2JLMA

Structure of a putative acetyltransferase (aciad1637) from acinetobacter baylyi adp1
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
177
structure length
177
Chain Sequence
TTTLFRFVECTEDQHALEILEILNDAIINSTALYDYKPRSKESMAAWFATKRQNNFPIIGAVNEVGQLLGFASWGSFRAFPAYKYTVEHSVYIHKDYRGLGLSKHLMNELIKRAVESEVHVMVGCIDATNVASIQLHQKLGFIHSGTIQQAGFKFGRWLDAAFYQLTLDTPLHPQDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE PHOSPHINOTHRICIN N-ACETYLTRANSFERASE
publication title Structure and Substrate Specificity of Acetyltransferase Aciad1637 from Acinetobacter Baylyi Adp1.
pubmed doi rcsb
source organism Acinetobacter baylyi
molecule tags Transferase
total genus 46
structure length 177
sequence length 177
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2jlmA00
2A4NA 2BL1A 2J8NA 4CS0B 2KCWA 4XPDC 1YK3A 3FIXA 1BOBA 4FD6A 2P6EA 3CXSA 4QUSA 3FRMA 3TOBA 2VEZA 3G3SA 4F0YA 3TE4A 2F5IA 1QSMA 3TTHA 3OWCA 2OH1A 4R3KA 2JDCA 1MJ9A 4NEXA 3DNSA 5GCNA 3GYAA 2PR1A 3CXPA 1YGHA 4CRYB 2G0BA 1FY7A 2ZW4A 1VKCA 3EXNA 1QSNA 4PV6A 3FBUA 3V8IA 1YVOA 3CXQA 3GY9A 4M85A 3DSBA 4I49A 2FIWA 2J8RA 2ZW6A 3I3GA 5JPHA 4UA3A 2AE6A 4UWIA 1PUAA 4EVYA 2R98A 1VHSA 3G8WA 1YR0A 1YVKA 2GE3A 4IUSA 4H6UA 1QSRA 3TO6A 3T9YA 1L0CA 2RC4A 2OB0A 1S7LA 4LUAA 1NMTA 2FE7A 1Q2CA 3P2HA 1RO5A 2C27A 4F6AA 3S6KA 2O28A 4R3LA 4QB9A 3SXNA 4XPDB 3FYNA 1Z9UA 1P0HA 3KKWA 4ONUA 5DWNA 1IB1E 4KOYA 3W6SA 4U9ZA 1S7NA 3W6XA 4JWPA 3P2FA 3S6HA 2B4DA 3DDDA 4CAXA 1CM0A 2REFA 2Q4VA 3N7ZA 4QVTA 2P0WA 2OZGA 3SXOA 2Y0MA 4YFJA 5H86A 2ZW7A 4JLYA 1CJWA 4AVBA 4MY0A 2JEVA 1ON0A 2R7HA 2Z10A 1QSTA 2D4PA 1XIXA 5J8FA 5JQ4A 4KOTA 1B87A 1MJAA 1I12A 4FD5A 2B5GB 4K30A 2FL4A 4CRZB 3DR8A 5C88A 1WK4A 4E2AA 2FCKA 2VZZA 3TO7A 4RI1A 1QSOA 4GS4A 4MJ8A 1N71A 4NXYA 4H89A 2NMTA 2WPXA 5FVJA 2VBQA 3JUWA 4FD7A 2OU2A 3BJ7A 1M1DA 5HH1A 1SQHA 1IIDA 2J8MA 4BMHA 2QECA 1J4JA 1I21A 4B5OA 3PP9A 3K9UA 3SHPA 2ZXVA 2PDOA 3IWGA 5C82A 1Z4RA 3S6FA 1S7KA 4KLVA 3FNCA 4ORFA 2AJ6A 4H6ZA 4DNCA 3NE7A 1R57A 4II9A 3C26A 5EBVA 3FXTA 4X5KA 2PC1A 5IX3A 2BEIA 2G3TA 1IYLA 3R1KA 4KOSA 1XE4A 3EY5A 4KZTA 1KUYA 1KUVA 1RXTA 3EO4A 1U6MA 3R96A 4E8OA 3LODA 1V0CA 3F5BA 2EVNA 1YX0A 3TCVA 4KOXA 5F46A 4AG7A 2ZPAA 3EC4A 2PRBA 3F0AA 3BLNA 1MJBA 1PU9A 2Q04A 2QMLA 5J8CA 5ISVA 2ATRA 4JXQA 4KOUA 3B8GA 2PQ8A 5KTAA 2CNMA 4NSQA 4HNYB 3D2MA 4E0AA 3PZJA 1YLEA 1P4NA 4R57A 3MGDA 2Z11A 5DWMA 2GIVA 2R1IA 3RYOA 4UBRA 2EUIA 4QC6A 2B3UA 1S3ZA 3LD2A 1K4JA 3ZJ0A 2VI7A 2ARHA 4XNHB 2FT0A 4KVXA 4NF1A 3ZZIA 2CNTA 2JDDA 4B5PB 3D3SA 4CAVA 3PGPA 3VWEA 4AVAA 5KTCA 4U9YA 1XF8A 4MY3A 2VZYA 2GANA 4MI4A 2REEA 4PK2A 4R9MA 2FSRA 3TOAA 4L8AA 2CY2A 2OZHA 2B5GA 5E96A 4PK3A 3WR7A 2CNSA 5H84A 2K5TA 1B6BA 1M4IA 1Z4EA 1NE9A 3T90A 4Y49B 1YREA 2VQYA 5KTDA 4HKFA 4M3SA 4QBJA 3R9EA 1XMTA 2HV2A 4KORA 4OADA 5EC4A 4OLLA 2BUEA 1XEBA 4OAEA 5HMNA 2Q7BA 3D8PA 4HNWB 4KOVA 2X7BA 4UWJA 4XNHC 2P6FA 4KLWA 4NCZA 1GHEA 5F48A 5F49A 1WWZA 2Q4YA 4JXRA 4YRHA 4KOWA 1Y7RA 4KVME 2I79A 1S7FA 4XPKA 2FS5A 2I00A 1Y9WA 3S6GA 2P6GA 2FIAA 2H5MA 2WPWA 4AB7A 5CNPA 3TT2A 3R95A 3E0KA 4KVOE 2Q44A 1MK4A 4IF5A 2BSWA 3I9SA 3R9GA 2B4BA 2OZUA 4MHDA 1Y9KA 1Q2DA 4Y49C 1I1DA 5F47A 1IYKA 3FB3A 4ZBGA 1TIQA 2PR8A 4CAWA 2QIRA 2R8VA 4MBUA 2B4DB 1KUXA 4JJXA 3IGRA 2PSWA 4FD4A 3UY5A 3VWDA 2D4OA 1M4DA 4AG9A 4HNXB 2DXQA 5IV0A 2ZW5A 1LRZA 1S60A 1S5KA 1UFHA 2Q0YA 4JD6A 4KUAA 3F8KA 4J3GA 2VXKA 3QB8A 3DR6A 5IB0A 1BO4A 4XPLA 3EFAA 1Q2YA 1M4GA 1NSLA 1KZFA 3JVNA 4LX9A 2HUZA 2G3AA 4PSWA 4R87A 3TO9A 3W91A 2B58A 2IL4A 1IICA 3H4QA 4RS2A 5I0CA 2Z0ZA 3TFYA 4L89A 4B5PA 4YGOA 2JLMA 3R9FA 3GKRA 1M44A 4KUBA 3BJ8A 1OZPA 2HQYA 4PSXA 3QAHA 2B3VA 4AVCA 3D2PA 4U5YA 2FXFA
chains in the Genus database with same CATH superfamily
2A4NA 2BL1A 2J8NA 3L2NA 4CS0B 3D4UA 2KCWA 3K9TA 4XPDC 1YK3A 2PJ1A 3FIXA 4MFZA 2IQ6A 4UCMA 4X8IA 4IHMA 1BOBA 3BXMA 4FD6A 4ONWA 5G20A 1TKHA 2Z3NA 3S9MA 3PB4X 2P6EA 3CXSA 4HPSA 3FRMA 4QUSA 3TOBA 1VIXA 2VEZA 3B3CA 3KHXA 2F7VA 3G3SA 4F0YA 3TE4A 2F5IA 2IMOA 1DE4C 1QSMA 3TTHA 4YU9A 3OWCA 2OH1A 1PCAA 2JDCA 1MJ9A 4R3KA 1Y7EA 1Z8WA 3PBEA 3GIUA 4NEXA 3DNSA 4NGNA 5GCNA 3GYAA 3VARA 3D7DA 2PR1A 1ZLIA 2GLFA 3CXPA 4KSIA 2XEJA 2JBKA 3GUXA 1YGHA 4P4BA 2G0BA 1FY7A 1F2OA 1VKCA 1LCPA 2ZW4A 3EXNA 4CRYB 1QSNA 1HEEA 4P4DA 4OIWA 5BWAB 4MHPA 1X10A 4NGQA 4PV6A 4UEEA 3WABA 3FBUA 3V8IA 5AG5A 1YVOA 3CT9A 3CXQA 3GY9A 4M85A 4F9UA 4NFRA 3DSBA 4I49A 2FIWA 5A27A 2J8RA 2ZW6A 1AUGA 3I3GA 5HVHA 5JPHA 4UA3A 3V38A 5I4MA 2AE6A 4UWIA 3QAYA 1PUAA 5LRJA 4EVYA 2ZENA 2R98A 4Q7AA 1RTQA 1CPXA 1VHSA 3PBBA 5G1ZA 4C68A 2F8HA 3GLJA 1CX8A 3G8WA 4NJQA 4NJRA 1YR0A 1YVKA 4MHNA 4C2XA 1CP6A 3B2YA 4F9VA 3IO1A 2GE3A 4IUSA 4H6UA 1QSRA 3TO6A 4A95A 2ZELA 4FUUA 4JZ0A 3T9YA 3HUVA 1R43A 2DF5A 2ZEPA 3BHXA 1YMEA 1L0CA 2POKA 1ZG7A 2RC4A 2OB0A 1S7LA 4NGTA 4P10A 4R76A 5LRGA 4M6HA 4Q36A 4LUAA 1NSAA 2JBJA 1NMTA 2FE7A 5HXDA 1Q2CA 1LAPA 3P2HA 1RO5A 2C27A 4F6AA 1TXRA 3S6KA 2O28A 4MHYA 4QB9A 4R3LA 3SXNA 4ZX9A 2Z3LA 3IWEA 4XPDB 3FYNA 1KWMA 3D66A 1Z9UA 2PJ3A 4CPAA 4CGLA 1P0HA 3KKWA 5D29A 4PXBA 4ONUA 5DWNA 3FEDA 1IB1E 2GLJA 2OOTA 1AYEA 4M6GA 4YWYA 2C1CA 4KOYA 4P4EA 3W6SA 2AFOA 4U9ZA 4TNUA 2DPSA 1S7NA 3W6XA 5LYLA 4JWPA 2HB6A 3GB0A 3P2FA 4IK2A 3S6HA 2B4DA 4MFQA 2BCOA 2Q51A 4UCPA 3SI0A 4B12A 4OC3A 2PJ2A 3DDDA 1ARMA 4P45A 1CM0A 4CAXA 2REFA 2Q4VA 3N7ZA 1Z8LA 3FX6A 2ABZA 4QVTA 3NH8A 3VH9A 2P0WA 2OZGA 4UFVA 3SXOA 2Y0MA 1XOVA 4YFJA 3FF3A 4ZY2A 5H86A 3IU1A 2ODFA 2ZW7A 4JLYA 1CJWA 5LYIA 4JYWA 4AVBA 3FECA 4MY0A 4OC1A 2JEVA 1ON0A 2R7HA 2Z10A 1QSTA 2D4PA 1XIXA 4BD9A 5J8FA 5JQ4A 2C6GA 4KOTA 1ZG9A 1B87A 1MJAA 1BAVA 4A32A 1TF8A 1I12A 4FD5A 4OC4A 4C7IA 2B5GB 4K30A 2FL4A 4CGPA 3NH4A 4CRZB 3DR8A 3IC1A 4CYNA 3KR5A 1IOFA 3K2KA 5C88A 1WK4A 4MMOA 4E2AA 2V77A 4RN7A 2FCKA 4IAVA 4C2ZA 3CPAA 4UFXA 4R7MA 2VZZA 3SJFA 3TO7A 2AFUA 3H5ZA 2ZEDA 4RI1A 2PJ4A 4CYPA 3H8GA 4MCSA 1QSOA 1HDUA 4GS4A 4OKOA 1JWQA 3SI1A 4MJ8A 5IB9A 2PJ8A 1N71A 4NXYA 4OC2A 1TKFA 4H89A 4P4FA 2NMTA 2WPXA 3D7GA 5JH9A 5FVJA 4OC5A 1IOIA 1M4LA 2VBQA 3JUWA 4FD7A 2OU2A 3BJ7A 1M1DA 2AFSA 2DPTA 5HH1A 5G21A 4MFPA 3RNZA 4Z65A 4DJLA 3S9NA 2BOAA 1SQHA 1IIDA 2J8MA 3HLPA 2O53A 4BMHA 2QECA 2Q7SA 5D8NA 4R6TA 1J4JA 4P4JA 1I21A 4B5OA 3PP9A 3K9UA 1YW6A 4EWTA 3SHPA 3WC5A 2ZOFA 1VHEA 2ZXVA 2PDOA 3IWGA 5C82A 4DUKA 1UWYA 3JRUA 5K8PA 1Z4RA 4MCQA 3KGQA 1Q7LA 2V8GA 3S6FA 1S7KA 4FWUA 4KLVA 4F8ZA 3NH5A 3FNCA 4ORFA 2AJ6A 4H6ZA 4DNCA 3LWUA 4B13A 3RZAA 3NE7A 2CTBA 3LMSA 4X3RA 1R57A 4II9A 3C26A 4MFJA 3FXTA 4X5KA 5EBVA 2PRQA 2PC1A 4FBEA 3IFEA 5IX3A 2BEIA 2G3TA 3CPXA 1LANA 3PB9X 1IYLA 1OBRA 3R1KA 4KOSA 1XE4A 3EY5A 4KZTA 4R8FA 2XEIA 1KUYA 1KUVA 1RXTA 4H2KA 3B3TA 2Q43A 3D68A 5THWA 4A94A 5F09A 5AG4A 1YW4A 1ELLP 1ZLHA 1U6MA 3EO4A 3R96A 2V8VA 4E8OA 5K8OA 3LODA 1V0CA 1YSJA 3F5BA 3IU2A 5K8MA 3KHZA 4CGMA 2EVNA 1YX0A 2WYRA 4B11A 4A37A 2YNDA 3B3WA 3I1UA 3TCVA 1LAMA 3MRUA 4KOXA 5G22A 2YNEA 5F46A 2PIYA 4AG7A 2ZPAA 1ZG8A 3EC4A 2ZOGA 2PRBA 1F57A 3F0AA 3BLNA 1Y0YA 3PFOA 1MJBA 2V8HA 1EE3P 1YQEA 1R3NA 2AFZA 1BPMA 1PU9A 2Q04A 2QMLA 4CYOA 5J8CA 2CTCA 3WC6A 2Z3PA 4Q38A 5EMIA 4CAEA 5ISVA 1ZO0A 2ATRA 4B10A 4JXQA 5A28A 4KOUA 2EWBA 1FNOA 1BPNA 2PVWA 3B8GA 3TC8A 2PQ8A 5KTAA 2CNMA 4PPZA 4NSQA 2J9AA 5LYDA 4HNYB 4F0XA 3D2MA 2WUUA 4E0AA 1TF9A 1XRYA 2QYVA 3IIBA 3PZJA 4AXVA 2Z3KA 2BO9A 4ZY0A 1YLEA 4UFWA 1P4NA 4LQ6A 4ZY1A 4R57A 3MGDA 2Z11A 5DWMA 2GIVA 1Z8TA 4MHZA 4KS9A 1IGBA 2R1IA 3IWWA 2O4HA 3FEEA 4MCPA 5AGEA 3RYOA 3FVLA 4UBRA 4BINA 2EUIA 2PJ9A 3B35A 5AG6A 3H8FA 2CIJA 4QC6A 1Z5RA 4PXEA 2B3UA 1S3ZA 2FVGA 3LD2A 4MFKA 2ZEHA 1A2ZA 1K4JA 4EMEA 2RFHA 3N5FA 1IY7A 2ARHA 2VI7A 2FT0A 4KVXA 4XNHB 4NF1A 3ZJ0A 3ZZIA 2CNTA 2JDDA 4MCRA 4B5PB 3D3SA 2HC9A 2PJ5A 1PYTB 2AFMA 2WSAA 4CAVA 3V7ZA 2EBJA 3PGPA 4ZI6A 3VWEA 5CPAA 4AVAA 4DYOA 1JQGA 2PVVA 4U9YA 5KTCA 1XF8A 4MY3A 3S9LA 3TX8A 1ELMP 2VZYA 2GANA 3KL9A 4MI4A 4NGPA 2XEFA 2I3CA 2REEA 1AMPA 4PK2A 4R9MA 2FSRA 2OR4A 4MFLA 3TOAA 4L8AA 3NFZA 4UEZA 3RBUA 2CY2A 4A33A 2OZHA 3QNVA 4NGRA 2B5GA 5E96A 1H8LA 4PK3A 3BI1A 1ARLA 3WR7A 2CNSA 2YNCC 5H84A 1QQ9A 2PIZA 4WWVA 3B3SA 2CXAA 4A38A 1FT7A 2K5TA 4P44A 6CPAA 1B6BA 3B7IA 1M4IA 1VGYA 1Z4EA 3FMCA 1NE9A 1GYTA 3JTKA 3PEIA 3T90A 4Y49B 2WZNA 1YREA 3WT4A 2VQYA 3FJUA 5KTDA 3VATA 3B3VA 3WC7A 4HKFA 4P6YA 4RUHA 4M3SA 4QBJA 3R9EA 4ZX8A 1XMTA 2HV2A 4KORA 4OADA 5EC4A 3SJGA 4KSAA 2V8DA 3ISZA 1Z8XA 4OLLA 3PB8X 2BUEA 5AG7A 1XEBA 4OAEA 1XMBA 5HMNA 4PXCA 2ZEMA 3D8PA 4HNWB 1XJOA 2Q7BA 4KOVA 4MXUA 2AFWA 2X7BA 1IU8A 4UWJA 4XNHC 1LFWA 1LOKA 2P6FA 2RB7A 4KLWA 3LACA 5HVFA 4NCZA 1GHEA 5F48A 1CPSA 2PJ7A 1WWZA 1Z2LA 2Q4YA 2ZEEA 1XFOA 4JXRA 4YRHA 5F49A 4OC0A 4KOWA 4KSFA 2JEWA 4UEFA 1Y7RA 1VHOA 4ZGYB 4KVME 1TKJA 5CBMA 2I79A 1S7FA 3MN8A 4XPKA 4FAIA 2C6PA 2FS5A 2XEGA 4UF4A 4CYQA 5LYFA 4K3NA 2EK9A 2I00A 1Y9WA 4B14A 3SI2A 3S6GA 2NYQA 2P6GA 4A2ZA 2FIAA 2H5MA 4NGSA 2WPWA 4B6ZA 3SJXA 1BLLE 4AB7A 2DEAA 4OP4A 3KQZA 5CNPA 1F2PA 3D7FA 2PJBA 3TT2A 3R95A 4G1PA 2IJZA 1CBXA 3A9LA 3PFEA 5K8NA 3E0KA 4KVOE 2Q44A 1MK4A 4IF5A 2BSWA 4OIDA 3I9SA 4A30A 3R9GA 2B4BA 2GREA 2OZUA 4GXHA 4MHDA 1Y9KA 5HVGA 4CAFA 3KZWA 1Q2DA 4Y49C 3T8WA 5ELYA 1I1DA 2ANPA 5F47A 1IYKA 3FB3A 4ZBGA 1TIQA 3D67A 4M6IA 2PR8A 4CAWA 5LRKA 2AFXA 2QIRA 2PJ0A 2R8VA 2PJ6A 2B4DB 2VL1A 1KUXA 4MBUA 4JJXA 4OMEA 4A39A 5JM6A 3IGRA 3BI0A 5J1QA 2PJAA 2PSWA 4FD4A 3KQXA 3PB6X 4PXDA 4CGNA 8CPAA 3UY5A 4O23A 3VWDA 1XBUA 2CF4A 2PJCA 2Q4ZA 4P4IA 2Z3OA 4NGMA 2D4OA 3FH4A 2YNCA 3RO0A 2GFQA 4LQGA 3PB7X 1M4DA 4A31A 4AG9A 4HNXB 2QVPA 2DXQA 4UIAA 5IV0A 2ZW5A 1LRZA 3IEHA 2PCUA 2Z3MA 1S60A 1S5KA 1UFHA 2Q0YA 4JD6A 4PQAA 4UCNA 5JGFA 4KUAA 2ZEOA 3F8KA 4J3GA 2VXKA 2G9DA 3KR4A 4MRIA 3KASA 3QB8A 1CP7A 3DR6A 3RAMA 5IB0A 2EK8A 4TWEA 1BO4A 4XPLA 3EFAA 2YGWA 1Q2YA 1X12A 1M4GA 3IJ3A 1NSLA 7CPAA 1KZFA 5DS0A 3D7HA 3H8EA 2C6CA 3NE8A 3DLJA 3JVNA 3CDXA 1DTDA 4LX9A 2HUZA 3SJEA 4GM5A 1QMUA 4X2TA 4EFDA 3PRTA 2G3AA 4PSWA 4ZYQA 4R87A 3TO9A 3W91A 2B58A 1CG2A 2GU2A 3CZXA 2IL4A 1IICA 1Y0RA 3H4QA 3KI9A 4CGOA 3DGVA 4BBHA 2EO8A 4RS2A 5I0CA 2Z0ZA 3TFYA 4L89A 3ISXA 4B5PA 4YGOA 2JLMA 2ZEFA 3R9FA 4UIBA 3GKRA 1M44A 4C7HA 4W9YA 4KUBA 3BJ8A 1OZPA 2HQYA 2QJ8A 4PSXA 4WJBA 3QAHA 2B3VA 2PE3A 1YLOA 2ZEGA 4AVCA 3D2PA 3NA6A 2NSMA 4U5YA 1HDQA 4C2YA 2FXFA
chains in the Genus database with same CATH topology
2A4NA 2BL1A 2J8NA 4CS0B 2KCWA 4XPDC 1YK3A 3FIXA 4MFZA 4UCMA 1BOBA 4FD6A 5G20A 2Z3NA 2P6EA 3CXSA 4QUSA 3FRMA 3TOBA 2VEZA 3G3SA 4F0YA 3TE4A 2F5IA 1QSMA 3TTHA 3OWCA 2OH1A 4R3KA 2JDCA 1MJ9A 4NEXA 3DNSA 5GCNA 3GYAA 2PR1A 3CXPA 1YGHA 4CRYB 2G0BA 1FY7A 2ZW4A 1VKCA 3EXNA 1QSNA 5BWAB 4PV6A 3FBUA 3V8IA 5AG5A 1YVOA 3CXQA 3GY9A 4M85A 3DSBA 4I49A 2FIWA 5A27A 2J8RA 2ZW6A 3I3GA 5JPHA 4UA3A 2AE6A 4UWIA 1PUAA 4EVYA 2R98A 1VHSA 5G1ZA 4C68A 3G8WA 1YR0A 1YVKA 4C2XA 2GE3A 4IUSA 4H6UA 1QSRA 3TO6A 4A95A 3T9YA 1L0CA 2RC4A 2OB0A 1S7LA 4Q36A 4LUAA 1NMTA 2FE7A 1Q2CA 3P2HA 1RO5A 2C27A 4F6AA 3S6KA 2O28A 4R3LA 4QB9A 3SXNA 2Z3LA 3IWEA 4XPDB 3FYNA 1Z9UA 4CGLA 1P0HA 3KKWA 4ONUA 5DWNA 1IB1E 4KOYA 3W6SA 4U9ZA 2DPSA 1S7NA 3W6XA 4JWPA 3P2FA 3S6HA 2B4DA 4MFQA 4UCPA 4B12A 3DDDA 4CAXA 4F0XA 1CM0A 2REFA 2Q4VA 3N7ZA 4QVTA 2P0WA 2OZGA 4UFVA 3SXOA 2Y0MA 4YFJA 5H86A 3IU1A 2ZW7A 4JLYA 1CJWA 4AVBA 4MY0A 2JEVA 1ON0A 2R7HA 2Z10A 1QSTA 2D4PA 1XIXA 5J8FA 5JQ4A 4KOTA 1B87A 1MJAA 4A32A 4C7IA 1I12A 4FD5A 2B5GB 4K30A 2FL4A 4CGPA 4CRZB 3DR8A 4CYNA 5C88A 1WK4A 4E2AA 2FCKA 4C2ZA 4UFXA 2VZZA 3TO7A 3H5ZA 4RI1A 4CYPA 1QSOA 4GS4A 4MJ8A 1N71A 4NXYA 4H89A 2NMTA 2WPXA 5FVJA 2VBQA 3JUWA 4FD7A 2OU2A 3BJ7A 1M1DA 2DPTA 5HH1A 5G21A 4MFPA 1SQHA 1IIDA 2J8MA 4BMHA 2QECA 1J4JA 1I21A 4B5OA 3PP9A 3K9UA 3SHPA 2ZXVA 2PDOA 3IWGA 5C82A 1Z4RA 3S6FA 1S7KA 4KLVA 3FNCA 4ORFA 2AJ6A 4H6ZA 4DNCA 4B13A 3NE7A 1R57A 4II9A 3C26A 4MFJA 3FXTA 4X5KA 5EBVA 2PC1A 5IX3A 2BEIA 2G3TA 1IYLA 3R1KA 4KOSA 1XE4A 3EY5A 4KZTA 1KUYA 1KUVA 1RXTA 5AG4A 3EO4A 1U6MA 3R96A 4E8OA 3LODA 1V0CA 3F5BA 3IU2A 4CGMA 2EVNA 1YX0A 4B11A 2YNDA 3TCVA 4KOXA 5G22A 2YNEA 5F46A 4AG7A 2ZPAA 3EC4A 2PRBA 3F0AA 3BLNA 1MJBA 1PU9A 2Q04A 2QMLA 4CYOA 5J8CA 2Z3PA 4Q38A 4CAEA 5ISVA 1ZO0A 2ATRA 4B10A 4JXQA 5A28A 4KOUA 3B8GA 2PQ8A 5KTAA 2CNMA 4NSQA 4HNYB 3D2MA 2WUUA 4E0AA 3PZJA 2Z3KA 1YLEA 4UFWA 1P4NA 4R57A 3MGDA 2Z11A 5DWMA 2GIVA 4KS9A 2R1IA 5AGEA 3RYOA 4UBRA 2EUIA 5AG6A 4QC6A 2B3UA 1S3ZA 4MFKA 3LD2A 1K4JA 3ZJ0A 2VI7A 2ARHA 4XNHB 2FT0A 4KVXA 4NF1A 3ZZIA 2CNTA 2JDDA 4B5PB 3D3SA 2WSAA 4CAVA 3PGPA 3VWEA 4AVAA 5KTCA 4U9YA 1XF8A 4MY3A 2VZYA 2GANA 4MI4A 2REEA 4PK2A 4R9MA 2FSRA 4MFLA 3TOAA 4L8AA 4A33A 2CY2A 2OZHA 2B5GA 5E96A 4PK3A 3WR7A 2CNSA 2YNCC 5H84A 2CXAA 2K5TA 1B6BA 1M4IA 1Z4EA 3JTKA 1NE9A 3T90A 4Y49B 1YREA 2VQYA 5KTDA 4HKFA 4M3SA 4QBJA 3R9EA 1XMTA 2HV2A 4KORA 4OADA 5EC4A 4KSAA 4OLLA 2BUEA 5AG7A 1XEBA 4OAEA 5HMNA 2Q7BA 3D8PA 4HNWB 4KOVA 2X7BA 4UWJA 4XNHC 2P6FA 4KLWA 4NCZA 1GHEA 5F48A 5F49A 1WWZA 2Q4YA 4JXRA 4YRHA 4KOWA 4KSFA 4ZGYB 1Y7RA 4KVME 2I79A 1S7FA 4XPKA 2FS5A 4CYQA 2I00A 1Y9WA 4B14A 3S6GA 2P6GA 4A2ZA 2FIAA 2H5MA 2WPWA 4AB7A 5CNPA 3TT2A 3R95A 3A9LA 3E0KA 4KVOE 2Q44A 1MK4A 4IF5A 2BSWA 3I9SA 4A30A 3R9GA 2B4BA 2OZUA 4MHDA 1Y9KA 4CAFA 1Q2DA 4Y49C 1I1DA 5F47A 1IYKA 3FB3A 4ZBGA 1TIQA 2PR8A 4CAWA 2QIRA 2R8VA 4MBUA 2B4DB 1KUXA 4JJXA 3IGRA 2PSWA 4FD4A 4CGNA 3UY5A 3VWDA 2Z3OA 2D4OA 2YNCA 1M4DA 4A31A 4AG9A 4HNXB 2DXQA 5IV0A 2ZW5A 1LRZA 2Z3MA 1S60A 1S5KA 1UFHA 2Q0YA 4JD6A 4UCNA 4KUAA 3F8KA 4J3GA 2VXKA 3QB8A 3DR6A 5IB0A 1BO4A 4XPLA 3EFAA 2YGWA 1Q2YA 1M4GA 1NSLA 1KZFA 3JVNA 4LX9A 2HUZA 2G3AA 4PSWA 4R87A 3TO9A 3W91A 2B58A 2IL4A 1IICA 3H4QA 4CGOA 4BBHA 4RS2A 5I0CA 2Z0ZA 3TFYA 4L89A 4B5PA 4YGOA 2JLMA 3R9FA 3GKRA 1M44A 4C7HA 4KUBA 3BJ8A 1OZPA 2HQYA 4PSXA 3QAHA 2B3VA 4AVCA 3D2PA 4U5YA 4C2YA 2FXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A4N A;  2BL1 A;  2J8N A;  4CS0 B;  2KCW A;  4XPD C;  1YK3 A;  3FIX A;  1BOB A;  4FD6 A;  2P6E A;  3CXS A;  4QUS A;  3FRM A;  3TOB A;  2VEZ A;  3G3S A;  4F0Y A;  3TE4 A;  2F5I A;  1QSM A;  3TTH A;  3OWC A;  2OH1 A;  4R3K A;  2JDC A;  1MJ9 A;  4NEX A;  3DNS A;  5GCN A;  3GYA A;  2PR1 A;  3CXP A;  1YGH A;  4CRY B;  2G0B A;  1FY7 A;  2ZW4 A;  1VKC A;  3EXN A;  1QSN A;  4PV6 A;  3FBU A;  3V8I A;  1YVO A;  3CXQ A;  3GY9 A;  4M85 A;  3DSB A;  4I49 A;  2FIW A;  2J8R A;  2ZW6 A;  3I3G A;  5JPH A;  4UA3 A;  2AE6 A;  4UWI A;  1PUA A;  4EVY A;  2R98 A;  1VHS A;  3G8W A;  1YR0 A;  1YVK A;  2GE3 A;  4IUS A;  4H6U A;  1QSR A;  3TO6 A;  3T9Y A;  1L0C A;  2RC4 A;  2OB0 A;  1S7L A;  4LUA A;  1NMT A;  2FE7 A;  1Q2C A;  3P2H A;  1RO5 A;  2C27 A;  4F6A A;  3S6K A;  2O28 A;  4R3L A;  4QB9 A;  3SXN A;  4XPD B;  3FYN A;  1Z9U A;  1P0H A;  3KKW A;  4ONU A;  5DWN A;  1IB1 E;  4KOY A;  3W6S A;  4U9Z A;  1S7N A;  3W6X A;  4JWP A;  3P2F A;  3S6H A;  2B4D A;  3DDD A;  4CAX A;  1CM0 A;  2REF A;  2Q4V A;  3N7Z A;  4QVT A;  2P0W A;  2OZG A;  3SXO A;  2Y0M A;  4YFJ A;  5H86 A;  2ZW7 A;  4JLY A;  1CJW A;  4AVB A;  4MY0 A;  2JEV A;  1ON0 A;  2R7H A;  2Z10 A;  1QST A;  2D4P A;  1XIX A;  5J8F A;  5JQ4 A;  4KOT A;  1B87 A;  1MJA A;  1I12 A;  4FD5 A;  2B5G B;  4K30 A;  2FL4 A;  4CRZ B;  3DR8 A;  5C88 A;  1WK4 A;  4E2A A;  2FCK A;  2VZZ A;  3TO7 A;  4RI1 A;  1QSO A;  4GS4 A;  4MJ8 A;  1N71 A;  4NXY A;  4H89 A;  2NMT A;  2WPX A;  5FVJ A;  2VBQ A;  3JUW A;  4FD7 A;  2OU2 A;  3BJ7 A;  1M1D A;  5HH1 A;  1SQH A;  1IID A;  2J8M A;  4BMH A;  2QEC A;  1J4J A;  1I21 A;  4B5O A;  3PP9 A;  3K9U A;  3SHP A;  2ZXV A;  2PDO A;  3IWG A;  5C82 A;  1Z4R A;  3S6F A;  1S7K A;  4KLV A;  3FNC A;  4ORF A;  2AJ6 A;  4H6Z A;  4DNC A;  3NE7 A;  1R57 A;  4II9 A;  3C26 A;  5EBV A;  3FXT A;  4X5K A;  2PC1 A;  5IX3 A;  2BEI A;  2G3T A;  1IYL A;  3R1K A;  4KOS A;  1XE4 A;  3EY5 A;  4KZT A;  1KUY A;  1KUV A;  1RXT A;  3EO4 A;  1U6M A;  3R96 A;  4E8O A;  3LOD A;  1V0C A;  3F5B A;  2EVN A;  1YX0 A;  3TCV A;  4KOX A;  5F46 A;  4AG7 A;  2ZPA A;  3EC4 A;  2PRB A;  3F0A A;  3BLN A;  1MJB A;  1PU9 A;  2Q04 A;  2QML A;  5J8C A;  5ISV A;  2ATR A;  4JXQ A;  4KOU A;  3B8G A;  2PQ8 A;  5KTA A;  2CNM A;  4NSQ A;  4HNY B;  3D2M A;  4E0A A;  3PZJ A;  1YLE A;  1P4N A;  4R57 A;  3MGD A;  2Z11 A;  5DWM A;  2GIV A;  2R1I A;  3RYO A;  4UBR A;  2EUI A;  4QC6 A;  2B3U A;  1S3Z A;  3LD2 A;  1K4J A;  3ZJ0 A;  2VI7 A;  2ARH A;  4XNH B;  2FT0 A;  4KVX A;  4NF1 A;  3ZZI A;  2CNT A;  2JDD A;  4B5P B;  3D3S A;  4CAV A;  3PGP A;  3VWE A;  4AVA A;  5KTC A;  4U9Y A;  1XF8 A;  4MY3 A;  2VZY A;  2GAN A;  4MI4 A;  2REE A;  4PK2 A;  4R9M A;  2FSR A;  3TOA A;  4L8A A;  2CY2 A;  2OZH A;  2B5G A;  5E96 A;  4PK3 A;  3WR7 A;  2CNS A;  5H84 A;  2K5T A;  1B6B A;  1M4I A;  1Z4E A;  1NE9 A;  3T90 A;  4Y49 B;  1YRE A;  2VQY A;  5KTD A;  4HKF A;  4M3S A;  4QBJ A;  3R9E A;  1XMT A;  2HV2 A;  4KOR A;  4OAD A;  5EC4 A;  4OLL A;  2BUE A;  1XEB A;  4OAE A;  5HMN A;  2Q7B A;  3D8P A;  4HNW B;  4KOV A;  2X7B A;  4UWJ A;  4XNH C;  2P6F A;  4KLW A;  4NCZ A;  1GHE A;  5F48 A;  5F49 A;  1WWZ A;  2Q4Y A;  4JXR A;  4YRH A;  4KOW A;  1Y7R A;  4KVM E;  2I79 A;  1S7F A;  4XPK A;  2FS5 A;  2I00 A;  1Y9W A;  3S6G A;  2P6G A;  2FIA A;  2H5M A;  2WPW A;  4AB7 A;  5CNP A;  3TT2 A;  3R95 A;  3E0K A;  4KVO E;  2Q44 A;  1MK4 A;  4IF5 A;  2BSW A;  3I9S A;  3R9G A;  2B4B A;  2OZU A;  4MHD A;  1Y9K A;  1Q2D A;  4Y49 C;  1I1D A;  5F47 A;  1IYK A;  3FB3 A;  4ZBG A;  1TIQ A;  2PR8 A;  4CAW A;  2QIR A;  2R8V A;  4MBU A;  2B4D B;  1KUX A;  4JJX A;  3IGR A;  2PSW A;  4FD4 A;  3UY5 A;  3VWD A;  2D4O A;  1M4D A;  4AG9 A;  4HNX B;  2DXQ A;  5IV0 A;  2ZW5 A;  1LRZ A;  1S60 A;  1S5K A;  1UFH A;  2Q0Y A;  4JD6 A;  4KUA A;  3F8K A;  4J3G A;  2VXK A;  3QB8 A;  3DR6 A;  5IB0 A;  1BO4 A;  4XPL A;  3EFA A;  1Q2Y A;  1M4G A;  1NSL A;  1KZF A;  3JVN A;  4LX9 A;  2HUZ A;  2G3A A;  4PSW A;  4R87 A;  3TO9 A;  3W91 A;  2B58 A;  2IL4 A;  1IIC A;  3H4Q A;  4RS2 A;  5I0C A;  2Z0Z A;  3TFY A;  4L89 A;  4B5P A;  4YGO A;  2JLM A;  3R9F A;  3GKR A;  1M44 A;  4KUB A;  3BJ8 A;  1OZP A;  2HQY A;  4PSX A;  3QAH A;  2B3V A;  4AVC A;  3D2P A;  4U5Y A;  2FXF A; 
#chains in the Genus database with same CATH topology
 2A4N A;  2BL1 A;  2J8N A;  3L2N A;  4CS0 B;  3D4U A;  2KCW A;  3K9T A;  4XPD C;  1YK3 A;  2PJ1 A;  3FIX A;  4MFZ A;  2IQ6 A;  4UCM A;  4X8I A;  4IHM A;  1BOB A;  3BXM A;  4FD6 A;  4ONW A;  5G20 A;  1TKH A;  2Z3N A;  3S9M A;  3PB4 X;  2P6E A;  3CXS A;  4HPS A;  3FRM A;  4QUS A;  3TOB A;  1VIX A;  2VEZ A;  3B3C A;  3KHX A;  2F7V A;  3G3S A;  4F0Y A;  3TE4 A;  2F5I A;  2IMO A;  1DE4 C;  1QSM A;  3TTH A;  4YU9 A;  3OWC A;  2OH1 A;  1PCA A;  2JDC A;  1MJ9 A;  4R3K A;  1Y7E A;  1Z8W A;  3PBE A;  3GIU A;  4NEX A;  3DNS A;  4NGN A;  5GCN A;  3GYA A;  3VAR A;  3D7D A;  2PR1 A;  1ZLI A;  2GLF A;  3CXP A;  4KSI A;  2XEJ A;  2JBK A;  3GUX A;  1YGH A;  4P4B A;  2G0B A;  1FY7 A;  1F2O A;  1VKC A;  1LCP A;  2ZW4 A;  3EXN A;  4CRY B;  1QSN A;  1HEE A;  4P4D A;  4OIW A;  5BWA B;  4MHP A;  1X10 A;  4NGQ A;  4PV6 A;  4UEE A;  3WAB A;  3FBU A;  3V8I A;  5AG5 A;  1YVO A;  3CT9 A;  3CXQ A;  3GY9 A;  4M85 A;  4F9U A;  4NFR A;  3DSB A;  4I49 A;  2FIW A;  5A27 A;  2J8R A;  2ZW6 A;  1AUG A;  3I3G A;  5HVH A;  5JPH A;  4UA3 A;  3V38 A;  5I4M A;  2AE6 A;  4UWI A;  3QAY A;  1PUA A;  5LRJ A;  4EVY A;  2ZEN A;  2R98 A;  4Q7A A;  1RTQ A;  1CPX A;  1VHS A;  3PBB A;  5G1Z A;  4C68 A;  2F8H A;  3GLJ A;  1CX8 A;  3G8W A;  4NJQ A;  4NJR A;  1YR0 A;  1YVK A;  4MHN A;  4C2X A;  1CP6 A;  3B2Y A;  4F9V A;  3IO1 A;  2GE3 A;  4IUS A;  4H6U A;  1QSR A;  3TO6 A;  4A95 A;  2ZEL A;  4FUU A;  4JZ0 A;  3T9Y A;  3HUV A;  1R43 A;  2DF5 A;  2ZEP A;  3BHX A;  1YME A;  1L0C A;  2POK A;  1ZG7 A;  2RC4 A;  2OB0 A;  1S7L A;  4NGT A;  4P10 A;  4R76 A;  5LRG A;  4M6H A;  4Q36 A;  4LUA A;  1NSA A;  2JBJ A;  1NMT A;  2FE7 A;  5HXD A;  1Q2C A;  1LAP A;  3P2H A;  1RO5 A;  2C27 A;  4F6A A;  1TXR A;  3S6K A;  2O28 A;  4MHY A;  4QB9 A;  4R3L A;  3SXN A;  4ZX9 A;  2Z3L A;  3IWE A;  4XPD B;  3FYN A;  1KWM A;  3D66 A;  1Z9U A;  2PJ3 A;  4CPA A;  4CGL A;  1P0H A;  3KKW A;  5D29 A;  4PXB A;  4ONU A;  5DWN A;  3FED A;  1IB1 E;  2GLJ A;  2OOT A;  1AYE A;  4M6G A;  4YWY A;  2C1C A;  4KOY A;  4P4E A;  3W6S A;  2AFO A;  4U9Z A;  4TNU A;  2DPS A;  1S7N A;  3W6X A;  5LYL A;  4JWP A;  2HB6 A;  3GB0 A;  3P2F A;  4IK2 A;  3S6H A;  2B4D A;  4MFQ A;  2BCO A;  2Q51 A;  4UCP A;  3SI0 A;  4B12 A;  4OC3 A;  2PJ2 A;  3DDD A;  1ARM A;  4P45 A;  1CM0 A;  4CAX A;  2REF A;  2Q4V A;  3N7Z A;  1Z8L A;  3FX6 A;  2ABZ A;  4QVT A;  3NH8 A;  3VH9 A;  2P0W A;  2OZG A;  4UFV A;  3SXO A;  2Y0M A;  1XOV A;  4YFJ A;  3FF3 A;  4ZY2 A;  5H86 A;  3IU1 A;  2ODF A;  2ZW7 A;  4JLY A;  1CJW A;  5LYI A;  4JYW A;  4AVB A;  3FEC A;  4MY0 A;  4OC1 A;  2JEV A;  1ON0 A;  2R7H A;  2Z10 A;  1QST A;  2D4P A;  1XIX A;  4BD9 A;  5J8F A;  5JQ4 A;  2C6G A;  4KOT A;  1ZG9 A;  1B87 A;  1MJA A;  1BAV A;  4A32 A;  1TF8 A;  1I12 A;  4FD5 A;  4OC4 A;  4C7I A;  2B5G B;  4K30 A;  2FL4 A;  4CGP A;  3NH4 A;  4CRZ B;  3DR8 A;  3IC1 A;  4CYN A;  3KR5 A;  1IOF A;  3K2K A;  5C88 A;  1WK4 A;  4MMO A;  4E2A A;  2V77 A;  4RN7 A;  2FCK A;  4IAV A;  4C2Z A;  3CPA A;  4UFX A;  4R7M A;  2VZZ A;  3SJF A;  3TO7 A;  2AFU A;  3H5Z A;  2ZED A;  4RI1 A;  2PJ4 A;  4CYP A;  3H8G A;  4MCS A;  1QSO A;  1HDU A;  4GS4 A;  4OKO A;  1JWQ A;  3SI1 A;  4MJ8 A;  5IB9 A;  2PJ8 A;  1N71 A;  4NXY A;  4OC2 A;  1TKF A;  4H89 A;  4P4F A;  2NMT A;  2WPX A;  3D7G A;  5JH9 A;  5FVJ A;  4OC5 A;  1IOI A;  1M4L A;  2VBQ A;  3JUW A;  4FD7 A;  2OU2 A;  3BJ7 A;  1M1D A;  2AFS A;  2DPT A;  5HH1 A;  5G21 A;  4MFP A;  3RNZ A;  4Z65 A;  4DJL A;  3S9N A;  2BOA A;  1SQH A;  1IID A;  2J8M A;  3HLP A;  2O53 A;  4BMH A;  2QEC A;  2Q7S A;  5D8N A;  4R6T A;  1J4J A;  4P4J A;  1I21 A;  4B5O A;  3PP9 A;  3K9U A;  1YW6 A;  4EWT A;  3SHP A;  3WC5 A;  2ZOF A;  1VHE A;  2ZXV A;  2PDO A;  3IWG A;  5C82 A;  4DUK A;  1UWY A;  3JRU A;  5K8P A;  1Z4R A;  4MCQ A;  3KGQ A;  1Q7L A;  2V8G A;  3S6F A;  1S7K A;  4FWU A;  4KLV A;  4F8Z A;  3NH5 A;  3FNC A;  4ORF A;  2AJ6 A;  4H6Z A;  4DNC A;  3LWU A;  4B13 A;  3RZA A;  3NE7 A;  2CTB A;  3LMS A;  4X3R A;  1R57 A;  4II9 A;  3C26 A;  4MFJ A;  3FXT A;  4X5K A;  5EBV A;  2PRQ A;  2PC1 A;  4FBE A;  3IFE A;  5IX3 A;  2BEI A;  2G3T A;  3CPX A;  1LAN A;  3PB9 X;  1IYL A;  1OBR A;  3R1K A;  4KOS A;  1XE4 A;  3EY5 A;  4KZT A;  4R8F A;  2XEI A;  1KUY A;  1KUV A;  1RXT A;  4H2K A;  3B3T A;  2Q43 A;  3D68 A;  5THW A;  4A94 A;  5F09 A;  5AG4 A;  1YW4 A;  1ELL P;  1ZLH A;  1U6M A;  3EO4 A;  3R96 A;  2V8V A;  4E8O A;  5K8O A;  3LOD A;  1V0C A;  1YSJ A;  3F5B A;  3IU2 A;  5K8M A;  3KHZ A;  4CGM A;  2EVN A;  1YX0 A;  2WYR A;  4B11 A;  4A37 A;  2YND A;  3B3W A;  3I1U A;  3TCV A;  1LAM A;  3MRU A;  4KOX A;  5G22 A;  2YNE A;  5F46 A;  2PIY A;  4AG7 A;  2ZPA A;  1ZG8 A;  3EC4 A;  2ZOG A;  2PRB A;  1F57 A;  3F0A A;  3BLN A;  1Y0Y A;  3PFO A;  1MJB A;  2V8H A;  1EE3 P;  1YQE A;  1R3N A;  2AFZ A;  1BPM A;  1PU9 A;  2Q04 A;  2QML A;  4CYO A;  5J8C A;  2CTC A;  3WC6 A;  2Z3P A;  4Q38 A;  5EMI A;  4CAE A;  5ISV A;  1ZO0 A;  2ATR A;  4B10 A;  4JXQ A;  5A28 A;  4KOU A;  2EWB A;  1FNO A;  1BPN A;  2PVW A;  3B8G A;  3TC8 A;  2PQ8 A;  5KTA A;  2CNM A;  4PPZ A;  4NSQ A;  2J9A A;  5LYD A;  4HNY B;  4F0X A;  3D2M A;  2WUU A;  4E0A A;  1TF9 A;  1XRY A;  2QYV A;  3IIB A;  3PZJ A;  4AXV A;  2Z3K A;  2BO9 A;  4ZY0 A;  1YLE A;  4UFW A;  1P4N A;  4LQ6 A;  4ZY1 A;  4R57 A;  3MGD A;  2Z11 A;  5DWM A;  2GIV A;  1Z8T A;  4MHZ A;  4KS9 A;  1IGB A;  2R1I A;  3IWW A;  2O4H A;  3FEE A;  4MCP A;  5AGE A;  3RYO A;  3FVL A;  4UBR A;  4BIN A;  2EUI A;  2PJ9 A;  3B35 A;  5AG6 A;  3H8F A;  2CIJ A;  4QC6 A;  1Z5R A;  4PXE A;  2B3U A;  1S3Z A;  2FVG A;  3LD2 A;  4MFK A;  2ZEH A;  1A2Z A;  1K4J A;  4EME A;  2RFH A;  3N5F A;  1IY7 A;  2ARH A;  2VI7 A;  2FT0 A;  4KVX A;  4XNH B;  4NF1 A;  3ZJ0 A;  3ZZI A;  2CNT A;  2JDD A;  4MCR A;  4B5P B;  3D3S A;  2HC9 A;  2PJ5 A;  1PYT B;  2AFM A;  2WSA A;  4CAV A;  3V7Z A;  2EBJ A;  3PGP A;  4ZI6 A;  3VWE A;  5CPA A;  4AVA A;  4DYO A;  1JQG A;  2PVV A;  4U9Y A;  5KTC A;  1XF8 A;  4MY3 A;  3S9L A;  3TX8 A;  1ELM P;  2VZY A;  2GAN A;  3KL9 A;  4MI4 A;  4NGP A;  2XEF A;  2I3C A;  2REE A;  1AMP A;  4PK2 A;  4R9M A;  2FSR A;  2OR4 A;  4MFL A;  3TOA A;  4L8A A;  3NFZ A;  4UEZ A;  3RBU A;  2CY2 A;  4A33 A;  2OZH A;  3QNV A;  4NGR A;  2B5G A;  5E96 A;  1H8L A;  4PK3 A;  3BI1 A;  1ARL A;  3WR7 A;  2CNS A;  2YNC C;  5H84 A;  1QQ9 A;  2PIZ A;  4WWV A;  3B3S A;  2CXA A;  4A38 A;  1FT7 A;  2K5T A;  4P44 A;  6CPA A;  1B6B A;  3B7I A;  1M4I A;  1VGY A;  1Z4E A;  3FMC A;  1NE9 A;  1GYT A;  3JTK A;  3PEI A;  3T90 A;  4Y49 B;  2WZN A;  1YRE A;  3WT4 A;  2VQY A;  3FJU A;  5KTD A;  3VAT A;  3B3V A;  3WC7 A;  4HKF A;  4P6Y A;  4RUH A;  4M3S A;  4QBJ A;  3R9E A;  4ZX8 A;  1XMT A;  2HV2 A;  4KOR A;  4OAD A;  5EC4 A;  3SJG A;  4KSA A;  2V8D A;  3ISZ A;  1Z8X A;  4OLL A;  3PB8 X;  2BUE A;  5AG7 A;  1XEB A;  4OAE A;  1XMB A;  5HMN A;  4PXC A;  2ZEM A;  3D8P A;  4HNW B;  1XJO A;  2Q7B A;  4KOV A;  4MXU A;  2AFW A;  2X7B A;  1IU8 A;  4UWJ A;  4XNH C;  1LFW A;  1LOK A;  2P6F A;  2RB7 A;  4KLW A;  3LAC A;  5HVF A;  4NCZ A;  1GHE A;  5F48 A;  1CPS A;  2PJ7 A;  1WWZ A;  1Z2L A;  2Q4Y A;  2ZEE A;  1XFO A;  4JXR A;  4YRH A;  5F49 A;  4OC0 A;  4KOW A;  4KSF A;  2JEW A;  4UEF A;  1Y7R A;  1VHO A;  4ZGY B;  4KVM E;  1TKJ A;  5CBM A;  2I79 A;  1S7F A;  3MN8 A;  4XPK A;  4FAI A;  2C6P A;  2FS5 A;  2XEG A;  4UF4 A;  4CYQ A;  5LYF A;  4K3N A;  2EK9 A;  2I00 A;  1Y9W A;  4B14 A;  3SI2 A;  3S6G A;  2NYQ A;  2P6G A;  4A2Z A;  2FIA A;  2H5M A;  4NGS A;  2WPW A;  4B6Z A;  3SJX A;  1BLL E;  4AB7 A;  2DEA A;  4OP4 A;  3KQZ A;  5CNP A;  1F2P A;  3D7F A;  2PJB A;  3TT2 A;  3R95 A;  4G1P A;  2IJZ A;  1CBX A;  3A9L A;  3PFE A;  5K8N A;  3E0K A;  4KVO E;  2Q44 A;  1MK4 A;  4IF5 A;  2BSW A;  4OID A;  3I9S A;  4A30 A;  3R9G A;  2B4B A;  2GRE A;  2OZU A;  4GXH A;  4MHD A;  1Y9K A;  5HVG A;  4CAF A;  3KZW A;  1Q2D A;  4Y49 C;  3T8W A;  5ELY A;  1I1D A;  2ANP A;  5F47 A;  1IYK A;  3FB3 A;  4ZBG A;  1TIQ A;  3D67 A;  4M6I A;  2PR8 A;  4CAW A;  5LRK A;  2AFX A;  2QIR A;  2PJ0 A;  2R8V A;  2PJ6 A;  2B4D B;  2VL1 A;  1KUX A;  4MBU A;  4JJX A;  4OME A;  4A39 A;  5JM6 A;  3IGR A;  3BI0 A;  5J1Q A;  2PJA A;  2PSW A;  4FD4 A;  3KQX A;  3PB6 X;  4PXD A;  4CGN A;  8CPA A;  3UY5 A;  4O23 A;  3VWD A;  1XBU A;  2CF4 A;  2PJC A;  2Q4Z A;  4P4I A;  2Z3O A;  4NGM A;  2D4O A;  3FH4 A;  2YNC A;  3RO0 A;  2GFQ A;  4LQG A;  3PB7 X;  1M4D A;  4A31 A;  4AG9 A;  4HNX B;  2QVP A;  2DXQ A;  4UIA A;  5IV0 A;  2ZW5 A;  1LRZ A;  3IEH A;  2PCU A;  2Z3M A;  1S60 A;  1S5K A;  1UFH A;  2Q0Y A;  4JD6 A;  4PQA A;  4UCN A;  5JGF A;  4KUA A;  2ZEO A;  3F8K A;  4J3G A;  2VXK A;  2G9D A;  3KR4 A;  4MRI A;  3KAS A;  3QB8 A;  1CP7 A;  3DR6 A;  3RAM A;  5IB0 A;  2EK8 A;  4TWE A;  1BO4 A;  4XPL A;  3EFA A;  2YGW A;  1Q2Y A;  1X12 A;  1M4G A;  3IJ3 A;  1NSL A;  7CPA A;  1KZF A;  5DS0 A;  3D7H A;  3H8E A;  2C6C A;  3NE8 A;  3DLJ A;  3JVN A;  3CDX A;  1DTD A;  4LX9 A;  2HUZ A;  3SJE A;  4GM5 A;  1QMU A;  4X2T A;  4EFD A;  3PRT A;  2G3A A;  4PSW A;  4ZYQ A;  4R87 A;  3TO9 A;  3W91 A;  2B58 A;  1CG2 A;  2GU2 A;  3CZX A;  2IL4 A;  1IIC A;  1Y0R A;  3H4Q A;  3KI9 A;  4CGO A;  3DGV A;  4BBH A;  2EO8 A;  4RS2 A;  5I0C A;  2Z0Z A;  3TFY A;  4L89 A;  3ISX A;  4B5P A;  4YGO A;  2JLM A;  2ZEF A;  3R9F A;  4UIB A;  3GKR A;  1M44 A;  4C7H A;  4W9Y A;  4KUB A;  3BJ8 A;  1OZP A;  2HQY A;  2QJ8 A;  4PSX A;  4WJB A;  3QAH A;  2B3V A;  2PE3 A;  1YLO A;  2ZEG A;  4AVC A;  3D2P A;  3NA6 A;  2NSM A;  4U5Y A;  1HDQ A;  4C2Y A;  2FXF A; 
#chains in the Genus database with same CATH homology
 2A4N A;  2BL1 A;  2J8N A;  4CS0 B;  2KCW A;  4XPD C;  1YK3 A;  3FIX A;  4MFZ A;  4UCM A;  1BOB A;  4FD6 A;  5G20 A;  2Z3N A;  2P6E A;  3CXS A;  4QUS A;  3FRM A;  3TOB A;  2VEZ A;  3G3S A;  4F0Y A;  3TE4 A;  2F5I A;  1QSM A;  3TTH A;  3OWC A;  2OH1 A;  4R3K A;  2JDC A;  1MJ9 A;  4NEX A;  3DNS A;  5GCN A;  3GYA A;  2PR1 A;  3CXP A;  1YGH A;  4CRY B;  2G0B A;  1FY7 A;  2ZW4 A;  1VKC A;  3EXN A;  1QSN A;  5BWA B;  4PV6 A;  3FBU A;  3V8I A;  5AG5 A;  1YVO A;  3CXQ A;  3GY9 A;  4M85 A;  3DSB A;  4I49 A;  2FIW A;  5A27 A;  2J8R A;  2ZW6 A;  3I3G A;  5JPH A;  4UA3 A;  2AE6 A;  4UWI A;  1PUA A;  4EVY A;  2R98 A;  1VHS A;  5G1Z A;  4C68 A;  3G8W A;  1YR0 A;  1YVK A;  4C2X A;  2GE3 A;  4IUS A;  4H6U A;  1QSR A;  3TO6 A;  4A95 A;  3T9Y A;  1L0C A;  2RC4 A;  2OB0 A;  1S7L A;  4Q36 A;  4LUA A;  1NMT A;  2FE7 A;  1Q2C A;  3P2H A;  1RO5 A;  2C27 A;  4F6A A;  3S6K A;  2O28 A;  4R3L A;  4QB9 A;  3SXN A;  2Z3L A;  3IWE A;  4XPD B;  3FYN A;  1Z9U A;  4CGL A;  1P0H A;  3KKW A;  4ONU A;  5DWN A;  1IB1 E;  4KOY A;  3W6S A;  4U9Z A;  2DPS A;  1S7N A;  3W6X A;  4JWP A;  3P2F A;  3S6H A;  2B4D A;  4MFQ A;  4UCP A;  4B12 A;  3DDD A;  4CAX A;  4F0X A;  1CM0 A;  2REF A;  2Q4V A;  3N7Z A;  4QVT A;  2P0W A;  2OZG A;  4UFV A;  3SXO A;  2Y0M A;  4YFJ A;  5H86 A;  3IU1 A;  2ZW7 A;  4JLY A;  1CJW A;  4AVB A;  4MY0 A;  2JEV A;  1ON0 A;  2R7H A;  2Z10 A;  1QST A;  2D4P A;  1XIX A;  5J8F A;  5JQ4 A;  4KOT A;  1B87 A;  1MJA A;  4A32 A;  4C7I A;  1I12 A;  4FD5 A;  2B5G B;  4K30 A;  2FL4 A;  4CGP A;  4CRZ B;  3DR8 A;  4CYN A;  5C88 A;  1WK4 A;  4E2A A;  2FCK A;  4C2Z A;  4UFX A;  2VZZ A;  3TO7 A;  3H5Z A;  4RI1 A;  4CYP A;  1QSO A;  4GS4 A;  4MJ8 A;  1N71 A;  4NXY A;  4H89 A;  2NMT A;  2WPX A;  5FVJ A;  2VBQ A;  3JUW A;  4FD7 A;  2OU2 A;  3BJ7 A;  1M1D A;  2DPT A;  5HH1 A;  5G21 A;  4MFP A;  1SQH A;  1IID A;  2J8M A;  4BMH A;  2QEC A;  1J4J A;  1I21 A;  4B5O A;  3PP9 A;  3K9U A;  3SHP A;  2ZXV A;  2PDO A;  3IWG A;  5C82 A;  1Z4R A;  3S6F A;  1S7K A;  4KLV A;  3FNC A;  4ORF A;  2AJ6 A;  4H6Z A;  4DNC A;  4B13 A;  3NE7 A;  1R57 A;  4II9 A;  3C26 A;  4MFJ A;  3FXT A;  4X5K A;  5EBV A;  2PC1 A;  5IX3 A;  2BEI A;  2G3T A;  1IYL A;  3R1K A;  4KOS A;  1XE4 A;  3EY5 A;  4KZT A;  1KUY A;  1KUV A;  1RXT A;  5AG4 A;  3EO4 A;  1U6M A;  3R96 A;  4E8O A;  3LOD A;  1V0C A;  3F5B A;  3IU2 A;  4CGM A;  2EVN A;  1YX0 A;  4B11 A;  2YND A;  3TCV A;  4KOX A;  5G22 A;  2YNE A;  5F46 A;  4AG7 A;  2ZPA A;  3EC4 A;  2PRB A;  3F0A A;  3BLN A;  1MJB A;  1PU9 A;  2Q04 A;  2QML A;  4CYO A;  5J8C A;  2Z3P A;  4Q38 A;  4CAE A;  5ISV A;  1ZO0 A;  2ATR A;  4B10 A;  4JXQ A;  5A28 A;  4KOU A;  3B8G A;  2PQ8 A;  5KTA A;  2CNM A;  4NSQ A;  4HNY B;  3D2M A;  2WUU A;  4E0A A;  3PZJ A;  2Z3K A;  1YLE A;  4UFW A;  1P4N A;  4R57 A;  3MGD A;  2Z11 A;  5DWM A;  2GIV A;  4KS9 A;  2R1I A;  5AGE A;  3RYO A;  4UBR A;  2EUI A;  5AG6 A;  4QC6 A;  2B3U A;  1S3Z A;  4MFK A;  3LD2 A;  1K4J A;  3ZJ0 A;  2VI7 A;  2ARH A;  4XNH B;  2FT0 A;  4KVX A;  4NF1 A;  3ZZI A;  2CNT A;  2JDD A;  4B5P B;  3D3S A;  2WSA A;  4CAV A;  3PGP A;  3VWE A;  4AVA A;  5KTC A;  4U9Y A;  1XF8 A;  4MY3 A;  2VZY A;  2GAN A;  4MI4 A;  2REE A;  4PK2 A;  4R9M A;  2FSR A;  4MFL A;  3TOA A;  4L8A A;  4A33 A;  2CY2 A;  2OZH A;  2B5G A;  5E96 A;  4PK3 A;  3WR7 A;  2CNS A;  2YNC C;  5H84 A;  2CXA A;  2K5T A;  1B6B A;  1M4I A;  1Z4E A;  3JTK A;  1NE9 A;  3T90 A;  4Y49 B;  1YRE A;  2VQY A;  5KTD A;  4HKF A;  4M3S A;  4QBJ A;  3R9E A;  1XMT A;  2HV2 A;  4KOR A;  4OAD A;  5EC4 A;  4KSA A;  4OLL A;  2BUE A;  5AG7 A;  1XEB A;  4OAE A;  5HMN A;  2Q7B A;  3D8P A;  4HNW B;  4KOV A;  2X7B A;  4UWJ A;  4XNH C;  2P6F A;  4KLW A;  4NCZ A;  1GHE A;  5F48 A;  5F49 A;  1WWZ A;  2Q4Y A;  4JXR A;  4YRH A;  4KOW A;  4KSF A;  4ZGY B;  1Y7R A;  4KVM E;  2I79 A;  1S7F A;  4XPK A;  2FS5 A;  4CYQ A;  2I00 A;  1Y9W A;  4B14 A;  3S6G A;  2P6G A;  4A2Z A;  2FIA A;  2H5M A;  2WPW A;  4AB7 A;  5CNP A;  3TT2 A;  3R95 A;  3A9L A;  3E0K A;  4KVO E;  2Q44 A;  1MK4 A;  4IF5 A;  2BSW A;  3I9S A;  4A30 A;  3R9G A;  2B4B A;  2OZU A;  4MHD A;  1Y9K A;  4CAF A;  1Q2D A;  4Y49 C;  1I1D A;  5F47 A;  1IYK A;  3FB3 A;  4ZBG A;  1TIQ A;  2PR8 A;  4CAW A;  2QIR A;  2R8V A;  4MBU A;  2B4D B;  1KUX A;  4JJX A;  3IGR A;  2PSW A;  4FD4 A;  4CGN A;  3UY5 A;  3VWD A;  2Z3O A;  2D4O A;  2YNC A;  1M4D A;  4A31 A;  4AG9 A;  4HNX B;  2DXQ A;  5IV0 A;  2ZW5 A;  1LRZ A;  2Z3M A;  1S60 A;  1S5K A;  1UFH A;  2Q0Y A;  4JD6 A;  4UCN A;  4KUA A;  3F8K A;  4J3G A;  2VXK A;  3QB8 A;  3DR6 A;  5IB0 A;  1BO4 A;  4XPL A;  3EFA A;  2YGW A;  1Q2Y A;  1M4G A;  1NSL A;  1KZF A;  3JVN A;  4LX9 A;  2HUZ A;  2G3A A;  4PSW A;  4R87 A;  3TO9 A;  3W91 A;  2B58 A;  2IL4 A;  1IIC A;  3H4Q A;  4CGO A;  4BBH A;  4RS2 A;  5I0C A;  2Z0Z A;  3TFY A;  4L89 A;  4B5P A;  4YGO A;  2JLM A;  3R9F A;  3GKR A;  1M44 A;  4C7H A;  4KUB A;  3BJ8 A;  1OZP A;  2HQY A;  4PSX A;  3QAH A;  2B3V A;  4AVC A;  3D2P A;  4U5Y A;  4C2Y A;  2FXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...