1ON0A

Crystal structure of putative acetyltransferase (yycn) from bacillus subtilis, northeast structural genomics consortium target sr144
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
156
structure length
156
Chain Sequence
TIMLTPMQTEEFRSYLTYTTKHYAEEKVKAGTWLPEDAQLLSKQVFTDLLPRGLETPHHHLWSLKLNEKDIVGWLWIHAEPEHPQQEAFIYDFGLYEPYRGKGYAKQALAALDQAARSMGIRKLSLHVFAHNQTARKLYEQTGFQETDVVMSKKLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords YycN protein
publication title Crystal Structure of Putative Acetyltransferase (YycN) from Bacillus subtilis
rcsb
source organism Bacillus subtilis
total genus 38
structure length 156
sequence length 156
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1on0A00
3TT2A 3PZJA 1XMTA 4JXQA 2F5IA 2B5GB 2PC1A 5JPHA 1BOBA 4Y49B 1CM0A 2B4DA 3E0KA 1YX0A 3FNCA 1Z4EA 4Y49C 4XPDC 1IYLA 4R57A 4MY0A 4QUSA 3D8PA 2P6FA 4KOTA 3EC4A 1RO5A 3TO7A 4KVOE 1IB1E 2HUZA 4M85A 2PQ8A 2ZW5A 5EC4A 4U9ZA 2OH1A 4KOUA 2BL1A 4R3KA 1RXTA 5F49A 4OAEA 3BLNA 4B5OA 1PUAA 4KOXA 5C88A 2DXQA 4KLWA 2Q7BA 5IX3A 2Q0YA 4IUSA 5KTDA 4E2AA 1NMTA 4KOYA 2FT0A 1B6BA 1MK4A 1K4JA 1LRZA 4E0AA 2AE6A 5IV0A 2RC4A 2FCKA 3F5BA 1R57A 4DNCA 1MJ9A 1YREA 2K5TA 2ATRA 1OZPA 3EXNA 2O28A 1Y7RA 3F0AA 1KUVA 4AVCA 2JDCA 2PDOA 4II9A 2I00A 3MGDA 1I21A 4PK2A 3SXNA 2FIWA 2VBQA 2JLMA 2OU2A 3I3GA 4HNWB 4NSQA 2QECA 2Q4YA 1KUYA 2OZUA 2R98A 5F47A 2EVNA 4I49A 1P4NA 5DWMA 1WWZA 4X5KA 2FSRA 2PR8A 3C26A 3W91A 2FE7A 2NMTA 2P0WA 2A4NA 3UY5A 1VKCA 3SXOA 2IL4A 1YR0A 4NXYA 2ZW4A 3B8GA 2Q4VA 2EUIA 1KUXA 3W6SA 1YK3A 3VWEA 1Q2YA 4JJXA 4PSXA 4XNHB 4JD6A 5IB0A 4KUAA 4XPLA 4R9MA 3I9SA 5E96A 4NEXA 2P6GA 4U5YA 1Y9WA 1XIXA 2FS5A 4JXRA 3TOBA 4KORA 3FB3A 3PP9A 1IIDA 1MJBA 4PSWA 2Q44A 4QBJA 2VZZA 3R9GA 1S7NA 2B3UA 4KOWA 2R7HA 4KLVA 4F0YA 4QB9A 4H6UA 4L89A 4NF1A 2FL4A 4KVXA 4FD7A 1M44A 2BUEA 2HV2A 3CXSA 3G3SA 2QMLA 4RS2A 1NE9A 2R8VA 2Q04A 1YLEA 4YRHA 3D2PA 2R1IA 1PU9A 4H6ZA 2ZW7A 1YVKA 3DR6A 3EO4A 3DR8A 1CJWA 3JVNA 1QSRA 3N7ZA 3ZJ0A 1I12A 2WPXA 2ZPAA 4LX9A 2G3AA 3D2MA 4HKFA 1SQHA 2REFA 4CAVA 2CNMA 3LD2A 1Z9UA 2Z11A 4B5PB 3GKRA 1J4JA 3F8KA 4AB7A 3TTHA 4F6AA 5HMNA 1M4GA 2VQYA 2J8NA 4MI4A 5ISVA 2G3TA 3R1KA 5F48A 3TE4A 4E8OA 2OB0A 1M4DA 4JLYA 2GE3A 1M1DA 3BJ8A 4QVTA 4H89A 2B5GA 2Z10A 2B4DB 3EY5A 1QSNA 2FIAA 3R96A 1S5KA 3VWDA 2GIVA 2REEA 4KVME 4FD6A 2G0BA 1Q2CA 1Q2DA 1XEBA 2Z0ZA 4MBUA 5J8FA 5I0CA 1WK4A 2VXKA 4KZTA 4UWIA 3IWGA 2HQYA 5JQ4A 4CRZB 2CNTA 3CXQA 4ORFA 2J8MA 5J8CA 1S7FA 1B87A 3TCVA 4OLLA 2JDDA 4PV6A 3S6FA 2PSWA 4MY3A 3TO9A 3JUWA 1MJAA 4XNHC 4IF5A 5EBVA 2WPWA 1S3ZA 4KOSA 5F46A 3QB8A 4FD5A 3P2FA 4GS4A 3BJ7A 1XE4A 2VZYA 4AG7A 4MHDA 3NE7A 5KTCA 4AG9A 1M4IA 3V8IA 3W6XA 4QC6A 1GHEA 4ZBGA 4HNYB 3FXTA 3CXPA 4U9YA 2OZHA 3T90A 4KUBA 5GCNA 4XPDB 1S60A 4L8AA 2AJ6A 3TOAA 3H4QA 1BO4A 3T9YA 2QIRA 1ON0A 2VI7A 1IYKA 3R95A 4AVBA 1NSLA 3TO6A 3FYNA 4PK3A 4FD4A 4YGOA 5H84A 4YFJA 4OADA 4R87A 4RI1A 2I79A 2P6EA 3FRMA 1QSMA 4UBRA 4CS0B 4UWJA 4CAWA 4ONUA 3IGRA 1TIQA 5KTAA 4HNXB 3KKWA 3PGPA 2BEIA 2J8RA 4JWPA 3P2HA 4EVYA 3QAHA 3FBUA 2ZXVA 2KCWA 4NCZA 2PR1A 3DSBA 3S6KA 1YVOA 2ARHA 1IICA 1S7LA 3K9UA 1U6MA 4CAXA 1Y9KA 5H86A 2ZW6A 4MJ8A 2Y0MA 3DDDA 1P0HA 5HH1A 2CNSA 2JEVA 3FIXA 1YGHA 3S6GA 1Z4RA 3RYOA 2BSWA 3G8WA 2B4BA 3EFAA 2X7BA 3TFYA 1VHSA 1QSTA 2GANA 2FXFA 2CY2A 5DWNA 2H5MA 3R9EA 2PRBA 1S7KA 1QSOA 1V0CA 4AVAA 5C82A 1I1DA 4R3LA 3ZZIA 4J3GA 2VEZA 3DNSA 2B3VA 2C27A 3WR7A 3R9FA 2D4PA 1FY7A 4XPKA 1UFHA 3D3SA 3S6HA 1XF8A 2OZGA 4CRYB 3OWCA 4B5PA 5FVJA 1N71A 4UA3A 1KZFA 4M3SA 5CNPA 4KOVA 1L0CA 3LODA 4K30A 2B58A 4BMHA 3GYAA 3SHPA 2D4OA 3GY9A 4LUAA
chains in the Genus database with same CATH superfamily
3CZXA 4P4BA 3TT2A 3KI9A 4W9YA 3PZJA 1XMTA 3FMCA 4KSAA 2POKA 4JXQA 4MHPA 2F5IA 2JBKA 2B5GB 2PC1A 5JPHA 4LQGA 5EMIA 1BOBA 4Y49B 1CM0A 2B4DA 4UIAA 3E0KA 2EK8A 3SI1A 1YX0A 3FNCA 3FX6A 3FVLA 4ZX8A 1Z4EA 3KGQA 4MCQA 4XPDC 4Y49C 4UFVA 1IYLA 3BXMA 3KHXA 4R57A 3WC5A 4A38A 4NGMA 4C7HA 2I3CA 4HPSA 4F9UA 4MY0A 4QUSA 3D8PA 2P6FA 4KOTA 1IU8A 1TKFA 5AG5A 3EC4A 1RO5A 3TO7A 3VATA 3KL9A 4KVOE 1IB1E 1VGYA 3B3WA 2O4HA 4CGOA 4ZI6A 2HUZA 4MHNA 4PXBA 4M85A 5K8NA 2PQ8A 3IC1A 3IO1A 2ZW5A 5EC4A 2IJZA 2CXAA 4U9ZA 1YW6A 2OH1A 2QVPA 4Q36A 4KOUA 5G1ZA 3S9LA 3PB7X 2BL1A 1YLOA 4R3KA 4LQ6A 1RXTA 5F49A 1JQGA 4OAEA 3BLNA 4B5OA 1PUAA 1PYTB 4KOXA 1LCPA 1TF8A 5C88A 2DXQA 2PJ0A 3BI0A 4KLWA 4MFJA 3TX8A 2Q7BA 5IX3A 2Q0YA 1GYTA 4TWEA 4IUSA 3CPXA 4E2AA 5KTDA 1NMTA 1BAVA 4JZ0A 3NH5A 4KOYA 1ZG7A 2FT0A 1B6BA 1MK4A 1K4JA 4A39A 1LRZA 4E0AA 2AE6A 5IV0A 4MHYA 2RC4A 3VARA 5JM6A 3PFEA 1HDQA 2FCKA 3F5BA 1R57A 4DNCA 1F2OA 4CAEA 4B13A 4UCPA 4Z65A 1MJ9A 2WUUA 1XMBA 1YREA 3WT4A 2K5TA 2QJ8A 2ATRA 5DS0A 1OZPA 3EXNA 3L2NA 2O28A 5G21A 2GREA 1Y7RA 2ZENA 3F0AA 3V38A 1BLLE 4P6YA 1KUVA 4AVCA 2JDCA 2PDOA 4ZY2A 4UEZA 4II9A 3GLJA 4R76A 1NSAA 5LYLA 3FEEA 6CPAA 2I00A 4OC0A 4O23A 1Z5RA 2EO8A 3MGDA 4ZYQA 1I21A 3PEIA 4PK2A 3SXNA 3NH4A 1DE4C 1QMUA 4A95A 2FIWA 2PJAA 2VBQA 2JLMA 5K8MA 2PJ2A 2OU2A 1ZLIA 2CIJA 3I3GA 1AUGA 4HNWB 2QECA 4NSQA 1XJOA 2Q4YA 3KQXA 1KUYA 2OZUA 1ELLP 4X3RA 2R98A 5F47A 2DF5A 2AFOA 3WABA 1CG2A 2PIYA 2EVNA 3CDXA 4I49A 1P4NA 4OC5A 5DWMA 1WWZA 4BD9A 4BINA 1ZLHA 1LANA 2FSRA 2PR8A 4X5KA 3C26A 5THWA 3W91A 1A2ZA 4A31A 2FE7A 3IU2A 2NMTA 2P0WA 3KR5A 2A4NA 3UY5A 2Z3LA 1VKCA 3SXOA 2IL4A 2PJCA 1YR0A 2AFUA 3BHXA 4K3NA 1TKJA 4NXYA 4DYOA 2ZW4A 3B8GA 1Y0YA 2Q4VA 4NGTA 4AXVA 2EUIA 1KUXA 3FF3A 4FBEA 4MFPA 3D7HA 4PXDA 1ARMA 1YK3A 2GLFA 4NGSA 3VWEA 3W6SA 3NE8A 3V7ZA 1Q2YA 3FH4A 4NGQA 4JJXA 4PSXA 2CTCA 4XNHB 4JD6A 5IB0A 4KUAA 2JEWA 4XPLA 4R9MA 5CBMA 3I9SA 3SJFA 2BOAA 5E96A 4R7MA 2DPTA 3KASA 2XEFA 2P6GA 3H5ZA 4NEXA 4U5YA 2Z3OA 1Y9WA 3B3CA 3S9MA 1XIXA 3WC7A 3RAMA 4R8FA 2FS5A 4P4IA 3PB9X 4FWUA 4WJBA 3SJEA 4EMEA 4JXRA 2ABZA 3TOBA 2Q51A 2ZELA 4KORA 4DJLA 3FB3A 3PP9A 1IIDA 1MJBA 2C6GA 5AG6A 1XRYA 2BCOA 1ZG8A 4PSWA 1VHEA 2Q44A 4QBJA 4B14A 2Z3MA 4CYQA 1IY7A 2VZZA 3R9GA 1S7NA 3RBUA 2B3UA 3ISXA 4C2XA 4KOWA 3WC6A 1YSJA 4FAIA 5LRGA 1LOKA 2R7HA 4KLVA 5G22A 5HXDA 4F0YA 4X2TA 4QB9A 8CPAA 4H6UA 4L89A 3LACA 2PJBA 4M6GA 2OOTA 4NF1A 2FL4A 2PVWA 4UFXA 4KVXA 4FD7A 1M44A 2BUEA 2HV2A 3CXSA 3G3SA 4UCNA 2QMLA 4OC1A 4CGMA 2ANPA 2F8HA 4RS2A 1NE9A 2R8VA 1CBXA 4OMEA 5IB9A 2XEIA 4CGLA 5BWAB 2Q04A 1YLEA 4YRHA 3D2PA 2R1IA 1PU9A 4H6ZA 3NA6A 2JBJA 1OBRA 4UIBA 2ZW7A 3JTKA 3RNZA 3LWUA 1YVKA 3DR6A 3EO4A 2EBJA 3DR8A 1CJWA 3JVNA 2ZOFA 1QSRA 2PJ3A 3B7IA 3N7ZA 3ZJ0A 5JH9A 2V8VA 3MN8A 1I12A 2WPXA 2ZPAA 4LX9A 2G3AA 4ZX9A 3BI1A 3D2MA 4HKFA 5AG4A 2V77A 2V8HA 2ZOGA 3ISZA 4UEFA 2OR4A 4B11A 1SQHA 5KTAA 2REFA 1ARLA 2G9DA 2F7VA 4OKOA 1Z8WA 5HVFA 4CAVA 2CNMA 4UCMA 3LD2A 4UF4A 3IWEA 2DEAA 4NGRA 1Z9UA 1IOFA 2Z11A 2ZEEA 4B5PB 3GKRA 2RFHA 4NGPA 2NSMA 4P4FA 1J4JA 2ZEDA 3F8KA 3IWWA 4AB7A 1YMEA 4CPAA 3H8EA 3TTHA 4F6AA 5HMNA 1M4GA 1VIXA 2VQYA 2J8NA 4MI4A 5ISVA 2G3TA 1CP6A 2PJ7A 3R1KA 5F48A 3TE4A 5A28A 1H8LA 4NGNA 4P45A 4F9VA 4E8OA 2OB0A 3SJXA 1M4DA 4JLYA 4EFDA 2GE3A 3SI2A 1M1DA 3BJ8A 4QVTA 1R3NA 4H89A 2B5GA 2Z10A 2B4DB 2GFQA 3HLPA 3EY5A 1QSNA 1BPNA 2IMOA 5LRKA 2FIAA 4MXUA 3R96A 4CAFA 1S5KA 3D67A 3VWDA 4ZGYB 2GIVA 4H2KA 4OC3A 2HB6A 2REEA 3PB6X 4KVME 3QAYA 4NFRA 1HDUA 4C2ZA 4FD6A 3RZAA 1CX8A 4C7IA 1F57A 2G0BA 2GU2A 1Q2CA 4MFKA 4ZY1A 2C1CA 1HEEA 4CGNA 3PBBA 3B35A 3FECA 3I1UA 1Q2DA 1RTQA 1XEBA 1YW4A 2Z0ZA 4MBUA 4B6ZA 2EK9A 5J8FA 4MFLA 5I0CA 2PJ4A 5D29A 1WK4A 3K2KA 4P4DA 2VXKA 4NJQA 4KZTA 1M4LA 3SI0A 4MMOA 2Z3PA 1QQ9A 4UWIA 4NJRA 3IWGA 2HQYA 5JQ4A 4CRZB 3A9LA 2CNTA 2CF4A 3CXQA 4IK2A 2ZEGA 2J8MA 4ORFA 4MRIA 5J8CA 1S7FA 1B87A 4KS9A 2Q7SA 2FVGA 2ZEOA 5D8NA 3TCVA 4OLLA 2JDDA 4PV6A 3S6FA 3VH9A 2PSWA 5K8PA 4MY3A 2CTBA 1YQEA 3D7DA 2V8DA 4WWVA 1Z8XA 2J9AA 3TO9A 2DPSA 1IOIA 3B2YA 3JUWA 1MJAA 4XNHC 4IF5A 5EBVA 5AGEA 3B3SA 2WPWA 2XEJA 1S3ZA 4KOSA 5F46A 2PJ9A 3GUXA 3QB8A 3JRUA 5ELYA 4PPZA 4P44A 2ODFA 1Y0RA 4FD5A 4KSFA 3KZWA 4P4EA 1Z8LA 4F8ZA 3P2FA 4MCSA 4GS4A 1Q7LA 3TC8A 3BJ7A 2YNCC 1XE4A 2VZYA 2XEGA 1Y7EA 5JGFA 4AG7A 1FT7A 4MHDA 1ZO0A 3NE7A 5KTCA 3H8GA 4AG9A 1M4IA 4B12A 3V8IA 3W6XA 2BO9A 1XFOA 2IQ6A 4PXEA 4MFZA 4QC6A 4CGPA 2AFZA 1GHEA 4ZBGA 2ZEFA 3IEHA 2PJ6A 4HNYB 3FXTA 3CXPA 4FUUA 4A30A 4U9YA 1ELMP 2OZHA 3T90A 4KUBA 5GCNA 3H8FA 4CYPA 4XPDB 1S60A 4L8AA 4PQAA 2AJ6A 3TOAA 3H4QA 1ZG9A 5LRJA 1BO4A 2PJ5A 3T8WA 4M6IA 1TXRA 1AMPA 2QYVA 5HVGA 3T9YA 2QIRA 5I4MA 4PXCA 3IFEA 2GLJA 1ON0A 2VI7A 1IYKA 3R95A 4A37A 4AVBA 1KWMA 1NSLA 4KSIA 4OP4A 1TKHA 3TO6A 2PVVA 1TF9A 2AFSA 3FYNA 4PK3A 4CYOA 3RO0A 4FD4A 4YGOA 2Q4ZA 2ZEHA 5H84A 4YFJA 3K9TA 4EWTA 4OADA 4R87A 4P10A 4A94A 4RI1A 1DTDA 4G1PA 2I79A 2P6EA 2WYRA 1UWYA 3FRMA 4OIWA 1XBUA 5LYIA 3NFZA 1QSMA 4ZY0A 2C6CA 4UBRA 4CS0B 4UWJA 4CAWA 4ONUA 1BPMA 1LAMA 3IGRA 2PIZA 1TIQA 2YNDA 1AYEA 4MFQA 4HNXB 4X8IA 2PCUA 3KKWA 1JWQA 2PRQA 2BEIA 3PGPA 2J8RA 2V8GA 1CP7A 4JWPA 3P2HA 4EVYA 3IU1A 2WSAA 3QAHA 2ZEMA 3FBUA 4UFWA 4A33A 2ZXVA 3PB8X 5HVHA 2ZEPA 2KCWA 2WZNA 4JYWA 4NCZA 2PR1A 3DSBA 3S6KA 1YVOA 3KHZA 2ARHA 3NH8A 1IICA 1S7LA 2VL1A 3K9UA 4B10A 2YNCA 3D7GA 1U6MA 4OC4A 4CAXA 2AFXA 3S9NA 3D68A 4BBHA 4Q38A 2Z3KA 1Y9KA 3D7FA 4P4JA 5H86A 4YWYA 4MCPA 3SJGA 1R43A 2HC9A 3QNVA 4MCRA 4ONWA 2ZW6A 2RB7A 4MJ8A 2Y0MA 3DDDA 1P0HA 3PFOA 2CNSA 2JEVA 5HH1A 3FIXA 1YGHA 3S6GA 1Z4RA 3RYOA 3PRTA 2BSWA 3IIBA 1LFWA 3D66A 3G8WA 2B4BA 4YU9A 1EE3P 4R6TA 3D4UA 5LYFA 3EFAA 2X7BA 3TFYA 1VHSA 4C2YA 1QSTA 1Z8TA 2GANA 2FXFA 5G20A 3B3TA 4OC2A 3KR4A 2PJ1A 7CPAA 2CY2A 1IGBA 1VHOA 3IJ3A 5DWNA 5CPAA 2C6PA 2H5MA 1FNOA 1X10A 3MRUA 4IAVA 3R9EA 2PRBA 1S7KA 1QSOA 1V0CA 2AFMA 4AVAA 5C82A 1I1DA 4M6HA 4R3LA 3ZZIA 5K8OA 2YGWA 2VEZA 3DNSA 4J3GA 2PJ8A 2B3VA 2C27A 3FJUA 2PE3A 5AG7A 1X12A 3PBEA 1CPXA 2NYQA 4C68A 3HUVA 3WR7A 3DLJA 3R9FA 3N5FA 3B3VA 1CPSA 3KQZA 2O53A 4Q7AA 4RUHA 3CPAA 3GB0A 5F09A 3PB4X 4GM5A 2Q43A 4MHZA 2D4PA 4A32A 1FY7A 4GXHA 4XPKA 1UFHA 1XOVA 3D3SA 3S6HA 2EWBA 5LYDA 1XF8A 3GIUA 2OZGA 3FEDA 3LMSA 4CRYB 3OWCA 5A27A 4OIDA 3CT9A 4B5PA 5FVJA 1N71A 4RN7A 4UA3A 2AFWA 1KZFA 4M3SA 5CNPA 1LAPA 1Z2LA 4KOVA 1L0CA 3LODA 4K30A 4TNUA 2YNEA 4A2ZA 4DUKA 2B58A 4CYNA 4F0XA 5J1QA 4BMHA 3GYAA 3SHPA 2D4OA 4UEEA 1PCAA 1F2PA 2Z3NA 4IHMA 3GY9A 4LUAA 3DGVA
chains in the Genus database with same CATH topology
3TT2A 3PZJA 1XMTA 4KSAA 4JXQA 2F5IA 2B5GB 2PC1A 5JPHA 1BOBA 4Y49B 1CM0A 2B4DA 3E0KA 1YX0A 3FNCA 1Z4EA 4Y49C 4XPDC 4UFVA 1IYLA 4C7HA 4R57A 4MY0A 4QUSA 3D8PA 2P6FA 4KOTA 5AG5A 3EC4A 1RO5A 3TO7A 4KVOE 1IB1E 4CGOA 2HUZA 4M85A 2PQ8A 2ZW5A 5EC4A 2CXAA 4U9ZA 2OH1A 4Q36A 4KOUA 5G1ZA 2BL1A 4R3KA 1RXTA 5F49A 4OAEA 3BLNA 4B5OA 1PUAA 4KOXA 5C88A 2DXQA 4KLWA 4MFJA 2Q7BA 5IX3A 2Q0YA 4IUSA 5KTDA 4E2AA 1NMTA 4KOYA 2FT0A 1B6BA 1MK4A 1K4JA 1LRZA 4E0AA 2AE6A 5IV0A 2RC4A 2FCKA 3F5BA 1R57A 4DNCA 4CAEA 4B13A 4UCPA 1MJ9A 2WUUA 1YREA 2K5TA 2ATRA 1OZPA 3EXNA 2O28A 5G21A 1Y7RA 3F0AA 1KUVA 4AVCA 2JDCA 2PDOA 4II9A 2I00A 3MGDA 1I21A 4PK2A 3SXNA 4A95A 2FIWA 2VBQA 2JLMA 2OU2A 3I3GA 4HNWB 4NSQA 2QECA 2Q4YA 1KUYA 2OZUA 2R98A 5F47A 2EVNA 4I49A 1P4NA 5DWMA 1WWZA 4X5KA 2FSRA 2PR8A 3C26A 3W91A 4A31A 2FE7A 3IU2A 2NMTA 2P0WA 2A4NA 3UY5A 2Z3LA 1VKCA 3SXOA 2IL4A 1YR0A 4NXYA 2ZW4A 3B8GA 2Q4VA 2EUIA 1KUXA 4MFPA 3W6SA 1YK3A 3VWEA 1Q2YA 4JJXA 4PSXA 4XNHB 4JD6A 5IB0A 4KUAA 4XPLA 4R9MA 3I9SA 5E96A 2DPTA 4NEXA 3H5ZA 2P6GA 4U5YA 2Z3OA 1Y9WA 1XIXA 2FS5A 4JXRA 3TOBA 4KORA 3FB3A 3PP9A 1IIDA 1MJBA 5AG6A 4PSWA 2Q44A 4QBJA 4B14A 2Z3MA 4CYQA 2VZZA 3R9GA 1S7NA 2B3UA 4C2XA 4KOWA 2R7HA 4KLVA 5G22A 4F0YA 4QB9A 4H6UA 4L89A 4NF1A 2FL4A 4UFXA 4KVXA 4FD7A 1M44A 2BUEA 2HV2A 3CXSA 3G3SA 4UCNA 2QMLA 4CGMA 4RS2A 1NE9A 2R8VA 4CGLA 5BWAB 2Q04A 1YLEA 4YRHA 3D2PA 2R1IA 1PU9A 4H6ZA 2ZW7A 3JTKA 1YVKA 3DR6A 3EO4A 3DR8A 1CJWA 3JVNA 1QSRA 3N7ZA 3ZJ0A 1I12A 2WPXA 2ZPAA 4LX9A 2G3AA 3D2MA 4HKFA 5AG4A 4B11A 1SQHA 2REFA 4CAVA 2CNMA 4UCMA 3LD2A 3IWEA 1Z9UA 2Z11A 4B5PB 3GKRA 1J4JA 3F8KA 4AB7A 3TTHA 4F6AA 5HMNA 1M4GA 2VQYA 2J8NA 4MI4A 5ISVA 2G3TA 3R1KA 5F48A 3TE4A 5A28A 4E8OA 2OB0A 1M4DA 4JLYA 2GE3A 1M1DA 3BJ8A 4QVTA 4H89A 2B5GA 2Z10A 2B4DB 3EY5A 1QSNA 2FIAA 3R96A 4CAFA 1S5KA 3VWDA 4ZGYB 2GIVA 2REEA 4KVME 4C2ZA 4FD6A 4C7IA 2G0BA 1Q2CA 4MFKA 4CGNA 1Q2DA 1XEBA 2Z0ZA 4MBUA 5J8FA 4MFLA 5I0CA 1WK4A 2VXKA 4KZTA 4UWIA 2Z3PA 3IWGA 2HQYA 5JQ4A 4CRZB 3A9LA 2CNTA 3CXQA 4ORFA 2J8MA 5J8CA 1S7FA 1B87A 4KS9A 3TCVA 4OLLA 2JDDA 4PV6A 3S6FA 2PSWA 4MY3A 3TO9A 2DPSA 3JUWA 1MJAA 4XNHC 4IF5A 5EBVA 5AGEA 2WPWA 1S3ZA 4KOSA 5F46A 3QB8A 4FD5A 4KSFA 3P2FA 4GS4A 3BJ7A 2YNCC 1XE4A 2VZYA 4AG7A 4MHDA 1ZO0A 3NE7A 5KTCA 4AG9A 1M4IA 4B12A 3V8IA 3W6XA 4QC6A 4MFZA 4CGPA 1GHEA 4ZBGA 4HNYB 3FXTA 3CXPA 4A30A 4U9YA 2OZHA 3T90A 4KUBA 5GCNA 4CYPA 4XPDB 1S60A 4L8AA 2AJ6A 3TOAA 3H4QA 1BO4A 3T9YA 2QIRA 1ON0A 2VI7A 1IYKA 3R95A 4AVBA 1NSLA 3TO6A 4CYOA 3FYNA 4PK3A 4FD4A 4YGOA 5H84A 4YFJA 4OADA 4R87A 4RI1A 2I79A 2P6EA 3FRMA 1QSMA 4UBRA 4CS0B 4UWJA 4CAWA 4ONUA 3IGRA 2YNDA 1TIQA 4MFQA 5KTAA 4HNXB 3KKWA 3PGPA 2BEIA 2J8RA 4JWPA 3P2HA 4EVYA 3IU1A 2WSAA 3QAHA 3FBUA 4UFWA 4A33A 2ZXVA 2KCWA 4NCZA 2PR1A 3DSBA 3S6KA 1YVOA 2ARHA 1IICA 1S7LA 3K9UA 4B10A 2YNCA 1U6MA 4CAXA 4BBHA 4Q38A 2Z3KA 1Y9KA 5H86A 2ZW6A 4MJ8A 2Y0MA 3DDDA 1P0HA 5HH1A 2CNSA 2JEVA 3FIXA 1YGHA 3S6GA 1Z4RA 3RYOA 2BSWA 3G8WA 2B4BA 3EFAA 2X7BA 3TFYA 1VHSA 4C2YA 1QSTA 2GANA 2FXFA 5G20A 2CY2A 5DWNA 2H5MA 3R9EA 2PRBA 1S7KA 1QSOA 1V0CA 4AVAA 5C82A 1I1DA 4R3LA 3ZZIA 2YGWA 2VEZA 3DNSA 4J3GA 2B3VA 2C27A 5AG7A 4C68A 3WR7A 3R9FA 4A32A 2D4PA 1FY7A 4XPKA 1UFHA 3D3SA 3S6HA 1XF8A 2OZGA 4CRYB 5A27A 3OWCA 4B5PA 5FVJA 1N71A 4UA3A 1KZFA 4M3SA 5CNPA 4KOVA 1L0CA 3LODA 4K30A 4A2ZA 2YNEA 2B58A 4CYNA 4F0XA 4BMHA 3GYAA 3SHPA 2D4OA 2Z3NA 3GY9A 4LUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TT2 A;  3PZJ A;  1XMT A;  4JXQ A;  2F5I A;  2B5G B;  2PC1 A;  5JPH A;  1BOB A;  4Y49 B;  1CM0 A;  2B4D A;  3E0K A;  1YX0 A;  3FNC A;  1Z4E A;  4Y49 C;  4XPD C;  1IYL A;  4R57 A;  4MY0 A;  4QUS A;  3D8P A;  2P6F A;  4KOT A;  3EC4 A;  1RO5 A;  3TO7 A;  4KVO E;  1IB1 E;  2HUZ A;  4M85 A;  2PQ8 A;  2ZW5 A;  5EC4 A;  4U9Z A;  2OH1 A;  4KOU A;  2BL1 A;  4R3K A;  1RXT A;  5F49 A;  4OAE A;  3BLN A;  4B5O A;  1PUA A;  4KOX A;  5C88 A;  2DXQ A;  4KLW A;  2Q7B A;  5IX3 A;  2Q0Y A;  4IUS A;  5KTD A;  4E2A A;  1NMT A;  4KOY A;  2FT0 A;  1B6B A;  1MK4 A;  1K4J A;  1LRZ A;  4E0A A;  2AE6 A;  5IV0 A;  2RC4 A;  2FCK A;  3F5B A;  1R57 A;  4DNC A;  1MJ9 A;  1YRE A;  2K5T A;  2ATR A;  1OZP A;  3EXN A;  2O28 A;  1Y7R A;  3F0A A;  1KUV A;  4AVC A;  2JDC A;  2PDO A;  4II9 A;  2I00 A;  3MGD A;  1I21 A;  4PK2 A;  3SXN A;  2FIW A;  2VBQ A;  2JLM A;  2OU2 A;  3I3G A;  4HNW B;  4NSQ A;  2QEC A;  2Q4Y A;  1KUY A;  2OZU A;  2R98 A;  5F47 A;  2EVN A;  4I49 A;  1P4N A;  5DWM A;  1WWZ A;  4X5K A;  2FSR A;  2PR8 A;  3C26 A;  3W91 A;  2FE7 A;  2NMT A;  2P0W A;  2A4N A;  3UY5 A;  1VKC A;  3SXO A;  2IL4 A;  1YR0 A;  4NXY A;  2ZW4 A;  3B8G A;  2Q4V A;  2EUI A;  1KUX A;  3W6S A;  1YK3 A;  3VWE A;  1Q2Y A;  4JJX A;  4PSX A;  4XNH B;  4JD6 A;  5IB0 A;  4KUA A;  4XPL A;  4R9M A;  3I9S A;  5E96 A;  4NEX A;  2P6G A;  4U5Y A;  1Y9W A;  1XIX A;  2FS5 A;  4JXR A;  3TOB A;  4KOR A;  3FB3 A;  3PP9 A;  1IID A;  1MJB A;  4PSW A;  2Q44 A;  4QBJ A;  2VZZ A;  3R9G A;  1S7N A;  2B3U A;  4KOW A;  2R7H A;  4KLV A;  4F0Y A;  4QB9 A;  4H6U A;  4L89 A;  4NF1 A;  2FL4 A;  4KVX A;  4FD7 A;  1M44 A;  2BUE A;  2HV2 A;  3CXS A;  3G3S A;  2QML A;  4RS2 A;  1NE9 A;  2R8V A;  2Q04 A;  1YLE A;  4YRH A;  3D2P A;  2R1I A;  1PU9 A;  4H6Z A;  2ZW7 A;  1YVK A;  3DR6 A;  3EO4 A;  3DR8 A;  1CJW A;  3JVN A;  1QSR A;  3N7Z A;  3ZJ0 A;  1I12 A;  2WPX A;  2ZPA A;  4LX9 A;  2G3A A;  3D2M A;  4HKF A;  1SQH A;  2REF A;  4CAV A;  2CNM A;  3LD2 A;  1Z9U A;  2Z11 A;  4B5P B;  3GKR A;  1J4J A;  3F8K A;  4AB7 A;  3TTH A;  4F6A A;  5HMN A;  1M4G A;  2VQY A;  2J8N A;  4MI4 A;  5ISV A;  2G3T A;  3R1K A;  5F48 A;  3TE4 A;  4E8O A;  2OB0 A;  1M4D A;  4JLY A;  2GE3 A;  1M1D A;  3BJ8 A;  4QVT A;  4H89 A;  2B5G A;  2Z10 A;  2B4D B;  3EY5 A;  1QSN A;  2FIA A;  3R96 A;  1S5K A;  3VWD A;  2GIV A;  2REE A;  4KVM E;  4FD6 A;  2G0B A;  1Q2C A;  1Q2D A;  1XEB A;  2Z0Z A;  4MBU A;  5J8F A;  5I0C A;  1WK4 A;  2VXK A;  4KZT A;  4UWI A;  3IWG A;  2HQY A;  5JQ4 A;  4CRZ B;  2CNT A;  3CXQ A;  4ORF A;  2J8M A;  5J8C A;  1S7F A;  1B87 A;  3TCV A;  4OLL A;  2JDD A;  4PV6 A;  3S6F A;  2PSW A;  4MY3 A;  3TO9 A;  3JUW A;  1MJA A;  4XNH C;  4IF5 A;  5EBV A;  2WPW A;  1S3Z A;  4KOS A;  5F46 A;  3QB8 A;  4FD5 A;  3P2F A;  4GS4 A;  3BJ7 A;  1XE4 A;  2VZY A;  4AG7 A;  4MHD A;  3NE7 A;  5KTC A;  4AG9 A;  1M4I A;  3V8I A;  3W6X A;  4QC6 A;  1GHE A;  4ZBG A;  4HNY B;  3FXT A;  3CXP A;  4U9Y A;  2OZH A;  3T90 A;  4KUB A;  5GCN A;  4XPD B;  1S60 A;  4L8A A;  2AJ6 A;  3TOA A;  3H4Q A;  1BO4 A;  3T9Y A;  2QIR A;  1ON0 A;  2VI7 A;  1IYK A;  3R95 A;  4AVB A;  1NSL A;  3TO6 A;  3FYN A;  4PK3 A;  4FD4 A;  4YGO A;  5H84 A;  4YFJ A;  4OAD A;  4R87 A;  4RI1 A;  2I79 A;  2P6E A;  3FRM A;  1QSM A;  4UBR A;  4CS0 B;  4UWJ A;  4CAW A;  4ONU A;  3IGR A;  1TIQ A;  5KTA A;  4HNX B;  3KKW A;  3PGP A;  2BEI A;  2J8R A;  4JWP A;  3P2H A;  4EVY A;  3QAH A;  3FBU A;  2ZXV A;  2KCW A;  4NCZ A;  2PR1 A;  3DSB A;  3S6K A;  1YVO A;  2ARH A;  1IIC A;  1S7L A;  3K9U A;  1U6M A;  4CAX A;  1Y9K A;  5H86 A;  2ZW6 A;  4MJ8 A;  2Y0M A;  3DDD A;  1P0H A;  5HH1 A;  2CNS A;  2JEV A;  3FIX A;  1YGH A;  3S6G A;  1Z4R A;  3RYO A;  2BSW A;  3G8W A;  2B4B A;  3EFA A;  2X7B A;  3TFY A;  1VHS A;  1QST A;  2GAN A;  2FXF A;  2CY2 A;  5DWN A;  2H5M A;  3R9E A;  2PRB A;  1S7K A;  1QSO A;  1V0C A;  4AVA A;  5C82 A;  1I1D A;  4R3L A;  3ZZI A;  4J3G A;  2VEZ A;  3DNS A;  2B3V A;  2C27 A;  3WR7 A;  3R9F A;  2D4P A;  1FY7 A;  4XPK A;  1UFH A;  3D3S A;  3S6H A;  1XF8 A;  2OZG A;  4CRY B;  3OWC A;  4B5P A;  5FVJ A;  1N71 A;  4UA3 A;  1KZF A;  4M3S A;  5CNP A;  4KOV A;  1L0C A;  3LOD A;  4K30 A;  2B58 A;  4BMH A;  3GYA A;  3SHP A;  2D4O A;  3GY9 A;  4LUA A; 
#chains in the Genus database with same CATH topology
 3CZX A;  4P4B A;  3TT2 A;  3KI9 A;  4W9Y A;  3PZJ A;  1XMT A;  3FMC A;  4KSA A;  2POK A;  4JXQ A;  4MHP A;  2F5I A;  2JBK A;  2B5G B;  2PC1 A;  5JPH A;  4LQG A;  5EMI A;  1BOB A;  4Y49 B;  1CM0 A;  2B4D A;  4UIA A;  3E0K A;  2EK8 A;  3SI1 A;  1YX0 A;  3FNC A;  3FX6 A;  3FVL A;  4ZX8 A;  1Z4E A;  3KGQ A;  4MCQ A;  4XPD C;  4Y49 C;  4UFV A;  1IYL A;  3BXM A;  3KHX A;  4R57 A;  3WC5 A;  4A38 A;  4NGM A;  4C7H A;  2I3C A;  4HPS A;  4F9U A;  4MY0 A;  4QUS A;  3D8P A;  2P6F A;  4KOT A;  1IU8 A;  1TKF A;  5AG5 A;  3EC4 A;  1RO5 A;  3TO7 A;  3VAT A;  3KL9 A;  4KVO E;  1IB1 E;  1VGY A;  3B3W A;  2O4H A;  4CGO A;  4ZI6 A;  2HUZ A;  4MHN A;  4PXB A;  4M85 A;  5K8N A;  2PQ8 A;  3IC1 A;  3IO1 A;  2ZW5 A;  5EC4 A;  2IJZ A;  2CXA A;  4U9Z A;  1YW6 A;  2OH1 A;  2QVP A;  4Q36 A;  4KOU A;  5G1Z A;  3S9L A;  3PB7 X;  2BL1 A;  1YLO A;  4R3K A;  4LQ6 A;  1RXT A;  5F49 A;  1JQG A;  4OAE A;  3BLN A;  4B5O A;  1PUA A;  1PYT B;  4KOX A;  1LCP A;  1TF8 A;  5C88 A;  2DXQ A;  2PJ0 A;  3BI0 A;  4KLW A;  4MFJ A;  3TX8 A;  2Q7B A;  5IX3 A;  2Q0Y A;  1GYT A;  4TWE A;  4IUS A;  3CPX A;  4E2A A;  5KTD A;  1NMT A;  1BAV A;  4JZ0 A;  3NH5 A;  4KOY A;  1ZG7 A;  2FT0 A;  1B6B A;  1MK4 A;  1K4J A;  4A39 A;  1LRZ A;  4E0A A;  2AE6 A;  5IV0 A;  4MHY A;  2RC4 A;  3VAR A;  5JM6 A;  3PFE A;  1HDQ A;  2FCK A;  3F5B A;  1R57 A;  4DNC A;  1F2O A;  4CAE A;  4B13 A;  4UCP A;  4Z65 A;  1MJ9 A;  2WUU A;  1XMB A;  1YRE A;  3WT4 A;  2K5T A;  2QJ8 A;  2ATR A;  5DS0 A;  1OZP A;  3EXN A;  3L2N A;  2O28 A;  5G21 A;  2GRE A;  1Y7R A;  2ZEN A;  3F0A A;  3V38 A;  1BLL E;  4P6Y A;  1KUV A;  4AVC A;  2JDC A;  2PDO A;  4ZY2 A;  4UEZ A;  4II9 A;  3GLJ A;  4R76 A;  1NSA A;  5LYL A;  3FEE A;  6CPA A;  2I00 A;  4OC0 A;  4O23 A;  1Z5R A;  2EO8 A;  3MGD A;  4ZYQ A;  1I21 A;  3PEI A;  4PK2 A;  3SXN A;  3NH4 A;  1DE4 C;  1QMU A;  4A95 A;  2FIW A;  2PJA A;  2VBQ A;  2JLM A;  5K8M A;  2PJ2 A;  2OU2 A;  1ZLI A;  2CIJ A;  3I3G A;  1AUG A;  4HNW B;  2QEC A;  4NSQ A;  1XJO A;  2Q4Y A;  3KQX A;  1KUY A;  2OZU A;  1ELL P;  4X3R A;  2R98 A;  5F47 A;  2DF5 A;  2AFO A;  3WAB A;  1CG2 A;  2PIY A;  2EVN A;  3CDX A;  4I49 A;  1P4N A;  4OC5 A;  5DWM A;  1WWZ A;  4BD9 A;  4BIN A;  1ZLH A;  1LAN A;  2FSR A;  2PR8 A;  4X5K A;  3C26 A;  5THW A;  3W91 A;  1A2Z A;  4A31 A;  2FE7 A;  3IU2 A;  2NMT A;  2P0W A;  3KR5 A;  2A4N A;  3UY5 A;  2Z3L A;  1VKC A;  3SXO A;  2IL4 A;  2PJC A;  1YR0 A;  2AFU A;  3BHX A;  4K3N A;  1TKJ A;  4NXY A;  4DYO A;  2ZW4 A;  3B8G A;  1Y0Y A;  2Q4V A;  4NGT A;  4AXV A;  2EUI A;  1KUX A;  3FF3 A;  4FBE A;  4MFP A;  3D7H A;  4PXD A;  1ARM A;  1YK3 A;  2GLF A;  4NGS A;  3VWE A;  3W6S A;  3NE8 A;  3V7Z A;  1Q2Y A;  3FH4 A;  4NGQ A;  4JJX A;  4PSX A;  2CTC A;  4XNH B;  4JD6 A;  5IB0 A;  4KUA A;  2JEW A;  4XPL A;  4R9M A;  5CBM A;  3I9S A;  3SJF A;  2BOA A;  5E96 A;  4R7M A;  2DPT A;  3KAS A;  2XEF A;  2P6G A;  3H5Z A;  4NEX A;  4U5Y A;  2Z3O A;  1Y9W A;  3B3C A;  3S9M A;  1XIX A;  3WC7 A;  3RAM A;  4R8F A;  2FS5 A;  4P4I A;  3PB9 X;  4FWU A;  4WJB A;  3SJE A;  4EME A;  4JXR A;  2ABZ A;  3TOB A;  2Q51 A;  2ZEL A;  4KOR A;  4DJL A;  3FB3 A;  3PP9 A;  1IID A;  1MJB A;  2C6G A;  5AG6 A;  1XRY A;  2BCO A;  1ZG8 A;  4PSW A;  1VHE A;  2Q44 A;  4QBJ A;  4B14 A;  2Z3M A;  4CYQ A;  1IY7 A;  2VZZ A;  3R9G A;  1S7N A;  3RBU A;  2B3U A;  3ISX A;  4C2X A;  4KOW A;  3WC6 A;  1YSJ A;  4FAI A;  5LRG A;  1LOK A;  2R7H A;  4KLV A;  5G22 A;  5HXD A;  4F0Y A;  4X2T A;  4QB9 A;  8CPA A;  4H6U A;  4L89 A;  3LAC A;  2PJB A;  4M6G A;  2OOT A;  4NF1 A;  2FL4 A;  2PVW A;  4UFX A;  4KVX A;  4FD7 A;  1M44 A;  2BUE A;  2HV2 A;  3CXS A;  3G3S A;  4UCN A;  2QML A;  4OC1 A;  4CGM A;  2ANP A;  2F8H A;  4RS2 A;  1NE9 A;  2R8V A;  1CBX A;  4OME A;  5IB9 A;  2XEI A;  4CGL A;  5BWA B;  2Q04 A;  1YLE A;  4YRH A;  3D2P A;  2R1I A;  1PU9 A;  4H6Z A;  3NA6 A;  2JBJ A;  1OBR A;  4UIB A;  2ZW7 A;  3JTK A;  3RNZ A;  3LWU A;  1YVK A;  3DR6 A;  3EO4 A;  2EBJ A;  3DR8 A;  1CJW A;  3JVN A;  2ZOF A;  1QSR A;  2PJ3 A;  3B7I A;  3N7Z A;  3ZJ0 A;  5JH9 A;  2V8V A;  3MN8 A;  1I12 A;  2WPX A;  2ZPA A;  4LX9 A;  2G3A A;  4ZX9 A;  3BI1 A;  3D2M A;  4HKF A;  5AG4 A;  2V77 A;  2V8H A;  2ZOG A;  3ISZ A;  4UEF A;  2OR4 A;  4B11 A;  1SQH A;  5KTA A;  2REF A;  1ARL A;  2G9D A;  2F7V A;  4OKO A;  1Z8W A;  5HVF A;  4CAV A;  2CNM A;  4UCM A;  3LD2 A;  4UF4 A;  3IWE A;  2DEA A;  4NGR A;  1Z9U A;  1IOF A;  2Z11 A;  2ZEE A;  4B5P B;  3GKR A;  2RFH A;  4NGP A;  2NSM A;  4P4F A;  1J4J A;  2ZED A;  3F8K A;  3IWW A;  4AB7 A;  1YME A;  4CPA A;  3H8E A;  3TTH A;  4F6A A;  5HMN A;  1M4G A;  1VIX A;  2VQY A;  2J8N A;  4MI4 A;  5ISV A;  2G3T A;  1CP6 A;  2PJ7 A;  3R1K A;  5F48 A;  3TE4 A;  5A28 A;  1H8L A;  4NGN A;  4P45 A;  4F9V A;  4E8O A;  2OB0 A;  3SJX A;  1M4D A;  4JLY A;  4EFD A;  2GE3 A;  3SI2 A;  1M1D A;  3BJ8 A;  4QVT A;  1R3N A;  4H89 A;  2B5G A;  2Z10 A;  2B4D B;  2GFQ A;  3HLP A;  3EY5 A;  1QSN A;  1BPN A;  2IMO A;  5LRK A;  2FIA A;  4MXU A;  3R96 A;  4CAF A;  1S5K A;  3D67 A;  3VWD A;  4ZGY B;  2GIV A;  4H2K A;  4OC3 A;  2HB6 A;  2REE A;  3PB6 X;  4KVM E;  3QAY A;  4NFR A;  1HDU A;  4C2Z A;  4FD6 A;  3RZA A;  1CX8 A;  4C7I A;  1F57 A;  2G0B A;  2GU2 A;  1Q2C A;  4MFK A;  4ZY1 A;  2C1C A;  1HEE A;  4CGN A;  3PBB A;  3B35 A;  3FEC A;  3I1U A;  1Q2D A;  1RTQ A;  1XEB A;  1YW4 A;  2Z0Z A;  4MBU A;  4B6Z A;  2EK9 A;  5J8F A;  4MFL A;  5I0C A;  2PJ4 A;  5D29 A;  1WK4 A;  3K2K A;  4P4D A;  2VXK A;  4NJQ A;  4KZT A;  1M4L A;  3SI0 A;  4MMO A;  2Z3P A;  1QQ9 A;  4UWI A;  4NJR A;  3IWG A;  2HQY A;  5JQ4 A;  4CRZ B;  3A9L A;  2CNT A;  2CF4 A;  3CXQ A;  4IK2 A;  2ZEG A;  2J8M A;  4ORF A;  4MRI A;  5J8C A;  1S7F A;  1B87 A;  4KS9 A;  2Q7S A;  2FVG A;  2ZEO A;  5D8N A;  3TCV A;  4OLL A;  2JDD A;  4PV6 A;  3S6F A;  3VH9 A;  2PSW A;  5K8P A;  4MY3 A;  2CTB A;  1YQE A;  3D7D A;  2V8D A;  4WWV A;  1Z8X A;  2J9A A;  3TO9 A;  2DPS A;  1IOI A;  3B2Y A;  3JUW A;  1MJA A;  4XNH C;  4IF5 A;  5EBV A;  5AGE A;  3B3S A;  2WPW A;  2XEJ A;  1S3Z A;  4KOS A;  5F46 A;  2PJ9 A;  3GUX A;  3QB8 A;  3JRU A;  5ELY A;  4PPZ A;  4P44 A;  2ODF A;  1Y0R A;  4FD5 A;  4KSF A;  3KZW A;  4P4E A;  1Z8L A;  4F8Z A;  3P2F A;  4MCS A;  4GS4 A;  1Q7L A;  3TC8 A;  3BJ7 A;  2YNC C;  1XE4 A;  2VZY A;  2XEG A;  1Y7E A;  5JGF A;  4AG7 A;  1FT7 A;  4MHD A;  1ZO0 A;  3NE7 A;  5KTC A;  3H8G A;  4AG9 A;  1M4I A;  4B12 A;  3V8I A;  3W6X A;  2BO9 A;  1XFO A;  2IQ6 A;  4PXE A;  4MFZ A;  4QC6 A;  4CGP A;  2AFZ A;  1GHE A;  4ZBG A;  2ZEF A;  3IEH A;  2PJ6 A;  4HNY B;  3FXT A;  3CXP A;  4FUU A;  4A30 A;  4U9Y A;  1ELM P;  2OZH A;  3T90 A;  4KUB A;  5GCN A;  3H8F A;  4CYP A;  4XPD B;  1S60 A;  4L8A A;  4PQA A;  2AJ6 A;  3TOA A;  3H4Q A;  1ZG9 A;  5LRJ A;  1BO4 A;  2PJ5 A;  3T8W A;  4M6I A;  1TXR A;  1AMP A;  2QYV A;  5HVG A;  3T9Y A;  2QIR A;  5I4M A;  4PXC A;  3IFE A;  2GLJ A;  1ON0 A;  2VI7 A;  1IYK A;  3R95 A;  4A37 A;  4AVB A;  1KWM A;  1NSL A;  4KSI A;  4OP4 A;  1TKH A;  3TO6 A;  2PVV A;  1TF9 A;  2AFS A;  3FYN A;  4PK3 A;  4CYO A;  3RO0 A;  4FD4 A;  4YGO A;  2Q4Z A;  2ZEH A;  5H84 A;  4YFJ A;  3K9T A;  4EWT A;  4OAD A;  4R87 A;  4P10 A;  4A94 A;  4RI1 A;  1DTD A;  4G1P A;  2I79 A;  2P6E A;  2WYR A;  1UWY A;  3FRM A;  4OIW A;  1XBU A;  5LYI A;  3NFZ A;  1QSM A;  4ZY0 A;  2C6C A;  4UBR A;  4CS0 B;  4UWJ A;  4CAW A;  4ONU A;  1BPM A;  1LAM A;  3IGR A;  2PIZ A;  1TIQ A;  2YND A;  1AYE A;  4MFQ A;  4HNX B;  4X8I A;  2PCU A;  3KKW A;  1JWQ A;  2PRQ A;  2BEI A;  3PGP A;  2J8R A;  2V8G A;  1CP7 A;  4JWP A;  3P2H A;  4EVY A;  3IU1 A;  2WSA A;  3QAH A;  2ZEM A;  3FBU A;  4UFW A;  4A33 A;  2ZXV A;  3PB8 X;  5HVH A;  2ZEP A;  2KCW A;  2WZN A;  4JYW A;  4NCZ A;  2PR1 A;  3DSB A;  3S6K A;  1YVO A;  3KHZ A;  2ARH A;  3NH8 A;  1IIC A;  1S7L A;  2VL1 A;  3K9U A;  4B10 A;  2YNC A;  3D7G A;  1U6M A;  4OC4 A;  4CAX A;  2AFX A;  3S9N A;  3D68 A;  4BBH A;  4Q38 A;  2Z3K A;  1Y9K A;  3D7F A;  4P4J A;  5H86 A;  4YWY A;  4MCP A;  3SJG A;  1R43 A;  2HC9 A;  3QNV A;  4MCR A;  4ONW A;  2ZW6 A;  2RB7 A;  4MJ8 A;  2Y0M A;  3DDD A;  1P0H A;  3PFO A;  2CNS A;  2JEV A;  5HH1 A;  3FIX A;  1YGH A;  3S6G A;  1Z4R A;  3RYO A;  3PRT A;  2BSW A;  3IIB A;  1LFW A;  3D66 A;  3G8W A;  2B4B A;  4YU9 A;  1EE3 P;  4R6T A;  3D4U A;  5LYF A;  3EFA A;  2X7B A;  3TFY A;  1VHS A;  4C2Y A;  1QST A;  1Z8T A;  2GAN A;  2FXF A;  5G20 A;  3B3T A;  4OC2 A;  3KR4 A;  2PJ1 A;  7CPA A;  2CY2 A;  1IGB A;  1VHO A;  3IJ3 A;  5DWN A;  5CPA A;  2C6P A;  2H5M A;  1FNO A;  1X10 A;  3MRU A;  4IAV A;  3R9E A;  2PRB A;  1S7K A;  1QSO A;  1V0C A;  2AFM A;  4AVA A;  5C82 A;  1I1D A;  4M6H A;  4R3L A;  3ZZI A;  5K8O A;  2YGW A;  2VEZ A;  3DNS A;  4J3G A;  2PJ8 A;  2B3V A;  2C27 A;  3FJU A;  2PE3 A;  5AG7 A;  1X12 A;  3PBE A;  1CPX A;  2NYQ A;  4C68 A;  3HUV A;  3WR7 A;  3DLJ A;  3R9F A;  3N5F A;  3B3V A;  1CPS A;  3KQZ A;  2O53 A;  4Q7A A;  4RUH A;  3CPA A;  3GB0 A;  5F09 A;  3PB4 X;  4GM5 A;  2Q43 A;  4MHZ A;  2D4P A;  4A32 A;  1FY7 A;  4GXH A;  4XPK A;  1UFH A;  1XOV A;  3D3S A;  3S6H A;  2EWB A;  5LYD A;  1XF8 A;  3GIU A;  2OZG A;  3FED A;  3LMS A;  4CRY B;  3OWC A;  5A27 A;  4OID A;  3CT9 A;  4B5P A;  5FVJ A;  1N71 A;  4RN7 A;  4UA3 A;  2AFW A;  1KZF A;  4M3S A;  5CNP A;  1LAP A;  1Z2L A;  4KOV A;  1L0C A;  3LOD A;  4K30 A;  4TNU A;  2YNE A;  4A2Z A;  4DUK A;  2B58 A;  4CYN A;  4F0X A;  5J1Q A;  4BMH A;  3GYA A;  3SHP A;  2D4O A;  4UEE A;  1PCA A;  1F2P A;  2Z3N A;  4IHM A;  3GY9 A;  4LUA A;  3DGV A; 
#chains in the Genus database with same CATH homology
 3TT2 A;  3PZJ A;  1XMT A;  4KSA A;  4JXQ A;  2F5I A;  2B5G B;  2PC1 A;  5JPH A;  1BOB A;  4Y49 B;  1CM0 A;  2B4D A;  3E0K A;  1YX0 A;  3FNC A;  1Z4E A;  4Y49 C;  4XPD C;  4UFV A;  1IYL A;  4C7H A;  4R57 A;  4MY0 A;  4QUS A;  3D8P A;  2P6F A;  4KOT A;  5AG5 A;  3EC4 A;  1RO5 A;  3TO7 A;  4KVO E;  1IB1 E;  4CGO A;  2HUZ A;  4M85 A;  2PQ8 A;  2ZW5 A;  5EC4 A;  2CXA A;  4U9Z A;  2OH1 A;  4Q36 A;  4KOU A;  5G1Z A;  2BL1 A;  4R3K A;  1RXT A;  5F49 A;  4OAE A;  3BLN A;  4B5O A;  1PUA A;  4KOX A;  5C88 A;  2DXQ A;  4KLW A;  4MFJ A;  2Q7B A;  5IX3 A;  2Q0Y A;  4IUS A;  5KTD A;  4E2A A;  1NMT A;  4KOY A;  2FT0 A;  1B6B A;  1MK4 A;  1K4J A;  1LRZ A;  4E0A A;  2AE6 A;  5IV0 A;  2RC4 A;  2FCK A;  3F5B A;  1R57 A;  4DNC A;  4CAE A;  4B13 A;  4UCP A;  1MJ9 A;  2WUU A;  1YRE A;  2K5T A;  2ATR A;  1OZP A;  3EXN A;  2O28 A;  5G21 A;  1Y7R A;  3F0A A;  1KUV A;  4AVC A;  2JDC A;  2PDO A;  4II9 A;  2I00 A;  3MGD A;  1I21 A;  4PK2 A;  3SXN A;  4A95 A;  2FIW A;  2VBQ A;  2JLM A;  2OU2 A;  3I3G A;  4HNW B;  4NSQ A;  2QEC A;  2Q4Y A;  1KUY A;  2OZU A;  2R98 A;  5F47 A;  2EVN A;  4I49 A;  1P4N A;  5DWM A;  1WWZ A;  4X5K A;  2FSR A;  2PR8 A;  3C26 A;  3W91 A;  4A31 A;  2FE7 A;  3IU2 A;  2NMT A;  2P0W A;  2A4N A;  3UY5 A;  2Z3L A;  1VKC A;  3SXO A;  2IL4 A;  1YR0 A;  4NXY A;  2ZW4 A;  3B8G A;  2Q4V A;  2EUI A;  1KUX A;  4MFP A;  3W6S A;  1YK3 A;  3VWE A;  1Q2Y A;  4JJX A;  4PSX A;  4XNH B;  4JD6 A;  5IB0 A;  4KUA A;  4XPL A;  4R9M A;  3I9S A;  5E96 A;  2DPT A;  4NEX A;  3H5Z A;  2P6G A;  4U5Y A;  2Z3O A;  1Y9W A;  1XIX A;  2FS5 A;  4JXR A;  3TOB A;  4KOR A;  3FB3 A;  3PP9 A;  1IID A;  1MJB A;  5AG6 A;  4PSW A;  2Q44 A;  4QBJ A;  4B14 A;  2Z3M A;  4CYQ A;  2VZZ A;  3R9G A;  1S7N A;  2B3U A;  4C2X A;  4KOW A;  2R7H A;  4KLV A;  5G22 A;  4F0Y A;  4QB9 A;  4H6U A;  4L89 A;  4NF1 A;  2FL4 A;  4UFX A;  4KVX A;  4FD7 A;  1M44 A;  2BUE A;  2HV2 A;  3CXS A;  3G3S A;  4UCN A;  2QML A;  4CGM A;  4RS2 A;  1NE9 A;  2R8V A;  4CGL A;  5BWA B;  2Q04 A;  1YLE A;  4YRH A;  3D2P A;  2R1I A;  1PU9 A;  4H6Z A;  2ZW7 A;  3JTK A;  1YVK A;  3DR6 A;  3EO4 A;  3DR8 A;  1CJW A;  3JVN A;  1QSR A;  3N7Z A;  3ZJ0 A;  1I12 A;  2WPX A;  2ZPA A;  4LX9 A;  2G3A A;  3D2M A;  4HKF A;  5AG4 A;  4B11 A;  1SQH A;  2REF A;  4CAV A;  2CNM A;  4UCM A;  3LD2 A;  3IWE A;  1Z9U A;  2Z11 A;  4B5P B;  3GKR A;  1J4J A;  3F8K A;  4AB7 A;  3TTH A;  4F6A A;  5HMN A;  1M4G A;  2VQY A;  2J8N A;  4MI4 A;  5ISV A;  2G3T A;  3R1K A;  5F48 A;  3TE4 A;  5A28 A;  4E8O A;  2OB0 A;  1M4D A;  4JLY A;  2GE3 A;  1M1D A;  3BJ8 A;  4QVT A;  4H89 A;  2B5G A;  2Z10 A;  2B4D B;  3EY5 A;  1QSN A;  2FIA A;  3R96 A;  4CAF A;  1S5K A;  3VWD A;  4ZGY B;  2GIV A;  2REE A;  4KVM E;  4C2Z A;  4FD6 A;  4C7I A;  2G0B A;  1Q2C A;  4MFK A;  4CGN A;  1Q2D A;  1XEB A;  2Z0Z A;  4MBU A;  5J8F A;  4MFL A;  5I0C A;  1WK4 A;  2VXK A;  4KZT A;  4UWI A;  2Z3P A;  3IWG A;  2HQY A;  5JQ4 A;  4CRZ B;  3A9L A;  2CNT A;  3CXQ A;  4ORF A;  2J8M A;  5J8C A;  1S7F A;  1B87 A;  4KS9 A;  3TCV A;  4OLL A;  2JDD A;  4PV6 A;  3S6F A;  2PSW A;  4MY3 A;  3TO9 A;  2DPS A;  3JUW A;  1MJA A;  4XNH C;  4IF5 A;  5EBV A;  5AGE A;  2WPW A;  1S3Z A;  4KOS A;  5F46 A;  3QB8 A;  4FD5 A;  4KSF A;  3P2F A;  4GS4 A;  3BJ7 A;  2YNC C;  1XE4 A;  2VZY A;  4AG7 A;  4MHD A;  1ZO0 A;  3NE7 A;  5KTC A;  4AG9 A;  1M4I A;  4B12 A;  3V8I A;  3W6X A;  4QC6 A;  4MFZ A;  4CGP A;  1GHE A;  4ZBG A;  4HNY B;  3FXT A;  3CXP A;  4A30 A;  4U9Y A;  2OZH A;  3T90 A;  4KUB A;  5GCN A;  4CYP A;  4XPD B;  1S60 A;  4L8A A;  2AJ6 A;  3TOA A;  3H4Q A;  1BO4 A;  3T9Y A;  2QIR A;  1ON0 A;  2VI7 A;  1IYK A;  3R95 A;  4AVB A;  1NSL A;  3TO6 A;  4CYO A;  3FYN A;  4PK3 A;  4FD4 A;  4YGO A;  5H84 A;  4YFJ A;  4OAD A;  4R87 A;  4RI1 A;  2I79 A;  2P6E A;  3FRM A;  1QSM A;  4UBR A;  4CS0 B;  4UWJ A;  4CAW A;  4ONU A;  3IGR A;  2YND A;  1TIQ A;  4MFQ A;  5KTA A;  4HNX B;  3KKW A;  3PGP A;  2BEI A;  2J8R A;  4JWP A;  3P2H A;  4EVY A;  3IU1 A;  2WSA A;  3QAH A;  3FBU A;  4UFW A;  4A33 A;  2ZXV A;  2KCW A;  4NCZ A;  2PR1 A;  3DSB A;  3S6K A;  1YVO A;  2ARH A;  1IIC A;  1S7L A;  3K9U A;  4B10 A;  2YNC A;  1U6M A;  4CAX A;  4BBH A;  4Q38 A;  2Z3K A;  1Y9K A;  5H86 A;  2ZW6 A;  4MJ8 A;  2Y0M A;  3DDD A;  1P0H A;  5HH1 A;  2CNS A;  2JEV A;  3FIX A;  1YGH A;  3S6G A;  1Z4R A;  3RYO A;  2BSW A;  3G8W A;  2B4B A;  3EFA A;  2X7B A;  3TFY A;  1VHS A;  4C2Y A;  1QST A;  2GAN A;  2FXF A;  5G20 A;  2CY2 A;  5DWN A;  2H5M A;  3R9E A;  2PRB A;  1S7K A;  1QSO A;  1V0C A;  4AVA A;  5C82 A;  1I1D A;  4R3L A;  3ZZI A;  2YGW A;  2VEZ A;  3DNS A;  4J3G A;  2B3V A;  2C27 A;  5AG7 A;  4C68 A;  3WR7 A;  3R9F A;  4A32 A;  2D4P A;  1FY7 A;  4XPK A;  1UFH A;  3D3S A;  3S6H A;  1XF8 A;  2OZG A;  4CRY B;  5A27 A;  3OWC A;  4B5P A;  5FVJ A;  1N71 A;  4UA3 A;  1KZF A;  4M3S A;  5CNP A;  4KOV A;  1L0C A;  3LOD A;  4K30 A;  4A2Z A;  2YNE A;  2B58 A;  4CYN A;  4F0X A;  4BMH A;  3GYA A;  3SHP A;  2D4O A;  2Z3N A;  3GY9 A;  4LUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...