4UFVA

Plasmodium vivax n-myristoyltransferase in complex with a pyridyl inhibitor (compound 18)
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
385
structure length
385
Chain Sequence
b'MDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Discovery of Pyridyl-Based Inhibitors of Plasmodium Falciparum N-Myristoyltransferase
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
total genus 121
structure length 385
sequence length 385
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ufvA00
4B14A 4C2ZA 5A27A 3IU1A 4CAFA 3H5ZA 4CYPA 4A31A 4A32A 4CGPA 4C2YA 5A28A 3JTKA 4C68A 3IWEA 4A30A 4UFXA 2YNEA 4B13A 4BBHA 5G20A 2YNDA 4UCPA 4CGNA 3IU2A 4B12A 4CYOA 4UFWA 4B10A 5AG6A 5AG5A 4UFVA 4CGMA 2YNCA 4A95A 4CYQA 2YNCC 5AGEA 4UCNA 4A2ZA 2WUUA 4CAEA 4CYNA 4CGOA 4C2XA 4C7IA 4CGLA 5G22A 4A33A 4UCMA 5G21A 5AG4A 5AG7A 4B11A 5G1ZA 2WSAA 4C7HA
chains in the Genus database with same CATH superfamily
1S7LA 3W6XA 3D7GA 1GHEA 2VBQA 2D4OA 5LYDA 4R3KA 2CF4A 4KUBA 3D68A 3SJGA 4AVAA 3DNSA 2PJBA 3B3TA 2GU2A 1XE4A 3D2PA 2POKA 4B13A 4FD5A 3FH4A 2DPTA 4X5KA 3D7FA 2V77A 3DR8A 4AB7A 2PR1A 2ZEDA 2HUZA 2PJ8A 7CPAA 1U6MA 5GCNA 5H86A 4CGMA 4CAWA 1QQ9A 2VEZA 3HUVA 3PB9X 4M85A 1HDQA 3SI1A 3VH9A 4GM5A 4CAEA 3P2FA 2PJAA 4C7IA 2PCUA 2EO8A 2PDOA 3R1KA 4M3SA 4NXYA 4OAEA 3FNCA 4NGSA 4MRIA 4MXUA 2FIWA 2REEA 3VWDA 4L8AA 2PJ3A 4JD6A 3SI2A 3CXPA 3RYOA 2B4DB 3NE8A 4KOVA 4ORFA 2V8GA 2B5GB 4B6ZA 1LAPA 2PJ7A 3MN8A 2OOTA 2Y0MA 3S9NA 2PSWA 3B3WA 3I1UA 2R98A 1RXTA 2B58A 2C27A 4R87A 2VQYA 5CBMA 3S6HA 4PK3A 5HH1A 2Q04A 2C6GA 4L89A 2OZUA 4MHPA 3B3CA 4NFRA 4NJRA 4M6HA 1AYEA 1RTQA 3ISZA 4LQ6A 3TTHA 3PGPA 1M1DA 1UWYA 2PJ6A 3K9UA 2AFXA 4A33A 4KOYA 3PB8X 2XEFA 4B14A 5CNPA 1A2ZA 2Q4ZA 2Z3OA 3CXSA 3NH8A 4PK2A 3FB3A 5K8MA 1VHOA 2Q51A 4DUKA 1Y0YA 1AUGA 2HB6A 4LQGA 3TT2A 5JGFA 2AJ6A 1XMTA 2CNSA 2PC1A 4FAIA 3WR7A 3TO9A 2XEIA 4B10A 3KR4A 4Q36A 5C88A 1Z5RA 4KS9A 3FEDA 4MFPA 4NGPA 4Q7AA 2ANPA 4CRZB 1OZPA 5H84A 3PZJA 3G3SA 3FVLA 2Z3MA 1LAMA 3T8WA 2J8MA 4QC6A 1TIQA 1ZG9A 3PB6X 4OC1A 3WC7A 1KWMA 2EBJA 2J9AA 3VWEA 4BMHA 2GLFA 5KTDA 5F46A 3TFYA 4AG7A 3D2MA 2ZEHA 1M4DA 4FD6A 1CM0A 4CGPA 2VZZA 3GUXA 4ZY2A 2JEVA 4DNCA 2PE3A 2CTCA 2FSRA 2O28A 4NGRA 3DDDA 4FUUA 1FY7A 3A9LA 4FWUA 2I00A 4BBHA 1CPXA 3RZAA 4ZGYB 1WK4A 5LYIA 3IJ3A 4F0XA 3SHPA 3B3SA 2EK8A 4MBUA 5AG5A 3T90A 1S7KA 1NSAA 4OIDA 2JBKA 2YNCC 1R57A 3D67A 4R6TA 4F0YA 2I3CA 3ISXA 4P45A 4X8IA 3S9LA 2F5IA 5JQ4A 4UBRA 1ZLIA 1M4GA 5HVGA 4EWTA 3KL9A 4OP4A 4PXBA 2F8HA 3SJXA 1XOVA 2V8DA 4RS2A 2JLMA 4P4JA 1ARMA 2JDDA 4EVYA 1YX0A 5LYLA 3B35A 1Q7LA 2EVNA 4NGQA 1YR0A 4OC4A 5A28A 3D4UA 3IWEA 3BI0A 2FCKA 3NH5A 1UFHA 2RFHA 3IU2A 2P6FA 3FF3A 3IWGA 2GLJA 3PB7X 2DF5A 4P4EA 2CNMA 2I79A 3KQXA 4NCZA 2PJ0A 4I49A 4OIWA 5LRJA 3W6SA 4CPAA 2K5TA 1YGHA 1L0CA 2GREA 3R95A 2P0WA 1IIDA 3F0AA 2DEAA 5D29A 5G1ZA 1PYTB 3G8WA 2KCWA 1LANA 3QAHA 4F9VA 2AFUA 2R8VA 1X10A 3H5ZA 3I9SA 2PJ2A 4KORA 4NSQA 2YGWA 3TOBA 2PJ9A 5FVJA 4ZYQA 1CX8A 3B7IA 1FT7A 1YVOA 3IC1A 4QB9A 5E96A 4ZX8A 3C26A 1I12A 2OR4A 3V38A 4IUSA 4PXEA 3IEHA 4A38A 5I0CA 4MCSA 1IGBA 2OB0A 1IU8A 1M44A 1CBXA 1TF8A 3F8KA 4ZI6A 4ONWA 3DSBA 1IICA 3H8FA 1F2OA 3MGDA 4KLWA 4O23A 4G1PA 2FVGA 2WUUA 4UCNA 2JEWA 4OADA 4CGOA 5LYFA 1MJBA 1BO4A 2PIYA 2VI7A 2AFWA 5IB9A 1F57A 3FX6A 3DGVA 2NSMA 3TC8A 4B11A 1Z8XA 2Q7BA 4JWPA 2EWBA 2QECA 4CRYB 2GE3A 3B3VA 2B5GA 3TO7A 4PXCA 3R9FA 5F47A 1QSTA 4E2AA 2AE6A 4GS4A 4JXRA 4ZY0A 4B5OA 4R8FA 1R3NA 2VL1A 1JWQA 2PVWA 1TKFA 2REFA 1QSOA 4B12A 2AFMA 3OWCA 2IMOA 4U9ZA 4NJQA 3ZJ0A 1YREA 5F49A 2FT0A 2G0BA 2ZEFA 4KOSA 2VZYA 3TX8A 4P44A 2OH1A 1TKHA 5D8NA 3FEEA 4CGLA 1M4LA 1QSRA 3FRMA 3EC4A 3H8GA 4MCQA 4NGMA 1BPNA 5IB0A 2BOAA 1Z9UA 1FNOA 5A27A 5LRGA 3GB0A 1XRYA 4H6UA 2ZW4A 1DE4C 4J3GA 2ZENA 3WABA 2EUIA 3KI9A 4C68A 2PIZA 2PJCA 3NE7A 3IO1A 3TE4A 3TCVA 4MCPA 4PSWA 4KZTA 4OLLA 1YW4A 4UEFA 4UWIA 3NFZA 3SXOA 1QMUA 4YFJA 2RC4A 1Q2CA 1ZG7A 1NSLA 4HKFA 4A95A 4CAXA 2JBJA 2R7HA 4AVBA 2QVPA 4XNHB 4XPDC 2DXQA 4XPKA 4CAVA 1ZO0A 6CPAA 2G3AA 4TWEA 4R7MA 3BI1A 4R9MA 4P6YA 1Z4RA 1CP6A 4KOWA 4MFKA 4UEEA 3CT9A 3IU1A 1XJOA 4F9UA 3S9MA 2GIVA 5DS0A 2GFQA 1Y0RA 4F6AA 2V8HA 4QVTA 4B5PA 1IOFA 1JQGA 4UFXA 4Y49B 4JJXA 3PFOA 1X12A 3JRUA 2YNEA 4JZ0A 3KQZA 4X3RA 3CPAA 4MY0A 5G20A 2HC9A 3CZXA 4MFQA 4E0AA 2A4NA 4MHZA 2FIAA 2R1IA 1LCPA 3K2KA 2Z3PA 5HVFA 4KOUA 4XPLA 4UFVA 4E8OA 4NGNA 5J1QA 3N7ZA 5BWAB 4M6GA 5HMNA 3W91A 1QSNA 2WPXA 1XIXA 2ZELA 4KOXA 4MHDA 1AMPA 1Q2DA 4OC2A 4UF4A 4MFLA 2ZOFA 4UA3A 3KGQA 1S7FA 4HNYB 2QMLA 4XNHC 2WSAA 4FD4A 4OC3A 4TNUA 4QBJA 1XF8A 3UY5A 1QSMA 4M6IA 8CPAA 3RNZA 5KTAA 1ON0A 1ZLHA 4IAVA 4MHNA 4A32A 2NYQA 2D4PA 2QJ8A 4K3NA 1F2PA 3D7DA 1Y9WA 2AFZA 1ELMP 2Z0ZA 1P0HA 2DPSA 1VIXA 4A30A 4BD9A 5IX3A 4Y49C 4IF5A 4P4BA 3NH4A 1NMTA 3QAYA 2BEIA 1Y7RA 2ZW6A 2ZXVA 2NMTA 4YU9A 1BAVA 2CXAA 2Q0YA 2ABZA 1S7NA 2G3TA 3E0KA 1EE3P 2C6PA 3QB8A 4KVXA 4MJ8A 1IYKA 1Z8TA 3I3GA 4PV6A 4A94A 2QIRA 1VHEA 2BUEA 5JH9A 1CJWA 2G9DA 1VKCA 1GYTA 3KR5A 4ZBGA 3CDXA 3EY5A 4H6ZA 3LMSA 1ELLP 3KZWA 2PRQA 5AG7A 4IHMA 1TKJA 2FXFA 4A37A 1OBRA 5ISVA 3FXTA 1KUVA 3D8PA 3SJFA 1Z8LA 3FYNA 1LFWA 4UIAA 4AVCA 1VGYA 2J8RA 2CIJA 2B3UA 1I1DA 1J4JA 4MI4A 3H4QA 3LACA 1TF9A 3QNVA 1S3ZA 3K9TA 4MHYA 2IJZA 5AG6A 3JVNA 1YSJA 1R43A 3KHXA 2ODFA 5EBVA 3B8GA 3IFEA 5ELYA 3T9YA 1IOIA 4KSFA 5AGEA 4CYQA 5I4MA 3NA6A 3LODA 2FL4A 5J8FA 3FBUA 5G21A 4OC5A 2X7BA 3D66A 2PRBA 4C7HA 2CNTA 3PB4X 5F48A 2B3VA 2QYVA 4CS0B 5DWNA 3S6GA 2F7VA 4KVME 1XEBA 2PJ4A 2B4DA 4KOTA 4KSAA 1LRZA 3D7HA 4K30A 4P4DA 4YRHA 2WYRA 4ZX9A 3IWWA 3EFAA 3WC6A 2C6CA 2ZOGA 2P6EA 4HNXB 1K4JA 2FE7A 4FD7A 5IV0A 2VXKA 4CYOA 2IQ6A 4MCRA 4OMEA 3JUWA 4UFWA 5JM6A 3WT4A 4AG9A 3BXMA 2V8VA 1I21A 3PP9A 4Q38A 2OZHA 1SQHA 5CPAA 5DWMA 1HEEA 2EK9A 2Q44A 2XEGA 2Z3KA 3HLPA 3MRUA 4XPDB 3V7ZA 3RO0A 5C82A 1Z2LA 3RAMA 3SXNA 3CPXA 2PJ5A 3EO4A 1B87A 3FIXA 5LRKA 3P2HA 4EMEA 4C2ZA 4NF1A 4UEZA 4CYPA 1YLOA 2CTBA 2XEJA 1BLLE 3FMCA 3WC5A 2ZEEA 1KUXA 4BINA 3JTKA 4C2YA 5HXDA 4P10A 1VHSA 2Q4YA 3B2YA 1Q2YA 3D3SA 3PEIA 1WWZA 3PBEA 2YNDA 2Q7SA 3KHZA 3LWUA 4CGNA 3BLNA 2ZEOA 4RN7A 4JLYA 2YNCA 2ATRA 3PRTA 1KUYA 4JXQA 3SJEA 3KASA 1S5KA 1CPSA 2AFOA 3BJ8A 4U5YA 1PUAA 1N71A 2IL4A 3DLJA 4KUAA 2OZGA 4DYOA 1MJAA 5JPHA 2Z3NA 2O4HA 4YGOA 3TO6A 1YQEA 2GANA 2PVVA 2ZPAA 4A31A 1HDUA 5K8OA 3BHXA 3GYAA 2Q43A 2BL1A 2PQ8A 4LUAA 4ONUA 4P4IA 4RUHA 5F09A 4MFZA 2WZNA 2PR8A 2FS5A 3PFEA 2PJ1A 4IK2A 1CG2A 4FBEA 1YK3A 1MJ9A 2Q4VA 1IB1E 1XMBA 4AXVA 2Z11A 4WJBA 1IY7A 4P4FA 5J8CA 2BCOA 5EC4A 4X2TA 3IIBA 1PCAA 4U9YA 4CYNA 3TOAA 2AFSA 1CP7A 1XFOA 2C1CA 4UIBA 3LD2A 1ZG8A 5THWA 1V0CA 1M4IA 1Z8WA 3PBBA 4YWYA 5AG4A 2BO9A 4PQAA 1MK4A 1RO5A 2ZW5A 3S6FA 2O53A 4Z65A 2ZEPA 3KKWA 4GXHA 3VATA 1YW6A 1BOBA 2P6GA 3N5FA 4R76A 3BJ7A 4ZY1A 2WPWA 4H2KA 2Z3LA 4WWVA 5HVHA 1ARLA 2B4BA 4PPZA 4B5PB 3V8IA 4MY3A 3ZZIA 1H8LA 4MFJA 1LOKA 4UCPA 4F8ZA 2ZEGA 3GY9A 3FJUA 2CY2A 4NGTA 3R9GA 3R96A 4EFDA 2HV2A 4II9A 1DTDA 1PU9A 3H8EA 3F5BA 4C2XA 4PSXA 4RI1A 4LX9A 3S6KA 4OC0A 4UCMA 2J8NA 1Z4EA 1P4NA 3CXQA 4A2ZA 1NE9A 1Y9KA 2JDCA 4R3LA 4HPSA 4H89A 4CAFA 5KTCA 4DJLA 3R9EA 4KVOE 5EMIA 2ARHA 4HNWB 4MMOA 3L2NA 4JYWA 1TXRA 2RB7A 3SI0A 3VARA 5K8PA 3GKRA 4R57A 1B6BA 1S60A 1XBUA 1YVKA 2OU2A 4W9YA 1KZFA 2HQYA 1YMEA 2ZEMA 3FECA 4PXDA 2H5MA 3DR6A 4KSIA 5K8NA 1IYLA 4QUSA 3IGRA 4OKOA 4UWJA 3GIUA 4NEXA 1BPMA 2Z10A 3GLJA 5G22A 2ZW7A 3RBUA 1YLEA 3EXNA 4KLVA 4A39A 1Y7EA 2BSWA
chains in the Genus database with same CATH topology
1S7LA 3W6XA 1GHEA 2VBQA 2D4OA 4R3KA 4KUBA 4AVAA 3DNSA 1XE4A 3D2PA 4B13A 4FD5A 4X5KA 2DPTA 3DR8A 4AB7A 2PR1A 2HUZA 1U6MA 5GCNA 5H86A 4CGMA 4CAWA 2VEZA 4M85A 4CAEA 3P2FA 4C7IA 2PDOA 3R1KA 4M3SA 4NXYA 4OAEA 3FNCA 2FIWA 2REEA 3VWDA 4L8AA 4JD6A 3CXPA 3RYOA 2B4DB 4ORFA 4KOVA 2B5GB 2Y0MA 2PSWA 2R98A 1RXTA 2B58A 2C27A 4R87A 2VQYA 3S6HA 4PK3A 5HH1A 2Q04A 4L89A 2OZUA 3TTHA 3PGPA 1M1DA 4A33A 3K9UA 4KOYA 4B14A 5CNPA 2Z3OA 3CXSA 4PK2A 3FB3A 3TT2A 2AJ6A 1XMTA 2CNSA 2PC1A 3WR7A 3TO9A 4B10A 4Q36A 5C88A 4KS9A 4MFPA 4CRZB 1OZPA 5H84A 3PZJA 3G3SA 2Z3MA 2J8MA 4QC6A 1TIQA 3VWEA 4BMHA 5KTDA 5F46A 3TFYA 4AG7A 3D2MA 1M4DA 4FD6A 1CM0A 4CGPA 2VZZA 2JEVA 4DNCA 2FSRA 2O28A 3DDDA 1FY7A 3A9LA 2I00A 4BBHA 4ZGYB 1WK4A 4F0XA 3SHPA 4MBUA 5AG5A 3T90A 1S7KA 2YNCC 1R57A 4F0YA 2F5IA 5JQ4A 4UBRA 1M4GA 4RS2A 2JLMA 2JDDA 4EVYA 1YX0A 2EVNA 5A28A 1YR0A 3IWEA 2FCKA 1UFHA 3IU2A 2P6FA 3IWGA 2CNMA 2I79A 4NCZA 4I49A 3W6SA 2K5TA 1YGHA 1L0CA 3R95A 2P0WA 1IIDA 3F0AA 5G1ZA 3G8WA 2KCWA 3QAHA 2R8VA 3H5ZA 3I9SA 4KORA 4NSQA 3TOBA 2YGWA 5FVJA 1YVOA 4QB9A 5E96A 3C26A 1I12A 4IUSA 5I0CA 2OB0A 1M44A 3F8KA 3DSBA 1IICA 3MGDA 4KLWA 4UCNA 2WUUA 4OADA 4CGOA 1MJBA 1BO4A 2VI7A 4B11A 2Q7BA 4JWPA 2QECA 4CRYB 2GE3A 2B5GA 3TO7A 3R9FA 5F47A 1QSTA 4E2AA 2AE6A 4GS4A 4JXRA 4B5OA 2REFA 1QSOA 4B12A 3OWCA 4U9ZA 3ZJ0A 1YREA 5F49A 2FT0A 2G0BA 4KOSA 2VZYA 2OH1A 4CGLA 1QSRA 3FRMA 3EC4A 5IB0A 1Z9UA 5A27A 4H6UA 2ZW4A 4J3GA 2EUIA 4C68A 3NE7A 3TE4A 3TCVA 4PSWA 4KZTA 4OLLA 4UWIA 3SXOA 4YFJA 2RC4A 1Q2CA 1NSLA 4HKFA 4A95A 4CAXA 2R7HA 4AVBA 4XNHB 4XPDC 2DXQA 4XPKA 4CAVA 1ZO0A 2G3AA 4R9MA 1Z4RA 4KOWA 4MFKA 3IU1A 2GIVA 4F6AA 4QVTA 4B5PA 4Y49B 4UFXA 4JJXA 2YNEA 5G20A 4MY0A 4MFQA 4E0AA 2A4NA 2FIAA 2R1IA 2Z3PA 4KOUA 4XPLA 4UFVA 4E8OA 3N7ZA 5BWAB 5HMNA 3W91A 1QSNA 2WPXA 1XIXA 4KOXA 4MHDA 1Q2DA 4MFLA 4XNHC 4UA3A 1S7FA 4HNYB 2QMLA 2WSAA 4FD4A 4QBJA 1XF8A 3UY5A 1QSMA 5KTAA 1ON0A 4A32A 2D4PA 1Y9WA 2Z0ZA 1P0HA 2DPSA 4A30A 5IX3A 4Y49C 4IF5A 1NMTA 2BEIA 1Y7RA 2ZW6A 2ZXVA 2NMTA 2CXAA 2Q0YA 3E0KA 1S7NA 2G3TA 3QB8A 4MJ8A 4PV6A 4KVXA 1IYKA 3I3GA 2QIRA 2BUEA 1CJWA 1VKCA 4ZBGA 3EY5A 4H6ZA 5AG7A 2FXFA 5ISVA 3FXTA 1KUVA 3D8PA 3FYNA 4AVCA 2J8RA 2B3UA 1I1DA 1J4JA 4MI4A 3H4QA 1S3ZA 5AG6A 3JVNA 5EBVA 3T9YA 3V8IA 3B8GA 4CYQA 4KSFA 5AGEA 3LODA 2FL4A 5J8FA 3FBUA 5G21A 2X7BA 2PRBA 4C7HA 2CNTA 5F48A 4CS0B 2B3VA 5DWNA 3S6GA 4KVME 1XEBA 4KOTA 2B4DA 4KSAA 1LRZA 4K30A 4YRHA 3EFAA 2P6EA 4HNXB 1K4JA 2FE7A 4FD7A 5IV0A 2VXKA 4CYOA 4UFWA 3JUWA 4AG9A 1I21A 3PP9A 4Q38A 2OZHA 1SQHA 5DWMA 4A2ZA 2Q44A 2Z3KA 4XPDB 5C82A 3SXNA 3EO4A 1B87A 3FIXA 3P2HA 4C2ZA 4NF1A 4CYPA 4C2YA 1KUXA 3JTKA 1VHSA 2Q4YA 1Q2YA 3D3SA 1WWZA 2YNDA 4CGNA 3BLNA 4JLYA 2YNCA 2ATRA 1KUYA 4JXQA 1S5KA 3BJ8A 4U5YA 1PUAA 1N71A 2IL4A 4KUAA 2OZGA 1MJAA 5JPHA 2Z3NA 4YGOA 3TO6A 2GANA 2ZPAA 4A31A 3GYAA 2BL1A 2PQ8A 4LUAA 4ONUA 4MFZA 2PR8A 2FS5A 1YK3A 1MJ9A 2Q4VA 1IB1E 2Z11A 5J8CA 5EC4A 4U9YA 4CYNA 3TOAA 3LD2A 1V0CA 1M4IA 5AG4A 1RO5A 1MK4A 2ZW5A 3S6FA 3KKWA 1BOBA 2P6GA 3BJ7A 2WPWA 2Z3LA 2B4BA 4B5PB 4MY3A 3ZZIA 4MFJA 4UCPA 3GY9A 2CY2A 3R9GA 3R96A 2HV2A 4II9A 1PU9A 3F5BA 4C2XA 4PSXA 4RI1A 4LX9A 3S6KA 4UCMA 2J8NA 1Z4EA 1P4NA 3CXQA 1NE9A 1Y9KA 2JDCA 4R3LA 4H89A 4CAFA 5KTCA 3R9EA 4KVOE 2ARHA 4HNWB 3GKRA 4R57A 1B6BA 1S60A 1YVKA 2OU2A 1KZFA 2HQYA 2H5MA 3DR6A 1IYLA 4QUSA 3IGRA 4UWJA 4NEXA 2Z10A 5G22A 2ZW7A 1YLEA 3EXNA 4KLVA 2BSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B14 A;  4C2Z A;  5A27 A;  3IU1 A;  4CAF A;  3H5Z A;  4CYP A;  4A31 A;  4A32 A;  4CGP A;  4C2Y A;  5A28 A;  3JTK A;  4C68 A;  3IWE A;  4A30 A;  4UFX A;  2YNE A;  4B13 A;  4BBH A;  5G20 A;  2YND A;  4UCP A;  4CGN A;  3IU2 A;  4B12 A;  4CYO A;  4UFW A;  4B10 A;  5AG6 A;  5AG5 A;  4UFV A;  4CGM A;  2YNC A;  4A95 A;  4CYQ A;  2YNC C;  5AGE A;  4UCN A;  4A2Z A;  2WUU A;  4CAE A;  4CYN A;  4CGO A;  4C2X A;  4C7I A;  4CGL A;  5G22 A;  4A33 A;  4UCM A;  5G21 A;  5AG4 A;  5AG7 A;  4B11 A;  5G1Z A;  2WSA A;  4C7H A; 
#chains in the Genus database with same CATH topology
 1S7L A;  3W6X A;  3D7G A;  1GHE A;  2VBQ A;  2D4O A;  5LYD A;  4R3K A;  2CF4 A;  4KUB A;  3D68 A;  3SJG A;  4AVA A;  3DNS A;  2PJB A;  3B3T A;  2GU2 A;  1XE4 A;  3D2P A;  2POK A;  4B13 A;  4FD5 A;  3FH4 A;  2DPT A;  4X5K A;  3D7F A;  2V77 A;  3DR8 A;  4AB7 A;  2PR1 A;  2ZED A;  2HUZ A;  2PJ8 A;  7CPA A;  1U6M A;  5GCN A;  5H86 A;  4CGM A;  4CAW A;  1QQ9 A;  2VEZ A;  3HUV A;  3PB9 X;  4M85 A;  1HDQ A;  3SI1 A;  3VH9 A;  4GM5 A;  4CAE A;  3P2F A;  2PJA A;  4C7I A;  2PCU A;  2EO8 A;  2PDO A;  3R1K A;  4M3S A;  4NXY A;  4OAE A;  3FNC A;  4NGS A;  4MRI A;  4MXU A;  2FIW A;  2REE A;  3VWD A;  4L8A A;  2PJ3 A;  4JD6 A;  3SI2 A;  3CXP A;  3RYO A;  2B4D B;  3NE8 A;  4KOV A;  4ORF A;  2V8G A;  2B5G B;  4B6Z A;  1LAP A;  2PJ7 A;  3MN8 A;  2OOT A;  2Y0M A;  3S9N A;  2PSW A;  3B3W A;  3I1U A;  2R98 A;  1RXT A;  2B58 A;  2C27 A;  4R87 A;  2VQY A;  5CBM A;  3S6H A;  4PK3 A;  5HH1 A;  2Q04 A;  2C6G A;  4L89 A;  2OZU A;  4MHP A;  3B3C A;  4NFR A;  4NJR A;  4M6H A;  1AYE A;  1RTQ A;  3ISZ A;  4LQ6 A;  3TTH A;  3PGP A;  1M1D A;  1UWY A;  2PJ6 A;  3K9U A;  2AFX A;  4A33 A;  4KOY A;  3PB8 X;  2XEF A;  4B14 A;  5CNP A;  1A2Z A;  2Q4Z A;  2Z3O A;  3CXS A;  3NH8 A;  4PK2 A;  3FB3 A;  5K8M A;  1VHO A;  2Q51 A;  4DUK A;  1Y0Y A;  1AUG A;  2HB6 A;  4LQG A;  3TT2 A;  5JGF A;  2AJ6 A;  1XMT A;  2CNS A;  2PC1 A;  4FAI A;  3WR7 A;  3TO9 A;  2XEI A;  4B10 A;  3KR4 A;  4Q36 A;  5C88 A;  1Z5R A;  4KS9 A;  3FED A;  4MFP A;  4NGP A;  4Q7A A;  2ANP A;  4CRZ B;  1OZP A;  5H84 A;  3PZJ A;  3G3S A;  3FVL A;  2Z3M A;  1LAM A;  3T8W A;  2J8M A;  4QC6 A;  1TIQ A;  1ZG9 A;  3PB6 X;  4OC1 A;  3WC7 A;  1KWM A;  2EBJ A;  2J9A A;  3VWE A;  4BMH A;  2GLF A;  5KTD A;  5F46 A;  3TFY A;  4AG7 A;  3D2M A;  2ZEH A;  1M4D A;  4FD6 A;  1CM0 A;  4CGP A;  2VZZ A;  3GUX A;  4ZY2 A;  2JEV A;  4DNC A;  2PE3 A;  2CTC A;  2FSR A;  2O28 A;  4NGR A;  3DDD A;  4FUU A;  1FY7 A;  3A9L A;  4FWU A;  2I00 A;  4BBH A;  1CPX A;  3RZA A;  4ZGY B;  1WK4 A;  5LYI A;  3IJ3 A;  4F0X A;  3SHP A;  3B3S A;  2EK8 A;  4MBU A;  5AG5 A;  3T90 A;  1S7K A;  1NSA A;  4OID A;  2JBK A;  2YNC C;  1R57 A;  3D67 A;  4R6T A;  4F0Y A;  2I3C A;  3ISX A;  4P45 A;  4X8I A;  3S9L A;  2F5I A;  5JQ4 A;  4UBR A;  1ZLI A;  1M4G A;  5HVG A;  4EWT A;  3KL9 A;  4OP4 A;  4PXB A;  2F8H A;  3SJX A;  1XOV A;  2V8D A;  4RS2 A;  2JLM A;  4P4J A;  1ARM A;  2JDD A;  4EVY A;  1YX0 A;  5LYL A;  3B35 A;  1Q7L A;  2EVN A;  4NGQ A;  1YR0 A;  4OC4 A;  5A28 A;  3D4U A;  3IWE A;  3BI0 A;  2FCK A;  3NH5 A;  1UFH A;  2RFH A;  3IU2 A;  2P6F A;  3FF3 A;  3IWG A;  2GLJ A;  3PB7 X;  2DF5 A;  4P4E A;  2CNM A;  2I79 A;  3KQX A;  4NCZ A;  2PJ0 A;  4I49 A;  4OIW A;  5LRJ A;  3W6S A;  4CPA A;  2K5T A;  1YGH A;  1L0C A;  2GRE A;  3R95 A;  2P0W A;  1IID A;  3F0A A;  2DEA A;  5D29 A;  5G1Z A;  1PYT B;  3G8W A;  2KCW A;  1LAN A;  3QAH A;  4F9V A;  2AFU A;  2R8V A;  1X10 A;  3H5Z A;  3I9S A;  2PJ2 A;  4KOR A;  4NSQ A;  2YGW A;  3TOB A;  2PJ9 A;  5FVJ A;  4ZYQ A;  1CX8 A;  3B7I A;  1FT7 A;  1YVO A;  3IC1 A;  4QB9 A;  5E96 A;  4ZX8 A;  3C26 A;  1I12 A;  2OR4 A;  3V38 A;  4IUS A;  4PXE A;  3IEH A;  4A38 A;  5I0C A;  4MCS A;  1IGB A;  2OB0 A;  1IU8 A;  1M44 A;  1CBX A;  1TF8 A;  3F8K A;  4ZI6 A;  4ONW A;  3DSB A;  1IIC A;  3H8F A;  1F2O A;  3MGD A;  4KLW A;  4O23 A;  4G1P A;  2FVG A;  2WUU A;  4UCN A;  2JEW A;  4OAD A;  4CGO A;  5LYF A;  1MJB A;  1BO4 A;  2PIY A;  2VI7 A;  2AFW A;  5IB9 A;  1F57 A;  3FX6 A;  3DGV A;  2NSM A;  3TC8 A;  4B11 A;  1Z8X A;  2Q7B A;  4JWP A;  2EWB A;  2QEC A;  4CRY B;  2GE3 A;  3B3V A;  2B5G A;  3TO7 A;  4PXC A;  3R9F A;  5F47 A;  1QST A;  4E2A A;  2AE6 A;  4GS4 A;  4JXR A;  4ZY0 A;  4B5O A;  4R8F A;  1R3N A;  2VL1 A;  1JWQ A;  2PVW A;  1TKF A;  2REF A;  1QSO A;  4B12 A;  2AFM A;  3OWC A;  2IMO A;  4U9Z A;  4NJQ A;  3ZJ0 A;  1YRE A;  5F49 A;  2FT0 A;  2G0B A;  2ZEF A;  4KOS A;  2VZY A;  3TX8 A;  4P44 A;  2OH1 A;  1TKH A;  5D8N A;  3FEE A;  4CGL A;  1M4L A;  1QSR A;  3FRM A;  3EC4 A;  3H8G A;  4MCQ A;  4NGM A;  1BPN A;  5IB0 A;  2BOA A;  1Z9U A;  1FNO A;  5A27 A;  5LRG A;  3GB0 A;  1XRY A;  4H6U A;  2ZW4 A;  1DE4 C;  4J3G A;  2ZEN A;  3WAB A;  2EUI A;  3KI9 A;  4C68 A;  2PIZ A;  2PJC A;  3NE7 A;  3IO1 A;  3TE4 A;  3TCV A;  4MCP A;  4PSW A;  4KZT A;  4OLL A;  1YW4 A;  4UEF A;  4UWI A;  3NFZ A;  3SXO A;  1QMU A;  4YFJ A;  2RC4 A;  1Q2C A;  1ZG7 A;  1NSL A;  4HKF A;  4A95 A;  4CAX A;  2JBJ A;  2R7H A;  4AVB A;  2QVP A;  4XNH B;  4XPD C;  2DXQ A;  4XPK A;  4CAV A;  1ZO0 A;  6CPA A;  2G3A A;  4TWE A;  4R7M A;  3BI1 A;  4R9M A;  4P6Y A;  1Z4R A;  1CP6 A;  4KOW A;  4MFK A;  4UEE A;  3CT9 A;  3IU1 A;  1XJO A;  4F9U A;  3S9M A;  2GIV A;  5DS0 A;  2GFQ A;  1Y0R A;  4F6A A;  2V8H A;  4QVT A;  4B5P A;  1IOF A;  1JQG A;  4UFX A;  4Y49 B;  4JJX A;  3PFO A;  1X12 A;  3JRU A;  2YNE A;  4JZ0 A;  3KQZ A;  4X3R A;  3CPA A;  4MY0 A;  5G20 A;  2HC9 A;  3CZX A;  4MFQ A;  4E0A A;  2A4N A;  4MHZ A;  2FIA A;  2R1I A;  1LCP A;  3K2K A;  2Z3P A;  5HVF A;  4KOU A;  4XPL A;  4UFV A;  4E8O A;  4NGN A;  5J1Q A;  3N7Z A;  5BWA B;  4M6G A;  5HMN A;  3W91 A;  1QSN A;  2WPX A;  1XIX A;  2ZEL A;  4KOX A;  4MHD A;  1AMP A;  1Q2D A;  4OC2 A;  4UF4 A;  4MFL A;  2ZOF A;  4UA3 A;  3KGQ A;  1S7F A;  4HNY B;  2QML A;  4XNH C;  2WSA A;  4FD4 A;  4OC3 A;  4TNU A;  4QBJ A;  1XF8 A;  3UY5 A;  1QSM A;  4M6I A;  8CPA A;  3RNZ A;  5KTA A;  1ON0 A;  1ZLH A;  4IAV A;  4MHN A;  4A32 A;  2NYQ A;  2D4P A;  2QJ8 A;  4K3N A;  1F2P A;  3D7D A;  1Y9W A;  2AFZ A;  1ELM P;  2Z0Z A;  1P0H A;  2DPS A;  1VIX A;  4A30 A;  4BD9 A;  5IX3 A;  4Y49 C;  4IF5 A;  4P4B A;  3NH4 A;  1NMT A;  3QAY A;  2BEI A;  1Y7R A;  2ZW6 A;  2ZXV A;  2NMT A;  4YU9 A;  1BAV A;  2CXA A;  2Q0Y A;  2ABZ A;  1S7N A;  2G3T A;  3E0K A;  1EE3 P;  2C6P A;  3QB8 A;  4KVX A;  4MJ8 A;  1IYK A;  1Z8T A;  3I3G A;  4PV6 A;  4A94 A;  2QIR A;  1VHE A;  2BUE A;  5JH9 A;  1CJW A;  2G9D A;  1VKC A;  1GYT A;  3KR5 A;  4ZBG A;  3CDX A;  3EY5 A;  4H6Z A;  3LMS A;  1ELL P;  3KZW A;  2PRQ A;  5AG7 A;  4IHM A;  1TKJ A;  2FXF A;  4A37 A;  1OBR A;  5ISV A;  3FXT A;  1KUV A;  3D8P A;  3SJF A;  1Z8L A;  3FYN A;  1LFW A;  4UIA A;  4AVC A;  1VGY A;  2J8R A;  2CIJ A;  2B3U A;  1I1D A;  1J4J A;  4MI4 A;  3H4Q A;  3LAC A;  1TF9 A;  3QNV A;  1S3Z A;  3K9T A;  4MHY A;  2IJZ A;  5AG6 A;  3JVN A;  1YSJ A;  1R43 A;  3KHX A;  2ODF A;  5EBV A;  3B8G A;  3IFE A;  5ELY A;  3T9Y A;  1IOI A;  4KSF A;  5AGE A;  4CYQ A;  5I4M A;  3NA6 A;  3LOD A;  2FL4 A;  5J8F A;  3FBU A;  5G21 A;  4OC5 A;  2X7B A;  3D66 A;  2PRB A;  4C7H A;  2CNT A;  3PB4 X;  5F48 A;  2B3V A;  2QYV A;  4CS0 B;  5DWN A;  3S6G A;  2F7V A;  4KVM E;  1XEB A;  2PJ4 A;  2B4D A;  4KOT A;  4KSA A;  1LRZ A;  3D7H A;  4K30 A;  4P4D A;  4YRH A;  2WYR A;  4ZX9 A;  3IWW A;  3EFA A;  3WC6 A;  2C6C A;  2ZOG A;  2P6E A;  4HNX B;  1K4J A;  2FE7 A;  4FD7 A;  5IV0 A;  2VXK A;  4CYO A;  2IQ6 A;  4MCR A;  4OME A;  3JUW A;  4UFW A;  5JM6 A;  3WT4 A;  4AG9 A;  3BXM A;  2V8V A;  1I21 A;  3PP9 A;  4Q38 A;  2OZH A;  1SQH A;  5CPA A;  5DWM A;  1HEE A;  2EK9 A;  2Q44 A;  2XEG A;  2Z3K A;  3HLP A;  3MRU A;  4XPD B;  3V7Z A;  3RO0 A;  5C82 A;  1Z2L A;  3RAM A;  3SXN A;  3CPX A;  2PJ5 A;  3EO4 A;  1B87 A;  3FIX A;  5LRK A;  3P2H A;  4EME A;  4C2Z A;  4NF1 A;  4UEZ A;  4CYP A;  1YLO A;  2CTB A;  2XEJ A;  1BLL E;  3FMC A;  3WC5 A;  2ZEE A;  1KUX A;  4BIN A;  3JTK A;  4C2Y A;  5HXD A;  4P10 A;  1VHS A;  2Q4Y A;  3B2Y A;  1Q2Y A;  3D3S A;  3PEI A;  1WWZ A;  3PBE A;  2YND A;  2Q7S A;  3KHZ A;  3LWU A;  4CGN A;  3BLN A;  2ZEO A;  4RN7 A;  4JLY A;  2YNC A;  2ATR A;  3PRT A;  1KUY A;  4JXQ A;  3SJE A;  3KAS A;  1S5K A;  1CPS A;  2AFO A;  3BJ8 A;  4U5Y A;  1PUA A;  1N71 A;  2IL4 A;  3DLJ A;  4KUA A;  2OZG A;  4DYO A;  1MJA A;  5JPH A;  2Z3N A;  2O4H A;  4YGO A;  3TO6 A;  1YQE A;  2GAN A;  2PVV A;  2ZPA A;  4A31 A;  1HDU A;  5K8O A;  3BHX A;  3GYA A;  2Q43 A;  2BL1 A;  2PQ8 A;  4LUA A;  4ONU A;  4P4I A;  4RUH A;  5F09 A;  4MFZ A;  2WZN A;  2PR8 A;  2FS5 A;  3PFE A;  2PJ1 A;  4IK2 A;  1CG2 A;  4FBE A;  1YK3 A;  1MJ9 A;  2Q4V A;  1IB1 E;  1XMB A;  4AXV A;  2Z11 A;  4WJB A;  1IY7 A;  4P4F A;  5J8C A;  2BCO A;  5EC4 A;  4X2T A;  3IIB A;  1PCA A;  4U9Y A;  4CYN A;  3TOA A;  2AFS A;  1CP7 A;  1XFO A;  2C1C A;  4UIB A;  3LD2 A;  1ZG8 A;  5THW A;  1V0C A;  1M4I A;  1Z8W A;  3PBB A;  4YWY A;  5AG4 A;  2BO9 A;  4PQA A;  1MK4 A;  1RO5 A;  2ZW5 A;  3S6F A;  2O53 A;  4Z65 A;  2ZEP A;  3KKW A;  4GXH A;  3VAT A;  1YW6 A;  1BOB A;  2P6G A;  3N5F A;  4R76 A;  3BJ7 A;  4ZY1 A;  2WPW A;  4H2K A;  2Z3L A;  4WWV A;  5HVH A;  1ARL A;  2B4B A;  4PPZ A;  4B5P B;  3V8I A;  4MY3 A;  3ZZI A;  1H8L A;  4MFJ A;  1LOK A;  4UCP A;  4F8Z A;  2ZEG A;  3GY9 A;  3FJU A;  2CY2 A;  4NGT A;  3R9G A;  3R96 A;  4EFD A;  2HV2 A;  4II9 A;  1DTD A;  1PU9 A;  3H8E A;  3F5B A;  4C2X A;  4PSX A;  4RI1 A;  4LX9 A;  3S6K A;  4OC0 A;  4UCM A;  2J8N A;  1Z4E A;  1P4N A;  3CXQ A;  4A2Z A;  1NE9 A;  1Y9K A;  2JDC A;  4R3L A;  4HPS A;  4H89 A;  4CAF A;  5KTC A;  4DJL A;  3R9E A;  4KVO E;  5EMI A;  2ARH A;  4HNW B;  4MMO A;  3L2N A;  4JYW A;  1TXR A;  2RB7 A;  3SI0 A;  3VAR A;  5K8P A;  3GKR A;  4R57 A;  1B6B A;  1S60 A;  1XBU A;  1YVK A;  2OU2 A;  4W9Y A;  1KZF A;  2HQY A;  1YME A;  2ZEM A;  3FEC A;  4PXD A;  2H5M A;  3DR6 A;  4KSI A;  5K8N A;  1IYL A;  4QUS A;  3IGR A;  4OKO A;  4UWJ A;  3GIU A;  4NEX A;  1BPM A;  2Z10 A;  3GLJ A;  5G22 A;  2ZW7 A;  3RBU A;  1YLE A;  3EXN A;  4KLV A;  4A39 A;  1Y7E A;  2BSW A; 
#chains in the Genus database with same CATH homology
 1S7L A;  3W6X A;  1GHE A;  2VBQ A;  2D4O A;  4R3K A;  4KUB A;  4AVA A;  3DNS A;  1XE4 A;  3D2P A;  4B13 A;  4FD5 A;  4X5K A;  2DPT A;  3DR8 A;  4AB7 A;  2PR1 A;  2HUZ A;  1U6M A;  5GCN A;  5H86 A;  4CGM A;  4CAW A;  2VEZ A;  4M85 A;  4CAE A;  3P2F A;  4C7I A;  2PDO A;  3R1K A;  4M3S A;  4NXY A;  4OAE A;  3FNC A;  2FIW A;  2REE A;  3VWD A;  4L8A A;  4JD6 A;  3CXP A;  3RYO A;  2B4D B;  4ORF A;  4KOV A;  2B5G B;  2Y0M A;  2PSW A;  2R98 A;  1RXT A;  2B58 A;  2C27 A;  4R87 A;  2VQY A;  3S6H A;  4PK3 A;  5HH1 A;  2Q04 A;  4L89 A;  2OZU A;  3TTH A;  3PGP A;  1M1D A;  4A33 A;  3K9U A;  4KOY A;  4B14 A;  5CNP A;  2Z3O A;  3CXS A;  4PK2 A;  3FB3 A;  3TT2 A;  2AJ6 A;  1XMT A;  2CNS A;  2PC1 A;  3WR7 A;  3TO9 A;  4B10 A;  4Q36 A;  5C88 A;  4KS9 A;  4MFP A;  4CRZ B;  1OZP A;  5H84 A;  3PZJ A;  3G3S A;  2Z3M A;  2J8M A;  4QC6 A;  1TIQ A;  3VWE A;  4BMH A;  5KTD A;  5F46 A;  3TFY A;  4AG7 A;  3D2M A;  1M4D A;  4FD6 A;  1CM0 A;  4CGP A;  2VZZ A;  2JEV A;  4DNC A;  2FSR A;  2O28 A;  3DDD A;  1FY7 A;  3A9L A;  2I00 A;  4BBH A;  4ZGY B;  1WK4 A;  4F0X A;  3SHP A;  4MBU A;  5AG5 A;  3T90 A;  1S7K A;  2YNC C;  1R57 A;  4F0Y A;  2F5I A;  5JQ4 A;  4UBR A;  1M4G A;  4RS2 A;  2JLM A;  2JDD A;  4EVY A;  1YX0 A;  2EVN A;  5A28 A;  1YR0 A;  3IWE A;  2FCK A;  1UFH A;  3IU2 A;  2P6F A;  3IWG A;  2CNM A;  2I79 A;  4NCZ A;  4I49 A;  3W6S A;  2K5T A;  1YGH A;  1L0C A;  3R95 A;  2P0W A;  1IID A;  3F0A A;  5G1Z A;  3G8W A;  2KCW A;  3QAH A;  2R8V A;  3H5Z A;  3I9S A;  4KOR A;  4NSQ A;  3TOB A;  2YGW A;  5FVJ A;  1YVO A;  4QB9 A;  5E96 A;  3C26 A;  1I12 A;  4IUS A;  5I0C A;  2OB0 A;  1M44 A;  3F8K A;  3DSB A;  1IIC A;  3MGD A;  4KLW A;  4UCN A;  2WUU A;  4OAD A;  4CGO A;  1MJB A;  1BO4 A;  2VI7 A;  4B11 A;  2Q7B A;  4JWP A;  2QEC A;  4CRY B;  2GE3 A;  2B5G A;  3TO7 A;  3R9F A;  5F47 A;  1QST A;  4E2A A;  2AE6 A;  4GS4 A;  4JXR A;  4B5O A;  2REF A;  1QSO A;  4B12 A;  3OWC A;  4U9Z A;  3ZJ0 A;  1YRE A;  5F49 A;  2FT0 A;  2G0B A;  4KOS A;  2VZY A;  2OH1 A;  4CGL A;  1QSR A;  3FRM A;  3EC4 A;  5IB0 A;  1Z9U A;  5A27 A;  4H6U A;  2ZW4 A;  4J3G A;  2EUI A;  4C68 A;  3NE7 A;  3TE4 A;  3TCV A;  4PSW A;  4KZT A;  4OLL A;  4UWI A;  3SXO A;  4YFJ A;  2RC4 A;  1Q2C A;  1NSL A;  4HKF A;  4A95 A;  4CAX A;  2R7H A;  4AVB A;  4XNH B;  4XPD C;  2DXQ A;  4XPK A;  4CAV A;  1ZO0 A;  2G3A A;  4R9M A;  1Z4R A;  4KOW A;  4MFK A;  3IU1 A;  2GIV A;  4F6A A;  4QVT A;  4B5P A;  4Y49 B;  4UFX A;  4JJX A;  2YNE A;  5G20 A;  4MY0 A;  4MFQ A;  4E0A A;  2A4N A;  2FIA A;  2R1I A;  2Z3P A;  4KOU A;  4XPL A;  4UFV A;  4E8O A;  3N7Z A;  5BWA B;  5HMN A;  3W91 A;  1QSN A;  2WPX A;  1XIX A;  4KOX A;  4MHD A;  1Q2D A;  4MFL A;  4XNH C;  4UA3 A;  1S7F A;  4HNY B;  2QML A;  2WSA A;  4FD4 A;  4QBJ A;  1XF8 A;  3UY5 A;  1QSM A;  5KTA A;  1ON0 A;  4A32 A;  2D4P A;  1Y9W A;  2Z0Z A;  1P0H A;  2DPS A;  4A30 A;  5IX3 A;  4Y49 C;  4IF5 A;  1NMT A;  2BEI A;  1Y7R A;  2ZW6 A;  2ZXV A;  2NMT A;  2CXA A;  2Q0Y A;  3E0K A;  1S7N A;  2G3T A;  3QB8 A;  4MJ8 A;  4PV6 A;  4KVX A;  1IYK A;  3I3G A;  2QIR A;  2BUE A;  1CJW A;  1VKC A;  4ZBG A;  3EY5 A;  4H6Z A;  5AG7 A;  2FXF A;  5ISV A;  3FXT A;  1KUV A;  3D8P A;  3FYN A;  4AVC A;  2J8R A;  2B3U A;  1I1D A;  1J4J A;  4MI4 A;  3H4Q A;  1S3Z A;  5AG6 A;  3JVN A;  5EBV A;  3T9Y A;  3V8I A;  3B8G A;  4CYQ A;  4KSF A;  5AGE A;  3LOD A;  2FL4 A;  5J8F A;  3FBU A;  5G21 A;  2X7B A;  2PRB A;  4C7H A;  2CNT A;  5F48 A;  4CS0 B;  2B3V A;  5DWN A;  3S6G A;  4KVM E;  1XEB A;  4KOT A;  2B4D A;  4KSA A;  1LRZ A;  4K30 A;  4YRH A;  3EFA A;  2P6E A;  4HNX B;  1K4J A;  2FE7 A;  4FD7 A;  5IV0 A;  2VXK A;  4CYO A;  4UFW A;  3JUW A;  4AG9 A;  1I21 A;  3PP9 A;  4Q38 A;  2OZH A;  1SQH A;  5DWM A;  4A2Z A;  2Q44 A;  2Z3K A;  4XPD B;  5C82 A;  3SXN A;  3EO4 A;  1B87 A;  3FIX A;  3P2H A;  4C2Z A;  4NF1 A;  4CYP A;  4C2Y A;  1KUX A;  3JTK A;  1VHS A;  2Q4Y A;  1Q2Y A;  3D3S A;  1WWZ A;  2YND A;  4CGN A;  3BLN A;  4JLY A;  2YNC A;  2ATR A;  1KUY A;  4JXQ A;  1S5K A;  3BJ8 A;  4U5Y A;  1PUA A;  1N71 A;  2IL4 A;  4KUA A;  2OZG A;  1MJA A;  5JPH A;  2Z3N A;  4YGO A;  3TO6 A;  2GAN A;  2ZPA A;  4A31 A;  3GYA A;  2BL1 A;  2PQ8 A;  4LUA A;  4ONU A;  4MFZ A;  2PR8 A;  2FS5 A;  1YK3 A;  1MJ9 A;  2Q4V A;  1IB1 E;  2Z11 A;  5J8C A;  5EC4 A;  4U9Y A;  4CYN A;  3TOA A;  3LD2 A;  1V0C A;  1M4I A;  5AG4 A;  1RO5 A;  1MK4 A;  2ZW5 A;  3S6F A;  3KKW A;  1BOB A;  2P6G A;  3BJ7 A;  2WPW A;  2Z3L A;  2B4B A;  4B5P B;  4MY3 A;  3ZZI A;  4MFJ A;  4UCP A;  3GY9 A;  2CY2 A;  3R9G A;  3R96 A;  2HV2 A;  4II9 A;  1PU9 A;  3F5B A;  4C2X A;  4PSX A;  4RI1 A;  4LX9 A;  3S6K A;  4UCM A;  2J8N A;  1Z4E A;  1P4N A;  3CXQ A;  1NE9 A;  1Y9K A;  2JDC A;  4R3L A;  4H89 A;  4CAF A;  5KTC A;  3R9E A;  4KVO E;  2ARH A;  4HNW B;  3GKR A;  4R57 A;  1B6B A;  1S60 A;  1YVK A;  2OU2 A;  1KZF A;  2HQY A;  2H5M A;  3DR6 A;  1IYL A;  4QUS A;  3IGR A;  4UWJ A;  4NEX A;  2Z10 A;  5G22 A;  2ZW7 A;  1YLE A;  3EXN A;  4KLV A;  2BSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...