2ZENA

Crystal structure of the human glutaminyl cyclase mutant d305a at 1.78 angstrom resolution
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
329
structure length
323
Chain Sequence
ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQADHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutaminyl-peptide cyclotransferase
publication title A conserved hydrogen-bond network in the catalytic centre of animal glutaminyl cyclases is critical for catalysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 108
structure length 323
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2zenA00
1PCAA 5JH9A 4PQAA 3H8GA 1KWMA 3B3WA 2EK8A 2ABZA 4R6TA 1HDUA 3L2NA 3IEHA 4B6ZA 2ZEMA 3KQZA 2XEIA 4A38A 4Z65A 4EWTA 2QYVA 3H8FA 1OBRA 2AFOA 1TF8A 3S9LA 3BI1A 3BI0A 5CBMA 4NJRA 2RFHA 3RZAA 3PBBA 5LYLA 1ARMA 3D4UA 1NSAA 2C6PA 3D7FA 3PB8X 3ISZA 2PJAA 3D67A 1YSJA 3SJFA 4R8FA 4RUHA 2V8GA 3RAMA 3LWUA 4PXBA 1ZG9A 5LYFA 3B35A 4P6YA 1CX8A 1Q7LA 1RTQA 1GYTA 5LRKA 5JGFA 4MHPA 5F09A 1VGYA 2FVGA 1Z2LA 4H2KA 2OOTA 2AFWA 4MHNA 4MCRA 3MRUA 4P10A 3FH4A 3SJEA 3KHXA 4PXCA 2PCUA 3H8EA 2PJ4A 2PJ2A 2PJBA 4MMOA 1LAPA 4NGMA 2C6CA 3FEEA 4PXEA 5DS0A 4IK2A 4ZY1A 4UIBA 1ZLHA 1LANA 3B2YA 4ZY2A 3T8WA 2JEWA 1CP7A 4DUKA 1Y7EA 2C1CA 2Q4ZA 2F7VA 2F8HA 2V8HA 1M4LA 1Y0YA 2EWBA 4BD9A 3ISXA 4G1PA 5D8NA 3V38A 6CPAA 1VIXA 2ZOFA 3FF3A 3FJUA 3SI1A 3CT9A 4F9VA 4O23A 3CDXA 3SI2A 4OMEA 5K8NA 2CTCA 3IC1A 4ZX9A 2NSMA 2ZELA 1ZLIA 1CBXA 1TXRA 4OC4A 2CTBA 3TC8A 1VHOA 1IY7A 2NYQA 3FMCA 1LCPA 3KR4A 1CG2A 2DEAA 5J1QA 2V8VA 2PJ9A 3B3TA 1ELLP 1ZG8A 3PBEA 5JM6A 4AXVA 1BPMA 3IJ3A 4GM5A 2BO9A 3GLJA 4DYOA 3LMSA 2IJZA 4PXDA 4CPAA 4TNUA 4A37A 2VL1A 3HLPA 4FUUA 1FT7A 2ZOGA 2O4HA 1TKHA 4YWYA 1IGBA 1XJOA 2ZEEA 4OP4A 5K8MA 4ONWA 1HEEA 2GU2A 3FECA 4JZ0A 4OC5A 4P44A 2PIYA 3WABA 2AFXA 2Q51A 4P45A 2CF4A 1LAMA 4OC3A 1XFOA 2OR4A 4ZX8A 1XBUA 2IMOA 5K8OA 4TWEA 5HXDA 2XEJA 5D29A 3VARA 4OC1A 2PJ7A 8CPAA 3WC6A 4OIDA 3GUXA 7CPAA 4EFDA 2ZEDA 4MRIA 2ANPA 3S9MA 5K8PA 3D7HA 2JBKA 4F8ZA 4MCSA 3JRUA 1YW4A 2ZEOA 3SJXA 1Y0RA 3PB7X 5HVFA 1XMBA 3SI0A 3FVLA 1JQGA 1ZG7A 3B7IA 3PRTA 2WYRA 2PJ5A 4P4JA 1AYEA 2BOAA 2V8DA 3IIBA 2QJ8A 2XEFA 4DJLA 3K2KA 4OC0A 4IAVA 2JBJA 1F57A 4P4DA 2ZEFA 2Q43A 3NA6A 2AFZA 4X2TA 2PJ6A 2IQ6A 4FAIA 2WZNA 4NGNA 4UEZA 1BPNA 4UEEA 2PJCA 5I4MA 2PE3A 1R3NA 3KI9A 3KGQA 2PVWA 3D66A 3KR5A 3NH8A 1LOKA 1YMEA 3PFEA 3K9TA 1XRYA 4ZY0A 3TX8A 3IWWA 4MXUA 2ZENA 3NH5A 1R43A 1QMUA 2PIZA 3D68A 2C6GA 3WC7A 4X3RA 2PJ8A 3DGVA 2ZEHA 2PJ1A 3CPAA 4W9YA 5LRGA 2HB6A 3BHXA 3VH9A 2GLJA 4MHYA 2XEGA 3FX6A 4LQGA 3D7DA 3SJGA 3HUVA 4UEFA 2EK9A 4P4FA 4YU9A 3IO1A 1FNOA 3B3VA 4UF4A 3WT4A 4MCQA 1BLLE 1HDQA 1Z5RA 2QVPA 4A94A 3RBUA 1PYTB 2V77A 4OKOA 3PB9X 3BXMA 4MHZA 4R7MA 4K3NA 4MCPA 2GLFA 3CPXA 5THWA 2AFMA 1F2OA 4P4IA 4FWUA 1BAVA 2PVVA 3DLJA 1CP6A 1CPSA 3D7GA 4NGSA 3QNVA 4PPZA 4WJBA 2O53A 2HC9A 1YW6A 4NGRA 4WWVA 3KASA 2POKA 2ZEPA 3PB4X 1QQ9A 2AFSA 1DTDA 3KZWA 2ZEGA 4P4BA 1ELMP 3FEDA 4A39A 4IHMA 4NFRA 3NFZA 1VHEA 2GREA 5LYDA 4JYWA 3PB6X 1LFWA 3IFEA 1AMPA 3PEIA 4ZYQA 5HVGA 3MN8A 4X8IA 1TF9A 4R76A 2I3CA 4NGQA 2PRQA 3WC5A 5LRJA 1Z8LA 4KSIA 3I1UA 3KL9A 1UWYA 4Q7AA 3KQXA 4NJQA 1TKJA 5IB9A 3V7ZA 4EMEA 2PJ0A 2PJ3A 3VATA 3GB0A 4NGPA 2BCOA 4UIAA 2G9DA 4OC2A 4ZI6A 5CPAA 4F9UA 1CPXA 2RB7A 2CIJA 3NH4A 1TKFA 3B3SA 4NGTA 4FBEA 1ARLA 5HVHA 3PFOA 3KHZA 1EE3P 3N5FA 1DE4C 1H8LA 1YLOA 1F2PA 2J9AA 5LYIA 5ELYA 4P4EA 2AFUA 3S9NA 4OIWA 3B3CA
chains in the Genus database with same CATH superfamily
1PCAA 4C7IA 1QSRA 5JH9A 4AB7A 4PQAA 3RNZA 4A31A 3H8GA 1KWMA 2DXQA 3B3WA 2EK8A 2ABZA 3B8GA 4R6TA 1HDUA 1UFHA 3L2NA 4UBRA 3RYOA 3IEHA 2J8NA 1CM0A 4H6ZA 4B6ZA 2D4OA 2ZEMA 2Z3KA 3KQZA 1P0HA 2XEIA 4A38A 4Z65A 2BSWA 3IWEA 4AG7A 4EWTA 1Z8XA 1MJ9A 2QYVA 3H8FA 1OBRA 4YGOA 1XOVA 2AFOA 5HMNA 4CAVA 1I21A 1TF8A 2I79A 2P6FA 2Z3PA 3H4QA 3S9LA 3BI1A 3QB8A 3BI0A 2A4NA 1CJWA 5CBMA 1KUXA 1XF8A 4NJRA 1Q2YA 5AG6A 1Y9KA 2RFHA 2ZPAA 4NF1A 2B4BA 3RZAA 1MJAA 3PBBA 5LYLA 1ARMA 2PR1A 3D4UA 4KOXA 2JDCA 1NSAA 4FD7A 1QSNA 2C6PA 1YVKA 4CGNA 3FXTA 3N7ZA 1NSLA 4C2XA 2OH1A 3D7FA 3PB8X 3R9FA 3ISZA 4MHDA 4MY3A 3BLNA 4DNCA 2PJAA 3FYNA 3D67A 1YSJA 5G20A 3WR7A 3TO7A 3SJFA 2JEVA 5JPHA 4R8FA 4BMHA 4RUHA 3R96A 2V8GA 3P2HA 3RAMA 3LWUA 4PXBA 3R95A 1ZG9A 2O28A 5LYFA 3W6SA 3NE7A 3B35A 4P6YA 2ZW7A 3D2PA 1CX8A 4B10A 1Q7LA 1RTQA 4GS4A 4B5OA 1GYTA 4MFJA 4CAXA 5LRKA 1Q2DA 5JGFA 2YNEA 4MHPA 3GY9A 4R57A 5F09A 1S7NA 1VGYA 2FVGA 4IF5A 1Z2LA 2PQ8A 1R57A 4H2KA 2OOTA 2AFWA 4MHNA 3DNSA 2B4DA 3MRUA 4MCRA 4P10A 3FH4A 3SJEA 2CNMA 3KHXA 4PXCA 4UCPA 2PCUA 4B12A 4LQ6A 3H8EA 3BJ8A 2PJ4A 4UWIA 2VZYA 2PJ2A 4RN7A 4B14A 3T90A 2PJBA 5AG5A 2H5MA 1U6MA 4MMOA 5F46A 1M4GA 4M3SA 1XEBA 1LAPA 4NGMA 2C6CA 3FEEA 4PXEA 4CYNA 5DS0A 3G3SA 4CGPA 4H6UA 3V8IA 4IK2A 4X5KA 4C7HA 4JXRA 4ZY1A 4UIBA 1Z4RA 1ZLHA 1LANA 2OZGA 3ZJ0A 3B2YA 2B3VA 4ZY2A 3T8WA 2VXKA 4E8OA 1MJBA 1TIQA 1CP7A 2JEWA 4DUKA 2R1IA 2ZW6A 1Y7EA 2C1CA 2Q4ZA 4NSQA 2F7VA 2F8HA 2V8HA 2ODFA 1M4LA 1Y0YA 2EWBA 2Q7SA 4MFKA 4BD9A 3ISXA 4OADA 4AVCA 4UCMA 4G1PA 5D8NA 1AUGA 3V38A 1VIXA 2ZOFA 3FF3A 3BJ7A 6CPAA 3FJUA 3I9SA 4E2AA 2Z10A 2Q44A 3SI1A 1BO4A 1A2ZA 5DWMA 3CT9A 5H86A 3PZJA 4F9VA 5EC4A 4O23A 5GCNA 2Y0MA 5KTCA 1J4JA 2BUEA 3CDXA 3CXQA 5F49A 3B3CA 2OZHA 2PR8A 4NEXA 4OMEA 3SI2A 5K8NA 2CTCA 2QIRA 3IC1A 4M6HA 2FE7A 3IU1A 4R3KA 4ZX9A 2NSMA 2VZZA 2ZELA 1B87A 2VQYA 3IU2A 1ZLIA 4KSFA 2B58A 1CBXA 4AVBA 3R9EA 2J8MA 1TXRA 4OC4A 4RS2A 1S7FA 2CTBA 3TC8A 2CNSA 3DDDA 1VHOA 1IY7A 3GIUA 3FMCA 2B5GB 3SHPA 1LCPA 2G3TA 3KR4A 3RO0A 1CG2A 2DEAA 2WUUA 3SXNA 5J1QA 2V8VA 2PRBA 3TO6A 2Q0YA 2PJ9A 3B3TA 2PC1A 1ELLP 3NE8A 1ZG8A 1YREA 3FNCA 3PBEA 1S3ZA 1KUYA 5I0CA 1LRZA 4B11A 5JM6A 4AXVA 3F0AA 2Z3LA 3FB3A 3S6GA 1BPMA 2DPTA 3GKRA 3D2MA 4KVME 4A32A 5IX3A 3IJ3A 4GM5A 4LUAA 1XIXA 3OWCA 2BO9A 3GLJA 4UCNA 2J8RA 4DYOA 3LMSA 2IJZA 4PXDA 4CPAA 4U9YA 4TNUA 5F48A 4A37A 2FL4A 2VL1A 2ATRA 3HLPA 4F0XA 3JVNA 1PUAA 4FUUA 4KOTA 1FT7A 3K9UA 4KVOE 1WWZA 3IGRA 2ZOGA 2O4HA 4CAWA 1TKHA 2HV2A 2ARHA 2VEZA 4YWYA 1IGBA 1XJOA 3C26A 2K5TA 3TFYA 5FVJA 2ZEEA 4OP4A 5K8MA 1Z9UA 4ONWA 2ZXVA 1HEEA 1MK4A 5H84A 4KOUA 3EC4A 2GU2A 2CXAA 3FECA 4JZ0A 4OC5A 4P44A 1M44A 2PIYA 2Z11A 2Z3NA 3WABA 2AFXA 2BL1A 2Q51A 4MFPA 2YNCC 4P45A 4KOSA 2CF4A 1LAMA 3W6XA 3VWDA 4OC3A 1I1DA 1WK4A 1XFOA 2OR4A 3PP9A 4ZX8A 1XBUA 2QMLA 2IMOA 4ONUA 5K8OA 4TWEA 4KLVA 5E96A 5EMIA 1M1DA 4CS0B 5HXDA 5KTAA 2WPWA 2XEJA 4R87A 5D29A 4FD5A 3VWEA 3P2FA 1VKCA 3VARA 5AG7A 2C27A 2FSRA 4JLYA 4OC1A 2PJ7A 8CPAA 4ZGYB 3WC6A 2Q04A 4OIDA 2VI7A 3GUXA 7CPAA 4EFDA 2GFQA 2ZEDA 2ANPA 4MRIA 4FD4A 1YR0A 3S9MA 3TCVA 5K8PA 3D7HA 3IWGA 1NE9A 1XMTA 2F5IA 2JBKA 2PDOA 4A2ZA 3ZZIA 4F8ZA 1IYKA 4MCSA 1YW4A 3JRUA 2ZEOA 3SJXA 4PSWA 3TT2A 1Y0RA 2YNDA 2HUZA 3CZXA 3PB7X 5HVFA 1XMBA 1M4IA 3SI0A 2FIWA 4KS9A 3H5ZA 2REFA 1V0CA 3FVLA 1JQGA 1I12A 1VHSA 1YK3A 1ZG7A 3B7IA 4XNHB 1Y7RA 3PRTA 2WYRA 2PJ5A 4CRZB 2P0WA 4XPDB 4CRYB 4P4JA 1AYEA 4BBHA 2BOAA 2V8DA 3IIBA 4I49A 2QJ8A 1IB1E 5C88A 2XEFA 4DJLA 5DWNA 3K2KA 1QSTA 4OC0A 4IAVA 4MBUA 1KZFA 1F57A 2JBJA 4P4DA 2ZEFA 1N71A 2Q43A 3NA6A 4CAEA 2AFZA 4X2TA 4QUSA 1Y9WA 4E0AA 2PJ6A 4MFQA 3LODA 2IQ6A 4CGMA 1SQHA 4CYQA 4FAIA 2GE3A 2NMTA 1IIDA 2WZNA 4NGNA 3FBUA 4UEZA 3SXOA 1BOBA 2IL4A 1BPNA 2YNCA 4B5PB 4UEEA 2PJCA 5I4MA 1NMTA 2PE3A 1S60A 2AE6A 1R3NA 3KI9A 4L89A 2R7HA 3KGQA 2HQYA 4KOYA 4U5YA 2PVWA 2B5GA 3D66A 3KR5A 3NH8A 2FS5A 1LOKA 1YMEA 4QC6A 2QECA 3PFEA 3CXSA 4R9MA 2GIVA 4K30A 5G22A 2ZW5A 4A95A 2FCKA 3QAYA 3K9TA 4XPLA 1XRYA 5IV0A 4ZY0A 3F5BA 3TX8A 4XNHC 1JWQA 3IWWA 4C2ZA 5F47A 4MXUA 2ZENA 3NH5A 5BWAB 1R43A 3LD2A 2VBQA 1QMUA 2PIZA 2JDDA 4XPDC 3D68A 3EFAA 2Z0ZA 2FXFA 2C6GA 2OZUA 3WC7A 4X3RA 4JXQA 2P6GA 2PJ8A 3DGVA 2ZEHA 1IYLA 1S7KA 1XE4A 2PJ1A 3F8KA 3CPAA 2OU2A 4KOVA 2G3AA 4W9YA 5LRGA 2HB6A 3S6FA 3BHXA 3TOAA 2X7BA 2DPSA 3R9GA 3VH9A 3FIXA 5AGEA 5G1ZA 2GLJA 4MHYA 1IOFA 4KZTA 2G0BA 2XEGA 3FX6A 4KUAA 4LQGA 2YGWA 4MFLA 2FT0A 3D7DA 3SJGA 2R98A 3TO9A 4AG9A 3HUVA 4UEFA 4Q38A 4FD6A 3PGPA 2BEIA 2EK9A 4P4FA 3GYAA 1B6BA 4YU9A 3IO1A 1FNOA 4L8AA 3B3VA 4UF4A 3WT4A 4MCQA 1BLLE 1HDQA 1Z5RA 2QVPA 3D8PA 4JJXA 4A94A 3S6KA 1ZO0A 3RBUA 1PYTB 2V77A 4OKOA 4MJ8A 3QAHA 3PB9X 2EVNA 4LX9A 4UFXA 4C68A 3BXMA 3KKWA 4CYOA 4MHZA 4CGLA 1Z8WA 1K4JA 4IUSA 4R7MA 5ISVA 4K3NA 5J8FA 1S7LA 1Z4EA 4MCPA 4QBJA 2GLFA 2JLMA 4CGOA 3CPXA 5EBVA 2AFMA 4JD6A 2I00A 5THWA 1OZPA 4M6GA 4NXYA 4UA3A 4MI4A 4A30A 1F2OA 5A27A 1X10A 3DSBA 2EO8A 4PV6A 1RO5A 4P4IA 2ZW4A 2D4PA 4U9ZA 4FWUA 4Y49B 1P4NA 4CAFA 2Q4YA 3DR6A 1BAVA 2PVVA 2Z3MA 4A33A 3DLJA 4RI1A 4MFZA 4PSXA 3TE4A 1CP6A 4PK2A 5HH1A 1CPSA 5A28A 4II9A 3DR8A 3D7GA 4YFJA 1IOIA 3W91A 4HKFA 2CY2A 4KLWA 4MY0A 1FY7A 4NGSA 4QVTA 3QNVA 3TTHA 4PPZA 4M85A 4HNXB 4KUBA 4WJBA 2O53A 3A9LA 4J3GA 4PK3A 2HC9A 1YW6A 2R8VA 4NGRA 1ON0A 3KASA 2GANA 2POKA 2ZEPA 3PB4X 4HPSA 4H89A 4WWVA 1QQ9A 2B4DB 2AFSA 1DTDA 4B13A 4CYPA 1PU9A 1KUVA 4F0YA 3KZWA 2ZEGA 4KORA 1ELMP 4P4BA 1QSOA 3I3GA 3FEDA 4KVXA 5CNPA 3JTKA 4A39A 4IHMA 4NFRA 4C2YA 3NFZA 1VHEA 4M6IA 2GREA 3T9YA 3EY5A 3E0KA 5LYDA 4JYWA 2KCWA 2P6EA 4UFWA 3TOBA 1IU8A 3PB6X 3S6HA 1LFWA 3IFEA 1AMPA 3PEIA 4ZYQA 3D3SA 5HVGA 3MN8A 4BINA 4X8IA 4KSAA 4OAEA 1TF9A 2RC4A 4R76A 5C82A 3EO4A 2EBJA 4EVYA 1Q2CA 3G8WA 2I3CA 4NGQA 2PRQA 1L0CA 2OB0A 2Q4VA 2PSWA 5G21A 3EXNA 5LRJA 1Z8LA 3WC5A 5J8CA 2CNTA 3JUWA 4KSIA 3I1UA 3KL9A 1UWYA 4Q7AA 1YLEA 3KQXA 1TKJA 4NJQA 5IB9A 1IICA 3V7ZA 2B3UA 2WSAA 4EMEA 4KOWA 2PJ0A 2FIAA 4ZBGA 2PJ3A 3VATA 3FRMA 4Y49C 3GB0A 4B5PA 4HNWB 4NGPA 2BCOA 4UIAA 2G9DA 1QSMA 4OC2A 4R3LA 4YRHA 4AVAA 4UFVA 5CPAA 4NCZA 4F6AA 1S5KA 4ZI6A 4F9UA 1YQEA 4HNYB 4UWJA 4OLLA 5IB0A 1GHEA 1YVOA 3LACA 4ORFA 1CPXA 1Z8TA 1M4DA 2DF5A 1X12A 4JWPA 4GXHA 2RB7A 3R1KA 2CIJA 2REEA 5JQ4A 3CXPA 4XPKA 3NH4A 1TKFA 3B3SA 2AJ6A 4QB9A 4NGTA 4FBEA 1ARLA 2Q7BA 5HVHA 2Z3OA 3PFOA 3MGDA 3KHZA 1EE3P 1YX0A 3N5FA 1DE4C 2WPXA 1H8LA 1YLOA 1F2PA 2J9AA 5LYIA 5KTDA 5ELYA 3UY5A 4P4EA 2AFUA 5AG4A 3S9NA 1YGHA 2EUIA 4OIWA 4Q36A 1RXTA 2NYQA
chains in the Genus database with same CATH topology
1PCAA 5JH9A 4PQAA 3H8GA 1KWMA 3B3WA 2EK8A 2ABZA 4R6TA 1HDUA 3L2NA 3IEHA 4B6ZA 2ZEMA 3KQZA 2XEIA 4A38A 4Z65A 4EWTA 2QYVA 3H8FA 1OBRA 2AFOA 1TF8A 3S9LA 3BI1A 3BI0A 5CBMA 4NJRA 2RFHA 3RZAA 3PBBA 5LYLA 1ARMA 3D4UA 1NSAA 2C6PA 3D7FA 3PB8X 3ISZA 2PJAA 3D67A 1YSJA 3SJFA 4R8FA 4RUHA 2V8GA 3RAMA 3LWUA 4PXBA 1ZG9A 5LYFA 3B35A 4P6YA 1CX8A 1Q7LA 1RTQA 1GYTA 5LRKA 5JGFA 4MHPA 5F09A 1VGYA 2FVGA 1Z2LA 4H2KA 2OOTA 2AFWA 4MHNA 4MCRA 3MRUA 4P10A 3FH4A 3SJEA 3KHXA 4PXCA 2PCUA 3H8EA 2PJ4A 2PJ2A 2PJBA 4MMOA 1LAPA 4NGMA 2C6CA 3FEEA 4PXEA 5DS0A 4IK2A 4ZY1A 4UIBA 1ZLHA 1LANA 3B2YA 4ZY2A 3T8WA 2JEWA 1CP7A 4DUKA 1Y7EA 2C1CA 2Q4ZA 2F7VA 2F8HA 2V8HA 1M4LA 1Y0YA 2EWBA 4BD9A 3ISXA 4G1PA 5D8NA 3V38A 6CPAA 1VIXA 2ZOFA 3FF3A 3FJUA 3SI1A 3CT9A 4F9VA 4O23A 3CDXA 3SI2A 4OMEA 5K8NA 2CTCA 3IC1A 4ZX9A 2NSMA 2ZELA 1ZLIA 1CBXA 1TXRA 4OC4A 2CTBA 3TC8A 1VHOA 1IY7A 2NYQA 3FMCA 1LCPA 3KR4A 1CG2A 2DEAA 5J1QA 2V8VA 2PJ9A 3B3TA 1ELLP 1ZG8A 3PBEA 5JM6A 4AXVA 1BPMA 3IJ3A 4GM5A 2BO9A 3GLJA 4DYOA 3LMSA 2IJZA 4PXDA 4CPAA 4TNUA 4A37A 2VL1A 3HLPA 4FUUA 1FT7A 2ZOGA 2O4HA 1TKHA 4YWYA 1IGBA 1XJOA 2ZEEA 4OP4A 5K8MA 4ONWA 1HEEA 2GU2A 3FECA 4JZ0A 4OC5A 4P44A 2PIYA 3WABA 2AFXA 2Q51A 4P45A 2CF4A 1LAMA 4OC3A 1XFOA 2OR4A 4ZX8A 1XBUA 2IMOA 5K8OA 4TWEA 5HXDA 2XEJA 5D29A 3VARA 4OC1A 2PJ7A 8CPAA 3WC6A 4OIDA 3GUXA 7CPAA 4EFDA 2ZEDA 4MRIA 2ANPA 3S9MA 5K8PA 3D7HA 2JBKA 4F8ZA 4MCSA 3JRUA 1YW4A 2ZEOA 3SJXA 1Y0RA 3PB7X 5HVFA 1XMBA 3SI0A 3FVLA 1JQGA 1ZG7A 3B7IA 3PRTA 2WYRA 2PJ5A 4P4JA 1AYEA 2BOAA 2V8DA 3IIBA 2QJ8A 2XEFA 4DJLA 3K2KA 4OC0A 4IAVA 2JBJA 1F57A 4P4DA 2ZEFA 2Q43A 3NA6A 2AFZA 4X2TA 2PJ6A 2IQ6A 4FAIA 2WZNA 4NGNA 4UEZA 1BPNA 4UEEA 2PJCA 5I4MA 2PE3A 1R3NA 3KI9A 3KGQA 2PVWA 3D66A 3KR5A 3NH8A 1LOKA 1YMEA 3PFEA 3K9TA 1XRYA 4ZY0A 3TX8A 3IWWA 4MXUA 2ZENA 3NH5A 1R43A 1QMUA 2PIZA 3D68A 2C6GA 3WC7A 4X3RA 2PJ8A 3DGVA 2ZEHA 2PJ1A 3CPAA 4W9YA 5LRGA 2HB6A 3BHXA 3VH9A 2GLJA 4MHYA 2XEGA 3FX6A 4LQGA 3D7DA 3SJGA 3HUVA 4UEFA 2EK9A 4P4FA 4YU9A 3IO1A 1FNOA 3B3VA 4UF4A 3WT4A 4MCQA 1BLLE 1HDQA 1Z5RA 2QVPA 4A94A 3RBUA 1PYTB 2V77A 4OKOA 3PB9X 3BXMA 4MHZA 4R7MA 4K3NA 4MCPA 2GLFA 3CPXA 5THWA 2AFMA 1F2OA 4P4IA 4FWUA 1BAVA 2PVVA 3DLJA 1CP6A 1CPSA 3D7GA 4NGSA 3QNVA 4PPZA 4WJBA 2O53A 2HC9A 1YW6A 4NGRA 4WWVA 3KASA 2POKA 2ZEPA 3PB4X 1QQ9A 2AFSA 1DTDA 3KZWA 2ZEGA 4P4BA 1ELMP 3FEDA 4A39A 4IHMA 4NFRA 3NFZA 1VHEA 2GREA 5LYDA 4JYWA 3PB6X 1LFWA 3IFEA 1AMPA 3PEIA 4ZYQA 5HVGA 3MN8A 4X8IA 1TF9A 4R76A 2I3CA 4NGQA 2PRQA 3WC5A 5LRJA 1Z8LA 4KSIA 3I1UA 3KL9A 1UWYA 4Q7AA 3KQXA 4NJQA 1TKJA 5IB9A 3V7ZA 4EMEA 2PJ0A 2PJ3A 3VATA 3GB0A 4NGPA 2BCOA 4UIAA 2G9DA 4OC2A 4ZI6A 5CPAA 4F9UA 1CPXA 2RB7A 2CIJA 3NH4A 1TKFA 3B3SA 4NGTA 4FBEA 1ARLA 5HVHA 3PFOA 3KHZA 1EE3P 3N5FA 1DE4C 1H8LA 1YLOA 1F2PA 2J9AA 5LYIA 5ELYA 4P4EA 2AFUA 3S9NA 4OIWA 3B3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PCA A;  5JH9 A;  4PQA A;  3H8G A;  1KWM A;  3B3W A;  2EK8 A;  2ABZ A;  4R6T A;  1HDU A;  3L2N A;  3IEH A;  4B6Z A;  2ZEM A;  3KQZ A;  2XEI A;  4A38 A;  4Z65 A;  4EWT A;  2QYV A;  3H8F A;  1OBR A;  2AFO A;  1TF8 A;  3S9L A;  3BI1 A;  3BI0 A;  5CBM A;  4NJR A;  2RFH A;  3RZA A;  3PBB A;  5LYL A;  1ARM A;  3D4U A;  1NSA A;  2C6P A;  3D7F A;  3PB8 X;  3ISZ A;  2PJA A;  3D67 A;  1YSJ A;  3SJF A;  4R8F A;  4RUH A;  2V8G A;  3RAM A;  3LWU A;  4PXB A;  1ZG9 A;  5LYF A;  3B35 A;  4P6Y A;  1CX8 A;  1Q7L A;  1RTQ A;  1GYT A;  5LRK A;  5JGF A;  4MHP A;  5F09 A;  1VGY A;  2FVG A;  1Z2L A;  4H2K A;  2OOT A;  2AFW A;  4MHN A;  4MCR A;  3MRU A;  4P10 A;  3FH4 A;  3SJE A;  3KHX A;  4PXC A;  2PCU A;  3H8E A;  2PJ4 A;  2PJ2 A;  2PJB A;  4MMO A;  1LAP A;  4NGM A;  2C6C A;  3FEE A;  4PXE A;  5DS0 A;  4IK2 A;  4ZY1 A;  4UIB A;  1ZLH A;  1LAN A;  3B2Y A;  4ZY2 A;  3T8W A;  2JEW A;  1CP7 A;  4DUK A;  1Y7E A;  2C1C A;  2Q4Z A;  2F7V A;  2F8H A;  2V8H A;  1M4L A;  1Y0Y A;  2EWB A;  4BD9 A;  3ISX A;  4G1P A;  5D8N A;  3V38 A;  6CPA A;  1VIX A;  2ZOF A;  3FF3 A;  3FJU A;  3SI1 A;  3CT9 A;  4F9V A;  4O23 A;  3CDX A;  3SI2 A;  4OME A;  5K8N A;  2CTC A;  3IC1 A;  4ZX9 A;  2NSM A;  2ZEL A;  1ZLI A;  1CBX A;  1TXR A;  4OC4 A;  2CTB A;  3TC8 A;  1VHO A;  1IY7 A;  2NYQ A;  3FMC A;  1LCP A;  3KR4 A;  1CG2 A;  2DEA A;  5J1Q A;  2V8V A;  2PJ9 A;  3B3T A;  1ELL P;  1ZG8 A;  3PBE A;  5JM6 A;  4AXV A;  1BPM A;  3IJ3 A;  4GM5 A;  2BO9 A;  3GLJ A;  4DYO A;  3LMS A;  2IJZ A;  4PXD A;  4CPA A;  4TNU A;  4A37 A;  2VL1 A;  3HLP A;  4FUU A;  1FT7 A;  2ZOG A;  2O4H A;  1TKH A;  4YWY A;  1IGB A;  1XJO A;  2ZEE A;  4OP4 A;  5K8M A;  4ONW A;  1HEE A;  2GU2 A;  3FEC A;  4JZ0 A;  4OC5 A;  4P44 A;  2PIY A;  3WAB A;  2AFX A;  2Q51 A;  4P45 A;  2CF4 A;  1LAM A;  4OC3 A;  1XFO A;  2OR4 A;  4ZX8 A;  1XBU A;  2IMO A;  5K8O A;  4TWE A;  5HXD A;  2XEJ A;  5D29 A;  3VAR A;  4OC1 A;  2PJ7 A;  8CPA A;  3WC6 A;  4OID A;  3GUX A;  7CPA A;  4EFD A;  2ZED A;  4MRI A;  2ANP A;  3S9M A;  5K8P A;  3D7H A;  2JBK A;  4F8Z A;  4MCS A;  3JRU A;  1YW4 A;  2ZEO A;  3SJX A;  1Y0R A;  3PB7 X;  5HVF A;  1XMB A;  3SI0 A;  3FVL A;  1JQG A;  1ZG7 A;  3B7I A;  3PRT A;  2WYR A;  2PJ5 A;  4P4J A;  1AYE A;  2BOA A;  2V8D A;  3IIB A;  2QJ8 A;  2XEF A;  4DJL A;  3K2K A;  4OC0 A;  4IAV A;  2JBJ A;  1F57 A;  4P4D A;  2ZEF A;  2Q43 A;  3NA6 A;  2AFZ A;  4X2T A;  2PJ6 A;  2IQ6 A;  4FAI A;  2WZN A;  4NGN A;  4UEZ A;  1BPN A;  4UEE A;  2PJC A;  5I4M A;  2PE3 A;  1R3N A;  3KI9 A;  3KGQ A;  2PVW A;  3D66 A;  3KR5 A;  3NH8 A;  1LOK A;  1YME A;  3PFE A;  3K9T A;  1XRY A;  4ZY0 A;  3TX8 A;  3IWW A;  4MXU A;  2ZEN A;  3NH5 A;  1R43 A;  1QMU A;  2PIZ A;  3D68 A;  2C6G A;  3WC7 A;  4X3R A;  2PJ8 A;  3DGV A;  2ZEH A;  2PJ1 A;  3CPA A;  4W9Y A;  5LRG A;  2HB6 A;  3BHX A;  3VH9 A;  2GLJ A;  4MHY A;  2XEG A;  3FX6 A;  4LQG A;  3D7D A;  3SJG A;  3HUV A;  4UEF A;  2EK9 A;  4P4F A;  4YU9 A;  3IO1 A;  1FNO A;  3B3V A;  4UF4 A;  3WT4 A;  4MCQ A;  1BLL E;  1HDQ A;  1Z5R A;  2QVP A;  4A94 A;  3RBU A;  1PYT B;  2V77 A;  4OKO A;  3PB9 X;  3BXM A;  4MHZ A;  4R7M A;  4K3N A;  4MCP A;  2GLF A;  3CPX A;  5THW A;  2AFM A;  1F2O A;  4P4I A;  4FWU A;  1BAV A;  2PVV A;  3DLJ A;  1CP6 A;  1CPS A;  3D7G A;  4NGS A;  3QNV A;  4PPZ A;  4WJB A;  2O53 A;  2HC9 A;  1YW6 A;  4NGR A;  4WWV A;  3KAS A;  2POK A;  2ZEP A;  3PB4 X;  1QQ9 A;  2AFS A;  1DTD A;  3KZW A;  2ZEG A;  4P4B A;  1ELM P;  3FED A;  4A39 A;  4IHM A;  4NFR A;  3NFZ A;  1VHE A;  2GRE A;  5LYD A;  4JYW A;  3PB6 X;  1LFW A;  3IFE A;  1AMP A;  3PEI A;  4ZYQ A;  5HVG A;  3MN8 A;  4X8I A;  1TF9 A;  4R76 A;  2I3C A;  4NGQ A;  2PRQ A;  3WC5 A;  5LRJ A;  1Z8L A;  4KSI A;  3I1U A;  3KL9 A;  1UWY A;  4Q7A A;  3KQX A;  4NJQ A;  1TKJ A;  5IB9 A;  3V7Z A;  4EME A;  2PJ0 A;  2PJ3 A;  3VAT A;  3GB0 A;  4NGP A;  2BCO A;  4UIA A;  2G9D A;  4OC2 A;  4ZI6 A;  5CPA A;  4F9U A;  1CPX A;  2RB7 A;  2CIJ A;  3NH4 A;  1TKF A;  3B3S A;  4NGT A;  4FBE A;  1ARL A;  5HVH A;  3PFO A;  3KHZ A;  1EE3 P;  3N5F A;  1DE4 C;  1H8L A;  1YLO A;  1F2P A;  2J9A A;  5LYI A;  5ELY A;  4P4E A;  2AFU A;  3S9N A;  4OIW A;  3B3C A; 
#chains in the Genus database with same CATH topology
 1PCA A;  4C7I A;  1QSR A;  5JH9 A;  4AB7 A;  4PQA A;  3RNZ A;  4A31 A;  3H8G A;  1KWM A;  2DXQ A;  3B3W A;  2EK8 A;  2ABZ A;  3B8G A;  4R6T A;  1HDU A;  1UFH A;  3L2N A;  4UBR A;  3RYO A;  3IEH A;  2J8N A;  1CM0 A;  4H6Z A;  4B6Z A;  2D4O A;  2ZEM A;  2Z3K A;  3KQZ A;  1P0H A;  2XEI A;  4A38 A;  4Z65 A;  2BSW A;  3IWE A;  4AG7 A;  4EWT A;  1Z8X A;  1MJ9 A;  2QYV A;  3H8F A;  1OBR A;  4YGO A;  1XOV A;  2AFO A;  5HMN A;  4CAV A;  1I21 A;  1TF8 A;  2I79 A;  2P6F A;  2Z3P A;  3H4Q A;  3S9L A;  3BI1 A;  3QB8 A;  3BI0 A;  2A4N A;  1CJW A;  5CBM A;  1KUX A;  1XF8 A;  4NJR A;  1Q2Y A;  5AG6 A;  1Y9K A;  2RFH A;  2ZPA A;  4NF1 A;  2B4B A;  3RZA A;  1MJA A;  3PBB A;  5LYL A;  1ARM A;  2PR1 A;  3D4U A;  4KOX A;  2JDC A;  1NSA A;  4FD7 A;  1QSN A;  2C6P A;  1YVK A;  4CGN A;  3FXT A;  3N7Z A;  1NSL A;  4C2X A;  2OH1 A;  3D7F A;  3PB8 X;  3R9F A;  3ISZ A;  4MHD A;  4MY3 A;  3BLN A;  4DNC A;  2PJA A;  3FYN A;  3D67 A;  1YSJ A;  5G20 A;  3WR7 A;  3TO7 A;  3SJF A;  2JEV A;  5JPH A;  4R8F A;  4BMH A;  4RUH A;  3R96 A;  2V8G A;  3P2H A;  3RAM A;  3LWU A;  4PXB A;  3R95 A;  1ZG9 A;  2O28 A;  5LYF A;  3W6S A;  3NE7 A;  3B35 A;  4P6Y A;  2ZW7 A;  3D2P A;  1CX8 A;  4B10 A;  1Q7L A;  1RTQ A;  4GS4 A;  4B5O A;  1GYT A;  4MFJ A;  4CAX A;  5LRK A;  1Q2D A;  5JGF A;  2YNE A;  4MHP A;  3GY9 A;  4R57 A;  5F09 A;  1S7N A;  1VGY A;  2FVG A;  4IF5 A;  1Z2L A;  2PQ8 A;  1R57 A;  4H2K A;  2OOT A;  2AFW A;  4MHN A;  3DNS A;  2B4D A;  3MRU A;  4MCR A;  4P10 A;  3FH4 A;  3SJE A;  2CNM A;  3KHX A;  4PXC A;  4UCP A;  2PCU A;  4B12 A;  4LQ6 A;  3H8E A;  3BJ8 A;  2PJ4 A;  4UWI A;  2VZY A;  2PJ2 A;  4RN7 A;  4B14 A;  3T90 A;  2PJB A;  5AG5 A;  2H5M A;  1U6M A;  4MMO A;  5F46 A;  1M4G A;  4M3S A;  1XEB A;  1LAP A;  4NGM A;  2C6C A;  3FEE A;  4PXE A;  4CYN A;  5DS0 A;  3G3S A;  4CGP A;  4H6U A;  3V8I A;  4IK2 A;  4X5K A;  4C7H A;  4JXR A;  4ZY1 A;  4UIB A;  1Z4R A;  1ZLH A;  1LAN A;  2OZG A;  3ZJ0 A;  3B2Y A;  2B3V A;  4ZY2 A;  3T8W A;  2VXK A;  4E8O A;  1MJB A;  1TIQ A;  1CP7 A;  2JEW A;  4DUK A;  2R1I A;  2ZW6 A;  1Y7E A;  2C1C A;  2Q4Z A;  4NSQ A;  2F7V A;  2F8H A;  2V8H A;  2ODF A;  1M4L A;  1Y0Y A;  2EWB A;  2Q7S A;  4MFK A;  4BD9 A;  3ISX A;  4OAD A;  4AVC A;  4UCM A;  4G1P A;  5D8N A;  1AUG A;  3V38 A;  1VIX A;  2ZOF A;  3FF3 A;  3BJ7 A;  6CPA A;  3FJU A;  3I9S A;  4E2A A;  2Z10 A;  2Q44 A;  3SI1 A;  1BO4 A;  1A2Z A;  5DWM A;  3CT9 A;  5H86 A;  3PZJ A;  4F9V A;  5EC4 A;  4O23 A;  5GCN A;  2Y0M A;  5KTC A;  1J4J A;  2BUE A;  3CDX A;  3CXQ A;  5F49 A;  3B3C A;  2OZH A;  2PR8 A;  4NEX A;  4OME A;  3SI2 A;  5K8N A;  2CTC A;  2QIR A;  3IC1 A;  4M6H A;  2FE7 A;  3IU1 A;  4R3K A;  4ZX9 A;  2NSM A;  2VZZ A;  2ZEL A;  1B87 A;  2VQY A;  3IU2 A;  1ZLI A;  4KSF A;  2B58 A;  1CBX A;  4AVB A;  3R9E A;  2J8M A;  1TXR A;  4OC4 A;  4RS2 A;  1S7F A;  2CTB A;  3TC8 A;  2CNS A;  3DDD A;  1VHO A;  1IY7 A;  3GIU A;  3FMC A;  2B5G B;  3SHP A;  1LCP A;  2G3T A;  3KR4 A;  3RO0 A;  1CG2 A;  2DEA A;  2WUU A;  3SXN A;  5J1Q A;  2V8V A;  2PRB A;  3TO6 A;  2Q0Y A;  2PJ9 A;  3B3T A;  2PC1 A;  1ELL P;  3NE8 A;  1ZG8 A;  1YRE A;  3FNC A;  3PBE A;  1S3Z A;  1KUY A;  5I0C A;  1LRZ A;  4B11 A;  5JM6 A;  4AXV A;  3F0A A;  2Z3L A;  3FB3 A;  3S6G A;  1BPM A;  2DPT A;  3GKR A;  3D2M A;  4KVM E;  4A32 A;  5IX3 A;  3IJ3 A;  4GM5 A;  4LUA A;  1XIX A;  3OWC A;  2BO9 A;  3GLJ A;  4UCN A;  2J8R A;  4DYO A;  3LMS A;  2IJZ A;  4PXD A;  4CPA A;  4U9Y A;  4TNU A;  5F48 A;  4A37 A;  2FL4 A;  2VL1 A;  2ATR A;  3HLP A;  4F0X A;  3JVN A;  1PUA A;  4FUU A;  4KOT A;  1FT7 A;  3K9U A;  4KVO E;  1WWZ A;  3IGR A;  2ZOG A;  2O4H A;  4CAW A;  1TKH A;  2HV2 A;  2ARH A;  2VEZ A;  4YWY A;  1IGB A;  1XJO A;  3C26 A;  2K5T A;  3TFY A;  5FVJ A;  2ZEE A;  4OP4 A;  5K8M A;  1Z9U A;  4ONW A;  2ZXV A;  1HEE A;  1MK4 A;  5H84 A;  4KOU A;  3EC4 A;  2GU2 A;  2CXA A;  3FEC A;  4JZ0 A;  4OC5 A;  4P44 A;  1M44 A;  2PIY A;  2Z11 A;  2Z3N A;  3WAB A;  2AFX A;  2BL1 A;  2Q51 A;  4MFP A;  2YNC C;  4P45 A;  4KOS A;  2CF4 A;  1LAM A;  3W6X A;  3VWD A;  4OC3 A;  1I1D A;  1WK4 A;  1XFO A;  2OR4 A;  3PP9 A;  4ZX8 A;  1XBU A;  2QML A;  2IMO A;  4ONU A;  5K8O A;  4TWE A;  4KLV A;  5E96 A;  5EMI A;  1M1D A;  4CS0 B;  5HXD A;  5KTA A;  2WPW A;  2XEJ A;  4R87 A;  5D29 A;  4FD5 A;  3VWE A;  3P2F A;  1VKC A;  3VAR A;  5AG7 A;  2C27 A;  2FSR A;  4JLY A;  4OC1 A;  2PJ7 A;  8CPA A;  4ZGY B;  3WC6 A;  2Q04 A;  4OID A;  2VI7 A;  3GUX A;  7CPA A;  4EFD A;  2GFQ A;  2ZED A;  2ANP A;  4MRI A;  4FD4 A;  1YR0 A;  3S9M A;  3TCV A;  5K8P A;  3D7H A;  3IWG A;  1NE9 A;  1XMT A;  2F5I A;  2JBK A;  2PDO A;  4A2Z A;  3ZZI A;  4F8Z A;  1IYK A;  4MCS A;  1YW4 A;  3JRU A;  2ZEO A;  3SJX A;  4PSW A;  3TT2 A;  1Y0R A;  2YND A;  2HUZ A;  3CZX A;  3PB7 X;  5HVF A;  1XMB A;  1M4I A;  3SI0 A;  2FIW A;  4KS9 A;  3H5Z A;  2REF A;  1V0C A;  3FVL A;  1JQG A;  1I12 A;  1VHS A;  1YK3 A;  1ZG7 A;  3B7I A;  4XNH B;  1Y7R A;  3PRT A;  2WYR A;  2PJ5 A;  4CRZ B;  2P0W A;  4XPD B;  4CRY B;  4P4J A;  1AYE A;  4BBH A;  2BOA A;  2V8D A;  3IIB A;  4I49 A;  2QJ8 A;  1IB1 E;  5C88 A;  2XEF A;  4DJL A;  5DWN A;  3K2K A;  1QST A;  4OC0 A;  4IAV A;  4MBU A;  1KZF A;  1F57 A;  2JBJ A;  4P4D A;  2ZEF A;  1N71 A;  2Q43 A;  3NA6 A;  4CAE A;  2AFZ A;  4X2T A;  4QUS A;  1Y9W A;  4E0A A;  2PJ6 A;  4MFQ A;  3LOD A;  2IQ6 A;  4CGM A;  1SQH A;  4CYQ A;  4FAI A;  2GE3 A;  2NMT A;  1IID A;  2WZN A;  4NGN A;  3FBU A;  4UEZ A;  3SXO A;  1BOB A;  2IL4 A;  1BPN A;  2YNC A;  4B5P B;  4UEE A;  2PJC A;  5I4M A;  1NMT A;  2PE3 A;  1S60 A;  2AE6 A;  1R3N A;  3KI9 A;  4L89 A;  2R7H A;  3KGQ A;  2HQY A;  4KOY A;  4U5Y A;  2PVW A;  2B5G A;  3D66 A;  3KR5 A;  3NH8 A;  2FS5 A;  1LOK A;  1YME A;  4QC6 A;  2QEC A;  3PFE A;  3CXS A;  4R9M A;  2GIV A;  4K30 A;  5G22 A;  2ZW5 A;  4A95 A;  2FCK A;  3QAY A;  3K9T A;  4XPL A;  1XRY A;  5IV0 A;  4ZY0 A;  3F5B A;  3TX8 A;  4XNH C;  1JWQ A;  3IWW A;  4C2Z A;  5F47 A;  4MXU A;  2ZEN A;  3NH5 A;  5BWA B;  1R43 A;  3LD2 A;  2VBQ A;  1QMU A;  2PIZ A;  2JDD A;  4XPD C;  3D68 A;  3EFA A;  2Z0Z A;  2FXF A;  2C6G A;  2OZU A;  3WC7 A;  4X3R A;  4JXQ A;  2P6G A;  2PJ8 A;  3DGV A;  2ZEH A;  1IYL A;  1S7K A;  1XE4 A;  2PJ1 A;  3F8K A;  3CPA A;  2OU2 A;  4KOV A;  2G3A A;  4W9Y A;  5LRG A;  2HB6 A;  3S6F A;  3BHX A;  3TOA A;  2X7B A;  2DPS A;  3R9G A;  3VH9 A;  3FIX A;  5AGE A;  5G1Z A;  2GLJ A;  4MHY A;  1IOF A;  4KZT A;  2G0B A;  2XEG A;  3FX6 A;  4KUA A;  4LQG A;  2YGW A;  4MFL A;  2FT0 A;  3D7D A;  3SJG A;  2R98 A;  3TO9 A;  4AG9 A;  3HUV A;  4UEF A;  4Q38 A;  4FD6 A;  3PGP A;  2BEI A;  2EK9 A;  4P4F A;  3GYA A;  1B6B A;  4YU9 A;  3IO1 A;  1FNO A;  4L8A A;  3B3V A;  4UF4 A;  3WT4 A;  4MCQ A;  1BLL E;  1HDQ A;  1Z5R A;  2QVP A;  3D8P A;  4JJX A;  4A94 A;  3S6K A;  1ZO0 A;  3RBU A;  1PYT B;  2V77 A;  4OKO A;  4MJ8 A;  3QAH A;  3PB9 X;  2EVN A;  4LX9 A;  4UFX A;  4C68 A;  3BXM A;  3KKW A;  4CYO A;  4MHZ A;  4CGL A;  1Z8W A;  1K4J A;  4IUS A;  4R7M A;  5ISV A;  4K3N A;  5J8F A;  1S7L A;  1Z4E A;  4MCP A;  4QBJ A;  2GLF A;  2JLM A;  4CGO A;  3CPX A;  5EBV A;  2AFM A;  4JD6 A;  2I00 A;  5THW A;  1OZP A;  4M6G A;  4NXY A;  4UA3 A;  4MI4 A;  4A30 A;  1F2O A;  5A27 A;  1X10 A;  3DSB A;  2EO8 A;  4PV6 A;  1RO5 A;  4P4I A;  2ZW4 A;  2D4P A;  4U9Z A;  4FWU A;  4Y49 B;  1P4N A;  4CAF A;  2Q4Y A;  3DR6 A;  1BAV A;  2PVV A;  2Z3M A;  4A33 A;  3DLJ A;  4RI1 A;  4MFZ A;  4PSX A;  3TE4 A;  1CP6 A;  4PK2 A;  5HH1 A;  1CPS A;  5A28 A;  4II9 A;  3DR8 A;  3D7G A;  4YFJ A;  1IOI A;  3W91 A;  4HKF A;  2CY2 A;  4KLW A;  4MY0 A;  1FY7 A;  4NGS A;  4QVT A;  3QNV A;  3TTH A;  4PPZ A;  4M85 A;  4HNX B;  4KUB A;  4WJB A;  2O53 A;  3A9L A;  4J3G A;  4PK3 A;  2HC9 A;  1YW6 A;  2R8V A;  4NGR A;  1ON0 A;  3KAS A;  2GAN A;  2POK A;  2ZEP A;  3PB4 X;  4HPS A;  4H89 A;  4WWV A;  1QQ9 A;  2B4D B;  2AFS A;  1DTD A;  4B13 A;  4CYP A;  1PU9 A;  1KUV A;  4F0Y A;  3KZW A;  2ZEG A;  4KOR A;  1ELM P;  4P4B A;  1QSO A;  3I3G A;  3FED A;  4KVX A;  5CNP A;  3JTK A;  4A39 A;  4IHM A;  4NFR A;  4C2Y A;  3NFZ A;  1VHE A;  4M6I A;  2GRE A;  3T9Y A;  3EY5 A;  3E0K A;  5LYD A;  4JYW A;  2KCW A;  2P6E A;  4UFW A;  3TOB A;  1IU8 A;  3PB6 X;  3S6H A;  1LFW A;  3IFE A;  1AMP A;  3PEI A;  4ZYQ A;  3D3S A;  5HVG A;  3MN8 A;  4BIN A;  4X8I A;  4KSA A;  4OAE A;  1TF9 A;  2RC4 A;  4R76 A;  5C82 A;  3EO4 A;  2EBJ A;  4EVY A;  1Q2C A;  3G8W A;  2I3C A;  4NGQ A;  2PRQ A;  1L0C A;  2OB0 A;  2Q4V A;  2PSW A;  5G21 A;  3EXN A;  5LRJ A;  1Z8L A;  3WC5 A;  5J8C A;  2CNT A;  3JUW A;  4KSI A;  3I1U A;  3KL9 A;  1UWY A;  4Q7A A;  1YLE A;  3KQX A;  1TKJ A;  4NJQ A;  5IB9 A;  1IIC A;  3V7Z A;  2B3U A;  2WSA A;  4EME A;  4KOW A;  2PJ0 A;  2FIA A;  4ZBG A;  2PJ3 A;  3VAT A;  3FRM A;  4Y49 C;  3GB0 A;  4B5P A;  4HNW B;  4NGP A;  2BCO A;  4UIA A;  2G9D A;  1QSM A;  4OC2 A;  4R3L A;  4YRH A;  4AVA A;  4UFV A;  5CPA A;  4NCZ A;  4F6A A;  1S5K A;  4ZI6 A;  4F9U A;  1YQE A;  4HNY B;  4UWJ A;  4OLL A;  5IB0 A;  1GHE A;  1YVO A;  3LAC A;  4ORF A;  1CPX A;  1Z8T A;  1M4D A;  2DF5 A;  1X12 A;  4JWP A;  4GXH A;  2RB7 A;  3R1K A;  2CIJ A;  2REE A;  5JQ4 A;  3CXP A;  4XPK A;  3NH4 A;  1TKF A;  3B3S A;  2AJ6 A;  4QB9 A;  4NGT A;  4FBE A;  1ARL A;  2Q7B A;  5HVH A;  2Z3O A;  3PFO A;  3MGD A;  3KHZ A;  1EE3 P;  1YX0 A;  3N5F A;  1DE4 C;  2WPX A;  1H8L A;  1YLO A;  1F2P A;  2J9A A;  5LYI A;  5KTD A;  5ELY A;  3UY5 A;  4P4E A;  2AFU A;  5AG4 A;  3S9N A;  1YGH A;  2EUI A;  4OIW A;  4Q36 A;  1RXT A;  2NYQ A; 
#chains in the Genus database with same CATH homology
 1PCA A;  5JH9 A;  4PQA A;  3H8G A;  1KWM A;  3B3W A;  2EK8 A;  2ABZ A;  4R6T A;  1HDU A;  3L2N A;  3IEH A;  4B6Z A;  2ZEM A;  3KQZ A;  2XEI A;  4A38 A;  4Z65 A;  4EWT A;  2QYV A;  3H8F A;  1OBR A;  2AFO A;  1TF8 A;  3S9L A;  3BI1 A;  3BI0 A;  5CBM A;  4NJR A;  2RFH A;  3RZA A;  3PBB A;  5LYL A;  1ARM A;  3D4U A;  1NSA A;  2C6P A;  3D7F A;  3PB8 X;  3ISZ A;  2PJA A;  3D67 A;  1YSJ A;  3SJF A;  4R8F A;  4RUH A;  2V8G A;  3RAM A;  3LWU A;  4PXB A;  1ZG9 A;  5LYF A;  3B35 A;  4P6Y A;  1CX8 A;  1Q7L A;  1RTQ A;  1GYT A;  5LRK A;  5JGF A;  4MHP A;  5F09 A;  1VGY A;  2FVG A;  1Z2L A;  4H2K A;  2OOT A;  2AFW A;  4MHN A;  4MCR A;  3MRU A;  4P10 A;  3FH4 A;  3SJE A;  3KHX A;  4PXC A;  2PCU A;  3H8E A;  2PJ4 A;  2PJ2 A;  2PJB A;  4MMO A;  1LAP A;  4NGM A;  2C6C A;  3FEE A;  4PXE A;  5DS0 A;  4IK2 A;  4ZY1 A;  4UIB A;  1ZLH A;  1LAN A;  3B2Y A;  4ZY2 A;  3T8W A;  2JEW A;  1CP7 A;  4DUK A;  1Y7E A;  2C1C A;  2Q4Z A;  2F7V A;  2F8H A;  2V8H A;  1M4L A;  1Y0Y A;  2EWB A;  4BD9 A;  3ISX A;  4G1P A;  5D8N A;  3V38 A;  6CPA A;  1VIX A;  2ZOF A;  3FF3 A;  3FJU A;  3SI1 A;  3CT9 A;  4F9V A;  4O23 A;  3CDX A;  3SI2 A;  4OME A;  5K8N A;  2CTC A;  3IC1 A;  4ZX9 A;  2NSM A;  2ZEL A;  1ZLI A;  1CBX A;  1TXR A;  4OC4 A;  2CTB A;  3TC8 A;  1VHO A;  1IY7 A;  2NYQ A;  3FMC A;  1LCP A;  3KR4 A;  1CG2 A;  2DEA A;  5J1Q A;  2V8V A;  2PJ9 A;  3B3T A;  1ELL P;  1ZG8 A;  3PBE A;  5JM6 A;  4AXV A;  1BPM A;  3IJ3 A;  4GM5 A;  2BO9 A;  3GLJ A;  4DYO A;  3LMS A;  2IJZ A;  4PXD A;  4CPA A;  4TNU A;  4A37 A;  2VL1 A;  3HLP A;  4FUU A;  1FT7 A;  2ZOG A;  2O4H A;  1TKH A;  4YWY A;  1IGB A;  1XJO A;  2ZEE A;  4OP4 A;  5K8M A;  4ONW A;  1HEE A;  2GU2 A;  3FEC A;  4JZ0 A;  4OC5 A;  4P44 A;  2PIY A;  3WAB A;  2AFX A;  2Q51 A;  4P45 A;  2CF4 A;  1LAM A;  4OC3 A;  1XFO A;  2OR4 A;  4ZX8 A;  1XBU A;  2IMO A;  5K8O A;  4TWE A;  5HXD A;  2XEJ A;  5D29 A;  3VAR A;  4OC1 A;  2PJ7 A;  8CPA A;  3WC6 A;  4OID A;  3GUX A;  7CPA A;  4EFD A;  2ZED A;  4MRI A;  2ANP A;  3S9M A;  5K8P A;  3D7H A;  2JBK A;  4F8Z A;  4MCS A;  3JRU A;  1YW4 A;  2ZEO A;  3SJX A;  1Y0R A;  3PB7 X;  5HVF A;  1XMB A;  3SI0 A;  3FVL A;  1JQG A;  1ZG7 A;  3B7I A;  3PRT A;  2WYR A;  2PJ5 A;  4P4J A;  1AYE A;  2BOA A;  2V8D A;  3IIB A;  2QJ8 A;  2XEF A;  4DJL A;  3K2K A;  4OC0 A;  4IAV A;  2JBJ A;  1F57 A;  4P4D A;  2ZEF A;  2Q43 A;  3NA6 A;  2AFZ A;  4X2T A;  2PJ6 A;  2IQ6 A;  4FAI A;  2WZN A;  4NGN A;  4UEZ A;  1BPN A;  4UEE A;  2PJC A;  5I4M A;  2PE3 A;  1R3N A;  3KI9 A;  3KGQ A;  2PVW A;  3D66 A;  3KR5 A;  3NH8 A;  1LOK A;  1YME A;  3PFE A;  3K9T A;  1XRY A;  4ZY0 A;  3TX8 A;  3IWW A;  4MXU A;  2ZEN A;  3NH5 A;  1R43 A;  1QMU A;  2PIZ A;  3D68 A;  2C6G A;  3WC7 A;  4X3R A;  2PJ8 A;  3DGV A;  2ZEH A;  2PJ1 A;  3CPA A;  4W9Y A;  5LRG A;  2HB6 A;  3BHX A;  3VH9 A;  2GLJ A;  4MHY A;  2XEG A;  3FX6 A;  4LQG A;  3D7D A;  3SJG A;  3HUV A;  4UEF A;  2EK9 A;  4P4F A;  4YU9 A;  3IO1 A;  1FNO A;  3B3V A;  4UF4 A;  3WT4 A;  4MCQ A;  1BLL E;  1HDQ A;  1Z5R A;  2QVP A;  4A94 A;  3RBU A;  1PYT B;  2V77 A;  4OKO A;  3PB9 X;  3BXM A;  4MHZ A;  4R7M A;  4K3N A;  4MCP A;  2GLF A;  3CPX A;  5THW A;  2AFM A;  1F2O A;  4P4I A;  4FWU A;  1BAV A;  2PVV A;  3DLJ A;  1CP6 A;  1CPS A;  3D7G A;  4NGS A;  3QNV A;  4PPZ A;  4WJB A;  2O53 A;  2HC9 A;  1YW6 A;  4NGR A;  4WWV A;  3KAS A;  2POK A;  2ZEP A;  3PB4 X;  1QQ9 A;  2AFS A;  1DTD A;  3KZW A;  2ZEG A;  4P4B A;  1ELM P;  3FED A;  4A39 A;  4IHM A;  4NFR A;  3NFZ A;  1VHE A;  2GRE A;  5LYD A;  4JYW A;  3PB6 X;  1LFW A;  3IFE A;  1AMP A;  3PEI A;  4ZYQ A;  5HVG A;  3MN8 A;  4X8I A;  1TF9 A;  4R76 A;  2I3C A;  4NGQ A;  2PRQ A;  3WC5 A;  5LRJ A;  1Z8L A;  4KSI A;  3I1U A;  3KL9 A;  1UWY A;  4Q7A A;  3KQX A;  4NJQ A;  1TKJ A;  5IB9 A;  3V7Z A;  4EME A;  2PJ0 A;  2PJ3 A;  3VAT A;  3GB0 A;  4NGP A;  2BCO A;  4UIA A;  2G9D A;  4OC2 A;  4ZI6 A;  5CPA A;  4F9U A;  1CPX A;  2RB7 A;  2CIJ A;  3NH4 A;  1TKF A;  3B3S A;  4NGT A;  4FBE A;  1ARL A;  5HVH A;  3PFO A;  3KHZ A;  1EE3 P;  3N5F A;  1DE4 C;  1H8L A;  1YLO A;  1F2P A;  2J9A A;  5LYI A;  5ELY A;  4P4E A;  2AFU A;  3S9N A;  4OIW A;  3B3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...