2ZENA

Crystal structure of the human glutaminyl cyclase mutant d305a at 1.78 angstrom resolution
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
329
structure length
323
Chain Sequence
b'ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQADHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl-peptide cyclotransferase
publication title A conserved hydrogen-bond network in the catalytic centre of animal glutaminyl cyclases is critical for catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 108
structure length 323
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2zenA00
4FAIA 2QYVA 2JEWA 1YLOA 3KI9A 1HDUA 1QQ9A 4P4JA 5CPAA 4A38A 5LYDA 3LMSA 1BPMA 4NJQA 4B6ZA 4P44A 3IIBA 3FMCA 5CBMA 5D29A 3LWUA 3WC6A 3KL9A 3B2YA 1H8LA 1CP7A 2XEIA 3HUVA 5JGFA 4TWEA 2C1CA 2C6GA 1BLLE 3BI1A 4NGSA 3WT4A 4NGPA 4R6TA 1FT7A 2PJBA 3B3VA 4K3NA 4F9VA 5HVGA 4EWTA 3VH9A 1CBXA 4P4FA 2ZOFA 1KWMA 3CPAA 4ZY0A 5LRGA 4WWVA 3H8FA 5JH9A 4MHPA 4OC1A 1TXRA 4IHMA 4MCPA 2JBKA 3NFZA 2AFZA 3PBEA 3PB7X 2IQ6A 3FH4A 2G9DA 3PFEA 4ZY2A 4Z65A 4R7MA 1TF9A 2IJZA 3FF3A 1YMEA 2PJ2A 2ZEPA 2HB6A 2AFXA 4LQGA 3K2KA 2IMOA 3ISXA 4UF4A 5LYLA 3IO1A 2ZEGA 3NH5A 4AXVA 4A37A 2ZENA 2PJ1A 3DGVA 4NJRA 1R43A 3QNVA 1YSJA 2PIZA 3WABA 1F2PA 1XJOA 2EK8A 1CP6A 3NH4A 4JYWA 4NGMA 3HLPA 4BD9A 6CPAA 3B3CA 2ZELA 3D66A 1LAMA 1YW6A 4TNUA 2FVGA 3IJ3A 2V8GA 2EK9A 2GLFA 2DEAA 3D7DA 5LYIA 3SI1A 3N5FA 2CTBA 2O4HA 1LFWA 3PB4X 3S9NA 1LOKA 4R76A 3SJXA 2PJ5A 3NH8A 4JZ0A 1LAPA 1TKHA 2ZEMA 4YU9A 2ANPA 4MCSA 1TKJA 3KASA 3PRTA 4UIBA 1Q7LA 3IEHA 4P4IA 3SI2A 4R8FA 2BO9A 1Y0YA 3D67A 2JBJA 4F9UA 2Q43A 1ARMA 3B7IA 3FVLA 3GUXA 4WJBA 4OIWA 1IGBA 4OIDA 3D7GA 3T8WA 4MRIA 1TF8A 2GU2A 2AFUA 3FEDA 4PXCA 2PJ4A 2PJ6A 3KHZA 1PCAA 3RBUA 1LCPA 4EFDA 4NGQA 5K8MA 3NA6A 3TC8A 1YW4A 4UEFA 4DYOA 2QVPA 4X3RA 4X2TA 4ZY1A 3RAMA 3MN8A 2OR4A 4UEEA 1QMUA 4OC2A 2Q4ZA 4OC5A 4MCQA 2GLJA 1HEEA 3H8EA 4NFRA 4ZX9A 2F8HA 3SJGA 1EE3P 1M4LA 2WYRA 3B3WA 2EWBA 2AFSA 1AMPA 3KGQA 1AYEA 2V8DA 1GYTA 4DJLA 3GB0A 1XBUA 4FBEA 1F2OA 1LANA 5K8OA 3K9TA 1ZG8A 2ZEEA 2ZOGA 3BHXA 3FEEA 2V8HA 4DUKA 7CPAA 3S9MA 3PEIA 2ZEHA 4MMOA 1JQGA 3D4UA 3KHXA 4GM5A 5I4MA 2PCUA 4P10A 2PJ3A 3H8GA 4W9YA 4ZI6A 2PJAA 4OMEA 1BPNA 2ABZA 4IAVA 1XRYA 3CPXA 3VATA 1PYTB 4KSIA 4MCRA 3VARA 4MHYA 2WZNA 2BOAA 3SJEA 1XMBA 4Q7AA 2C6PA 3PFOA 5F09A 1VIXA 3D68A 4A39A 2ZEDA 2V77A 3ISZA 2AFMA 2CF4A 3JRUA 4P6YA 5ELYA 2PVWA 1Z5RA 1NSAA 4CPAA 5LRKA 2CIJA 4ONWA 4UIAA 3V38A 2PJ7A 3GLJA 2XEFA 1Y7EA 3KQZA 5DS0A 3L2NA 2XEGA 8CPAA 1ZLIA 1VGYA 3B3SA 3PB6X 4EMEA 1ARLA 1F57A 1OBRA 1ZG9A 3PB8X 3S9LA 4IK2A 3IC1A 1ELMP 5K8PA 4P4BA 1Y0RA 4ZX8A 2ZEFA 1Z8LA 2Q51A 3SI0A 4OKOA 2POKA 4NGRA 4P4EA 2QJ8A 2O53A 3KQXA 3BXMA 1ELLP 4O23A 4PXBA 3PB9X 4A94A 2GREA 1XFOA 4PXEA 3B3TA 1CG2A 3D7HA 2I3CA 5HVFA 3WC5A 2NSMA 2F7VA 1ZG7A 4RUHA 5THWA 4PXDA 2RB7A 2AFWA 2PVVA 3IWWA 5IB9A 3KR4A 3TX8A 1HDQA 1DE4C 4MHZA 4P4DA 5K8NA 3IFEA 5J1QA 3RZAA 1FNOA 2AFOA 2PRQA 1TKFA 2PE3A 2C6CA 2CTCA 4F8ZA 4PPZA 1Z2LA 5LRJA 5HXDA 1R3NA 3B35A 2HC9A 1BAVA 3I1UA 2VL1A 2ZEOA 2RFHA 1CPXA 3KZWA 4UEZA 5JM6A 2V8VA 3WC7A 4H2KA 3PBBA 4YWYA 2PJCA 4P45A 1VHEA 1VHOA 5HVHA 4G1PA 3FECA 4MHNA 1CPSA 4PQAA 5D8NA 3FJUA 1CX8A 3D7FA 2PJ0A 1IY7A 2PJ9A 1UWYA 4OC4A 4ZYQA 3FX6A 2XEJA 2J9AA 3CDXA 5LYFA 4NGTA 3V7ZA 2PIYA 1DTDA 3KR5A 2BCOA 4FWUA 4NGNA 3CT9A 4OC3A 2NYQA 4OP4A 4OC0A 1RTQA 3BI0A 4X8IA 1ZLHA 3MRUA 3SJFA 4FUUA 2OOTA 2PJ8A 3DLJA 4MXUA
chains in the Genus database with same CATH superfamily
3C26A 2QYVA 4FAIA 1N71A 2ZW7A 2JEWA 1YLOA 3KI9A 1HDUA 1QQ9A 2Z0ZA 4P4JA 4K30A 5CPAA 5F49A 2HQYA 4XPLA 3IU2A 4A38A 5LYDA 3LMSA 4KOTA 1BPMA 2VZZA 1Q2YA 3R95A 4NJQA 2AJ6A 4B6ZA 4FD4A 1X12A 2OH1A 4P44A 3F5BA 3IIBA 4M6IA 4HKFA 1YR0A 3PGPA 3FMCA 3DDDA 5A28A 5EBVA 5CBMA 5D29A 3LWUA 3WC6A 3KL9A 3B2YA 4KUAA 2REEA 2Z11A 2GFQA 5C88A 1H8LA 1CP7A 2H5MA 4NEXA 4PK2A 4R3KA 2XEIA 3HUVA 5JGFA 1Z8XA 2PR1A 3G3SA 4TWEA 2C1CA 2C6GA 4KVME 4B14A 1BLLE 3BI1A 4NGSA 1BO4A 4C7HA 3WT4A 1SQHA 2PSWA 4NGPA 2G0BA 4R6TA 1FT7A 2IL4A 3R9EA 3S6HA 3RO0A 1S5KA 2G3TA 2PJBA 3B3VA 4K3NA 4F9VA 5HVGA 4JXRA 4B10A 4EWTA 4Y49B 4CYQA 3VH9A 2PRBA 1CBXA 4P4FA 2ZOFA 1KWMA 1WK4A 1MJBA 1OZPA 3CPAA 4R57A 4WWVA 5LRGA 4B13A 4ZY0A 2R98A 3H8FA 2YGWA 5JH9A 4MHPA 3RYOA 4OC1A 2G3AA 1TXRA 3I9SA 5AG4A 4B11A 4A33A 4YFJA 4IHMA 1Y7RA 4MCPA 2WPWA 4BINA 1NE9A 2JBKA 3NFZA 4NSQA 3W6XA 2AFZA 2VXKA 3PBEA 2VBQA 3PB7X 2IQ6A 3FH4A 4RN7A 4Y49C 4AG9A 4C7IA 2G9DA 3PFEA 4ONUA 4ZY2A 2QECA 2P6EA 4Z65A 1IYLA 2Q44A 4U9YA 4R7MA 4UFWA 5HH1A 1TF9A 2IJZA 3JVNA 2VQYA 4HNWB 4A32A 4BMHA 3FF3A 3SXNA 4RI1A 3R9GA 1KUYA 3CXSA 1YMEA 4UBRA 2PJ2A 4CAXA 2Q7BA 2ZEPA 2HB6A 2WUUA 2AFXA 2DPSA 4LQGA 3K2KA 3QB8A 2QIRA 2IMOA 2OB0A 4CAVA 4CAEA 3ISXA 5E96A 4ORFA 4UF4A 5LYLA 3BJ8A 3IO1A 5J8CA 2GANA 2ZEGA 4OAEA 3FYNA 2B5GA 3NH5A 3FBUA 3QAHA 1XIXA 4PSWA 4AXVA 1QSMA 4A37A 2ZENA 5JPHA 2PJ1A 3GKRA 3DGVA 3FIXA 1GHEA 2B58A 4NJRA 2FS5A 1R43A 4MY0A 1I21A 2BSWA 3QNVA 1YSJA 2PIZA 3DR6A 3WABA 1X10A 4J3GA 1F2PA 2JDCA 3EFAA 1XJOA 4MY3A 2EK8A 1CP6A 4UCPA 1J4JA 5A27A 3FRMA 3D3SA 3A9LA 3NH4A 2GE3A 1CJWA 4JYWA 4NGMA 2BL1A 1XF8A 3HLPA 4BD9A 4AB7A 1S60A 3B8GA 1XOVA 2CNSA 3B3CA 3D2PA 4ZGYB 6CPAA 2Q4VA 2ZELA 1PUAA 2ZW6A 4PK3A 3UY5A 4B5OA 5J8FA 3D66A 4MXUA 2B3VA 3R9FA 1LAMA 4II9A 1YW6A 4TNUA 2KCWA 2FVGA 3KKWA 3MGDA 3IJ3A 2V8GA 2EK9A 2GLFA 4CAFA 1P0HA 2JLMA 3LD2A 2YNCC 3GYAA 3QAYA 1MJ9A 2ARHA 4F0YA 2DEAA 3D7DA 4H6UA 5LYIA 3SI1A 3N5FA 4QB9A 2CTBA 2O4HA 1LFWA 3PB4X 5F47A 4B12A 3DR8A 3S9NA 4IF5A 5EMIA 3F8KA 1R57A 4MFKA 4MFJA 1LOKA 2GIVA 4R76A 3SJXA 2PJ5A 2Z3NA 2CNMA 3T9YA 3I3GA 3EC4A 3NH8A 4JZ0A 1LAPA 1TKHA 4A95A 2ZEMA 4YRHA 4YU9A 2ANPA 5CNPA 4CGNA 4MCSA 2FT0A 1TKJA 3KASA 3PRTA 2Z3OA 1Q7LA 4GS4A 4UIBA 3TO9A 1IB1E 2D4OA 3IEHA 4P4IA 2O28A 3SI2A 4R8FA 3BLNA 4IUSA 4KOYA 2BO9A 1Y0YA 2I00A 4MBUA 2ODFA 3D67A 4UFXA 2JBJA 3IU1A 4F9UA 2Q43A 1ARMA 3B7IA 3IWGA 3FVLA 3GUXA 3R1KA 4KLVA 4WJBA 1NSLA 4OIWA 2CY2A 1IGBA 4OIDA 3D7GA 5F48A 1TIQA 2B5GB 4XNHB 3T8WA 3PZJA 4U5YA 4MRIA 1TF8A 2GU2A 2AFUA 3NE7A 3FEDA 2K5TA 4PXCA 2PJ4A 2OU2A 2PJ6A 3KHZA 4KS9A 1PCAA 2ATRA 2DF5A 3RBUA 1WWZA 1LCPA 4EFDA 2HUZA 4NGQA 5K8MA 1Z8TA 2Q0YA 3NA6A 2JDDA 2YNEA 4GXHA 3TC8A 1YGHA 1YW4A 4KOVA 1Z8WA 5DWMA 4XPDB 1VHSA 3EO4A 3GY9A 4Q38A 2QVPA 4UEFA 4DYOA 1I12A 3VWEA 4X3RA 4X2TA 1L0CA 5H84A 4KUBA 3S6FA 1RO5A 2FIWA 2ZW4A 4F0XA 4ZY1A 4KSAA 1YX0A 4HPSA 3MN8A 2OR4A 3RAMA 2Z3KA 1QMUA 4UEEA 4OC2A 1NMTA 4FD6A 4OADA 2PDOA 5AG5A 2Q4ZA 1IOFA 3ZJ0A 4OC5A 3LACA 4MCQA 3TTHA 4CGMA 2GLJA 1HEEA 2X7BA 3H8EA 2JEVA 4NFRA 5AG6A 4C2ZA 4JJXA 1S7FA 4ZX9A 3S6KA 2F8HA 2OZGA 3EXNA 1EE3P 1M4LA 5GCNA 3SJGA 4B5PA 2WYRA 3BJ7A 3B3WA 2EWBA 2AFSA 1AMPA 3KGQA 1AYEA 4CYPA 4XPDC 3TT2A 2V8DA 5G22A 3VWDA 1GYTA 4DJLA 3GB0A 5KTCA 1XBUA 4PSXA 4FBEA 1F2OA 2HV2A 2YNDA 1Y9KA 4QVTA 1LANA 4A31A 5K8OA 3K9TA 4BBHA 1ZG8A 2ZEEA 2ZOGA 3BHXA 4LX9A 3FEEA 4M6GA 5BWAB 2DXQA 4LUAA 2V8HA 3P2HA 4DUKA 4KLWA 7CPAA 4H89A 4CGLA 3S9MA 4KSFA 3PEIA 3W6SA 1VKCA 2ZEHA 1JQGA 4MJ8A 4MMOA 5FVJA 3D4UA 3H5ZA 2PR8A 2F5IA 3KHXA 4C68A 4GM5A 5I4MA 2PCUA 2R7HA 4P10A 2WSAA 1M1DA 2PJ3A 3H4QA 2FCKA 4H6ZA 4I49A 3H8GA 2P6GA 4W9YA 4ZI6A 2PJAA 1YLEA 4OMEA 5KTAA 1BPNA 2ABZA 4IAVA 4RS2A 1XRYA 1S3ZA 3CPXA 3D2MA 3VATA 1PYTB 1I1DA 4KSIA 2Q4YA 4MCRA 3VARA 1Q2CA 2J8MA 4MHYA 3TOAA 4AVBA 2WZNA 2BOAA 3SJEA 1XMBA 4Q7AA 2BUEA 2C6PA 2R1IA 3P2FA 3PFOA 4JD6A 5G20A 2BEIA 4HNYB 2EO8A 5F09A 1VIXA 3D68A 1MJAA 1B87A 2ZEDA 4UCNA 4A39A 3RNZA 2V77A 1IYKA 3ISZA 2AFMA 2CF4A 3JRUA 4P6YA 4R9MA 4NCZA 1KZFA 2P6FA 3R96A 4C2YA 5ELYA 2PVWA 1CM0A 4UWIA 2J8RA 1A2ZA 1Z5RA 1NSAA 3TO6A 2CNTA 4CPAA 2B4DA 4MFZA 5LRKA 2CIJA 4ONWA 4UIAA 2PQ8A 2Z3LA 2NMTA 3FXTA 4CRYB 3V38A 2FXFA 2C27A 2PJ7A 3GLJA 2XEFA 1RXTA 1Z4EA 1Y7EA 1PU9A 3IGRA 4Q36A 5F46A 4XPKA 3DSBA 4PV6A 3KQZA 3WR7A 2VEZA 5DS0A 3L2NA 3IWEA 2XEGA 5DWNA 8CPAA 1ZLIA 1QSOA 3CZXA 1VGYA 2P0WA 3B3SA 3PB6X 4EMEA 5IV0A 1ARLA 4UA3A 4JLYA 4ZBGA 5IX3A 1F57A 1OBRA 1ZG9A 3G8WA 4R87A 1S7KA 3PB8X 3S9LA 2ZW5A 3GIUA 1KUXA 1M4DA 4IK2A 4JWPA 3S6GA 3IC1A 1V0CA 3TE4A 1ELMP 5K8PA 1U6MA 1ZO0A 1Y0RA 4P4BA 5H86A 2Z3PA 3TFYA 4ZX8A 1Z9UA 2YNCA 2ZEFA 1Z8LA 4C2XA 1K4JA 2Q51A 4B5PB 2B4BA 3SI0A 1BOBA 4OKOA 5HMNA 2POKA 4NGRA 5AG7A 4A30A 4P4EA 2QJ8A 2O53A 4MI4A 4E8OA 3KQXA 4KZTA 1QSTA 1YREA 3BXMA 1M4IA 1ELLP 4CRZB 1S7LA 4O23A 1YK3A 4PXBA 3PB9X 4DNCA 1YQEA 5G1ZA 4M85A 4A94A 2GREA 2QMLA 5AGEA 1XFOA 2RC4A 3K9UA 3TO7A 4PXEA 3B3TA 1JWQA 1CG2A 3D7HA 2I3CA 5HVFA 4NF1A 3WC5A 5C82A 2NSMA 4M6HA 3D8PA 2F7VA 4KORA 1ZG7A 4RUHA 5THWA 4PXDA 2RB7A 2ZXVA 2PC1A 4XNHC 4CYOA 5JQ4A 2AFWA 2PVVA 4CAWA 3IWWA 3T90A 4UFVA 5IB9A 1B6BA 4FD7A 4KVOE 1IU8A 2FL4A 2EUIA 3KR4A 4HNXB 4UCMA 1YVOA 3TX8A 1HDQA 2FIAA 1Y9WA 3SXOA 1DE4C 4MHZA 5G21A 2Q7SA 4P4DA 5K8NA 1IICA 3IFEA 3EY5A 5J1QA 4KOSA 1FY7A 1FNOA 2VI7A 2AFOA 3RZAA 2PRQA 1TKFA 4AVAA 2PE3A 2FE7A 2C6CA 1Z4RA 2D4PA 4UWJA 2CTCA 4E0AA 5IB0A 4F8ZA 1IOIA 2OZUA 3FB3A 4PPZA 2WPXA 4LQ6A 4MFPA 3JTKA 4U9ZA 1Z2LA 5ISVA 5LRJA 1XMTA 4KOUA 4KOWA 4M3SA 3SHPA 5HXDA 1R3NA 2Z10A 4X5KA 2DPTA 2VZYA 2B4DB 3B35A 3F0AA 2HC9A 1BAVA 3V8IA 3ZZIA 3I1UA 2VL1A 2ZEOA 3CXPA 4L8AA 2RFHA 1CPXA 3KZWA 2Z3MA 4UEZA 4MFLA 2V8VA 5JM6A 2AE6A 3WC7A 4H2KA 4A2ZA 3PBBA 3TCVA 4YWYA 1ON0A 2REFA 4QBJA 2PJCA 2I79A 1M44A 1S7NA 1VHEA 4OLLA 4P45A 5I0CA 1VHOA 3N7ZA 5HVHA 4G1PA 2OZHA 5KTDA 3FECA 4MHNA 2FSRA 1XEBA 1CPSA 1YVKA 3NE8A 4PQAA 5D8NA 3FJUA 4QC6A 2A4NA 2B3UA 1CX8A 3DNSA 3D7FA 4CGPA 4CYNA 4R3LA 2PJ0A 1IY7A 3LODA 2EBJA 2PJ9A 1IIDA 1MK4A 1P4NA 1UFHA 1UWYA 4OC4A 3FX6A 3JUWA 4YGOA 4EVYA 4ZYQA 4MHDA 2XEJA 4AG7A 3FNCA 4CGOA 4CS0B 2J9AA 1LRZA 3CDXA 5LYFA 4NGTA 4MFQA 3V7ZA 3W91A 2PIYA 4QUSA 1DTDA 2ZPAA 3KR5A 2BCOA 1M4GA 3PP9A 1QSNA 4FD5A 1QSRA 4FWUA 4L89A 4NGNA 3CT9A 4E2AA 2CXAA 1XE4A 4OC3A 1Q2DA 3TOBA 2Q04A 2NYQA 1AUGA 3CXQA 3E0KA 4OP4A 2EVNA 4OC0A 1RTQA 4KVXA 3BI0A 4X8IA 4JXQA 1ZLHA 3MRUA 3OWCA 4AVCA 3SJFA 2R8VA 4FUUA 5EC4A 2OOTA 2Y0MA 1KUVA 2J8NA 2PJ8A 4NXYA 3DLJA 4KOXA 4F6AA
chains in the Genus database with same CATH topology
4FAIA 2QYVA 2JEWA 1YLOA 3KI9A 1HDUA 1QQ9A 4P4JA 5CPAA 4A38A 5LYDA 3LMSA 1BPMA 4NJQA 4B6ZA 4P44A 3IIBA 3FMCA 5CBMA 5D29A 3LWUA 3WC6A 3KL9A 3B2YA 1H8LA 1CP7A 2XEIA 3HUVA 5JGFA 4TWEA 2C1CA 2C6GA 1BLLE 3BI1A 4NGSA 3WT4A 4NGPA 4R6TA 1FT7A 2PJBA 3B3VA 4K3NA 4F9VA 5HVGA 4EWTA 3VH9A 1CBXA 4P4FA 2ZOFA 1KWMA 3CPAA 4ZY0A 5LRGA 4WWVA 3H8FA 5JH9A 4MHPA 4OC1A 1TXRA 4IHMA 4MCPA 2JBKA 3NFZA 2AFZA 3PBEA 3PB7X 2IQ6A 3FH4A 2G9DA 3PFEA 4ZY2A 4Z65A 4R7MA 1TF9A 2IJZA 3FF3A 1YMEA 2PJ2A 2ZEPA 2HB6A 2AFXA 4LQGA 3K2KA 2IMOA 3ISXA 4UF4A 5LYLA 3IO1A 2ZEGA 3NH5A 4AXVA 4A37A 2ZENA 2PJ1A 3DGVA 4NJRA 1R43A 3QNVA 1YSJA 2PIZA 3WABA 1F2PA 1XJOA 2EK8A 1CP6A 3NH4A 4JYWA 4NGMA 3HLPA 4BD9A 6CPAA 3B3CA 2ZELA 3D66A 1LAMA 1YW6A 4TNUA 2FVGA 3IJ3A 2V8GA 2EK9A 2GLFA 2DEAA 3D7DA 5LYIA 3SI1A 3N5FA 2CTBA 2O4HA 1LFWA 3PB4X 3S9NA 1LOKA 4R76A 3SJXA 2PJ5A 3NH8A 4JZ0A 1LAPA 1TKHA 2ZEMA 4YU9A 2ANPA 4MCSA 1TKJA 3KASA 3PRTA 4UIBA 1Q7LA 3IEHA 4P4IA 3SI2A 4R8FA 2BO9A 1Y0YA 3D67A 2JBJA 4F9UA 2Q43A 1ARMA 3B7IA 3FVLA 3GUXA 4WJBA 4OIWA 1IGBA 4OIDA 3D7GA 3T8WA 4MRIA 1TF8A 2GU2A 2AFUA 3FEDA 4PXCA 2PJ4A 2PJ6A 3KHZA 1PCAA 3RBUA 1LCPA 4EFDA 4NGQA 5K8MA 3NA6A 3TC8A 1YW4A 4UEFA 4DYOA 2QVPA 4X3RA 4X2TA 4ZY1A 3RAMA 3MN8A 2OR4A 4UEEA 1QMUA 4OC2A 2Q4ZA 4OC5A 4MCQA 2GLJA 1HEEA 3H8EA 4NFRA 4ZX9A 2F8HA 3SJGA 1EE3P 1M4LA 2WYRA 3B3WA 2EWBA 2AFSA 1AMPA 3KGQA 1AYEA 2V8DA 1GYTA 4DJLA 3GB0A 1XBUA 4FBEA 1F2OA 1LANA 5K8OA 3K9TA 1ZG8A 2ZEEA 2ZOGA 3BHXA 3FEEA 2V8HA 4DUKA 7CPAA 3S9MA 3PEIA 2ZEHA 4MMOA 1JQGA 3D4UA 3KHXA 4GM5A 5I4MA 2PCUA 4P10A 2PJ3A 3H8GA 4W9YA 4ZI6A 2PJAA 4OMEA 1BPNA 2ABZA 4IAVA 1XRYA 3CPXA 3VATA 1PYTB 4KSIA 4MCRA 3VARA 4MHYA 2WZNA 2BOAA 3SJEA 1XMBA 4Q7AA 2C6PA 3PFOA 5F09A 1VIXA 3D68A 4A39A 2ZEDA 2V77A 3ISZA 2AFMA 2CF4A 3JRUA 4P6YA 5ELYA 2PVWA 1Z5RA 1NSAA 4CPAA 5LRKA 2CIJA 4ONWA 4UIAA 3V38A 2PJ7A 3GLJA 2XEFA 1Y7EA 3KQZA 5DS0A 3L2NA 2XEGA 8CPAA 1ZLIA 1VGYA 3B3SA 3PB6X 4EMEA 1ARLA 1F57A 1OBRA 1ZG9A 3PB8X 3S9LA 4IK2A 3IC1A 1ELMP 5K8PA 4P4BA 1Y0RA 4ZX8A 2ZEFA 1Z8LA 2Q51A 3SI0A 4OKOA 2POKA 4NGRA 4P4EA 2QJ8A 2O53A 3KQXA 3BXMA 1ELLP 4O23A 4PXBA 3PB9X 4A94A 2GREA 1XFOA 4PXEA 3B3TA 1CG2A 3D7HA 2I3CA 5HVFA 3WC5A 2NSMA 2F7VA 1ZG7A 4RUHA 5THWA 4PXDA 2RB7A 2AFWA 2PVVA 3IWWA 5IB9A 3KR4A 3TX8A 1HDQA 1DE4C 4MHZA 4P4DA 5K8NA 3IFEA 5J1QA 3RZAA 1FNOA 2AFOA 2PRQA 1TKFA 2PE3A 2C6CA 2CTCA 4F8ZA 4PPZA 1Z2LA 5LRJA 5HXDA 1R3NA 3B35A 2HC9A 1BAVA 3I1UA 2VL1A 2ZEOA 2RFHA 1CPXA 3KZWA 4UEZA 5JM6A 2V8VA 3WC7A 4H2KA 3PBBA 4YWYA 2PJCA 4P45A 1VHEA 1VHOA 5HVHA 4G1PA 3FECA 4MHNA 1CPSA 4PQAA 5D8NA 3FJUA 1CX8A 3D7FA 2PJ0A 1IY7A 2PJ9A 1UWYA 4OC4A 4ZYQA 3FX6A 2XEJA 2J9AA 3CDXA 5LYFA 4NGTA 3V7ZA 2PIYA 1DTDA 3KR5A 2BCOA 4FWUA 4NGNA 3CT9A 4OC3A 2NYQA 4OP4A 4OC0A 1RTQA 3BI0A 4X8IA 1ZLHA 3MRUA 3SJFA 4FUUA 2OOTA 2PJ8A 3DLJA 4MXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FAI A;  2QYV A;  2JEW A;  1YLO A;  3KI9 A;  1HDU A;  1QQ9 A;  4P4J A;  5CPA A;  4A38 A;  5LYD A;  3LMS A;  1BPM A;  4NJQ A;  4B6Z A;  4P44 A;  3IIB A;  3FMC A;  5CBM A;  5D29 A;  3LWU A;  3WC6 A;  3KL9 A;  3B2Y A;  1H8L A;  1CP7 A;  2XEI A;  3HUV A;  5JGF A;  4TWE A;  2C1C A;  2C6G A;  1BLL E;  3BI1 A;  4NGS A;  3WT4 A;  4NGP A;  4R6T A;  1FT7 A;  2PJB A;  3B3V A;  4K3N A;  4F9V A;  5HVG A;  4EWT A;  3VH9 A;  1CBX A;  4P4F A;  2ZOF A;  1KWM A;  3CPA A;  4ZY0 A;  5LRG A;  4WWV A;  3H8F A;  5JH9 A;  4MHP A;  4OC1 A;  1TXR A;  4IHM A;  4MCP A;  2JBK A;  3NFZ A;  2AFZ A;  3PBE A;  3PB7 X;  2IQ6 A;  3FH4 A;  2G9D A;  3PFE A;  4ZY2 A;  4Z65 A;  4R7M A;  1TF9 A;  2IJZ A;  3FF3 A;  1YME A;  2PJ2 A;  2ZEP A;  2HB6 A;  2AFX A;  4LQG A;  3K2K A;  2IMO A;  3ISX A;  4UF4 A;  5LYL A;  3IO1 A;  2ZEG A;  3NH5 A;  4AXV A;  4A37 A;  2ZEN A;  2PJ1 A;  3DGV A;  4NJR A;  1R43 A;  3QNV A;  1YSJ A;  2PIZ A;  3WAB A;  1F2P A;  1XJO A;  2EK8 A;  1CP6 A;  3NH4 A;  4JYW A;  4NGM A;  3HLP A;  4BD9 A;  6CPA A;  3B3C A;  2ZEL A;  3D66 A;  1LAM A;  1YW6 A;  4TNU A;  2FVG A;  3IJ3 A;  2V8G A;  2EK9 A;  2GLF A;  2DEA A;  3D7D A;  5LYI A;  3SI1 A;  3N5F A;  2CTB A;  2O4H A;  1LFW A;  3PB4 X;  3S9N A;  1LOK A;  4R76 A;  3SJX A;  2PJ5 A;  3NH8 A;  4JZ0 A;  1LAP A;  1TKH A;  2ZEM A;  4YU9 A;  2ANP A;  4MCS A;  1TKJ A;  3KAS A;  3PRT A;  4UIB A;  1Q7L A;  3IEH A;  4P4I A;  3SI2 A;  4R8F A;  2BO9 A;  1Y0Y A;  3D67 A;  2JBJ A;  4F9U A;  2Q43 A;  1ARM A;  3B7I A;  3FVL A;  3GUX A;  4WJB A;  4OIW A;  1IGB A;  4OID A;  3D7G A;  3T8W A;  4MRI A;  1TF8 A;  2GU2 A;  2AFU A;  3FED A;  4PXC A;  2PJ4 A;  2PJ6 A;  3KHZ A;  1PCA A;  3RBU A;  1LCP A;  4EFD A;  4NGQ A;  5K8M A;  3NA6 A;  3TC8 A;  1YW4 A;  4UEF A;  4DYO A;  2QVP A;  4X3R A;  4X2T A;  4ZY1 A;  3RAM A;  3MN8 A;  2OR4 A;  4UEE A;  1QMU A;  4OC2 A;  2Q4Z A;  4OC5 A;  4MCQ A;  2GLJ A;  1HEE A;  3H8E A;  4NFR A;  4ZX9 A;  2F8H A;  3SJG A;  1EE3 P;  1M4L A;  2WYR A;  3B3W A;  2EWB A;  2AFS A;  1AMP A;  3KGQ A;  1AYE A;  2V8D A;  1GYT A;  4DJL A;  3GB0 A;  1XBU A;  4FBE A;  1F2O A;  1LAN A;  5K8O A;  3K9T A;  1ZG8 A;  2ZEE A;  2ZOG A;  3BHX A;  3FEE A;  2V8H A;  4DUK A;  7CPA A;  3S9M A;  3PEI A;  2ZEH A;  4MMO A;  1JQG A;  3D4U A;  3KHX A;  4GM5 A;  5I4M A;  2PCU A;  4P10 A;  2PJ3 A;  3H8G A;  4W9Y A;  4ZI6 A;  2PJA A;  4OME A;  1BPN A;  2ABZ A;  4IAV A;  1XRY A;  3CPX A;  3VAT A;  1PYT B;  4KSI A;  4MCR A;  3VAR A;  4MHY A;  2WZN A;  2BOA A;  3SJE A;  1XMB A;  4Q7A A;  2C6P A;  3PFO A;  5F09 A;  1VIX A;  3D68 A;  4A39 A;  2ZED A;  2V77 A;  3ISZ A;  2AFM A;  2CF4 A;  3JRU A;  4P6Y A;  5ELY A;  2PVW A;  1Z5R A;  1NSA A;  4CPA A;  5LRK A;  2CIJ A;  4ONW A;  4UIA A;  3V38 A;  2PJ7 A;  3GLJ A;  2XEF A;  1Y7E A;  3KQZ A;  5DS0 A;  3L2N A;  2XEG A;  8CPA A;  1ZLI A;  1VGY A;  3B3S A;  3PB6 X;  4EME A;  1ARL A;  1F57 A;  1OBR A;  1ZG9 A;  3PB8 X;  3S9L A;  4IK2 A;  3IC1 A;  1ELM P;  5K8P A;  4P4B A;  1Y0R A;  4ZX8 A;  2ZEF A;  1Z8L A;  2Q51 A;  3SI0 A;  4OKO A;  2POK A;  4NGR A;  4P4E A;  2QJ8 A;  2O53 A;  3KQX A;  3BXM A;  1ELL P;  4O23 A;  4PXB A;  3PB9 X;  4A94 A;  2GRE A;  1XFO A;  4PXE A;  3B3T A;  1CG2 A;  3D7H A;  2I3C A;  5HVF A;  3WC5 A;  2NSM A;  2F7V A;  1ZG7 A;  4RUH A;  5THW A;  4PXD A;  2RB7 A;  2AFW A;  2PVV A;  3IWW A;  5IB9 A;  3KR4 A;  3TX8 A;  1HDQ A;  1DE4 C;  4MHZ A;  4P4D A;  5K8N A;  3IFE A;  5J1Q A;  3RZA A;  1FNO A;  2AFO A;  2PRQ A;  1TKF A;  2PE3 A;  2C6C A;  2CTC A;  4F8Z A;  4PPZ A;  1Z2L A;  5LRJ A;  5HXD A;  1R3N A;  3B35 A;  2HC9 A;  1BAV A;  3I1U A;  2VL1 A;  2ZEO A;  2RFH A;  1CPX A;  3KZW A;  4UEZ A;  5JM6 A;  2V8V A;  3WC7 A;  4H2K A;  3PBB A;  4YWY A;  2PJC A;  4P45 A;  1VHE A;  1VHO A;  5HVH A;  4G1P A;  3FEC A;  4MHN A;  1CPS A;  4PQA A;  5D8N A;  3FJU A;  1CX8 A;  3D7F A;  2PJ0 A;  1IY7 A;  2PJ9 A;  1UWY A;  4OC4 A;  4ZYQ A;  3FX6 A;  2XEJ A;  2J9A A;  3CDX A;  5LYF A;  4NGT A;  3V7Z A;  2PIY A;  1DTD A;  3KR5 A;  2BCO A;  4FWU A;  4NGN A;  3CT9 A;  4OC3 A;  2NYQ A;  4OP4 A;  4OC0 A;  1RTQ A;  3BI0 A;  4X8I A;  1ZLH A;  3MRU A;  3SJF A;  4FUU A;  2OOT A;  2PJ8 A;  3DLJ A;  4MXU A; 
#chains in the Genus database with same CATH topology
 3C26 A;  2QYV A;  4FAI A;  1N71 A;  2ZW7 A;  2JEW A;  1YLO A;  3KI9 A;  1HDU A;  1QQ9 A;  2Z0Z A;  4P4J A;  4K30 A;  5CPA A;  5F49 A;  2HQY A;  4XPL A;  3IU2 A;  4A38 A;  5LYD A;  3LMS A;  4KOT A;  1BPM A;  2VZZ A;  1Q2Y A;  3R95 A;  4NJQ A;  2AJ6 A;  4B6Z A;  4FD4 A;  1X12 A;  2OH1 A;  4P44 A;  3F5B A;  3IIB A;  4M6I A;  4HKF A;  1YR0 A;  3PGP A;  3FMC A;  3DDD A;  5A28 A;  5EBV A;  5CBM A;  5D29 A;  3LWU A;  3WC6 A;  3KL9 A;  3B2Y A;  4KUA A;  2REE A;  2Z11 A;  2GFQ A;  5C88 A;  1H8L A;  1CP7 A;  2H5M A;  4NEX A;  4PK2 A;  4R3K A;  2XEI A;  3HUV A;  5JGF A;  1Z8X A;  2PR1 A;  3G3S A;  4TWE A;  2C1C A;  2C6G A;  4KVM E;  4B14 A;  1BLL E;  3BI1 A;  4NGS A;  1BO4 A;  4C7H A;  3WT4 A;  1SQH A;  2PSW A;  4NGP A;  2G0B A;  4R6T A;  1FT7 A;  2IL4 A;  3R9E A;  3S6H A;  3RO0 A;  1S5K A;  2G3T A;  2PJB A;  3B3V A;  4K3N A;  4F9V A;  5HVG A;  4JXR A;  4B10 A;  4EWT A;  4Y49 B;  4CYQ A;  3VH9 A;  2PRB A;  1CBX A;  4P4F A;  2ZOF A;  1KWM A;  1WK4 A;  1MJB A;  1OZP A;  3CPA A;  4R57 A;  4WWV A;  5LRG A;  4B13 A;  4ZY0 A;  2R98 A;  3H8F A;  2YGW A;  5JH9 A;  4MHP A;  3RYO A;  4OC1 A;  2G3A A;  1TXR A;  3I9S A;  5AG4 A;  4B11 A;  4A33 A;  4YFJ A;  4IHM A;  1Y7R A;  4MCP A;  2WPW A;  4BIN A;  1NE9 A;  2JBK A;  3NFZ A;  4NSQ A;  3W6X A;  2AFZ A;  2VXK A;  3PBE A;  2VBQ A;  3PB7 X;  2IQ6 A;  3FH4 A;  4RN7 A;  4Y49 C;  4AG9 A;  4C7I A;  2G9D A;  3PFE A;  4ONU A;  4ZY2 A;  2QEC A;  2P6E A;  4Z65 A;  1IYL A;  2Q44 A;  4U9Y A;  4R7M A;  4UFW A;  5HH1 A;  1TF9 A;  2IJZ A;  3JVN A;  2VQY A;  4HNW B;  4A32 A;  4BMH A;  3FF3 A;  3SXN A;  4RI1 A;  3R9G A;  1KUY A;  3CXS A;  1YME A;  4UBR A;  2PJ2 A;  4CAX A;  2Q7B A;  2ZEP A;  2HB6 A;  2WUU A;  2AFX A;  2DPS A;  4LQG A;  3K2K A;  3QB8 A;  2QIR A;  2IMO A;  2OB0 A;  4CAV A;  4CAE A;  3ISX A;  5E96 A;  4ORF A;  4UF4 A;  5LYL A;  3BJ8 A;  3IO1 A;  5J8C A;  2GAN A;  2ZEG A;  4OAE A;  3FYN A;  2B5G A;  3NH5 A;  3FBU A;  3QAH A;  1XIX A;  4PSW A;  4AXV A;  1QSM A;  4A37 A;  2ZEN A;  5JPH A;  2PJ1 A;  3GKR A;  3DGV A;  3FIX A;  1GHE A;  2B58 A;  4NJR A;  2FS5 A;  1R43 A;  4MY0 A;  1I21 A;  2BSW A;  3QNV A;  1YSJ A;  2PIZ A;  3DR6 A;  3WAB A;  1X10 A;  4J3G A;  1F2P A;  2JDC A;  3EFA A;  1XJO A;  4MY3 A;  2EK8 A;  1CP6 A;  4UCP A;  1J4J A;  5A27 A;  3FRM A;  3D3S A;  3A9L A;  3NH4 A;  2GE3 A;  1CJW A;  4JYW A;  4NGM A;  2BL1 A;  1XF8 A;  3HLP A;  4BD9 A;  4AB7 A;  1S60 A;  3B8G A;  1XOV A;  2CNS A;  3B3C A;  3D2P A;  4ZGY B;  6CPA A;  2Q4V A;  2ZEL A;  1PUA A;  2ZW6 A;  4PK3 A;  3UY5 A;  4B5O A;  5J8F A;  3D66 A;  4MXU A;  2B3V A;  3R9F A;  1LAM A;  4II9 A;  1YW6 A;  4TNU A;  2KCW A;  2FVG A;  3KKW A;  3MGD A;  3IJ3 A;  2V8G A;  2EK9 A;  2GLF A;  4CAF A;  1P0H A;  2JLM A;  3LD2 A;  2YNC C;  3GYA A;  3QAY A;  1MJ9 A;  2ARH A;  4F0Y A;  2DEA A;  3D7D A;  4H6U A;  5LYI A;  3SI1 A;  3N5F A;  4QB9 A;  2CTB A;  2O4H A;  1LFW A;  3PB4 X;  5F47 A;  4B12 A;  3DR8 A;  3S9N A;  4IF5 A;  5EMI A;  3F8K A;  1R57 A;  4MFK A;  4MFJ A;  1LOK A;  2GIV A;  4R76 A;  3SJX A;  2PJ5 A;  2Z3N A;  2CNM A;  3T9Y A;  3I3G A;  3EC4 A;  3NH8 A;  4JZ0 A;  1LAP A;  1TKH A;  4A95 A;  2ZEM A;  4YRH A;  4YU9 A;  2ANP A;  5CNP A;  4CGN A;  4MCS A;  2FT0 A;  1TKJ A;  3KAS A;  3PRT A;  2Z3O A;  1Q7L A;  4GS4 A;  4UIB A;  3TO9 A;  1IB1 E;  2D4O A;  3IEH A;  4P4I A;  2O28 A;  3SI2 A;  4R8F A;  3BLN A;  4IUS A;  4KOY A;  2BO9 A;  1Y0Y A;  2I00 A;  4MBU A;  2ODF A;  3D67 A;  4UFX A;  2JBJ A;  3IU1 A;  4F9U A;  2Q43 A;  1ARM A;  3B7I A;  3IWG A;  3FVL A;  3GUX A;  3R1K A;  4KLV A;  4WJB A;  1NSL A;  4OIW A;  2CY2 A;  1IGB A;  4OID A;  3D7G A;  5F48 A;  1TIQ A;  2B5G B;  4XNH B;  3T8W A;  3PZJ A;  4U5Y A;  4MRI A;  1TF8 A;  2GU2 A;  2AFU A;  3NE7 A;  3FED A;  2K5T A;  4PXC A;  2PJ4 A;  2OU2 A;  2PJ6 A;  3KHZ A;  4KS9 A;  1PCA A;  2ATR A;  2DF5 A;  3RBU A;  1WWZ A;  1LCP A;  4EFD A;  2HUZ A;  4NGQ A;  5K8M A;  1Z8T A;  2Q0Y A;  3NA6 A;  2JDD A;  2YNE A;  4GXH A;  3TC8 A;  1YGH A;  1YW4 A;  4KOV A;  1Z8W A;  5DWM A;  4XPD B;  1VHS A;  3EO4 A;  3GY9 A;  4Q38 A;  2QVP A;  4UEF A;  4DYO A;  1I12 A;  3VWE A;  4X3R A;  4X2T A;  1L0C A;  5H84 A;  4KUB A;  3S6F A;  1RO5 A;  2FIW A;  2ZW4 A;  4F0X A;  4ZY1 A;  4KSA A;  1YX0 A;  4HPS A;  3MN8 A;  2OR4 A;  3RAM A;  2Z3K A;  1QMU A;  4UEE A;  4OC2 A;  1NMT A;  4FD6 A;  4OAD A;  2PDO A;  5AG5 A;  2Q4Z A;  1IOF A;  3ZJ0 A;  4OC5 A;  3LAC A;  4MCQ A;  3TTH A;  4CGM A;  2GLJ A;  1HEE A;  2X7B A;  3H8E A;  2JEV A;  4NFR A;  5AG6 A;  4C2Z A;  4JJX A;  1S7F A;  4ZX9 A;  3S6K A;  2F8H A;  2OZG A;  3EXN A;  1EE3 P;  1M4L A;  5GCN A;  3SJG A;  4B5P A;  2WYR A;  3BJ7 A;  3B3W A;  2EWB A;  2AFS A;  1AMP A;  3KGQ A;  1AYE A;  4CYP A;  4XPD C;  3TT2 A;  2V8D A;  5G22 A;  3VWD A;  1GYT A;  4DJL A;  3GB0 A;  5KTC A;  1XBU A;  4PSX A;  4FBE A;  1F2O A;  2HV2 A;  2YND A;  1Y9K A;  4QVT A;  1LAN A;  4A31 A;  5K8O A;  3K9T A;  4BBH A;  1ZG8 A;  2ZEE A;  2ZOG A;  3BHX A;  4LX9 A;  3FEE A;  4M6G A;  5BWA B;  2DXQ A;  4LUA A;  2V8H A;  3P2H A;  4DUK A;  4KLW A;  7CPA A;  4H89 A;  4CGL A;  3S9M A;  4KSF A;  3PEI A;  3W6S A;  1VKC A;  2ZEH A;  1JQG A;  4MJ8 A;  4MMO A;  5FVJ A;  3D4U A;  3H5Z A;  2PR8 A;  2F5I A;  3KHX A;  4C68 A;  4GM5 A;  5I4M A;  2PCU A;  2R7H A;  4P10 A;  2WSA A;  1M1D A;  2PJ3 A;  3H4Q A;  2FCK A;  4H6Z A;  4I49 A;  3H8G A;  2P6G A;  4W9Y A;  4ZI6 A;  2PJA A;  1YLE A;  4OME A;  5KTA A;  1BPN A;  2ABZ A;  4IAV A;  4RS2 A;  1XRY A;  1S3Z A;  3CPX A;  3D2M A;  3VAT A;  1PYT B;  1I1D A;  4KSI A;  2Q4Y A;  4MCR A;  3VAR A;  1Q2C A;  2J8M A;  4MHY A;  3TOA A;  4AVB A;  2WZN A;  2BOA A;  3SJE A;  1XMB A;  4Q7A A;  2BUE A;  2C6P A;  2R1I A;  3P2F A;  3PFO A;  4JD6 A;  5G20 A;  2BEI A;  4HNY B;  2EO8 A;  5F09 A;  1VIX A;  3D68 A;  1MJA A;  1B87 A;  2ZED A;  4UCN A;  4A39 A;  3RNZ A;  2V77 A;  1IYK A;  3ISZ A;  2AFM A;  2CF4 A;  3JRU A;  4P6Y A;  4R9M A;  4NCZ A;  1KZF A;  2P6F A;  3R96 A;  4C2Y A;  5ELY A;  2PVW A;  1CM0 A;  4UWI A;  2J8R A;  1A2Z A;  1Z5R A;  1NSA A;  3TO6 A;  2CNT A;  4CPA A;  2B4D A;  4MFZ A;  5LRK A;  2CIJ A;  4ONW A;  4UIA A;  2PQ8 A;  2Z3L A;  2NMT A;  3FXT A;  4CRY B;  3V38 A;  2FXF A;  2C27 A;  2PJ7 A;  3GLJ A;  2XEF A;  1RXT A;  1Z4E A;  1Y7E A;  1PU9 A;  3IGR A;  4Q36 A;  5F46 A;  4XPK A;  3DSB A;  4PV6 A;  3KQZ A;  3WR7 A;  2VEZ A;  5DS0 A;  3L2N A;  3IWE A;  2XEG A;  5DWN A;  8CPA A;  1ZLI A;  1QSO A;  3CZX A;  1VGY A;  2P0W A;  3B3S A;  3PB6 X;  4EME A;  5IV0 A;  1ARL A;  4UA3 A;  4JLY A;  4ZBG A;  5IX3 A;  1F57 A;  1OBR A;  1ZG9 A;  3G8W A;  4R87 A;  1S7K A;  3PB8 X;  3S9L A;  2ZW5 A;  3GIU A;  1KUX A;  1M4D A;  4IK2 A;  4JWP A;  3S6G A;  3IC1 A;  1V0C A;  3TE4 A;  1ELM P;  5K8P A;  1U6M A;  1ZO0 A;  1Y0R A;  4P4B A;  5H86 A;  2Z3P A;  3TFY A;  4ZX8 A;  1Z9U A;  2YNC A;  2ZEF A;  1Z8L A;  4C2X A;  1K4J A;  2Q51 A;  4B5P B;  2B4B A;  3SI0 A;  1BOB A;  4OKO A;  5HMN A;  2POK A;  4NGR A;  5AG7 A;  4A30 A;  4P4E A;  2QJ8 A;  2O53 A;  4MI4 A;  4E8O A;  3KQX A;  4KZT A;  1QST A;  1YRE A;  3BXM A;  1M4I A;  1ELL P;  4CRZ B;  1S7L A;  4O23 A;  1YK3 A;  4PXB A;  3PB9 X;  4DNC A;  1YQE A;  5G1Z A;  4M85 A;  4A94 A;  2GRE A;  2QML A;  5AGE A;  1XFO A;  2RC4 A;  3K9U A;  3TO7 A;  4PXE A;  3B3T A;  1JWQ A;  1CG2 A;  3D7H A;  2I3C A;  5HVF A;  4NF1 A;  3WC5 A;  5C82 A;  2NSM A;  4M6H A;  3D8P A;  2F7V A;  4KOR A;  1ZG7 A;  4RUH A;  5THW A;  4PXD A;  2RB7 A;  2ZXV A;  2PC1 A;  4XNH C;  4CYO A;  5JQ4 A;  2AFW A;  2PVV A;  4CAW A;  3IWW A;  3T90 A;  4UFV A;  5IB9 A;  1B6B A;  4FD7 A;  4KVO E;  1IU8 A;  2FL4 A;  2EUI A;  3KR4 A;  4HNX B;  4UCM A;  1YVO A;  3TX8 A;  1HDQ A;  2FIA A;  1Y9W A;  3SXO A;  1DE4 C;  4MHZ A;  5G21 A;  2Q7S A;  4P4D A;  5K8N A;  1IIC A;  3IFE A;  3EY5 A;  5J1Q A;  4KOS A;  1FY7 A;  1FNO A;  2VI7 A;  2AFO A;  3RZA A;  2PRQ A;  1TKF A;  4AVA A;  2PE3 A;  2FE7 A;  2C6C A;  1Z4R A;  2D4P A;  4UWJ A;  2CTC A;  4E0A A;  5IB0 A;  4F8Z A;  1IOI A;  2OZU A;  3FB3 A;  4PPZ A;  2WPX A;  4LQ6 A;  4MFP A;  3JTK A;  4U9Z A;  1Z2L A;  5ISV A;  5LRJ A;  1XMT A;  4KOU A;  4KOW A;  4M3S A;  3SHP A;  5HXD A;  1R3N A;  2Z10 A;  4X5K A;  2DPT A;  2VZY A;  2B4D B;  3B35 A;  3F0A A;  2HC9 A;  1BAV A;  3V8I A;  3ZZI A;  3I1U A;  2VL1 A;  2ZEO A;  3CXP A;  4L8A A;  2RFH A;  1CPX A;  3KZW A;  2Z3M A;  4UEZ A;  4MFL A;  2V8V A;  5JM6 A;  2AE6 A;  3WC7 A;  4H2K A;  4A2Z A;  3PBB A;  3TCV A;  4YWY A;  1ON0 A;  2REF A;  4QBJ A;  2PJC A;  2I79 A;  1M44 A;  1S7N A;  1VHE A;  4OLL A;  4P45 A;  5I0C A;  1VHO A;  3N7Z A;  5HVH A;  4G1P A;  2OZH A;  5KTD A;  3FEC A;  4MHN A;  2FSR A;  1XEB A;  1CPS A;  1YVK A;  3NE8 A;  4PQA A;  5D8N A;  3FJU A;  4QC6 A;  2A4N A;  2B3U A;  1CX8 A;  3DNS A;  3D7F A;  4CGP A;  4CYN A;  4R3L A;  2PJ0 A;  1IY7 A;  3LOD A;  2EBJ A;  2PJ9 A;  1IID A;  1MK4 A;  1P4N A;  1UFH A;  1UWY A;  4OC4 A;  3FX6 A;  3JUW A;  4YGO A;  4EVY A;  4ZYQ A;  4MHD A;  2XEJ A;  4AG7 A;  3FNC A;  4CGO A;  4CS0 B;  2J9A A;  1LRZ A;  3CDX A;  5LYF A;  4NGT A;  4MFQ A;  3V7Z A;  3W91 A;  2PIY A;  4QUS A;  1DTD A;  2ZPA A;  3KR5 A;  2BCO A;  1M4G A;  3PP9 A;  1QSN A;  4FD5 A;  1QSR A;  4FWU A;  4L89 A;  4NGN A;  3CT9 A;  4E2A A;  2CXA A;  1XE4 A;  4OC3 A;  1Q2D A;  3TOB A;  2Q04 A;  2NYQ A;  1AUG A;  3CXQ A;  3E0K A;  4OP4 A;  2EVN A;  4OC0 A;  1RTQ A;  4KVX A;  3BI0 A;  4X8I A;  4JXQ A;  1ZLH A;  3MRU A;  3OWC A;  4AVC A;  3SJF A;  2R8V A;  4FUU A;  5EC4 A;  2OOT A;  2Y0M A;  1KUV A;  2J8N A;  2PJ8 A;  4NXY A;  3DLJ A;  4KOX A;  4F6A A; 
#chains in the Genus database with same CATH homology
 4FAI A;  2QYV A;  2JEW A;  1YLO A;  3KI9 A;  1HDU A;  1QQ9 A;  4P4J A;  5CPA A;  4A38 A;  5LYD A;  3LMS A;  1BPM A;  4NJQ A;  4B6Z A;  4P44 A;  3IIB A;  3FMC A;  5CBM A;  5D29 A;  3LWU A;  3WC6 A;  3KL9 A;  3B2Y A;  1H8L A;  1CP7 A;  2XEI A;  3HUV A;  5JGF A;  4TWE A;  2C1C A;  2C6G A;  1BLL E;  3BI1 A;  4NGS A;  3WT4 A;  4NGP A;  4R6T A;  1FT7 A;  2PJB A;  3B3V A;  4K3N A;  4F9V A;  5HVG A;  4EWT A;  3VH9 A;  1CBX A;  4P4F A;  2ZOF A;  1KWM A;  3CPA A;  4ZY0 A;  5LRG A;  4WWV A;  3H8F A;  5JH9 A;  4MHP A;  4OC1 A;  1TXR A;  4IHM A;  4MCP A;  2JBK A;  3NFZ A;  2AFZ A;  3PBE A;  3PB7 X;  2IQ6 A;  3FH4 A;  2G9D A;  3PFE A;  4ZY2 A;  4Z65 A;  4R7M A;  1TF9 A;  2IJZ A;  3FF3 A;  1YME A;  2PJ2 A;  2ZEP A;  2HB6 A;  2AFX A;  4LQG A;  3K2K A;  2IMO A;  3ISX A;  4UF4 A;  5LYL A;  3IO1 A;  2ZEG A;  3NH5 A;  4AXV A;  4A37 A;  2ZEN A;  2PJ1 A;  3DGV A;  4NJR A;  1R43 A;  3QNV A;  1YSJ A;  2PIZ A;  3WAB A;  1F2P A;  1XJO A;  2EK8 A;  1CP6 A;  3NH4 A;  4JYW A;  4NGM A;  3HLP A;  4BD9 A;  6CPA A;  3B3C A;  2ZEL A;  3D66 A;  1LAM A;  1YW6 A;  4TNU A;  2FVG A;  3IJ3 A;  2V8G A;  2EK9 A;  2GLF A;  2DEA A;  3D7D A;  5LYI A;  3SI1 A;  3N5F A;  2CTB A;  2O4H A;  1LFW A;  3PB4 X;  3S9N A;  1LOK A;  4R76 A;  3SJX A;  2PJ5 A;  3NH8 A;  4JZ0 A;  1LAP A;  1TKH A;  2ZEM A;  4YU9 A;  2ANP A;  4MCS A;  1TKJ A;  3KAS A;  3PRT A;  4UIB A;  1Q7L A;  3IEH A;  4P4I A;  3SI2 A;  4R8F A;  2BO9 A;  1Y0Y A;  3D67 A;  2JBJ A;  4F9U A;  2Q43 A;  1ARM A;  3B7I A;  3FVL A;  3GUX A;  4WJB A;  4OIW A;  1IGB A;  4OID A;  3D7G A;  3T8W A;  4MRI A;  1TF8 A;  2GU2 A;  2AFU A;  3FED A;  4PXC A;  2PJ4 A;  2PJ6 A;  3KHZ A;  1PCA A;  3RBU A;  1LCP A;  4EFD A;  4NGQ A;  5K8M A;  3NA6 A;  3TC8 A;  1YW4 A;  4UEF A;  4DYO A;  2QVP A;  4X3R A;  4X2T A;  4ZY1 A;  3RAM A;  3MN8 A;  2OR4 A;  4UEE A;  1QMU A;  4OC2 A;  2Q4Z A;  4OC5 A;  4MCQ A;  2GLJ A;  1HEE A;  3H8E A;  4NFR A;  4ZX9 A;  2F8H A;  3SJG A;  1EE3 P;  1M4L A;  2WYR A;  3B3W A;  2EWB A;  2AFS A;  1AMP A;  3KGQ A;  1AYE A;  2V8D A;  1GYT A;  4DJL A;  3GB0 A;  1XBU A;  4FBE A;  1F2O A;  1LAN A;  5K8O A;  3K9T A;  1ZG8 A;  2ZEE A;  2ZOG A;  3BHX A;  3FEE A;  2V8H A;  4DUK A;  7CPA A;  3S9M A;  3PEI A;  2ZEH A;  4MMO A;  1JQG A;  3D4U A;  3KHX A;  4GM5 A;  5I4M A;  2PCU A;  4P10 A;  2PJ3 A;  3H8G A;  4W9Y A;  4ZI6 A;  2PJA A;  4OME A;  1BPN A;  2ABZ A;  4IAV A;  1XRY A;  3CPX A;  3VAT A;  1PYT B;  4KSI A;  4MCR A;  3VAR A;  4MHY A;  2WZN A;  2BOA A;  3SJE A;  1XMB A;  4Q7A A;  2C6P A;  3PFO A;  5F09 A;  1VIX A;  3D68 A;  4A39 A;  2ZED A;  2V77 A;  3ISZ A;  2AFM A;  2CF4 A;  3JRU A;  4P6Y A;  5ELY A;  2PVW A;  1Z5R A;  1NSA A;  4CPA A;  5LRK A;  2CIJ A;  4ONW A;  4UIA A;  3V38 A;  2PJ7 A;  3GLJ A;  2XEF A;  1Y7E A;  3KQZ A;  5DS0 A;  3L2N A;  2XEG A;  8CPA A;  1ZLI A;  1VGY A;  3B3S A;  3PB6 X;  4EME A;  1ARL A;  1F57 A;  1OBR A;  1ZG9 A;  3PB8 X;  3S9L A;  4IK2 A;  3IC1 A;  1ELM P;  5K8P A;  4P4B A;  1Y0R A;  4ZX8 A;  2ZEF A;  1Z8L A;  2Q51 A;  3SI0 A;  4OKO A;  2POK A;  4NGR A;  4P4E A;  2QJ8 A;  2O53 A;  3KQX A;  3BXM A;  1ELL P;  4O23 A;  4PXB A;  3PB9 X;  4A94 A;  2GRE A;  1XFO A;  4PXE A;  3B3T A;  1CG2 A;  3D7H A;  2I3C A;  5HVF A;  3WC5 A;  2NSM A;  2F7V A;  1ZG7 A;  4RUH A;  5THW A;  4PXD A;  2RB7 A;  2AFW A;  2PVV A;  3IWW A;  5IB9 A;  3KR4 A;  3TX8 A;  1HDQ A;  1DE4 C;  4MHZ A;  4P4D A;  5K8N A;  3IFE A;  5J1Q A;  3RZA A;  1FNO A;  2AFO A;  2PRQ A;  1TKF A;  2PE3 A;  2C6C A;  2CTC A;  4F8Z A;  4PPZ A;  1Z2L A;  5LRJ A;  5HXD A;  1R3N A;  3B35 A;  2HC9 A;  1BAV A;  3I1U A;  2VL1 A;  2ZEO A;  2RFH A;  1CPX A;  3KZW A;  4UEZ A;  5JM6 A;  2V8V A;  3WC7 A;  4H2K A;  3PBB A;  4YWY A;  2PJC A;  4P45 A;  1VHE A;  1VHO A;  5HVH A;  4G1P A;  3FEC A;  4MHN A;  1CPS A;  4PQA A;  5D8N A;  3FJU A;  1CX8 A;  3D7F A;  2PJ0 A;  1IY7 A;  2PJ9 A;  1UWY A;  4OC4 A;  4ZYQ A;  3FX6 A;  2XEJ A;  2J9A A;  3CDX A;  5LYF A;  4NGT A;  3V7Z A;  2PIY A;  1DTD A;  3KR5 A;  2BCO A;  4FWU A;  4NGN A;  3CT9 A;  4OC3 A;  2NYQ A;  4OP4 A;  4OC0 A;  1RTQ A;  3BI0 A;  4X8I A;  1ZLH A;  3MRU A;  3SJF A;  4FUU A;  2OOT A;  2PJ8 A;  3DLJ A;  4MXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...