2JLMA

Structure of a putative acetyltransferase (aciad1637) from acinetobacter baylyi adp1
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
177
structure length
177
Chain Sequence
TTTLFRFVECTEDQHALEILEILNDAIINSTALYDYKPRSKESMAAWFATKRQNNFPIIGAVNEVGQLLGFASWGSFRAFPAYKYTVEHSVYIHKDYRGLGLSKHLMNELIKRAVESEVHVMVGCIDATNVASIQLHQKLGFIHSGTIQQAGFKFGRWLDAAFYQLTLDTPLHPQDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PUTATIVE PHOSPHINOTHRICIN N-ACETYLTRANSFERASE
publication title Structure and Substrate Specificity of Acetyltransferase Aciad1637 from Acinetobacter Baylyi Adp1.
pubmed doi rcsb
source organism Acinetobacter baylyi
total genus 46
structure length 177
sequence length 177
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2jlmA00
2G3AA 2CNMA 2D4OA 5I0CA 4KLWA 2ATRA 4MBUA 4AVCA 3LD2A 2EVNA 4R87A 3TT2A 2D4PA 2A4NA 1Y9KA 2P0WA 1OZPA 3G3SA 2B58A 3QB8A 4KOUA 2NMTA 3KKWA 4DNCA 1S60A 4I49A 1XF8A 2FCKA 2J8RA 2HQYA 2FL4A 3TO9A 3FB3A 3EXNA 5FVJA 5JPHA 2GE3A 1VHSA 1ON0A 1Z4RA 2PDOA 3PZJA 4AB7A 1J4JA 2VBQA 3JVNA 4U9YA 1M4DA 1RXTA 4PK3A 4XNHB 2OZUA 1Q2DA 2ZW4A 4QBJA 2Q4VA 5F47A 4KOYA 5HH1A 4J3GA 3H4QA 4X5KA 4XPKA 3DNSA 4ORFA 1YVKA 1GHEA 2R7HA 2QECA 2OZGA 2FIWA 4KVXA 4AG9A 3V8IA 2DXQA 2Y0MA 4KOVA 2PC1A 4PV6A 1IYLA 3I9SA 3G8WA 3DSBA 4KLVA 4PK2A 4YGOA 4MJ8A 1BOBA 2R8VA 3OWCA 2GIVA 5DWNA 2GANA 3D8PA 2P6FA 3FIXA 3T9YA 3F8KA 3P2FA 5EBVA 3S6KA 2G0BA 1VKCA 1WK4A 4ONUA 4CAXA 3PGPA 5JQ4A 2AE6A 2X7BA 1PU9A 2CNTA 2VI7A 1XEBA 4QB9A 2B3UA 3ZJ0A 4H89A 1M4GA 2VZZA 4FD6A 4FD7A 3TTHA 2PRBA 4NSQA 3TOBA 3E0KA 2HUZA 1S3ZA 3R96A 4KOTA 1R57A 1MK4A 2F5IA 4JXRA 1BO4A 3MGDA 3PP9A 2B4DB 1S7KA 4M3SA 2JLMA 2P6EA 3TOAA 4LUAA 2B4DA 2B3VA 2P6GA 4H6UA 3QAHA 2O28A 4ZBGA 3BLNA 2R1IA 4GS4A 4CRZB 4MI4A 5H86A 1Z9UA 4XNHC 2Z11A 4JWPA 4U5YA 4Y49B 1MJBA 4R3LA 5E96A 3FYNA 1TIQA 1M44A 4OLLA 1IB1E 1NMTA 4NCZA 1S7FA 4MHDA 3WR7A 3GKRA 3DDDA 1I21A 4B5OA 2EUIA 2JDCA 4H6ZA 5F46A 2I00A 4YFJA 3DR8A 4KUBA 1NE9A 2C27A 4UWJA 2BL1A 4II9A 4NXYA 2J8NA 3BJ8A 1XMTA 1XE4A 3R9FA 2FE7A 4BMHA 5KTAA 2Q44A 4UWIA 2WPXA 4MY0A 4JJXA 3JUWA 1QSMA 4AG7A 2Q7BA 2BEIA 3EO4A 3R9EA 4K30A 4CRYB 3S6HA 5C88A 3EY5A 1YGHA 1K4JA 4UA3A 1CJWA 3FXTA 3N7ZA 1YVOA 2REFA 5GCNA 3TO7A 4AVBA 3TCVA 4XPLA 3BJ7A 3R95A 4HNYB 4QUSA 2VXKA 1I1DA 4KUAA 1B87A 2REEA 1QSNA 2J8MA 2OH1A 3W6SA 2OU2A 4NF1A 4CAVA 4R57A 5HMNA 1IYKA 2FSRA 4JLYA 4KVOE 3GY9A 2VQYA 1QSRA 2VEZA 3D2PA 1LRZA 1Q2CA 4CS0B 1Y9WA 2K5TA 4YRHA 1KZFA 1M4IA 4R9MA 2ARHA 2QMLA 4M85A 5J8CA 4HKFA 5J8FA 1KUVA 3F0AA 4L8AA 1KUYA 3VWEA 3T90A 2JDDA 2B4BA 4OADA 5C82A 4EVYA 2FXFA 5F49A 2ZW5A 5IB0A 4KORA 3FRMA 3S6FA 3ZZIA 1S7NA 1MJ9A 4E8OA 1KUXA 4Y49C 4LX9A 1YX0A 5IV0A 4B5PB 2CNSA 3FBUA 4HNXB 3SXOA 4F0YA 4F6AA 4B5PA 5IX3A 1QSOA 4RS2A 4FD5A 1M1DA 4PSWA 5H84A 2I79A 4E0AA 2Q0YA 3FNCA 2Z10A 3W91A 1V0CA 4FD4A 2FIAA 1XIXA 4JD6A 2ZXVA 1SQHA 4KOXA 2WPWA 2BUEA 1YK3A 2BSWA 2HV2A 3I3GA 4PSXA 3SHPA 2Z0ZA 1IICA 2PQ8A 1Y7RA 1YLEA 1IIDA 1P4NA 4IF5A 1N71A 3TFYA 4NEXA 1YR0A 2IL4A 4L89A 2ZW7A 3SXNA 1I12A 4XPDC 2OZHA 3IGRA 3R1KA 3CXSA 1P0HA 4HNWB 3EC4A 3K9UA 3EFAA 3RYOA 2Q4YA 4XPDB 3D3SA 2PSWA 4UBRA 3TO6A 3W6XA 1Q2YA 4R3KA 2OB0A 4AVAA 3GYAA 2AJ6A 5DWMA 1QSTA 2QIRA 3DR6A 2KCWA 2FT0A 1CM0A 4U9ZA 1S7LA 2CY2A 1MJAA 1YREA 2JEVA 2ZW6A 5KTCA 4IUSA 1UFHA 2R98A 3R9GA 1L0CA 2ZPAA 1NSLA 4OAEA 3B8GA 3CXPA 2RC4A 4QC6A 4QVTA 5KTDA 4KOSA 1B6BA 3F5BA 5F48A 2B5GB 4CAWA 3TE4A 1U6MA 2FS5A 1S5KA 4JXQA 5CNPA 1PUAA 3UY5A 2B5GA 1WWZA 3VWDA 4KOWA 3CXQA 3P2HA 2PR1A 2VZYA 3IWGA 4KVME 4MY3A 3LODA 3S6GA 2Q04A 5EC4A 1RO5A 4KZTA 3C26A 4RI1A 3NE7A 4E2AA 3D2MA 5ISVA 2G3TA 2H5MA 1FY7A 2PR8A 1Z4EA
chains in the Genus database with same CATH superfamily
2G3AA 1IOFA 1AUGA 2QJ8A 2CNMA 4P6YA 1ZLIA 3GIUA 2D4OA 5I0CA 2ATRA 4KLWA 4MBUA 5G1ZA 4AVCA 3H8FA 2PJ7A 3LD2A 5A28A 4NGPA 3CDXA 2EVNA 4IHMA 2DPTA 4R87A 4NJQA 2PJCA 2D4PA 2AFUA 5LRGA 2A4NA 1Y9KA 2P0WA 3DGVA 2WUUA 3BXMA 4B14A 2PCUA 1OZPA 1X12A 3G3SA 3B3SA 2PJ6A 5K8MA 2B58A 3QB8A 4K3NA 2NMTA 3KKWA 4KOUA 1YSJA 1S60A 2PVWA 4DNCA 3NA6A 4I49A 1XF8A 5D29A 1CX8A 2FCKA 2YNDA 4GXHA 2J8RA 2PRQA 2Z3NA 2Z3OA 4FWUA 4OC5A 2HQYA 2FL4A 2XEIA 4OC4A 4OC2A 5AG4A 3TO9A 3FB3A 4HPSA 1F2PA 3EXNA 5FVJA 5JPHA 2GE3A 1VHSA 1ON0A 1Z4RA 3CPAA 2PDOA 3PB9X 3A9LA 2OOTA 4FAIA 2ZEFA 3V7ZA 5CBMA 3PZJA 3IWWA 1ZG7A 3PB8X 3ZJ0A 4AB7A 3B35A 3FH4A 1J4JA 2VBQA 3JVNA 4U9YA 2Z3PA 1M4DA 3K2KA 1RXTA 4PK3A 4XNHB 3WC6A 2OZUA 2EK8A 2YGWA 2ZENA 1Q2DA 2ZW4A 2V8HA 4QBJA 2Q4VA 4R76A 1Z2LA 1ELLP 4P4EA 3WABA 4A37A 5F47A 1IU8A 3FMCA 1TKFA 4KOYA 4P44A 4P45A 3JTKA 5HH1A 4TWEA 2C6CA 4J3GA 3H4QA 4X5KA 2O4HA 3IEHA 4ZY1A 4CGLA 4MFLA 4XPKA 3DNSA 4ORFA 1YVKA 2CXAA 1GHEA 2R7HA 5I4MA 4M6IA 2QECA 3NH5A 2ZEHA 4P4DA 1HDQA 3HLPA 2OZGA 4MCSA 4KSFA 1IGBA 3SJGA 2FIWA 3HUVA 2V8DA 4IAVA 4KVXA 4X2TA 3V8IA 1CPXA 2DXQA 2Y0MA 2AFMA 4KOVA 4AG9A 2PC1A 4PV6A 3SI0A 5EMIA 2HB6A 1IYLA 1RTQA 2PJ9A 3I9SA 3PBEA 3G8WA 3IJ3A 5A27A 3D67A 3DSBA 2PIZA 2XEFA 1AMPA 5THWA 4KLVA 1XJOA 3IFEA 4PK2A 3WT4A 2I3CA 3PEIA 5D8NA 1F2OA 5HVFA 3VARA 4YGOA 4A32A 4MJ8A 1BOBA 4X8IA 3RO0A 2R8VA 4B6ZA 4KS9A 3FEEA 2ZEEA 3OWCA 3CPXA 2IQ6A 3LACA 2GIVA 5DWNA 4C2XA 3TT2A 2GANA 4ZY0A 8CPAA 3D8PA 2P6FA 3FIXA 3T9YA 3F8KA 3H8GA 3SI2A 3IC1A 4A38A 2PJ8A 2ZEDA 3RZAA 3P2FA 3SJXA 5EBVA 5AG7A 3S6KA 2G0BA 3IIBA 1VKCA 1LOKA 1WK4A 4OC0A 4ONUA 4AXVA 4R6TA 4CGOA 2C6PA 2GFQA 2JBJA 2Q51A 2WSAA 3PGPA 4CAXA 2AFXA 5JQ4A 3PBBA 2AE6A 1ZG9A 3QAYA 3CZXA 2X7BA 2EO8A 1HDUA 1JWQA 1PU9A 2CNTA 3S9MA 2EK9A 4MHYA 4PXDA 2VI7A 1XEBA 2ZEPA 4QB9A 5ELYA 2B3UA 2JEWA 4H89A 5G22A 1M4GA 2V8VA 2VZZA 3NH8A 4FD6A 3KHXA 4NJRA 4R8FA 4FD7A 4UCNA 3TTHA 1LAPA 2PRBA 4NSQA 3TOBA 3E0KA 5IB9A 2YNCC 2HUZA 4PXEA 1S3ZA 3R96A 4MCQA 2BOAA 3FEDA 4KOTA 1R57A 1MK4A 1XOVA 1Z8TA 4ZY2A 4B13A 3GUXA 1CPSA 1Z8LA 1YLOA 4NGRA 2F5IA 4JXRA 1BO4A 3MGDA 3GB0A 3KI9A 4A94A 3PP9A 2B4DB 2ZEOA 1S7KA 4M3SA 5LRKA 5K8NA 4MFPA 4UFVA 2HC9A 1GYTA 4CYPA 2JLMA 2P6EA 2YNCA 3TOAA 4PQAA 4LUAA 4BBHA 4MXUA 2B4DA 2B3VA 2P6GA 4MRIA 3LWUA 4F0XA 4OIWA 4OC3A 4MFKA 1JQGA 4CAEA 4MMOA 4WJBA 4KSIA 4C7HA 4H6UA 2PJ0A 5HVGA 3QAHA 3PFOA 2O28A 4ZBGA 3BLNA 1IOIA 1IY7A 1ZG8A 2R1IA 2JBKA 1CG2A 1LAMA 4GS4A 5AG5A 3ISZA 2YNEA 5LYFA 3KQZA 1VIXA 4CRZB 1TKJA 4MI4A 4RN7A 4UF4A 5H86A 1Z9UA 3VH9A 4XNHC 4A33A 2Z11A 4JWPA 4U5YA 4Y49B 4ZGYB 4OP4A 5HXDA 1MJBA 3PB7X 4R3LA 1TKHA 5E96A 3FYNA 4Z65A 1TIQA 4UEFA 1M44A 4OLLA 1IB1E 1NMTA 4NCZA 1S7FA 4MHDA 2PIYA 3B3WA 3RBUA 3WR7A 5LRJA 1Z5RA 3GKRA 3DDDA 1DE4C 1I21A 2C1CA 3IU1A 3PB6X 4A30A 4B5OA 2EUIA 2Q7SA 2JDCA 3B7IA 3TC8A 1TXRA 4Q36A 4H6ZA 4EMEA 2V77A 4O23A 5F46A 2I00A 4YFJA 3VATA 3DR8A 5JM6A 3SI1A 4B12A 1PYTB 5LYIA 1FNOA 2ANPA 5LYDA 4RUHA 1EE3P 2GLFA 2AFWA 1H8LA 2BO9A 2QVPA 3BI0A 4KUBA 4BD9A 1NE9A 2C27A 4UWJA 2BL1A 2XEJA 4II9A 1PCAA 3RAMA 4NXYA 3FF3A 2J8NA 3H5ZA 3BJ8A 3TX8A 1XMTA 3D7DA 5F09A 1XE4A 3R9FA 2FE7A 3KL9A 4BMHA 5KTAA 2Q44A 4X3RA 5HVHA 1Y7EA 4UWIA 5J1QA 1YQEA 2WPXA 2CTBA 4MY0A 4JJXA 3JUWA 4MCRA 4H2KA 1QSMA 1XBUA 4AG7A 3I1UA 4WWVA 2Q7BA 4R7MA 2BEIA 2AFZA 4UEEA 4A95A 2Q43A 4PPZA 3D66A 3EO4A 2V8GA 2VL1A 5K8OA 3R9EA 1AYEA 4K30A 4CRYB 3S9LA 4P4FA 1BAVA 4TNUA 3S6HA 4CYQA 2NSMA 5C88A 3EY5A 1YGHA 1K4JA 2CF4A 1ELMP 4UA3A 1CJWA 3FXTA 3N7ZA 2GLJA 4GM5A 4NGTA 1YVOA 2REFA 3FJUA 3K9TA 3MN8A 5GCNA 3TO7A 2Z3KA 2AFOA 4AVBA 3FX6A 2DPSA 4MHPA 3TCVA 4XPLA 3BJ7A 3R95A 3H8EA 3D7GA 1BLLE 4MHNA 3B3TA 4HNYB 4QUSA 4UFXA 2O53A 4UEZA 3LMSA 4LQGA 1LCPA 1I1DA 2VXKA 4KUAA 1B87A 2IMOA 2REEA 1QSNA 1VGYA 1ZLHA 2J8MA 4EWTA 3QNVA 5DS0A 2OH1A 4UIBA 2OU2A 2PJ5A 2RFHA 4MFZA 4NF1A 3W6SA 4R57A 4CAVA 5HMNA 4MFJA 1IYKA 2FSRA 2Z3MA 3B2YA 4JLYA 4KVOE 3NE8A 3GY9A 2VQYA 1KWMA 1QSRA 2VEZA 4NFRA 3D2PA 1LRZA 1Q2CA 3BI1A 4PXBA 2PJBA 2PJAA 4JYWA 4M6GA 4CS0B 2EWBA 1FT7A 2ODFA 2EBJA 1Y9WA 2K5TA 4YRHA 3S9NA 1Z8XA 2ZEMA 2CTCA 3D7HA 1OBRA 2WYRA 4OIDA 3V38A 1KZFA 1M4IA 4P4BA 4Q7AA 1CP7A 2AFSA 4R9MA 4A31A 2ARHA 2QMLA 4M85A 4NGQA 4Q38A 4B11A 5J8CA 1VHEA 3DLJA 4IK2A 4HKFA 5BWAB 1KUVA 3F0AA 4L8AA 1KUYA 3VWEA 3T90A 5J8FA 2JDDA 3KHZA 2B4BA 4OADA 5C82A 4EVYA 2FXFA 3IU2A 1QQ9A 5F49A 2ZW5A 4UIAA 5IB0A 4KORA 3FRMA 3S6FA 3JRUA 4ONWA 5CPAA 3ZZIA 1S7NA 1YMEA 4CYNA 1MJ9A 4E8OA 1KUXA 4Y49C 4OKOA 4DYOA 4LX9A 4A39A 1YX0A 5IV0A 6CPAA 4B5PB 4NGSA 2CNSA 2PJ1A 4CAFA 2ZEGA 3FBUA 3IWEA 4FUUA 4HNXB 1CBXA 3SXOA 4F0YA 2NYQA 4B5PA 4F6AA 3KR5A 5IX3A 1QSOA 4MCPA 4RS2A 4FD5A 1M1DA 1TF8A 2F7VA 4PSWA 3D7FA 1Z8WA 2PJ3A 5H84A 1ARMA 2I79A 2CIJA 3B3VA 2ZOGA 4P10A 2BCOA 2Q0YA 3FNCA 2Z10A 3KR4A 2G9DA 3L2NA 3D4UA 4E0AA 4UCMA 1Q7LA 4MHZA 2DF5A 3W91A 5K8PA 1V0CA 1YW4A 2ZOFA 4FD4A 2FIAA 3FECA 4C7IA 4LQ6A 1HEEA 1XIXA 4JZ0A 4JD6A 2ZXVA 5G21A 4C2ZA 1F57A 1ARLA 1SQHA 4CGNA 4F9VA 4KOXA 2WPWA 2BUEA 1LFWA 1YK3A 2BSWA 1Y0RA 2HV2A 3I3GA 4DUKA 3IO1A 1UWYA 3KGQA 1QMUA 2PJ2A 4NGMA 1X10A 4PSXA 1A2ZA 1M4LA 1YW6A 5AG6A 3SHPA 2Z0ZA 1IICA 1NSAA 1Y7RA 2ABZA 2PQ8A 3FVLA 2ZELA 4F8ZA 1YLEA 4OC1A 1BPMA 2J9AA 3GLJA 1IIDA 1P4NA 4IF5A 1N71A 3N5FA 2QYVA 3TFYA 3KZWA 4F9UA 4NEXA 5AGEA 3B3CA 1YR0A 2IL4A 2WZNA 4L89A 2ZW7A 5G20A 3NFZA 1I12A 3SXNA 4CGPA 4XPDC 2OZHA 4UCPA 2XEGA 2F8HA 2POKA 3IGRA 3KASA 3R1KA 3CXSA 1P0HA 4HNWB 3EC4A 4P4JA 3D68A 3K9UA 4CPAA 2IJZA 3KQXA 3EFAA 3RYOA 2Q4YA 4XPDB 3D3SA 2PSWA 4UBRA 3TO6A 4NGNA 1Q2YA 4YWYA 3W6XA 4C68A 3PRTA 4R3KA 4A2ZA 2OB0A 2GU2A 4ZX8A 3BHXA 4AVAA 3SJEA 7CPAA 3GYAA 4CGMA 2AJ6A 2PJ4A 4EFDA 5DWMA 3CT9A 1QSTA 2QIRA 3DR6A 1DTDA 1R43A 2KCWA 2FT0A 1CM0A 4U9ZA 1CP6A 1S7LA 2CY2A 1XFOA 1MJAA 1YREA 3ISXA 2JEVA 2ZW6A 4KSAA 2OR4A 4W9YA 5KTCA 4IUSA 1XRYA 1Y0YA 1UFHA 2R98A 4P4IA 3R9GA 3PFEA 4BINA 1L0CA 2ZPAA 1NSLA 2PVVA 4PXCA 4FBEA 4M6HA 4OAEA 5JH9A 3PB4X 2PE3A 3B8GA 5JGFA 3RNZA 1VHOA 3CXPA 3WC7A 4G1PA 4UFWA 4C2YA 1LANA 4ZI6A 2RC4A 1BPNA 4QC6A 4QVTA 5KTDA 4KOSA 2FVGA 1B6BA 3F5BA 3T8WA 2C6GA 2Q4ZA 2RB7A 5F48A 4MFQA 2B5GB 3NH4A 4CAWA 1R3NA 1U6MA 2FS5A 4B10A 1S5KA 4JXQA 3TE4A 5CNPA 3MRUA 1PUAA 4OMEA 4YU9A 4ZX9A 3UY5A 3SJFA 2B5GA 1WWZA 3VWDA 4KOWA 3CXQA 3P2HA 2PR1A 2VZYA 3IWGA 4KVME 4MY3A 4DJLA 5LYLA 2DEAA 3LODA 3S6GA 2Q04A 5EC4A 3WC5A 1RO5A 1XMBA 4KZTA 2GREA 3C26A 2Z3LA 4RI1A 1TF9A 3NE7A 4E2AA 4ZYQA 4CYOA 3D2MA 5ISVA 1ZO0A 2G3TA 2H5MA 1FY7A 2PR8A 1Z4EA
chains in the Genus database with same CATH topology
2G3AA 2CNMA 2D4OA 5I0CA 2ATRA 4KLWA 4MBUA 5G1ZA 4AVCA 5A28A 3LD2A 2EVNA 2DPTA 4R87A 3TT2A 2D4PA 2A4NA 1Y9KA 2P0WA 2WUUA 4B14A 1OZPA 3G3SA 2B58A 3QB8A 4KOUA 2NMTA 3KKWA 4DNCA 1S60A 4I49A 1XF8A 2FCKA 2YNDA 2J8RA 2Z3NA 2Z3OA 2HQYA 2FL4A 5AG4A 3TO9A 3FB3A 3EXNA 5FVJA 5JPHA 2GE3A 1VHSA 1ON0A 1Z4RA 2PDOA 3A9LA 3PZJA 4AB7A 1J4JA 2VBQA 3JVNA 4U9YA 2Z3PA 1M4DA 1RXTA 4PK3A 4XNHB 2OZUA 2YGWA 1Q2DA 2ZW4A 4QBJA 2Q4VA 5F47A 4KOYA 3JTKA 5HH1A 4J3GA 3H4QA 4X5KA 4CGLA 4MFLA 4XPKA 3DNSA 4ORFA 1YVKA 2CXAA 1GHEA 2R7HA 2QECA 2OZGA 4KSFA 2FIWA 4KVXA 4AG9A 3V8IA 2DXQA 2Y0MA 4KOVA 2PC1A 4PV6A 1IYLA 3I9SA 3G8WA 5A27A 3DSBA 4KLVA 4PK2A 4YGOA 4A32A 4MJ8A 1BOBA 2R8VA 4KS9A 3OWCA 2GIVA 5DWNA 4C2XA 2GANA 3D8PA 2P6FA 3FIXA 3T9YA 3F8KA 3P2FA 5EBVA 5AG7A 3S6KA 2G0BA 1VKCA 1WK4A 4ONUA 4CGOA 4CAXA 3PGPA 2WSAA 5JQ4A 2AE6A 2X7BA 1PU9A 2CNTA 2VI7A 1XEBA 4QB9A 2B3UA 3ZJ0A 4H89A 5G22A 1M4GA 2VZZA 4FD6A 4FD7A 4UCNA 3TTHA 2PRBA 4NSQA 3TOBA 3E0KA 2YNCC 2HUZA 1S3ZA 3R96A 4KOTA 1R57A 1MK4A 4B13A 2F5IA 4JXRA 1BO4A 3MGDA 3PP9A 2B4DB 1S7KA 4M3SA 4MFPA 4UFVA 4CYPA 2JLMA 2P6EA 2YNCA 3TOAA 4LUAA 4BBHA 2B4DA 2B3VA 2P6GA 4MFKA 4CAEA 4C7HA 4H6UA 3QAHA 2O28A 4ZBGA 3BLNA 2R1IA 4GS4A 5AG5A 2YNEA 4CRZB 4MI4A 5H86A 1Z9UA 4XNHC 4A33A 2Z11A 4JWPA 4U5YA 4Y49B 4ZGYB 1MJBA 4R3LA 5E96A 3FYNA 1TIQA 1M44A 4OLLA 1IB1E 1NMTA 4NCZA 1S7FA 4MHDA 3WR7A 3GKRA 3DDDA 4A30A 1I21A 3IU1A 4B5OA 2EUIA 2JDCA 4Q36A 4H6ZA 5F46A 2I00A 4YFJA 3DR8A 4B12A 4KUBA 1NE9A 2C27A 4UWJA 2BL1A 4II9A 4NXYA 2J8NA 3H5ZA 3BJ8A 1XMTA 1XE4A 3R9FA 2FE7A 4BMHA 5KTAA 2Q44A 4UWIA 2WPXA 4MY0A 4JJXA 3JUWA 1QSMA 4AG7A 2Q7BA 2BEIA 4A95A 3EO4A 3R9EA 4K30A 4CRYB 3S6HA 4CYQA 5C88A 3EY5A 1YGHA 1K4JA 4UA3A 1CJWA 3FXTA 3N7ZA 1YVOA 2REFA 5GCNA 3TO7A 2Z3KA 4AVBA 2DPSA 3TCVA 4XPLA 3BJ7A 3R95A 4HNYB 4QUSA 4UFXA 2VXKA 1I1DA 4KUAA 1B87A 2REEA 1QSNA 2J8MA 2OH1A 3W6SA 2OU2A 4NF1A 4MFZA 4CAVA 4R57A 5HMNA 4MFJA 1IYKA 2FSRA 2Z3MA 4JLYA 4KVOE 3GY9A 2VQYA 1QSRA 2VEZA 3D2PA 1LRZA 1Q2CA 4CS0B 1Y9WA 2K5TA 4YRHA 1KZFA 1M4IA 4A31A 4R9MA 2ARHA 2QMLA 4M85A 4Q38A 4B11A 5J8CA 5BWAB 4HKFA 5J8FA 1KUVA 3F0AA 4L8AA 1KUYA 3VWEA 3T90A 2JDDA 2B4BA 4OADA 5C82A 4EVYA 2FXFA 3IU2A 5F49A 2ZW5A 5IB0A 4KORA 3FRMA 3S6FA 3ZZIA 1S7NA 4CYNA 1MJ9A 4E8OA 1KUXA 4Y49C 4LX9A 1YX0A 5IV0A 4B5PB 2CNSA 4CAFA 3FBUA 3IWEA 4HNXB 3SXOA 4F0YA 4F6AA 4B5PA 5IX3A 1QSOA 4RS2A 4FD5A 1M1DA 4PSWA 5H84A 2I79A 4E0AA 2Q0YA 3FNCA 2Z10A 4UCMA 3W91A 1V0CA 4FD4A 2FIAA 4C7IA 1XIXA 4JD6A 2ZXVA 5G21A 4C2ZA 1SQHA 4CGNA 4KOXA 2WPWA 2BUEA 1YK3A 2BSWA 2HV2A 3I3GA 4PSXA 5AG6A 3SHPA 2Z0ZA 1IICA 2PQ8A 1Y7RA 1YLEA 1IIDA 1P4NA 4IF5A 1N71A 3TFYA 4NEXA 5AGEA 1YR0A 2IL4A 4L89A 2ZW7A 5G20A 3SXNA 1I12A 4CGPA 4XPDC 2OZHA 4UCPA 3IGRA 3R1KA 3CXSA 1P0HA 4HNWB 3EC4A 3K9UA 4F0XA 3EFAA 3RYOA 2Q4YA 4XPDB 3D3SA 2PSWA 4UBRA 3TO6A 3W6XA 1Q2YA 4C68A 4R3KA 4A2ZA 2OB0A 4AVAA 3GYAA 4CGMA 2AJ6A 5DWMA 1QSTA 2QIRA 3DR6A 2KCWA 2FT0A 1CM0A 4U9ZA 1S7LA 2CY2A 1MJAA 1YREA 2JEVA 2ZW6A 4KSAA 5KTCA 4IUSA 1UFHA 2R98A 3R9GA 1L0CA 2ZPAA 1NSLA 4OAEA 3B8GA 3CXPA 4UFWA 4C2YA 2RC4A 4QC6A 4QVTA 5KTDA 4KOSA 1B6BA 3F5BA 5F48A 4MFQA 2B5GB 4CAWA 3TE4A 1U6MA 2FS5A 4B10A 1S5KA 4JXQA 5CNPA 1PUAA 3UY5A 2B5GA 1WWZA 3VWDA 4KOWA 3CXQA 3P2HA 2PR1A 2VZYA 3IWGA 4KVME 4MY3A 3LODA 3S6GA 2Q04A 5EC4A 1RO5A 4KZTA 3C26A 2Z3LA 4RI1A 3NE7A 4E2AA 4CYOA 3D2MA 5ISVA 1ZO0A 2G3TA 2H5MA 1FY7A 2PR8A 1Z4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G3A A;  2CNM A;  2D4O A;  5I0C A;  4KLW A;  2ATR A;  4MBU A;  4AVC A;  3LD2 A;  2EVN A;  4R87 A;  3TT2 A;  2D4P A;  2A4N A;  1Y9K A;  2P0W A;  1OZP A;  3G3S A;  2B58 A;  3QB8 A;  4KOU A;  2NMT A;  3KKW A;  4DNC A;  1S60 A;  4I49 A;  1XF8 A;  2FCK A;  2J8R A;  2HQY A;  2FL4 A;  3TO9 A;  3FB3 A;  3EXN A;  5FVJ A;  5JPH A;  2GE3 A;  1VHS A;  1ON0 A;  1Z4R A;  2PDO A;  3PZJ A;  4AB7 A;  1J4J A;  2VBQ A;  3JVN A;  4U9Y A;  1M4D A;  1RXT A;  4PK3 A;  4XNH B;  2OZU A;  1Q2D A;  2ZW4 A;  4QBJ A;  2Q4V A;  5F47 A;  4KOY A;  5HH1 A;  4J3G A;  3H4Q A;  4X5K A;  4XPK A;  3DNS A;  4ORF A;  1YVK A;  1GHE A;  2R7H A;  2QEC A;  2OZG A;  2FIW A;  4KVX A;  4AG9 A;  3V8I A;  2DXQ A;  2Y0M A;  4KOV A;  2PC1 A;  4PV6 A;  1IYL A;  3I9S A;  3G8W A;  3DSB A;  4KLV A;  4PK2 A;  4YGO A;  4MJ8 A;  1BOB A;  2R8V A;  3OWC A;  2GIV A;  5DWN A;  2GAN A;  3D8P A;  2P6F A;  3FIX A;  3T9Y A;  3F8K A;  3P2F A;  5EBV A;  3S6K A;  2G0B A;  1VKC A;  1WK4 A;  4ONU A;  4CAX A;  3PGP A;  5JQ4 A;  2AE6 A;  2X7B A;  1PU9 A;  2CNT A;  2VI7 A;  1XEB A;  4QB9 A;  2B3U A;  3ZJ0 A;  4H89 A;  1M4G A;  2VZZ A;  4FD6 A;  4FD7 A;  3TTH A;  2PRB A;  4NSQ A;  3TOB A;  3E0K A;  2HUZ A;  1S3Z A;  3R96 A;  4KOT A;  1R57 A;  1MK4 A;  2F5I A;  4JXR A;  1BO4 A;  3MGD A;  3PP9 A;  2B4D B;  1S7K A;  4M3S A;  2JLM A;  2P6E A;  3TOA A;  4LUA A;  2B4D A;  2B3V A;  2P6G A;  4H6U A;  3QAH A;  2O28 A;  4ZBG A;  3BLN A;  2R1I A;  4GS4 A;  4CRZ B;  4MI4 A;  5H86 A;  1Z9U A;  4XNH C;  2Z11 A;  4JWP A;  4U5Y A;  4Y49 B;  1MJB A;  4R3L A;  5E96 A;  3FYN A;  1TIQ A;  1M44 A;  4OLL A;  1IB1 E;  1NMT A;  4NCZ A;  1S7F A;  4MHD A;  3WR7 A;  3GKR A;  3DDD A;  1I21 A;  4B5O A;  2EUI A;  2JDC A;  4H6Z A;  5F46 A;  2I00 A;  4YFJ A;  3DR8 A;  4KUB A;  1NE9 A;  2C27 A;  4UWJ A;  2BL1 A;  4II9 A;  4NXY A;  2J8N A;  3BJ8 A;  1XMT A;  1XE4 A;  3R9F A;  2FE7 A;  4BMH A;  5KTA A;  2Q44 A;  4UWI A;  2WPX A;  4MY0 A;  4JJX A;  3JUW A;  1QSM A;  4AG7 A;  2Q7B A;  2BEI A;  3EO4 A;  3R9E A;  4K30 A;  4CRY B;  3S6H A;  5C88 A;  3EY5 A;  1YGH A;  1K4J A;  4UA3 A;  1CJW A;  3FXT A;  3N7Z A;  1YVO A;  2REF A;  5GCN A;  3TO7 A;  4AVB A;  3TCV A;  4XPL A;  3BJ7 A;  3R95 A;  4HNY B;  4QUS A;  2VXK A;  1I1D A;  4KUA A;  1B87 A;  2REE A;  1QSN A;  2J8M A;  2OH1 A;  3W6S A;  2OU2 A;  4NF1 A;  4CAV A;  4R57 A;  5HMN A;  1IYK A;  2FSR A;  4JLY A;  4KVO E;  3GY9 A;  2VQY A;  1QSR A;  2VEZ A;  3D2P A;  1LRZ A;  1Q2C A;  4CS0 B;  1Y9W A;  2K5T A;  4YRH A;  1KZF A;  1M4I A;  4R9M A;  2ARH A;  2QML A;  4M85 A;  5J8C A;  4HKF A;  5J8F A;  1KUV A;  3F0A A;  4L8A A;  1KUY A;  3VWE A;  3T90 A;  2JDD A;  2B4B A;  4OAD A;  5C82 A;  4EVY A;  2FXF A;  5F49 A;  2ZW5 A;  5IB0 A;  4KOR A;  3FRM A;  3S6F A;  3ZZI A;  1S7N A;  1MJ9 A;  4E8O A;  1KUX A;  4Y49 C;  4LX9 A;  1YX0 A;  5IV0 A;  4B5P B;  2CNS A;  3FBU A;  4HNX B;  3SXO A;  4F0Y A;  4F6A A;  4B5P A;  5IX3 A;  1QSO A;  4RS2 A;  4FD5 A;  1M1D A;  4PSW A;  5H84 A;  2I79 A;  4E0A A;  2Q0Y A;  3FNC A;  2Z10 A;  3W91 A;  1V0C A;  4FD4 A;  2FIA A;  1XIX A;  4JD6 A;  2ZXV A;  1SQH A;  4KOX A;  2WPW A;  2BUE A;  1YK3 A;  2BSW A;  2HV2 A;  3I3G A;  4PSX A;  3SHP A;  2Z0Z A;  1IIC A;  2PQ8 A;  1Y7R A;  1YLE A;  1IID A;  1P4N A;  4IF5 A;  1N71 A;  3TFY A;  4NEX A;  1YR0 A;  2IL4 A;  4L89 A;  2ZW7 A;  3SXN A;  1I12 A;  4XPD C;  2OZH A;  3IGR A;  3R1K A;  3CXS A;  1P0H A;  4HNW B;  3EC4 A;  3K9U A;  3EFA A;  3RYO A;  2Q4Y A;  4XPD B;  3D3S A;  2PSW A;  4UBR A;  3TO6 A;  3W6X A;  1Q2Y A;  4R3K A;  2OB0 A;  4AVA A;  3GYA A;  2AJ6 A;  5DWM A;  1QST A;  2QIR A;  3DR6 A;  2KCW A;  2FT0 A;  1CM0 A;  4U9Z A;  1S7L A;  2CY2 A;  1MJA A;  1YRE A;  2JEV A;  2ZW6 A;  5KTC A;  4IUS A;  1UFH A;  2R98 A;  3R9G A;  1L0C A;  2ZPA A;  1NSL A;  4OAE A;  3B8G A;  3CXP A;  2RC4 A;  4QC6 A;  4QVT A;  5KTD A;  4KOS A;  1B6B A;  3F5B A;  5F48 A;  2B5G B;  4CAW A;  3TE4 A;  1U6M A;  2FS5 A;  1S5K A;  4JXQ A;  5CNP A;  1PUA A;  3UY5 A;  2B5G A;  1WWZ A;  3VWD A;  4KOW A;  3CXQ A;  3P2H A;  2PR1 A;  2VZY A;  3IWG A;  4KVM E;  4MY3 A;  3LOD A;  3S6G A;  2Q04 A;  5EC4 A;  1RO5 A;  4KZT A;  3C26 A;  4RI1 A;  3NE7 A;  4E2A A;  3D2M A;  5ISV A;  2G3T A;  2H5M A;  1FY7 A;  2PR8 A;  1Z4E A; 
#chains in the Genus database with same CATH topology
 2G3A A;  1IOF A;  1AUG A;  2QJ8 A;  2CNM A;  4P6Y A;  1ZLI A;  3GIU A;  2D4O A;  5I0C A;  2ATR A;  4KLW A;  4MBU A;  5G1Z A;  4AVC A;  3H8F A;  2PJ7 A;  3LD2 A;  5A28 A;  4NGP A;  3CDX A;  2EVN A;  4IHM A;  2DPT A;  4R87 A;  4NJQ A;  2PJC A;  2D4P A;  2AFU A;  5LRG A;  2A4N A;  1Y9K A;  2P0W A;  3DGV A;  2WUU A;  3BXM A;  4B14 A;  2PCU A;  1OZP A;  1X12 A;  3G3S A;  3B3S A;  2PJ6 A;  5K8M A;  2B58 A;  3QB8 A;  4K3N A;  2NMT A;  3KKW A;  4KOU A;  1YSJ A;  1S60 A;  2PVW A;  4DNC A;  3NA6 A;  4I49 A;  1XF8 A;  5D29 A;  1CX8 A;  2FCK A;  2YND A;  4GXH A;  2J8R A;  2PRQ A;  2Z3N A;  2Z3O A;  4FWU A;  4OC5 A;  2HQY A;  2FL4 A;  2XEI A;  4OC4 A;  4OC2 A;  5AG4 A;  3TO9 A;  3FB3 A;  4HPS A;  1F2P A;  3EXN A;  5FVJ A;  5JPH A;  2GE3 A;  1VHS A;  1ON0 A;  1Z4R A;  3CPA A;  2PDO A;  3PB9 X;  3A9L A;  2OOT A;  4FAI A;  2ZEF A;  3V7Z A;  5CBM A;  3PZJ A;  3IWW A;  1ZG7 A;  3PB8 X;  3ZJ0 A;  4AB7 A;  3B35 A;  3FH4 A;  1J4J A;  2VBQ A;  3JVN A;  4U9Y A;  2Z3P A;  1M4D A;  3K2K A;  1RXT A;  4PK3 A;  4XNH B;  3WC6 A;  2OZU A;  2EK8 A;  2YGW A;  2ZEN A;  1Q2D A;  2ZW4 A;  2V8H A;  4QBJ A;  2Q4V A;  4R76 A;  1Z2L A;  1ELL P;  4P4E A;  3WAB A;  4A37 A;  5F47 A;  1IU8 A;  3FMC A;  1TKF A;  4KOY A;  4P44 A;  4P45 A;  3JTK A;  5HH1 A;  4TWE A;  2C6C A;  4J3G A;  3H4Q A;  4X5K A;  2O4H A;  3IEH A;  4ZY1 A;  4CGL A;  4MFL A;  4XPK A;  3DNS A;  4ORF A;  1YVK A;  2CXA A;  1GHE A;  2R7H A;  5I4M A;  4M6I A;  2QEC A;  3NH5 A;  2ZEH A;  4P4D A;  1HDQ A;  3HLP A;  2OZG A;  4MCS A;  4KSF A;  1IGB A;  3SJG A;  2FIW A;  3HUV A;  2V8D A;  4IAV A;  4KVX A;  4X2T A;  3V8I A;  1CPX A;  2DXQ A;  2Y0M A;  2AFM A;  4KOV A;  4AG9 A;  2PC1 A;  4PV6 A;  3SI0 A;  5EMI A;  2HB6 A;  1IYL A;  1RTQ A;  2PJ9 A;  3I9S A;  3PBE A;  3G8W A;  3IJ3 A;  5A27 A;  3D67 A;  3DSB A;  2PIZ A;  2XEF A;  1AMP A;  5THW A;  4KLV A;  1XJO A;  3IFE A;  4PK2 A;  3WT4 A;  2I3C A;  3PEI A;  5D8N A;  1F2O A;  5HVF A;  3VAR A;  4YGO A;  4A32 A;  4MJ8 A;  1BOB A;  4X8I A;  3RO0 A;  2R8V A;  4B6Z A;  4KS9 A;  3FEE A;  2ZEE A;  3OWC A;  3CPX A;  2IQ6 A;  3LAC A;  2GIV A;  5DWN A;  4C2X A;  3TT2 A;  2GAN A;  4ZY0 A;  8CPA A;  3D8P A;  2P6F A;  3FIX A;  3T9Y A;  3F8K A;  3H8G A;  3SI2 A;  3IC1 A;  4A38 A;  2PJ8 A;  2ZED A;  3RZA A;  3P2F A;  3SJX A;  5EBV A;  5AG7 A;  3S6K A;  2G0B A;  3IIB A;  1VKC A;  1LOK A;  1WK4 A;  4OC0 A;  4ONU A;  4AXV A;  4R6T A;  4CGO A;  2C6P A;  2GFQ A;  2JBJ A;  2Q51 A;  2WSA A;  3PGP A;  4CAX A;  2AFX A;  5JQ4 A;  3PBB A;  2AE6 A;  1ZG9 A;  3QAY A;  3CZX A;  2X7B A;  2EO8 A;  1HDU A;  1JWQ A;  1PU9 A;  2CNT A;  3S9M A;  2EK9 A;  4MHY A;  4PXD A;  2VI7 A;  1XEB A;  2ZEP A;  4QB9 A;  5ELY A;  2B3U A;  2JEW A;  4H89 A;  5G22 A;  1M4G A;  2V8V A;  2VZZ A;  3NH8 A;  4FD6 A;  3KHX A;  4NJR A;  4R8F A;  4FD7 A;  4UCN A;  3TTH A;  1LAP A;  2PRB A;  4NSQ A;  3TOB A;  3E0K A;  5IB9 A;  2YNC C;  2HUZ A;  4PXE A;  1S3Z A;  3R96 A;  4MCQ A;  2BOA A;  3FED A;  4KOT A;  1R57 A;  1MK4 A;  1XOV A;  1Z8T A;  4ZY2 A;  4B13 A;  3GUX A;  1CPS A;  1Z8L A;  1YLO A;  4NGR A;  2F5I A;  4JXR A;  1BO4 A;  3MGD A;  3GB0 A;  3KI9 A;  4A94 A;  3PP9 A;  2B4D B;  2ZEO A;  1S7K A;  4M3S A;  5LRK A;  5K8N A;  4MFP A;  4UFV A;  2HC9 A;  1GYT A;  4CYP A;  2JLM A;  2P6E A;  2YNC A;  3TOA A;  4PQA A;  4LUA A;  4BBH A;  4MXU A;  2B4D A;  2B3V A;  2P6G A;  4MRI A;  3LWU A;  4F0X A;  4OIW A;  4OC3 A;  4MFK A;  1JQG A;  4CAE A;  4MMO A;  4WJB A;  4KSI A;  4C7H A;  4H6U A;  2PJ0 A;  5HVG A;  3QAH A;  3PFO A;  2O28 A;  4ZBG A;  3BLN A;  1IOI A;  1IY7 A;  1ZG8 A;  2R1I A;  2JBK A;  1CG2 A;  1LAM A;  4GS4 A;  5AG5 A;  3ISZ A;  2YNE A;  5LYF A;  3KQZ A;  1VIX A;  4CRZ B;  1TKJ A;  4MI4 A;  4RN7 A;  4UF4 A;  5H86 A;  1Z9U A;  3VH9 A;  4XNH C;  4A33 A;  2Z11 A;  4JWP A;  4U5Y A;  4Y49 B;  4ZGY B;  4OP4 A;  5HXD A;  1MJB A;  3PB7 X;  4R3L A;  1TKH A;  5E96 A;  3FYN A;  4Z65 A;  1TIQ A;  4UEF A;  1M44 A;  4OLL A;  1IB1 E;  1NMT A;  4NCZ A;  1S7F A;  4MHD A;  2PIY A;  3B3W A;  3RBU A;  3WR7 A;  5LRJ A;  1Z5R A;  3GKR A;  3DDD A;  1DE4 C;  1I21 A;  2C1C A;  3IU1 A;  3PB6 X;  4A30 A;  4B5O A;  2EUI A;  2Q7S A;  2JDC A;  3B7I A;  3TC8 A;  1TXR A;  4Q36 A;  4H6Z A;  4EME A;  2V77 A;  4O23 A;  5F46 A;  2I00 A;  4YFJ A;  3VAT A;  3DR8 A;  5JM6 A;  3SI1 A;  4B12 A;  1PYT B;  5LYI A;  1FNO A;  2ANP A;  5LYD A;  4RUH A;  1EE3 P;  2GLF A;  2AFW A;  1H8L A;  2BO9 A;  2QVP A;  3BI0 A;  4KUB A;  4BD9 A;  1NE9 A;  2C27 A;  4UWJ A;  2BL1 A;  2XEJ A;  4II9 A;  1PCA A;  3RAM A;  4NXY A;  3FF3 A;  2J8N A;  3H5Z A;  3BJ8 A;  3TX8 A;  1XMT A;  3D7D A;  5F09 A;  1XE4 A;  3R9F A;  2FE7 A;  3KL9 A;  4BMH A;  5KTA A;  2Q44 A;  4X3R A;  5HVH A;  1Y7E A;  4UWI A;  5J1Q A;  1YQE A;  2WPX A;  2CTB A;  4MY0 A;  4JJX A;  3JUW A;  4MCR A;  4H2K A;  1QSM A;  1XBU A;  4AG7 A;  3I1U A;  4WWV A;  2Q7B A;  4R7M A;  2BEI A;  2AFZ A;  4UEE A;  4A95 A;  2Q43 A;  4PPZ A;  3D66 A;  3EO4 A;  2V8G A;  2VL1 A;  5K8O A;  3R9E A;  1AYE A;  4K30 A;  4CRY B;  3S9L A;  4P4F A;  1BAV A;  4TNU A;  3S6H A;  4CYQ A;  2NSM A;  5C88 A;  3EY5 A;  1YGH A;  1K4J A;  2CF4 A;  1ELM P;  4UA3 A;  1CJW A;  3FXT A;  3N7Z A;  2GLJ A;  4GM5 A;  4NGT A;  1YVO A;  2REF A;  3FJU A;  3K9T A;  3MN8 A;  5GCN A;  3TO7 A;  2Z3K A;  2AFO A;  4AVB A;  3FX6 A;  2DPS A;  4MHP A;  3TCV A;  4XPL A;  3BJ7 A;  3R95 A;  3H8E A;  3D7G A;  1BLL E;  4MHN A;  3B3T A;  4HNY B;  4QUS A;  4UFX A;  2O53 A;  4UEZ A;  3LMS A;  4LQG A;  1LCP A;  1I1D A;  2VXK A;  4KUA A;  1B87 A;  2IMO A;  2REE A;  1QSN A;  1VGY A;  1ZLH A;  2J8M A;  4EWT A;  3QNV A;  5DS0 A;  2OH1 A;  4UIB A;  2OU2 A;  2PJ5 A;  2RFH A;  4MFZ A;  4NF1 A;  3W6S A;  4R57 A;  4CAV A;  5HMN A;  4MFJ A;  1IYK A;  2FSR A;  2Z3M A;  3B2Y A;  4JLY A;  4KVO E;  3NE8 A;  3GY9 A;  2VQY A;  1KWM A;  1QSR A;  2VEZ A;  4NFR A;  3D2P A;  1LRZ A;  1Q2C A;  3BI1 A;  4PXB A;  2PJB A;  2PJA A;  4JYW A;  4M6G A;  4CS0 B;  2EWB A;  1FT7 A;  2ODF A;  2EBJ A;  1Y9W A;  2K5T A;  4YRH A;  3S9N A;  1Z8X A;  2ZEM A;  2CTC A;  3D7H A;  1OBR A;  2WYR A;  4OID A;  3V38 A;  1KZF A;  1M4I A;  4P4B A;  4Q7A A;  1CP7 A;  2AFS A;  4R9M A;  4A31 A;  2ARH A;  2QML A;  4M85 A;  4NGQ A;  4Q38 A;  4B11 A;  5J8C A;  1VHE A;  3DLJ A;  4IK2 A;  4HKF A;  5BWA B;  1KUV A;  3F0A A;  4L8A A;  1KUY A;  3VWE A;  3T90 A;  5J8F A;  2JDD A;  3KHZ A;  2B4B A;  4OAD A;  5C82 A;  4EVY A;  2FXF A;  3IU2 A;  1QQ9 A;  5F49 A;  2ZW5 A;  4UIA A;  5IB0 A;  4KOR A;  3FRM A;  3S6F A;  3JRU A;  4ONW A;  5CPA A;  3ZZI A;  1S7N A;  1YME A;  4CYN A;  1MJ9 A;  4E8O A;  1KUX A;  4Y49 C;  4OKO A;  4DYO A;  4LX9 A;  4A39 A;  1YX0 A;  5IV0 A;  6CPA A;  4B5P B;  4NGS A;  2CNS A;  2PJ1 A;  4CAF A;  2ZEG A;  3FBU A;  3IWE A;  4FUU A;  4HNX B;  1CBX A;  3SXO A;  4F0Y A;  2NYQ A;  4B5P A;  4F6A A;  3KR5 A;  5IX3 A;  1QSO A;  4MCP A;  4RS2 A;  4FD5 A;  1M1D A;  1TF8 A;  2F7V A;  4PSW A;  3D7F A;  1Z8W A;  2PJ3 A;  5H84 A;  1ARM A;  2I79 A;  2CIJ A;  3B3V A;  2ZOG A;  4P10 A;  2BCO A;  2Q0Y A;  3FNC A;  2Z10 A;  3KR4 A;  2G9D A;  3L2N A;  3D4U A;  4E0A A;  4UCM A;  1Q7L A;  4MHZ A;  2DF5 A;  3W91 A;  5K8P A;  1V0C A;  1YW4 A;  2ZOF A;  4FD4 A;  2FIA A;  3FEC A;  4C7I A;  4LQ6 A;  1HEE A;  1XIX A;  4JZ0 A;  4JD6 A;  2ZXV A;  5G21 A;  4C2Z A;  1F57 A;  1ARL A;  1SQH A;  4CGN A;  4F9V A;  4KOX A;  2WPW A;  2BUE A;  1LFW A;  1YK3 A;  2BSW A;  1Y0R A;  2HV2 A;  3I3G A;  4DUK A;  3IO1 A;  1UWY A;  3KGQ A;  1QMU A;  2PJ2 A;  4NGM A;  1X10 A;  4PSX A;  1A2Z A;  1M4L A;  1YW6 A;  5AG6 A;  3SHP A;  2Z0Z A;  1IIC A;  1NSA A;  1Y7R A;  2ABZ A;  2PQ8 A;  3FVL A;  2ZEL A;  4F8Z A;  1YLE A;  4OC1 A;  1BPM A;  2J9A A;  3GLJ A;  1IID A;  1P4N A;  4IF5 A;  1N71 A;  3N5F A;  2QYV A;  3TFY A;  3KZW A;  4F9U A;  4NEX A;  5AGE A;  3B3C A;  1YR0 A;  2IL4 A;  2WZN A;  4L89 A;  2ZW7 A;  5G20 A;  3NFZ A;  1I12 A;  3SXN A;  4CGP A;  4XPD C;  2OZH A;  4UCP A;  2XEG A;  2F8H A;  2POK A;  3IGR A;  3KAS A;  3R1K A;  3CXS A;  1P0H A;  4HNW B;  3EC4 A;  4P4J A;  3D68 A;  3K9U A;  4CPA A;  2IJZ A;  3KQX A;  3EFA A;  3RYO A;  2Q4Y A;  4XPD B;  3D3S A;  2PSW A;  4UBR A;  3TO6 A;  4NGN A;  1Q2Y A;  4YWY A;  3W6X A;  4C68 A;  3PRT A;  4R3K A;  4A2Z A;  2OB0 A;  2GU2 A;  4ZX8 A;  3BHX A;  4AVA A;  3SJE A;  7CPA A;  3GYA A;  4CGM A;  2AJ6 A;  2PJ4 A;  4EFD A;  5DWM A;  3CT9 A;  1QST A;  2QIR A;  3DR6 A;  1DTD A;  1R43 A;  2KCW A;  2FT0 A;  1CM0 A;  4U9Z A;  1CP6 A;  1S7L A;  2CY2 A;  1XFO A;  1MJA A;  1YRE A;  3ISX A;  2JEV A;  2ZW6 A;  4KSA A;  2OR4 A;  4W9Y A;  5KTC A;  4IUS A;  1XRY A;  1Y0Y A;  1UFH A;  2R98 A;  4P4I A;  3R9G A;  3PFE A;  4BIN A;  1L0C A;  2ZPA A;  1NSL A;  2PVV A;  4PXC A;  4FBE A;  4M6H A;  4OAE A;  5JH9 A;  3PB4 X;  2PE3 A;  3B8G A;  5JGF A;  3RNZ A;  1VHO A;  3CXP A;  3WC7 A;  4G1P A;  4UFW A;  4C2Y A;  1LAN A;  4ZI6 A;  2RC4 A;  1BPN A;  4QC6 A;  4QVT A;  5KTD A;  4KOS A;  2FVG A;  1B6B A;  3F5B A;  3T8W A;  2C6G A;  2Q4Z A;  2RB7 A;  5F48 A;  4MFQ A;  2B5G B;  3NH4 A;  4CAW A;  1R3N A;  1U6M A;  2FS5 A;  4B10 A;  1S5K A;  4JXQ A;  3TE4 A;  5CNP A;  3MRU A;  1PUA A;  4OME A;  4YU9 A;  4ZX9 A;  3UY5 A;  3SJF A;  2B5G A;  1WWZ A;  3VWD A;  4KOW A;  3CXQ A;  3P2H A;  2PR1 A;  2VZY A;  3IWG A;  4KVM E;  4MY3 A;  4DJL A;  5LYL A;  2DEA A;  3LOD A;  3S6G A;  2Q04 A;  5EC4 A;  3WC5 A;  1RO5 A;  1XMB A;  4KZT A;  2GRE A;  3C26 A;  2Z3L A;  4RI1 A;  1TF9 A;  3NE7 A;  4E2A A;  4ZYQ A;  4CYO A;  3D2M A;  5ISV A;  1ZO0 A;  2G3T A;  2H5M A;  1FY7 A;  2PR8 A;  1Z4E A; 
#chains in the Genus database with same CATH homology
 2G3A A;  2CNM A;  2D4O A;  5I0C A;  2ATR A;  4KLW A;  4MBU A;  5G1Z A;  4AVC A;  5A28 A;  3LD2 A;  2EVN A;  2DPT A;  4R87 A;  3TT2 A;  2D4P A;  2A4N A;  1Y9K A;  2P0W A;  2WUU A;  4B14 A;  1OZP A;  3G3S A;  2B58 A;  3QB8 A;  4KOU A;  2NMT A;  3KKW A;  4DNC A;  1S60 A;  4I49 A;  1XF8 A;  2FCK A;  2YND A;  2J8R A;  2Z3N A;  2Z3O A;  2HQY A;  2FL4 A;  5AG4 A;  3TO9 A;  3FB3 A;  3EXN A;  5FVJ A;  5JPH A;  2GE3 A;  1VHS A;  1ON0 A;  1Z4R A;  2PDO A;  3A9L A;  3PZJ A;  4AB7 A;  1J4J A;  2VBQ A;  3JVN A;  4U9Y A;  2Z3P A;  1M4D A;  1RXT A;  4PK3 A;  4XNH B;  2OZU A;  2YGW A;  1Q2D A;  2ZW4 A;  4QBJ A;  2Q4V A;  5F47 A;  4KOY A;  3JTK A;  5HH1 A;  4J3G A;  3H4Q A;  4X5K A;  4CGL A;  4MFL A;  4XPK A;  3DNS A;  4ORF A;  1YVK A;  2CXA A;  1GHE A;  2R7H A;  2QEC A;  2OZG A;  4KSF A;  2FIW A;  4KVX A;  4AG9 A;  3V8I A;  2DXQ A;  2Y0M A;  4KOV A;  2PC1 A;  4PV6 A;  1IYL A;  3I9S A;  3G8W A;  5A27 A;  3DSB A;  4KLV A;  4PK2 A;  4YGO A;  4A32 A;  4MJ8 A;  1BOB A;  2R8V A;  4KS9 A;  3OWC A;  2GIV A;  5DWN A;  4C2X A;  2GAN A;  3D8P A;  2P6F A;  3FIX A;  3T9Y A;  3F8K A;  3P2F A;  5EBV A;  5AG7 A;  3S6K A;  2G0B A;  1VKC A;  1WK4 A;  4ONU A;  4CGO A;  4CAX A;  3PGP A;  2WSA A;  5JQ4 A;  2AE6 A;  2X7B A;  1PU9 A;  2CNT A;  2VI7 A;  1XEB A;  4QB9 A;  2B3U A;  3ZJ0 A;  4H89 A;  5G22 A;  1M4G A;  2VZZ A;  4FD6 A;  4FD7 A;  4UCN A;  3TTH A;  2PRB A;  4NSQ A;  3TOB A;  3E0K A;  2YNC C;  2HUZ A;  1S3Z A;  3R96 A;  4KOT A;  1R57 A;  1MK4 A;  4B13 A;  2F5I A;  4JXR A;  1BO4 A;  3MGD A;  3PP9 A;  2B4D B;  1S7K A;  4M3S A;  4MFP A;  4UFV A;  4CYP A;  2JLM A;  2P6E A;  2YNC A;  3TOA A;  4LUA A;  4BBH A;  2B4D A;  2B3V A;  2P6G A;  4MFK A;  4CAE A;  4C7H A;  4H6U A;  3QAH A;  2O28 A;  4ZBG A;  3BLN A;  2R1I A;  4GS4 A;  5AG5 A;  2YNE A;  4CRZ B;  4MI4 A;  5H86 A;  1Z9U A;  4XNH C;  4A33 A;  2Z11 A;  4JWP A;  4U5Y A;  4Y49 B;  4ZGY B;  1MJB A;  4R3L A;  5E96 A;  3FYN A;  1TIQ A;  1M44 A;  4OLL A;  1IB1 E;  1NMT A;  4NCZ A;  1S7F A;  4MHD A;  3WR7 A;  3GKR A;  3DDD A;  4A30 A;  1I21 A;  3IU1 A;  4B5O A;  2EUI A;  2JDC A;  4Q36 A;  4H6Z A;  5F46 A;  2I00 A;  4YFJ A;  3DR8 A;  4B12 A;  4KUB A;  1NE9 A;  2C27 A;  4UWJ A;  2BL1 A;  4II9 A;  4NXY A;  2J8N A;  3H5Z A;  3BJ8 A;  1XMT A;  1XE4 A;  3R9F A;  2FE7 A;  4BMH A;  5KTA A;  2Q44 A;  4UWI A;  2WPX A;  4MY0 A;  4JJX A;  3JUW A;  1QSM A;  4AG7 A;  2Q7B A;  2BEI A;  4A95 A;  3EO4 A;  3R9E A;  4K30 A;  4CRY B;  3S6H A;  4CYQ A;  5C88 A;  3EY5 A;  1YGH A;  1K4J A;  4UA3 A;  1CJW A;  3FXT A;  3N7Z A;  1YVO A;  2REF A;  5GCN A;  3TO7 A;  2Z3K A;  4AVB A;  2DPS A;  3TCV A;  4XPL A;  3BJ7 A;  3R95 A;  4HNY B;  4QUS A;  4UFX A;  2VXK A;  1I1D A;  4KUA A;  1B87 A;  2REE A;  1QSN A;  2J8M A;  2OH1 A;  3W6S A;  2OU2 A;  4NF1 A;  4MFZ A;  4CAV A;  4R57 A;  5HMN A;  4MFJ A;  1IYK A;  2FSR A;  2Z3M A;  4JLY A;  4KVO E;  3GY9 A;  2VQY A;  1QSR A;  2VEZ A;  3D2P A;  1LRZ A;  1Q2C A;  4CS0 B;  1Y9W A;  2K5T A;  4YRH A;  1KZF A;  1M4I A;  4A31 A;  4R9M A;  2ARH A;  2QML A;  4M85 A;  4Q38 A;  4B11 A;  5J8C A;  5BWA B;  4HKF A;  5J8F A;  1KUV A;  3F0A A;  4L8A A;  1KUY A;  3VWE A;  3T90 A;  2JDD A;  2B4B A;  4OAD A;  5C82 A;  4EVY A;  2FXF A;  3IU2 A;  5F49 A;  2ZW5 A;  5IB0 A;  4KOR A;  3FRM A;  3S6F A;  3ZZI A;  1S7N A;  4CYN A;  1MJ9 A;  4E8O A;  1KUX A;  4Y49 C;  4LX9 A;  1YX0 A;  5IV0 A;  4B5P B;  2CNS A;  4CAF A;  3FBU A;  3IWE A;  4HNX B;  3SXO A;  4F0Y A;  4F6A A;  4B5P A;  5IX3 A;  1QSO A;  4RS2 A;  4FD5 A;  1M1D A;  4PSW A;  5H84 A;  2I79 A;  4E0A A;  2Q0Y A;  3FNC A;  2Z10 A;  4UCM A;  3W91 A;  1V0C A;  4FD4 A;  2FIA A;  4C7I A;  1XIX A;  4JD6 A;  2ZXV A;  5G21 A;  4C2Z A;  1SQH A;  4CGN A;  4KOX A;  2WPW A;  2BUE A;  1YK3 A;  2BSW A;  2HV2 A;  3I3G A;  4PSX A;  5AG6 A;  3SHP A;  2Z0Z A;  1IIC A;  2PQ8 A;  1Y7R A;  1YLE A;  1IID A;  1P4N A;  4IF5 A;  1N71 A;  3TFY A;  4NEX A;  5AGE A;  1YR0 A;  2IL4 A;  4L89 A;  2ZW7 A;  5G20 A;  3SXN A;  1I12 A;  4CGP A;  4XPD C;  2OZH A;  4UCP A;  3IGR A;  3R1K A;  3CXS A;  1P0H A;  4HNW B;  3EC4 A;  3K9U A;  4F0X A;  3EFA A;  3RYO A;  2Q4Y A;  4XPD B;  3D3S A;  2PSW A;  4UBR A;  3TO6 A;  3W6X A;  1Q2Y A;  4C68 A;  4R3K A;  4A2Z A;  2OB0 A;  4AVA A;  3GYA A;  4CGM A;  2AJ6 A;  5DWM A;  1QST A;  2QIR A;  3DR6 A;  2KCW A;  2FT0 A;  1CM0 A;  4U9Z A;  1S7L A;  2CY2 A;  1MJA A;  1YRE A;  2JEV A;  2ZW6 A;  4KSA A;  5KTC A;  4IUS A;  1UFH A;  2R98 A;  3R9G A;  1L0C A;  2ZPA A;  1NSL A;  4OAE A;  3B8G A;  3CXP A;  4UFW A;  4C2Y A;  2RC4 A;  4QC6 A;  4QVT A;  5KTD A;  4KOS A;  1B6B A;  3F5B A;  5F48 A;  4MFQ A;  2B5G B;  4CAW A;  3TE4 A;  1U6M A;  2FS5 A;  4B10 A;  1S5K A;  4JXQ A;  5CNP A;  1PUA A;  3UY5 A;  2B5G A;  1WWZ A;  3VWD A;  4KOW A;  3CXQ A;  3P2H A;  2PR1 A;  2VZY A;  3IWG A;  4KVM E;  4MY3 A;  3LOD A;  3S6G A;  2Q04 A;  5EC4 A;  1RO5 A;  4KZT A;  3C26 A;  2Z3L A;  4RI1 A;  3NE7 A;  4E2A A;  4CYO A;  3D2M A;  5ISV A;  1ZO0 A;  2G3T A;  2H5M A;  1FY7 A;  2PR8 A;  1Z4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...