 A;  2FSR A;  4UFW A;  3GKR A;  4KSF A;  5C82 A;  1Z4R A;  4JWP A;  4LX9 A;  4CRY B;  3FYN A;  3P2H A;  2Y0M A;  4Y49 B;  3NE7 A;  3TTH A;  3W6X A;  2CNT A;  2CNS A;  4PSW A;  2QML A;  3WR7 A;  2A4N A;  5AGE A;  4H89 A;  1S7F A;  3N7Z A;  4DNC A;  4OLL A;  5I0C A;  4R87 A;  4RS2 A;  1YK3 A;  2B58 A;  3TOB A;  1XF8 A;  2Z3K A;  3H4Q A;  5G1Z A;  4M85 A;  4E8O A;  1Z4E A;  1J4J A;  4AVB A;  5C88 A;  3IWE A;  2VQY A;  1QST A;  2PC1 A;  4PK2 A;  2VI7 A;  4B12 A;  2D4O A;  4B5P A;  4QVT A;  1VKC A;  4ZBG A;  3TFY A;  1IYL A;  2Z3L A;  4YRH A;  2YNE A;  4CAE A;  2Z3N A;  4KOX A;  3CXP A;  4A32 A;  3R9E A;  3R95 A;  2YND A;  2Z3P A;  4YFJ A;  2Q4V A;  1KUV A;  2B4D A;  3QB8 A;  4KS9 A;  1IID A;  4UBR A;  3IWG A;  3S6F A;  5EBV A;  1YVO A;  2KCW A;  2FT0 A;  4MJ8 A;  2WPW A;  1YX0 A;  3V8I A;  4OAE A;  5AG6 A;  5DWN A;  4B13 A;  1M44 A;  3TO9 A;  2J8M A;  2DPS A;  2R98 A;  3PZJ A;  4AG7 A;  4C7I A;  4GS4 A;  4KOV A;  4FD5 A;  4Y49 C;  1S3Z A;  2G0B A;  2Q0Y A;  4NF1 A;  2F5I A;  2OZG A;  3DR8 A;  2B4B A;  3ZZI A;  4CGL A;  2BUE A;  2REE A;  4CYO A;  2X7B A;  1Y7R A;  2VZZ A;  4X5K A;  4CAX A;  2ZW6 A;  1MJA A;  2I00 A;  4K30 A;  4KUB A;  4QUS A;  3T9Y A;  4QC6 A;  3KKW A;  2ZW5 A;  1I21 A;  3E0K A;  5J8C A;  1QSR A;  4KOT A;  4M3S A;  5F47 A;  2OB0 A;  1YGH A;  4NXY A;  2G3T A;  2OU2 A;  3I3G A;  1XE4 A;  1M4D A;  5FVJ A;  4CAV A;  3I9S A;  4F0X A;  2B3V A;  3FB3 A;  4UFV A;  3EFA A;  2VXK A;  1NE9 A;  1P0H A;  2PR1 A;  4HNW B;  1R57 A;  4AVC A;  1WK4 A;  4KVX A;  3FRM A;  1B6B A;  2QEC A;  2VEZ A;  3DR6 A;  3MGD A;  4PV6 A;  4A31 A;  1S5K A;  4CGM A;  4MFJ A;  3JUW A;  5KTC A;  2EUI A;  1CM0 A;  3TOA A;  3EO4 A;  5IX3 A;  4BMH A;  5G21 A;  4KSA A;  4MY0 A;  4HNY B;  1SQH A;  3FXT A;  3H5Z A;  2J8N A;  1WWZ A;  3FNC A;  2K5T A;  4XPL A;  4QBJ A;  1FY7 A;  4JJX A;  3EY5 A;  4B14 A;  5F49 A;  4MI4 A;  4LUA A;  4MFL A;  3C26 A;  4NSQ A;  4MFZ A;  4E0A A;  3SXN A;  3G3S A;  5G20 A;  4F6A A;  2VBQ A;  2WUU A;  3RYO A;  4CRZ B;  5A28 A;  1BO4 A;  4JD6 A;  3D2P A;  1Y9K A;  2JLM A;  2Z0Z A;  4CYP A;  1MK4 A;  4B5O A;  3FIX A;  2YGW A;  4FD7 A;  2JDC A;  1KUY A;  1UFH A;  3QAH A;  4KVM E;  1YR0 A;  2PRB A;  1YLE A;  1V0C A;  3IGR A;  4KLW A;  1ZO0 A;  5ISV A;  3OWC A;  2GIV A;  4L89 A;  4L8A A;  1Q2C A;  1YVK A;  1VHS A;  2QIR A;  4CAW A;  2HV2 A;  3D3S A;  4U9Z A;  4R3K A;  2PSW A;  2O28 A;  5F48 A;  2Z3M A;  4OAD A;  4PSX A;  4RI1 A;  1ON0 A;  2I79 A;  3S6H A;  4U5Y A;  4II9 A;  3TT2 A;  2EVN A;  1GHE A;  5DWM A;  3IU1 A;  2YNC C;  3UY5 A;  5G22 A;  3DDD A;  4R57 A;  3S6G A;  5HH1 A;  1MJ9 A;  4C2Y A;  3VWD A;  4R3L A;  2JEV A;  4A30 A;  3T90 A;  4UCP A;  1IB1 E;  4C68 A;  3F5B A;  3R9G A;  1IYK A;  2B3U A;  1Q2D A;  2YNC A;  4KOU A;  4AB7 A;  5IB0 A;  5KTA A;  3P2F A;  4B10 A;  2OZH A;  1B87 A;  1PUA A;  4ORF A;  4BBH A;  1MJB A;  4KOY A;  5H84 A;  2ARH A;  2P6F A;  4HKF A;  2HQY A;  1CJW A;  1S7L A;  2GAN A;  1K4J A;  4Q38 A;  4NEX A;  5A27 A;  2C27 A;  4C7H A;  4XPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...