3FMCA

Crystal structure of a putative succinylglutamate desuccinylase / aspartoacylase family protein (sama_0604) from shewanella amazonensis sb2b at 1.80 a resolution
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
365
structure length
365
Chain Sequence
VDKHEVRVGELAAGQPLSLPVYRFKGKGAGPSVYIQANVHGAEVQGNAVIYQLMKLLEHYELLGDISLVPLANPLGINQKSGEFTLGRFDPITGVNWNREYLDHGFNIEVWYQEHSHLDDDTLITAFRATLVEECARRLNNPWGVTTGHRLAVTLQSMAHRADIVLDLHTGPKSCKHLYCPEYERSAAQYFSIPYTLLIPNSFGGAMDEAAFVPWWTLAEVASSHGRELGVRVSALTLELGSQERIDLDDALEDAEGILAYLSHRGVIAETVLPKPMKRYGCFLKNYRKFHAPKAGMVEYLGKVGVPMKATDPLVNLLRLDLYGTGEELTVLRLPEDGVPILHFASASVHQGTELYKVMTKVFEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative succinylglutamate desuccinylase / aspartoacylase
publication title Crystal structure of putative succinylglutamate desuccinylase / aspartoacylase (YP_926482.1) from Shewanella amazonensis SB2B at 1.80 A resolution
rcsb
source organism Shewanella amazonensis
molecule tags Hydrolase
total genus 112
structure length 365
sequence length 365
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3fmcA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3fmcA01
3KLRA 4Z65A 4KHZA 4R7MA 2O4HA 1YW6A 3PV0A 1AYEA 5THWA 1T5EA 2BA0A 4F9UA 1YMEA 4TQUS 3NH8A 1H9SA 2NN6I 4JZ0A 2Q51A 4KKTA 2AFXA 2PVWA 3FX6A 3LNNA 4AXVA 1VHEA 3IFEA 3A8IE 2AFOA 2PIZA 4H44C 3PB8X 3BI1A 1LOKA 4ZY1A 2YYZA 2DNCA 2BCOA 2JBKA 1Z7TA 4X2TA 2PPBC 1OXSC 4UF4A 1HTPA 3VR4A 1OXVA 4NJQA 3B3CA 4KKUA 1LACA 2PCUA 4WWVA 1TKFA 1DD2A 1DTDA 3T56B 4OO1H 3ISZA 4MXUA 5D8NA 4TKOB 2JEAI 3GB0A 1HDUA 4OMEA 4X3RA 2V4DA 2G9DA 2O5IC 3SJXA 1ZKOA 1Y69U 2EWBA 3NE5B 3FVLA 1H9MA 3PFEA 3S9MA 5LYFA 1Y8NB 3FMCA 3I4LA 1SMYC 1Q12A 1DE4C 1HEEA 1CG2A 4P45A 2WZNA 2O5JC 2ZEMA 3B3VA 2GU2A 2BA1A 3NFZA 2EJGC 2D2CC 3TZUA 4P4BA 4NFRA 5IB9A 4P4FA 3MN8A 2A68C 3HGBA 5KNBA 2K32A 2V8GA 5I4MA 3KL9A 8CPAA 4HR7B 1B9NA 1V8QA 2XEFA 3VR3A 4DNTB 3FEEA 3IC1A 1ZG8A 3QJYA 1ZG7A 2QYVA 2PJ2A 2EK9A 2B8FA 4PPZA 3M4YA 3KR4A 1XRYA 4P10A 4YU9A 1IW7C 4DNRB 4G7HC 1DCZA 4ZY2A 4IQZA 4W9YA 3SI2A 3FH4A 3U9SA 3M7NA 3OOCA 4KI0A 2FVGA 1JQGA 2RFHA 4MHNA 3PUYA 4A38A 4WJBA 4RCNA 1Y0RA 3SE0A 3PEIA 1OXTA 1Y8PB 4NGQA 5HVHA 3PB9X 2D62A 3L7ZC 5K36G 2ZEFA 3L2NA 5DS0A 1LANA 4O23A 6CPAA 2C6CA 1Q7LA 2ZOFA 2ZEEA 2BE5D 4ZYQA 1GUNA 2K33A 5LRGA 2AUJD 2PRQA 1H9JA 5K8MA 1Y0YA 3WT4A 1UWYA 3KR5A 4OC5A 4G1PA 2D5DA 3IWWA 1CPXA 2ZENA 1R3NA 3W3AA 5BN5A 4R6TA 4KN7C 2ZEGA 4TNUA 3MRUA 1H9SB 1BPMA 3KQZA 4OC3A 2EVBA 3KHZA 3T53B 4MMOA 7CPAA 3T51B 4P44A 3VR6A 2A69D 2ZEDA 3D7DA 3FEDA 3IO1A 4OC1A 4L8JA 4OO1G 2JEWA 2GREA 3WC7A 3BHXA 5D29A 2E76C 1TF9A 2A6HD 4MHPA 4DYOA 2EJMA 4LQGA 1BDOA 2F8HA 2PIYA 3PBEA 2DNEA 5KNDA 2K7VA 1Y7EA 3BXMA 4PXCA 3RAMA 4K3NA 4TWEA 3N5FA 2OOTA 3TC8A 3PB6X 1NSAA 1PYTB 1VF7A 4JYWA 3NA6A 3SJFA 3B2YA 1CI3M 1GUGA 3AB9A 3PUVA 3SJEA 3A7LA 1Z2LA 2E74C 5K8NA 2PJBA 1CP6A 1HDQA 4F8ZA 3OPOA 1VHOA 3JRUA 5JEAH 1HCZA 5LYIA 3CDXA 4ZY0A 2OR4A 4MCSA 2NN6H 1GUOA 3D7GA 2NSMA 2XEJA 4CPAA 3RLFA 1Y8OB 1ARLA 4A37A 3KZWA 1OXUA 3KHXA 5BN4A 3PUXA 4H2KA 2V8VA 1Q90A 4MRIA 4G7OC 2IJZA 4EFDA 1O78A 4BA2I 3D68A 5KNCA 1ONLA 4ZI6A 4ONWA 2PJAA 2NYQA 1LFWA 4DUKA 5JH9A 4OC4A 3CRKC 1CBXA 3BDOA 4XTCS 1Q1BA 2AFMA 2DEAA 1K8OA 3GLJA 1IGBA 1E2WA 3H94A 1PCAA 4A94A 3D4UA 4UEFA 2PJ7A 1VCIA 4NGMA 5LRJA 4H13C 4P4JA 1YNNC 4UEEA 1F2PA 5HVFA 4LJZC 2A68D 3LMSA 3V38A 5HVGA 1R43A 1LABA 1ZYRC 2PJ4A 3BI0A 2BOAA 2O53A 2QJ8A 2EK8A 4DK0A 5C0XG 2V77A 3WC6A 4DJLA 4OP4A 1GUSA 3VR2A 1RTQA 3H8GA 4NGTA 4IFDH 1OBRA 2A6EC 1ZG9A 3WC5A 3KQXA 4IK2A 4KKSA 2ZELA 4NGPA 3KASA 4MCRA 2VL1A 2QF7A 3GD7A 4UEZA 4BA1I 1IW7D 1OXXK 2B8GA 3OW7A 1GUTA 2XEIA 4PXBA 1GYTA 1CP7A 1E2ZA 3IIBA 4PQAA 3SI0A 1F2OA 4FAIA 1GHJA 1BPNA 3I72A 1TKJA 1H8LA 3CRLC 3QG1A 1F57A 5ELYA 2PJ9A 2AFUA 3RZAA 4IHMA 4OIWA 5C0XH 1KWMA 2PJCA 3CPAA 1Z5RA 4UIAA 1YSJA 3LWUA 1ZLHA 5LYLA 1TKHA 3WABA 3IKJA 4P4DA 3NH5A 3H8FA 3HLPA 1I6VC 1QJOA 2E75C 2F1MA 1BLLE 1YLOA 1FR3A 3IFTA 2EDGA 2AFSA 2V8DA 2Q43A 2KCCA 3IJ3A 3I73A 3ISXA 1H9KA 2Q4ZA 2PJ6A 4KMUC 4F9VA 3VATA 4EMEA 1GHKA 5JEAG 4NGRA 1DXMA 3PB4X 2PJ1A 4UIBA 1IYVA 2NN6G 3B35A 2ZT9C 2ZEOA 2CIJA 2CF4A 2PJ5A 4OC0A 2A69C 2ZOGA 4NGNA 1QQ9A 1VF5C 1LAPA 4JBWA 4R76A 5CPAA 4OC2A 2GLFA 1XFOA 3WDNA 3ND9A 1HQMC 2JEBI 3EQLC 3BG3A 1HPCA 2BO9A 1YW4A 3B3TA 3PB7X 3KI9A 1YNJC 3A8KE 2GLJA 1VIXA 1CPSA 4H0LC 2AWOA 2PJ0A 2HB6A 2I3CA 3B7IA 3T8WA 1IYUA 4GZYC 4ZX9A 4P4IA 3VARA 1XJOA 4KN4C 3K9TA 3B3WA 5HXDA 3CT9A 2CTCA 3P20A 2BDOA 2POKA 1BAVA 3QIAA 4NJRA 2ZEHA 1E2VA 2KA7A 2C6GA 3M85A 4IAVA 1EE3P 2JE6I 2IQ6A 1G291 3GUXA 3K2KA 1VDZA 1TU2B 4IFDG 3QNVA 5A35A 4MCPA 3I1UA 5K8PA 1CX8A 2PJ3A 2QVPA 2CTBA 3FPPA 3D67A 5LYDA 3PUZA 2ZEPA 3S9LA 2PNRC 1CTMA 4B6ZA 3KGQA 4ZX8A 4RUHA 2PVVA 4P6YA 3VH9A 3D7HA 4X8IA 4OKOA 2PE3A 3FF3A 1B9MA 2WYRA 2V8HA 3B3SA 1CFMA 1Q1EA 2RB7A 1EWHA 4PXDA 1IY7A 1VGYA 3V7ZA 4EWTA 5K8OA 2IMOA 2AUKA 2JXMB 1GJXA 4KSIA 4OIDA 4Q7AA 2DN8A 2EJFC 4NGSA 1LCPA 3A7AB 2L5TA 3ND8A 5J1QA 1ELMP 3D4RA 2A6ED 4FWUA 4P4EA 2PJ8A 4FUUA 2ABZA 4BD9A 3VR5A 4LK1C 3N6RA 3PBBA 2XEGA 1PMRA 3MFYA 5BN3A 3PFOA 4MCQA 5JGFA 4PV1C 4XIGS 5LRKA 2AFZA 1AMPA 2ANPA 2JBJA 4GM5A 2F7VA 3DXJC 1O7LA 5JM6A 1ZLIA 4G7ZC 4MHYA 3VA7A 4R8FA 2LMCB 3D31A 1FYCA 1K8MA 1XMBA 1QMUA 3D66A 2BE5C 1Z6HA 2R6GA 3FJUA 3D7FA 4MHZA 3FECA 4OGQC 2HC9A 1TXRA 3SI1A 2C6PA 3RBUA 4FBEA 4JK1C 2IT1A 3A8JE 3H8EA 1FNOA 3CPXA 3SDZA 3PRTA 4PXEA 3S9NA 5F09A 4YWYA 1M4LA 3IEHA 2CW0C 2C1CA 2Q8IB 3NH4A 3SJGA 4DK1A 1ARMA 1ELLP 1LAMA 3DGVA 4I7ZC 3DLJA 4A39A 3PUWA 1XBUA 1H9RA 1V43A 2AFWA 3HUVA 3GQBA 3TX8A 1TF8A 1Z8LA 3MXUA 1TKWB 1FT7A 2PCFB 2J9AA 5K36H 1A6XA 5CBMA 2A6HC
chains in the Genus database with same CATH superfamily
3KLRA 1HJPA 1NTGA 3E9IA 3K9UA 2LSSA 4KHZA 2DJGC 5EAYA 3PV0A 1Y7RA 3CP0A 1PH1A 1UAPA 1R4QB 5THWA 5C3EB 3RNZA 1YMEA 1SN8A 3K7UC 1QSNA 4C7IA 2AFXA 2PVWA 3TE4A 2F0OA 1MK4A 1VHEA 2AFOA 5AGEA 3P7JA 2MFIA 4PNYA 4QL5A 4WJ4A 4DR7Q 3M4OB 3DSBA 1SNOA 1MGSA 3F2CA 2YYZA 2ZW5A 2AMCB 4DXGA 1JCKB 5M5XH 2EYMA 1HTPA 3TS2A 1IYLA 4OLLA 5D3IB 1OXVA 4WFN3 2JLMA 4X6AH 3KFUA 1D1IA 5C3EH 1N8RC 4ME3A 4OO1H 2PRBA 4MXUA 3MZ5A 4HJ5A 1HDUA 2AKWB 4OMEA 4X3RA 2FT0A 4R9MA 4KY7A 2EY5A 2Y0SE 2ZTEA 1IKMA 2FCKA 3SJXA 3L0OA 4L5TA 4JWPA 2EWBA 1PXUA 4RGTA 1QVGA 1W6KA 4PG3A 3NQIA 1SE4A 1E1TA 1EEFD 4UWIA 2B63G 1JE5A 3W6XA 5JJZA 3S9WA 1SQHA 1YLEA 1HEEA 4E6IA 3Q23A 1V9PA 5HGTA 3NE7A 4P45A 2WZNA 2VUMB 2F0TA 2PDOA 3B3VA 3PGZA 2ARHA 4N9PA 2I79A 3R9EA 3K8AA 1UEAB 3TZUA 4NFRA 4JI0Q 3MN8A 4IFDI 3HGBA 1I50B 5CORA 1PV4A 2F0WA 2JA8G 3CW2C 2EVNA 4HJ8A 1FY7A 3DNSA 5IT9E 2LXKA 1V8QA 3AU7A 5EGTA 5M5YH 3A55A 1IOFA 3VR3A 2MQHA 4DNTB 1YHBA 2E2IB 2KUMA 4OL7A 4QY7A 2VQEL 2VBQA 4H6ZA 1X54A 5C5LA 5JJKA 2QYVA 3C2PA 1S3OA 2B8FA 4IO9A 3M4YA 2A73B 1IYKA 1TWHH 2NUCA 4HCEA 4P10A 4F87A 5C0XI 4YU9A 3TFYA 1SNCA 1CQVA 1DCZA 2EXDA 3TZDA 2HHHQ 2L9HA 5C4ZA 4XPDC 1DOMA 3MXNB 4B3RQ 3D3RA 3Q0AA 1BCPC 2PSWA 3PCOB 2IWHA 1PH9A 2VNUD 2IHEA 1MI2A 1QG7A 3V2TA 4DXFA 4PZ8A 4GKKQ 3ULPA 4O2DA 4JXRA 1PH7A 5K36G 5DS0A 3V05A 3NH4A 4LW1A 2PMZB 1PTOF 2ZEEA 4ZYQA 4ZCKA 4UA3A 1N36L 4OELB 1OZPA 4A3MG 5IT9L 3WT4A 5IGCA 3KR5A 5KYLA 1AEXA 3SEBA 4K30A 1K8AC 4K0KQ 1AH9A 4Q38A 2QW7A 4A31A 2YGWA 3S15B 4QCLA 4II9A 2E2DC 2RDFA 4P71A 1EY0A 3MRUA 1BPMA 1AZQA 4GN3B 3MAQA 3KQZA 4OC3A 2UXCL 2CW0D 3T90A 1ILQA 2QIRA 4A3GB 1EY4A 3RNUA 3EXNA 3DWAA 3FRMA 3KLSA 2A69D 4OC1A 3IO1A 5M3MB 2N78A 3O13A 2E2JH 4L8JA 1KC8C 1W6JA 3SK5A 4DKAC 4A3MH 1N33Q 2GREA 4DPGA 3BHXA 1PH4A 2P6FA 1E24A 2XWJB 4B13A 1NMTA 1MBYA 2RSOA 4LF6Q 3D4DA 1Q2DA 4ONUA 2HQYA 1D5XC 4ID6A 2PIYA 1KDCA 3PBEA 4A33A 1C48A 4YCVA 2K5HA 2JA7G 2EYPA 3N5FA 1QWYA 2HUGA 2PI2A 3MEFA 4FF4A 3CKIB 2C27A 3S1RH 3PUVA 4A75A 1F2YA 3A7LA 3ZYYX 1Z8XA 5M3MH 5I9PA 3PIP3 1SE3A 4ULLA 3T1YL 2PJBA 4F8ZA 1VHOA 3JRUA 1G8ZD 4DNCA 3CXCA 3Q24A 2OR4A 5EKIA 4JPBW 2NN6H 4F88A 1GUOA 4GN5A 2XEJA 5FKAC 4CPAA 1Y8OB 4MN3A 1IBLL 1EYCA 4N8FA 4M6HA 3KHXA 4JVZA 2NZOA 2QGQA 2GIVA 2F0EA 1JE4A 1LUZA 4LF4L 3I90A 4H7BA 5DM73 5EPKA 4G7OC 2IJZA 4RH6A 3T16A 1HNZQ 1CM9A 1RCVD 1YHQA 4JOIC 4OADA 5HY6A 4KS9A 5DNFA 3MA2B 4RAUC 4AYBB 3GTKB 5DAUA 1E1OA 1BXTA 1DGSA 3CRKC 4C1NK 1Q1BA 4BY7B 4YFJA 1VKCA 2AFMA 4MFJA 3R2IA 2R61A 4RGOS 1E2WA 1ZEQX 4KJNA 4IALA 3CCQA 1VQOA 4GKJL 4NCZA 1F2LA 1XPOA 1S5FD 4H13C 4NPSA 3JAMc 4P4JA 1YNNC 4UEEA 4UCNA 5HVFA 1ZXTA 2A68D 2VXKA 3K5MA 4X62Q 3LMSA 4B5PA 5BR8Q 5G1ZA 4C3IB 4CRZB 2LS01 2BOAA 1E22A 3DWQA 3WC6A 4DJLA 4GNXB 1S5KA 3GTKH 3FHWA 1KD1C 1TT2A 1GUSA 1MSGA 2RBMA 3VR2A 4BY7H 5IP7G 1ZG9A 4IK2A 4MFKA 2FL4A 1O7IA 3RUZA 4UFXA 4C3JG 4YWMA 4HIOA 4DV0L 1S7NA 1OXXK 3GTLB 4Y52H 1RJTA 3OW7A 1GUTA 2HDMA 3J81c 1Z8WA 1CP7A 3SI0A 3SXNA 3GV3A 1PYWD 3HP3A 1VQLA 1Y1VG 1KNAA 2K5QA 3CHBD 1BPNA 5AG6A 3I72A 4C3IH 2YU9B 3A56A 3CRLC 1X3EA 3QG1A 1F9PA 4BY1B 1F57A 3RYOA 4KY5A 2I5HA 4C2YA 5M3FB 3DM3A 2PJCA 3CPAA 1YSJA 3LWUA 1TKHA 2NZHA 1L0CA 3JAML 1BBWA 2F52A 3UDFA 1PH2A 1EEID 1NAPA 1LT4D 5IP7H 2OWOA 3HOUG 4MHDA 4NXMQ 4F6AA 5KIXA 2XVSA 1V0CA 2B4BA 2F0SA 4C3JH 4JI0L 2DXQA 1QJOA 1PA6A 4LFCQ 2C35B 3CCJA 3G6JB 2GFQA 4M85A 3HS0C 1KRSA 2EY6A 2V8DA 1Y1VH 2BL1A 5GROA 3BJ7A 3IJ3A 2YV5A 1U4LA 1QILA 2VB3X 4RKBA 5M3FH 3R9GA 4FAIA 4B08A 4KMUC 3BU2A 3ULLA 3HOZB 2Z6BA 3C3LA 1XF8A 2P0WA 4EMEA 1GHKA 5I0CA 4FXDA 2R93G 2PJ1A 1EY5A 1L0YB 3HOUH 3PZJA 3B35A 2EOTA 3EBEA 2ZT9C 3B6YA 5I6YA 4ILWA 2CIJA 1EWIA 3EFXD 4A3JG 5FLXE 2ZW4A 1M8AA 2ATRA 1SJHD 2EYOA 4R57A 1G91A 1B8AA 4B10A 5CPAA 2VQYA 3HKZE 5EC4A 2OQ0A 4NMZA 1V1OA 1GO3E 3KKWA 1YIJA 4F7XA 4L8AA 1OO9B 4KORA 1B4OA 1SSOA 3X3NA 5K5PA 3I55A 5G20A 4XNHC 2B3UA 3HOZH 1L0XB 2Y0MA 2OF1A 2C9OA 3KI9A 1YNJC 3A8KE 1B6BA 2J0TD 1UNSA 4H0LC 2R93H 2K6AA 2AWOA 2WB1G 5FLMG 4LF7L 1UEBA 1UE6A 1PH6A 1PH5A 1CA6A 4LF8L 1IYUA 4OWTB 2I3CA 4MJ8A 5F47A 4A3JH 2OZHA 2WIIB 2VY3A 5JPHA 4K0KL 1XJOA 4KN4C 3K9TA 3S6KA 2A4NA 2J7ZA 2JQOA 3GTOB 1EUJA 4A2ZA 3P20A 2POKA 4NJRA 3HZXA 2KJXA 2RCFA 1STYA 4IAVA 3CXQA 4IUQA 4GNXC 1CZWA 4MHEA 5A2QE 2JSOA 4B5PB 1ET9A 2MPMA 5FLXL 5A35A 2K52A 1KDBA 1SMYD 4GOPB 5K8PA 4R9WA 1HUMA 2G3TA 2EYFA 2AHOB 3CCUA 2CTBA 5JEAJ 5M5WH 3QWNA 5FLMH 1SJED 3S9LA 2ZXVA 1LM0A 1SYBA 1CTMA 4B6ZA 3KGQA 4RUHA 1N9WA 4P6YA 3PO3G 3FNCA 2PE3A 1B9MA 2WYRA 1IKLA 1VQ5A 4HMJA 1EIYB 1X32A 3VYTA 3TOBA 5IGEA 4HIKA 3T13A 1EWHA 1CKMA 3TQYA 4EWTA 5FOBB 4G4KA 1C0AA 1ESFA 1ZYRD 4JI1L 4POFA 1GJXA 4UPAA 4C2MB 4XPLA 5LHY1 2BOSA 1X3PA 2MUYA 4NGSA 2NVXB 4R4CA 1P8LA 3R8BA 1ELMP 1HR0W 2A6ED 5A2QL 1K83B 2F5IA 1J9OA 3PBBA 3PO3H 1EQTA 3MFYA 3PFOA 2JDCA 2FJ2A 2KEDA 1HNZL 1AMPA 2Z3NA 1SYDA 2JBJA 3DXJC 2WAQG 4PK2A 5JM6A 1W2BA 2Z0SA 1ZLIA 3HOWG 2WUUA 4CGNA 2OT2A 4IFDJ 2LMCB 3OTOL 4JI7Q 4A3KB 5IGFA 4IZ8A 3S16B 1XMBA 3D66A 2NVXH 1PZJD 1L1OA 3SK6A 3PO2G 3FECA 4IUUA 4X3KA 1ML0D 3NHHA 3G8WA 2F0PA 2C6PA 1PYSB 2ICIA 4OONA 2HQEA 2B2WC 2EY2A 1A2ZA 3K80C 4J1MA 1FNOA 3CPXA 2Z3MA 1FL0A 4R1JA 3J7ZC 2F0IA 4YWYA 2UXDL 4H6UA 5C0XJ 3IEHA 4MY0A 2C1CA 1R9TH 1H95A 4ZGYB 3SJGA 4E2AA 2J4XA 4HN7A 1ELLP 4J15A 2E5LQ 3HOWH 5ISRA 4A3KH 3S16H 5F49A 4A39A 3PUWA 3A5ZB 4K5XA 1B50A 1V43A 4A3EG 3KJOA 2OZGA 1WCMG 3PO2H 3MXUA 4EQ5A 2EZVA 1A6XA 3AFPA 1VQMA 1TKWB 3DR6A 2PCFB 2B2VC 3U50C 4CBVA 3S6FA 2D2CC 3CQZB 1JWUD 3HOYB 3E0JA 4Z65A 5IYBG 2M2LA 4CKBA 4R7MA 1PTOB 5IWAL 2O4HA 1P0HA 3BVGA 4X66L 1VQPA 3I3GA 1YITA 1WTQA 5KRUA 1QUQB 1T5EA 2BA0A 2FXQA 5EBCA 4TQUS 4QMGA 1CHPD 2BDNA 2QILA 3FX6A 4AXVA 2VQEQ 1ENCA 1EZ6A 3IFEA 5JPNC 2XRQD 1TIQA 4H44C 1LTID 1SE8A 4A3EH 1AP0A 1KZFA 4ZY1A 5AG7A 1WCMH 5I2XA 3NPPA 1LTLA 2BCOA 1U9RA 1Z7TA 4N9TA 3F5BA 4OEMB 3CC2A 3CQZH 2PPBC 4Y7NB 3OW2A 3VR4A 2CWAA 1PTOH 1S7KA 4M6GA 3B3CA 4RWSC 5JPMC 1STBA 4KKUA 1NMFA 1SYEA 1LACA 4YY3L 2PCUA 3B8GA 4P75A 3IWGA 3T56B 1IBKL 2NTSA 2JEAI 2WP8J 4OAEA 2TMPA 3GB0A 3H0GB 2Z4HA 1LTAD 2V4DA 5CYUA 5IYCG 4DGZA 1Y69U 4KOTA 4IURA 2WINB 3H5ZA 3FVLA 1EIGA 5LMNW 5LYFA 1TWFB 1VQKA 4A3DB 2XTIA 1RXTA 3I4LA 1N36Q 4DAVA 3V8IA 4Y7NH 5C4JB 4FVMA 1XXGA 3DEOA 5I6WA 1YJWA 2ZEMA 2WKDA 4CKCA 4I65A 3UDGA 3NFZA 3GP7A 1C9OA 4NSQA 4P4BA 2KCWA 2RSNA 1KABA 4UP9A 1ILPA 4JI2Q 3DDDA 2GVAA 4A93B 2NZ1D 3WR7A 4P73A 3V96A 5EBDA 2UXCQ 2VI7A 4MTKA 5IYCH 2XEFA 4PSWA 1NNXA 2MO1A 3IC1A 1TWFH 2PMZE 4A3DH 1ZG8A 3NBIA 1QSOA 3T1HL 1YGHA 5C4JH 1L1OB 5F46A 3KR4A 1SE2A 1XRYA 5J22A 1LTGD 3U9OA 1MD2D 3BDLA 4YIJA 2F0UA 3D6CA 2B5GB 4WJ3M 1XMQQ 1UUPA 3FH4A 2D4PA 3K57A 4BBRG 4A93H 5CBEE 1FNVA 3PUYA 4A38A 1HH2P 2Q2IA 2Z10A 4L6TB 1EU4A 1Y0RA 3SE0A 1Y8PB 1XYIA 4LAAA 5CV9A 3RMHA 4ALPA 4LF5Q 3OHXC 1NR4A 4UP7A 2J8NA 2KQ3A 3MXPA 5IGBA 5DWMA 1TS5A 1IXRA 2CHBD 3A5UA 1TIID 3R93A 3ERQA 4O23A 3K5OA 2ZOFA 1FVIA 4ZBGA 5LRGA 3G7LA 3BYYB 4AB7A 1EFID 5K8MA 2ZXPA 5FO8B 4OC5A 4R4TA 1II3A 4WORA 3TP5A 1IBLQ 2VZYA 1HQRD 4OIJA 3PF4A 4AG9A 2DY8A 1I4PA 1KLGD 2CKZB 3RO0A 4KUAA 1VQDA 3W3AA 4LF4Q 2K5WA 4KN7C 4JOIA 3EA6A 1HXYD 2ZEGA 3CPFA 4K6DA 1C8CA 2K5TA 4DAYA 2F0JA 4M3SA 5CV6A 1IIDA 1E3PA 1XNRL 4KV6A 2RVLA 3CXPA 5CNPA 3KHZA 3T53B 4BBHA 4DV7L 1WD0A 4C68A 2IX3A 3F8TA 3AMUA 5KTDA 4TRDA 4P44A 2ZEDA 1QVFA 3HOVB 2EYLA 4IOCA 3D7DA 3FEDA 1AW7A 4LF9L 1YI2A 1FNUA 5C3EG 4GKJQ 4OO1G 2JEWA 3EN2A 4JW0A 4KHVA 1Z9UA 3F0AA 5KGUA 3FEWX 2I5MX 2HUZA 3CCMA 1K73C 2WFWA 5GAHC 1BDOA 3K59A 2OB0A 1DYQA 1D7QA 4L5QA 4KUBA 1LTTD 4DU9A 4TWEA 2OOTA 4JI7L 3PB6X 3HEJA 3SJFA 1W3SA 2JN4A 1CI3M 1GUGA 3T4AC 1SLJA 4DNIA 2B3VA 4ME5A 3HOVH 5ELCA 2ZXOA 5EQ0A 1D8LA 5T1IA 5K8NA 4KD4A 3S2HB 3S14B 1NJIC 2R3ZA 2QDBA 5JEAH 4DV0Q 4NXNL 1ON0A 3OWCA 2HCCA 4HNWB 2B29A 1SRUA 3CDXA 5H86A 4ZY0A 1NSLA 3KF6B 3ULJA 5H1SE 2I5LX 2AJ6A 4HIDA 1A62A 4KLKA 2HIVA 1ZO0A 2NVYB 1OXUA 5J1ZA 1GKHA 4DK3C 5FO9B 3SK4A 4DV6Q 2V8VA 1CSQA 1Q90A 3M4OH 4MRIA 2E5LL 2X6LA 1LRZA 1LT6D 1VQ7A 4BA2I 1XEBA 2VUMG 5C4XB 4IPDA 3F1ZA 5CBAE 3GO5A 4X65L 3VDYA 1Y9KA 1E7ZA 4ZI6A 2P6GA 5EMIA 4Z9CB 4J8QA 3CAMA 3S2HH 2R7FA 1QSMA 3D8GA 2E2HB 1YR0A 1CBXA 3BDOA 3DHQA 3PF5A 3HOXB 3GLJA 4MTNA 1B3QA 4E0AA 3H94A 1PCAA 3PP9A 1WTHA 3EFAA 3E0EA 3D4UA 3DR8A 1I6HB 1VCIA 4KSAA 5JJIA 5IT9c 4IN3A 4QB4A 3KBGA 2JA6B 4HMIA 4AQYL 4LFAQ 5HVGA 3A0JA 5IB0A 1R4PB 1LABA 2PJ4A 2H1EA 5KEEA 5C4XH 1SBBB 2F3VA 2KCMA 5C0XG 3N52A 2VUMH 2BSWA 4IF5A 2OTJA 1DOKA 1S5ED 1CUKA 2E2HH 2CH4W 4NGTA 2N49A 4IFDH 1XMTA 1B2TA 4APVA 3HOXH 4KLVA 4E8OA 3KQXA 1I50H 4KKSA 5C5MA 2ZELA 1JJ2A 4NGPA 3CF5A 4MCRA 4DR4Q 2VL1A 3QOLA 2A1AA 4A3LG 1N32Q 1JICA 2B8GA 1HZ9A 2E2IH 2XEIA 2G0BA 1E2ZA 5DWNA 1GHJA 4MIUA 1UWVA 3UY5A 1TKJA 3MEHA 4QC6A 2Z4IA 1WTRA 1JORA 2PJ9A 2B3GA 1LTBD 4KJOA 1Q82C 2AFUA 5C0XH 1KWMA 2D0OA 1Q2CA 3K5NA 4QIWB 1TWGB 1ZLHA 2EBJA 4C56C 4H02A 3OSOA 3PMFA 2EE1A 3PIO3 4LF7Q 5ISVA 2PZUA 3SXHA 4LF8Q 3H8FA 2XN9C 4GS4A 4LUOA 3UDIA 4HIMA 4A3LH 1UE7A 3VWEA 5J8CA 1X6OA 4JI2L 5D65A 1X12A 1GM5A 3PQIA 3DEPA 1PRTF 4DK6C 3R2TA 3F2UA 1HR0Q 1FR3A 4RN7A 4A3GG 3RN2A 2IHFA 1AE3A 2KCCA 1YZ6A 1YK3A 2IL4A 2P6EA 3QB8A 3RLNA 2Q4ZA 1IHZA 3J81j 2LXJA 2PJ6A 2ICEC 5M3MG 1S40A 1PFSA 4OWWB 3VATA 5IY0A 4PZ7A 2WB1E 1STHA 4CJ2C 3T9YA 2VQFL 1BO4A 2H5MA 2ZJRA 3PB4X 4ZAIA 5CC4A 3LODA 2NN6G 4PMWA 2N88A 1IZ6A 2PJ5A 1XMQL 3S15H 4OC0A 4GN4B 2A69C 1YVCA 2F0DA 2ZOGA 1QQ9A 4NGNA 4A32A 1VF5C 1EU3A 4R76A 3K7AB 5D14A 2UUBL 4HTHA 2YNDA 3EC4A 4DR2L 2SDFA 1KAAA 4RGNA 3P2HA 2YNCC 3GYAA 4A3GH 4MFQA 1EY8A 1VMPA 3OMGA 1PU9A 4LF5L 4JI1Q 4BS9A 1D6EC 2Q44A 2R92B 1Q8IA 1YW4A 2L4NA 3B3TA 3JTKA 1WK4A 2GLJA 1Q46A 1PFNA 3TOAA 2F03A 2B4DA 2Z3LA 5AG5A 3FKIB 2M9VA 2K04A 4U673 2KOLA 3BZKA 3S1MB 3B7IA 4P4IA 1HNWQ 3K7AH 2ENBA 4JLYA 3B3WA 2B2TC 4DR5L 3S6HA 3QR8A 2BDOA 4ZK9B 1WFQA 1KDAA 3QIAA 3NENA 1I3QB 1LO5D 4GLAC 2C6GA 1AN8A 3ZJYC 4X64L 1KRTA 1HUNA 3NEMA 4AYBG 2X7BA 3L3OC 1CM0A 3OWFA 1EE3P 1CSPA 1VQ8A 4FF3A 1Y1WB 3K2KA 1TU2B 4BY7G 3QNVA 2IJ0A 3OTOQ 1VQEA 3FKIH 3D8PA 2JP1A 1SNMA 1PZID 5J3BA 1CX8A 3S1NB 3IAYA 3RZDB 2QVPA 2ID0A 1HRJA 3S1MH 3CXSA 2B2WA 4IUPA 2Q2UA 5GAGC 1F77A 3PUZA 4RCOA 4KLWA 1BUVT 2WPWA 4C3HB 4ZX8A 1YREA 2EUIA 2O4XA 3IU1A 4DV2L 2PVVA 3F2BA 4C3IG 1JWSD 2FFKB 3VH9A 4KOXA 3S2DB 1J4JA 2UXDQ 4NEXA 1KHIA 2V8HA 2WAQE 3STBC 1CKOA 1HFGA 4ORFA 1YNND 1Y1WH 3GTQB 1SXTA 2REEA 4RA8A 5HMNA 2RHQB 3J7YW 3S1QB 1QB5D 1S5BD 1I5FA 3IU2A 2CNTA 3TBIB 4OIDA 2FIWA 4QUCA 1FGBD 2PZWA 4DAPA 2DN8A 1XPRA 1STEA 2NWGA 4C3HH 1LCPA 2L5TA 4CGMA 3RD4A 1QOHA 5LMNQ 3FYNA 2PJ8A 2Y0SB 2L1BA 3S2DH 3VR5A 5IWAQ 4BY1G 4X66Q 5E4WC 2HV2A 1EYDA 2CXAA 5GAEC 1R57A 3A9LA 5M3FG 5BN3A 4DV6L 2AE6A 2H4OA 3GTQH 4XIGS 2TSSA 3KK7A 4MFPA 1O80A 2N3SA 1XNQL 1BCPF 2JK8A 3S1QH 1HZAA 4CYPA 4MHYA 5IODA 4R8FA 3D31A 1FYCA 2VZZA 4A3CG 2BE5C 2R6GA 3GTLH 3D7FA 3K58A 2ZJQA 4OGQC 1K0SA 3EY5A 3SI1A 3CCVA 5HGQA 4JCVE 1EIFA 4JK1C 2MHVA 2YU9H 2IT1A 4BY1H 1OTCA 4YY3Q 1ET6A 3I4MB 3CMEA 2GANA 1JWMD 1IBKQ 2ZXRA 3HOZG 3PRTA 3S9NA 4LFAL 2G3AA 3FB3A 5F09A 2HIXA 1V1PA 3EJIA 3P75A 4JI6L 3CD6A 4JV5L 2MO0A 2CY2A 3I4OA 3M7GA 1A3TA 4RGMA 1TS2A 1C4QA 2KHIA 2Z6KC 3HG9A 1RIPA 4DK1A 1B1ZA 5I2YA 5L37A 1ARMA 1LAMA 4U9YA 4IUNA 5G21A 2Q8RE 1XBUA 2GE3A 1H9RA 3A54A 4A3CH 2YTYA 2R7ZB 5FLXc 1EQVA 1EZ8A 3EVQA 3GQBA 3TREA 3HUVA 1Z8LA 4DR4L 4K6LA 4POGA 2UUAQ 3FRPB 1N32L 4KHPL 2J9AA 3I4NB 2A6HC 4NDXA 4OWXB 2DUDA 5CR3A 3TP8A 2EPBA 1U6MA 5A27A 1YW6A 2VZAA 1KL9A 2PO4A 4JI5L 3I70A 5AG4A 2FIAA 1AYEA 4P72A 1EQQA 1Z4EA 3D6WA 1EY9A 2PW5A 3PGPA 5IV0A 1TY2A 4JJXA 3T1HQ 1U0LA 4HSPA 2PIZA 1DZ1A 2R7ZH 4HNYB 1A2TA 2I00A 3S24A 3PB8X 1S5CD 3BI1A 5KTAA 1YNJD 4ABNA 1P16A 2DNCA 3F8KA 1YBYA 3QAHA 5DM63 3I4NH 1RTNA 1OXSC 4UF4A 2ASBA 3H91A 4A3IB 1MJBA 1LTSD 2Z1CA 1BQQT 1HR0L 4FF1A 2Q4YA 3LD2A 1NMGA 3LGJA 5IE8A 4WWVA 2R7DA 1DD2A 3UE0A 1DTDA 3R3OA 1TKFA 3ISZA 3NTKA 3LX0A 5A28A 2OTLA 1SNDA 5C3WA 2O5IC 1FNWA 2VXWA 4C7HA 1A63A 2FS5A 1LV9A 3TP6A 3UI2A 4JYAL 3NE5B 2BUEA 4DF7A 3H3VI 1GD7A 1Y8NB 3FMCA 4FF2A 3M4PA 3GTOH 1SMYC 4CHTB 1EQRA 2XNAC 2HCIA 4XQNA 1M1DA 4A3IH 1X3FA 1GXDC 3M3YB 4O0AA 1J6QA 1JMCA 1TWAB 4GS3A 4LUZA 1VQHA 3PIOA 1QCBD 3VWDA 5IB9A 2KVMA 5ELDA 4HSVA 1NBWA 4ZKBB 1WD1A 3KL9A 1CZGA 5CV8A 5C44B 4HR7B 1J5EL 3ITPA 8CPAA 4R3LA 4YWLA 1B9NA 1F9SA 3J80i 1XNRQ 1JQYD 1AZPA 1BF4A 1RD9D 4KOSA 3FEEA 2NB0A 5E1FA 4DV7Q 2EIFA 1TQOA 3FDTA 2PZTA 1WVLA 4LF9Q 4C2XA 1IYJB 1HNWL 3OIQA 4PPZA 2UUCQ 2WKCA 4DFAA 1RL2A 3M3YH 4NF1A 1IW7C 3M4QA 5GQOA 4G7HC 2ZW7A 5KYIA 2N55A 2K50A 4DR3L 4ZY2A 4YGOA 4IQZA 4W9YA 3SI2A 5C3XA 2IPKD 3U9SA 3OOCA 2RFHA 1JQGA 1EYGA 2AQ2B 4MHNA 4CYOA 2IY5B 5FJ8G 3W6SA 4A3KG 4A30A 4C2MH 4P2CB 1OXTA 1QNKA 3S17B 5EKLA 1SAPA 1MJCA 4X3UA 2SNMA 5HVHA 1WTVA 4XQJA 1F9RA 2D62A 5FK9C 4JG2A 4JD6A 2WSAA 3FVQA 1K83H 2Z3PA 1L2FA 1O7ZA 1UFHA 2KEEA 3L2NA 2L15A 1G6PA 1LANA 3GTGB 3D0FA 2M00A 4NXNQ 3TO6A 3TT2A 1GUNA 4R4QA 2AUJD 3PIPA 1Y0YA 1UWYA 2Q8TA 2F0GA 4K8IA 2R98A 4K2LA 4OHJA 4G1PA 2D5DA 3H15A 1CPXA 2ZENA 1I1DA 1R3NA 3OYYA 5FJ8H 5BN5A 4QGUA 4KVXA 3RLOA 4BMHA 3KF8A 4CKEA 2K5NA 5IOCA 4FD4A 1VQJA 2AQ3B 4X65Q 1F2ZA 2K4KA 2KCTA 2L11A 1YHAA 4KTAA 4KY6A 2EVBA 1NUCA 3HOYG 2UXBQ 4QJFA 5E3FA 3KUPA 3T51B 5LMNL 3VR6A 4GLVB 1RODA 1YJNA 2Q04A 1Z4RA 3WC7A 4AVCA 2VL6A 1VS0A 2F0LA 4GOPC 2E76C 5EBVA 4B5OA 2QA4A 4AQYQ 1PFBA 4DYOA 2EJMA 1M1KC 1XOVA 5ELFA 1PLFA 2EQSA 3ICEA 2K7VA 1Y7EA 5I4DA 3BXMA 1PRTB 3WOEA 3DLLA 3RAMA 3TC8A 3JUWA 4CGOA 1NSAA 4JYWA 1BOSA 5JOBA 1X9NA 3KDFA 2CQAA 3AB9A 3HOYH 4K2KA 1ASZA 1Z2LA 1SFOB 2E74C 4R4OA 2NMTA 4KOVA 5BWAB 3J80E 1VMCA 3OPOA 1HCZA 5LYIA 4U9ZA 1RTOA 2BH8A 4MCSA 3H0GG 3D7GA 4FP5D 2NSMA 4DR6Q 3RLFA 3GV6A 1B44D 5HH1A 1JT8A 4A37A 1KQSA 2ZTDA 5C4HA 3E0KA 2VB2X 5BN4A 4A3DG 4H2KA 1UE1A 4B9WA 2NTTA 1BVSA 4DV4L 3NE8A 5D3DA 4LUVA 3D68A 4JC0A 1VQGA 3TCVA 3HKSA 4MNOA 2JEVA 2MP1A 2KCNA 3K81C 3HKZB 3H4QA 1A3UA 2A74C 2UUAL 2PJAA 2NYQA 1LFWA 2A5HA 1JR0D 5CV7A 2OH1A 5JH9A 1GHEA 5CV5A 2Q2TA 3JVNA 2DEAA 2B2YC 4HAEA 4A93G 1JB3A 4MZ9A 2FINB 3H0GH 2ZJPA 3L2PA 4QB9A 1RHPA 3BS1A 2PJ7A 3SXOA 1KNEA 4MI4A 4NGMA 5LRJA 4QBJA 4R4IA 4K8JA 1MKHA 2R7HA 1F2PA 3SR1A 4QIWE 4DV5L 4LJZC 1RO5A 2EYHA 3AFQA 4LWCA 3J80L 3V38A 3BI0A 2I07B 2EK8A 4DK0A 2LY7A 5EJWA 2VQFQ 1K0RA 1PFMA 4B3MQ 3W5OA 4LX9A 2FSRA 1MJAA 1RTQA 3H8GA 2GVBA 1OBRA 5G3LD 3GIUA 2OEOA 2VEZA 3WC5A 2PQAA 3K0XA 3KASA 3IWEA 3PSIA 2K01A 2UUBQ 2YNCA 2QF7A 4DR2Q 1M4IA 1YNXA 4BA1I 4K5WA 3I9SA 4B3SL 4DV3L 2F4VL 1PYBA 1IL8A 4U5YA 5CMDA 1GYTA 1IICA 4PQAA 3IIBA 2OCEA 3A74A 2JJQA 3KF8B 1H8LA 5ELYA 2PNHA 1VQ6A 4AVBA 2SNSA 1JJGA 1I4GA 3CZXA 1MIUA 4IHMA 3RZAA 1Z5RA 2O2LD 4AG7A 4MY3A 4DUYQ 3WABA 1PTOC 2F4IA 3KJPA 3EO4A 1BKBA 3IKJA 4A3BG 3IRBA 3NBHA 5ELOA 2B2TA 3TDQA 4A3BB 3NH5A 1PRTD 3CPWA 3NK9A 4GXHA 4UP8A 2I0QA 4DR5Q 4FNFA 1YEZA 4CS0B 3KLSX 1KXLA 3I56A 4BBSB 1TR5A 5LMUL 1M90C 4MFLA 2K1BA 1XIXA 4LMQD 4X64Q 2E75C 2K05A 4X5KA 1YLOA 3NTHA 1Z8TA 2EDGA 3KOJA 4XQQA 4DV1Q 3E9HA 4KK7A 4KVME 3ISXA 3MXNA 2PR8A 3HOVG 4F9VA 1GVPA 1X55A 3TEHB 2WPXA 3KDFB 1Q81C 5JEAG 2UUCL 4A3BH 4XPDB 2MNAA 1J8IA 3RN5A 4UIBA 1IYVA 1BCPB 1PZKD 4ZKCB 3C1FA 4UCPA 4R87A 3EROA 4Q5VA 2CF4A 4DV2Q 1HZCA 1KIXA 1NR2A 2C5CA 4A3FB 2CFMA 3TSSA 1LAPA 1F2MA 2UU9L 3E3XA 4AYBE 1U4RA 2Q4VA 4OC2A 2GLFA 3C1EA 4YWKA 1N34Q 3UDXA 4DR1L 1HQMC 2JEBI 3MFGA 5LL6S 3EQLC 4EX5A 2OU2A 4F0XA 1DOLA 1QNUA 4BWGB 3PB7X 4CJ1B 2BH2A 3W1BA 1BR9A 3CCLA 4OO1I 3ONAB 1JOKA 1D1KA 3MWYW 4IJHA 4LUAA 2HB6A 1ENAA 2XWBB 3BZCA 4A3FH 4GZYC 4PMCA 5DEHA 2RC4A 4MFZA 1GOZA 4ZX9A 3SHPA 2JYOA 3I91A 2EY1A 3CT9A 4JI8L 3TRZA 2ZM6Q 2R8VA 4CYNA 1VQAA 4JI3L 2ZEHA 5EPLA 5C4XG 1L1OC 3M85A 2RF4A 1HNXL 1XNQQ 1HFNA 1JB7A 1PH3A 2F0VA 4KD3A 1LTRD 3S14H 2YTVA 3I2ZA 4IFDG 2FMCA 2IX1A 3HOXG 2UXBL 2DJFC 4R8IA 4UBRA 1HHVA 2Q7BA 1I4XA 1VQNA 5CGKA 3RR5A 1DM0B 2ATWA 1EFWA 4KOWA 1IL2A 5M5YB 5LYDA 2NVYH 4XT3B 2PQAB 2JA6G 3VYSA 1ESRA 5M9OA 1B53A 2AQ1B 2B63B 4LFBQ 2EXZA 2CH4A 1RDPD 4OKOA 3FF3A 4C2ZA 3B3SA 2Z6KA 1TWHB 4JI6Q 4IUVA 4JV5Q 5F48A 1Q1EA 4OX9L 3W2DA 2ALYB 4FD6A 3V7ZA 3SVMA 5K8OA 3D2PA 2IMOA 3GTPB 1IB1E 4HKFA 2K5DA 1ASYA 1AFPA 2F3IA 3BVZA 2MJ8A 4XYOA 3VYUA 2JA8B 3MXGA 4DUZQ 1HA6A 1X3QA 2IW3A 3DWPA 2DF5A 3NBHB 5JAVA 2G5DA 2EJFC 1I6HH 3GDEA 5I9OA 1VQIA 4KHPQ 3A7AB 4FXKC 2H5XA 2HQLA 3FP9A 5AFWA 5G3LF 5HURA 5IIFA 2JA6H 5J1QA 5GADC 2B63H 4HJ7A 2Z3OA 1HA5A 1TS3A 4DR6L 4P4EA 1MJEA 4BD9A 4LK1C 3N6RA 2PI2E 2AWNA 4JI5Q 2XEGA 2ZPAA 1BCPD 4RI1A 1MHWC 4FD7A 5JGFA 4DAYB 4M1UB 4DA2A 1NE3A 4PV1C 5LRKA 1I94L 3SGIA 2AFZA 2ANPA 2IX0A 4ODGA 5IYDG 5JVG3 3GTPH 4GM5A 5FVJA 1A15A 1O7LA 4KOUA 3ER0A 2JA8H 3M9BA 4G7ZC 2L55A 2RDHA 1WWZA 3AYHB 3VA7A 5LL6X 1B70B 1QMUA 1Z6HA 3BZDB 4AH6A 1WTOA 4HNXB 4MHZA 4GNXA 4YHHL 4UWJA 3I8ZA 2B2UC 3S6GA 3RBUA 4FBEA 3JAMi 4IPHA 5IGDA 2L12A 4PQXA 3SDZA 2E2JB 1TWGH 1XMOQ 4PXEA 1Z9FA 4F0YA 4A3MB 1LT5D 4FO2A 1IU8A 5IYDH 1M4LA 2ES2A 4QQBX 4JYAQ 2CVRA 2CW0C 4B3ML 1B87A 3KYHC 1IBML 3DGVA 1ENFA 2JA9A 3W1GA 1I4HA 1QVCA 3G4SA 4CYQA 2FE7A 2K75A 4CAEA 2AFWA 4V0BA 4KZTA 3TX8A 4QUFA 4BINA 4L63B 2JDDA 3ZJ0A 1SYFA 1WJJA 2LKVA 3J81i 2FHTA 3S1RB 5K36H 5CBMA 2NVQB 2R92G 2Z0ZA 2KBNA 1J5EQ 4JI4Q 1B3AA 1SR3A 3NELA 3FKIG 4F9UA 3VA5A 2F0NA 1VQBA 3NH8A 3R1KA 3QO2A 1KUXA 1STNA 1S3ZA 1H9SA 5G22A 2NN6I 4DUYL 2Q51A 4KKTA 4JZ0A 3LNNA 1BBXC 3A8IE 1DJRD 3BVMA 1KUVA 2HD3A 3CCEA 3LACA 1EOTA 4B3TQ 1LOKA 2JA7B 2JBKA 4AVAA 4X2TA 2XIWA 4DR3Q 2NVQH 1X65A 4I7AA 1KUYA 1G6ZA 1NCVA 4NJQA 3CMAA 1Y1WG 3Q8DA 4UDUC 5F2DA 2R92H 4FYDA 1JWQA 4DV1L 1STAA 2PW7A 4R8NA 5D8NA 2HDLA 2BEIA 4TKOB 3HRZC 2G9DA 1ZKOA 4RMFA 3AEVA 1XX8A 2PYKA 1MJ9A 4C3HG 1Q2YA 1H9MA 1EIHA 1U5KA 3PFEA 3S9MA 2QEJC 4JBJA 2LFNA 2JA7H 2Z9HA 2F0HA 1Q12A 3MVVA 1DE4C 2OZUA 1I3QH 1CG2A 2L0CA 4RKLA 4XNHB 1CT1D 2O5JC 1TVXA 2WV6D 5AJ3L 2XRSD 5DLQE 3CC4A 4IJLA 1G51A 2GU2A 4LQ6A 3CCSA 2BA1A 1S72A 1N34L 2EJGC 4H89A 1K3RA 3GY9A 4P4FA 2A68C 3EIVA 5KNBA 4JBKA 2K32A 2V8GA 4LNQA 2D9UA 5I4MA 1VQFA 3S1NH 3RZDH 1BBUA 3NWTA 1XTDA 3STBD 2B2VA 3JAME 3VYRA 1TXYA 1K9MC 4B14A 2B39A 4G57A 4MBUA 3QJYA 2Y0SG 1ZG7A 1XE4A 1Z47A 1STGA 2PJ2A 2EK9A 1M4DA 1A3VA 3TMEA 1FJGQ 1XPUA 4DR7L 4GOPA 4YRHA 4RHRA 4J3GA 4DNRB 2ZM6L 2O28A 4KSFA 1F9QA 1KAWA 1SDFA 5NUCA 3G3SA 4UFWA 3M7NA 5E96A 4KI0A 2VS1A 2FVGA 1UE5A 1LYLA 4WJBA 2G9HD 1SROA 3E6ZX 4RCNA 3J81E 2J8RA 2CQOA 1Q3LA 3BJUA 4C3JB 1YQEA 4UFVA 3PEIA 4CAXA 4NGQA 1TS4A 1P4NA 3PB9X 2PR1A 4ZYSA 1Y1VB 3QB3A 1SYCA 3L7ZC 5COYA 4HJ9A 3I4MG 2ZEFA 6CPAA 3FBUA 1I12A 4CAVA 2MGSA 2F3WA 1Q7LA 2C6CA 2QMLA 2BE5D 4CRYB 2A19A 2K33A 4LFBL 3FXTA 3NQTA 1H9JA 1PH8A 1AUGA 2PRQA 3DMUA 2SOBA 4HCSA 1EL0A 4B11A 1SEBD 3HOUB 2D4OA 1TWCB 3IWWA 5IX3A 4DV4Q 2P5ZX 1N71A 2HT1A 4R6TA 3H09A 1WTXA 5EPJA 2R7ZG 2A8VA 4TNUA 2B4DB 3D4WA 1H9SB 2ZW6A 1A2UA 3MC0B 3SK8A 4DUZL 4WRDA 5E7NA 4L5SA 4KVOE 4A95A 3OIPA 4EQOA 2B2YA 3I4NG 4MMOA 1FD7D 1Q8KA 1SNQA 3I4MH 2DPTA 7CPAA 4WJWA 1QSTA 3TP7A 2RA4A 3J81L 2X6GA 1HZBA 4QF4A 1QE6A 4V190 3TO9A 3NWSA 2R93B 5D29A 1TWCH 4EQPA 1TF9A 3NSWA 5T1GA 2A6HD 3P1HA 4DV5Q 4HPSA 2HHHL 1Y14B 4MHPA 3K5LA 4A3JB 3J7AF 4LQGA 3R9FA 4B3RL 2F8HA 2DNEA 4K14A 5KNDA 4PXCA 4XXEA 3TO7A 4K3NA 4UHVA 4Y49B 5ELBA 1VF7A 1PYTB 3NA6A 5J8FA 3B2YA 5JQ4A 1EY7A 3UE1A 4P74A 4A3IG 1K8GA 1M4GA 4GKKL 3SJEA 4R3KA 4O42A 4EVYA 5J39A 4QVTA 1X3GA 1CP6A 3C26A 4ZLTF 1HDQA 1A8VA 2N8NA 2YNEA 4B3SQ 3URYA 4DV3Q 2F4VQ 1Y9WA 2XSCA 1XMOL 1VQCA 2NVTB 2WB1B 1QZGA 5M5WB 4HJAA 3DUZA 1ARLA 3HFZB 3AQQA 1YVOA 1Q7YC 3KZWA 5ELNA 3PUXA 4CDEC 1PHJA 3MTSA 4L89A 1A0IA 3SHLA 4EFDA 1D2BA 1O78A 3KBXA 5KNCA 1QUQA 3FPUB 3TN2A 3J7A5 1ONLA 3OMCA 4ONWA 3R96A 4XYQA 3D3SA 1M4VA 4CJ0B 1PDQA 3IFDA 4DUKA 1S7LA 4OC4A 5JVH3 3H6MA 5EKKA 4RG1A 4XTCS 4PV6A 4NB3A 3QOJA 3BYTB 1I4RA 4U68A 5LMUQ 5C44G 1K8OA 1IGBA 3TTHA 4Q36A 2NVTH 4KOYA 4A94A 2FXFA 4RHSA 4NW2A 4UEFA 4JI4L 4EGVA 1N33L 4PSXA 2PQEA 2IL8A 1S5DD 1V1QA 1WOCA 3H3VH 1SNPA 2QEXA 1ICWA 1K3BC 1O7YA 4LF6L 3GTMB 1RKNA 3PO3B 1R43A 1ZYRC 4CGPA 2O53A 2QJ8A 3K0YA 2V77A 2I46A 4X3TA 4B3TL 1VQ9A 4IOAA 4OP4A 1TWAH 2VW9A 2FMMA 2A6EC 2B58A 2KHSA 1LLRD 4CDFC 5E4XA 4EQNA 2UU9Q 5C44H 2CNSA 4NXYA 3GD7A 4RFBA 1YX0A 1V1PB 4UEZA 2KENA 4X3SA 1IW7D 4YCUA 1M44A 4FDBA 2CWPA 4DR1Q 4PXBA 3GTMH 1F2OA 3NP8A 1HTLD 2NBFA 3IL8A 4IPCA 2F0QA 2J8MA 4B12A 4OIWA 1I21A 4UIAA 3N7ZA 1CKNA 4XT1B 5LYLA 2RHSB 2PQ8A 4P4DA 4A76A 1JC7A 4HEDA 4TSSA 2WAQB 1DONA 1R9TB 4L5RC 1CK1A 1NE9A 3NXWA 5H84A 4O1NA 3G6EA 3HOWB 2K03A 4JI8Q 4M8AA 3GTJB 3HLPA 2RCNA 4JI3Q 1I6VC 3S17H 1SYGA 3PO2B 3U4VA 4FXGC 4A4IA 1HNXQ 4UY8C 3BDCA 3CU7A 2F1MA 1BLLE 4NKLA 2B5GA 3IFTA 4ZUJA 1C7YA 1L0WA 2AFSA 4OIKA 2Q43A 4Y49C 1S7FA 1WTPA 3I73A 1H9KA 3GTGH 2F0MA 4X62L 4NP5A 1PUAA 5BR8L 3L9AX 3G71A 1B7YB 2WACA 2V1CC 1FJGL 2Q7SA 4NGRA 1DXMA 3I3CA 2ODFA 2K28A 4K5VA 4CGLA 1KTKA 1T5XD 2CNMA 4ZUIA 1WI5A 3Q6SA 3GTJH 2ZEOA 1D5MC 1BNZA 1X10A 4JBWA 2RKSA 4A3EB 3H3VC 3R95A 1WCMB 1XFOA 4OX9Q 2ZTCA 3NUCA 3WDNA 1MSHA 4FD5A 3ND9A 1X56A 3P2FA 2OQKA 2DY7A 1EWCA 3BG3A 1HPCA 2BO9A 2JA5G 4N8X1 1T9HA 2F0FA 4M6IA 2KHJA 5C88A 2JA5B 5FO7B 3J80c 4GLXA 2KECA 4PZ6A 1VIXA 1CPSA 4S3SA 4Q0FA 2PJ0A 1XTCD 1E0BA 1SMXA 1WYDA 3T8WA 5C6AA 3VARA 4EVOA 4NXML 3GKRA 3Q22A 1FGUA 4C1NI 3W91A 4TVAB 5HXDA 1TY0A 2CTCA 1CHQD 4YCWA 1XJVA 1BAVA 2SEBD 2XGTA 1K4JA 3F2DA 2DGYA 1I94Q 4LFCL 4AIMA 1E2VA 1WTWA 5IP9G 2KA7A 1CJWA 1CQFA 3HKZG 4ZQ3A 2GN5A 4RS2A 1KLUD 5IYBH 1ICFB 1SFOH 3D2MA 2IQ6A 2JE6I 3J7AV 3CCRA 1G291 3ERSX 3MHBA 2JA5H 3GUXA 1VDZA 2GA4B 2QCPX 3DM1A 2Q0YA 4MCPA 3I1UA 2B2UA 1PVOA 4IUTA 2PJ3A 4CDCC 4B9XA 3IGRA 1CA5A 4YHHQ 3FIXA 1VHSA 3FPPA 3D67A 3ZZIA 1I4QA 2ZEPA 3BJ8A 3QAYA 4QUSA 2PNRC 1Q86C 2K5VA 3NTIA 4CAFA 5GCNA 4XDXA 3D7HA 4UCMA 4X8IA 4OXPA 1IOIA 5IP9H 3JC66 4XPKA 1CFMA 3KF6A 2Z11A 3K6OA 2RB7A 4PXDA 1IY7A 1IBMQ 1VGYA 5KTCA 3E5SA 3I7FA 1EY6A 2AUKA 1G2TA 1CKNB 1QZHA 1D5ZC 2D0PA 2JXMB 1S60A 2QKIC 4KSIA 4Q7AA 1U4PA 2Z3KA 2RQXA 2K14A 5IGGA 2Z8LA 2DPSA 1AE2A 2REFA 1NSNS 1NY4A 1LT3D 2NYZD 3ND8A 2QECA 3D4RA 4CDDC 3BLNA 4FWUA 4IUSA 4FUUA 2ABZA 5JJLA 1RF2D 1PMRA 1G2SA 3TS0A 4MCQA 1XWEA 2EO8A 2X69A 5C82A 1YVKA 2CCZA 2F7VA 2OXPA 2E8GA 4BXXG 1S4ZA 3RZOB 1BO0A 2R1IA 4JBMA 4JXQA 4BBRB 4I49A 4PK3A 4UAIA 4PMBA 4BBSG 4DN4M 1K8MA 3KLWA 3OWEB 3FJUA 1PTOD 1EOVA 2HC9A 2EYJA 3CC7A 1TXRA 2PC1A 1VQ4A 5TSSA 3T1YQ 1PRTC 4CGYB 3C46A 3A8JE 3H8EA 4F8MA 1BOBA 1K28A 2YTXA 5CV4A 4IPGA 1JJCB 4CAWA 1U4MA 5ELEA 4J6HA 3RZOH 4BXXH 2Q8IB 2RDGA 4BBRH 3LWEA 1QSRA 3WWVA 3WOFA 3MGDA 4A3FG 4I7ZC 3DLJA 4BBSH 3U4ZA 1TF8A 1JOQA 1EYAA 4ZRZA 1JOOA 5AJ3Q 4DAMA 3U58A 1YJ9A 1FT7A 2QDLA 5M5XB 3G48A 3X3MA 2Q2HA 2F0KA 1GUWA
chains in the Genus database with same CATH topology
3KLRA 4KHZA 3PV0A 1UAPA 1R4QB 5THWA 5C3EB 1YMEA 2AFXA 2PVWA 2F0OA 1VHEA 2AFOA 3P7JA 4PNYA 3M4OB 1SNOA 1MGSA 2YYZA 4DXGA 1JCKB 2EYMA 1HTPA 5D3IB 1OXVA 4WFN3 1D1IA 4OO1H 4MXUA 3MZ5A 1HDUA 4OMEA 4X3RA 4KY7A 2EY5A 3SJXA 1IKMA 2EWBA 1PXUA 4RGTA 1W6KA 3NQIA 1SE4A 1EEFD 5JJZA 3S9WA 1HEEA 4E6IA 3Q23A 5HGTA 4P45A 2WZNA 2VUMB 2F0TA 3B3VA 4N9PA 1UEAB 3TZUA 4NFRA 3MN8A 4IFDI 3HGBA 1I50B 5CORA 2F0WA 5IT9E 1V8QA 3AU7A 5EGTA 3A55A 3VR3A 4DNTB 2E2IB 2KUMA 4OL7A 5C5LA 2QYVA 3C2PA 2B8FA 3M4YA 2A73B 2NUCA 4HCEA 4P10A 4F87A 5C0XI 4YU9A 1SNCA 1CQVA 1DCZA 3TZDA 2L9HA 5C4ZA 1DOMA 3D3RA 3Q0AA 1BCPC 2IWHA 2VNUD 1MI2A 1QG7A 3V2TA 4DXFA 5K36G 5DS0A 3V05A 2PMZB 1PTOF 2ZEEA 4ZYQA 5IT9L 3WT4A 5IGCA 3KR5A 5KYLA 1AEXA 3SEBA 3S15B 4QCLA 2E2DC 2RDFA 1EY0A 3MRUA 1BPMA 1AZQA 3KQZA 3MAQA 4OC3A 2CW0D 1ILQA 4A3GB 1EY4A 3DWAA 3KLSA 2A69D 4OC1A 3IO1A 5M3MB 3O13A 4L8JA 1W6JA 3SK5A 2GREA 3BHXA 2XWJB 1MBYA 2RSOA 3D4DA 1D5XC 4ID6A 2PIYA 1KDCA 3PBEA 1C48A 2EYPA 3N5FA 1QWYA 2HUGA 4FF4A 3CKIB 3PUVA 1F2YA 3A7LA 3ZYYX 5I9PA 3PIP3 1SE3A 4ULLA 2PJBA 4F8ZA 1VHOA 3JRUA 1G8ZD 3Q24A 2OR4A 5EKIA 2NN6H 4F88A 1GUOA 2XEJA 4CPAA 5FKAC 1Y8OB 4MN3A 1EYCA 3KHXA 2F0EA 1JE4A 3I90A 4H7BA 5DM73 5EPKA 4G7OC 2IJZA 4RH6A 3T16A 1CM9A 1RCVD 5DNFA 3MA2B 4RAUC 4AYBB 3GTKB 5DAUA 1BXTA 3CRKC 4C1NK 1Q1BA 4BY7B 2AFMA 3R2IA 2R61A 4RGOS 1E2WA 1ZEQX 4KJNA 4IALA 1F2LA 1S5FD 4H13C 4P4JA 1YNNC 4UEEA 5HVFA 1ZXTA 2A68D 3K5MA 3LMSA 4C3IB 2LS01 2BOAA 3DWQA 3WC6A 4DJLA 1TT2A 1GUSA 1MSGA 2RBMA 3VR2A 1ZG9A 4IK2A 3RUZA 4C3JG 1OXXK 3GTLB 1RJTA 3OW7A 1GUTA 2HDMA 1CP7A 3SI0A 3GV3A 1PYWD 3HP3A 4FAIA 3CHBD 1KNAA 2K5QA 1BPNA 3I72A 2YU9B 3A56A 3CRLC 3QG1A 1F57A 1F9PA 4BY1B 4KY5A 5M3FB 2PJCA 3CPAA 1YSJA 3LWUA 1TKHA 3JAML 1EEID 1NAPA 1LT4D 5KIXA 2XVSA 2F0SA 1QJOA 3G6JB 3HS0C 2EY6A 2V8DA 3IJ3A 1U4LA 1QILA 2VB3X 4RKBA 4B08A 4KMUC 3HOZB 3C3LA 4EMEA 1GHKA 4FXDA 2PJ1A 1EY5A 1L0YB 3B35A 2EOTA 2ZT9C 5I6YA 4ILWA 2CIJA 3EFXD 5FLXE 1M8AA 1SJHD 2EYOA 1G91A 5CPAA 4NMZA 1V1OA 4F7XA 1OO9B 1B4OA 1SSOA 3X3NA 5K5PA 1L0XB 2OF1A 2C9OA 3KI9A 1YNJC 3A8KE 2J0TD 1UNSA 4H0LC 2K6AA 2AWOA 2I3CA 1CA6A 1IYUA 2WIIB 1XJOA 4KN4C 3K9TA 2J7ZA 3GTOB 3P20A 2POKA 4NJRA 3HZXA 2KJXA 1STYA 4IAVA 4IUQA 1CZWA 4MHEA 5A2QE 2JSOA 1ET9A 2MPMA 5FLXL 5A35A 1KDBA 1SMYD 5K8PA 4R9WA 1HUMA 2EYFA 2CTBA 5JEAJ 3QWNA 1SJED 3S9LA 1SYBA 1CTMA 4B6ZA 3KGQA 4RUHA 4P6YA 2PE3A 1B9MA 2WYRA 1IKLA 4HMJA 1X32A 3VYTA 5IGEA 3T13A 1EWHA 4EWTA 5FOBB 4G4KA 1ESFA 1ZYRD 1GJXA 4C2MB 5LHY1 2BOSA 1X3PA 2MUYA 4NGSA 2NVXB 3R8BA 1ELMP 2A6ED 5A2QL 1K83B 1J9OA 3PBBA 1EQTA 3MFYA 3PFOA 2FJ2A 2KEDA 1AMPA 1SYDA 2JBJA 3DXJC 5JM6A 1ZLIA 2OT2A 4IFDJ 2LMCB 3S16B 4A3KB 5IGFA 4IZ8A 1XMBA 3D66A 1PZJD 3SK6A 3FECA 4IUUA 4X3KA 1ML0D 3NHHA 2F0PA 2C6PA 2ICIA 2HQEA 2B2WC 2EY2A 4J1MA 1FNOA 3CPXA 2F0IA 4YWYA 5C0XJ 3IEHA 2C1CA 3SJGA 2J4XA 4HN7A 1ELLP 5ISRA 4A39A 3PUWA 4K5XA 1B50A 1V43A 3MXUA 1A6XA 2EZVA 1TKWB 2PCFB 2B2VC 4CBVA 2D2CC 3CQZB 1JWUD 3HOYB 3E0JA 4Z65A 2M2LA 4CKBA 4R7MA 1PTOB 2O4HA 3BVGA 1WTQA 5KRUA 1T5EA 2BA0A 5EBCA 4TQUS 4QMGA 1CHPD 2BDNA 2QILA 3FX6A 4AXVA 1ENCA 1EZ6A 3IFEA 5JPNC 2XRQD 4H44C 1LTID 1AP0A 4ZY1A 5I2XA 3NPPA 2BCOA 1U9RA 1Z7TA 4N9TA 2PPBC 4Y7NB 3VR4A 1PTOH 3B3CA 4RWSC 5JPMC 1STBA 4KKUA 1SYEA 1LACA 2PCUA 3T56B 2NTSA 2JEAI 2WP8J 2TMPA 3GB0A 3H0GB 2Z4HA 1LTAD 2V4DA 5CYUA 4DGZA 1Y69U 4IURA 2WINB 3FVLA 1EIGA 5LYFA 1TWFB 4A3DB 3I4LA 4DAVA 5C4JB 4FVMA 1XXGA 3DEOA 5I6WA 2ZEMA 2WKDA 4CKCA 4I65A 3NFZA 3GP7A 4P4BA 2RSNA 1KABA 1ILPA 4A93B 2NZ1D 3V96A 5EBDA 2XEFA 3IC1A 1ZG8A 3NBIA 3KR4A 1SE2A 1XRYA 5J22A 1LTGD 3U9OA 1MD2D 3BDLA 4YIJA 2F0UA 3D6CA 1UUPA 3FH4A 3K57A 5CBEE 1FNVA 3PUYA 4A38A 4L6TB 1EU4A 1Y0RA 3SE0A 1Y8PB 1XYIA 4LAAA 5CV9A 3RMHA 3OHXC 1NR4A 2KQ3A 3MXPA 5IGBA 1TS5A 2CHBD 1TIID 3R93A 3ERQA 4O23A 3K5OA 2ZOFA 5LRGA 3G7LA 3BYYB 1EFID 5K8MA 2ZXPA 5FO8B 4OC5A 1II3A 4WORA 3TP5A 1HQRD 4OIJA 2DY8A 1I4PA 1KLGD 3W3AA 2K5WA 4KN7C 3EA6A 1HXYD 2ZEGA 4K6DA 1C8CA 4DAYA 2F0JA 5CV6A 4KV6A 2RVLA 3KHZA 3T53B 1WD0A 2IX3A 3AMUA 4TRDA 4P44A 2ZEDA 3HOVB 3D7DA 2EYLA 3FEDA 1AW7A 1FNUA 4OO1G 2JEWA 4KHVA 5KGUA 3FEWX 3K59A 1BDOA 1DYQA 1LTTD 4DU9A 4TWEA 2OOTA 3PB6X 3HEJA 3SJFA 1CI3M 1GUGA 3T4AC 4ME5A 5ELCA 2ZXOA 5EQ0A 5T1IA 5K8NA 4KD4A 3S2HB 3S14B 2R3ZA 2QDBA 5JEAH 2HCCA 3CDXA 4ZY0A 2NVYB 1OXUA 5J1ZA 5FO9B 3SK4A 2V8VA 1Q90A 4MRIA 2X6LA 1LT6D 4BA2I 5C4XB 5CBAE 3GO5A 4ZI6A 4Z9CB 4J8QA 3D8GA 2E2HB 1CBXA 3BDOA 3DHQA 3HOXB 3GLJA 3H94A 1PCAA 3D4UA 1I6HB 1VCIA 4IN3A 4QB4A 3KBGA 2JA6B 4HMIA 5HVGA 1R4PB 1LABA 2PJ4A 2H1EA 5KEEA 1SBBB 2F3VA 5C0XG 3N52A 1DOKA 1S5ED 4NGTA 4IFDH 1B2TA 3KQXA 4KKSA 5C5MA 2ZELA 4NGPA 4MCRA 2VL1A 3QOLA 1JICA 2B8GA 2XEIA 1E2ZA 1GHJA 4MIUA 1TKJA 3MEHA 2Z4IA 1WTRA 1JORA 2PJ9A 4KJOA 1LTBD 2AFUA 5C0XH 1KWMA 3K5NA 4QIWB 1TWGB 1ZLHA 4C56C 3OSOA 3PMFA 2EE1A 3PIO3 2PZUA 3SXHA 3H8FA 2XN9C 5D65A 3DEPA 1PRTF 3R2TA 3F2UA 1FR3A 2KCCA 2Q4ZA 1IHZA 2PJ6A 2ICEC 3VATA 1STHA 4CJ2C 3PB4X 4ZAIA 5CC4A 2NN6G 4PMWA 2N88A 2PJ5A 4OC0A 2A69C 2F0DA 2ZOGA 4NGNA 1QQ9A 1VF5C 1EU3A 4R76A 3K7AB 5D14A 4HTHA 2SDFA 1KAAA 4RGNA 1EY8A 1VMPA 3OMGA 4BS9A 1D6EC 2R92B 1Q8IA 1YW4A 2L4NA 3B3TA 2GLJA 1PFNA 2F03A 3FKIB 2M9VA 2K04A 4U673 2KOLA 3S1MB 3B7IA 4P4IA 2ENBA 3B3WA 2B2TC 2BDOA 4ZK9B 1KDAA 3QIAA 1I3QB 1LO5D 2C6GA 1AN8A 1HUNA 3L3OC 3OWFA 1EE3P 4FF3A 1Y1WB 3K2KA 1TU2B 3QNVA 2IJ0A 2JP1A 1SNMA 1PZID 1CX8A 3S1NB 3IAYA 3RZDB 2QVPA 2ID0A 1HRJA 2B2WA 4IUPA 1F77A 3PUZA 4RCOA 1BUVT 4C3HB 4ZX8A 2O4XA 2PVVA 4C3IG 1JWSD 2FFKB 3VH9A 3S2DB 2V8HA 1HFGA 1YNND 3GTQB 1SXTA 4RA8A 3J7YW 3S1QB 1QB5D 1S5BD 4OIDA 3TBIB 4QUCA 1FGBD 2PZWA 4DAPA 2DN8A 1STEA 2NWGA 1LCPA 2L5TA 3RD4A 1QOHA 2PJ8A 2Y0SB 2L1BA 3VR5A 5E4WC 1EYDA 5BN3A 2H4OA 4XIGS 2TSSA 3KK7A 1O80A 1BCPF 4MHYA 5IODA 4R8FA 3D31A 1FYCA 2BE5C 2R6GA 3D7FA 3K58A 4OGQC 3SI1A 4JK1C 2MHVA 2IT1A 3I4MB 1ET6A 1JWMD 2ZXRA 3PRTA 3S9NA 5F09A 1V1PA 3EJIA 3P75A 3M7GA 1A3TA 4RGMA 1TS2A 1C4QA 5I2YA 3NH4A 3HG9A 4DK1A 1B1ZA 1ARMA 1LAMA 4IUNA 2Q8RE 1XBUA 1H9RA 3A54A 2R7ZB 3HUVA 1EQVA 1EZ8A 3EVQA 3GQBA 1Z8LA 4K6LA 3FRPB 2J9AA 3I4NB 4NDXA 2A6HC 5CR3A 3TP8A 2EPBA 1YW6A 2PO4A 3I70A 1AYEA 3D6WA 1EY9A 2PW5A 1TY2A 4HSPA 2PIZA 1DZ1A 1A2TA 3PB8X 1S5CD 3BI1A 1YNJD 4ABNA 2DNCA 5DM63 1RTNA 1OXSC 4UF4A 3H91A 4A3IB 1LTSD 2Z1CA 1BQQT 4FF1A 4WWVA 1TKFA 1DD2A 1DTDA 3R3OA 3ISZA 3NTKA 3LX0A 1SNDA 5C3WA 2O5IC 1FNWA 2VXWA 1LV9A 3TP6A 3UI2A 3NE5B 4DF7A 1Y8NB 3FMCA 4FF2A 1SMYC 4CHTB 2XNAC 2HCIA 4XQNA 1GXDC 3M3YB 1TWAB 1QCBD 5IB9A 2KVMA 5ELDA 4HSVA 4ZKBB 1WD1A 3KL9A 1CZGA 5CV8A 5C44B 4HR7B 8CPAA 3ITPA 1B9NA 1F9SA 1JQYD 1AZPA 1BF4A 1RD9D 3FEEA 2NB0A 5E1FA 1TQOA 3FDTA 2PZTA 1WVLA 4PPZA 3OIQA 2WKCA 4DFAA 1IW7C 4G7HC 5KYIA 2N55A 4ZY2A 4IQZA 4W9YA 3SI2A 5C3XA 2IPKD 3U9SA 3OOCA 2RFHA 1JQGA 4MHNA 2AQ2B 4P2CB 1OXTA 1QNKA 3S17B 5EKLA 1SAPA 4X3UA 5HVHA 2SNMA 1WTVA 4XQJA 1F9RA 2D62A 5FK9C 3FVQA 1O7ZA 2KEEA 3L2NA 1LANA 3GTGB 2M00A 1GUNA 2AUJD 1Y0YA 1UWYA 2Q8TA 2F0GA 4K8IA 4K2LA 4OHJA 4G1PA 2D5DA 1CPXA 2ZENA 1R3NA 5BN5A 3KF8A 4CKEA 5IOCA 2AQ3B 1F2ZA 2L11A 4KTAA 4KY6A 2EVBA 1NUCA 5E3FA 3KUPA 3T51B 3VR6A 1RODA 3WC7A 2F0LA 2E76C 1PFBA 4DYOA 2EJMA 5ELFA 1PLFA 2K7VA 1Y7EA 5I4DA 3BXMA 1PRTB 3WOEA 3RAMA 3TC8A 1NSAA 4JYWA 1BOSA 5JOBA 2CQAA 3AB9A 4K2KA 1Z2LA 1SFOB 2E74C 3J80E 1VMCA 3OPOA 1HCZA 5LYIA 1RTOA 4MCSA 3D7GA 4FP5D 2NSMA 3RLFA 3GV6A 1B44D 4A37A 5C4HA 2VB2X 5BN4A 4H2KA 4B9WA 2NTTA 5D3DA 3D68A 2MP1A 2KCNA 3HKZB 1A3UA 2A74C 2PJAA 2NYQA 1LFWA 2A5HA 1JR0D 5CV7A 5JH9A 5CV5A 2DEAA 2B2YC 4HAEA 1JB3A 2FINB 1RHPA 3BS1A 2PJ7A 1KNEA 4NGMA 5LRJA 4K8JA 1F2PA 3SR1A 4LJZC 2EYHA 3J80L 3V38A 3BI0A 2I07B 2EK8A 4DK0A 2LY7A 5EJWA 1PFMA 1RTQA 3H8GA 1OBRA 5G3LD 2OEOA 3WC5A 3KASA 2K01A 2QF7A 4BA1I 4K5WA 1IL8A 5CMDA 1GYTA 4PQAA 3IIBA 1H8LA 5ELYA 2SNSA 1I4GA 3RZAA 4IHMA 1Z5RA 2O2LD 3WABA 1PTOC 2F4IA 3IKJA 3NBHA 2B2TA 3TDQA 4A3BB 3NH5A 1PRTD 3NK9A 4FNFA 3KLSX 4BBSB 1TR5A 2K1BA 4LMQD 2E75C 2K05A 1YLOA 3NTHA 2EDGA 4XQQA 4KK7A 3ISXA 3MXNA 4F9VA 5JEAG 1J8IA 4UIBA 1IYVA 1BCPB 1PZKD 4ZKCB 3C1FA 3EROA 4Q5VA 2CF4A 1NR2A 2C5CA 4A3FB 3TSSA 1LAPA 1F2MA 1U4RA 4OC2A 2GLFA 3C1EA 1HQMC 2JEBI 3MFGA 5LL6S 3EQLC 1DOLA 1QNUA 4BWGB 3PB7X 4CJ1B 1BR9A 4OO1I 3ONAB 1JOKA 1D1KA 3MWYW 2HB6A 1ENAA 2XWBB 4ZX9A 4GZYC 4PMCA 5DEHA 1GOZA 2JYOA 3I91A 2EY1A 3CT9A 2ZEHA 5EPLA 3M85A 1HFNA 2F0VA 4KD3A 1LTRD 4IFDG 2FMCA 2IX1A 4R8IA 1HHVA 1I4XA 5CGKA 1DM0B 5M5YB 5LYDA 4XT3B 3VYSA 1ESRA 5M9OA 1B53A 2AQ1B 2B63B 2EXZA 1RDPD 4OKOA 3FF3A 3B3SA 1TWHB 4IUVA 1Q1EA 3W2DA 3V7ZA 3SVMA 5K8OA 2IMOA 3GTPB 2K5DA 1AFPA 3BVZA 2MJ8A 4XYOA 3VYUA 2JA8B 3MXGA 1HA6A 1X3QA 2IW3A 3DWPA 5JAVA 2EJFC 5I9OA 5HURA 3A7AB 4FXKC 5AFWA 5G3LF 5J1QA 5IIFA 1HA5A 1TS3A 4P4EA 4BD9A 4LK1C 3N6RA 2AWNA 2XEGA 1BCPD 5JGFA 4M1UB 4DA2A 4PV1C 5LRKA 2AFZA 2ANPA 2IX0A 4ODGA 5JVG3 4GM5A 1A15A 1O7LA 4G7ZC 2L55A 2RDHA 3VA7A 5LL6X 1QMUA 1Z6HA 3BZDB 1WTOA 4MHZA 3I8ZA 2B2UC 3RBUA 4FBEA 5IGDA 2L12A 4PQXA 3SDZA 2E2JB 4PXEA 4A3MB 1LT5D 4FO2A 1M4LA 2CVRA 2CW0C 3DGVA 1ENFA 1I4HA 2AFWA 4V0BA 3TX8A 4QUFA 4L63B 1SYFA 2LKVA 2FHTA 3S1RB 5K36H 5CBMA 2NVQB 1B3AA 4F9UA 3VA5A 2F0NA 3NH8A 3QO2A 1STNA 1H9SA 2NN6I 4JZ0A 2Q51A 4KKTA 3LNNA 1BBXC 3A8IE 1DJRD 3BVMA 1EOTA 1LOKA 2JA7B 2JBKA 4X2TA 2XIWA 1G6ZA 1NCVA 4NJQA 4UDUC 5F2DA 4FYDA 1STAA 2PW7A 4R8NA 5D8NA 2HDLA 4TKOB 3HRZC 2G9DA 1ZKOA 1XX8A 2PYKA 4C3HG 1H9MA 1EIHA 3PFEA 3S9MA 2QEJC 2LFNA 2F0HA 1Q12A 3MVVA 1DE4C 1CG2A 2L0CA 4RKLA 1CT1D 2O5JC 1TVXA 2WV6D 2XRSD 2GU2A 2BA1A 2EJGC 4P4FA 2A68C 5KNBA 2K32A 2V8GA 2D9UA 5I4MA 3NWTA 2B2VA 3JAME 3VYRA 2B39A 4G57A 3QJYA 1ZG7A 1Z47A 1STGA 2PJ2A 2EK9A 1A3VA 3TMEA 4RHRA 4DNRB 1F9QA 5NUCA 1SDFA 3M7NA 4KI0A 2FVGA 4WJBA 2G9HD 3E6ZX 4RCNA 3J81E 1Q3LA 4C3JB 3PEIA 4NGQA 1TS4A 3PB9X 4ZYSA 1Y1VB 3QB3A 1SYCA 3L7ZC 5COYA 2ZEFA 6CPAA 2MGSA 2F3WA 1Q7LA 2C6CA 2BE5D 2K33A 3NQTA 1H9JA 2PRQA 3DMUA 2SOBA 4HCSA 1EL0A 1SEBD 3HOUB 1TWCB 3IWWA 4R6TA 3H09A 1WTXA 5EPJA 4TNUA 3D4WA 1H9SB 1A2UA 3MC0B 3SK8A 4WRDA 3OIPA 4EQOA 2B2YA 4MMOA 1FD7D 1SNQA 7CPAA 4WJWA 3TP7A 2RA4A 3J81L 2X6GA 4QF4A 4V190 1QE6A 3NWSA 2R93B 5D29A 4EQPA 1TF9A 3NSWA 5T1GA 2A6HD 3P1HA 4MHPA 3K5LA 4A3JB 3J7AF 4LQGA 2F8HA 2DNEA 4K14A 5KNDA 4PXCA 4XXEA 4K3NA 5ELBA 1VF7A 1PYTB 3NA6A 3B2YA 1EY7A 3SJEA 4O42A 5J39A 1CP6A 4ZLTF 1HDQA 3URYA 2XSCA 2NVTB 2WB1B 5M5WB 3DUZA 1ARLA 3KZWA 3PUXA 3MTSA 3SHLA 4EFDA 1D2BA 1O78A 3KBXA 5KNCA 3FPUB 3TN2A 1ONLA 3OMCA 4ONWA 4XYQA 1M4VA 4CJ0B 1PDQA 3IFDA 4DUKA 4OC4A 5JVH3 3H6MA 5EKKA 4XTCS 3QOJA 3BYTB 1I4RA 4U68A 1K8OA 1IGBA 4A94A 4RHSA 4NW2A 4UEFA 4EGVA 2PQEA 2IL8A 1S5DD 1SNPA 1ICWA 1O7YA 3GTMB 1RKNA 3PO3B 1R43A 1ZYRC 2O53A 2QJ8A 3K0YA 2V77A 2I46A 4X3TA 4OP4A 2FMMA 2A6EC 2KHSA 1LLRD 5E4XA 4EQNA 3GD7A 4RFBA 1V1PB 4UEZA 4X3SA 1IW7D 4PXBA 1F2OA 3NP8A 1HTLD 2NBFA 3IL8A 2F0QA 4OIWA 4UIAA 4XT1B 5LYLA 4P4DA 1JC7A 4HEDA 4TSSA 2WAQB 1DONA 1R9TB 1CK1A 3NXWA 4O1NA 3HOWB 2K03A 3GTJB 4M8AA 3HLPA 1I6VC 1SYGA 3PO2B 4FXGC 3BDCA 3CU7A 2F1MA 1BLLE 4NKLA 3IFTA 4ZUJA 2AFSA 4OIKA 2Q43A 1WTPA 3I73A 1H9KA 2F0MA 4NP5A 3L9AX 2WACA 4NGRA 1DXMA 3I3CA 2K28A 4K5VA 1KTKA 1T5XD 4ZUIA 3Q6SA 2ZEOA 1D5MC 1BNZA 4JBWA 2RKSA 4A3EB 3H3VC 1WCMB 1XFOA 3NUCA 3WDNA 1MSHA 3ND9A 2DY7A 1EWCA 3BG3A 1HPCA 2BO9A 2F0FA 2JA5B 5FO7B 2KECA 1VIXA 1CPSA 4S3SA 4Q0FA 2PJ0A 1XTCD 1E0BA 3T8WA 5C6AA 3VARA 4EVOA 3Q22A 4C1NI 5HXDA 1TY0A 2CTCA 1CHQD 1BAVA 2SEBD 1E2VA 1WTWA 2KA7A 1CQFA 4ZQ3A 1KLUD 2IQ6A 2JE6I 3J7AV 1G291 3MHBA 3GUXA 1VDZA 2GA4B 2QCPX 3DM1A 4MCPA 3I1UA 2B2UA 4IUTA 2PJ3A 4B9XA 1CA5A 3FPPA 3D67A 1I4QA 2ZEPA 2PNRC 3NTIA 4XDXA 3D7HA 4X8IA 1CFMA 3K6OA 2RB7A 4PXDA 1IY7A 1VGYA 3E5SA 1EY6A 2AUKA 1G2TA 1D5ZC 2JXMB 2QKIC 4KSIA 4Q7AA 1U4PA 2RQXA 5IGGA 2Z8LA 1NSNS 1LT3D 2NYZD 3ND8A 3D4RA 4FWUA 4FUUA 2ABZA 1RF2D 1PMRA 1G2SA 4MCQA 1XWEA 2X69A 2F7VA 2OXPA 1S4ZA 3RZOB 1BO0A 4BBRB 4UAIA 4PMBA 4DN4M 1K8MA 3OWEB 3FJUA 1PTOD 2HC9A 2EYJA 1TXRA 5TSSA 1PRTC 4CGYB 3C46A 3A8JE 3H8EA 4F8MA 5CV4A 1U4MA 5ELEA 4J6HA 2Q8IB 2RDGA 3LWEA 3WOFA 4I7ZC 3DLJA 1TF8A 1JOQA 1EYAA 4ZRZA 1JOOA 1FT7A 5M5XB 3X3MA 2F0KA 1GUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KLR A;  4Z65 A;  4KHZ A;  4R7M A;  2O4H A;  1YW6 A;  3PV0 A;  1AYE A;  5THW A;  1T5E A;  2BA0 A;  4F9U A;  1YME A;  4TQU S;  3NH8 A;  1H9S A;  2NN6 I;  4JZ0 A;  2Q51 A;  4KKT A;  2AFX A;  2PVW A;  3FX6 A;  3LNN A;  4AXV A;  1VHE A;  3IFE A;  3A8I E;  2AFO A;  2PIZ A;  4H44 C;  3PB8 X;  3BI1 A;  1LOK A;  4ZY1 A;  2YYZ A;  2DNC A;  2BCO A;  2JBK A;  1Z7T A;  4X2T A;  2PPB C;  1OXS C;  4UF4 A;  1HTP A;  3VR4 A;  1OXV A;  4NJQ A;  3B3C A;  4KKU A;  1LAC A;  2PCU A;  4WWV A;  1TKF A;  1DD2 A;  1DTD A;  3T56 B;  4OO1 H;  3ISZ A;  4MXU A;  5D8N A;  4TKO B;  2JEA I;  3GB0 A;  1HDU A;  4OME A;  4X3R A;  2V4D A;  2G9D A;  2O5I C;  3SJX A;  1ZKO A;  1Y69 U;  2EWB A;  3NE5 B;  3FVL A;  1H9M A;  3PFE A;  3S9M A;  5LYF A;  1Y8N B;  3FMC A;  3I4L A;  1SMY C;  1Q12 A;  1DE4 C;  1HEE A;  1CG2 A;  4P45 A;  2WZN A;  2O5J C;  2ZEM A;  3B3V A;  2GU2 A;  2BA1 A;  3NFZ A;  2EJG C;  2D2C C;  3TZU A;  4P4B A;  4NFR A;  5IB9 A;  4P4F A;  3MN8 A;  2A68 C;  3HGB A;  5KNB A;  2K32 A;  2V8G A;  5I4M A;  3KL9 A;  8CPA A;  4HR7 B;  1B9N A;  1V8Q A;  2XEF A;  3VR3 A;  4DNT B;  3FEE A;  3IC1 A;  1ZG8 A;  3QJY A;  1ZG7 A;  2QYV A;  2PJ2 A;  2EK9 A;  2B8F A;  4PPZ A;  3M4Y A;  3KR4 A;  1XRY A;  4P10 A;  4YU9 A;  1IW7 C;  4DNR B;  4G7H C;  1DCZ A;  4ZY2 A;  4IQZ A;  4W9Y A;  3SI2 A;  3FH4 A;  3U9S A;  3M7N A;  3OOC A;  4KI0 A;  2FVG A;  1JQG A;  2RFH A;  4MHN A;  3PUY A;  4A38 A;  4WJB A;  4RCN A;  1Y0R A;  3SE0 A;  3PEI A;  1OXT A;  1Y8P B;  4NGQ A;  5HVH A;  3PB9 X;  2D62 A;  3L7Z C;  5K36 G;  2ZEF A;  3L2N A;  5DS0 A;  1LAN A;  4O23 A;  6CPA A;  2C6C A;  1Q7L A;  2ZOF A;  2ZEE A;  2BE5 D;  4ZYQ A;  1GUN A;  2K33 A;  5LRG A;  2AUJ D;  2PRQ A;  1H9J A;  5K8M A;  1Y0Y A;  3WT4 A;  1UWY A;  3KR5 A;  4OC5 A;  4G1P A;  2D5D A;  3IWW A;  1CPX A;  2ZEN A;  1R3N A;  3W3A A;  5BN5 A;  4R6T A;  4KN7 C;  2ZEG A;  4TNU A;  3MRU A;  1H9S B;  1BPM A;  3KQZ A;  4OC3 A;  2EVB A;  3KHZ A;  3T53 B;  4MMO A;  7CPA A;  3T51 B;  4P44 A;  3VR6 A;  2A69 D;  2ZED A;  3D7D A;  3FED A;  3IO1 A;  4OC1 A;  4L8J A;  4OO1 G;  2JEW A;  2GRE A;  3WC7 A;  3BHX A;  5D29 A;  2E76 C;  1TF9 A;  2A6H D;  4MHP A;  4DYO A;  2EJM A;  4LQG A;  1BDO A;  2F8H A;  2PIY A;  3PBE A;  2DNE A;  5KND A;  2K7V A;  1Y7E A;  3BXM A;  4PXC A;  3RAM A;  4K3N A;  4TWE A;  3N5F A;  2OOT A;  3TC8 A;  3PB6 X;  1NSA A;  1PYT B;  1VF7 A;  4JYW A;  3NA6 A;  3SJF A;  3B2Y A;  1CI3 M;  1GUG A;  3AB9 A;  3PUV A;  3SJE A;  3A7L A;  1Z2L A;  2E74 C;  5K8N A;  2PJB A;  1CP6 A;  1HDQ A;  4F8Z A;  3OPO A;  1VHO A;  3JRU A;  5JEA H;  1HCZ A;  5LYI A;  3CDX A;  4ZY0 A;  2OR4 A;  4MCS A;  2NN6 H;  1GUO A;  3D7G A;  2NSM A;  2XEJ A;  4CPA A;  3RLF A;  1Y8O B;  1ARL A;  4A37 A;  3KZW A;  1OXU A;  3KHX A;  5BN4 A;  3PUX A;  4H2K A;  2V8V A;  1Q90 A;  4MRI A;  4G7O C;  2IJZ A;  4EFD A;  1O78 A;  4BA2 I;  3D68 A;  5KNC A;  1ONL A;  4ZI6 A;  4ONW A;  2PJA A;  2NYQ A;  1LFW A;  4DUK A;  5JH9 A;  4OC4 A;  3CRK C;  1CBX A;  3BDO A;  4XTC S;  1Q1B A;  2AFM A;  2DEA A;  1K8O A;  3GLJ A;  1IGB A;  1E2W A;  3H94 A;  1PCA A;  4A94 A;  3D4U A;  4UEF A;  2PJ7 A;  1VCI A;  4NGM A;  5LRJ A;  4H13 C;  4P4J A;  1YNN C;  4UEE A;  1F2P A;  5HVF A;  4LJZ C;  2A68 D;  3LMS A;  3V38 A;  5HVG A;  1R43 A;  1LAB A;  1ZYR C;  2PJ4 A;  3BI0 A;  2BOA A;  2O53 A;  2QJ8 A;  2EK8 A;  4DK0 A;  5C0X G;  2V77 A;  3WC6 A;  4DJL A;  4OP4 A;  1GUS A;  3VR2 A;  1RTQ A;  3H8G A;  4NGT A;  4IFD H;  1OBR A;  2A6E C;  1ZG9 A;  3WC5 A;  3KQX A;  4IK2 A;  4KKS A;  2ZEL A;  4NGP A;  3KAS A;  4MCR A;  2VL1 A;  2QF7 A;  3GD7 A;  4UEZ A;  4BA1 I;  1IW7 D;  1OXX K;  2B8G A;  3OW7 A;  1GUT A;  2XEI A;  4PXB A;  1GYT A;  1CP7 A;  1E2Z A;  3IIB A;  4PQA A;  3SI0 A;  1F2O A;  4FAI A;  1GHJ A;  1BPN A;  3I72 A;  1TKJ A;  1H8L A;  3CRL C;  3QG1 A;  1F57 A;  5ELY A;  2PJ9 A;  2AFU A;  3RZA A;  4IHM A;  4OIW A;  5C0X H;  1KWM A;  2PJC A;  3CPA A;  1Z5R A;  4UIA A;  1YSJ A;  3LWU A;  1ZLH A;  5LYL A;  1TKH A;  3WAB A;  3IKJ A;  4P4D A;  3NH5 A;  3H8F A;  3HLP A;  1I6V C;  1QJO A;  2E75 C;  2F1M A;  1BLL E;  1YLO A;  1FR3 A;  3IFT A;  2EDG A;  2AFS A;  2V8D A;  2Q43 A;  2KCC A;  3IJ3 A;  3I73 A;  3ISX A;  1H9K A;  2Q4Z A;  2PJ6 A;  4KMU C;  4F9V A;  3VAT A;  4EME A;  1GHK A;  5JEA G;  4NGR A;  1DXM A;  3PB4 X;  2PJ1 A;  4UIB A;  1IYV A;  2NN6 G;  3B35 A;  2ZT9 C;  2ZEO A;  2CIJ A;  2CF4 A;  2PJ5 A;  4OC0 A;  2A69 C;  2ZOG A;  4NGN A;  1QQ9 A;  1VF5 C;  1LAP A;  4JBW A;  4R76 A;  5CPA A;  4OC2 A;  2GLF A;  1XFO A;  3WDN A;  3ND9 A;  1HQM C;  2JEB I;  3EQL C;  3BG3 A;  1HPC A;  2BO9 A;  1YW4 A;  3B3T A;  3PB7 X;  3KI9 A;  1YNJ C;  3A8K E;  2GLJ A;  1VIX A;  1CPS A;  4H0L C;  2AWO A;  2PJ0 A;  2HB6 A;  2I3C A;  3B7I A;  3T8W A;  1IYU A;  4GZY C;  4ZX9 A;  4P4I A;  3VAR A;  1XJO A;  4KN4 C;  3K9T A;  3B3W A;  5HXD A;  3CT9 A;  2CTC A;  3P20 A;  2BDO A;  2POK A;  1BAV A;  3QIA A;  4NJR A;  2ZEH A;  1E2V A;  2KA7 A;  2C6G A;  3M85 A;  4IAV A;  1EE3 P;  2JE6 I;  2IQ6 A;  1G29 1;  3GUX A;  3K2K A;  1VDZ A;  1TU2 B;  4IFD G;  3QNV A;  5A35 A;  4MCP A;  3I1U A;  5K8P A;  1CX8 A;  2PJ3 A;  2QVP A;  2CTB A;  3FPP A;  3D67 A;  5LYD A;  3PUZ A;  2ZEP A;  3S9L A;  2PNR C;  1CTM A;  4B6Z A;  3KGQ A;  4ZX8 A;  4RUH A;  2PVV A;  4P6Y A;  3VH9 A;  3D7H A;  4X8I A;  4OKO A;  2PE3 A;  3FF3 A;  1B9M A;  2WYR A;  2V8H A;  3B3S A;  1CFM A;  1Q1E A;  2RB7 A;  1EWH A;  4PXD A;  1IY7 A;  1VGY A;  3V7Z A;  4EWT A;  5K8O A;  2IMO A;  2AUK A;  2JXM B;  1GJX A;  4KSI A;  4OID A;  4Q7A A;  2DN8 A;  2EJF C;  4NGS A;  1LCP A;  3A7A B;  2L5T A;  3ND8 A;  5J1Q A;  1ELM P;  3D4R A;  2A6E D;  4FWU A;  4P4E A;  2PJ8 A;  4FUU A;  2ABZ A;  4BD9 A;  3VR5 A;  4LK1 C;  3N6R A;  3PBB A;  2XEG A;  1PMR A;  3MFY A;  5BN3 A;  3PFO A;  4MCQ A;  5JGF A;  4PV1 C;  4XIG S;  5LRK A;  2AFZ A;  1AMP A;  2ANP A;  2JBJ A;  4GM5 A;  2F7V A;  3DXJ C;  1O7L A;  5JM6 A;  1ZLI A;  4G7Z C;  4MHY A;  3VA7 A;  4R8F A;  2LMC B;  3D31 A;  1FYC A;  1K8M A;  1XMB A;  1QMU A;  3D66 A;  2BE5 C;  1Z6H A;  2R6G A;  3FJU A;  3D7F A;  4MHZ A;  3FEC A;  4OGQ C;  2HC9 A;  1TXR A;  3SI1 A;  2C6P A;  3RBU A;  4FBE A;  4JK1 C;  2IT1 A;  3A8J E;  3H8E A;  1FNO A;  3CPX A;  3SDZ A;  3PRT A;  4PXE A;  3S9N A;  5F09 A;  4YWY A;  1M4L A;  3IEH A;  2CW0 C;  2C1C A;  2Q8I B;  3NH4 A;  3SJG A;  4DK1 A;  1ARM A;  1ELL P;  1LAM A;  3DGV A;  4I7Z C;  3DLJ A;  4A39 A;  3PUW A;  1XBU A;  1H9R A;  1V43 A;  2AFW A;  3HUV A;  3GQB A;  3TX8 A;  1TF8 A;  1Z8L A;  3MXU A;  1TKW B;  1FT7 A;  2PCF B;  2J9A A;  5K36 H;  1A6X A;  5CBM A;  2A6H C; 
#chains in the Genus database with same CATH topology
 3KLR A;  1HJP A;  1NTG A;  3E9I A;  3K9U A;  2LSS A;  4KHZ A;  2DJG C;  5EAY A;  3PV0 A;  1Y7R A;  3CP0 A;  1PH1 A;  1UAP A;  1R4Q B;  5THW A;  5C3E B;  3RNZ A;  1YME A;  1SN8 A;  3K7U C;  1QSN A;  4C7I A;  2AFX A;  2PVW A;  3TE4 A;  2F0O A;  1MK4 A;  1VHE A;  2AFO A;  5AGE A;  3P7J A;  2MFI A;  4PNY A;  4QL5 A;  4WJ4 A;  4DR7 Q;  3M4O B;  3DSB A;  1SNO A;  1MGS A;  3F2C A;  2YYZ A;  2ZW5 A;  2AMC B;  4DXG A;  1JCK B;  5M5X H;  2EYM A;  1HTP A;  3TS2 A;  1IYL A;  4OLL A;  5D3I B;  1OXV A;  4WFN 3;  2JLM A;  4X6A H;  3KFU A;  1D1I A;  5C3E H;  1N8R C;  4ME3 A;  4OO1 H;  2PRB A;  4MXU A;  3MZ5 A;  4HJ5 A;  1HDU A;  2AKW B;  4OME A;  4X3R A;  2FT0 A;  4R9M A;  4KY7 A;  2EY5 A;  2Y0S E;  2ZTE A;  1IKM A;  2FCK A;  3SJX A;  3L0O A;  4L5T A;  4JWP A;  2EWB A;  1PXU A;  4RGT A;  1QVG A;  1W6K A;  4PG3 A;  3NQI A;  1SE4 A;  1E1T A;  1EEF D;  4UWI A;  2B63 G;  1JE5 A;  3W6X A;  5JJZ A;  3S9W A;  1SQH A;  1YLE A;  1HEE A;  4E6I A;  3Q23 A;  1V9P A;  5HGT A;  3NE7 A;  4P45 A;  2WZN A;  2VUM B;  2F0T A;  2PDO A;  3B3V A;  3PGZ A;  2ARH A;  4N9P A;  2I79 A;  3R9E A;  3K8A A;  1UEA B;  3TZU A;  4NFR A;  4JI0 Q;  3MN8 A;  4IFD I;  3HGB A;  1I50 B;  5COR A;  1PV4 A;  2F0W A;  2JA8 G;  3CW2 C;  2EVN A;  4HJ8 A;  1FY7 A;  3DNS A;  5IT9 E;  2LXK A;  1V8Q A;  3AU7 A;  5EGT A;  5M5Y H;  3A55 A;  1IOF A;  3VR3 A;  2MQH A;  4DNT B;  1YHB A;  2E2I B;  2KUM A;  4OL7 A;  4QY7 A;  2VQE L;  2VBQ A;  4H6Z A;  1X54 A;  5C5L A;  5JJK A;  2QYV A;  3C2P A;  1S3O A;  2B8F A;  4IO9 A;  3M4Y A;  2A73 B;  1IYK A;  1TWH H;  2NUC A;  4HCE A;  4P10 A;  4F87 A;  5C0X I;  4YU9 A;  3TFY A;  1SNC A;  1CQV A;  1DCZ A;  2EXD A;  3TZD A;  2HHH Q;  2L9H A;  5C4Z A;  4XPD C;  1DOM A;  3MXN B;  4B3R Q;  3D3R A;  3Q0A A;  1BCP C;  2PSW A;  3PCO B;  2IWH A;  1PH9 A;  2VNU D;  2IHE A;  1MI2 A;  1QG7 A;  3V2T A;  4DXF A;  4PZ8 A;  4GKK Q;  3ULP A;  4O2D A;  4JXR A;  1PH7 A;  5K36 G;  5DS0 A;  3V05 A;  3NH4 A;  4LW1 A;  2PMZ B;  1PTO F;  2ZEE A;  4ZYQ A;  4ZCK A;  4UA3 A;  1N36 L;  4OEL B;  1OZP A;  4A3M G;  5IT9 L;  3WT4 A;  5IGC A;  3KR5 A;  5KYL A;  1AEX A;  3SEB A;  4K30 A;  1K8A C;  4K0K Q;  1AH9 A;  4Q38 A;  2QW7 A;  4A31 A;  2YGW A;  3S15 B;  4QCL A;  4II9 A;  2E2D C;  2RDF A;  4P71 A;  1EY0 A;  3MRU A;  1BPM A;  1AZQ A;  4GN3 B;  3MAQ A;  3KQZ A;  4OC3 A;  2UXC L;  2CW0 D;  3T90 A;  1ILQ A;  2QIR A;  4A3G B;  1EY4 A;  3RNU A;  3EXN A;  3DWA A;  3FRM A;  3KLS A;  2A69 D;  4OC1 A;  3IO1 A;  5M3M B;  2N78 A;  3O13 A;  2E2J H;  4L8J A;  1KC8 C;  1W6J A;  3SK5 A;  4DKA C;  4A3M H;  1N33 Q;  2GRE A;  4DPG A;  3BHX A;  1PH4 A;  2P6F A;  1E24 A;  2XWJ B;  4B13 A;  1NMT A;  1MBY A;  2RSO A;  4LF6 Q;  3D4D A;  1Q2D A;  4ONU A;  2HQY A;  1D5X C;  4ID6 A;  2PIY A;  1KDC A;  3PBE A;  4A33 A;  1C48 A;  4YCV A;  2K5H A;  2JA7 G;  2EYP A;  3N5F A;  1QWY A;  2HUG A;  2PI2 A;  3MEF A;  4FF4 A;  3CKI B;  2C27 A;  3S1R H;  3PUV A;  4A75 A;  1F2Y A;  3A7L A;  3ZYY X;  1Z8X A;  5M3M H;  5I9P A;  3PIP 3;  1SE3 A;  4ULL A;  3T1Y L;  2PJB A;  4F8Z A;  1VHO A;  3JRU A;  1G8Z D;  4DNC A;  3CXC A;  3Q24 A;  2OR4 A;  5EKI A;  4JPB W;  2NN6 H;  4F88 A;  1GUO A;  4GN5 A;  2XEJ A;  5FKA C;  4CPA A;  1Y8O B;  4MN3 A;  1IBL L;  1EYC A;  4N8F A;  4M6H A;  3KHX A;  4JVZ A;  2NZO A;  2QGQ A;  2GIV A;  2F0E A;  1JE4 A;  1LUZ A;  4LF4 L;  3I90 A;  4H7B A;  5DM7 3;  5EPK A;  4G7O C;  2IJZ A;  4RH6 A;  3T16 A;  1HNZ Q;  1CM9 A;  1RCV D;  1YHQ A;  4JOI C;  4OAD A;  5HY6 A;  4KS9 A;  5DNF A;  3MA2 B;  4RAU C;  4AYB B;  3GTK B;  5DAU A;  1E1O A;  1BXT A;  1DGS A;  3CRK C;  4C1N K;  1Q1B A;  4BY7 B;  4YFJ A;  1VKC A;  2AFM A;  4MFJ A;  3R2I A;  2R61 A;  4RGO S;  1E2W A;  1ZEQ X;  4KJN A;  4IAL A;  3CCQ A;  1VQO A;  4GKJ L;  4NCZ A;  1F2L A;  1XPO A;  1S5F D;  4H13 C;  4NPS A;  3JAM c;  4P4J A;  1YNN C;  4UEE A;  4UCN A;  5HVF A;  1ZXT A;  2A68 D;  2VXK A;  3K5M A;  4X62 Q;  3LMS A;  4B5P A;  5BR8 Q;  5G1Z A;  4C3I B;  4CRZ B;  2LS0 1;  2BOA A;  1E22 A;  3DWQ A;  3WC6 A;  4DJL A;  4GNX B;  1S5K A;  3GTK H;  3FHW A;  1KD1 C;  1TT2 A;  1GUS A;  1MSG A;  2RBM A;  3VR2 A;  4BY7 H;  5IP7 G;  1ZG9 A;  4IK2 A;  4MFK A;  2FL4 A;  1O7I A;  3RUZ A;  4UFX A;  4C3J G;  4YWM A;  4HIO A;  4DV0 L;  1S7N A;  1OXX K;  3GTL B;  4Y52 H;  1RJT A;  3OW7 A;  1GUT A;  2HDM A;  3J81 c;  1Z8W A;  1CP7 A;  3SI0 A;  3SXN A;  3GV3 A;  1PYW D;  3HP3 A;  1VQL A;  1Y1V G;  1KNA A;  2K5Q A;  3CHB D;  1BPN A;  5AG6 A;  3I72 A;  4C3I H;  2YU9 B;  3A56 A;  3CRL C;  1X3E A;  3QG1 A;  1F9P A;  4BY1 B;  1F57 A;  3RYO A;  4KY5 A;  2I5H A;  4C2Y A;  5M3F B;  3DM3 A;  2PJC A;  3CPA A;  1YSJ A;  3LWU A;  1TKH A;  2NZH A;  1L0C A;  3JAM L;  1BBW A;  2F52 A;  3UDF A;  1PH2 A;  1EEI D;  1NAP A;  1LT4 D;  5IP7 H;  2OWO A;  3HOU G;  4MHD A;  4NXM Q;  4F6A A;  5KIX A;  2XVS A;  1V0C A;  2B4B A;  2F0S A;  4C3J H;  4JI0 L;  2DXQ A;  1QJO A;  1PA6 A;  4LFC Q;  2C35 B;  3CCJ A;  3G6J B;  2GFQ A;  4M85 A;  3HS0 C;  1KRS A;  2EY6 A;  2V8D A;  1Y1V H;  2BL1 A;  5GRO A;  3BJ7 A;  3IJ3 A;  2YV5 A;  1U4L A;  1QIL A;  2VB3 X;  4RKB A;  5M3F H;  3R9G A;  4FAI A;  4B08 A;  4KMU C;  3BU2 A;  3ULL A;  3HOZ B;  2Z6B A;  3C3L A;  1XF8 A;  2P0W A;  4EME A;  1GHK A;  5I0C A;  4FXD A;  2R93 G;  2PJ1 A;  1EY5 A;  1L0Y B;  3HOU H;  3PZJ A;  3B35 A;  2EOT A;  3EBE A;  2ZT9 C;  3B6Y A;  5I6Y A;  4ILW A;  2CIJ A;  1EWI A;  3EFX D;  4A3J G;  5FLX E;  2ZW4 A;  1M8A A;  2ATR A;  1SJH D;  2EYO A;  4R57 A;  1G91 A;  1B8A A;  4B10 A;  5CPA A;  2VQY A;  3HKZ E;  5EC4 A;  2OQ0 A;  4NMZ A;  1V1O A;  1GO3 E;  3KKW A;  1YIJ A;  4F7X A;  4L8A A;  1OO9 B;  4KOR A;  1B4O A;  1SSO A;  3X3N A;  5K5P A;  3I55 A;  5G20 A;  4XNH C;  2B3U A;  3HOZ H;  1L0X B;  2Y0M A;  2OF1 A;  2C9O A;  3KI9 A;  1YNJ C;  3A8K E;  1B6B A;  2J0T D;  1UNS A;  4H0L C;  2R93 H;  2K6A A;  2AWO A;  2WB1 G;  5FLM G;  4LF7 L;  1UEB A;  1UE6 A;  1PH6 A;  1PH5 A;  1CA6 A;  4LF8 L;  1IYU A;  4OWT B;  2I3C A;  4MJ8 A;  5F47 A;  4A3J H;  2OZH A;  2WII B;  2VY3 A;  5JPH A;  4K0K L;  1XJO A;  4KN4 C;  3K9T A;  3S6K A;  2A4N A;  2J7Z A;  2JQO A;  3GTO B;  1EUJ A;  4A2Z A;  3P20 A;  2POK A;  4NJR A;  3HZX A;  2KJX A;  2RCF A;  1STY A;  4IAV A;  3CXQ A;  4IUQ A;  4GNX C;  1CZW A;  4MHE A;  5A2Q E;  2JSO A;  4B5P B;  1ET9 A;  2MPM A;  5FLX L;  5A35 A;  2K52 A;  1KDB A;  1SMY D;  4GOP B;  5K8P A;  4R9W A;  1HUM A;  2G3T A;  2EYF A;  2AHO B;  3CCU A;  2CTB A;  5JEA J;  5M5W H;  3QWN A;  5FLM H;  1SJE D;  3S9L A;  2ZXV A;  1LM0 A;  1SYB A;  1CTM A;  4B6Z A;  3KGQ A;  4RUH A;  1N9W A;  4P6Y A;  3PO3 G;  3FNC A;  2PE3 A;  1B9M A;  2WYR A;  1IKL A;  1VQ5 A;  4HMJ A;  1EIY B;  1X32 A;  3VYT A;  3TOB A;  5IGE A;  4HIK A;  3T13 A;  1EWH A;  1CKM A;  3TQY A;  4EWT A;  5FOB B;  4G4K A;  1C0A A;  1ESF A;  1ZYR D;  4JI1 L;  4POF A;  1GJX A;  4UPA A;  4C2M B;  4XPL A;  5LHY 1;  2BOS A;  1X3P A;  2MUY A;  4NGS A;  2NVX B;  4R4C A;  1P8L A;  3R8B A;  1ELM P;  1HR0 W;  2A6E D;  5A2Q L;  1K83 B;  2F5I A;  1J9O A;  3PBB A;  3PO3 H;  1EQT A;  3MFY A;  3PFO A;  2JDC A;  2FJ2 A;  2KED A;  1HNZ L;  1AMP A;  2Z3N A;  1SYD A;  2JBJ A;  3DXJ C;  2WAQ G;  4PK2 A;  5JM6 A;  1W2B A;  2Z0S A;  1ZLI A;  3HOW G;  2WUU A;  4CGN A;  2OT2 A;  4IFD J;  2LMC B;  3OTO L;  4JI7 Q;  4A3K B;  5IGF A;  4IZ8 A;  3S16 B;  1XMB A;  3D66 A;  2NVX H;  1PZJ D;  1L1O A;  3SK6 A;  3PO2 G;  3FEC A;  4IUU A;  4X3K A;  1ML0 D;  3NHH A;  3G8W A;  2F0P A;  2C6P A;  1PYS B;  2ICI A;  4OON A;  2HQE A;  2B2W C;  2EY2 A;  1A2Z A;  3K80 C;  4J1M A;  1FNO A;  3CPX A;  2Z3M A;  1FL0 A;  4R1J A;  3J7Z C;  2F0I A;  4YWY A;  2UXD L;  4H6U A;  5C0X J;  3IEH A;  4MY0 A;  2C1C A;  1R9T H;  1H95 A;  4ZGY B;  3SJG A;  4E2A A;  2J4X A;  4HN7 A;  1ELL P;  4J15 A;  2E5L Q;  3HOW H;  5ISR A;  4A3K H;  3S16 H;  5F49 A;  4A39 A;  3PUW A;  3A5Z B;  4K5X A;  1B50 A;  1V43 A;  4A3E G;  3KJO A;  2OZG A;  1WCM G;  3PO2 H;  3MXU A;  4EQ5 A;  2EZV A;  1A6X A;  3AFP A;  1VQM A;  1TKW B;  3DR6 A;  2PCF B;  2B2V C;  3U50 C;  4CBV A;  3S6F A;  2D2C C;  3CQZ B;  1JWU D;  3HOY B;  3E0J A;  4Z65 A;  5IYB G;  2M2L A;  4CKB A;  4R7M A;  1PTO B;  5IWA L;  2O4H A;  1P0H A;  3BVG A;  4X66 L;  1VQP A;  3I3G A;  1YIT A;  1WTQ A;  5KRU A;  1QUQ B;  1T5E A;  2BA0 A;  2FXQ A;  5EBC A;  4TQU S;  4QMG A;  1CHP D;  2BDN A;  2QIL A;  3FX6 A;  4AXV A;  2VQE Q;  1ENC A;  1EZ6 A;  3IFE A;  5JPN C;  2XRQ D;  1TIQ A;  4H44 C;  1LTI D;  1SE8 A;  4A3E H;  1AP0 A;  1KZF A;  4ZY1 A;  5AG7 A;  1WCM H;  5I2X A;  3NPP A;  1LTL A;  2BCO A;  1U9R A;  1Z7T A;  4N9T A;  3F5B A;  4OEM B;  3CC2 A;  3CQZ H;  2PPB C;  4Y7N B;  3OW2 A;  3VR4 A;  2CWA A;  1PTO H;  1S7K A;  4M6G A;  3B3C A;  4RWS C;  5JPM C;  1STB A;  4KKU A;  1NMF A;  1SYE A;  1LAC A;  4YY3 L;  2PCU A;  3B8G A;  4P75 A;  3IWG A;  3T56 B;  1IBK L;  2NTS A;  2JEA I;  2WP8 J;  4OAE A;  2TMP A;  3GB0 A;  3H0G B;  2Z4H A;  1LTA D;  2V4D A;  5CYU A;  5IYC G;  4DGZ A;  1Y69 U;  4KOT A;  4IUR A;  2WIN B;  3H5Z A;  3FVL A;  1EIG A;  5LMN W;  5LYF A;  1TWF B;  1VQK A;  4A3D B;  2XTI A;  1RXT A;  3I4L A;  1N36 Q;  4DAV A;  3V8I A;  4Y7N H;  5C4J B;  4FVM A;  1XXG A;  3DEO A;  5I6W A;  1YJW A;  2ZEM A;  2WKD A;  4CKC A;  4I65 A;  3UDG A;  3NFZ A;  3GP7 A;  1C9O A;  4NSQ A;  4P4B A;  2KCW A;  2RSN A;  1KAB A;  4UP9 A;  1ILP A;  4JI2 Q;  3DDD A;  2GVA A;  4A93 B;  2NZ1 D;  3WR7 A;  4P73 A;  3V96 A;  5EBD A;  2UXC Q;  2VI7 A;  4MTK A;  5IYC H;  2XEF A;  4PSW A;  1NNX A;  2MO1 A;  3IC1 A;  1TWF H;  2PMZ E;  4A3D H;  1ZG8 A;  3NBI A;  1QSO A;  3T1H L;  1YGH A;  5C4J H;  1L1O B;  5F46 A;  3KR4 A;  1SE2 A;  1XRY A;  5J22 A;  1LTG D;  3U9O A;  1MD2 D;  3BDL A;  4YIJ A;  2F0U A;  3D6C A;  2B5G B;  4WJ3 M;  1XMQ Q;  1UUP A;  3FH4 A;  2D4P A;  3K57 A;  4BBR G;  4A93 H;  5CBE E;  1FNV A;  3PUY A;  4A38 A;  1HH2 P;  2Q2I A;  2Z10 A;  4L6T B;  1EU4 A;  1Y0R A;  3SE0 A;  1Y8P B;  1XYI A;  4LAA A;  5CV9 A;  3RMH A;  4ALP A;  4LF5 Q;  3OHX C;  1NR4 A;  4UP7 A;  2J8N A;  2KQ3 A;  3MXP A;  5IGB A;  5DWM A;  1TS5 A;  1IXR A;  2CHB D;  3A5U A;  1TII D;  3R93 A;  3ERQ A;  4O23 A;  3K5O A;  2ZOF A;  1FVI A;  4ZBG A;  5LRG A;  3G7L A;  3BYY B;  4AB7 A;  1EFI D;  5K8M A;  2ZXP A;  5FO8 B;  4OC5 A;  4R4T A;  1II3 A;  4WOR A;  3TP5 A;  1IBL Q;  2VZY A;  1HQR D;  4OIJ A;  3PF4 A;  4AG9 A;  2DY8 A;  1I4P A;  1KLG D;  2CKZ B;  3RO0 A;  4KUA A;  1VQD A;  3W3A A;  4LF4 Q;  2K5W A;  4KN7 C;  4JOI A;  3EA6 A;  1HXY D;  2ZEG A;  3CPF A;  4K6D A;  1C8C A;  2K5T A;  4DAY A;  2F0J A;  4M3S A;  5CV6 A;  1IID A;  1E3P A;  1XNR L;  4KV6 A;  2RVL A;  3CXP A;  5CNP A;  3KHZ A;  3T53 B;  4BBH A;  4DV7 L;  1WD0 A;  4C68 A;  2IX3 A;  3F8T A;  3AMU A;  5KTD A;  4TRD A;  4P44 A;  2ZED A;  1QVF A;  3HOV B;  2EYL A;  4IOC A;  3D7D A;  3FED A;  1AW7 A;  4LF9 L;  1YI2 A;  1FNU A;  5C3E G;  4GKJ Q;  4OO1 G;  2JEW A;  3EN2 A;  4JW0 A;  4KHV A;  1Z9U A;  3F0A A;  5KGU A;  3FEW X;  2I5M X;  2HUZ A;  3CCM A;  1K73 C;  2WFW A;  5GAH C;  1BDO A;  3K59 A;  2OB0 A;  1DYQ A;  1D7Q A;  4L5Q A;  4KUB A;  1LTT D;  4DU9 A;  4TWE A;  2OOT A;  4JI7 L;  3PB6 X;  3HEJ A;  3SJF A;  1W3S A;  2JN4 A;  1CI3 M;  1GUG A;  3T4A C;  1SLJ A;  4DNI A;  2B3V A;  4ME5 A;  3HOV H;  5ELC A;  2ZXO A;  5EQ0 A;  1D8L A;  5T1I A;  5K8N A;  4KD4 A;  3S2H B;  3S14 B;  1NJI C;  2R3Z A;  2QDB A;  5JEA H;  4DV0 Q;  4NXN L;  1ON0 A;  3OWC A;  2HCC A;  4HNW B;  2B29 A;  1SRU A;  3CDX A;  5H86 A;  4ZY0 A;  1NSL A;  3KF6 B;  3ULJ A;  5H1S E;  2I5L X;  2AJ6 A;  4HID A;  1A62 A;  4KLK A;  2HIV A;  1ZO0 A;  2NVY B;  1OXU A;  5J1Z A;  1GKH A;  4DK3 C;  5FO9 B;  3SK4 A;  4DV6 Q;  2V8V A;  1CSQ A;  1Q90 A;  3M4O H;  4MRI A;  2E5L L;  2X6L A;  1LRZ A;  1LT6 D;  1VQ7 A;  4BA2 I;  1XEB A;  2VUM G;  5C4X B;  4IPD A;  3F1Z A;  5CBA E;  3GO5 A;  4X65 L;  3VDY A;  1Y9K A;  1E7Z A;  4ZI6 A;  2P6G A;  5EMI A;  4Z9C B;  4J8Q A;  3CAM A;  3S2H H;  2R7F A;  1QSM A;  3D8G A;  2E2H B;  1YR0 A;  1CBX A;  3BDO A;  3DHQ A;  3PF5 A;  3HOX B;  3GLJ A;  4MTN A;  1B3Q A;  4E0A A;  3H94 A;  1PCA A;  3PP9 A;  1WTH A;  3EFA A;  3E0E A;  3D4U A;  3DR8 A;  1I6H B;  1VCI A;  4KSA A;  5JJI A;  5IT9 c;  4IN3 A;  4QB4 A;  3KBG A;  2JA6 B;  4HMI A;  4AQY L;  4LFA Q;  5HVG A;  3A0J A;  5IB0 A;  1R4P B;  1LAB A;  2PJ4 A;  2H1E A;  5KEE A;  5C4X H;  1SBB B;  2F3V A;  2KCM A;  5C0X G;  3N52 A;  2VUM H;  2BSW A;  4IF5 A;  2OTJ A;  1DOK A;  1S5E D;  1CUK A;  2E2H H;  2CH4 W;  4NGT A;  2N49 A;  4IFD H;  1XMT A;  1B2T A;  4APV A;  3HOX H;  4KLV A;  4E8O A;  3KQX A;  1I50 H;  4KKS A;  5C5M A;  2ZEL A;  1JJ2 A;  4NGP A;  3CF5 A;  4MCR A;  4DR4 Q;  2VL1 A;  3QOL A;  2A1A A;  4A3L G;  1N32 Q;  1JIC A;  2B8G A;  1HZ9 A;  2E2I H;  2XEI A;  2G0B A;  1E2Z A;  5DWN A;  1GHJ A;  4MIU A;  1UWV A;  3UY5 A;  1TKJ A;  3MEH A;  4QC6 A;  2Z4I A;  1WTR A;  1JOR A;  2PJ9 A;  2B3G A;  1LTB D;  4KJO A;  1Q82 C;  2AFU A;  5C0X H;  1KWM A;  2D0O A;  1Q2C A;  3K5N A;  4QIW B;  1TWG B;  1ZLH A;  2EBJ A;  4C56 C;  4H02 A;  3OSO A;  3PMF A;  2EE1 A;  3PIO 3;  4LF7 Q;  5ISV A;  2PZU A;  3SXH A;  4LF8 Q;  3H8F A;  2XN9 C;  4GS4 A;  4LUO A;  3UDI A;  4HIM A;  4A3L H;  1UE7 A;  3VWE A;  5J8C A;  1X6O A;  4JI2 L;  5D65 A;  1X12 A;  1GM5 A;  3PQI A;  3DEP A;  1PRT F;  4DK6 C;  3R2T A;  3F2U A;  1HR0 Q;  1FR3 A;  4RN7 A;  4A3G G;  3RN2 A;  2IHF A;  1AE3 A;  2KCC A;  1YZ6 A;  1YK3 A;  2IL4 A;  2P6E A;  3QB8 A;  3RLN A;  2Q4Z A;  1IHZ A;  3J81 j;  2LXJ A;  2PJ6 A;  2ICE C;  5M3M G;  1S40 A;  1PFS A;  4OWW B;  3VAT A;  5IY0 A;  4PZ7 A;  2WB1 E;  1STH A;  4CJ2 C;  3T9Y A;  2VQF L;  1BO4 A;  2H5M A;  2ZJR A;  3PB4 X;  4ZAI A;  5CC4 A;  3LOD A;  2NN6 G;  4PMW A;  2N88 A;  1IZ6 A;  2PJ5 A;  1XMQ L;  3S15 H;  4OC0 A;  4GN4 B;  2A69 C;  1YVC A;  2F0D A;  2ZOG A;  1QQ9 A;  4NGN A;  4A32 A;  1VF5 C;  1EU3 A;  4R76 A;  3K7A B;  5D14 A;  2UUB L;  4HTH A;  2YND A;  3EC4 A;  4DR2 L;  2SDF A;  1KAA A;  4RGN A;  3P2H A;  2YNC C;  3GYA A;  4A3G H;  4MFQ A;  1EY8 A;  1VMP A;  3OMG A;  1PU9 A;  4LF5 L;  4JI1 Q;  4BS9 A;  1D6E C;  2Q44 A;  2R92 B;  1Q8I A;  1YW4 A;  2L4N A;  3B3T A;  3JTK A;  1WK4 A;  2GLJ A;  1Q46 A;  1PFN A;  3TOA A;  2F03 A;  2B4D A;  2Z3L A;  5AG5 A;  3FKI B;  2M9V A;  2K04 A;  4U67 3;  2KOL A;  3BZK A;  3S1M B;  3B7I A;  4P4I A;  1HNW Q;  3K7A H;  2ENB A;  4JLY A;  3B3W A;  2B2T C;  4DR5 L;  3S6H A;  3QR8 A;  2BDO A;  4ZK9 B;  1WFQ A;  1KDA A;  3QIA A;  3NEN A;  1I3Q B;  1LO5 D;  4GLA C;  2C6G A;  1AN8 A;  3ZJY C;  4X64 L;  1KRT A;  1HUN A;  3NEM A;  4AYB G;  2X7B A;  3L3O C;  1CM0 A;  3OWF A;  1EE3 P;  1CSP A;  1VQ8 A;  4FF3 A;  1Y1W B;  3K2K A;  1TU2 B;  4BY7 G;  3QNV A;  2IJ0 A;  3OTO Q;  1VQE A;  3FKI H;  3D8P A;  2JP1 A;  1SNM A;  1PZI D;  5J3B A;  1CX8 A;  3S1N B;  3IAY A;  3RZD B;  2QVP A;  2ID0 A;  1HRJ A;  3S1M H;  3CXS A;  2B2W A;  4IUP A;  2Q2U A;  5GAG C;  1F77 A;  3PUZ A;  4RCO A;  4KLW A;  1BUV T;  2WPW A;  4C3H B;  4ZX8 A;  1YRE A;  2EUI A;  2O4X A;  3IU1 A;  4DV2 L;  2PVV A;  3F2B A;  4C3I G;  1JWS D;  2FFK B;  3VH9 A;  4KOX A;  3S2D B;  1J4J A;  2UXD Q;  4NEX A;  1KHI A;  2V8H A;  2WAQ E;  3STB C;  1CKO A;  1HFG A;  4ORF A;  1YNN D;  1Y1W H;  3GTQ B;  1SXT A;  2REE A;  4RA8 A;  5HMN A;  2RHQ B;  3J7Y W;  3S1Q B;  1QB5 D;  1S5B D;  1I5F A;  3IU2 A;  2CNT A;  3TBI B;  4OID A;  2FIW A;  4QUC A;  1FGB D;  2PZW A;  4DAP A;  2DN8 A;  1XPR A;  1STE A;  2NWG A;  4C3H H;  1LCP A;  2L5T A;  4CGM A;  3RD4 A;  1QOH A;  5LMN Q;  3FYN A;  2PJ8 A;  2Y0S B;  2L1B A;  3S2D H;  3VR5 A;  5IWA Q;  4BY1 G;  4X66 Q;  5E4W C;  2HV2 A;  1EYD A;  2CXA A;  5GAE C;  1R57 A;  3A9L A;  5M3F G;  5BN3 A;  4DV6 L;  2AE6 A;  2H4O A;  3GTQ H;  4XIG S;  2TSS A;  3KK7 A;  4MFP A;  1O80 A;  2N3S A;  1XNQ L;  1BCP F;  2JK8 A;  3S1Q H;  1HZA A;  4CYP A;  4MHY A;  5IOD A;  4R8F A;  3D31 A;  1FYC A;  2VZZ A;  4A3C G;  2BE5 C;  2R6G A;  3GTL H;  3D7F A;  3K58 A;  2ZJQ A;  4OGQ C;  1K0S A;  3EY5 A;  3SI1 A;  3CCV A;  5HGQ A;  4JCV E;  1EIF A;  4JK1 C;  2MHV A;  2YU9 H;  2IT1 A;  4BY1 H;  1OTC A;  4YY3 Q;  1ET6 A;  3I4M B;  3CME A;  2GAN A;  1JWM D;  1IBK Q;  2ZXR A;  3HOZ G;  3PRT A;  3S9N A;  4LFA L;  2G3A A;  3FB3 A;  5F09 A;  2HIX A;  1V1P A;  3EJI A;  3P75 A;  4JI6 L;  3CD6 A;  4JV5 L;  2MO0 A;  2CY2 A;  3I4O A;  3M7G A;  1A3T A;  4RGM A;  1TS2 A;  1C4Q A;  2KHI A;  2Z6K C;  3HG9 A;  1RIP A;  4DK1 A;  1B1Z A;  5I2Y A;  5L37 A;  1ARM A;  1LAM A;  4U9Y A;  4IUN A;  5G21 A;  2Q8R E;  1XBU A;  2GE3 A;  1H9R A;  3A54 A;  4A3C H;  2YTY A;  2R7Z B;  5FLX c;  1EQV A;  1EZ8 A;  3EVQ A;  3GQB A;  3TRE A;  3HUV A;  1Z8L A;  4DR4 L;  4K6L A;  4POG A;  2UUA Q;  3FRP B;  1N32 L;  4KHP L;  2J9A A;  3I4N B;  2A6H C;  4NDX A;  4OWX B;  2DUD A;  5CR3 A;  3TP8 A;  2EPB A;  1U6M A;  5A27 A;  1YW6 A;  2VZA A;  1KL9 A;  2PO4 A;  4JI5 L;  3I70 A;  5AG4 A;  2FIA A;  1AYE A;  4P72 A;  1EQQ A;  1Z4E A;  3D6W A;  1EY9 A;  2PW5 A;  3PGP A;  5IV0 A;  1TY2 A;  4JJX A;  3T1H Q;  1U0L A;  4HSP A;  2PIZ A;  1DZ1 A;  2R7Z H;  4HNY B;  1A2T A;  2I00 A;  3S24 A;  3PB8 X;  1S5C D;  3BI1 A;  5KTA A;  1YNJ D;  4ABN A;  1P16 A;  2DNC A;  3F8K A;  1YBY A;  3QAH A;  5DM6 3;  3I4N H;  1RTN A;  1OXS C;  4UF4 A;  2ASB A;  3H91 A;  4A3I B;  1MJB A;  1LTS D;  2Z1C A;  1BQQ T;  1HR0 L;  4FF1 A;  2Q4Y A;  3LD2 A;  1NMG A;  3LGJ A;  5IE8 A;  4WWV A;  2R7D A;  1DD2 A;  3UE0 A;  1DTD A;  3R3O A;  1TKF A;  3ISZ A;  3NTK A;  3LX0 A;  5A28 A;  2OTL A;  1SND A;  5C3W A;  2O5I C;  1FNW A;  2VXW A;  4C7H A;  1A63 A;  2FS5 A;  1LV9 A;  3TP6 A;  3UI2 A;  4JYA L;  3NE5 B;  2BUE A;  4DF7 A;  3H3V I;  1GD7 A;  1Y8N B;  3FMC A;  4FF2 A;  3M4P A;  3GTO H;  1SMY C;  4CHT B;  1EQR A;  2XNA C;  2HCI A;  4XQN A;  1M1D A;  4A3I H;  1X3F A;  1GXD C;  3M3Y B;  4O0A A;  1J6Q A;  1JMC A;  1TWA B;  4GS3 A;  4LUZ A;  1VQH A;  3PIO A;  1QCB D;  3VWD A;  5IB9 A;  2KVM A;  5ELD A;  4HSV A;  1NBW A;  4ZKB B;  1WD1 A;  3KL9 A;  1CZG A;  5CV8 A;  5C44 B;  4HR7 B;  1J5E L;  3ITP A;  8CPA A;  4R3L A;  4YWL A;  1B9N A;  1F9S A;  3J80 i;  1XNR Q;  1JQY D;  1AZP A;  1BF4 A;  1RD9 D;  4KOS A;  3FEE A;  2NB0 A;  5E1F A;  4DV7 Q;  2EIF A;  1TQO A;  3FDT A;  2PZT A;  1WVL A;  4LF9 Q;  4C2X A;  1IYJ B;  1HNW L;  3OIQ A;  4PPZ A;  2UUC Q;  2WKC A;  4DFA A;  1RL2 A;  3M3Y H;  4NF1 A;  1IW7 C;  3M4Q A;  5GQO A;  4G7H C;  2ZW7 A;  5KYI A;  2N55 A;  2K50 A;  4DR3 L;  4ZY2 A;  4YGO A;  4IQZ A;  4W9Y A;  3SI2 A;  5C3X A;  2IPK D;  3U9S A;  3OOC A;  2RFH A;  1JQG A;  1EYG A;  2AQ2 B;  4MHN A;  4CYO A;  2IY5 B;  5FJ8 G;  3W6S A;  4A3K G;  4A30 A;  4C2M H;  4P2C B;  1OXT A;  1QNK A;  3S17 B;  5EKL A;  1SAP A;  1MJC A;  4X3U A;  2SNM A;  5HVH A;  1WTV A;  4XQJ A;  1F9R A;  2D62 A;  5FK9 C;  4JG2 A;  4JD6 A;  2WSA A;  3FVQ A;  1K83 H;  2Z3P A;  1L2F A;  1O7Z A;  1UFH A;  2KEE A;  3L2N A;  2L15 A;  1G6P A;  1LAN A;  3GTG B;  3D0F A;  2M00 A;  4NXN Q;  3TO6 A;  3TT2 A;  1GUN A;  4R4Q A;  2AUJ D;  3PIP A;  1Y0Y A;  1UWY A;  2Q8T A;  2F0G A;  4K8I A;  2R98 A;  4K2L A;  4OHJ A;  4G1P A;  2D5D A;  3H15 A;  1CPX A;  2ZEN A;  1I1D A;  1R3N A;  3OYY A;  5FJ8 H;  5BN5 A;  4QGU A;  4KVX A;  3RLO A;  4BMH A;  3KF8 A;  4CKE A;  2K5N A;  5IOC A;  4FD4 A;  1VQJ A;  2AQ3 B;  4X65 Q;  1F2Z A;  2K4K A;  2KCT A;  2L11 A;  1YHA A;  4KTA A;  4KY6 A;  2EVB A;  1NUC A;  3HOY G;  2UXB Q;  4QJF A;  5E3F A;  3KUP A;  3T51 B;  5LMN L;  3VR6 A;  4GLV B;  1ROD A;  1YJN A;  2Q04 A;  1Z4R A;  3WC7 A;  4AVC A;  2VL6 A;  1VS0 A;  2F0L A;  4GOP C;  2E76 C;  5EBV A;  4B5O A;  2QA4 A;  4AQY Q;  1PFB A;  4DYO A;  2EJM A;  1M1K C;  1XOV A;  5ELF A;  1PLF A;  2EQS A;  3ICE A;  2K7V A;  1Y7E A;  5I4D A;  3BXM A;  1PRT B;  3WOE A;  3DLL A;  3RAM A;  3TC8 A;  3JUW A;  4CGO A;  1NSA A;  4JYW A;  1BOS A;  5JOB A;  1X9N A;  3KDF A;  2CQA A;  3AB9 A;  3HOY H;  4K2K A;  1ASZ A;  1Z2L A;  1SFO B;  2E74 C;  4R4O A;  2NMT A;  4KOV A;  5BWA B;  3J80 E;  1VMC A;  3OPO A;  1HCZ A;  5LYI A;  4U9Z A;  1RTO A;  2BH8 A;  4MCS A;  3H0G G;  3D7G A;  4FP5 D;  2NSM A;  4DR6 Q;  3RLF A;  3GV6 A;  1B44 D;  5HH1 A;  1JT8 A;  4A37 A;  1KQS A;  2ZTD A;  5C4H A;  3E0K A;  2VB2 X;  5BN4 A;  4A3D G;  4H2K A;  1UE1 A;  4B9W A;  2NTT A;  1BVS A;  4DV4 L;  3NE8 A;  5D3D A;  4LUV A;  3D68 A;  4JC0 A;  1VQG A;  3TCV A;  3HKS A;  4MNO A;  2JEV A;  2MP1 A;  2KCN A;  3K81 C;  3HKZ B;  3H4Q A;  1A3U A;  2A74 C;  2UUA L;  2PJA A;  2NYQ A;  1LFW A;  2A5H A;  1JR0 D;  5CV7 A;  2OH1 A;  5JH9 A;  1GHE A;  5CV5 A;  2Q2T A;  3JVN A;  2DEA A;  2B2Y C;  4HAE A;  4A93 G;  1JB3 A;  4MZ9 A;  2FIN B;  3H0G H;  2ZJP A;  3L2P A;  4QB9 A;  1RHP A;  3BS1 A;  2PJ7 A;  3SXO A;  1KNE A;  4MI4 A;  4NGM A;  5LRJ A;  4QBJ A;  4R4I A;  4K8J A;  1MKH A;  2R7H A;  1F2P A;  3SR1 A;  4QIW E;  4DV5 L;  4LJZ C;  1RO5 A;  2EYH A;  3AFQ A;  4LWC A;  3J80 L;  3V38 A;  3BI0 A;  2I07 B;  2EK8 A;  4DK0 A;  2LY7 A;  5EJW A;  2VQF Q;  1K0R A;  1PFM A;  4B3M Q;  3W5O A;  4LX9 A;  2FSR A;  1MJA A;  1RTQ A;  3H8G A;  2GVB A;  1OBR A;  5G3L D;  3GIU A;  2OEO A;  2VEZ A;  3WC5 A;  2PQA A;  3K0X A;  3KAS A;  3IWE A;  3PSI A;  2K01 A;  2UUB Q;  2YNC A;  2QF7 A;  4DR2 Q;  1M4I A;  1YNX A;  4BA1 I;  4K5W A;  3I9S A;  4B3S L;  4DV3 L;  2F4V L;  1PYB A;  1IL8 A;  4U5Y A;  5CMD A;  1GYT A;  1IIC A;  4PQA A;  3IIB A;  2OCE A;  3A74 A;  2JJQ A;  3KF8 B;  1H8L A;  5ELY A;  2PNH A;  1VQ6 A;  4AVB A;  2SNS A;  1JJG A;  1I4G A;  3CZX A;  1MIU A;  4IHM A;  3RZA A;  1Z5R A;  2O2L D;  4AG7 A;  4MY3 A;  4DUY Q;  3WAB A;  1PTO C;  2F4I A;  3KJP A;  3EO4 A;  1BKB A;  3IKJ A;  4A3B G;  3IRB A;  3NBH A;  5ELO A;  2B2T A;  3TDQ A;  4A3B B;  3NH5 A;  1PRT D;  3CPW A;  3NK9 A;  4GXH A;  4UP8 A;  2I0Q A;  4DR5 Q;  4FNF A;  1YEZ A;  4CS0 B;  3KLS X;  1KXL A;  3I56 A;  4BBS B;  1TR5 A;  5LMU L;  1M90 C;  4MFL A;  2K1B A;  1XIX A;  4LMQ D;  4X64 Q;  2E75 C;  2K05 A;  4X5K A;  1YLO A;  3NTH A;  1Z8T A;  2EDG A;  3KOJ A;  4XQQ A;  4DV1 Q;  3E9H A;  4KK7 A;  4KVM E;  3ISX A;  3MXN A;  2PR8 A;  3HOV G;  4F9V A;  1GVP A;  1X55 A;  3TEH B;  2WPX A;  3KDF B;  1Q81 C;  5JEA G;  2UUC L;  4A3B H;  4XPD B;  2MNA A;  1J8I A;  3RN5 A;  4UIB A;  1IYV A;  1BCP B;  1PZK D;  4ZKC B;  3C1F A;  4UCP A;  4R87 A;  3ERO A;  4Q5V A;  2CF4 A;  4DV2 Q;  1HZC A;  1KIX A;  1NR2 A;  2C5C A;  4A3F B;  2CFM A;  3TSS A;  1LAP A;  1F2M A;  2UU9 L;  3E3X A;  4AYB E;  1U4R A;  2Q4V A;  4OC2 A;  2GLF A;  3C1E A;  4YWK A;  1N34 Q;  3UDX A;  4DR1 L;  1HQM C;  2JEB I;  3MFG A;  5LL6 S;  3EQL C;  4EX5 A;  2OU2 A;  4F0X A;  1DOL A;  1QNU A;  4BWG B;  3PB7 X;  4CJ1 B;  2BH2 A;  3W1B A;  1BR9 A;  3CCL A;  4OO1 I;  3ONA B;  1JOK A;  1D1K A;  3MWY W;  4IJH A;  4LUA A;  2HB6 A;  1ENA A;  2XWB B;  3BZC A;  4A3F H;  4GZY C;  4PMC A;  5DEH A;  2RC4 A;  4MFZ A;  1GOZ A;  4ZX9 A;  3SHP A;  2JYO A;  3I91 A;  2EY1 A;  3CT9 A;  4JI8 L;  3TRZ A;  2ZM6 Q;  2R8V A;  4CYN A;  1VQA A;  4JI3 L;  2ZEH A;  5EPL A;  5C4X G;  1L1O C;  3M85 A;  2RF4 A;  1HNX L;  1XNQ Q;  1HFN A;  1JB7 A;  1PH3 A;  2F0V A;  4KD3 A;  1LTR D;  3S14 H;  2YTV A;  3I2Z A;  4IFD G;  2FMC A;  2IX1 A;  3HOX G;  2UXB L;  2DJF C;  4R8I A;  4UBR A;  1HHV A;  2Q7B A;  1I4X A;  1VQN A;  5CGK A;  3RR5 A;  1DM0 B;  2ATW A;  1EFW A;  4KOW A;  1IL2 A;  5M5Y B;  5LYD A;  2NVY H;  4XT3 B;  2PQA B;  2JA6 G;  3VYS A;  1ESR A;  5M9O A;  1B53 A;  2AQ1 B;  2B63 B;  4LFB Q;  2EXZ A;  2CH4 A;  1RDP D;  4OKO A;  3FF3 A;  4C2Z A;  3B3S A;  2Z6K A;  1TWH B;  4JI6 Q;  4IUV A;  4JV5 Q;  5F48 A;  1Q1E A;  4OX9 L;  3W2D A;  2ALY B;  4FD6 A;  3V7Z A;  3SVM A;  5K8O A;  3D2P A;  2IMO A;  3GTP B;  1IB1 E;  4HKF A;  2K5D A;  1ASY A;  1AFP A;  2F3I A;  3BVZ A;  2MJ8 A;  4XYO A;  3VYU A;  2JA8 B;  3MXG A;  4DUZ Q;  1HA6 A;  1X3Q A;  2IW3 A;  3DWP A;  2DF5 A;  3NBH B;  5JAV A;  2G5D A;  2EJF C;  1I6H H;  3GDE A;  5I9O A;  1VQI A;  4KHP Q;  3A7A B;  4FXK C;  2H5X A;  2HQL A;  3FP9 A;  5AFW A;  5G3L F;  5HUR A;  5IIF A;  2JA6 H;  5J1Q A;  5GAD C;  2B63 H;  4HJ7 A;  2Z3O A;  1HA5 A;  1TS3 A;  4DR6 L;  4P4E A;  1MJE A;  4BD9 A;  4LK1 C;  3N6R A;  2PI2 E;  2AWN A;  4JI5 Q;  2XEG A;  2ZPA A;  1BCP D;  4RI1 A;  1MHW C;  4FD7 A;  5JGF A;  4DAY B;  4M1U B;  4DA2 A;  1NE3 A;  4PV1 C;  5LRK A;  1I94 L;  3SGI A;  2AFZ A;  2ANP A;  2IX0 A;  4ODG A;  5IYD G;  5JVG 3;  3GTP H;  4GM5 A;  5FVJ A;  1A15 A;  1O7L A;  4KOU A;  3ER0 A;  2JA8 H;  3M9B A;  4G7Z C;  2L55 A;  2RDH A;  1WWZ A;  3AYH B;  3VA7 A;  5LL6 X;  1B70 B;  1QMU A;  1Z6H A;  3BZD B;  4AH6 A;  1WTO A;  4HNX B;  4MHZ A;  4GNX A;  4YHH L;  4UWJ A;  3I8Z A;  2B2U C;  3S6G A;  3RBU A;  4FBE A;  3JAM i;  4IPH A;  5IGD A;  2L12 A;  4PQX A;  3SDZ A;  2E2J B;  1TWG H;  1XMO Q;  4PXE A;  1Z9F A;  4F0Y A;  4A3M B;  1LT5 D;  4FO2 A;  1IU8 A;  5IYD H;  1M4L A;  2ES2 A;  4QQB X;  4JYA Q;  2CVR A;  2CW0 C;  4B3M L;  1B87 A;  3KYH C;  1IBM L;  3DGV A;  1ENF A;  2JA9 A;  3W1G A;  1I4H A;  1QVC A;  3G4S A;  4CYQ A;  2FE7 A;  2K75 A;  4CAE A;  2AFW A;  4V0B A;  4KZT A;  3TX8 A;  4QUF A;  4BIN A;  4L63 B;  2JDD A;  3ZJ0 A;  1SYF A;  1WJJ A;  2LKV A;  3J81 i;  2FHT A;  3S1R B;  5K36 H;  5CBM A;  2NVQ B;  2R92 G;  2Z0Z A;  2KBN A;  1J5E Q;  4JI4 Q;  1B3A A;  1SR3 A;  3NEL A;  3FKI G;  4F9U A;  3VA5 A;  2F0N A;  1VQB A;  3NH8 A;  3R1K A;  3QO2 A;  1KUX A;  1STN A;  1S3Z A;  1H9S A;  5G22 A;  2NN6 I;  4DUY L;  2Q51 A;  4KKT A;  4JZ0 A;  3LNN A;  1BBX C;  3A8I E;  1DJR D;  3BVM A;  1KUV A;  2HD3 A;  3CCE A;  3LAC A;  1EOT A;  4B3T Q;  1LOK A;  2JA7 B;  2JBK A;  4AVA A;  4X2T A;  2XIW A;  4DR3 Q;  2NVQ H;  1X65 A;  4I7A A;  1KUY A;  1G6Z A;  1NCV A;  4NJQ A;  3CMA A;  1Y1W G;  3Q8D A;  4UDU C;  5F2D A;  2R92 H;  4FYD A;  1JWQ A;  4DV1 L;  1STA A;  2PW7 A;  4R8N A;  5D8N A;  2HDL A;  2BEI A;  4TKO B;  3HRZ C;  2G9D A;  1ZKO A;  4RMF A;  3AEV A;  1XX8 A;  2PYK A;  1MJ9 A;  4C3H G;  1Q2Y A;  1H9M A;  1EIH A;  1U5K A;  3PFE A;  3S9M A;  2QEJ C;  4JBJ A;  2LFN A;  2JA7 H;  2Z9H A;  2F0H A;  1Q12 A;  3MVV A;  1DE4 C;  2OZU A;  1I3Q H;  1CG2 A;  2L0C A;  4RKL A;  4XNH B;  1CT1 D;  2O5J C;  1TVX A;  2WV6 D;  5AJ3 L;  2XRS D;  5DLQ E;  3CC4 A;  4IJL A;  1G51 A;  2GU2 A;  4LQ6 A;  3CCS A;  2BA1 A;  1S72 A;  1N34 L;  2EJG C;  4H89 A;  1K3R A;  3GY9 A;  4P4F A;  2A68 C;  3EIV A;  5KNB A;  4JBK A;  2K32 A;  2V8G A;  4LNQ A;  2D9U A;  5I4M A;  1VQF A;  3S1N H;  3RZD H;  1BBU A;  3NWT A;  1XTD A;  3STB D;  2B2V A;  3JAM E;  3VYR A;  1TXY A;  1K9M C;  4B14 A;  2B39 A;  4G57 A;  4MBU A;  3QJY A;  2Y0S G;  1ZG7 A;  1XE4 A;  1Z47 A;  1STG A;  2PJ2 A;  2EK9 A;  1M4D A;  1A3V A;  3TME A;  1FJG Q;  1XPU A;  4DR7 L;  4GOP A;  4YRH A;  4RHR A;  4J3G A;  4DNR B;  2ZM6 L;  2O28 A;  4KSF A;  1F9Q A;  1KAW A;  1SDF A;  5NUC A;  3G3S A;  4UFW A;  3M7N A;  5E96 A;  4KI0 A;  2VS1 A;  2FVG A;  1UE5 A;  1LYL A;  4WJB A;  2G9H D;  1SRO A;  3E6Z X;  4RCN A;  3J81 E;  2J8R A;  2CQO A;  1Q3L A;  3BJU A;  4C3J B;  1YQE A;  4UFV A;  3PEI A;  4CAX A;  4NGQ A;  1TS4 A;  1P4N A;  3PB9 X;  2PR1 A;  4ZYS A;  1Y1V B;  3QB3 A;  1SYC A;  3L7Z C;  5COY A;  4HJ9 A;  3I4M G;  2ZEF A;  6CPA A;  3FBU A;  1I12 A;  4CAV A;  2MGS A;  2F3W A;  1Q7L A;  2C6C A;  2QML A;  2BE5 D;  4CRY B;  2A19 A;  2K33 A;  4LFB L;  3FXT A;  3NQT A;  1H9J A;  1PH8 A;  1AUG A;  2PRQ A;  3DMU A;  2SOB A;  4HCS A;  1EL0 A;  4B11 A;  1SEB D;  3HOU B;  2D4O A;  1TWC B;  3IWW A;  5IX3 A;  4DV4 Q;  2P5Z X;  1N71 A;  2HT1 A;  4R6T A;  3H09 A;  1WTX A;  5EPJ A;  2R7Z G;  2A8V A;  4TNU A;  2B4D B;  3D4W A;  1H9S B;  2ZW6 A;  1A2U A;  3MC0 B;  3SK8 A;  4DUZ L;  4WRD A;  5E7N A;  4L5S A;  4KVO E;  4A95 A;  3OIP A;  4EQO A;  2B2Y A;  3I4N G;  4MMO A;  1FD7 D;  1Q8K A;  1SNQ A;  3I4M H;  2DPT A;  7CPA A;  4WJW A;  1QST A;  3TP7 A;  2RA4 A;  3J81 L;  2X6G A;  1HZB A;  4QF4 A;  1QE6 A;  4V19 0;  3TO9 A;  3NWS A;  2R93 B;  5D29 A;  1TWC H;  4EQP A;  1TF9 A;  3NSW A;  5T1G A;  2A6H D;  3P1H A;  4DV5 Q;  4HPS A;  2HHH L;  1Y14 B;  4MHP A;  3K5L A;  4A3J B;  3J7A F;  4LQG A;  3R9F A;  4B3R L;  2F8H A;  2DNE A;  4K14 A;  5KND A;  4PXC A;  4XXE A;  3TO7 A;  4K3N A;  4UHV A;  4Y49 B;  5ELB A;  1VF7 A;  1PYT B;  3NA6 A;  5J8F A;  3B2Y A;  5JQ4 A;  1EY7 A;  3UE1 A;  4P74 A;  4A3I G;  1K8G A;  1M4G A;  4GKK L;  3SJE A;  4R3K A;  4O42 A;  4EVY A;  5J39 A;  4QVT A;  1X3G A;  1CP6 A;  3C26 A;  4ZLT F;  1HDQ A;  1A8V A;  2N8N A;  2YNE A;  4B3S Q;  3URY A;  4DV3 Q;  2F4V Q;  1Y9W A;  2XSC A;  1XMO L;  1VQC A;  2NVT B;  2WB1 B;  1QZG A;  5M5W B;  4HJA A;  3DUZ A;  1ARL A;  3HFZ B;  3AQQ A;  1YVO A;  1Q7Y C;  3KZW A;  5ELN A;  3PUX A;  4CDE C;  1PHJ A;  3MTS A;  4L89 A;  1A0I A;  3SHL A;  4EFD A;  1D2B A;  1O78 A;  3KBX A;  5KNC A;  1QUQ A;  3FPU B;  3TN2 A;  3J7A 5;  1ONL A;  3OMC A;  4ONW A;  3R96 A;  4XYQ A;  3D3S A;  1M4V A;  4CJ0 B;  1PDQ A;  3IFD A;  4DUK A;  1S7L A;  4OC4 A;  5JVH 3;  3H6M A;  5EKK A;  4RG1 A;  4XTC S;  4PV6 A;  4NB3 A;  3QOJ A;  3BYT B;  1I4R A;  4U68 A;  5LMU Q;  5C44 G;  1K8O A;  1IGB A;  3TTH A;  4Q36 A;  2NVT H;  4KOY A;  4A94 A;  2FXF A;  4RHS A;  4NW2 A;  4UEF A;  4JI4 L;  4EGV A;  1N33 L;  4PSX A;  2PQE A;  2IL8 A;  1S5D D;  1V1Q A;  1WOC A;  3H3V H;  1SNP A;  2QEX A;  1ICW A;  1K3B C;  1O7Y A;  4LF6 L;  3GTM B;  1RKN A;  3PO3 B;  1R43 A;  1ZYR C;  4CGP A;  2O53 A;  2QJ8 A;  3K0Y A;  2V77 A;  2I46 A;  4X3T A;  4B3T L;  1VQ9 A;  4IOA A;  4OP4 A;  1TWA H;  2VW9 A;  2FMM A;  2A6E C;  2B58 A;  2KHS A;  1LLR D;  4CDF C;  5E4X A;  4EQN A;  2UU9 Q;  5C44 H;  2CNS A;  4NXY A;  3GD7 A;  4RFB A;  1YX0 A;  1V1P B;  4UEZ A;  2KEN A;  4X3S A;  1IW7 D;  4YCU A;  1M44 A;  4FDB A;  2CWP A;  4DR1 Q;  4PXB A;  3GTM H;  1F2O A;  3NP8 A;  1HTL D;  2NBF A;  3IL8 A;  4IPC A;  2F0Q A;  2J8M A;  4B12 A;  4OIW A;  1I21 A;  4UIA A;  3N7Z A;  1CKN A;  4XT1 B;  5LYL A;  2RHS B;  2PQ8 A;  4P4D A;  4A76 A;  1JC7 A;  4HED A;  4TSS A;  2WAQ B;  1DON A;  1R9T B;  4L5R C;  1CK1 A;  1NE9 A;  3NXW A;  5H84 A;  4O1N A;  3G6E A;  3HOW B;  2K03 A;  4JI8 Q;  4M8A A;  3GTJ B;  3HLP A;  2RCN A;  4JI3 Q;  1I6V C;  3S17 H;  1SYG A;  3PO2 B;  3U4V A;  4FXG C;  4A4I A;  1HNX Q;  4UY8 C;  3BDC A;  3CU7 A;  2F1M A;  1BLL E;  4NKL A;  2B5G A;  3IFT A;  4ZUJ A;  1C7Y A;  1L0W A;  2AFS A;  4OIK A;  2Q43 A;  4Y49 C;  1S7F A;  1WTP A;  3I73 A;  1H9K A;  3GTG H;  2F0M A;  4X62 L;  4NP5 A;  1PUA A;  5BR8 L;  3L9A X;  3G71 A;  1B7Y B;  2WAC A;  2V1C C;  1FJG L;  2Q7S A;  4NGR A;  1DXM A;  3I3C A;  2ODF A;  2K28 A;  4K5V A;  4CGL A;  1KTK A;  1T5X D;  2CNM A;  4ZUI A;  1WI5 A;  3Q6S A;  3GTJ H;  2ZEO A;  1D5M C;  1BNZ A;  1X10 A;  4JBW A;  2RKS A;  4A3E B;  3H3V C;  3R95 A;  1WCM B;  1XFO A;  4OX9 Q;  2ZTC A;  3NUC A;  3WDN A;  1MSH A;  4FD5 A;  3ND9 A;  1X56 A;  3P2F A;  2OQK A;  2DY7 A;  1EWC A;  3BG3 A;  1HPC A;  2BO9 A;  2JA5 G;  4N8X 1;  1T9H A;  2F0F A;  4M6