3EO4A

The crystal structure of a domain from methanocaldococcus jannaschii dsm 2661
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
162
structure length
158
Chain Sequence
ANCKKSKIIIRQITDNDLELLMAWRSNPLIYKFFYIQKEPLKWEEHYSWWMSRENRVDWIILLRENNTIRKVGSVNVSQLNTDNPEIGILIGEFFLWGKHIGRHSVSLVLKWLKNIGYKKAHARILENNIRSIKLFESLGFKKTKKGRENEWIYEVNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of a domain from Methanocaldococcus jannaschii DSM 2661
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein MJ1062
total genus 43
structure length 158
sequence length 162
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3eo4A00
1XIXA 1I21A 1RO5A 2AE6A 4RI1A 1K4JA 1WK4A 3V8IA 3ZZIA 1M1DA 4NSQA 2D4PA 1S7NA 3CXSA 3R96A 2ATRA 4ONUA 4JWPA 3TE4A 5E96A 2OU2A 1YX0A 1GHEA 5GCNA 3JVNA 5FVJA 4MY3A 1YREA 2Z10A 3GY9A 5H84A 3BLNA 3QAHA 2VZYA 3PP9A 4Y49C 2WPWA 5C88A 3D2PA 3FXTA 4PK3A 2AJ6A 4IF5A 3RYOA 1Z4EA 4ORFA 4MY0A 4QC6A 3D8PA 2GIVA 2VQYA 1Q2CA 2ZW4A 1B6BA 1R57A 4KOTA 2FXFA 3DR8A 4KOXA 3P2FA 1QSTA 2QMLA 4R87A 2Z0ZA 3FNCA 1QSRA 3S6GA 2ZXVA 3PGPA 1LRZA 1XMTA 4U5YA 2HV2A 4E8OA 4CAXA 1FY7A 2BL1A 2Q7BA 3NE7A 3LODA 2Q44A 1NMTA 1YVKA 4DNCA 4XPLA 4B5PB 4KUAA 3TTHA 2B4DB 3F8KA 4KOYA 2PDOA 3I9SA 1KZFA 4R9MA 1BO4A 1CJWA 2P6GA 4FD5A 1PU9A 1S7KA 1MK4A 1MJ9A 2G3AA 2HUZA 2VXKA 5HMNA 2OZUA 2KCWA 3D2MA 3TOBA 2DXQA 2P6EA 2JEVA 2VI7A 1S3ZA 4L8AA 3R95A 1Z9UA 4FD4A 3DDDA 3E0KA 1NE9A 1YGHA 2I00A 4XPDC 1Y9KA 2PSWA 1YVOA 5DWNA 3F5BA 1N71A 2FCKA 2J8RA 1M4GA 4X5KA 1XF8A 1SQHA 1U6MA 2B4DA 4KORA 2FE7A 3DR6A 5CNPA 2CNSA 3W6XA 4BMHA 3GYAA 4MHDA 4R3KA 2Q4VA 4XNHB 1PUAA 2B3VA 3TCVA 2FSRA 4QB9A 3G3SA 4UWJA 1M44A 3C26A 4CRZB 1QSNA 3BJ8A 3IGRA 3EO4A 2OZGA 3F0AA 5J8CA 4K30A 2ZW7A 5ISVA 4KUBA 4E0AA 4II9A 4F6AA 4M3SA 2P6FA 4H6ZA 4CAWA 1KUXA 1MJBA 4KVOE 3EY5A 2VZZA 1ON0A 2FT0A 1Q2DA 4MI4A 2PR1A 1Y9WA 1BOBA 2WPXA 2BUEA 5J8FA 2A4NA 1KUVA 4MJ8A 4NEXA 2H5MA 3P2HA 5F47A 3WR7A 4AB7A 1VHSA 4AG9A 2G3TA 2OZHA 4I49A 3T9YA 5IV0A 3FBUA 1MJAA 4HKFA 1L0CA 4KOSA 2ZW6A 2CY2A 3W6SA 2R1IA 3D3SA 4NCZA 2VEZA 2K5TA 3SXNA 4L89A 4YFJA 4PSWA 3MGDA 1IIDA 4LX9A 3FYNA 5H86A 5F46A 1TIQA 1YR0A 4JXQA 4AVCA 5JPHA 2FIAA 3H4QA 4FD7A 4KVME 2F5IA 4KOVA 5DWMA 2PQ8A 3UY5A 1WWZA 3CXQA 3K9UA 3OWCA 2ZPAA 5JQ4A 4HNWB 3SHPA 4KLWA 2Q4YA 4NF1A 1I12A 3S6FA 3FRMA 2FS5A 3R9EA 4OAEA 2OH1A 1IYKA 2QIRA 1S60A 5KTDA 5KTAA 3EC4A 3IWGA 4B5OA 4H6UA 4HNXB 4YRHA 4U9ZA 2C27A 4KOUA 3W91A 4PSXA 4AVAA 4KVXA 2GANA 3B8GA 4JLYA 4XNHC 2X7BA 2CNMA 4JXRA 3EXNA 2CNTA 2B4BA 3SXOA 4F0YA 1P4NA 5F48A 2HQYA 1S5KA 3FIXA 3BJ7A 4PV6A 2EVNA 4UBRA 1XE4A 2G0BA 4YGOA 1KUYA 2Y0MA 5IB0A 2Z11A 1UFHA 3FB3A 4R57A 2REFA 3R9FA 2PC1A 1I1DA 3S6HA 3TO6A 2FL4A 3TO9A 2JDDA 2VBQA 1S7FA 2BSWA 1Q2YA 3KKWA 5C82A 3DSBA 2PR8A 4JD6A 2Q0YA 5IX3A 2PRBA 2EUIA 5I0CA 2FIWA 3ZJ0A 1J4JA 2QECA 4E2AA 4M85A 3TFYA 5EC4A 4R3LA 4NXYA 3VWDA 2JLMA 5F49A 3PZJA 1CM0A 1QSMA 3TOAA 2D4OA 4KOWA 3EFAA 4EVYA 1P0HA 4KLVA 3VWEA 2B58A 2NMTA 4Y49B 3LD2A 1IB1E 2P0WA 1M4DA 1NSLA 1YLEA 3G8WA 4ZBGA 4J3GA 4MBUA 2GE3A 4XPKA 4RS2A 2O28A 5KTCA 2R7HA 2B3UA 4B5PA 5EBVA 5HH1A 4CS0B 1OZPA 1XEBA 3R9GA 2B5GA 3GKRA 4H89A 3DNSA 1VKCA 3JUWA 4QVTA 3TO7A 2REEA 1Z4RA 2JDCA 2BEIA 2OB0A 4QUSA 1QSOA 2B5GB 4GS4A 3R1KA 4JJXA 2R8VA 4PK2A 2J8NA 4HNYB 4CAVA 3S6KA 4AG7A 4CRYB 3CXPA 4QBJA 4KZTA 2R98A 4IUSA 1IICA 3I3GA 4U9YA 4OLLA 3T90A 1M4IA 3TT2A 4FD6A 4LUAA 1V0CA 4UWIA 2J8MA 2IL4A 1YK3A 1B87A 4XPDB 2ARHA 4UA3A 2ZW5A 4OADA 1Y7RA 4AVBA 1S7LA 3N7ZA 2RC4A 1RXTA 2I79A 2Q04A 1IYLA 3QB8A
chains in the Genus database with same CATH superfamily
5JM6A 3D68A 2Q7SA 2AFOA 5D29A 4MHZA 1XIXA 1I21A 4A95A 4AXVA 1RO5A 4KSAA 2AE6A 4RI1A 1K4JA 3BI0A 1EE3P 3KQXA 4MHNA 4PQAA 1WK4A 4RN7A 3V8IA 3ZZIA 4CGNA 1M1DA 1LAPA 3PFOA 2Q4ZA 4NSQA 2D4PA 4B10A 3N5FA 1S7NA 3CXSA 3FEEA 3R96A 4H2KA 2ATRA 4ZX9A 4IHMA 4JWPA 4ONUA 4PXCA 3TE4A 4UEZA 3FH4A 4MFLA 4R7MA 5E96A 3WT4A 4DJLA 2ZEPA 2OU2A 4O23A 1YX0A 4CGLA 1GHEA 4PXEA 5GCNA 3JVNA 3FX6A 5FVJA 2ZOGA 4M6GA 3TX8A 2Q43A 4MY3A 1HDUA 1YREA 3IU2A 3VATA 4P4DA 5J1QA 2Z10A 3GY9A 4P4EA 5DS0A 3BLNA 5H84A 3KASA 3QAHA 2ZEDA 2EK8A 2VZYA 3PP9A 2WPWA 4Y49C 2Z3NA 5C88A 3K2KA 3PRTA 3D2PA 3ISXA 2GLJA 3RO0A 4UFXA 3NA6A 3NH8A 3FXTA 4CYOA 4PK3A 5AG7A 5LYDA 2AJ6A 3D7FA 3WC6A 4IF5A 3RYOA 1Z4EA 2YNDA 4ORFA 3PB4X 4MY0A 3VH9A 1JWQA 1TXRA 1Z5RA 4QC6A 4MRIA 3D8PA 3B35A 4A2ZA 2GIVA 2IJZA 2VQYA 2EWBA 1Q2CA 2WSAA 3CT9A 4NJQA 3KHXA 2ZW4A 4KSFA 1B6BA 1R57A 4KOTA 3GUXA 4NGMA 1KWMA 2FXFA 2CTBA 3DR8A 4KOXA 2ABZA 4ZY2A 2WZNA 3P2FA 4X3RA 1QSTA 2QMLA 4DUKA 1XRYA 4NGNA 4R87A 2PJ9A 2Z0ZA 3CZXA 3FNCA 2Q51A 1QSRA 3S6GA 5BWAB 2ZXVA 3QNVA 4OP4A 4P4BA 3WC5A 3PGPA 1TKJA 4F0XA 1LRZA 1XMTA 2V8VA 2HV2A 4U5YA 2Z3PA 4CAXA 4E8OA 1F2PA 1FY7A 2BL1A 2QVPA 2Q7BA 2RFHA 3NE7A 1AMPA 3LODA 2CF4A 1Q7LA 2Q44A 1NMTA 4UEFA 1YVKA 4OC3A 2EK9A 4DNCA 4XPLA 3KI9A 3B3VA 5D8NA 4B5PB 3SJFA 4KUAA 4MFKA 3TTHA 2B4DB 7CPAA 3F8KA 4KOYA 2PDOA 3I9SA 3K9TA 3NE8A 1KZFA 4UIAA 3PFEA 4R9MA 1BO4A 3PBEA 3B2YA 5EMIA 5K8NA 1CJWA 2P6GA 4FD5A 4G1PA 1Z8TA 4KSIA 3WC7A 2C6PA 1PU9A 1S7KA 3D7GA 5AG4A 1MK4A 1MJ9A 1PCAA 2QJ8A 4HPSA 4OIDA 4CGPA 2G3AA 2HUZA 2VXKA 3IC1A 5HMNA 1CPXA 4NGPA 2C6CA 2BO9A 2OZUA 1ZG7A 2CIJA 3H5ZA 4NGTA 2KCWA 1FNOA 4NGSA 4P4FA 3D2MA 2ZEGA 3TOBA 4P4IA 4MXUA 4P44A 1QMUA 2DXQA 2P6EA 1DE4C 2JEVA 2VI7A 2XEGA 1ZG8A 4YWYA 1S3ZA 4L8AA 4OC0A 3R95A 3H8EA 1Z9UA 4FD4A 4NJRA 2AFUA 3PB7X 3DDDA 1IGBA 3E0KA 4ZY0A 1NE9A 1YGHA 2I00A 1XJOA 4XPDC 1Y9KA 1LFWA 4X8IA 2O4HA 2PE3A 2PSWA 2PJAA 4UEEA 1YVOA 5DWNA 3F5BA 1N71A 4OC4A 1LAMA 1ZG9A 2O53A 3B3CA 4MFPA 2FCKA 4R8FA 2J8RA 1M4GA 2WUUA 3LWUA 4NGQA 2AFSA 2ZEHA 4UFWA 4X5KA 1ZLHA 1XF8A 3PEIA 1M4LA 4F9VA 1SQHA 1U6MA 2B4DA 4KORA 2FE7A 3DR6A 5CNPA 3L2NA 1AUGA 1YW4A 2CNSA 3W6XA 3WABA 4MCSA 4BMHA 3S9MA 1YQEA 3GYAA 4MHDA 4R3KA 2G9DA 2Q4VA 2PCUA 2XEIA 3KR5A 3VARA 4CGOA 5K8OA 4XNHB 3FMCA 1PUAA 2PJ4A 2B3VA 3TCVA 4A31A 2FSRA 3KZWA 3PBBA 1ARLA 3SJEA 4QB9A 5ELYA 3G3SA 4UWJA 1M44A 2WYRA 3C26A 4CRZB 3PB6X 1RTQA 1QSNA 3BJ8A 4CAEA 1XFOA 2YNEA 3IGRA 3FVLA 4UCNA 3EO4A 5LYFA 2OZGA 2VL1A 3F0AA 5J8CA 1VHEA 4K30A 1AYEA 2ZW7A 5HXDA 5ISVA 1LCPA 4KUBA 3D4UA 4E0AA 4II9A 1LOKA 1ELLP 4M3SA 4F6AA 3JTKA 2P6FA 4H6ZA 4CAWA 1IU8A 1KUXA 4FBEA 5JH9A 1MJBA 4KVOE 1R43A 3EY5A 3RAMA 1IY7A 5AGEA 2PVWA 2VZZA 1ON0A 4Z65A 2FT0A 1Q2DA 1VIXA 4MI4A 2PR1A 3SJGA 1Y9WA 1BPNA 4UCMA 3KL9A 2ZENA 4C2XA 1VHOA 1BOBA 2PJCA 2WPXA 3FEDA 2BUEA 2PJ5A 4ZYQA 2Z3OA 5J8FA 2A4NA 4W9YA 1KUVA 2JBJA 4MJ8A 4C2ZA 4P45A 4NEXA 1X12A 2H5MA 3P2HA 3T8WA 5F47A 3WR7A 4LQ6A 4WJBA 3V38A 4AB7A 5LYIA 1VHSA 3BHXA 4AG9A 2G3TA 2OZHA 2EO8A 2V8GA 4I49A 3T9YA 4BINA 5IV0A 3FBUA 1MJAA 4HKFA 1L0CA 2PJ0A 3LMSA 1CP7A 2ZEMA 4KOSA 2ZW6A 2CY2A 3IJ3A 3KQZA 3W6SA 2R1IA 1OBRA 3D3SA 4ONWA 1HEEA 2GU2A 4NCZA 3B3WA 2VEZA 4Q7AA 5LRJA 4BD9A 1Y0YA 3KGQA 1Z2LA 2K5TA 3SXNA 4L89A 4YFJA 4PSWA 3NH4A 2C1CA 3MGDA 1IIDA 4LX9A 5CBMA 3CPAA 4EWTA 2GFQA 4C7HA 3FYNA 5H86A 5F46A 3D66A 1TIQA 2XEJA 1YR0A 2AFWA 2XEFA 4JXQA 4AVCA 4CPAA 5G22A 2AFXA 2PJ8A 5JPHA 2FIAA 3H4QA 4FD7A 3A9LA 4M6HA 4MFQA 3V7ZA 2I3CA 3IIBA 1TF9A 2BCOA 4ZY1A 4KVME 4C68A 2F5IA 3D7DA 4KOVA 5DWMA 3KHZA 1TKFA 1HDQA 5THWA 8CPAA 2PRQA 4CGMA 3SJXA 1IOIA 2PQ8A 5LRKA 2GLFA 3PB8X 3RBUA 2RB7A 3UY5A 1WWZA 2PJBA 3CXQA 4CYNA 4PXBA 3K9UA 2PVVA 3OWCA 2ZPAA 5K8MA 2F7VA 3DLJA 5JQ4A 4HNWB 4FWUA 3SHPA 5LYLA 4B6ZA 3SI1A 2ZOFA 4KLWA 5G20A 2Q4YA 5K8PA 5IB9A 4NF1A 1I12A 3S6FA 3FRMA 2FS5A 3R9EA 1PYTB 4B11A 4OAEA 4C7IA 3DGVA 4DYOA 2OH1A 2F8HA 4MMOA 4OC5A 1IYKA 1YW6A 2QIRA 1S60A 2NYQA 4GM5A 2GREA 2YNCC 3EC4A 5KTAA 5KTDA 4A94A 3IWGA 4B5OA 2Z3MA 4H6UA 4HNXB 4YRHA 2DPSA 4U9ZA 2C27A 2ZEEA 4KOUA 4MFZA 2Z3LA 3HLPA 1Z8XA 1X10A 3W91A 1F2OA 2OOTA 4A30A 2OR4A 4PSXA 5LRGA 4AVAA 5JGFA 1ELMP 4KVXA 3QAYA 4FUUA 3RZAA 2ZEFA 4UF4A 3LACA 2GANA 5CPAA 3B8GA 2V77A 4JLYA 4OKOA 4XNHC 2X7BA 1R3NA 2CNMA 2J9AA 4JXRA 4Q38A 4NGRA 1H8LA 3EXNA 3MRUA 4ZI6A 3RNZA 1YLOA 4TWEA 3BXMA 2CNTA 4MCQA 2B4BA 4LQGA 3S9NA 3SXOA 3KR4A 1P4NA 4F0YA 5F48A 2HQYA 2IMOA 1S5KA 1GYTA 4B13A 3FIXA 4OC1A 4WWVA 3BJ7A 2C6GA 4PV6A 2EVNA 4UBRA 1XE4A 2G0BA 4YGOA 1KUYA 2Y0MA 5IB0A 2HB6A 3B7IA 1TKHA 2Z11A 1UFHA 1NSAA 3FB3A 4R57A 3IFEA 4MCPA 2ANPA 1CP6A 2REFA 3R9FA 3B3TA 4GXHA 2PC1A 1I1DA 3S6HA 4F9UA 3TO6A 4A32A 4FAIA 2FL4A 3CDXA 2JDDA 1Z8WA 3TO9A 2VBQA 2JBKA 1S7FA 3MN8A 4A33A 2BSWA 1Q2YA 3KKWA 5C82A 3DSBA 2PR8A 4ZX8A 4JD6A 4PPZA 3D7HA 2Q0YA 3H8GA 5HVHA 5IX3A 3FECA 2PRBA 3GB0A 2EUIA 1BLLE 5I0CA 2FIWA 4KS9A 4R6TA 5AG6A 1J4JA 3ZJ0A 4P10A 1YMEA 3D67A 2QECA 3HUVA 4E2AA 4M85A 2DF5A 2EBJA 4B14A 3TFYA 1IOFA 5EC4A 4R3LA 4P4JA 4NXYA 1CG2A 1VGYA 4YU9A 2JLMA 1BPMA 3TC8A 5F49A 3VWDA 3PZJA 2PIZA 4PXDA 1CM0A 6CPAA 4OIWA 1QSMA 1F57A 1XBUA 3NFZA 3TOAA 2IQ6A 2D4OA 4UCPA 4C2YA 4KOWA 4MFJA 4RUHA 3EFAA 1ZO0A 2ZELA 4EVYA 1P0HA 4KLVA 4A39A 3VWEA 2B58A 2NMTA 5AG5A 4Y49B 3LD2A 1BAVA 1IB1E 2P0WA 2PJ3A 1M4DA 1NSLA 1YLEA 2POKA 2Z3KA 4CYPA 3G8WA 4ZBGA 3FF3A 3GIUA 4J3GA 2GE3A 4MBUA 4RS2A 4XPKA 1XOVA 2O28A 1ARMA 5KTCA 2PJ6A 2R7HA 3SI0A 2BOAA 1DTDA 3S9LA 3JRUA 2B3UA 2YGWA 2V8HA 1TF8A 4OMEA 5EBVA 5HH1A 4B5PA 4CS0B 2PJ2A 1OZPA 1XEBA 3R9GA 1ZLIA 2B5GA 3IU1A 2QYVA 3GKRA 4H89A 3DNSA 1VKCA 3NH5A 4JYWA 5G21A 3BI1A 1CX8A 3JUWA 4B12A 4UFVA 4QVTA 3IWEA 5G1ZA 3TO7A 2REEA 1Z4RA 2JDCA 1UWYA 2BEIA 1A2ZA 2OB0A 1FT7A 4QUSA 5F09A 2YNCA 1QSOA 2B5GB 2ODFA 3IO1A 4GS4A 3H8FA 1LANA 1QQ9A 4EMEA 1CBXA 3R1KA 2R8VA 4JJXA 4MCRA 4PK2A 2J8NA 4OC2A 4HNYB 4CAVA 2CTCA 4M6IA 3S6KA 4AG7A 4CRYB 3CXPA 3GLJA 5I4MA 3I1UA 5HVGA 4QBJA 4KZTA 3ISZA 2ZEOA 2R98A 4IUSA 4NFRA 3IEHA 3IWWA 1Z8LA 1IICA 2PIYA 2PJ7A 2V8DA 4BBHA 1XMBA 1YSJA 3I3GA 4U9YA 4X2TA 4EFDA 4OLLA 2PJ1A 2NSMA 3CPXA 5A28A 4A38A 1Y7EA 1JQGA 4K3NA 3SI2A 3T90A 3B3SA 4JZ0A 4R76A 1M4IA 3TT2A 2AFMA 2CXAA 4FD6A 1V0CA 4LUAA 2DPTA 4MHYA 4UWIA 2DEAA 2J8MA 4UIBA 2IL4A 1YK3A 1B87A 4XPDB 4IK2A 2ARHA 4TNUA 4UA3A 2ZW5A 5HVFA 4CAFA 4OADA 1CPSA 1Y7RA 2FVGA 4CYQA 4IAVA 4F8ZA 4A37A 4AVBA 4ZGYB 2JEWA 1S7LA 2HC9A 2RC4A 3N7ZA 1RXTA 4P6YA 5A27A 4MHPA 2AFZA 1Y0RA 2I79A 2Q04A 3FJUA 1IYLA 4Q36A 3PB9X 3QB8A
chains in the Genus database with same CATH topology
1XIXA 1I21A 4A95A 1RO5A 4KSAA 2AE6A 4RI1A 1K4JA 1WK4A 3V8IA 3ZZIA 4CGNA 1M1DA 4NSQA 2D4PA 4B10A 1S7NA 3CXSA 3R96A 2ATRA 4ONUA 4JWPA 3TE4A 4MFLA 5E96A 2OU2A 1YX0A 4CGLA 1GHEA 5GCNA 3JVNA 5FVJA 4MY3A 1YREA 3IU2A 2Z10A 3GY9A 5H84A 3BLNA 3QAHA 2VZYA 3PP9A 4Y49C 2WPWA 5C88A 2Z3NA 3D2PA 4UFXA 3FXTA 4CYOA 4PK3A 5AG7A 2AJ6A 4IF5A 3RYOA 1Z4EA 2YNDA 4ORFA 4MY0A 4QC6A 3D8PA 4A2ZA 2GIVA 2VQYA 1Q2CA 2WSAA 2ZW4A 4KSFA 1B6BA 1R57A 4KOTA 2FXFA 3DR8A 4KOXA 3P2FA 1QSTA 2QMLA 4R87A 2Z0ZA 3FNCA 1QSRA 3S6GA 5BWAB 2ZXVA 3PGPA 4F0XA 1LRZA 1XMTA 4U5YA 2HV2A 4E8OA 2Z3PA 4CAXA 1FY7A 2BL1A 2Q7BA 3NE7A 3LODA 2Q44A 1NMTA 1YVKA 4DNCA 4XPLA 4B5PB 4KUAA 4MFKA 3TTHA 2B4DB 3F8KA 4KOYA 2PDOA 3I9SA 1KZFA 4R9MA 1BO4A 1CJWA 2P6GA 4FD5A 1PU9A 1S7KA 5AG4A 1MK4A 1MJ9A 4CGPA 2G3AA 2HUZA 2VXKA 5HMNA 2OZUA 3H5ZA 2KCWA 3D2MA 3TOBA 2DXQA 2P6EA 2JEVA 2VI7A 1S3ZA 4L8AA 3R95A 1Z9UA 4FD4A 3DDDA 3E0KA 1NE9A 1YGHA 2I00A 4XPDC 1Y9KA 2PSWA 1YVOA 5DWNA 3F5BA 1N71A 4MFPA 2FCKA 2J8RA 1M4GA 2WUUA 4UFWA 4X5KA 1XF8A 1SQHA 1U6MA 2B4DA 4KORA 2FE7A 3DR6A 5CNPA 2CNSA 3W6XA 4BMHA 3GYAA 4MHDA 4R3KA 2Q4VA 4CGOA 4XNHB 1PUAA 2B3VA 3TCVA 4A31A 2FSRA 4QB9A 3G3SA 4UWJA 1M44A 3C26A 4CRZB 1QSNA 3BJ8A 4CAEA 2YNEA 3IGRA 4UCNA 3EO4A 2OZGA 3F0AA 5J8CA 4K30A 2ZW7A 5ISVA 4KUBA 4E0AA 4II9A 4F6AA 4M3SA 3JTKA 2P6FA 4H6ZA 4CAWA 1KUXA 1MJBA 4KVOE 3EY5A 5AGEA 2VZZA 1ON0A 2FT0A 1Q2DA 4MI4A 2PR1A 1Y9WA 4UCMA 4C2XA 1BOBA 2WPXA 2BUEA 2Z3OA 5J8FA 2A4NA 1KUVA 4MJ8A 4C2ZA 4NEXA 2H5MA 3P2HA 5F47A 3WR7A 4AB7A 1VHSA 4AG9A 2G3TA 2OZHA 4I49A 3T9YA 5IV0A 3FBUA 1MJAA 4HKFA 1L0CA 4KOSA 2ZW6A 2CY2A 3W6SA 2R1IA 3D3SA 4NCZA 2VEZA 2K5TA 3SXNA 4L89A 4YFJA 4PSWA 3MGDA 1IIDA 4LX9A 4C7HA 3FYNA 5H86A 5F46A 1TIQA 1YR0A 4JXQA 4AVCA 5G22A 5JPHA 2FIAA 3H4QA 4FD7A 3A9LA 4MFQA 4KVME 4C68A 2F5IA 4KOVA 5DWMA 4CGMA 2PQ8A 3UY5A 1WWZA 3CXQA 4CYNA 3K9UA 3OWCA 2ZPAA 5JQ4A 4HNWB 3SHPA 4KLWA 5G20A 2Q4YA 4NF1A 1I12A 3S6FA 3FRMA 2FS5A 3R9EA 4B11A 4OAEA 4C7IA 2OH1A 1IYKA 2QIRA 1S60A 5KTDA 2YNCC 3EC4A 5KTAA 3IWGA 4B5OA 2Z3MA 4H6UA 4HNXB 4YRHA 2DPSA 4U9ZA 2C27A 4KOUA 4MFZA 2Z3LA 3W91A 4A30A 4PSXA 4AVAA 4KVXA 2GANA 3B8GA 4JLYA 4XNHC 2X7BA 2CNMA 4JXRA 4Q38A 3EXNA 2CNTA 2B4BA 3SXOA 4F0YA 1P4NA 5F48A 2HQYA 1S5KA 4B13A 3FIXA 3BJ7A 4PV6A 2EVNA 4UBRA 1XE4A 2G0BA 4YGOA 1KUYA 2Y0MA 5IB0A 2Z11A 1UFHA 3FB3A 4R57A 2REFA 3R9FA 2PC1A 1I1DA 3S6HA 3TO6A 4A32A 2FL4A 3TO9A 2JDDA 2VBQA 1S7FA 4A33A 2BSWA 1Q2YA 3KKWA 5C82A 3DSBA 2PR8A 4JD6A 2Q0YA 5IX3A 2PRBA 2EUIA 5I0CA 2FIWA 4KS9A 5AG6A 3ZJ0A 1J4JA 2QECA 4E2AA 4M85A 4B14A 3TFYA 5EC4A 4R3LA 4NXYA 3VWDA 2JLMA 5F49A 3PZJA 1CM0A 1QSMA 3TOAA 4UCPA 2D4OA 4C2YA 4KOWA 4MFJA 3EFAA 1ZO0A 4EVYA 1P0HA 4KLVA 3VWEA 2B58A 2NMTA 5AG5A 4Y49B 3LD2A 1IB1E 2P0WA 1M4DA 1NSLA 1YLEA 2Z3KA 4CYPA 3G8WA 4ZBGA 4J3GA 4MBUA 2GE3A 4XPKA 4RS2A 2O28A 5KTCA 2R7HA 2B3UA 2YGWA 4B5PA 5EBVA 5HH1A 4CS0B 1OZPA 1XEBA 3R9GA 2B5GA 3IU1A 3GKRA 4H89A 3DNSA 1VKCA 5G21A 3JUWA 4B12A 4UFVA 4QVTA 3IWEA 5G1ZA 3TO7A 2REEA 1Z4RA 2JDCA 2BEIA 2OB0A 4QUSA 2YNCA 1QSOA 2B5GB 4GS4A 3R1KA 4JJXA 2R8VA 4PK2A 2J8NA 4HNYB 4CAVA 3S6KA 4AG7A 4CRYB 3CXPA 4QBJA 4KZTA 2R98A 4IUSA 1IICA 4BBHA 3I3GA 4U9YA 5A28A 4OLLA 3T90A 1M4IA 3TT2A 2CXAA 4FD6A 1V0CA 4LUAA 2DPTA 4UWIA 2J8MA 2IL4A 1YK3A 1B87A 4XPDB 2ARHA 4UA3A 4CAFA 2ZW5A 4OADA 4CYQA 1Y7RA 4AVBA 4ZGYB 5A27A 1S7LA 3N7ZA 2RC4A 1RXTA 2I79A 2Q04A 4Q36A 1IYLA 3QB8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XIX A;  1I21 A;  1RO5 A;  2AE6 A;  4RI1 A;  1K4J A;  1WK4 A;  3V8I A;  3ZZI A;  1M1D A;  4NSQ A;  2D4P A;  1S7N A;  3CXS A;  3R96 A;  2ATR A;  4ONU A;  4JWP A;  3TE4 A;  5E96 A;  2OU2 A;  1YX0 A;  1GHE A;  5GCN A;  3JVN A;  5FVJ A;  4MY3 A;  1YRE A;  2Z10 A;  3GY9 A;  5H84 A;  3BLN A;  3QAH A;  2VZY A;  3PP9 A;  4Y49 C;  2WPW A;  5C88 A;  3D2P A;  3FXT A;  4PK3 A;  2AJ6 A;  4IF5 A;  3RYO A;  1Z4E A;  4ORF A;  4MY0 A;  4QC6 A;  3D8P A;  2GIV A;  2VQY A;  1Q2C A;  2ZW4 A;  1B6B A;  1R57 A;  4KOT A;  2FXF A;  3DR8 A;  4KOX A;  3P2F A;  1QST A;  2QML A;  4R87 A;  2Z0Z A;  3FNC A;  1QSR A;  3S6G A;  2ZXV A;  3PGP A;  1LRZ A;  1XMT A;  4U5Y A;  2HV2 A;  4E8O A;  4CAX A;  1FY7 A;  2BL1 A;  2Q7B A;  3NE7 A;  3LOD A;  2Q44 A;  1NMT A;  1YVK A;  4DNC A;  4XPL A;  4B5P B;  4KUA A;  3TTH A;  2B4D B;  3F8K A;  4KOY A;  2PDO A;  3I9S A;  1KZF A;  4R9M A;  1BO4 A;  1CJW A;  2P6G A;  4FD5 A;  1PU9 A;  1S7K A;  1MK4 A;  1MJ9 A;  2G3A A;  2HUZ A;  2VXK A;  5HMN A;  2OZU A;  2KCW A;  3D2M A;  3TOB A;  2DXQ A;  2P6E A;  2JEV A;  2VI7 A;  1S3Z A;  4L8A A;  3R95 A;  1Z9U A;  4FD4 A;  3DDD A;  3E0K A;  1NE9 A;  1YGH A;  2I00 A;  4XPD C;  1Y9K A;  2PSW A;  1YVO A;  5DWN A;  3F5B A;  1N71 A;  2FCK A;  2J8R A;  1M4G A;  4X5K A;  1XF8 A;  1SQH A;  1U6M A;  2B4D A;  4KOR A;  2FE7 A;  3DR6 A;  5CNP A;  2CNS A;  3W6X A;  4BMH A;  3GYA A;  4MHD A;  4R3K A;  2Q4V A;  4XNH B;  1PUA A;  2B3V A;  3TCV A;  2FSR A;  4QB9 A;  3G3S A;  4UWJ A;  1M44 A;  3C26 A;  4CRZ B;  1QSN A;  3BJ8 A;  3IGR A;  3EO4 A;  2OZG A;  3F0A A;  5J8C A;  4K30 A;  2ZW7 A;  5ISV A;  4KUB A;  4E0A A;  4II9 A;  4F6A A;  4M3S A;  2P6F A;  4H6Z A;  4CAW A;  1KUX A;  1MJB A;  4KVO E;  3EY5 A;  2VZZ A;  1ON0 A;  2FT0 A;  1Q2D A;  4MI4 A;  2PR1 A;  1Y9W A;  1BOB A;  2WPX A;  2BUE A;  5J8F A;  2A4N A;  1KUV A;  4MJ8 A;  4NEX A;  2H5M A;  3P2H A;  5F47 A;  3WR7 A;  4AB7 A;  1VHS A;  4AG9 A;  2G3T A;  2OZH A;  4I49 A;  3T9Y A;  5IV0 A;  3FBU A;  1MJA A;  4HKF A;  1L0C A;  4KOS A;  2ZW6 A;  2CY2 A;  3W6S A;  2R1I A;  3D3S A;  4NCZ A;  2VEZ A;  2K5T A;  3SXN A;  4L89 A;  4YFJ A;  4PSW A;  3MGD A;  1IID A;  4LX9 A;  3FYN A;  5H86 A;  5F46 A;  1TIQ A;  1YR0 A;  4JXQ A;  4AVC A;  5JPH A;  2FIA A;  3H4Q A;  4FD7 A;  4KVM E;  2F5I A;  4KOV A;  5DWM A;  2PQ8 A;  3UY5 A;  1WWZ A;  3CXQ A;  3K9U A;  3OWC A;  2ZPA A;  5JQ4 A;  4HNW B;  3SHP A;  4KLW A;  2Q4Y A;  4NF1 A;  1I12 A;  3S6F A;  3FRM A;  2FS5 A;  3R9E A;  4OAE A;  2OH1 A;  1IYK A;  2QIR A;  1S60 A;  5KTD A;  5KTA A;  3EC4 A;  3IWG A;  4B5O A;  4H6U A;  4HNX B;  4YRH A;  4U9Z A;  2C27 A;  4KOU A;  3W91 A;  4PSX A;  4AVA A;  4KVX A;  2GAN A;  3B8G A;  4JLY A;  4XNH C;  2X7B A;  2CNM A;  4JXR A;  3EXN A;  2CNT A;  2B4B A;  3SXO A;  4F0Y A;  1P4N A;  5F48 A;  2HQY A;  1S5K A;  3FIX A;  3BJ7 A;  4PV6 A;  2EVN A;  4UBR A;  1XE4 A;  2G0B A;  4YGO A;  1KUY A;  2Y0M A;  5IB0 A;  2Z11 A;  1UFH A;  3FB3 A;  4R57 A;  2REF A;  3R9F A;  2PC1 A;  1I1D A;  3S6H A;  3TO6 A;  2FL4 A;  3TO9 A;  2JDD A;  2VBQ A;  1S7F A;  2BSW A;  1Q2Y A;  3KKW A;  5C82 A;  3DSB A;  2PR8 A;  4JD6 A;  2Q0Y A;  5IX3 A;  2PRB A;  2EUI A;  5I0C A;  2FIW A;  3ZJ0 A;  1J4J A;  2QEC A;  4E2A A;  4M85 A;  3TFY A;  5EC4 A;  4R3L A;  4NXY A;  3VWD A;  2JLM A;  5F49 A;  3PZJ A;  1CM0 A;  1QSM A;  3TOA A;  2D4O A;  4KOW A;  3EFA A;  4EVY A;  1P0H A;  4KLV A;  3VWE A;  2B58 A;  2NMT A;  4Y49 B;  3LD2 A;  1IB1 E;  2P0W A;  1M4D A;  1NSL A;  1YLE A;  3G8W A;  4ZBG A;  4J3G A;  4MBU A;  2GE3 A;  4XPK A;  4RS2 A;  2O28 A;  5KTC A;  2R7H A;  2B3U A;  4B5P A;  5EBV A;  5HH1 A;  4CS0 B;  1OZP A;  1XEB A;  3R9G A;  2B5G A;  3GKR A;  4H89 A;  3DNS A;  1VKC A;  3JUW A;  4QVT A;  3TO7 A;  2REE A;  1Z4R A;  2JDC A;  2BEI A;  2OB0 A;  4QUS A;  1QSO A;  2B5G B;  4GS4 A;  3R1K A;  4JJX A;  2R8V A;  4PK2 A;  2J8N A;  4HNY B;  4CAV A;  3S6K A;  4AG7 A;  4CRY B;  3CXP A;  4QBJ A;  4KZT A;  2R98 A;  4IUS A;  1IIC A;  3I3G A;  4U9Y A;  4OLL A;  3T90 A;  1M4I A;  3TT2 A;  4FD6 A;  4LUA A;  1V0C A;  4UWI A;  2J8M A;  2IL4 A;  1YK3 A;  1B87 A;  4XPD B;  2ARH A;  4UA3 A;  2ZW5 A;  4OAD A;  1Y7R A;  4AVB A;  1S7L A;  3N7Z A;  2RC4 A;  1RXT A;  2I79 A;  2Q04 A;  1IYL A;  3QB8 A; 
#chains in the Genus database with same CATH topology
 5JM6 A;  3D68 A;  2Q7S A;  2AFO A;  5D29 A;  4MHZ A;  1XIX A;  1I21 A;  4A95 A;  4AXV A;  1RO5 A;  4KSA A;  2AE6 A;  4RI1 A;  1K4J A;  3BI0 A;  1EE3 P;  3KQX A;  4MHN A;  4PQA A;  1WK4 A;  4RN7 A;  3V8I A;  3ZZI A;  4CGN A;  1M1D A;  1LAP A;  3PFO A;  2Q4Z A;  4NSQ A;  2D4P A;  4B10 A;  3N5F A;  1S7N A;  3CXS A;  3FEE A;  3R96 A;  4H2K A;  2ATR A;  4ZX9 A;  4IHM A;  4JWP A;  4ONU A;  4PXC A;  3TE4 A;  4UEZ A;  3FH4 A;  4MFL A;  4R7M A;  5E96 A;  3WT4 A;  4DJL A;  2ZEP A;  2OU2 A;  4O23 A;  1YX0 A;  4CGL A;  1GHE A;  4PXE A;  5GCN A;  3JVN A;  3FX6 A;  5FVJ A;  2ZOG A;  4M6G A;  3TX8 A;  2Q43 A;  4MY3 A;  1HDU A;  1YRE A;  3IU2 A;  3VAT A;  4P4D A;  5J1Q A;  2Z10 A;  3GY9 A;  4P4E A;  5DS0 A;  3BLN A;  5H84 A;  3KAS A;  3QAH A;  2ZED A;  2EK8 A;  2VZY A;  3PP9 A;  2WPW A;  4Y49 C;  2Z3N A;  5C88 A;  3K2K A;  3PRT A;  3D2P A;  3ISX A;  2GLJ A;  3RO0 A;  4UFX A;  3NA6 A;  3NH8 A;  3FXT A;  4CYO A;  4PK3 A;  5AG7 A;  5LYD A;  2AJ6 A;  3D7F A;  3WC6 A;  4IF5 A;  3RYO A;  1Z4E A;  2YND A;  4ORF A;  3PB4 X;  4MY0 A;  3VH9 A;  1JWQ A;  1TXR A;  1Z5R A;  4QC6 A;  4MRI A;  3D8P A;  3B35 A;  4A2Z A;  2GIV A;  2IJZ A;  2VQY A;  2EWB A;  1Q2C A;  2WSA A;  3CT9 A;  4NJQ A;  3KHX A;  2ZW4 A;  4KSF A;  1B6B A;  1R57 A;  4KOT A;  3GUX A;  4NGM A;  1KWM A;  2FXF A;  2CTB A;  3DR8 A;  4KOX A;  2ABZ A;  4ZY2 A;  2WZN A;  3P2F A;  4X3R A;  1QST A;  2QML A;  4DUK A;  1XRY A;  4NGN A;  4R87 A;  2PJ9 A;  2Z0Z A;  3CZX A;  3FNC A;  2Q51 A;  1QSR A;  3S6G A;  5BWA B;  2ZXV A;  3QNV A;  4OP4 A;  4P4B A;  3WC5 A;  3PGP A;  1TKJ A;  4F0X A;  1LRZ A;  1XMT A;  2V8V A;  2HV2 A;  4U5Y A;  2Z3P A;  4CAX A;  4E8O A;  1F2P A;  1FY7 A;  2BL1 A;  2QVP A;  2Q7B A;  2RFH A;  3NE7 A;  1AMP A;  3LOD A;  2CF4 A;  1Q7L A;  2Q44 A;  1NMT A;  4UEF A;  1YVK A;  4OC3 A;  2EK9 A;  4DNC A;  4XPL A;  3KI9 A;  3B3V A;  5D8N A;  4B5P B;  3SJF A;  4KUA A;  4MFK A;  3TTH A;  2B4D B;  7CPA A;  3F8K A;  4KOY A;  2PDO A;  3I9S A;  3K9T A;  3NE8 A;  1KZF A;  4UIA A;  3PFE A;  4R9M A;  1BO4 A;  3PBE A;  3B2Y A;  5EMI A;  5K8N A;  1CJW A;  2P6G A;  4FD5 A;  4G1P A;  1Z8T A;  4KSI A;  3WC7 A;  2C6P A;  1PU9 A;  1S7K A;  3D7G A;  5AG4 A;  1MK4 A;  1MJ9 A;  1PCA A;  2QJ8 A;  4HPS A;  4OID A;  4CGP A;  2G3A A;  2HUZ A;  2VXK A;  3IC1 A;  5HMN A;  1CPX A;  4NGP A;  2C6C A;  2BO9 A;  2OZU A;  1ZG7 A;  2CIJ A;  3H5Z A;  4NGT A;  2KCW A;  1FNO A;  4NGS A;  4P4F A;  3D2M A;  2ZEG A;  3TOB A;  4P4I A;  4MXU A;  4P44 A;  1QMU A;  2DXQ A;  2P6E A;  1DE4 C;  2JEV A;  2VI7 A;  2XEG A;  1ZG8 A;  4YWY A;  1S3Z A;  4L8A A;  4OC0 A;  3R95 A;  3H8E A;  1Z9U A;  4FD4 A;  4NJR A;  2AFU A;  3PB7 X;  3DDD A;  1IGB A;  3E0K A;  4ZY0 A;  1NE9 A;  1YGH A;  2I00 A;  1XJO A;  4XPD C;  1Y9K A;  1LFW A;  4X8I A;  2O4H A;  2PE3 A;  2PSW A;  2PJA A;  4UEE A;  1YVO A;  5DWN A;  3F5B A;  1N71 A;  4OC4 A;  1LAM A;  1ZG9 A;  2O53 A;  3B3C A;  4MFP A;  2FCK A;  4R8F A;  2J8R A;  1M4G A;  2WUU A;  3LWU A;  4NGQ A;  2AFS A;  2ZEH A;  4UFW A;  4X5K A;  1ZLH A;  1XF8 A;  3PEI A;  1M4L A;  4F9V A;  1SQH A;  1U6M A;  2B4D A;  4KOR A;  2FE7 A;  3DR6 A;  5CNP A;  3L2N A;  1AUG A;  1YW4 A;  2CNS A;  3W6X A;  3WAB A;  4MCS A;  4BMH A;  3S9M A;  1YQE A;  3GYA A;  4MHD A;  4R3K A;  2G9D A;  2Q4V A;  2PCU A;  2XEI A;  3KR5 A;  3VAR A;  4CGO A;  5K8O A;  4XNH B;  3FMC A;  1PUA A;  2PJ4 A;  2B3V A;  3TCV A;  4A31 A;  2FSR A;  3KZW A;  3PBB A;  1ARL A;  3SJE A;  4QB9 A;  5ELY A;  3G3S A;  4UWJ A;  1M44 A;  2WYR A;  3C26 A;  4CRZ B;  3PB6 X;  1RTQ A;  1QSN A;  3BJ8 A;  4CAE A;  1XFO A;  2YNE A;  3IGR A;  3FVL A;  4UCN A;  3EO4 A;  5LYF A;  2OZG A;  2VL1 A;  3F0A A;  5J8C A;  1VHE A;  4K30 A;  1AYE A;  2ZW7 A;  5HXD A;  5ISV A;  1LCP A;  4KUB A;  3D4U A;  4E0A A;  4II9 A;  1LOK A;  1ELL P;  4M3S A;  4F6A A;  3JTK A;  2P6F A;  4H6Z A;  4CAW A;  1IU8 A;  1KUX A;  4FBE A;  5JH9 A;  1MJB A;  4KVO E;  1R43 A;  3EY5 A;  3RAM A;  1IY7 A;  5AGE A;  2PVW A;  2VZZ A;  1ON0 A;  4Z65 A;  2FT0 A;  1Q2D A;  1VIX A;  4MI4 A;  2PR1 A;  3SJG A;  1Y9W A;  1BPN A;  4UCM A;  3KL9 A;  2ZEN A;  4C2X A;  1VHO A;  1BOB A;  2PJC A;  2WPX A;  3FED A;  2BUE A;  2PJ5 A;  4ZYQ A;  2Z3O A;  5J8F A;  2A4N A;  4W9Y A;  1KUV A;  2JBJ A;  4MJ8 A;  4C2Z A;  4P45 A;  4NEX A;  1X12 A;  2H5M A;  3P2H A;  3T8W A;  5F47 A;  3WR7 A;  4LQ6 A;  4WJB A;  3V38 A;  4AB7 A;  5LYI A;  1VHS A;  3BHX A;  4AG9 A;  2G3T A;  2OZH A;  2EO8 A;  2V8G A;  4I49 A;  3T9Y A;  4BIN A;  5IV0 A;  3FBU A;  1MJA A;  4HKF A;  1L0C A;  2PJ0 A;  3LMS A;  1CP7 A;  2ZEM A;  4KOS A;  2ZW6 A;  2CY2 A;  3IJ3 A;  3KQZ A;  3W6S A;  2R1I A;  1OBR A;  3D3S A;  4ONW A;  1HEE A;  2GU2 A;  4NCZ A;  3B3W A;  2VEZ A;  4Q7A A;  5LRJ A;  4BD9 A;  1Y0Y A;  3KGQ A;  1Z2L A;  2K5T A;  3SXN A;  4L89 A;  4YFJ A;  4PSW A;  3NH4 A;  2C1C A;  3MGD A;  1IID A;  4LX9 A;  5CBM A;  3CPA A;  4EWT A;  2GFQ A;  4C7H A;  3FYN A;  5H86 A;  5F46 A;  3D66 A;  1TIQ A;  2XEJ A;  1YR0 A;  2AFW A;  2XEF A;  4JXQ A;  4AVC A;  4CPA A;  5G22 A;  2AFX A;  2PJ8 A;  5JPH A;  2FIA A;  3H4Q A;  4FD7 A;  3A9L A;  4M6H A;  4MFQ A;  3V7Z A;  2I3C A;  3IIB A;  1TF9 A;  2BCO A;  4ZY1 A;  4KVM E;  4C68 A;  2F5I A;  3D7D A;  4KOV A;  5DWM A;  3KHZ A;  1TKF A;  1HDQ A;  5THW A;  8CPA A;  2PRQ A;  4CGM A;  3SJX A;  1IOI A;  2PQ8 A;  5LRK A;  2GLF A;  3PB8 X;  3RBU A;  2RB7 A;  3UY5 A;  1WWZ A;  2PJB A;  3CXQ A;  4CYN A;  4PXB A;  3K9U A;  2PVV A;  3OWC A;  2ZPA A;  5K8M A;  2F7V A;  3DLJ A;  5JQ4 A;  4HNW B;  4FWU A;  3SHP A;  5LYL A;  4B6Z A;  3SI1 A;  2ZOF A;  4KLW A;  5G20 A;  2Q4Y A;  5K8P A;  5IB9 A;  4NF1 A;  1I12 A;  3S6F A;  3FRM A;  2FS5 A;  3R9E A;  1PYT B;  4B11 A;  4OAE A;  4C7I A;  3DGV A;  4DYO A;  2OH1 A;  2F8H A;  4MMO A;  4OC5 A;  1IYK A;  1YW6 A;  2QIR A;  1S60 A;  2NYQ A;  4GM5 A;  2GRE A;  2YNC C;  3EC4 A;  5KTA A;  5KTD A;  4A94 A;  3IWG A;  4B5O A;  2Z3M A;  4H6U A;  4HNX B;  4YRH A;  2DPS A;  4U9Z A;  2C27 A;  2ZEE A;  4KOU A;  4MFZ A;  2Z3L A;  3HLP A;  1Z8X A;  1X10 A;  3W91 A;  1F2O A;  2OOT A;  4A30 A;  2OR4 A;  4PSX A;  5LRG A;  4AVA A;  5JGF A;  1ELM P;  4KVX A;  3QAY A;  4FUU A;  3RZA A;  2ZEF A;  4UF4 A;  3LAC A;  2GAN A;  5CPA A;  3B8G A;  2V77 A;  4JLY A;  4OKO A;  4XNH C;  2X7B A;  1R3N A;  2CNM A;  2J9A A;  4JXR A;  4Q38 A;  4NGR A;  1H8L A;  3EXN A;  3MRU A;  4ZI6 A;  3RNZ A;  1YLO A;  4TWE A;  3BXM A;  2CNT A;  4MCQ A;  2B4B A;  4LQG A;  3S9N A;  3SXO A;  3KR4 A;  1P4N A;  4F0Y A;  5F48 A;  2HQY A;  2IMO A;  1S5K A;  1GYT A;  4B13 A;  3FIX A;  4OC1 A;  4WWV A;  3BJ7 A;  2C6G A;  4PV6 A;  2EVN A;  4UBR A;  1XE4 A;  2G0B A;  4YGO A;  1KUY A;  2Y0M A;  5IB0 A;  2HB6 A;  3B7I A;  1TKH A;  2Z11 A;  1UFH A;  1NSA A;  3FB3 A;  4R57 A;  3IFE A;  4MCP A;  2ANP A;  1CP6 A;  2REF A;  3R9F A;  3B3T A;  4GXH A;  2PC1 A;  1I1D A;  3S6H A;  4F9U A;  3TO6 A;  4A32 A;  4FAI A;  2FL4 A;  3CDX A;  2JDD A;  1Z8W A;  3TO9 A;  2VBQ A;  2JBK A;  1S7F A;  3MN8 A;  4A33 A;  2BSW A;  1Q2Y A;  3KKW A;  5C82 A;  3DSB A;  2PR8 A;  4ZX8 A;  4JD6 A;  4PPZ A;  3D7H A;  2Q0Y A;  3H8G A;  5HVH A;  5IX3 A;  3FEC A;  2PRB A;  3GB0 A;  2EUI A;  1BLL E;  5I0C A;  2FIW A;  4KS9 A;  4R6T A;  5AG6 A;  1J4J A;  3ZJ0 A;  4P10 A;  1YME A;  3D67 A;  2QEC A;  3HUV A;  4E2A A;  4M85 A;  2DF5 A;  2EBJ A;  4B14 A;  3TFY A;  1IOF A;  5EC4 A;  4R3L A;  4P4J A;  4NXY A;  1CG2 A;  1VGY A;  4YU9 A;  2JLM A;  1BPM A;  3TC8 A;  5F49 A;  3VWD A;  3PZJ A;  2PIZ A;  4PXD A;  1CM0 A;  6CPA A;  4OIW A;  1QSM A;  1F57 A;  1XBU A;  3NFZ A;  3TOA A;  2IQ6 A;  2D4O A;  4UCP A;  4C2Y A;  4KOW A;  4MFJ A;  4RUH A;  3EFA A;  1ZO0 A;  2ZEL A;  4EVY A;  1P0H A;  4KLV A;  4A39 A;  3VWE A;  2B58 A;  2NMT A;  5AG5 A;  4Y49 B;  3LD2 A;  1BAV A;  1IB1 E;  2P0W A;  2PJ3 A;  1M4D A;  1NSL A;  1YLE A;  2POK A;  2Z3K A;  4CYP A;  3G8W A;  4ZBG A;  3FF3 A;  3GIU A;  4J3G A;  2GE3 A;  4MBU A;  4RS2 A;  4XPK A;  1XOV A;  2O28 A;  1ARM A;  5KTC A;  2PJ6 A;  2R7H A;  3SI0 A;  2BOA A;  1DTD A;  3S9L A;  3JRU A;  2B3U A;  2YGW A;  2V8H A;  1TF8 A;  4OME A;  5EBV A;  5HH1 A;  4B5P A;  4CS0 B;  2PJ2 A;  1OZP A;  1XEB A;  3R9G A;  1ZLI A;  2B5G A;  3IU1 A;  2QYV A;  3GKR A;  4H89 A;  3DNS A;  1VKC A;  3NH5 A;  4JYW A;  5G21 A;  3BI1 A;  1CX8 A;  3JUW A;  4B12 A;  4UFV A;  4QVT A;  3IWE A;  5G1Z A;  3TO7 A;  2REE A;  1Z4R A;  2JDC A;  1UWY A;  2BEI A;  1A2Z A;  2OB0 A;  1FT7 A;  4QUS A;  5F09 A;  2YNC A;  1QSO A;  2B5G B;  2ODF A;  3IO1 A;  4GS4 A;  3H8F A;  1LAN A;  1QQ9 A;  4EME A;  1CBX A;  3R1K A;  2R8V A;  4JJX A;  4MCR A;  4PK2 A;  2J8N A;  4OC2 A;  4HNY B;  4CAV A;  2CTC A;  4M6I A;  3S6K A;  4AG7 A;  4CRY B;  3CXP A;  3GLJ A;  5I4M A;  3I1U A;  5HVG A;  4QBJ A;  4KZT A;  3ISZ A;  2ZEO A;  2R98 A;  4IUS A;  4NFR A;  3IEH A;  3IWW A;  1Z8L A;  1IIC A;  2PIY A;  2PJ7 A;  2V8D A;  4BBH A;  1XMB A;  1YSJ A;  3I3G A;  4U9Y A;  4X2T A;  4EFD A;  4OLL A;  2PJ1 A;  2NSM A;  3CPX A;  5A28 A;  4A38 A;  1Y7E A;  1JQG A;  4K3N A;  3SI2 A;  3T90 A;  3B3S A;  4JZ0 A;  4R76 A;  1M4I A;  3TT2 A;  2AFM A;  2CXA A;  4FD6 A;  1V0C A;  4LUA A;  2DPT A;  4MHY A;  4UWI A;  2DEA A;  2J8M A;  4UIB A;  2IL4 A;  1YK3 A;  1B87 A;  4XPD B;  4IK2 A;  2ARH A;  4TNU A;  4UA3 A;  2ZW5 A;  5HVF A;  4CAF A;  4OAD A;  1CPS A;  1Y7R A;  2FVG A;  4CYQ A;  4IAV A;  4F8Z A;  4A37 A;  4AVB A;  4ZGY B;  2JEW A;  1S7L A;  2HC9 A;  2RC4 A;  3N7Z A;  1RXT A;  4P6Y A;  5A27 A;  4MHP A;  2AFZ A;  1Y0R A;  2I79 A;  2Q04 A;  3FJU A;  1IYL A;  4Q36 A;  3PB9 X;  3QB8 A; 
#chains in the Genus database with same CATH homology
 1XIX A;  1I21 A;  4A95 A;  1RO5 A;  4KSA A;  2AE6 A;  4RI1 A;  1K4J A;  1WK4 A;  3V8I A;  3ZZI A;  4CGN A;  1M1D A;  4NSQ A;  2D4P A;  4B10 A;  1S7N A;  3CXS A;  3R96 A;  2ATR A;  4ONU A;  4JWP A;  3TE4 A;  4MFL A;  5E96 A;  2OU2 A;  1YX0 A;  4CGL A;  1GHE A;  5GCN A;  3JVN A;  5FVJ A;  4MY3 A;  1YRE A;  3IU2 A;  2Z10 A;  3GY9 A;  5H84 A;  3BLN A;  3QAH A;  2VZY A;  3PP9 A;  4Y49 C;  2WPW A;  5C88 A;  2Z3N A;  3D2P A;  4UFX A;  3FXT A;  4CYO A;  4PK3 A;  5AG7 A;  2AJ6 A;  4IF5 A;  3RYO A;  1Z4E A;  2YND A;  4ORF A;  4MY0 A;  4QC6 A;  3D8P A;  4A2Z A;  2GIV A;  2VQY A;  1Q2C A;  2WSA A;  2ZW4 A;  4KSF A;  1B6B A;  1R57 A;  4KOT A;  2FXF A;  3DR8 A;  4KOX A;  3P2F A;  1QST A;  2QML A;  4R87 A;  2Z0Z A;  3FNC A;  1QSR A;  3S6G A;  5BWA B;  2ZXV A;  3PGP A;  4F0X A;  1LRZ A;  1XMT A;  4U5Y A;  2HV2 A;  4E8O A;  2Z3P A;  4CAX A;  1FY7 A;  2BL1 A;  2Q7B A;  3NE7 A;  3LOD A;  2Q44 A;  1NMT A;  1YVK A;  4DNC A;  4XPL A;  4B5P B;  4KUA A;  4MFK A;  3TTH A;  2B4D B;  3F8K A;  4KOY A;  2PDO A;  3I9S A;  1KZF A;  4R9M A;  1BO4 A;  1CJW A;  2P6G A;  4FD5 A;  1PU9 A;  1S7K A;  5AG4 A;  1MK4 A;  1MJ9 A;  4CGP A;  2G3A A;  2HUZ A;  2VXK A;  5HMN A;  2OZU A;  3H5Z A;  2KCW A;  3D2M A;  3TOB A;  2DXQ A;  2P6E A;  2JEV A;  2VI7 A;  1S3Z A;  4L8A A;  3R95 A;  1Z9U A;  4FD4 A;  3DDD A;  3E0K A;  1NE9 A;  1YGH A;  2I00 A;  4XPD C;  1Y9K A;  2PSW A;  1YVO A;  5DWN A;  3F5B A;  1N71 A;  4MFP A;  2FCK A;  2J8R A;  1M4G A;  2WUU A;  4UFW A;  4X5K A;  1XF8 A;  1SQH A;  1U6M A;  2B4D A;  4KOR A;  2FE7 A;  3DR6 A;  5CNP A;  2CNS A;  3W6X A;  4BMH A;  3GYA A;  4MHD A;  4R3K A;  2Q4V A;  4CGO A;  4XNH B;  1PUA A;  2B3V A;  3TCV A;  4A31 A;  2FSR A;  4QB9 A;  3G3S A;  4UWJ A;  1M44 A;  3C26 A;  4CRZ B;  1QSN A;  3BJ8 A;  4CAE A;  2YNE A;  3IGR A;  4UCN A;  3EO4 A;  2OZG A;  3F0A A;  5J8C A;  4K30 A;  2ZW7 A;  5ISV A;  4KUB A;  4E0A A;  4II9 A;  4F6A A;  4M3S A;  3JTK A;  2P6F A;  4H6Z A;  4CAW A;  1KUX A;  1MJB A;  4KVO E;  3EY5 A;  5AGE A;  2VZZ A;  1ON0 A;  2FT0 A;  1Q2D A;  4MI4 A;  2PR1 A;  1Y9W A;  4UCM A;  4C2X A;  1BOB A;  2WPX A;  2BUE A;  2Z3O A;  5J8F A;  2A4N A;  1KUV A;  4MJ8 A;  4C2Z A;  4NEX A;  2H5M A;  3P2H A;  5F47 A;  3WR7 A;  4AB7 A;  1VHS A;  4AG9 A;  2G3T A;  2OZH A;  4I49 A;  3T9Y A;  5IV0 A;  3FBU A;  1MJA A;  4HKF A;  1L0C A;  4KOS A;  2ZW6 A;  2CY2 A;  3W6S A;  2R1I A;  3D3S A;  4NCZ A;  2VEZ A;  2K5T A;  3SXN A;  4L89 A;  4YFJ A;  4PSW A;  3MGD A;  1IID A;  4LX9 A;  4C7H A;  3FYN A;  5H86 A;  5F46 A;  1TIQ A;  1YR0 A;  4JXQ A;  4AVC A;  5G22 A;  5JPH A;  2FIA A;  3H4Q A;  4FD7 A;  3A9L A;  4MFQ A;  4KVM E;  4C68 A;  2F5I A;  4KOV A;  5DWM A;  4CGM A;  2PQ8 A;  3UY5 A;  1WWZ A;  3CXQ A;  4CYN A;  3K9U A;  3OWC A;  2ZPA A;  5JQ4 A;  4HNW B;  3SHP A;  4KLW A;  5G20 A;  2Q4Y A;  4NF1 A;  1I12 A;  3S6F A;  3FRM A;  2FS5 A;  3R9E A;  4B11 A;  4OAE A;  4C7I A;  2OH1 A;  1IYK A;  2QIR A;  1S60 A;  5KTD A;  2YNC C;  3EC4 A;  5KTA A;  3IWG A;  4B5O A;  2Z3M A;  4H6U A;  4HNX B;  4YRH A;  2DPS A;  4U9Z A;  2C27 A;  4KOU A;  4MFZ A;  2Z3L A;  3W91 A;  4A30 A;  4PSX A;  4AVA A;  4KVX A;  2GAN A;  3B8G A;  4JLY A;  4XNH C;  2X7B A;  2CNM A;  4JXR A;  4Q38 A;  3EXN A;  2CNT A;  2B4B A;  3SXO A;  4F0Y A;  1P4N A;  5F48 A;  2HQY A;  1S5K A;  4B13 A;  3FIX A;  3BJ7 A;  4PV6 A;  2EVN A;  4UBR A;  1XE4 A;  2G0B A;  4YGO A;  1KUY A;  2Y0M A;  5IB0 A;  2Z11 A;  1UFH A;  3FB3 A;  4R57 A;  2REF A;  3R9F A;  2PC1 A;  1I1D A;  3S6H A;  3TO6 A;  4A32 A;  2FL4 A;  3TO9 A;  2JDD A;  2VBQ A;  1S7F A;  4A33 A;  2BSW A;  1Q2Y A;  3KKW A;  5C82 A;  3DSB A;  2PR8 A;  4JD6 A;  2Q0Y A;  5IX3 A;  2PRB A;  2EUI A;  5I0C A;  2FIW A;  4KS9 A;  5AG6 A;  3ZJ0 A;  1J4J A;  2QEC A;  4E2A A;  4M85 A;  4B14 A;  3TFY A;  5EC4 A;  4R3L A;  4NXY A;  3VWD A;  2JLM A;  5F49 A;  3PZJ A;  1CM0 A;  1QSM A;  3TOA A;  4UCP A;  2D4O A;  4C2Y A;  4KOW A;  4MFJ A;  3EFA A;  1ZO0 A;  4EVY A;  1P0H A;  4KLV A;  3VWE A;  2B58 A;  2NMT A;  5AG5 A;  4Y49 B;  3LD2 A;  1IB1 E;  2P0W A;  1M4D A;  1NSL A;  1YLE A;  2Z3K A;  4CYP A;  3G8W A;  4ZBG A;  4J3G A;  4MBU A;  2GE3 A;  4XPK A;  4RS2 A;  2O28 A;  5KTC A;  2R7H A;  2B3U A;  2YGW A;  4B5P A;  5EBV A;  5HH1 A;  4CS0 B;  1OZP A;  1XEB A;  3R9G A;  2B5G A;  3IU1 A;  3GKR A;  4H89 A;  3DNS A;  1VKC A;  5G21 A;  3JUW A;  4B12 A;  4UFV A;  4QVT A;  3IWE A;  5G1Z A;  3TO7 A;  2REE A;  1Z4R A;  2JDC A;  2BEI A;  2OB0 A;  4QUS A;  2YNC A;  1QSO A;  2B5G B;  4GS4 A;  3R1K A;  4JJX A;  2R8V A;  4PK2 A;  2J8N A;  4HNY B;  4CAV A;  3S6K A;  4AG7 A;  4CRY B;  3CXP A;  4QBJ A;  4KZT A;  2R98 A;  4IUS A;  1IIC A;  4BBH A;  3I3G A;  4U9Y A;  5A28 A;  4OLL A;  3T90 A;  1M4I A;  3TT2 A;  2CXA A;  4FD6 A;  1V0C A;  4LUA A;  2DPT A;  4UWI A;  2J8M A;  2IL4 A;  1YK3 A;  1B87 A;  4XPD B;  2ARH A;  4UA3 A;  4CAF A;  2ZW5 A;  4OAD A;  4CYQ A;  1Y7R A;  4AVB A;  4ZGY B;  5A27 A;  1S7L A;  3N7Z A;  2RC4 A;  1RXT A;  2I79 A;  2Q04 A;  4Q36 A;  1IYL A;  3QB8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...