3EO4A

The crystal structure of a domain from methanocaldococcus jannaschii dsm 2661
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
162
structure length
158
Chain Sequence
ANCKKSKIIIRQITDNDLELLMAWRSNPLIYKFFYIQKEPLKWEEHYSWWMSRENRVDWIILLRENNTIRKVGSVNVSQLNTDNPEIGILIGEFFLWGKHIGRHSVSLVLKWLKNIGYKKAHARILENNIRSIKLFESLGFKKTKKGRENEWIYEVNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein MJ1062
publication title The crystal structure of a domain from Methanocaldococcus jannaschii DSM 2661
rcsb
source organism Methanocaldococcus jannaschii
total genus 43
structure length 158
sequence length 162
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3eo4A00
1WWZA 2VZZA 3JVNA 2NMTA 1P0HA 3B8GA 3DR6A 3K9UA 4F0YA 4R87A 1L0CA 4H6ZA 1I12A 3SXNA 1NSLA 2ZPAA 3JUWA 4MY3A 2B4DA 4H6UA 4IF5A 1PUAA 3CXQA 3EC4A 4MY0A 2C27A 1RXTA 2CNSA 1GHEA 3SXOA 4KORA 5IV0A 1I1DA 1YGHA 3QAHA 4UBRA 1RO5A 5KTDA 3RYOA 2RC4A 2P6FA 5J8CA 4NCZA 4AB7A 3TO7A 4FD5A 4KLWA 1XEBA 2ZW7A 4KVOE 4UWIA 1OZPA 3FXTA 3TFYA 4KUAA 4QBJA 5I0CA 4I49A 3FNCA 3G3SA 5ISVA 3TOAA 1YLEA 1KUVA 1LRZA 4XNHB 4NXYA 4E0AA 3I3GA 1MK4A 3PP9A 5DWNA 3CXPA 1YVKA 2PDOA 4YRHA 5F47A 4CAVA 3H4QA 2PC1A 2B3VA 2OH1A 5HH1A 4BMHA 3EO4A 2VZYA 3W6XA 4AG7A 2Q04A 4AVBA 4KOSA 1IIDA 2B5GA 1I21A 2GE3A 3BJ7A 3V8IA 1QSTA 1R57A 4HKFA 1S3ZA 1NMTA 2ZW5A 1Y9WA 3PGPA 1S7KA 2CNMA 2REFA 3TCVA 5KTAA 4X5KA 1BOBA 1Q2CA 1TIQA 3IGRA 4KOTA 5E96A 4RS2A 5IX3A 2B4DB 2F5IA 1S7NA 1VKCA 3R95A 3LODA 1YR0A 2VEZA 1Z4RA 4OADA 1YREA 2R8VA 1S5KA 3WR7A 4FD6A 4ZBGA 2DXQA 2J8MA 2G3AA 3F5BA 2K5TA 3I9SA 2PQ8A 2JDCA 3GKRA 3D2MA 5F48A 3EY5A 2Q44A 1IICA 2AE6A 4KOYA 1S60A 4E8OA 3TO6A 4KOUA 1N71A 4PK3A 2Z11A 4M85A 1M44A 3S6KA 3S6HA 2ATRA 3EXNA 1P4NA 1MJ9A 5F46A 3FB3A 1PU9A 3S6GA 1K4JA 4Y49C 2H5MA 1S7LA 2PR1A 3OWCA 1KUXA 4HNXB 3SHPA 4KVXA 3FYNA 4ORFA 3TTHA 2B3UA 1FY7A 2HV2A 4KOXA 4QVTA 1Z4EA 2FIWA 4R57A 4JLYA 2X7BA 2R98A 2R1IA 5HMNA 4AG9A 4R3KA 4CAWA 5IB0A 2Q0YA 4R3LA 2ZW6A 3DNSA 3R1KA 2PR8A 5DWMA 3FIXA 4KLVA 3W91A 4B5PA 5JPHA 1ON0A 4PV6A 4KVME 2OZHA 4H89A 2J8NA 2P6GA 4F6AA 5F49A 3EFAA 4MJ8A 4R9MA 1YX0A 2AJ6A 3P2FA 4B5OA 4QC6A 2VI7A 4NSQA 3D2PA 2WPWA 3C26A 2BL1A 1M4GA 3R9GA 2KCWA 4DNCA 1QSNA 3S6FA 4QUSA 1CM0A 4KOWA 2PSWA 2BSWA 3NE7A 2Z0ZA 3DDDA 2G3TA 2FL4A 1MJBA 4MI4A 2FS5A 2OZGA 2JLMA 1S7FA 4U9ZA 2JEVA 1M1DA 2VQYA 4HNWB 4FD4A 3VWEA 4M3SA 3DR8A 2B58A 4XPLA 2OZUA 3N7ZA 1V0CA 4PK2A 4K30A 1Q2YA 4CRZB 1NE9A 2VBQA 1B87A 4ONUA 4IUSA 2WPXA 5H84A 3TT2A 2G0BA 2I00A 4CAXA 2Y0MA 4XPDB 4GS4A 4KOVA 1CJWA 3T90A 4U5YA 2O28A 4U9YA 4XPKA 1XF8A 2GANA 3ZZIA 4XNHC 4PSXA 5H86A 3TE4A 3F8KA 4UA3A 3LD2A 2ARHA 1BO4A 1YVOA 3R9EA 4JXQA 3PZJA 3E0KA 3FBUA 4MBUA 5JQ4A 2J8RA 2FE7A 1Y9KA 5GCNA 3TO9A 2R7HA 3IWGA 4B5PB 2VXKA 4EVYA 4CRYB 2BEIA 2CNTA 4L8AA 5FVJA 1B6BA 2PRBA 2B4BA 2P6EA 5CNPA 2ZXVA 5J8FA 1QSOA 4RI1A 1UFHA 4L89A 3ZJ0A 3QB8A 4AVCA 1KZFA 3R96A 4UWJA 3D3SA 2D4OA 3CXSA 1Z9UA 3BLNA 2Z10A 2D4PA 3W6SA 2ZW4A 1IYLA 2B5GB 4JD6A 4OAEA 4LX9A 2Q7BA 5C88A 4JJXA 5C82A 1M4DA 1IB1E 3KKWA 3FRMA 4E2AA 2FT0A 4FD7A 4LUAA 4HNYB 4XPDC 4JWPA 3UY5A 4II9A 3F0AA 2HUZA 1KUYA 5EBVA 2FCKA 2EVNA 1IYKA 1XMTA 4KZTA 2FSRA 1WK4A 3DSBA 3G8WA 4AVAA 4Y49B 2REEA 4YGOA 2Q4YA 2GIVA 2FIAA 4JXRA 2FXFA 3TOBA 4NEXA 2JDDA 2QIRA 4CS0B 2OU2A 4YFJA 3D8PA 2I79A 3R9FA 1QSMA 2A4NA 1YK3A 3MGDA 3BJ8A 2EUIA 2HQYA 1VHSA 1Y7RA 1M4IA 3GY9A 1XIXA 4KUBA 2IL4A 3P2HA 2QMLA 5KTCA 4NF1A 2BUEA 2P0WA 3VWDA 3T9YA 1U6MA 4OLLA 1J4JA 3GYAA 5EC4A 1XE4A 1Q2DA 4PSWA 2QECA 4J3GA 4MHDA 4QB9A 2OB0A 1SQHA 2Q4VA 2CY2A 1QSRA 1MJAA
chains in the Genus database with same CATH superfamily
3KHZA 2PE3A 1WWZA 2V8HA 2VZZA 3S9LA 3TX8A 3JVNA 2NMTA 1P0HA 2CTCA 2XEIA 2PJ4A 3B8GA 1Z5RA 3DR6A 3K9UA 3NH8A 3PFEA 4TWEA 4F0YA 2POKA 4R87A 1JWQA 1TF8A 1F2PA 2AFOA 1L0CA 4H6ZA 4KSAA 1I12A 4CYQA 1HEEA 4MHZA 4M6IA 2WYRA 3SXNA 1LAPA 1NSLA 3IJ3A 2ZPAA 3JUWA 4MY3A 4OC0A 5LYDA 3IC1A 5CPAA 4PQAA 2B4DA 4ZYQA 2WUUA 4H6UA 4P44A 5K8OA 4IF5A 3IO1A 4RUHA 1PUAA 4UEEA 3CXQA 3EC4A 4MY0A 4OC5A 4C2YA 2C27A 1RXTA 2CXAA 2CNSA 2EO8A 3PFOA 4R8FA 3SJGA 3T8WA 1GHEA 3SXOA 5JH9A 4KORA 3RAMA 4JYWA 5IV0A 1I1DA 1HDUA 1YGHA 3QAHA 4UBRA 4TNUA 3D66A 1RO5A 4P4FA 3IWWA 5KTDA 3RYOA 2AFXA 4FAIA 4P4EA 5LRKA 2RC4A 3GIUA 4UEZA 2P6FA 4HPSA 3MRUA 5J8CA 4NCZA 2QJ8A 1F2OA 2BO9A 1Z8WA 4UIBA 4AB7A 3D67A 2ZEHA 4MCSA 4FD5A 3TO7A 4CRZB 4DUKA 4KLWA 3PBBA 1XEBA 3SI0A 2ZW7A 2F8HA 4KVOE 4UEFA 4UWIA 1OZPA 1VGYA 3FXTA 2PCUA 4KUAA 4QBJA 3TFYA 2QYVA 4P45A 5I0CA 4I49A 1CP7A 3SI2A 3DGVA 5D29A 4UCMA 3FNCA 3G3SA 3IEHA 3D68A 5ISVA 4O23A 4B6ZA 5HVFA 3TOAA 4X8IA 1YLEA 2YNCA 1KUVA 5IB9A 2PVVA 1CPSA 1LRZA 1TXRA 2YGWA 3D7DA 3H8EA 4MFZA 4XNHB 4A37A 2OOTA 4NXYA 4E0AA 3B3CA 1XMBA 3I3GA 1MK4A 2HB6A 2ZEDA 3PP9A 4K3NA 5AG7A 5DWNA 3CXPA 4X2TA 1YVKA 2PDOA 2AFZA 2JBKA 4YRHA 5F47A 4CGNA 4LQGA 1BLLE 4CAVA 3H4QA 2PC1A 3BI0A 2WSAA 3BXMA 1YLOA 2B3VA 2OH1A 3LACA 4ZGYB 5HH1A 4BMHA 2Z3MA 2ABZA 3EO4A 2V8VA 4A38A 2VZYA 4R6TA 3W6XA 4AG7A 2Q04A 4AVBA 1YW6A 1AUGA 4KOSA 2EK8A 4UCPA 1IIDA 2B5GA 1I21A 2Z3OA 2GE3A 3BJ7A 4PPZA 3CPXA 3V38A 3V8IA 5J1QA 1YQEA 4UCNA 1QSTA 4OC1A 1R57A 3FH4A 3TC8A 3ISZA 2ZELA 1X10A 2RFHA 4HKFA 4UFVA 1S3ZA 2Z3NA 1NMTA 1EE3P 2ZW5A 3GLJA 1CG2A 4YU9A 1Y9WA 3PGPA 1LAMA 5HVGA 1S7KA 2CNMA 1LCPA 2REFA 4MCPA 4NGTA 3TCVA 2PIYA 2AFWA 4C7HA 5KTAA 4X5KA 1BOBA 1Z8XA 2PIZA 1Q2CA 1TIQA 3H8FA 3IGRA 3KR4A 2GREA 4KOTA 1Z8TA 4OKOA 4F9VA 5E96A 4RS2A 5IX3A 2B4DB 2F5IA 1QMUA 3NH5A 1S7NA 1VKCA 3R95A 5LRGA 3LODA 1YR0A 3N5FA 5AGEA 2VEZA 1Z4RA 3JRUA 2NSMA 4OADA 1YREA 2V8DA 3RZAA 2BOAA 2R8VA 4CGLA 2ZEMA 4CYPA 1S5KA 3B3VA 3WR7A 1TKJA 2JEWA 4FD6A 4ZBGA 2AFUA 2DXQA 2G3AA 2J8MA 2K5TA 3D4UA 3F5BA 3I9SA 2PQ8A 4MFJA 2JDCA 3RO0A 3GKRA 3FVLA 4G1PA 3D2MA 4MFKA 1R43A 4OP4A 5F48A 5BWAB 3EY5A 5JM6A 2Q44A 1IICA 2AE6A 4KOYA 2O53A 1S60A 4E8OA 1OBRA 2ZEFA 3TO6A 4P4IA 4KOUA 2QVPA 1N71A 4ONWA 4PK3A 4P4DA 3SJFA 4B12A 2J9AA 2Z11A 4M85A 1M44A 4MCRA 3S6KA 3S6HA 2ATRA 2XEJA 2CTBA 1P4NA 3EXNA 4FUUA 2GFQA 1MJ9A 3BI1A 3KL9A 3PB6X 5F46A 3FB3A 1PU9A 3S6GA 1YW4A 4MHYA 1K4JA 4Y49C 2H5MA 4IAVA 1S7LA 3D7FA 2PR1A 3OWCA 2HC9A 1KUXA 3KQZA 4DJLA 4HNXB 4DYOA 4RN7A 3SHPA 4KVXA 2DF5A 3PB4X 4A31A 4MFPA 3FYNA 4ORFA 3TTHA 2WZNA 1JQGA 4BINA 2B3UA 4OIWA 4NGMA 1FY7A 2HV2A 4KOXA 3FX6A 1Z4EA 2FIWA 3B3TA 3LMSA 3QAYA 4QVTA 1ARLA 4R76A 4KSFA 4OMEA 4JLYA 4R57A 4BD9A 2X7BA 3S9NA 2R98A 3PEIA 3NE8A 2R1IA 5HMNA 4AG9A 1TKHA 4R3KA 4CAWA 5IB0A 2Q0YA 4R3LA 2ZW6A 3DNSA 3NA6A 4EFDA 2VL1A 2PR8A 3H5ZA 3R1KA 5DWMA 2IJZA 1CX8A 3FIXA 4KLVA 5LRJA 1Q7LA 3W91A 4C2XA 3PB9X 2C1CA 4B5PA 1IOIA 5JGFA 5JPHA 5LYIA 2ZENA 3V7ZA 1ON0A 1IGBA 6CPAA 4CGMA 4PV6A 1ZO0A 2C6CA 1VHEA 3CT9A 4KVME 3KR5A 5AG6A 2OZHA 4IHMA 5CBMA 3ISXA 4A32A 4PXEA 4H89A 3RNZA 2J8NA 2P6GA 4F6AA 2V8GA 5F49A 3WT4A 3A9LA 2ZOGA 4A30A 3EFAA 4PXBA 4MJ8A 4R9MA 1YX0A 2AJ6A 3KGQA 1VHOA 3P2FA 4B5OA 2CIJA 4QC6A 3JTKA 2VI7A 4NSQA 3D2PA 4F0XA 1VIXA 2WPWA 3C26A 4MCQA 1Z8LA 1XBUA 2BL1A 1M4GA 4MHPA 4A95A 5LYFA 3R9GA 3PRTA 4YWYA 2KCWA 1YSJA 4DNCA 1QSNA 3S6FA 2PJ3A 4QUSA 1CM0A 5ELYA 4Q38A 3IU1A 1DE4C 4KOWA 2PSWA 3WABA 3CPAA 5THWA 5A27A 5K8NA 3VH9A 2BSWA 3NE7A 3KHXA 2Z0ZA 3DDDA 2G9DA 2G3TA 2FL4A 1MJBA 2DPTA 2XEFA 4MI4A 2FS5A 4F8ZA 4GXHA 2OZGA 2JLMA 2YNCC 1AYEA 1Y0RA 2OR4A 1S7FA 3HUVA 4P4JA 3FECA 5G21A 3FMCA 1FNOA 4U9ZA 4EMEA 1RTQA 2JEVA 1M1DA 4MFQA 2VQYA 5I4MA 4HNWB 5HXDA 4FD4A 4LQ6A 3GUXA 3H8GA 4M3SA 3K2KA 3VWEA 4NFRA 2PJ8A 3DR8A 2B58A 4XPLA 2OZUA 3N7ZA 1V0CA 4PK2A 4K30A 1Q2YA 2O4HA 1F57A 4FWUA 4JZ0A 1DTDA 1NE9A 1TKFA 1B87A 2VBQA 4IUSA 4ONUA 3SI1A 4BBHA 2WPXA 5K8MA 5H84A 4OC2A 3TT2A 4CAEA 2G0BA 1ZLIA 1CP6A 3NFZA 2I00A 4CAXA 2IMOA 2Y0MA 4UF4A 1XJOA 4GS4A 4KOVA 1CJWA 4XPDB 4MHNA 3T90A 4CYOA 4U5YA 2O28A 4U9YA 4XPKA 4CPAA 3RBUA 1XF8A 2I3CA 2GANA 2NYQA 2RB7A 3ZZIA 3GB0A 4F9UA 4XNHC 1UWYA 5AG4A 2AFMA 4PSXA 3VATA 2EK9A 5H86A 3TE4A 3FEDA 5DS0A 3F8KA 3KQXA 1R3NA 4Q7AA 4UA3A 1HDQA 1BPMA 3LD2A 2ARHA 1BO4A 1YVOA 3R9EA 4MFLA 2ANPA 4JXQA 2XEGA 2DEAA 1ARMA 3PZJA 7CPAA 5EMIA 4CGOA 1LANA 3E0KA 3FBUA 4MBUA 5JQ4A 1Z2LA 1BPNA 2J8RA 2FE7A 1Y9KA 5GCNA 2BCOA 2F7VA 3TO9A 2AFSA 1QQ9A 2PJAA 2R7HA 2Z3LA 2GLFA 3IWGA 4ZY2A 4C68A 2ZEOA 2ZEGA 4B5PB 2VXKA 4A2ZA 4EVYA 4CRYB 2BEIA 2CNTA 2ZEPA 5F09A 4L8AA 5FVJA 4MXUA 4ZI6A 1B6BA 2PRBA 3B35A 3NH4A 4NJQA 3PBEA 4CAFA 4ZY1A 3KASA 2B4BA 4Z65A 2PJ5A 3IWEA 2P6EA 5CNPA 4ZX8A 3VARA 2ZXVA 5J8FA 4NGPA 1QSOA 4RI1A 4ZY0A 1UFHA 4L89A 2PJ0A 3ZJ0A 3QB8A 4NGNA 5G1ZA 4AVCA 5G22A 1CBXA 3I1UA 2V77A 1KZFA 4M6GA 1X12A 3KZWA 4P10A 2ODFA 3D3SA 4UWJA 3R96A 3SJXA 1PYTB 2D4OA 3CXSA 2PJ1A 4W9YA 1Z9UA 1ELMP 3BLNA 3IFEA 2Z10A 2D4PA 4GM5A 3W6SA 2ZW4A 3D7HA 2CF4A 5AG5A 4WJBA 4UFXA 1M4LA 1IYLA 2B5GB 4JD6A 2Z3PA 1PCAA 2PJCA 4B14A 4OAEA 4P4BA 4FBEA 4LX9A 2Q7BA 5C88A 4JJXA 1GYTA 3FF3A 3CDXA 5C82A 1M4DA 1IB1E 4C7IA 3KKWA 4X3RA 4UFWA 3FRMA 4NGQA 4E2AA 1IU8A 2FT0A 2PJ2A 2PVWA 4FD7A 3BHXA 4LUAA 4UIAA 1KWMA 3CZXA 4HNYB 1XOVA 4XPDC 4CGPA 4JWPA 3UY5A 4II9A 3F0AA 3SJEA 1XRYA 3QNVA 2HUZA 1KUYA 2PJ7A 1LOKA 4MMOA 2C6PA 3HLPA 5EBVA 2Q7SA 3FEEA 1A2ZA 3B7IA 2FCKA 4KS9A 4P6YA 2EVNA 3IU2A 4NGSA 3DLJA 1IYKA 1CPXA 2IQ6A 2ZEEA 1AMPA 1XMTA 4B11A 4KZTA 1Y7EA 2FSRA 2Q4ZA 1WK4A 1ZLHA 8CPAA 3DSBA 4A94A 3G8WA 1H8LA 4AVAA 4OC4A 4Y49B 4C2ZA 1NSAA 1ZG7A 2REEA 3B3SA 4YGOA 2Q4YA 3MN8A 1FT7A 2GIVA 2FIAA 4A39A 4JXRA 2FXFA 2PJ6A 4PXDA 4ZX9A 5G20A 3TOBA 4NEXA 4NGRA 4WWVA 2JDDA 2QIRA 4CS0B 4Q36A 2OU2A 4CYNA 2GU2A 4YFJA 3D8PA 2I79A 2YNEA 1QSMA 2A4NA 3R9FA 3PB8X 4MRIA 1Y0YA 1YK3A 3LWUA 3MGDA 2PJ9A 2PJBA 3KI9A 3L2NA 4AXVA 3B3WA 3BJ8A 2FVGA 5D8NA 2EUIA 1IOFA 3K9TA 2HQYA 3FJUA 1VHSA 1Y7RA 4KSIA 1ELLP 1ZG8A 4H2KA 1M4IA 3GY9A 4B10A 2GLJA 1XIXA 2EWBA 2Z3KA 1IY7A 2IL4A 4KUBA 3P2HA 1LFWA 5HVHA 2QMLA 4B13A 4NJRA 2C6GA 4IK2A 4EWTA 5KTCA 3D7GA 4NF1A 4PXCA 2EBJA 2BUEA 4M6HA 2P0WA 3VWDA 3T9YA 1U6MA 4OLLA 2ZOFA 2Q43A 1ZG9A 3WC5A 2DPSA 1J4JA 3GYAA 4OIDA 5A28A 1YMEA 3PB7X 1XFOA 2PRQA 3WC6A 1BAVA 4A33A 5EC4A 2JBJA 1XE4A 2YNDA 3IIBA 3WC7A 1Q2DA 4PSWA 5LYLA 2QECA 4J3GA 4OC3A 4MHDA 1TF9A 4QB9A 2OB0A 5K8PA 1SQHA 2Q4VA 2CY2A 4R7MA 3B2YA 2Q51A 3S9MA 1QSRA 1MJAA
chains in the Genus database with same CATH topology
1WWZA 2VZZA 3JVNA 2NMTA 1P0HA 3B8GA 3DR6A 3K9UA 4F0YA 4R87A 1L0CA 4H6ZA 4KSAA 1I12A 4CYQA 3SXNA 1NSLA 2ZPAA 3JUWA 4MY3A 2B4DA 2WUUA 4H6UA 4IF5A 1PUAA 3CXQA 3EC4A 4MY0A 4C2YA 2C27A 1RXTA 2CXAA 2CNSA 1GHEA 3SXOA 4KORA 5IV0A 1I1DA 1YGHA 3QAHA 4UBRA 1RO5A 5KTDA 3RYOA 2RC4A 2P6FA 5J8CA 4NCZA 4AB7A 3TO7A 4FD5A 4KLWA 1XEBA 2ZW7A 4KVOE 4UWIA 1OZPA 3FXTA 3TFYA 4KUAA 4QBJA 5I0CA 4I49A 4UCMA 3FNCA 3G3SA 5ISVA 3TOAA 1YLEA 2YNCA 1KUVA 1LRZA 2YGWA 4MFZA 4XNHB 4NXYA 4E0AA 3I3GA 1MK4A 5AG7A 3PP9A 5DWNA 3CXPA 1YVKA 2PDOA 4YRHA 4CGNA 5F47A 4CAVA 3H4QA 2PC1A 2WSAA 2B3VA 2OH1A 4ZGYB 5HH1A 4BMHA 2Z3MA 3EO4A 2VZYA 3W6XA 4AG7A 2Q04A 4AVBA 4KOSA 4UCPA 1IIDA 2B5GA 1I21A 2Z3OA 2GE3A 3BJ7A 3V8IA 4UCNA 1QSTA 1R57A 4HKFA 4UFVA 1S3ZA 2Z3NA 1NMTA 2ZW5A 1Y9WA 3PGPA 1S7KA 2CNMA 2REFA 3TCVA 4C7HA 5KTAA 4X5KA 1BOBA 1Q2CA 1TIQA 3IGRA 4KOTA 5E96A 4RS2A 5IX3A 2B4DB 2F5IA 1S7NA 1VKCA 3R95A 3LODA 1YR0A 5AGEA 2VEZA 1Z4RA 4OADA 1YREA 2R8VA 4CGLA 4CYPA 1S5KA 3WR7A 4FD6A 4ZBGA 2DXQA 2J8MA 2G3AA 3F5BA 2K5TA 3I9SA 4MFJA 2PQ8A 2JDCA 3GKRA 3D2MA 4MFKA 5F48A 5BWAB 3EY5A 2Q44A 1IICA 2AE6A 4KOYA 1S60A 4E8OA 3TO6A 4KOUA 1N71A 4PK3A 4B12A 2Z11A 4M85A 1M44A 3S6KA 3S6HA 2ATRA 3EXNA 1P4NA 1MJ9A 5F46A 3FB3A 1PU9A 3S6GA 1K4JA 4Y49C 2H5MA 1S7LA 2PR1A 3OWCA 1KUXA 4HNXB 3SHPA 4KVXA 4A31A 4MFPA 3FYNA 4ORFA 3TTHA 2B3UA 1FY7A 2HV2A 4KOXA 4QVTA 1Z4EA 2FIWA 4KSFA 4R57A 4JLYA 2X7BA 2R98A 2R1IA 5HMNA 4AG9A 4R3KA 4CAWA 5IB0A 2Q0YA 4R3LA 2ZW6A 3DNSA 3H5ZA 2PR8A 3R1KA 5DWMA 3FIXA 4KLVA 3W91A 4C2XA 4B5PA 5JPHA 1ON0A 4CGMA 4PV6A 1ZO0A 4KVME 5AG6A 2OZHA 4A32A 4H89A 2J8NA 2P6GA 4F6AA 5F49A 3A9LA 4A30A 3EFAA 4MJ8A 4R9MA 1YX0A 2AJ6A 3P2FA 4B5OA 4QC6A 3JTKA 2VI7A 4NSQA 3D2PA 4F0XA 2WPWA 3C26A 2BL1A 1M4GA 4A95A 3R9GA 2KCWA 4DNCA 1QSNA 3S6FA 4QUSA 1CM0A 4Q38A 3IU1A 4KOWA 2PSWA 5A27A 2BSWA 3NE7A 2Z0ZA 3DDDA 2G3TA 2FL4A 1MJBA 2DPTA 4MI4A 2FS5A 2OZGA 2JLMA 2YNCC 1S7FA 5G21A 4U9ZA 2JEVA 1M1DA 4MFQA 2VQYA 4HNWB 4FD4A 3VWEA 4M3SA 3DR8A 2B58A 4XPLA 2OZUA 3N7ZA 1V0CA 4PK2A 4K30A 1Q2YA 4CRZB 4CYNA 1NE9A 2VBQA 1B87A 4ONUA 4IUSA 4BBHA 2WPXA 5H84A 3TT2A 4CAEA 2G0BA 2I00A 4CAXA 2Y0MA 4XPDB 4CYOA 4GS4A 4KOVA 1CJWA 3T90A 4U5YA 2O28A 4U9YA 4XPKA 1XF8A 2GANA 3ZZIA 4XNHC 5AG4A 4PSXA 5H86A 3TE4A 3F8KA 4UA3A 3LD2A 2ARHA 1BO4A 1YVOA 3R9EA 4MFLA 4JXQA 3PZJA 4CGOA 3E0KA 3FBUA 4MBUA 5JQ4A 2J8RA 2FE7A 1Y9KA 5GCNA 3TO9A 2Z3LA 2R7HA 3IWGA 4C68A 4B5PB 2VXKA 4A2ZA 4EVYA 4CRYB 2BEIA 2CNTA 4L8AA 5FVJA 1B6BA 2PRBA 4CAFA 2B4BA 3IWEA 2P6EA 5CNPA 2ZXVA 5J8FA 1QSOA 4RI1A 1UFHA 4L89A 3ZJ0A 3QB8A 4AVCA 5G1ZA 5G22A 1KZFA 3R96A 4UWJA 3D3SA 2D4OA 3CXSA 1Z9UA 3BLNA 2Z10A 2D4PA 3W6SA 2ZW4A 5AG5A 4UFXA 1IYLA 2B5GB 4JD6A 2Z3PA 4B14A 4OAEA 4LX9A 2Q7BA 5C88A 4JJXA 5C82A 1M4DA 1IB1E 4C7IA 3KKWA 4UFWA 3FRMA 4E2AA 2FT0A 4FD7A 4LUAA 4HNYB 4XPDC 4CGPA 4JWPA 3UY5A 4II9A 3F0AA 2HUZA 1KUYA 5EBVA 2FCKA 4KS9A 2EVNA 3IU2A 1IYKA 1XMTA 4B11A 4KZTA 2FSRA 1WK4A 3DSBA 3G8WA 4AVAA 4Y49B 4C2ZA 2REEA 4YGOA 2Q4YA 2GIVA 2FIAA 4JXRA 2FXFA 5G20A 3TOBA 4NEXA 2JDDA 2QIRA 4CS0B 4Q36A 2OU2A 4YFJA 3D8PA 2I79A 2YNEA 1QSMA 2A4NA 3R9FA 1YK3A 3MGDA 3BJ8A 2EUIA 2HQYA 1VHSA 1Y7RA 1M4IA 3GY9A 4B10A 1XIXA 2Z3KA 4KUBA 2IL4A 3P2HA 2QMLA 4B13A 5KTCA 4NF1A 2BUEA 2P0WA 3VWDA 3T9YA 1U6MA 4OLLA 2DPSA 1J4JA 3GYAA 5A28A 4A33A 5EC4A 1XE4A 2YNDA 1Q2DA 4PSWA 2QECA 4J3GA 4MHDA 4QB9A 2OB0A 1SQHA 2Q4VA 2CY2A 1QSRA 1MJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WWZ A;  2VZZ A;  3JVN A;  2NMT A;  1P0H A;  3B8G A;  3DR6 A;  3K9U A;  4F0Y A;  4R87 A;  1L0C A;  4H6Z A;  1I12 A;  3SXN A;  1NSL A;  2ZPA A;  3JUW A;  4MY3 A;  2B4D A;  4H6U A;  4IF5 A;  1PUA A;  3CXQ A;  3EC4 A;  4MY0 A;  2C27 A;  1RXT A;  2CNS A;  1GHE A;  3SXO A;  4KOR A;  5IV0 A;  1I1D A;  1YGH A;  3QAH A;  4UBR A;  1RO5 A;  5KTD A;  3RYO A;  2RC4 A;  2P6F A;  5J8C A;  4NCZ A;  4AB7 A;  3TO7 A;  4FD5 A;  4KLW A;  1XEB A;  2ZW7 A;  4KVO E;  4UWI A;  1OZP A;  3FXT A;  3TFY A;  4KUA A;  4QBJ A;  5I0C A;  4I49 A;  3FNC A;  3G3S A;  5ISV A;  3TOA A;  1YLE A;  1KUV A;  1LRZ A;  4XNH B;  4NXY A;  4E0A A;  3I3G A;  1MK4 A;  3PP9 A;  5DWN A;  3CXP A;  1YVK A;  2PDO A;  4YRH A;  5F47 A;  4CAV A;  3H4Q A;  2PC1 A;  2B3V A;  2OH1 A;  5HH1 A;  4BMH A;  3EO4 A;  2VZY A;  3W6X A;  4AG7 A;  2Q04 A;  4AVB A;  4KOS A;  1IID A;  2B5G A;  1I21 A;  2GE3 A;  3BJ7 A;  3V8I A;  1QST A;  1R57 A;  4HKF A;  1S3Z A;  1NMT A;  2ZW5 A;  1Y9W A;  3PGP A;  1S7K A;  2CNM A;  2REF A;  3TCV A;  5KTA A;  4X5K A;  1BOB A;  1Q2C A;  1TIQ A;  3IGR A;  4KOT A;  5E96 A;  4RS2 A;  5IX3 A;  2B4D B;  2F5I A;  1S7N A;  1VKC A;  3R95 A;  3LOD A;  1YR0 A;  2VEZ A;  1Z4R A;  4OAD A;  1YRE A;  2R8V A;  1S5K A;  3WR7 A;  4FD6 A;  4ZBG A;  2DXQ A;  2J8M A;  2G3A A;  3F5B A;  2K5T A;  3I9S A;  2PQ8 A;  2JDC A;  3GKR A;  3D2M A;  5F48 A;  3EY5 A;  2Q44 A;  1IIC A;  2AE6 A;  4KOY A;  1S60 A;  4E8O A;  3TO6 A;  4KOU A;  1N71 A;  4PK3 A;  2Z11 A;  4M85 A;  1M44 A;  3S6K A;  3S6H A;  2ATR A;  3EXN A;  1P4N A;  1MJ9 A;  5F46 A;  3FB3 A;  1PU9 A;  3S6G A;  1K4J A;  4Y49 C;  2H5M A;  1S7L A;  2PR1 A;  3OWC A;  1KUX A;  4HNX B;  3SHP A;  4KVX A;  3FYN A;  4ORF A;  3TTH A;  2B3U A;  1FY7 A;  2HV2 A;  4KOX A;  4QVT A;  1Z4E A;  2FIW A;  4R57 A;  4JLY A;  2X7B A;  2R98 A;  2R1I A;  5HMN A;  4AG9 A;  4R3K A;  4CAW A;  5IB0 A;  2Q0Y A;  4R3L A;  2ZW6 A;  3DNS A;  3R1K A;  2PR8 A;  5DWM A;  3FIX A;  4KLV A;  3W91 A;  4B5P A;  5JPH A;  1ON0 A;  4PV6 A;  4KVM E;  2OZH A;  4H89 A;  2J8N A;  2P6G A;  4F6A A;  5F49 A;  3EFA A;  4MJ8 A;  4R9M A;  1YX0 A;  2AJ6 A;  3P2F A;  4B5O A;  4QC6 A;  2VI7 A;  4NSQ A;  3D2P A;  2WPW A;  3C26 A;  2BL1 A;  1M4G A;  3R9G A;  2KCW A;  4DNC A;  1QSN A;  3S6F A;  4QUS A;  1CM0 A;  4KOW A;  2PSW A;  2BSW A;  3NE7 A;  2Z0Z A;  3DDD A;  2G3T A;  2FL4 A;  1MJB A;  4MI4 A;  2FS5 A;  2OZG A;  2JLM A;  1S7F A;  4U9Z A;  2JEV A;  1M1D A;  2VQY A;  4HNW B;  4FD4 A;  3VWE A;  4M3S A;  3DR8 A;  2B58 A;  4XPL A;  2OZU A;  3N7Z A;  1V0C A;  4PK2 A;  4K30 A;  1Q2Y A;  4CRZ B;  1NE9 A;  2VBQ A;  1B87 A;  4ONU A;  4IUS A;  2WPX A;  5H84 A;  3TT2 A;  2G0B A;  2I00 A;  4CAX A;  2Y0M A;  4XPD B;  4GS4 A;  4KOV A;  1CJW A;  3T90 A;  4U5Y A;  2O28 A;  4U9Y A;  4XPK A;  1XF8 A;  2GAN A;  3ZZI A;  4XNH C;  4PSX A;  5H86 A;  3TE4 A;  3F8K A;  4UA3 A;  3LD2 A;  2ARH A;  1BO4 A;  1YVO A;  3R9E A;  4JXQ A;  3PZJ A;  3E0K A;  3FBU A;  4MBU A;  5JQ4 A;  2J8R A;  2FE7 A;  1Y9K A;  5GCN A;  3TO9 A;  2R7H A;  3IWG A;  4B5P B;  2VXK A;  4EVY A;  4CRY B;  2BEI A;  2CNT A;  4L8A A;  5FVJ A;  1B6B A;  2PRB A;  2B4B A;  2P6E A;  5CNP A;  2ZXV A;  5J8F A;  1QSO A;  4RI1 A;  1UFH A;  4L89 A;  3ZJ0 A;  3QB8 A;  4AVC A;  1KZF A;  3R96 A;  4UWJ A;  3D3S A;  2D4O A;  3CXS A;  1Z9U A;  3BLN A;  2Z10 A;  2D4P A;  3W6S A;  2ZW4 A;  1IYL A;  2B5G B;  4JD6 A;  4OAE A;  4LX9 A;  2Q7B A;  5C88 A;  4JJX A;  5C82 A;  1M4D A;  1IB1 E;  3KKW A;  3FRM A;  4E2A A;  2FT0 A;  4FD7 A;  4LUA A;  4HNY B;  4XPD C;  4JWP A;  3UY5 A;  4II9 A;  3F0A A;  2HUZ A;  1KUY A;  5EBV A;  2FCK A;  2EVN A;  1IYK A;  1XMT A;  4KZT A;  2FSR A;  1WK4 A;  3DSB A;  3G8W A;  4AVA A;  4Y49 B;  2REE A;  4YGO A;  2Q4Y A;  2GIV A;  2FIA A;  4JXR A;  2FXF A;  3TOB A;  4NEX A;  2JDD A;  2QIR A;  4CS0 B;  2OU2 A;  4YFJ A;  3D8P A;  2I79 A;  3R9F A;  1QSM A;  2A4N A;  1YK3 A;  3MGD A;  3BJ8 A;  2EUI A;  2HQY A;  1VHS A;  1Y7R A;  1M4I A;  3GY9 A;  1XIX A;  4KUB A;  2IL4 A;  3P2H A;  2QML A;  5KTC A;  4NF1 A;  2BUE A;  2P0W A;  3VWD A;  3T9Y A;  1U6M A;  4OLL A;  1J4J A;  3GYA A;  5EC4 A;  1XE4 A;  1Q2D A;  4PSW A;  2QEC A;  4J3G A;  4MHD A;  4QB9 A;  2OB0 A;  1SQH A;  2Q4V A;  2CY2 A;  1QSR A;  1MJA A; 
#chains in the Genus database with same CATH topology
 3KHZ A;  2PE3 A;  1WWZ A;  2V8H A;  2VZZ A;  3S9L A;  3TX8 A;  3JVN A;  2NMT A;  1P0H A;  2CTC A;  2XEI A;  2PJ4 A;  3B8G A;  1Z5R A;  3DR6 A;  3K9U A;  3NH8 A;  3PFE A;  4TWE A;  4F0Y A;  2POK A;  4R87 A;  1JWQ A;  1TF8 A;  1F2P A;  2AFO A;  1L0C A;  4H6Z A;  4KSA A;  1I12 A;  4CYQ A;  1HEE A;  4MHZ A;  4M6I A;  2WYR A;  3SXN A;  1LAP A;  1NSL A;  3IJ3 A;  2ZPA A;  3JUW A;  4MY3 A;  4OC0 A;  5LYD A;  3IC1 A;  5CPA A;  4PQA A;  2B4D A;  4ZYQ A;  2WUU A;  4H6U A;  4P44 A;  5K8O A;  4IF5 A;  3IO1 A;  4RUH A;  1PUA A;  4UEE A;  3CXQ A;  3EC4 A;  4MY0 A;  4OC5 A;  4C2Y A;  2C27 A;  1RXT A;  2CXA A;  2CNS A;  2EO8 A;  3PFO A;  4R8F A;  3SJG A;  3T8W A;  1GHE A;  3SXO A;  5JH9 A;  4KOR A;  3RAM A;  4JYW A;  5IV0 A;  1I1D A;  1HDU A;  1YGH A;  3QAH A;  4UBR A;  4TNU A;  3D66 A;  1RO5 A;  4P4F A;  3IWW A;  5KTD A;  3RYO A;  2AFX A;  4FAI A;  4P4E A;  5LRK A;  2RC4 A;  3GIU A;  4UEZ A;  2P6F A;  4HPS A;  3MRU A;  5J8C A;  4NCZ A;  2QJ8 A;  1F2O A;  2BO9 A;  1Z8W A;  4UIB A;  4AB7 A;  3D67 A;  2ZEH A;  4MCS A;  4FD5 A;  3TO7 A;  4CRZ B;  4DUK A;  4KLW A;  3PBB A;  1XEB A;  3SI0 A;  2ZW7 A;  2F8H A;  4KVO E;  4UEF A;  4UWI A;  1OZP A;  1VGY A;  3FXT A;  2PCU A;  4KUA A;  4QBJ A;  3TFY A;  2QYV A;  4P45 A;  5I0C A;  4I49 A;  1CP7 A;  3SI2 A;  3DGV A;  5D29 A;  4UCM A;  3FNC A;  3G3S A;  3IEH A;  3D68 A;  5ISV A;  4O23 A;  4B6Z A;  5HVF A;  3TOA A;  4X8I A;  1YLE A;  2YNC A;  1KUV A;  5IB9 A;  2PVV A;  1CPS A;  1LRZ A;  1TXR A;  2YGW A;  3D7D A;  3H8E A;  4MFZ A;  4XNH B;  4A37 A;  2OOT A;  4NXY A;  4E0A A;  3B3C A;  1XMB A;  3I3G A;  1MK4 A;  2HB6 A;  2ZED A;  3PP9 A;  4K3N A;  5AG7 A;  5DWN A;  3CXP A;  4X2T A;  1YVK A;  2PDO A;  2AFZ A;  2JBK A;  4YRH A;  5F47 A;  4CGN A;  4LQG A;  1BLL E;  4CAV A;  3H4Q A;  2PC1 A;  3BI0 A;  2WSA A;  3BXM A;  1YLO A;  2B3V A;  2OH1 A;  3LAC A;  4ZGY B;  5HH1 A;  4BMH A;  2Z3M A;  2ABZ A;  3EO4 A;  2V8V A;  4A38 A;  2VZY A;  4R6T A;  3W6X A;  4AG7 A;  2Q04 A;  4AVB A;  1YW6 A;  1AUG A;  4KOS A;  2EK8 A;  4UCP A;  1IID A;  2B5G A;  1I21 A;  2Z3O A;  2GE3 A;  3BJ7 A;  4PPZ A;  3CPX A;  3V38 A;  3V8I A;  5J1Q A;  1YQE A;  4UCN A;  1QST A;  4OC1 A;  1R57 A;  3FH4 A;  3TC8 A;  3ISZ A;  2ZEL A;  1X10 A;  2RFH A;  4HKF A;  4UFV A;  1S3Z A;  2Z3N A;  1NMT A;  1EE3 P;  2ZW5 A;  3GLJ A;  1CG2 A;  4YU9 A;  1Y9W A;  3PGP A;  1LAM A;  5HVG A;  1S7K A;  2CNM A;  1LCP A;  2REF A;  4MCP A;  4NGT A;  3TCV A;  2PIY A;  2AFW A;  4C7H A;  5KTA A;  4X5K A;  1BOB A;  1Z8X A;  2PIZ A;  1Q2C A;  1TIQ A;  3H8F A;  3IGR A;  3KR4 A;  2GRE A;  4KOT A;  1Z8T A;  4OKO A;  4F9V A;  5E96 A;  4RS2 A;  5IX3 A;  2B4D B;  2F5I A;  1QMU A;  3NH5 A;  1S7N A;  1VKC A;  3R95 A;  5LRG A;  3LOD A;  1YR0 A;  3N5F A;  5AGE A;  2VEZ A;  1Z4R A;  3JRU A;  2NSM A;  4OAD A;  1YRE A;  2V8D A;  3RZA A;  2BOA A;  2R8V A;  4CGL A;  2ZEM A;  4CYP A;  1S5K A;  3B3V A;  3WR7 A;  1TKJ A;  2JEW A;  4FD6 A;  4ZBG A;  2AFU A;  2DXQ A;  2G3A A;  2J8M A;  2K5T A;  3D4U A;  3F5B A;  3I9S A;  2PQ8 A;  4MFJ A;  2JDC A;  3RO0 A;  3GKR A;  3FVL A;  4G1P A;  3D2M A;  4MFK A;  1R43 A;  4OP4 A;  5F48 A;  5BWA B;  3EY5 A;  5JM6 A;  2Q44 A;  1IIC A;  2AE6 A;  4KOY A;  2O53 A;  1S60 A;  4E8O A;  1OBR A;  2ZEF A;  3TO6 A;  4P4I A;  4KOU A;  2QVP A;  1N71 A;  4ONW A;  4PK3 A;  4P4D A;  3SJF A;  4B12 A;  2J9A A;  2Z11 A;  4M85 A;  1M44 A;  4MCR A;  3S6K A;  3S6H A;  2ATR A;  2XEJ A;  2CTB A;  1P4N A;  3EXN A;  4FUU A;  2GFQ A;  1MJ9 A;  3BI1 A;  3KL9 A;  3PB6 X;  5F46 A;  3FB3 A;  1PU9 A;  3S6G A;  1YW4 A;  4MHY A;  1K4J A;  4Y49 C;  2H5M A;  4IAV A;  1S7L A;  3D7F A;  2PR1 A;  3OWC A;  2HC9 A;  1KUX A;  3KQZ A;  4DJL A;  4HNX B;  4DYO A;  4RN7 A;  3SHP A;  4KVX A;  2DF5 A;  3PB4 X;  4A31 A;  4MFP A;  3FYN A;  4ORF A;  3TTH A;  2WZN A;  1JQG A;  4BIN A;  2B3U A;  4OIW A;  4NGM A;  1FY7 A;  2HV2 A;  4KOX A;  3FX6 A;  1Z4E A;  2FIW A;  3B3T A;  3LMS A;  3QAY A;  4QVT A;  1ARL A;  4R76 A;  4KSF A;  4OME A;  4JLY A;  4R57 A;  4BD9 A;  2X7B A;  3S9N A;  2R98 A;  3PEI A;  3NE8 A;  2R1I A;  5HMN A;  4AG9 A;  1TKH A;  4R3K A;  4CAW A;  5IB0 A;  2Q0Y A;  4R3L A;  2ZW6 A;  3DNS A;  3NA6 A;  4EFD A;  2VL1 A;  2PR8 A;  3H5Z A;  3R1K A;  5DWM A;  2IJZ A;  1CX8 A;  3FIX A;  4KLV A;  5LRJ A;  1Q7L A;  3W91 A;  4C2X A;  3PB9 X;  2C1C A;  4B5P A;  1IOI A;  5JGF A;  5JPH A;  5LYI A;  2ZEN A;  3V7Z A;  1ON0 A;  1IGB A;  6CPA A;  4CGM A;  4PV6 A;  1ZO0 A;  2C6C A;  1VHE A;  3CT9 A;  4KVM E;  3KR5 A;  5AG6 A;  2OZH A;  4IHM A;  5CBM A;  3ISX A;  4A32 A;  4PXE A;  4H89 A;  3RNZ A;  2J8N A;  2P6G A;  4F6A A;  2V8G A;  5F49 A;  3WT4 A;  3A9L A;  2ZOG A;  4A30 A;  3EFA A;  4PXB A;  4MJ8 A;  4R9M A;  1YX0 A;  2AJ6 A;  3KGQ A;  1VHO A;  3P2F A;  4B5O A;  2CIJ A;  4QC6 A;  3JTK A;  2VI7 A;  4NSQ A;  3D2P A;  4F0X A;  1VIX A;  2WPW A;  3C26 A;  4MCQ A;  1Z8L A;  1XBU A;  2BL1 A;  1M4G A;  4MHP A;  4A95 A;  5LYF A;  3R9G A;  3PRT A;  4YWY A;  2KCW A;  1YSJ A;  4DNC A;  1QSN A;  3S6F A;  2PJ3 A;  4QUS A;  1CM0 A;  5ELY A;  4Q38 A;  3IU1 A;  1DE4 C;  4KOW A;  2PSW A;  3WAB A;  3CPA A;  5THW A;  5A27 A;  5K8N A;  3VH9 A;  2BSW A;  3NE7 A;  3KHX A;  2Z0Z A;  3DDD A;  2G9D A;  2G3T A;  2FL4 A;  1MJB A;  2DPT A;  2XEF A;  4MI4 A;  2FS5 A;  4F8Z A;  4GXH A;  2OZG A;  2JLM A;  2YNC C;  1AYE A;  1Y0R A;  2OR4 A;  1S7F A;  3HUV A;  4P4J A;  3FEC A;  5G21 A;  3FMC A;  1FNO A;  4U9Z A;  4EME A;  1RTQ A;  2JEV A;  1M1D A;  4MFQ A;  2VQY A;  5I4M A;  4HNW B;  5HXD A;  4FD4 A;  4LQ6 A;  3GUX A;  3H8G A;  4M3S A;  3K2K A;  3VWE A;  4NFR A;  2PJ8 A;  3DR8 A;  2B58 A;  4XPL A;  2OZU A;  3N7Z A;  1V0C A;  4PK2 A;  4K30 A;  1Q2Y A;  2O4H A;  1F57 A;  4FWU A;  4JZ0 A;  1DTD A;  1NE9 A;  1TKF A;  1B87 A;  2VBQ A;  4IUS A;  4ONU A;  3SI1 A;  4BBH A;  2WPX A;  5K8M A;  5H84 A;  4OC2 A;  3TT2 A;  4CAE A;  2G0B A;  1ZLI A;  1CP6 A;  3NFZ A;  2I00 A;  4CAX A;  2IMO A;  2Y0M A;  4UF4 A;  1XJO A;  4GS4 A;  4KOV A;  1CJW A;  4XPD B;  4MHN A;  3T90 A;  4CYO A;  4U5Y A;  2O28 A;  4U9Y A;  4XPK A;  4CPA A;  3RBU A;  1XF8 A;  2I3C A;  2GAN A;  2NYQ A;  2RB7 A;  3ZZI A;  3GB0 A;  4F9U A;  4XNH C;  1UWY A;  5AG4 A;  2AFM A;  4PSX A;  3VAT A;  2EK9 A;  5H86 A;  3TE4 A;  3FED A;  5DS0 A;  3F8K A;  3KQX A;  1R3N A;  4Q7A A;  4UA3 A;  1HDQ A;  1BPM A;  3LD2 A;  2ARH A;  1BO4 A;  1YVO A;  3R9E A;  4MFL A;  2ANP A;  4JXQ A;  2XEG A;  2DEA A;  1ARM A;  3PZJ A;  7CPA A;  5EMI A;  4CGO A;  1LAN A;  3E0K A;  3FBU A;  4MBU A;  5JQ4 A;  1Z2L A;  1BPN A;  2J8R A;  2FE7 A;  1Y9K A;  5GCN A;  2BCO A;  2F7V A;  3TO9 A;  2AFS A;  1QQ9 A;  2PJA A;  2R7H A;  2Z3L A;  2GLF A;  3IWG A;  4ZY2 A;  4C68 A;  2ZEO A;  2ZEG A;  4B5P B;  2VXK A;  4A2Z A;  4EVY A;  4CRY B;  2BEI A;  2CNT A;  2ZEP A;  5F09 A;  4L8A A;  5FVJ A;  4MXU A;  4ZI6 A;  1B6B A;  2PRB A;  3B35 A;  3NH4 A;  4NJQ A;  3PBE A;  4CAF A;  4ZY1 A;  3KAS A;  2B4B A;  4Z65 A;  2PJ5 A;  3IWE A;  2P6E A;  5CNP A;  4ZX8 A;  3VAR A;  2ZXV A;  5J8F A;  4NGP A;  1QSO A;  4RI1 A;  4ZY0 A;  1UFH A;  4L89 A;  2PJ0 A;  3ZJ0 A;  3QB8 A;  4NGN A;  5G1Z A;  4AVC A;  5G22 A;  1CBX A;  3I1U A;  2V77 A;  1KZF A;  4M6G A;  1X12 A;  3KZW A;  4P10 A;  2ODF A;  3D3S A;  4UWJ A;  3R96 A;  3SJX A;  1PYT B;  2D4O A;  3CXS A;  2PJ1 A;  4W9Y A;  1Z9U A;  1ELM P;  3BLN A;  3IFE A;  2Z10 A;  2D4P A;  4GM5 A;  3W6S A;  2ZW4 A;  3D7H A;  2CF4 A;  5AG5 A;  4WJB A;  4UFX A;  1M4L A;  1IYL A;  2B5G B;  4JD6 A;  2Z3P A;  1PCA A;  2PJC A;  4B14 A;  4OAE A;  4P4B A;  4FBE A;  4LX9 A;  2Q7B A;  5C88 A;  4JJX A;  1GYT A;  3FF3 A;  3CDX A;  5C82 A;  1M4D A;  1IB1 E;  4C7I A;  3KKW A;  4X3R A;  4UFW A;  3FRM A;  4NGQ A;  4E2A A;  1IU8 A;  2FT0 A;  2PJ2 A;  2PVW A;  4FD7 A;  3BHX A;  4LUA A;  4UIA A;  1KWM A;  3CZX A;  4HNY B;  1XOV A;  4XPD C;  4CGP A;  4JWP A;  3UY5 A;  4II9 A;  3F0A A;  3SJE A;  1XRY A;  3QNV A;  2HUZ A;  1KUY A;  2PJ7 A;  1LOK A;  4MMO A;  2C6P A;  3HLP A;  5EBV A;  2Q7S A;  3FEE A;  1A2Z A;  3B7I A;  2FCK A;  4KS9 A;  4P6Y A;  2EVN A;  3IU2 A;  4NGS A;  3DLJ A;  1IYK A;  1CPX A;  2IQ6 A;  2ZEE A;  1AMP A;  1XMT A;  4B11 A;  4KZT A;  1Y7E A;  2FSR A;  2Q4Z A;  1WK4 A;  1ZLH A;  8CPA A;  3DSB A;  4A94 A;  3G8W A;  1H8L A;  4AVA A;  4OC4 A;  4Y49 B;  4C2Z A;  1NSA A;  1ZG7 A;  2REE A;  3B3S A;  4YGO A;  2Q4Y A;  3MN8 A;  1FT7 A;  2GIV A;  2FIA A;  4A39 A;  4JXR A;  2FXF A;  2PJ6 A;  4PXD A;  4ZX9 A;  5G20 A;  3TOB A;  4NEX A;  4NGR A;  4WWV A;  2JDD A;  2QIR A;  4CS0 B;  4Q36 A;  2OU2 A;  4CYN A;  2GU2 A;  4YFJ A;  3D8P A;  2I79 A;  2YNE A;  1QSM A;  2A4N A;  3R9F A;  3PB8 X;  4MRI A;  1Y0Y A;  1YK3 A;  3LWU A;  3MGD A;  2PJ9 A;  2PJB A;  3KI9 A;  3L2N A;  4AXV A;  3B3W A;  3BJ8 A;  2FVG A;  5D8N A;  2EUI A;  1IOF A;  3K9T A;  2HQY A;  3FJU A;  1VHS A;  1Y7R A;  4KSI A;  1ELL P;  1ZG8 A;  4H2K A;  1M4I A;  3GY9 A;  4B10 A;  2GLJ A;  1XIX A;  2EWB A;  2Z3K A;  1IY7 A;  2IL4 A;  4KUB A;  3P2H A;  1LFW A;  5HVH A;  2QML A;  4B13 A;  4NJR A;  2C6G A;  4IK2 A;  4EWT A;  5KTC A;  3D7G A;  4NF1 A;  4PXC A;  2EBJ A;  2BUE A;  4M6H A;  2P0W A;  3VWD A;  3T9Y A;  1U6M A;  4OLL A;  2ZOF A;  2Q43 A;  1ZG9 A;  3WC5 A;  2DPS A;  1J4J A;  3GYA A;  4OID A;  5A28 A;  1YME A;  3PB7 X;  1XFO A;  2PRQ A;  3WC6 A;  1BAV A;  4A33 A;  5EC4 A;  2JBJ A;  1XE4 A;  2YND A;  3IIB A;  3WC7 A;  1Q2D A;  4PSW A;  5LYL A;  2QEC A;  4J3G A;  4OC3 A;  4MHD A;  1TF9 A;  4QB9 A;  2OB0 A;  5K8P A;  1SQH A;  2Q4V A;  2CY2 A;  4R7M A;  3B2Y A;  2Q51 A;  3S9M A;  1QSR A;  1MJA A; 
#chains in the Genus database with same CATH homology
 1WWZ A;  2VZZ A;  3JVN A;  2NMT A;  1P0H A;  3B8G A;  3DR6 A;  3K9U A;  4F0Y A;  4R87 A;  1L0C A;  4H6Z A;  4KSA A;  1I12 A;  4CYQ A;  3SXN A;  1NSL A;  2ZPA A;  3JUW A;  4MY3 A;  2B4D A;  2WUU A;  4H6U A;  4IF5 A;  1PUA A;  3CXQ A;  3EC4 A;  4MY0 A;  4C2Y A;  2C27 A;  1RXT A;  2CXA A;  2CNS A;  1GHE A;  3SXO A;  4KOR A;  5IV0 A;  1I1D A;  1YGH A;  3QAH A;  4UBR A;  1RO5 A;  5KTD A;  3RYO A;  2RC4 A;  2P6F A;  5J8C A;  4NCZ A;  4AB7 A;  3TO7 A;  4FD5 A;  4KLW A;  1XEB A;  2ZW7 A;  4KVO E;  4UWI A;  1OZP A;  3FXT A;  3TFY A;  4KUA A;  4QBJ A;  5I0C A;  4I49 A;  4UCM A;  3FNC A;  3G3S A;  5ISV A;  3TOA A;  1YLE A;  2YNC A;  1KUV A;  1LRZ A;  2YGW A;  4MFZ A;  4XNH B;  4NXY A;  4E0A A;  3I3G A;  1MK4 A;  5AG7 A;  3PP9 A;  5DWN A;  3CXP A;  1YVK A;  2PDO A;  4YRH A;  4CGN A;  5F47 A;  4CAV A;  3H4Q A;  2PC1 A;  2WSA A;  2B3V A;  2OH1 A;  4ZGY B;  5HH1 A;  4BMH A;  2Z3M A;  3EO4 A;  2VZY A;  3W6X A;  4AG7 A;  2Q04 A;  4AVB A;  4KOS A;  4UCP A;  1IID A;  2B5G A;  1I21 A;  2Z3O A;  2GE3 A;  3BJ7 A;  3V8I A;  4UCN A;  1QST A;  1R57 A;  4HKF A;  4UFV A;  1S3Z A;  2Z3N A;  1NMT A;  2ZW5 A;  1Y9W A;  3PGP A;  1S7K A;  2CNM A;  2REF A;  3TCV A;  4C7H A;  5KTA A;  4X5K A;  1BOB A;  1Q2C A;  1TIQ A;  3IGR A;  4KOT A;  5E96 A;  4RS2 A;  5IX3 A;  2B4D B;  2F5I A;  1S7N A;  1VKC A;  3R95 A;  3LOD A;  1YR0 A;  5AGE A;  2VEZ A;  1Z4R A;  4OAD A;  1YRE A;  2R8V A;  4CGL A;  4CYP A;  1S5K A;  3WR7 A;  4FD6 A;  4ZBG A;  2DXQ A;  2J8M A;  2G3A A;  3F5B A;  2K5T A;  3I9S A;  4MFJ A;  2PQ8 A;  2JDC A;  3GKR A;  3D2M A;  4MFK A;  5F48 A;  5BWA B;  3EY5 A;  2Q44 A;  1IIC A;  2AE6 A;  4KOY A;  1S60 A;  4E8O A;  3TO6 A;  4KOU A;  1N71 A;  4PK3 A;  4B12 A;  2Z11 A;  4M85 A;  1M44 A;  3S6K A;  3S6H A;  2ATR A;  3EXN A;  1P4N A;  1MJ9 A;  5F46 A;  3FB3 A;  1PU9 A;  3S6G A;  1K4J A;  4Y49 C;  2H5M A;  1S7L A;  2PR1 A;  3OWC A;  1KUX A;  4HNX B;  3SHP A;  4KVX A;  4A31 A;  4MFP A;  3FYN A;  4ORF A;  3TTH A;  2B3U A;  1FY7 A;  2HV2 A;  4KOX A;  4QVT A;  1Z4E A;  2FIW A;  4KSF A;  4R57 A;  4JLY A;  2X7B A;  2R98 A;  2R1I A;  5HMN A;  4AG9 A;  4R3K A;  4CAW A;  5IB0 A;  2Q0Y A;  4R3L A;  2ZW6 A;  3DNS A;  3H5Z A;  2PR8 A;  3R1K A;  5DWM A;  3FIX A;  4KLV A;  3W91 A;  4C2X A;  4B5P A;  5JPH A;  1ON0 A;  4CGM A;  4PV6 A;  1ZO0 A;  4KVM E;  5AG6 A;  2OZH A;  4A32 A;  4H89 A;  2J8N A;  2P6G A;  4F6A A;  5F49 A;  3A9L A;  4A30 A;  3EFA A;  4MJ8 A;  4R9M A;  1YX0 A;  2AJ6 A;  3P2F A;  4B5O A;  4QC6 A;  3JTK A;  2VI7 A;  4NSQ A;  3D2P A;  4F0X A;  2WPW A;  3C26 A;  2BL1 A;  1M4G A;  4A95 A;  3R9G A;  2KCW A;  4DNC A;  1QSN A;  3S6F A;  4QUS A;  1CM0 A;  4Q38 A;  3IU1 A;  4KOW A;  2PSW A;  5A27 A;  2BSW A;  3NE7 A;  2Z0Z A;  3DDD A;  2G3T A;  2FL4 A;  1MJB A;  2DPT A;  4MI4 A;  2FS5 A;  2OZG A;  2JLM A;  2YNC C;  1S7F A;  5G21 A;  4U9Z A;  2JEV A;  1M1D A;  4MFQ A;  2VQY A;  4HNW B;  4FD4 A;  3VWE A;  4M3S A;  3DR8 A;  2B58 A;  4XPL A;  2OZU A;  3N7Z A;  1V0C A;  4PK2 A;  4K30 A;  1Q2Y A;  4CRZ B;  4CYN A;  1NE9 A;  2VBQ A;  1B87 A;  4ONU A;  4IUS A;  4BBH A;  2WPX A;  5H84 A;  3TT2 A;  4CAE A;  2G0B A;  2I00 A;  4CAX A;  2Y0M A;  4XPD B;  4CYO A;  4GS4 A;  4KOV A;  1CJW A;  3T90 A;  4U5Y A;  2O28 A;  4U9Y A;  4XPK A;  1XF8 A;  2GAN A;  3ZZI A;  4XNH C;  5AG4 A;  4PSX A;  5H86 A;  3TE4 A;  3F8K A;  4UA3 A;  3LD2 A;  2ARH A;  1BO4 A;  1YVO A;  3R9E A;  4MFL A;  4JXQ A;  3PZJ A;  4CGO A;  3E0K A;  3FBU A;  4MBU A;  5JQ4 A;  2J8R A;  2FE7 A;  1Y9K A;  5GCN A;  3TO9 A;  2Z3L A;  2R7H A;  3IWG A;  4C68 A;  4B5P B;  2VXK A;  4A2Z A;  4EVY A;  4CRY B;  2BEI A;  2CNT A;  4L8A A;  5FVJ A;  1B6B A;  2PRB A;  4CAF A;  2B4B A;  3IWE A;  2P6E A;  5CNP A;  2ZXV A;  5J8F A;  1QSO A;  4RI1 A;  1UFH A;  4L89 A;  3ZJ0 A;  3QB8 A;  4AVC A;  5G1Z A;  5G22 A;  1KZF A;  3R96 A;  4UWJ A;  3D3S A;  2D4O A;  3CXS A;  1Z9U A;  3BLN A;  2Z10 A;  2D4P A;  3W6S A;  2ZW4 A;  5AG5 A;  4UFX A;  1IYL A;  2B5G B;  4JD6 A;  2Z3P A;  4B14 A;  4OAE A;  4LX9 A;  2Q7B A;  5C88 A;  4JJX A;  5C82 A;  1M4D A;  1IB1 E;  4C7I A;  3KKW A;  4UFW A;  3FRM A;  4E2A A;  2FT0 A;  4FD7 A;  4LUA A;  4HNY B;  4XPD C;  4CGP A;  4JWP A;  3UY5 A;  4II9 A;  3F0A A;  2HUZ A;  1KUY A;  5EBV A;  2FCK A;  4KS9 A;  2EVN A;  3IU2 A;  1IYK A;  1XMT A;  4B11 A;  4KZT A;  2FSR A;  1WK4 A;  3DSB A;  3G8W A;  4AVA A;  4Y49 B;  4C2Z A;  2REE A;  4YGO A;  2Q4Y A;  2GIV A;  2FIA A;  4JXR A;  2FXF A;  5G20 A;  3TOB A;  4NEX A;  2JDD A;  2QIR A;  4CS0 B;  4Q36 A;  2OU2 A;  4YFJ A;  3D8P A;  2I79 A;  2YNE A;  1QSM A;  2A4N A;  3R9F A;  1YK3 A;  3MGD A;  3BJ8 A;  2EUI A;  2HQY A;  1VHS A;  1Y7R A;  1M4I A;  3GY9 A;  4B10 A;  1XIX A;  2Z3K A;  4KUB A;  2IL4 A;  3P2H A;  2QML A;  4B13 A;  5KTC A;  4NF1 A;  2BUE A;  2P0W A;  3VWD A;  3T9Y A;  1U6M A;  4OLL A;  2DPS A;  1J4J A;  3GYA A;  5A28 A;  4A33 A;  5EC4 A;  1XE4 A;  2YND A;  1Q2D A;  4PSW A;  2QEC A;  4J3G A;  4MHD A;  4QB9 A;  2OB0 A;  1SQH A;  2Q4V A;  2CY2 A;  1QSR A;  1MJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...