3FMCA

Crystal structure of a putative succinylglutamate desuccinylase / aspartoacylase family protein (sama_0604) from shewanella amazonensis sb2b at 1.80 a resolution
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
365
structure length
365
Chain Sequence
VDKHEVRVGELAAGQPLSLPVYRFKGKGAGPSVYIQANVHGAEVQGNAVIYQLMKLLEHYELLGDISLVPLANPLGINQKSGEFTLGRFDPITGVNWNREYLDHGFNIEVWYQEHSHLDDDTLITAFRATLVEECARRLNNPWGVTTGHRLAVTLQSMAHRADIVLDLHTGPKSCKHLYCPEYERSAAQYFSIPYTLLIPNSFGGAMDEAAFVPWWTLAEVASSHGRELGVRVSALTLELGSQERIDLDDALEDAEGILAYLSHRGVIAETVLPKPMKRYGCFLKNYRKFHAPKAGMVEYLGKVGVPMKATDPLVNLLRLDLYGTGEELTVLRLPEDGVPILHFASASVHQGTELYKVMTKVFEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative succinylglutamate desuccinylase / aspartoacylase
publication title Crystal structure of putative succinylglutamate desuccinylase / aspartoacylase (YP_926482.1) from Shewanella amazonensis SB2B at 1.80 A resolution
rcsb
source organism Shewanella amazonensis
total genus 112
structure length 365
sequence length 365
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3fmcA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3fmcA01
2PVWA 4KSIA 4G7OC 4TNUA 2NN6I 2OOTA 2BO9A 4MRIA 2PJ6A 4OIWA 1DTDA 4EMEA 3KASA 1HDQA 1YNJC 3BXMA 4LJZC 1YW4A 2WYRA 3K2KA 5ELYA 3DGVA 4KI0A 3JRUA 3QNVA 4KHZA 4R6TA 2F1MA 3PFOA 2BE5C 4RCNA 4X3RA 3I73A 2CTBA 4F9UA 1YSJA 3LMSA 5BN4A 3KQZA 1PCAA 4HR7B 3K9TA 4KN7C 1CTMA 3PUXA 3T51B 1CP7A 4OC4A 1O78A 4OO1H 2WZNA 2ZEOA 5LYLA 2PCFB 1Y0YA 5BN3A 1TU2B 3BHXA 5HVFA 2O5JC 1R3NA 4IAVA 2PJ4A 4A38A 1XBUA 2EJFC 3FF3A 3I1UA 1XRYA 3H8EA 2PNRC 2ABZA 2AFMA 2QF7A 3GB0A 2BOAA 5D29A 5KNDA 1LOKA 3PUVA 3VARA 3L2NA 3PUYA 2D2CC 2ANPA 3CT9A 2V77A 1RTQA 2PVVA 1Q12A 3MN8A 3IIBA 1AMPA 4Q7AA 1BLLE 4NGQA 3WC5A 3ND9A 4NGRA 5KNBA 2A68C 1ZG9A 2AWOA 3M4YA 1Y8OB 3BG3A 3H8FA 3MRUA 4H13C 1JQGA 1BDOA 4PXEA 3A8JE 3OW7A 3LWUA 4F9VA 2E75C 5F09A 3FJUA 3OOCA 1Y8NB 4NJRA 3B2YA 2JBKA 3QIAA 3B3VA 3VH9A 1H8LA 4ZY0A 1HDUA 5BN5A 1Z6HA 5C0XH 4ZI6A 3TX8A 2Q8IB 4GZYC 2NSMA 1Y69U 2PE3A 3I4LA 4GM5A 1VGYA 2I3CA 4KMUC 1H9JA 4NGSA 1F57A 3ND8A 4P4FA 2RB7A 1UWYA 2C6PA 3WT4A 3PUWA 4OO1G 5JEAH 1VHOA 4FWUA 1CPSA 4FUUA 2A6ED 3PUZA 1BPMA 4UIBA 3HUVA 4A37A 4I7ZC 4H2KA 3SI2A 4P44A 1Z7TA 3FECA 1B9MA 2PJ0A 2EJMA 4X8IA 3OPOA 1TKHA 2GREA 3SI1A 4ONWA 4P4JA 4OC2A 3DXJC 3IO1A 2PJ9A 1VF7A 2EDGA 2YYZA 4NFRA 1GYTA 3NFZA 4WJBA 4PPZA 3SJGA 4P6YA 6CPAA 5IB9A 5J1QA 4P4EA 4MCQA 3TZUA 3VATA 1YLOA 2ZEFA 2A6HD 1R43A 4IFDH 2QVPA 2JXMB 3SJEA 1HCZA 3VR5A 3AB9A 3VR6A 2B8GA 3MXUA 4PXCA 3S9NA 1VHEA 3CPAA 2IJZA 3WABA 4MCRA 1Z2LA 2DNCA 1IW7C 1QJOA 3PB4X 5C0XG 3A8IE 4CPAA 5K8OA 1I6VC 3NH8A 2OR4A 2ZOGA 4PV1C 1ZG7A 3H94A 2PJ7A 4KKSA 1LAPA 1ELLP 3QG1A 5LRJA 2A68D 3FPPA 1E2VA 2A69D 1ARMA 3BDOA 3VA7A 1EWHA 5JEAG 3PBEA 4NGPA 3SJXA 2BDOA 1DD2A 2ZENA 1SMYC 3GQBA 1CBXA 4O23A 4RUHA 2E74C 4YU9A 2IMOA 1YNNC 2PIZA 3SDZA 1XJOA 2AFWA 3ISZA 3I72A 5JH9A 2O5IC 4AXVA 2EJGC 1DXMA 1V8QA 1ARLA 1CFMA 1A6XA 3KR5A 2NN6H 3A7LA 1LAMA 2C1CA 1GUOA 3B3WA 3D7DA 4OKOA 1OXXK 4MCPA 2XEFA 4UEFA 5LRKA 1TKFA 3U9SA 3PEIA 4MCSA 2ZT9C 2JBJA 2PJ1A 4IFDG 4ZY1A 2XEIA 1Z5RA 1XMBA 4FAIA 4MHZA 3PB7X 4NJQA 5K36H 4BA2I 1ZKOA 2AUJD 3EQLC 1TF8A 4F8ZA 5KNCA 4XIGS 2PJ2A 4PXDA 1GUNA 2ZEMA 3H8GA 1E2ZA 3N5FA 1GHKA 3V38A 4LK1C 1OXTA 2BCOA 1CI3M 3D7FA 3KZWA 4EWTA 2V8VA 3IJ3A 4WWVA 1FT7A 2PRQA 1OBRA 4FBEA 2CF4A 1Q90A 3GLJA 3M85A 1FR3A 3RAMA 1Y0RA 3IC1A 1IYUA 3S9LA 2Q43A 1VDZA 3KL9A 1B9NA 3D7GA 4G1PA 1GHJA 1IY7A 4DK1A 2F7VA 2QJ8A 1LABA 4NGNA 3T53B 2FVGA 2ZEGA 1Q1BA 4NGMA 4OIDA 1TXRA 3CPXA 3VR3A 4BA1I 7CPAA 2AFOA 2PJ5A 2PJ8A 2IQ6A 1TKJA 2O53A 3IWWA 4DK0A 3V7ZA 4H0LC 2Q4ZA 1TF9A 2NYQA 4DNTB 4PQAA 3KR4A 4KKUA 2BE5D 1HEEA 2F8HA 2HC9A 1QQ9A 4OGQC 3NH4A 4P4IA 3WC6A 2ZEEA 1ONLA 1IYVA 4MHPA 4P10A 4Z65A 4DYOA 3PV0A 2ZEPA 4R76A 4TWEA 3PB8X 2K32A 2G9DA 3D66A 1CP6A 3N6RA 2PJ3A 4DUKA 3KQXA 2JEBI 1K8MA 3LNNA 5D8NA 3IFTA 4IHMA 1FNOA 3CDXA 5LRGA 1F2OA 3L7ZC 4ZY2A 4A39A 3W3AA 5CPAA 4JZ0A 4ZX8A 2AFSA 2RFHA 2DNEA 1NSAA 3RZAA 4UEEA 4H44C 2PJBA 4JBWA 3VR2A 2CW0C 2EWBA 3T8WA 1OXVA 2Q51A 3B3TA 1LACA 2ZOFA 4UEZA 4W9YA 3KI9A 3FMCA 3KLRA 3T56B 1H9KA 3BI1A 2V8DA 1G291 4DNRB 4UF4A 1ZG8A 2E76C 2K7VA 3FX6A 2D5DA 5LYFA 8CPAA 2DEAA 2A6EC 3QJYA 1HPCA 2CTCA 1CPXA 3B3CA 4JYWA 1KWMA 4OP4A 3RLFA 2KA7A 2JEWA 1O7LA 3KHXA 2GU2A 2L5TA 1H9MA 2EVBA 4P45A 1E2WA 1F2PA 3RBUA 2DN8A 1YW6A 4OC3A 3DLJA 1Y8PB 3MFYA 1Z8LA 5THWA 1HQMC 3ISXA 4IK2A 2ZELA 2EK9A 3B35A 5A35A 3GD7A 2EK8A 3D68A 1BPNA 3NA6A 3FH4A 3D67A 2POKA 4L8JA 2A6HC 3VR4A 4TKOB 3PRTA 1FYCA 2PJAA 1XFOA 3IEHA 4P4DA 1LFWA 3P20A 4UIAA 4NGTA 5K8PA 2CIJA 4KKTA 1IGBA 1VIXA 2GLJA 3FEEA 2LMCB 3CRKC 1HTPA 3PBBA 1Q1EA 1H9SA 3PB9X 2V8HA 3D7HA 3SI0A 1VCIA 3NH5A 3HGBA 3KGQA 4DJLA 4OC5A 2ZEHA 3BI0A 1Y7EA 1YMEA 2ZEDA 4MHYA 1ZLIA 2R6GA 1QMUA 1PMRA 2A69C 3PFEA 4ZYQA 4MMOA 4K3NA 4R8FA 5LYIA 3IFEA 3PB6X 1ZYRC 5K8NA 2XEJA 3D4RA 3SE0A 1GUGA 3KHZA 1AYEA 3IKJA 1H9RA 4R7MA 4MXUA 3TC8A 3S9MA 2GLFA 1ZLHA 1Q7LA 1CG2A 2XEGA 1TKWB 4ZX9A 2PIYA 1IW7D 1H9SB 4KN4C 1PYTB 4TQUS 1LCPA 5LYDA 2QYVA 2PPBC 1V43A 3FEDA 2NN6G 5CBMA 2KCCA 3CRLC 1ELMP 1GUSA 5DS0A 3B7IA 4YWYA 5JM6A 3B3SA 2PJCA 3GUXA 3HLPA 2V4DA 3WDNA 4LQGA 2AUKA 3D4UA 2HB6A 1GJXA 2IT1A 4B6ZA 2JEAI 2B8FA 4G7HC 1OXSC 1DE4C 2C6GA 5K36G 3FVLA 1M4LA 2BA1A 5HVGA 2VL1A 3SJFA 4MHNA 1K8OA 2K33A 1CX8A 5K8MA 4OC0A 4OMEA 3NE5B 1LANA 2AFUA 2PCUA 2V8GA 5HVHA 2JE6I 3A8KE 4JK1C 4G7ZC 1OXUA 3D31A 4P4BA 4IQZA 5JGFA 2J9AA 4XTCS 2BA0A 3M7NA 4PXBA 4A94A 2C6CA 1BAVA 4BD9A 4X2TA 1T5EA 5I4MA 3WC7A 1GUTA 1DCZA 1VF5C 3A7AB 4EFDA 2D62A 2O4HA 2AFXA 1EE3P 4OC1A 5HXDA 2AFZA
chains in the Genus database with same CATH superfamily
5BR8L 4KSIA 4NCZA 2EYPA 1FL0A 3K57A 3PQIA 4MNOA 1XX8A 4LFAL 3GTQH 3RMHA 1BO4A 5H86A 5IGEA 1DTDA 2VW9A 3LWEA 3HOYH 4JBKA 1HDQA 4LJZC 3OTOL 2B3GA 1AZPA 2ATRA 2WYRA 3K2KA 1XWEA 5ELYA 3DGVA 4CS0B 5FLMG 1Z8WA 1EUJA 1Q2YA 4ME5A 2EYMA 2LXJA 4C2ZA 4B9XA 4RCNA 1NMFA 1VQBA 2CTBA 3GTKB 3KQZA 1SNOA 2ICIA 2KHSA 1P8LA 1NE3A 2J7ZA 1PRTB 3N7ZA 2IPKD 3T51B 4JI8L 4OC4A 4CDCC 2QDBA 1YBYA 1A0IA 4KHVA 1TU2B 2OQ0A 3NSWA 3BHXA 3MWYW 3K59A 1HZCA 2JYOA 1BBWA 4IAVA 4A38A 2HIVA 2ZW7A 4JI2Q 3S6FA 3W6SA 4KTAA 1AE3A 2PZTA 4DR4Q 4CAEA 3HP3A 3GB0A 4POGA 2BOAA 1PRTC 4ILWA 4B3RQ 5D29A 5KNDA 3T4AC 1D5MC 1PFBA 3I3CA 1STHA 1O7YA 4QJFA 3OYYA 3WOEA 3S1RH 3MN8A 2R7ZG 4MFQA 4Q7AA 4OX9L 4EQPA 2KCTA 2B63H 4V190 1BLLE 2Z3PA 4A95A 5C4JB 5KNBA 1K9MC 1ZG9A 2ZW5A 4X64Q 2TSSA 2B3UA 4AVCA 1LUZA 1Z4EA 1JQGA 2YU9B 1BDOA 3DM3A 2I0QA 4BY7B 2HUZA 4HIDA 3OW7A 4DFAA 2F5IA 2JA5H 3JAMc 3BVGA 4BINA 1NNXA 4UAIA 3GTJB 5G1ZA 2GFQA 5ELCA 2XVSA 1VQFA 1EFWA 4HKFA 1LTID 2Z11A 4IUVA 4B10A 3B3VA 4KD3A 3NTHA 3HKZB 4DV2Q 3A56A 1GD7A 1C8CA 3SXNA 1MJEA 1BUVT 5CV6A 1UUPA 2QGQA 4K8IA 5LMNL 2PE3A 1Y1VB 1RTNA 3I4LA 3CCUA 4GM5A 3J80E 1SE4A 2PMZB 4ODGA 1YK3A 2GIVA 1NR2A 4ZBGA 2K01A 4OIKA 3OWFA 3WT4A 4DR7L 4F8MA 1EU3A 3K5MA 3T9YA 1VHOA 2JA7G 2Y0SG 5AGEA 2A6ED 2OF1A 5I9PA 2AWNA 3K7AB 4N9PA 2DJGC 3Q22A 1U4RA 1J8IA 4I7ZC 2CNMA 2RCFA 2EE1A 5F47A 1RIPA 4JI5L 1EZ6A 4R4IA 1Z7TA 3FECA 1B9MA 3QR8A 4BWGB 4DNIA 1MGSA 3OPOA 2GREA 3L3OC 1QOHA 4V0BA 1X12A 1EYAA 4KS9A 4P4JA 3IO1A 4JV5Q 4NXNQ 3AYHB 1AFPA 1HZAA 3ULJA 5IY0A 3FB3A 1FJGL 3NFZA 3S1MH 1XNRQ 2YGWA 5IB9A 4Z9CB 5J1QA 4P4EA 1FNUA 2ZXVA 1SMXA 2SNSA 4AQYL 3S16H 1LTAD 2A6HD 3S15H 1R43A 1L1OA 3F8TA 3R93A 4IFDH 4RGMA 2B5GB 4CAFA 5JQ4A 1D1KA 4BBRG 1HCZA 3VR5A 4E0AA 3AB9A 1OTCA 2REEA 1VQCA 4HTHA 3AQQA 2B8GA 3CXQA 5J8FA 3S9NA 4Y7NB 2GN5A 2JEVA 1VHEA 2VNUD 3LD2A 4MCRA 3E0KA 3IFDA 3KF8B 3W2DA 1U4MA 3BU2A 5IODA 5C0XG 4RAUC 2PZWA 4CGPA 1I6VC 3NH8A 2O2LD 2OXPA 4JI0Q 2QILA 2PJ7A 4KKSA 1K3RA 3QG1A 5LRJA 3CPWA 2L1BA 2A68D 2J8MA 3CCSA 1WTWA 2JDDA 2VBQA 3HFZB 1PH8A 1N34Q 2HHHQ 1ARMA 4H6ZA 1PHJA 1EEID 2ALYB 1SYEA 1ASZA 3FIXA 3NENA 2M00A 1GHEA 4XQJA 1ZYRD 2ZTCA 4YY3L 4OWWB 2JA6H 1G6ZA 2ZENA 1YVCA 1VQGA 3GQBA 4U68A 3T1HL 5COYA 1O7IA 1XPRA 1PH9A 2R7HA 4RUHA 1I4GA 3I4NG 2A5HA 1SNQA 3MEHA 2B3VA 2MO0A 2YV5A 2PR8A 4L6TB 1SJHD 1SQHA 2AFWA 3QAHA 5IYBG 1VKCA 5JH9A 5DM63 1HHVA 4AXVA 3A5ZB 2EJGC 1CFMA 1XMQQ 1KABA 4GN3B 2A19A 4DXFA 4E8OA 2WV6D 2NN6H 4K6DA 5DLQE 2MO1A 1D2BA 3D3SA 2UXBQ 3B3WA 3H3VC 1CJWA 3IU2A 4OKOA 2R93G 1TS4A 1HR0W 3J7ZC 2K4KA 1CA6A 4C2MH 4UEFA 4FF3A 4IUTA 5IWAQ 2KJXA 1N8RC 1I1DA 2B2WC 4JXRA 2L55A 3PEIA 2ZT9C 2PJ1A 4MCSA 1HQRD 3NE8A 4KJNA 2XWJB 3J80i 4M6GA 3SEBA 4UP8A 4FAIA 3PB7X 4NJQA 5K36H 4JI1L 1YJWA 3V2TA 2Z0SA 4XIGS 4BY1H 2PJ2A 4K6LA 3R95A 5M3MH 4JI6Q 1PTOH 3N5FA 4RKLA 3VYSA 2DPTA 1QB5D 1RJTA 2BH2A 1FNWA 2BCOA 3D7FA 1CK1A 2YTYA 1H95A 4HPSA 4BBHA 4C3JG 4JCVE 4X6AH 5JJLA 4FD5A 2AKWB 4WWVA 3NBHB 3TP5A 3UE0A 3G48A 4FBEA 2K50A 1Q90A 1O80A 3GLJA 4AG7A 2OZHA 1DOLA 1PU9A 1Y0RA 1XJVA 2N55A 3H0GG 3HOVB 2K52A 3O13A 1VDZA 4RHSA 5D65A 3TBIB 5FJ8G 1II3A 2F7VA 2HQYA 3PO2H 4X3TA 2QJ8A 4JI4Q 4NGNA 3T1YL 1KDCA 2FJ2A 4PSWA 2ZEGA 3GTLB 1A62A 4NGMA 1GO3E 3CPXA 3NHHA 4IUPA 1SJED 3CCJA 7CPAA 2PJ8A 1ESFA 4UCNA 2O53A 3IWWA 3M9BA 3H91A 4RHRA 4A3MB 3EFXD 4DNTB 3J80c 3CP0A 5L37A 2F0FA 4QY7A 4A3DH 1A3VA 1JORA 1RHPA 4FXKC 2HC9A 5AFWA 4BBRB 1V1QA 4F7XA 1IYVA 1G91A 2ZEEA 4KOXA 4P10A 5DWMA 3PV0A 4TWEA 3PB8X 4QC6A 1CP6A 3J7A5 2WB1G 3CMEA 4QIWE 3N6RA 2PJ3A 1B4OA 2NBFA 1WI5A 5EAYA 5IIFA 3FRMA 3WR7A 3LNNA 4IHMA 1FNOA 4ZY2A 4A39A 3B8GA 1QSRA 1MHWC 1VQ4A 4IO9A 4DAYB 2KHJA 4B3SL 1SYCA 1Q82C 2EYFA 4DUZQ 2I07B 4WJ3M 4LFCQ 3B3TA 2R8VA 4IUSA 3W1BA 4XPDB 1P4NA 5JJIA 2V8DA 2VUMG 2E5LQ 4DNRB 2Z3MA 3G7LA 1V1OA 3I4NB 1RL2A 2ZJQA 2D5DA 4OONA 1HNXQ 3GTMB 1XE4A 1HNZL 1LRZA 5KYIA 2F3IA 2OH1A 2D0PA 3TE4A 4P74A 4JYWA 3CQZB 2HCIA 1WOCA 2JEWA 5IT9E 1O7LA 1R4QB 1TS3A 4DR2Q 2DXQA 3KOJA 1N32Q 4A3BG 2YNCA 4ZQ3A 2DN8A 4LF5Q 5FO8B 5M5WB 2PQAB 1SE8A 2J4XA 3E9HA 2JQOA 2RSNA 2R93B 3DLJA 1Z8LA 5F46A 3MFGA 3KDFA 1PFMA 4C1NK 2ZELA 5J39A 5A35A 3GD7A 3K6OA 4FDBA 1BPNA 5HXDA 2F0PA 3PIO3 3UE1A 1JR0D 3JAML 3C1FA 1VQMA 4MY3A 4TKOB 3I90A 2I5LX 2JA7H 3J81L 3IWEA 2E2IB 4KOSA 3EN2A 3HOUB 5EBVA 4YHHL 1L0YB 1V0CA 3OIQA 2LMCB 2VEZA 2JN4A 2V1CC 4DR5L 4B13A 1Y9KA 2IW3A 2HUGA 4K8JA 2NMTA 3HOWH 3S6GA 2VB3X 2EUIA 4MTKA 4RI1A 1VCIA 3U9OA 2FXFA 1UNSA 3D6CA 4C7IA 3HGBA 4DJLA 5HGQA 4OC5A 2ZEDA 2ICEC 4MHYA 3C1EA 1EYDA 2H5MA 1RODA 3M4PA 5CBAE 2UUAQ 3NELA 3STBC 2G0BA 3G71A 3PO3B 3EXNA 3EFAA 1L0CA 4ZLTF 4QVTA 4X65L 4Q5VA 2NVXB 1HA6A 3T13A 1C4QA 5CMDA 3Q24A 2XN9C 2QEXA 2F3VA 4R8FA 2K6AA 4H6UA 5K8NA 2XEJA 1LTLA 1YLEA 3CXCA 1IB1E 2CCZA 1M4GA 3K58A 1AYEA 3GTPB 1A3UA 4XNHB 1F2MA 4PMBA 4WORA 2NZHA 3D8GA 5JJZA 1A2ZA 4FNFA 4ZX9A 1H9SB 4LMQD 1JE5A 1FGBD 4L63B 1PYTB 5EPKA 3HRZC 2DUDA 4KY7A 2PPBC 3WOFA 4XNHC 1I4XA 4GOPA 1FD7D 1S5KA 5C5LA 3QAYA 1JICA 4KORA 1EIHA 1ELMP 1Q46A 5E7NA 1ILQA 3KLWA 5DS0A 5C3EG 3GTOB 1HZ9A 5M5XH 5EQ0A 4MZ9A 3WDNA 1EIYB 1MJCA 4U9YA 2AUKA 3I2ZA 5ELDA 2HB6A 2IT1A 1HUNA 4HIOA 1PH4A 2B8FA 4G57A 4H02A 1DE4C 1NMTA 2AQ3B 3QOJA 5IYBH 2OWOA 1YEZA 2ZM6L 3HS0C 1N71A 1K8OA 4LF8L 3HZXA 4CJ1B 3P75A 2I00A 4DR3L 3ITPA 2AFUA 5CV7A 1K83B 4KLWA 4CGMA 5HVHA 1LTTD 2K5TA 1YX0A 4MY0A 1HUMA 1JOKA 2O4XA 4IQZA 4CGOA 1E1OA 4XTCS 4YIJA 5TSSA 2A8VA 3MAQA 3DDDA 1BAVA 3IU1A 1D5ZC 2B4DB 5F48A 1XEBA 1KAWA 3AMUA 1DCZA 1PTOF 3TOBA 2D62A 2DY7A 3RUZA 1QCBD 1Z8XA 2KCMA 4OC1A 1Y1WB 1WD1A 2BH8A 3BDLA 1X3QA 2AFZA 4N8FA 2PVWA 1J6QA 4G7OC 2NN6I 5BWAB 1NBWA 4ORFA 4MRIA 3UY5A 3GKRA 3G4SA 4JI7L 3OMGA 4R4QA 4DF7A 4OADA 2ZTEA 2KENA 5CGKA 3BXMA 3QWNA 2D4PA 4KI0A 4C3JH 2CH4W 3A54A 4NEXA 4YGOA 3QNVA 1JC7A 5IV0A 4R6TA 2JK8A 2RCNA 3ULLA 2QECA 2Z3NA 5IGDA 5HH1A 1ICFB 1HNWL 2EO8A 3FNCA 4F9UA 1Q8KA 1YSJA 3LMSA 3H0GH 4HR7B 2UUCQ 3K9TA 1CTMA 4K2LA 2BOSA 5JPMC 5FJ8H 5EMIA 1X3PA 2I5MX 3PUXA 1CP7A 4LF7Q 1LM0A 1BO0A 4P75A 2Z3KA 1R9TB 1XF8A 2PCFB 4CKCA 1L1OB 1Y0YA 4GS4A 2B2VA 3S14B 2NZ1D 3KLSA 4P2CB 2DF5A 2IX1A 2PJ4A 3S9WA 1A15A 1XBUA 2EJFC 3CC2A 3TP8A 1UWVA 4PSXA 3GP7A 4DR1Q 3M7GA 1TWFH 2WSAA 3ZJ0A 5BR8Q 3PUVA 4LFAQ 2XRSD 1L1OC 2D2CC 1C0AA 1KXLA 2V77A 1U5KA 4IALA 3OTOQ 4L5TA 3M4QA 4DV0L 4K0KL 3NBIA 4DV5L 4MHDA 4HIMA 4NKLA 3WC5A 1X3GA 2A68C 2WAQG 5C4HA 1HR0Q 3GTQB 3MRUA 4LF6L 1BBXC 1JOQA 5IGBA 4HCEA 4PXEA 3IL8A 4HMIA 2E75C 4JI8Q 4A3IH 2PW5A 4DV3Q 1I4QA 4B14A 3FJUA 3P2HA 1Y8NB 3J80L 4LW1A 2WP8J 3Q0AA 4CYOA 1H8LA 4ZY0A 1HDUA 4BY7G 1YGHA 2ZTDA 5JEAJ 1U4PA 3TX8A 2PDOA 5ISRA 4NW2A 2Q8IB 3EVQA 1G8ZD 4GZYC 2YNDA 1RF2D 2L11A 4DV4L 1TWGH 1IBML 2VQYA 2RBMA 4CJ0B 4KMUC 5EJWA 2E2JB 2VUMH 1JT8A 1HTLD 1VGYA 1F57A 2OQKA 3HKZG 2C6PA 2F0WA 3PF5A 4OX9Q 3T90A 4FXGC 4OO1G 2HD3A 1WJJA 4FWUA 1S7KA 1Y1VG 4FD7A 4FUUA 4DUYL 1RKNA 1CKNA 1YI2A 1RXTA 4UIBA 1AE2A 3HUVA 4UWIA 4QIWB 1Z9FA 2SEBD 1F9PA 1MSGA 2F0LA 1IXRA 5E4XA 3SR1A 4A3BH 4CGLA 4B3TQ 4C68A 4GN4B 2EJMA 5KGUA 1OZPA 1TKHA 1R57A 2A4NA 4OC2A 1VF7A 2ZW4A 2JA5B 4FF2A 1GYTA 4DU9A 1PH5A 4PPZA 4HAEA 4P6YA 6CPAA 4IPGA 5KTDA 2R7DA 2PI2A 3V96A 4MCQA 2Q8RE 5M3FH 1YLOA 2A74C 5LL6X 3F2CA 1XNQL 1K28A 1Y14B 3CU7A 4JD6A 3S1NH 4GLXA 4DR7Q 1MIUA 1EY8A 4PQXA 3E0JA 4RG1A 3VR6A 3MXUA 1RO5A 2JA9A 4FXDA 2EXDA 1PZJD 2B2UC 1EWIA 4K5VA 2E2HH 2FCKA 1KUXA 5IP7G 1QJOA 3OWEB 4C1NI 5AG5A 4NSQA 5C3WA 5K8OA 3SXHA 3UDXA 2EIFA 2OR4A 3BVZA 2HDMA 4RMFA 1XOVA 3DLLA 3ONAB 1LAPA 3CCMA 2EY6A 4CKBA 1JOOA 3FRPB 2AJ6A 4OAEA 1TWHB 1W6KA 4L8AA 3JAMi 5KEEA 3STBD 1X9NA 1PYSB 3NQTA 3J81i 1CA5A 1FJGQ 1EWHA 1SFOB 4CYQA 5JEAG 1N36L 2AHOB 3D8PA 1AUGA 1QSTA 4NGPA 4AQYQ 2BDOA 3KF6B 4GKKL 1CBXA 4O23A 4KUAA 3CCLA 1WWZA 1LTGD 2DY8A 3BDCA 4HJ7A 4O0AA 2PIZA 1V1PA 4K2KA 3SDZA 1TWAB 4ALPA 3OW2A 1I12A 3S2DH 1XJOA 3DSBA 1JCKB 5IYCG 3ISZA 2JJQA 4X62Q 4A30A 2ZJPA 3S16B 3RZDH 2FFKB 3S15B 2WAQB 4A3KG 3A5UA 3OSOA 1AW7A 4DR6Q 2RDHA 3I4OA 1A6XA 3A7LA 2L4NA 2C1CA 4EVYA 5FVJA 1I6HB 1VQOA 2CVRA 5IP9G 3DWQA 2PI2E 2ASBA 5EC4A 5KIXA 1KHIA 3U9SA 3NXWA 5C3EH 3DEOA 2KEDA 1J9OA 4ZAIA 5KYLA 5LMUL 5C4XB 2J8NA 3RLOA 5C0XI 4BXXG 3E5SA 2XWBB 4WRDA 5E4WC 4DN4M 1YREA 1ENCA 4F6AA 1YHQA 1SBBB 2EYOA 1EOTA 4APVA 1W6JA 2VQEL 4JYAQ 3FXTA 4NXML 3KKWA 1IYKA 4BA2I 2PSWA 3PP9A 4F8ZA 3J81c 3H09A 2B2TA 1GUNA 2ZEMA 4PZ8A 1EQTA 1JWUD 2QEJC 4JWPA 4LF4L 3V38A 3NWSA 1XTCD 1TQOA 1CI3M 4EWTA 2UXDL 4LX9A 3KDFB 3IJ3A 1EFID 2B2YC 1N33L 4UFVA 1EEFD 3H4QA 3VA5A 3TO9A 1QVCA 4B3MQ 1OBRA 1VQIA 4FD6A 2I46A 2FMMA 5FLXE 4P73A 3QB8A 3RN5A 3RAMA 1R4PB 3P1HA 1PH6A 2UUBQ 3H6MA 4GKJL 2H4OA 3I4MB 3S9LA 3KL9A 4NB3A 3VYUA 5CNPA 4A3EG 2HIXA 3FKIB 3K0YA 2PYKA 4ZKCB 2FVGA 1S5DD 1B44D 2QDLA 4OIDA 1TXRA 5K5PA 3I3GA 4BBSH 3D4DA 1U4LA 1O7ZA 2Q2HA 1KAAA 1KC8C 3S17B 1M1DA 1WTRA 3HOVG 4A3LG 4JVZA 4H89A 2I79A 3N52A 3R2IA 1WTPA 4JI1Q 1SN8A 4KLKA 2NYQA 3Q23A 2F0TA 1BF4A 1KZFA 5HGTA 2NVTB 3KR4A 1ET6A 2F0JA 1F9QA 3WC6A 4B9WA 1QQ9A 4QB9A 3NH4A 1SSOA 1YIJA 4XT1B 4MHPA 1EIFA 1NY4A 4F0XA 3KBXA 4A3MG 2K32A 3F8KA 1IL8A 2CWPA 3S1QB 4LQ6A 2IHFA 1GUWA 1GM5A 3GTKH 4UP7A 1K8MA 2KVMA 3OIPA 4P72A 3IFTA 3D2MA 4UDUC 3CDXA 4YWMA 2Z4IA 3W3AA 2F0NA 5CPAA 4ZX8A 2DNEA 2WB1E 2X7BA 3TQYA 3RLNA 4AH6A 4UEEA 1NCVA 4H44C 1EL0A 1PTOC 2PJBA 1VHSA 3LACA 1S5BD 4QF4A 1U6MA 5T1GA 3DWPA 2ZOFA 2XGTA 3GY9A 3KI9A 3R3OA 3FMCA 4LUVA 2H1EA 4GOPB 1TIID 3BI1A 4KY5A 1F2ZA 3I7FA 5CV9A 4CYPA 1LO5D 4UF4A 1J5EL 2KQ3A 3KLSX 4B5PB 4EVOA 2DGYA 2C9OA 3GIUA 1S4ZA 2CTCA 2IX0A 4K14A 2CY2A 4B3RL 5C4JH 3J7AV 1JJGA 3EY5A 1KWMA 4OP4A 4UP9A 2OT2A 4A3KB 3KHXA 4GOPC 3R1KA 1H9MA 1PLFA 2YU9H 1X3EA 4DAVA 1CHQD 2WKCA 4YCVA 1F2PA 2MQHA 3RBUA 4HJ5A 2MUYA 3GTJH 3MFYA 1Y8PB 1SRUA 3JVNA 4IK2A 3MXNA 3U50C 4M6IA 5IE8A 4AIMA 2EK9A 3B35A 2D9UA 2R7FA 2NVQB 4A3JG 4B3SQ 2F0OA 4R8IA 1BBUA 4EQ5A 3FH4A 4J1MA 1QUQA 4LAAA 3R8BA 1EYGA 1B1ZA 4UFWA 3PRTA 5G21A 2OB0A 4A3FG 4CDEC 5DEHA 3U4ZA 1PH2A 4FYDA 3P20A 4L5SA 1LFWA 3GV3A 4JOIA 2WUUA 4P4DA 2CIJA 4UIAA 4DV2L 1STGA 1D5XC 2XSCA 1HNZQ 3R96A 1HH2P 1DONA 1YVKA 2QIRA 3HOXB 3K7UC 1TXYA 4L5QA 5G3LF 1BOSA 3HG9A 3K7AH 4A93B 5JPHA 3ICEA 2C27A 1Q2CA 4NPSA 3HOUG 2P5ZX 2FIAA 1KNEA 2EPBA 2L9HA 4YCWA 4DV6L 3BI0A 5I9OA 2H5XA 4CRYB 4A3EB 1YR0A 3SK5A 3GYAA 2A69C 4KJOA 3R9FA 2NVYB 2MFIA 4F87A 4K3NA 5LYIA 2EZVA 3L2PA 3IFEA 3PB6X 2K03A 4X3KA 4HIKA 3D6WA 4MFPA 2SDFA 5I6YA 4M8AA 4DK6C 4KOYA 3PO3G 3CW2C 3TC8A 4ZKBB 1EZ8A 4XXEA 4YHHQ 2GA4B 4H7BA 1KQSA 4NXNL 5C4ZA 1W2BA 3RZOB 1ZLHA 3A55A 1CG2A 4DR5Q 4ME3A 4ZRZA 1PH1A 4RWSC 2VI7A 5FO9B 3MTSA 2X6LA 5GQOA 1CM0A 4Y7NH 2EYLA 5FLMH 1LCPA 5FLXc 4AB7A 1JWSD 4HJAA 1QSOA 3FEDA 1JQYD 1I50B 2MGSA 3ERSX 4KD4A 2RDGA 2KCCA 5LMNW 1SYDA 1CZWA 4M85A 3CRLC 2NB0A 2GVBA 5FOBB 1E24A 3DHQA 4B5OA 1CQFA 2JP1A 4UBRA 3TMEA 4X65Q 1UE7A 3B3SA 4Y49B 2KOLA 4ABNA 2F3WA 2WIIB 1GJXA 1F77A 1NSLA 1M1KC 1PZID 2JEAI 3A9LA 4A31A 3FVLA 3ERQA 4HCSA 2K33A 3KK7A 1W3SA 1WTVA 1B3QA 2WACA 2LS01 5D3IB 1I4PA 4PMWA 4Y49C 1WYDA 4GNXA 2HHHL 1WK4A 2UXCL 2V8GA 1ENAA 2HDLA 5IP9H 3A8KE 2G3AA 4G7ZC 1OXUA 3D31A 4P4BA 4RA8A 1VS0A 4DK3C 1VQ6A 2R7ZH 2F52A 4A94A 4PXBA 1E22A 4BD9A 2RA4A 4X2TA 4BXXH 5DNFA 3SXOA 5I4MA 4RH6A 4IPHA 2EY5A 3CZXA 3TEHB 4A75A 3R9GA 4FP5D 2P0WA 3CPFA 1QILA 1HFNA 2VZYA 1CKNB 1PFSA 1BXTA 2LY7A 2ZPAA 2OOTA 3CC7A 1SR3A 3RYOA 1HZBA 2PJ6A 4OIWA 4R57A 4A3JB 3KJOA 2UXBL 1TVXA 1YNJC 4II9A 4L5RC 1KUVA 4M1UB 4R4TA 4UHVA 2F0DA 2ZM6Q 1Y1WG 3JRUA 1XPOA 5EBCA 4LF8Q 3GV6A 4K5WA 4QMGA 4A3FB 3PMFA 1I4HA 5M5YH 5FO7B 1E0BA 1S5ED 1X55A 4KN7C 4I49A 1KNAA 2M2LA 1Q3LA 1EY6A 4RGNA 3TO6A 1BCPF 1PH3A 2WZNA 5LYLA 1NMGA 2B29A 1BOBA 1UE6A 3S2HB 4FVMA 5CC4A 1DJRD 2N8NA 2EYHA 1Q81C 3HOZB 3FF3A 4A3LH 4C3IG 3H8EA 3AEVA 1SYGA 3SVMA 2ABZA 3MVVA 1DOKA 2M9VA 4BMHA 2F0IA 3IRBA 1PZKD 2E8GA 4JI7Q 3GTLH 2ID0A 3BVMA 3L2NA 1B87A 3CT9A 5M9OA 4DAPA 3TS0A 3CXPA 1Q12A 2EY2A 3IIBA 2KUMA 1K4JA 1YQEA 1KDAA 1PRTF 2KCNA 4A3MH 4NGQA 1VQEA 3M4YA 5C6AA 1Y8OB 3BZCA 1HNWQ 3H8FA 3S6HA 5AJ3Q 3C46A 3P7JA 1ICWA 2EXZA 5JPNC 4F9VA 3JTKA 4BBRH 1M4IA 2Q4VA 1UEAB 3SK4A 1IKMA 2Q04A 4N8X1 3QO2A 4NJRA 2IY5B 3B2YA 2JBKA 3QIAA 1S7LA 1BR9A 4Q0FA 1V1PB 3HOYG 2R92B 3W6XA 5BN5A 5C0XH 4ZI6A 4X66Q 3GTGB 4JPBW 1PTOD 1B7YB 1IBLL 1Y69U 2PW7A 4LFBL 3DNSA 5ELNA 1B53A 1I94Q 4NXYA 4XPKA 4NGSA 2L12A 4J6HA 3ND8A 4FF1A 2OZGA 4MFJA 4P4FA 5I2XA 4CGNA 4ZGYB 2RB7A 1N9WA 1UWYA 4K0KQ 2LXKA 3RNUA 2CH4A 3MGDA 1TWCB 4LWCA 2Q2TA 5CV4A 4PV6A 3E6ZX 4WJWA 3CC4A 3M4OB 1BPMA 4LF6Q 2R61A 4A37A 3HKZE 4XYQA 4E6IA 3I70A 3KF8A 3I4NH 4BS9A 3M3YB 3SI2A 5GCNA 4P44A 3GTMH 3SHLA 3NP8A 3TN2A 2PJ0A 4IN3A 4O1NA 4DV7Q 5AG6A 4X8IA 4IFDJ 2PMZE 3CQZH 2AQ2B 4ONWA 3K5LA 3SI1A 5KTAA 2E5LL 3CCVA 1PUAA 4PK2A 1PYBA 2PJ9A 4L89A 2EDGA 2YYZA 1Z47A 4NFRA 4UWJA 4EX5A 1DOMA 4Q38A 4R9MA 5M5WH 1KDBA 5GROA 3SJGA 3PIOA 2R93H 3T16A 4DV4Q 1IBMQ 3RD4A 3TZUA 2B2TC 1VMPA 2VQFQ 4XYOA 1RCVD 4GS3A 1QZHA 5E3FA 2RHSB 2MJ8A 5D14A 2JXMB 4AYBE 4DR2L 3SJEA 4C2XA 4XDXA 2RF4A 1EY0A 4X3SA 2JA5G 1SAPA 1HRJA 1M4VA 4IPCA 5JVG3 1K8GA 1ASYA 2Z3LA 1A2TA 4DUYQ 4A3GB 2B2WA 2IJ0A 3CPAA 4RS2A 4U9ZA 2IJZA 3WABA 2D0OA 2YTVA 1S40A 2E2IH 2F4VL 2Z0ZA 3TT2A 4DAMA 2DNCA 1IW7C 3HOUH 1G6PA 2ZW6A 3PB4X 3A8IE 4CPAA 1STNA 4OO1I 3ER0A 1LYLA 1KTKA 4F88A 4PV1C 1ZG7A 3H94A 1I3QB 1DZ1A 5E1FA 1LT3D 4HEDA 1Z4RA 1E1TA 1I5FA 1EYCA 3FPPA 1E2VA 1EOVA 2JA8B 4MI4A 1STAA 1CM9A 2A69D 3BDOA 3MZ5A 2REFA 2GVAA 4C3IB 1WTOA 5C44B 2N78A 4KK7A 3PBEA 3SJXA 1SMYC 1XNQQ 1YZ6A 3PO3H 3K81C 2NWGA 3D4WA 5ELEA 4DKAC 5IT9c 1B70B 1ZXTA 2NVXH 2FHTA 1LTRD 4C3HB 2IMOA 3D2PA 3EA6A 1MK4A 5A28A 1YNNC 3LGJA 5KTCA 3F1ZA 5HURA 3CCRA 3QB3A 3I72A 2O5IC 4G4KA 3GTPH 1DXMA 1V8QA 3KUPA 4HJ8A 3NPPA 1WCMB 2FSRA 3FEWX 2AE6A 1A2UA 1LAMA 4DPGA 4CHTB 3R9EA 1GUOA 3H15A 1PXUA 1NTGA 4QB4A 5A27A 2FIWA 2F0EA 1VQ9A 1OXXK 4MCPA 1A63A 2XEFA 1TIQA 4OL7A 4PG3A 3PF4A 1TKFA 4JXQA 5LRKA 3OMCA 4TRDA 2HV2A 4ZUJA 2E2HB 1YHBA 3PCOB 2JBJA 4IFDG 4O42A 3C2PA 4ZY1A 1Z9UA 4NF1A 3VDYA 4CRZB 2XEIA 1Z5RA 3CCQA 3I55A 3HOYB 3J81j 1N36Q 4MHZA 1SYBA 1QZGA 1SEBD 3GTOH 1ZKOA 3TO7A 1TF8A 2PO4A 2KHIA 5KNCA 5FLXL 5C4XG 4YRHA 4HNXB 4PXDA 4U5YA 4CAXA 3H8GA 1E2ZA 5T1IA 1WTXA 1IIDA 1GHKA 4MN3A 4LK1C 1OXTA 2HT1A 3SHPA 2IL8A 5D3DA 4PK3A 3E9IA 4A2ZA 3E3XA 1T5XD 1FT7A 1D6EC 3VWDA 2BDNA 2CF4A 4ZK9B 3K9UA 2KBNA 2MPMA 3M85A 1PA6A 2OU2A 3BJ7A 1F2YA 2JLMA 1K83H 1CKOA 4FD4A 1Y9WA 2Q43A 4G1PA 2G5DA 2K5DA 2SNMA 3SGIA 1LABA 3ZYYX 1RTOA 5LMUQ 4DXGA 3F5BA 2ARHA 3H3VI 2Q4YA 2Z1CA 1SXTA 3VR3A 1X6OA 4BA1I 2L0CA 2PJ5A 3W5OA 2IQ6A 4NP5A 3S1RB 3I4MG 1TKJA 2VQEQ 4NXMQ 4F0YA 4H0LC 1Y1WH 3FKIG 2B63B 1E3PA 1YNJD 2Y0SE 1ZO0A 2K14A 2EYJA 3CXSA 2UU9L 2NTSA 3V05A 1C48A 5HY6A 4LF4Q 2F8HA 1HEEA 1S60A 4OGQC 1VQ5A 3JUWA 5EKKA 3RN2A 1PDQA 2L15A 3X3MA 3I9SA 3RO0A 1N33Q 4DYOA 4R76A 4P71A 4A76A 5LMNQ 4PMCA 2G9DA 3JC66 3KFUA 4GN5A 2OZUA 1JB7A 4LF9L 1LT6D 5IX3A 1Y7RA 4R3KA 1MJ9A 4DUKA 4GKJQ 4QBJA 2JEBI 5D8NA 3WWVA 1AN8A 1F2OA 3UI2A 3TP6A 1R9TH 1AEXA 2QW7A 1QWYA 3S14H 5M3MG 1NSAA 2KEEA 3NEMA 3VR2A 5CR3A 3G8WA 2CW0C 4JI5Q 5I6WA 4YCUA 2K28A 2Q51A 3HKSA 4LF7L 4UEZA 4X5KA 4W9YA 2Z3OA 1H9KA 1G291 2VL6A 4CDDC 2B4BA 1F9SA 2K7VA 5LYFA 2DEAA 1BCPB 1KRSA 3QJYA 4OEMB 1IKLA 3I91A 3B3CA 1E7ZA 1X56A 3SK8A 1M4DA 2BL1A 5H1SE 2F0VA 2KA7A 3MA2B 2F0GA 4TVAB 4WFN3 3J7YW 1IBKL 2Q7BA 2GU2A 2OTLA 4AVBA 2EVBA 2X69A 1E2WA 2NZOA 2I5HA 5JJKA 3DM1A 3S1MB 1UE1A 4J8QA 1XPUA 2DJFC 5EGTA 1VQDA 4A3CG 1BCPC 1EQVA 2K04A 1YW6A 5A2QE 2B58A 4OC3A 5THWA 2F0SA 4KOUA 4A3DG 4OWTB 1HR0L 2CNSA 4GNXB 4QUFA 1BQQT 1Z8TA 4OXPA 1QNUA 3NA6A 1CHPD 3V8IA 3VWEA 1I4RA 3D67A 2F0QA 1IICA 2POKA 4YWLA 3VYTA 4DV3L 2G3TA 4L8JA 5J1ZA 1NJIC 4A33A 3VR4A 1VQ8A 2PJAA 1XFOA 2Z4HA 1KIXA 1C7YA 4I7AA 1IHZA 3K80C 2R3ZA 5CBEE 1QVGA 1J5EQ 1YJ9A 2E2JH 4NGTA 5K8PA 4GNXC 4KKTA 1IGBA 4KHPL 1VIXA 2GLJA 2GE3A 1HTPA 2PNHA 3PBBA 1VQKA 5EPJA 3W1GA 1KUYA 1F9RA 4OLLA 1H9SA 3PB9X 4YY3Q 3PIP3 4KOWA 1ZEQX 3TTHA 2BUEA 3T1HQ 3GO5A 3D7HA 3SI0A 4A4IA 3CF5A 1EQQA 3NTKA 3NK9A 3NH5A 3SK6A 2Q8TA 1VQAA 2QKIC 1YMEA 1KLGD 3X3NA 4KVOE 4JJXA 1EIGA 1ZLIA 2JA6B 3HOXG 4IPDA 1XIXA 1ENFA 1GKHA 2OCEA 5C0XJ 4A93G 4ULLA 4R9WA 3E0EA 5I4DA 4C56C 3BLNA 2A73B 2YNCC 1LTSD 3SE0A 3KHZA 4B3TL 1KRTA 2ENBA 2QMLA 2FMCA 5J22A 4R7MA 4JBMA 4MXUA 4JI3L 1RDPD 2F0KA 4UA3A 1X54A 4B11A 2NTTA 1EQRA 3MXPA 4R4CA 2GLFA 2VXKA 4A32A 1Q7LA 1TKWB 4FF4A 2PIYA 1IW7D 4KN4C 1UFHA 2RQXA 2IWHA 4C2MB 2K5HA 2P6GA 4DV1L 3OHXC 3DWAA 3TDQA 2QYVA 1MI2A 1VMCA 1V43A 2B4DA 5CBMA 2RKSA 2IHEA 4DV6Q 1QNKA 1XMOL 1BNZA 1KL9A 4XPLA 1GOZA 4PNYA 5ELBA 1SNCA 3F2DA 1TR5A 4YWYA 1BVSA 3GUXA 4BY1B 3HLPA 1TWHH 3I8ZA 4LQGA 1HXYD 5M3MB 3D4UA 1PTOB 4IJLA 3EC4A 1SMYD 1WTHA 4AYBB 3EJIA 3LODA 4B6ZA 4U673 1OXSC 4G7HC 1QVFA 1TT2A 1SFOH 2ES2A 1ESRA 2C6GA 1M4LA 1U0LA 5CYUA 5HVGA 3HOWG 1YNND 3CD6A 3SJFA 2HCCA 2MHVA 2QA4A 5J8CA 1VQNA 4FO2A 3T1YQ 1XXGA 2CQAA 1YHAA 3S24A 1CQVA 2WPWA 3NE5B 1LANA 5HMNA 1TY0A 1IYJB 2FINB 2PCUA 1L2FA 3FPUB 1TWAH 5JGFA 3PO2B 1K3BC 1ON0A 4PZ7A 4HN7A 2J9AA 2BA0A 2C6CA 2HQLA 4NMZA 5IT9L 3I56A 5CORA 4YWKA 3WC7A 1VQHA 5G3LD 1JJ2A 3A7AB 4EFDA 1I6HH 2O4HA 1FNVA 4JI2L 4ID6A 2AFXA 4JC0A 1EE3P 1PVOA 4DR4L 1EY7A 4X62L 4JG2A 3PIPA 1EY9A 4TNUA 5C4XH 1XYIA 2K5VA 4PZ6A 5EKLA 2BO9A 4A3DB 2JSOA 5EPLA 4DR6L 4CYNA 2B39A 2CXAA 4EMEA 3KASA 4BY7H 1STEA 1YW4A 1JJCB 4KHZA 1P16A 4Q36A 5DWNA 2F1MA 2IL4A 3PFOA 1SNPA 2BE5C 1S3OA 4MJ8A 4X64L 4X3RA 3I73A 2ZXPA 2NUCA 2UXCQ 4R8NA 1B3AA 5BN4A 1PCAA 4WJ4A 1AH9A 1FY7A 4JYAL 1LT5D 1O78A 4OO1H 3U58A 5LL6S 2ZEOA 4MFLA 1Y1VH 5BN3A 5HVFA 3EIVA 1PYWD 2O5JC 1R3NA 1MKHA 3TSSA 3C3LA 2Q0YA 3I1UA 1ET9A 3I4MH 1XRYA 1A3TA 2PNRC 4HSPA 2QF7A 2AFMA 3L0OA 2R7ZB 3AFQA 3FKIH 4RFBA 1LOKA 2CFMA 4B3ML 3VARA 3PUYA 3TS2A 3IWGA 2ANPA 2NYZD 3HOZG 5AG4A 1GVPA 3S17H 2UUBL 1RTQA 2PVVA 4KOTA 1AMPA 4J3GA 4YFJA 2Q2IA 1NSNS 2RHQB 1FVIA 3ND9A 3IAYA 4NGRA 2AWOA 3BG3A 1LT4D 4QGUA 2RVLA 4MBUA 4H13C 1S7FA 2NVTH 2PQ8A 1JMCA 1UE5A 3A8JE 3LWUA 4UY8C 2CNTA 1FGUA 5F09A 5I0CA 2CWAA 2ZXRA 3OOCA 2RC4A 3S1QH 1G2SA 3F2UA 4JW0A 1J4JA 5M5YB 3VH9A 2VZZA 3KJPA 1SNMA 3FBUA 4JV5L 5IP7H 1AZQA 1Z6HA 1IOIA 2J0TD 4AG9A 2NSMA 3CCEA 1XNRL 2CW0D 2JA7B 2Z6KA 2Y0SB 5IOCA 2Y0MA 1DGSA 1EWCA 2B2UA 1YVOA 3U4VA 2I3CA 2PRBA 1H9JA 2B2VC 3C26A 2SOBA 2CQOA 2R92G 3H5ZA 1SE2A 4IF5A 3PUWA 3K8AA 3F0AA 5NUCA 5JEAH 3HOWB 1CPSA 4LNQA 4GLAC 2VB2X 2Q7SA 4RGOS 2KECA 3D3RA 3PUZA 4UCMA 5IGCA 2J8RA 2P6EA 3UDGA 4UPAA 1XTDA 4TSSA 3FYNA 2LKVA 4H2KA 3MC0B 1CUKA 5GAGC 2C5CA 5F2DA 4A3CH 4QCLA 5IYCH 4KVXA 5IYDG 4JI0L 1LLRD 5GADC 1MD2D 1BCPD 2EQSA 3DXJC 4A3KH 5JOBA 3W91A 4LUZA 2K05A 2TMPA 1X10A 3H3VH 1N34L 1AP0A 1SYFA 4DGZA 1IBLQ 4WJBA 4LFBQ 3DUZA 3VATA 1D8LA 2ZEFA 3KF6A 2NVQH 2EVNA 4RGTA 2O28A 2QVPA 3NTIA 5FKAC 1RD9D 1IL2A 3IGRA 3TRZA 4A3IG 4PXCA 1SROA 1HJPA 2K1BA 1PRTD 4NDXA 4IOAA 1Z2LA 1PH7A 1XMQL 2Z9HA 2IX3A 1L0WA 2MNAA 1KLUD 1PV4A 2Z10A 1VQJA 3K0XA 2BEIA 3IEHA 3LX0A 2ZOGA 3PZJA 3DR6A 3DR8A 2P6FA 2FL4A 4A3GG 3HOXH 1QSNA 1ELLP 5M5XB 3URYA 4CBVA 4J15A 1V9PA 3VYRA 5IWAL 2KCWA 4A93H 2F03A 4CAVA 4DR3Q 1PFNA 3A74A 3G6JB 3VA7A 5AG7A 4KOVA 2B2YA 1Q86C 4A3EH 3ZJYC 4RKBA 1DD2A 5JAVA 2NVYH 1B6BA 4XPDC 5JVH3 2JA8G 4M6HA 4RN7A 2ZJRA 2E74C 4JI6L 2A1AA 4YU9A 4QUCA 4XT3B 1XMTA 3NE7A 3HOVH 2K5WA 4R1JA 4B08A 2R98A 1TY2A 5C44G 3TFYA 1MBYA 5DM73 3B6YA 2F4VQ 3G3SA 3ZZIA 1ARLA 1IYLA 1VQLA 3CAMA 3Q8DA 4MHEA 3KR5A 4C3HG 3RZOH 1ML0D 3D7DA 5DAUA 2Q2UA 1SNDA 4ZCKA 3BS1A 5M3FG 4JI4L 2ODFA 3J7AF 1TS5A 1Q8IA 3PSIA 5F49A 1WCMG 2Z8LA 1I50H 1XMBA 1S5FD 3K5OA 4UCPA 4C7HA 4C3JB 2D4OA 1IU8A 2AUJD 3EQLC 2WAQE 3TREA 4XQQA 1K8AC 3GDEA 1X65A 4KY6A 5J3BA 4IUQA 2DPSA 3NQIA 3H0GB 3KZWA 3MEFA 1GXDC 2PZUA 3UDFA 1T9HA 5C88A 2V8VA 4GXHA 2HQEA 1ILPA 1UAPA 2K5NA 3KBGA 2PRQA 4JLYA 1NAPA 4I65A 1FR3A 1EY5A 4IJHA 1CSQA 2MP1A 3IC1A 1JWMD 3RNZA 3S6KA 1IYUA 5GAEC 2B5GA 1NUCA 5ELOA 4DV0Q 1B9NA 3D7GA 1GHJA 1IY7A 2FXQA 1TWFB 4DK1A 4DV5Q 3D0FA 5C5MA 1DM0B 2AMCB 3T53B 4R87A 1Q1BA 1I21A 2EBJA 1WD0A 1STYA 3BYYB 4QQBX 2AFOA 1L0XB 4M3SA 2VXWA 4KLVA 4DK0A 4HMJA 2F0MA 3V7ZA 2FE7A 2Q4ZA 4DUZL 4RCOA 4LFCL 1TF9A 4IFDI 4KVME 4PQAA 5IGFA 4GLVB 2WB1B 2AQ1B 4XQNA 2CHBD 4KKUA 2BE5D 4P4IA 4A3JH 1ONLA 4B5PA 1HNXL 4IURA 4A3IB 4Z65A 2ATWA 2ZEPA 2B63G 2LFNA 5ELFA 2PQEA 3D66A 4EQNA 3FHWA 4A3FH 5CV5A 3KQXA 1N32L 4IUNA 4EQOA 4LF5L 5LRGA 4B12A 3L7ZC 2WPXA 3TCVA 4JZ0A 1TWGB 2EOTA 2AFSA 2RFHA 5LHY1 3S2HH 2VUMB 3RZAA 1D7QA 1CT1D 3HOZH 5ISVA 4JBWA 2EWBA 4O2DA 3T8WA 2K75A 4K5XA 1OXVA 1LACA 1M8AA 3KLRA 3T56B 3G6EA 5I2YA 2UU9Q 4S3SA 1VQPA 1ZG8A 1S5CD 2E76C 5IGGA 1LTBD 4KSAA 1S3ZA 3FX6A 4QUSA 4HNYB 3PGZA 4A3BB 8CPAA 2A6EC 4Y52H 1JB3A 1HPCA 5A2QL 1Q2DA 4HSVA 2XNAC 1CPXA 2F0HA 4QL5A 4LF9Q 3RR5A 1SLJA 2LSSA 3RLFA 2PR1A 4BBSG 3BZKA 1SE3A 2CKZB 1MJBA 2VZAA 2L5TA 4OWXB 4P45A 4EGVA 4DNCA 3MHBA 2K5QA 4R4OA 4DA2A 2FS5A 4ONUA 1U9RA 2XRQD 3R2TA 5C3XA 1HQMC 3TOAA 2WKDA 4OHJA 3ISXA 1K73C 5M3FB 2UUAL 1F2LA 3NBHA 2QCPX 4JBJA 4ZUIA 5AJ3L 2EK8A 3D68A 2R92H 3S1NB 1B8AA 2E2DC 1UEBA 2C35B 3P2FA 3GTGH 1IOFA 2GANA 1WTQA 4N9TA 2A6HC 1K0SA 1VQ7A 1FYCA 4IOCA 3F2BA 2BSWA 1QG7A 3CHBD 4KUBA 1CKMA 2VS1A 2WINB 4E2AA 2RDFA 1MSHA 3FEEA 4X66L 3CRKC 2G9HD 3FVQA 1Q1EA 1TWCH 3JAME 1I94L 4GKKQ 1IBKQ 5IYDH 2V8HA 4CAWA 3M4OH 3J81E 3BYTB 4IZ8A 1STBA 2N88A 2OEOA 3KGQA 4X3UA 3A0JA 1HA5A 1Q7YC 3M3YH 2ZEHA 1Y7EA 2FT0A 3NUCA 4MFKA 5G22A 1YITA 3QOLA 3MXNB 2R6GA 1M90C 4K30A 1QMUA 1D1IA 2N3SA 1PMRA 1NE9A 3PFEA 3AU7A 4ZYQA 3UDIA 2X6GA 2Z6BA 1BKBA 2VY3A 4MMOA 3EBEA 3K5NA 1QUQB 3DMUA 1X3FA 3NWTA 4LUOA 1ZYRC 3D4RA 4ZYSA 1GUGA 3S2DB 1DYQA 1YNXA 2XIWA 4DV7L 2JA6G 1G2TA 2N49A 1IZ6A 1H9RA 3IKJA 2YTXA 1X32A 3RZDB 1TS2A 3S9MA 2XTIA 2F4IA 3FDTA 4AVAA 1K0RA 4KHPQ 3TP7A 2XEGA 5KRUA 4DAYA 2YNEA 3Q6SA 5E96A 1JWQA 3MXGA 5C3EB 4A3GH 3BJUA 1B2TA 5C82A 4TQUS 3L9AX 5LYDA 3HEJA 2VQFL 2RSOA 4LUAA 4OIJA 4R3LA 2NN6G 1QE6A 1B50A 1S72A 4JOIC 4CKEA 1YJNA 5EKIA 2F0UA 3TZDA 1HFGA 3FP9A 1GUSA 2UXDQ 1S7NA 5IB0A 1JE4A 2PC1A 1G51A 3EROA 4HJ9A 1I3QH 3PGPA 3B7IA 4MFZA 5JM6A 2PJCA 1EU4A 4OELB 2V4DA 3CKIB 4C2YA 3DEPA 2EY1A 2JA8H 1MJAA 4CDFC 5FK9C 4UFXA 4IUUA 1C9OA 3BJ8A 1CSPA 4C3IH 5K36G 1LV9A 2BA1A 1NR4A 5C44H 2VL1A 3AFPA 4MHNA 5EBDA 3BZDB 4KZTA 2Q44A 4JI3Q 2PQAA 1M44A 2ZXOA 1CX8A 4BY1G 4CJ2C 5K8MA 4OC0A 4OMEA 2OTJA 1WVLA 4CGYB 4C3HH 4AYBG 5H84A 4KV6A 1KD1C 1SDFA 1EY4A 2JE6I 1A8VA 5GAHC 4JK1C 4POFA 3ULPA 2UUCL 1P0HA 4HNWB 4DV1Q 3EO4A 3M7NA 4MIUA 1OO9B 2WFWA 3KYHC 3CMAA 2R1IA 2JDCA 1T5EA 4BBSB 1CZGA 3OWCA 1WCMH 1XMOQ 1GUTA 4KSFA 1VF5C 5CV8A 1WFQA 5G20A 1QSMA 3PO2G 4MTNA 4DR1L 2Z6KC
chains in the Genus database with same CATH topology
4KSIA 2EYPA 3K57A 1XX8A 3RMHA 5IGEA 1DTDA 3LWEA 1HDQA 4LJZC 1AZPA 2WYRA 3K2KA 1XWEA 5ELYA 3DGVA 4ME5A 2EYMA 4B9XA 4RCNA 2CTBA 3GTKB 3KQZA 1SNOA 2ICIA 2KHSA 2J7ZA 1PRTB 2IPKD 3T51B 4OC4A 2QDBA 4KHVA 1TU2B 3NSWA 3BHXA 3MWYW 3K59A 2JYOA 4IAVA 4A38A 4KTAA 2PZTA 3HP3A 3GB0A 2BOAA 1PRTC 4ILWA 5D29A 5KNDA 3T4AC 1D5MC 1PFBA 3I3CA 1STHA 1O7YA 3WOEA 3MN8A 4Q7AA 4EQPA 4V190 1BLLE 5C4JB 5KNBA 1ZG9A 2TSSA 1JQGA 2YU9B 1BDOA 4BY7B 3OW7A 4DFAA 3BVGA 4UAIA 3GTJB 5ELCA 2XVSA 1LTID 4IUVA 3B3VA 4KD3A 3NTHA 3HKZB 3A56A 1C8CA 1BUVT 5CV6A 1UUPA 4K8IA 2PE3A 1Y1VB 1RTNA 3I4LA 4GM5A 3J80E 1SE4A 2PMZB 4ODGA 1NR2A 3WT4A 2K01A 4OIKA 3OWFA 4F8MA 1EU3A 3K5MA 1VHOA 2A6ED 2OF1A 5I9PA 2AWNA 3K7AB 4N9PA 3Q22A 1U4RA 1J8IA 4I7ZC 2EE1A 1EZ6A 1Z7TA 3FECA 1B9MA 4BWGB 1MGSA 3OPOA 2GREA 3L3OC 1QOHA 4V0BA 1EYAA 4P4JA 3IO1A 1AFPA 3NFZA 5IB9A 4Z9CB 5J1QA 4P4EA 1FNUA 2SNSA 1LTAD 2A6HD 1R43A 3R93A 4IFDH 4RGMA 1D1KA 1HCZA 3VR5A 3AB9A 4HTHA 2B8GA 3S9NA 4Y7NB 1VHEA 2VNUD 4MCRA 3IFDA 3W2DA 1U4MA 5IODA 5C0XG 4RAUC 2PZWA 1I6VC 3NH8A 2O2LD 2OXPA 2QILA 2PJ7A 4KKSA 3QG1A 5LRJA 2L1BA 2A68D 1WTWA 1ARMA 1EEID 1SYEA 2M00A 4XQJA 1ZYRD 1G6ZA 2ZENA 3GQBA 4U68A 5COYA 4RUHA 1I4GA 2A5HA 1SNQA 3MEHA 4L6TB 1SJHD 2AFWA 5JH9A 5DM63 1HHVA 4AXVA 2EJGC 1CFMA 1KABA 4DXFA 2WV6D 2NN6H 4K6DA 1D2BA 3B3WA 3H3VC 4OKOA 1TS4A 1CA6A 4UEFA 4FF3A 4IUTA 2KJXA 2B2WC 2L55A 3PEIA 2ZT9C 2PJ1A 4MCSA 1HQRD 4KJNA 2XWJB 3SEBA 4FAIA 3PB7X 4NJQA 5K36H 3V2TA 4XIGS 2PJ2A 4K6LA 1PTOH 3N5FA 4RKLA 3VYSA 1QB5D 1RJTA 1FNWA 2BCOA 3D7FA 1CK1A 4C3JG 4WWVA 3TP5A 4FBEA 1Q90A 1O80A 3GLJA 1DOLA 1Y0RA 2N55A 3HOVB 3O13A 5D65A 1VDZA 4RHSA 3TBIB 1II3A 2F7VA 4X3TA 2QJ8A 4NGNA 1KDCA 2FJ2A 2ZEGA 3GTLB 4NGMA 3CPXA 3NHHA 4IUPA 1SJED 7CPAA 2PJ8A 1ESFA 2O53A 3IWWA 3H91A 4RHRA 4A3MB 3EFXD 4DNTB 2F0FA 1A3VA 1JORA 1RHPA 4FXKC 2HC9A 5AFWA 4BBRB 1G91A 4F7XA 1IYVA 2ZEEA 4P10A 3PV0A 4TWEA 3PB8X 1CP6A 3N6RA 2PJ3A 1B4OA 2NBFA 5IIFA 3LNNA 4IHMA 1FNOA 4ZY2A 4A39A 1SYCA 2EYFA 2I07B 3B3TA 2V8DA 4DNRB 3G7LA 1V1OA 3I4NB 2D5DA 3GTMB 5KYIA 4JYWA 3CQZB 2HCIA 2JEWA 5IT9E 1O7LA 1R4QB 1TS3A 4ZQ3A 2DN8A 5FO8B 5M5WB 2J4XA 2R93B 3DLJA 2RSNA 1Z8LA 3MFGA 4C1NK 1PFMA 2ZELA 5J39A 5A35A 3GD7A 3K6OA 1BPNA 2F0PA 3PIO3 1JR0D 3JAML 3C1FA 4TKOB 3I90A 3J81L 2E2IB 3HOUB 1L0YB 3OIQA 2LMCB 2IW3A 2HUGA 4K8JA 2VB3X 1VCIA 3U9OA 1UNSA 3D6CA 3HGBA 4DJLA 4OC5A 2ZEDA 2ICEC 4MHYA 3C1EA 1EYDA 1RODA 5CBAE 3PO3B 4ZLTF 1HA6A 4Q5VA 2NVXB 3T13A 1C4QA 5CMDA 3Q24A 2XN9C 4R8FA 2F3VA 2K6AA 5K8NA 2XEJA 3K58A 1AYEA 3GTPB 1A3UA 1F2MA 4PMBA 4WORA 3D8GA 5JJZA 4FNFA 4ZX9A 1H9SB 4LMQD 1FGBD 4L63B 1PYTB 5EPKA 3HRZC 4KY7A 2PPBC 3WOFA 1I4XA 1FD7D 5C5LA 1JICA 1EIHA 1ELMP 1ILQA 5DS0A 3GTOB 5EQ0A 3WDNA 2AUKA 5ELDA 2HB6A 2IT1A 1HUNA 2B8FA 4G57A 1DE4C 2AQ3B 3QOJA 3HS0C 1K8OA 3HZXA 4CJ1B 3P75A 3ITPA 2AFUA 5CV7A 1K83B 5HVHA 1LTTD 1HUMA 1JOKA 2O4XA 4IQZA 4YIJA 4XTCS 5TSSA 3MAQA 1BAVA 1D5ZC 3AMUA 1DCZA 1PTOF 2D62A 2DY7A 3RUZA 1QCBD 4OC1A 1Y1WB 1WD1A 3BDLA 1X3QA 2AFZA 2PVWA 4G7OC 2NN6I 4MRIA 3OMGA 4DF7A 5CGKA 3BXMA 3QWNA 4KI0A 3A54A 3QNVA 1JC7A 4R6TA 5IGDA 4F9UA 1YSJA 3LMSA 4HR7B 3K9TA 1CTMA 4K2LA 2BOSA 5JPMC 1X3PA 3PUXA 1CP7A 1BO0A 1R9TB 2PCFB 4CKCA 1Y0YA 2B2VA 3S14B 2NZ1D 3KLSA 4P2CB 2IX1A 2PJ4A 3S9WA 1A15A 1XBUA 2EJFC 3TP8A 3GP7A 3M7GA 3PUVA 2XRSD 2D2CC 2V77A 4IALA 3NBIA 4NKLA 3WC5A 2A68C 5C4HA 3GTQB 3MRUA 1JOQA 1BBXC 5IGBA 4HCEA 4PXEA 3IL8A 4HMIA 2E75C 2PW5A 1I4QA 3FJUA 1Y8NB 3J80L 2WP8J 3Q0AA 1H8LA 4ZY0A 1HDUA 5JEAJ 1U4PA 3TX8A 5ISRA 4NW2A 2Q8IB 3EVQA 1G8ZD 4GZYC 1RF2D 2L11A 2RBMA 4CJ0B 4KMUC 5EJWA 2E2JB 1VGYA 1HTLD 1F57A 2C6PA 2F0WA 4FXGC 4OO1G 4FWUA 4FUUA 1RKNA 4UIBA 3HUVA 4QIWB 2SEBD 1F9PA 1MSGA 2F0LA 5E4XA 3SR1A 2EJMA 5KGUA 1TKHA 4OC2A 1VF7A 2JA5B 4FF2A 1GYTA 4DU9A 4PPZA 4HAEA 4P6YA 6CPAA 3V96A 4MCQA 2Q8RE 1YLOA 2A74C 5LL6X 3CU7A 1EY8A 4PQXA 3E0JA 3VR6A 3MXUA 4FXDA 1PZJD 2B2UC 4K5VA 1QJOA 3OWEB 4C1NI 5C3WA 5K8OA 3SXHA 2OR4A 3BVZA 2HDMA 3ONAB 1LAPA 2EY6A 4CKBA 1JOOA 3FRPB 1TWHB 1W6KA 5KEEA 3NQTA 1CA5A 1EWHA 1SFOB 5JEAG 4NGPA 2BDOA 1CBXA 4O23A 1LTGD 2DY8A 3BDCA 2PIZA 1V1PA 4K2KA 3SDZA 1TWAB 1XJOA 1JCKB 3ISZA 3S16B 2FFKB 3S15B 2WAQB 3OSOA 1AW7A 2RDHA 1A6XA 3A7LA 2L4NA 2C1CA 1I6HB 2CVRA 3DWQA 5KIXA 3U9SA 3NXWA 3DEOA 2KEDA 1J9OA 4ZAIA 5KYLA 5C4XB 5C0XI 3E5SA 2XWBB 4WRDA 5E4WC 4DN4M 1ENCA 1SBBB 2EYOA 1EOTA 1W6JA 4BA2I 4F8ZA 3H09A 2B2TA 1GUNA 2ZEMA 1EQTA 1JWUD 2QEJC 3V38A 3NWSA 1XTCD 1TQOA 1CI3M 4EWTA 3IJ3A 1EFID 2B2YC 1EEFD 3VA5A 1OBRA 2I46A 2FMMA 5FLXE 3RAMA 1R4PB 3P1HA 3H6MA 2H4OA 3I4MB 3S9LA 3KL9A 3VYUA 3FKIB 3K0YA 2PYKA 4ZKCB 2FVGA 1S5DD 1B44D 4OIDA 1TXRA 5K5PA 3D4DA 1U4LA 1O7ZA 3S17B 1KAAA 1WTRA 3N52A 3R2IA 1WTPA 2NYQA 3Q23A 2F0TA 1BF4A 5HGTA 2NVTB 3KR4A 1ET6A 2F0JA 1F9QA 3WC6A 4B9WA 1QQ9A 3NH4A 1SSOA 4XT1B 4MHPA 3KBXA 2K32A 1IL8A 3S1QB 1GUWA 1K8MA 2KVMA 3OIPA 3IFTA 4UDUC 3CDXA 2Z4IA 3W3AA 2F0NA 5CPAA 4ZX8A 2DNEA 4UEEA 1NCVA 4H44C 1EL0A 1PTOC 2PJBA 1S5BD 4QF4A 5T1GA 3DWPA 2ZOFA 3KI9A 3R3OA 3FMCA 2H1EA 1TIID 3BI1A 4KY5A 1F2ZA 5CV9A 1LO5D 4UF4A 2KQ3A 3KLSX 4EVOA 2C9OA 1S4ZA 2CTCA 2IX0A 4K14A 3J7AV 1KWMA 4OP4A 2OT2A 4A3KB 3KHXA 1H9MA 1PLFA 4DAVA 1CHQD 2WKCA 1F2PA 3RBUA 2MUYA 1Y8PB 3MFYA 4IK2A 3MXNA 2EK9A 3B35A 2D9UA 2NVQB 2F0OA 4R8IA 3FH4A 4J1MA 4LAAA 3R8BA 1B1ZA 3PRTA 3IEHA 5DEHA 4FYDA 4P4DA 1LFWA 3P20A 4UIAA 3GV3A 2CIJA 1STGA 1D5XC 2XSCA 1DONA 3HOXB 5G3LF 1BOSA 3HG9A 4A93B 1KNEA 2EPBA 2L9HA 3BI0A 5I9OA 4A3EB 3SK5A 2A69C 4KJOA 2NVYB 4F87A 4K3NA 5LYIA 2EZVA 3IFEA 3PB6X 2K03A 4X3KA 3D6WA 2SDFA 5I6YA 4M8AA 3TC8A 4ZKBB 1EZ8A 4XXEA 2GA4B 4H7BA 1ZLHA 5C4ZA 3RZOB 3A55A 1CG2A 4ZRZA 4RWSC 5FO9B 3MTSA 2X6LA 2EYLA 1LCPA 1JWSD 3FEDA 1JQYD 1I50B 2MGSA 4KD4A 2RDGA 2KCCA 1SYDA 1CZWA 3CRLC 2NB0A 5FOBB 3DHQA 1CQFA 2JP1A 3TMEA 3B3SA 2KOLA 4ABNA 2F3WA 2WIIB 1GJXA 1F77A 1PZID 2JEAI 3FVLA 3ERQA 4HCSA 2K33A 3KK7A 1WTVA 2WACA 2LS01 5D3IB 1I4PA 4PMWA 2V8GA 1ENAA 2HDLA 3A8KE 4G7ZC 1OXUA 3D31A 4P4BA 4RA8A 4A94A 4PXBA 4BD9A 2RA4A 4X2TA 5DNFA 5I4MA 4RH6A 2EY5A 4FP5D 1QILA 1HFNA 1BXTA 2LY7A 2OOTA 2PJ6A 4OIWA 4A3JB 1TVXA 1YNJC 4M1UB 2F0DA 3JRUA 5EBCA 3GV6A 4K5WA 4QMGA 4A3FB 3PMFA 1I4HA 5FO7B 1E0BA 1S5ED 4KN7C 1KNAA 2M2LA 1Q3LA 1EY6A 4RGNA 1BCPF 2WZNA 5LYLA 3S2HB 4FVMA 5CC4A 1DJRD 2EYHA 3HOZB 3FF3A 4C3IG 3H8EA 1SYGA 3SVMA 2ABZA 3MVVA 1DOKA 2M9VA 2F0IA 1PZKD 3L2NA 2ID0A 3BVMA 3CT9A 5M9OA 4DAPA 1Q12A 2EY2A 3IIBA 2KUMA 1KDAA 1PRTF 2KCNA 4NGQA 3M4YA 5C6AA 1Y8OB 3H8FA 3C46A 3P7JA 1ICWA 2EXZA 5JPNC 4F9VA 1UEAB 3SK4A 1IKMA 3QO2A 4NJRA 3B2YA 2JBKA 3QIAA 1BR9A 4Q0FA 1V1PB 2R92B 5BN5A 5C0XH 4ZI6A 3GTGB 1PTOD 1Y69U 2PW7A 1B53A 4NGSA 2L12A 4J6HA 3ND8A 4FF1A 4P4FA 5I2XA 2RB7A 1UWYA 1TWCB 5CV4A 3E6ZX 4WJWA 3M4OB 1BPMA 2R61A 4A37A 4XYQA 4E6IA 3I70A 3KF8A 4BS9A 3M3YB 3SI2A 4P44A 3SHLA 3NP8A 3TN2A 2PJ0A 4IN3A 4O1NA 4X8IA 4IFDJ 4ONWA 3SI1A 2AQ2B 3K5LA 2PJ9A 2EDGA 2YYZA 1Z47A 4NFRA 1DOMA 3SJGA 1KDBA 3T16A 3RD4A 3TZUA 2B2TC 1VMPA 4XYOA 1RCVD 5E3FA 5D14A 2MJ8A 2JXMB 3SJEA 4XDXA 1EY0A 4X3SA 1SAPA 1HRJA 1M4VA 5JVG3 1A2TA 4A3GB 2B2WA 2IJ0A 3CPAA 2IJZA 3WABA 2DNCA 1IW7C 3PB4X 3A8IE 4CPAA 1STNA 4OO1I 1KTKA 4F88A 4PV1C 1ZG7A 3H94A 1I3QB 1DZ1A 5E1FA 1LT3D 4HEDA 1EYCA 3FPPA 1E2VA 2JA8B 1STAA 1CM9A 2A69D 3BDOA 3MZ5A 4C3IB 1WTOA 5C44B 4KK7A 3PBEA 3SJXA 1SMYC 2NWGA 3D4WA 5ELEA 1ZXTA 2FHTA 1LTRD 4C3HB 2IMOA 3EA6A 1YNNC 5HURA 3QB3A 3I72A 2O5IC 4G4KA 1DXMA 1V8QA 3KUPA 3NPPA 1WCMB 3FEWX 1A2UA 1LAMA 4CHTB 1GUOA 1PXUA 4QB4A 2F0EA 1OXXK 4MCPA 2XEFA 4OL7A 5LRKA 1TKFA 3OMCA 4TRDA 4ZUJA 2E2HB 2JBJA 4IFDG 4O42A 3C2PA 4ZY1A 2XEIA 1Z5RA 3HOYB 4MHZA 1SYBA 1SEBD 1ZKOA 1TF8A 2PO4A 5KNCA 5FLXL 4PXDA 3H8GA 1E2ZA 5T1IA 1WTXA 1GHKA 4MN3A 4LK1C 1OXTA 2IL8A 5D3DA 1T5XD 1FT7A 1D6EC 2BDNA 2CF4A 4ZK9B 2MPMA 3M85A 1F2YA 2Q43A 4G1PA 2K5DA 2SNMA 1LABA 3ZYYX 1RTOA 4DXGA 2Z1CA 3VR3A 4BA1I 1SXTA 2L0CA 2PJ5A 2IQ6A 4NP5A 3S1RB 1TKJA 4H0LC 2B63B 1YNJD 2EYJA 2NTSA 3V05A 1C48A 2F8HA 1HEEA 4OGQC 5EKKA 1PDQA 3X3MA 4DYOA 4R76A 4PMCA 2G9DA 1LT6D 4DUKA 2JEBI 5D8NA 1AN8A 1F2OA 3UI2A 3TP6A 1AEXA 1QWYA 1NSAA 2KEEA 3VR2A 5CR3A 2CW0C 5I6WA 2K28A 2Q51A 4UEZA 4W9YA 1H9KA 1G291 1F9SA 2K7VA 5LYFA 2DEAA 1BCPB 3QJYA 1IKLA 3I91A 3B3CA 3SK8A 2F0VA 2KA7A 3MA2B 2F0GA 4WFN3 3J7YW 2GU2A 2EVBA 2X69A 1E2WA 3DM1A 3S1MB 4J8QA 1YW6A 5EGTA 4OC3A 1BCPC 1EQVA 2K04A 5THWA 5A2QE 2F0SA 4QUFA 1BQQT 1QNUA 3NA6A 1CHPD 1I4RA 3D67A 2F0QA 2POKA 3VYTA 4L8JA 5J1ZA 3VR4A 2PJAA 1XFOA 2Z4HA 1IHZA 2R3ZA 5CBEE 4NGTA 5K8PA 4KKTA 1IGBA 1VIXA 2GLJA 1HTPA 3PBBA 5EPJA 1F9RA 1H9SA 3PB9X 3PIP3 1ZEQX 3D7HA 3SI0A 3GO5A 3NTKA 3NK9A 3NH5A 3SK6A 2Q8TA 2QKIC 1YMEA 1KLGD 3X3NA 1EIGA 1ZLIA 2JA6B 1ENFA 5C0XJ 4ULLA 4R9WA 5I4DA 4C56C 2A73B 1LTSD 3SE0A 3KHZA 2ENBA 2FMCA 5J22A 4R7MA 4MXUA 1RDPD 2F0KA 2NTTA 3MXPA 2GLFA 1Q7LA 1TKWB 4FF4A 2PIYA 1IW7D 4KN4C 2RQXA 2IWHA 4C2MB 3OHXC 3DWAA 3TDQA 2QYVA 1MI2A 1VMCA 1V43A 5CBMA 2RKSA 1QNKA 1BNZA 1GOZA 4PNYA 5ELBA 1SNCA 1TR5A 4YWYA 3GUXA 4BY1B 3HLPA 3I8ZA 4LQGA 1HXYD 5M3MB 3D4UA 1PTOB 1SMYD 4AYBB 3EJIA 4B6ZA 4U673 1OXSC 4G7HC 2C6GA 1TT2A 1ESRA 1M4LA 5CYUA 5HVGA 1YNND 3SJFA 2HCCA 2MHVA 4FO2A 1XXGA 2CQAA 1CQVA 3NE5B 1LANA 1TY0A 2FINB 2PCUA 3FPUB 5JGFA 3PO2B 4HN7A 2J9AA 2BA0A 2C6CA 4NMZA 5IT9L 5CORA 3WC7A 5G3LD 3A7AB 4EFDA 2O4HA 1FNVA 4ID6A 2AFXA 1EE3P 1EY7A 1EY9A 4TNUA 1XYIA 5EKLA 2BO9A 4A3DB 2JSOA 5EPLA 2B39A 4EMEA 3KASA 1STEA 1YW4A 4KHZA 2F1MA 3PFOA 1SNPA 2BE5C 4X3RA 3I73A 2ZXPA 2NUCA 4R8NA 1B3AA 5BN4A 1PCAA 1LT5D 1O78A 4OO1H 2ZEOA 5LL6S 5BN3A 5HVFA 1PYWD 2O5JC 1R3NA 3TSSA 3C3LA 3I1UA 1ET9A 1XRYA 1A3TA 2PNRC 4HSPA 2QF7A 2AFMA 2R7ZB 4RFBA 1LOKA 3VARA 3PUYA 2ANPA 2NYZD 1RTQA 2PVVA 1AMPA 1NSNS 3ND9A 3IAYA 4NGRA 2AWOA 3BG3A 1LT4D 2RVLA 4H13C 3A8JE 3LWUA 5F09A 2ZXRA 3OOCA 1G2SA 3F2UA 3VH9A 5M5YB 1SNMA 1AZQA 1Z6HA 2J0TD 2NSMA 2CW0D 2JA7B 2Y0SB 5IOCA 1EWCA 2B2UA 2I3CA 1H9JA 2B2VC 2SOBA 1SE2A 3PUWA 5NUCA 5JEAH 3HOWB 1CPSA 2VB2X 4RGOS 2KECA 3D3RA 3PUZA 5IGCA 4TSSA 4H2KA 2LKVA 3MC0B 2C5CA 5F2DA 4QCLA 1LLRD 1MD2D 1BCPD 3DXJC 5JOBA 2K05A 2TMPA 1AP0A 1SYFA 4DGZA 4WJBA 3DUZA 3VATA 2ZEFA 4RGTA 2QVPA 3NTIA 5FKAC 1RD9D 4PXCA 2K1BA 1PRTD 4NDXA 1Z2LA 2IX3A 1KLUD 3LX0A 2ZOGA 1ELLP 5M5XB 3URYA 4CBVA 3VYRA 2F03A 1PFNA 3G6JB 3VA7A 2B2YA 4RKBA 1DD2A 5JAVA 5JVH3 2E74C 4YU9A 4QUCA 4XT3B 2K5WA 4B08A 1TY2A 1MBYA 5DM73 1ARLA 4MHEA 3KR5A 4C3HG 1ML0D 3D7DA 5DAUA 1SNDA 3BS1A 3J7AF 1TS5A 1Q8IA 2Z8LA 1XMBA 1S5FD 3K5OA 4C3JB 2AUJD 3EQLC 4XQQA 4KY6A 4IUQA 3NQIA 3H0GB 3KZWA 1GXDC 2PZUA 2V8VA 2HQEA 1ILPA 1UAPA 3KBGA 2PRQA 1NAPA 4I65A 1FR3A 1EY5A 2MP1A 3IC1A 1JWMD 1IYUA 1NUCA 1B9NA 3D7GA 1GHJA 1IY7A 4DK1A 1TWFB 5C5MA 1DM0B 3T53B 1Q1BA 1WD0A 1STYA 3BYYB 2AFOA 1L0XB 2VXWA 4DK0A 4HMJA 2F0MA 3V7ZA 2Q4ZA 4RCOA 1TF9A 4IFDI 4PQAA 5IGFA 2WB1B 2AQ1B 4XQNA 2CHBD 4KKUA 2BE5D 4P4IA 1ONLA 4IURA 4A3IB 4Z65A 2ZEPA 2LFNA 5ELFA 2PQEA 3D66A 4EQNA 5CV5A 3KQXA 4IUNA 4EQOA 5LRGA 3L7ZC 4JZ0A 1TWGB 2EOTA 2AFSA 2RFHA 5LHY1 2VUMB 3RZAA 1CT1D 4JBWA 2EWBA 3T8WA 4K5XA 1OXVA 1LACA 1M8AA 3KLRA 3T56B 5I2YA 4S3SA 1ZG8A 1S5CD 2E76C 5IGGA 1LTBD 3FX6A 4A3BB 8CPAA 2A6EC 1JB3A 1HPCA 5A2QL 4HSVA 2XNAC 1CPXA 2F0HA 3RLFA 1SE3A 2L5TA 4P45A 4EGVA 3MHBA 2K5QA 4DA2A 1U9RA 2XRQD 3R2TA 5C3XA 1HQMC 2WKDA 4OHJA 3ISXA 5M3FB 1F2LA 3NBHA 2QCPX 2EK8A 4ZUIA 3D68A 3S1NB 2E2DC 1WTQA 4N9TA 2A6HC 1FYCA 1QG7A 3CHBD 2WINB 2RDFA 1MSHA 3FEEA 3CRKC 2G9HD 3FVQA 1Q1EA 3JAME 2V8HA 3J81E 3BYTB 4IZ8A 1STBA 2N88A 2OEOA 3KGQA 4X3UA 1HA5A 2ZEHA 1Y7EA 3NUCA 3QOLA 2R6GA 1QMUA 1D1IA 1PMRA 3PFEA 3AU7A 4ZYQA 2X6GA 4MMOA 3K5NA 3DMUA 3NWTA 1ZYRC 3D4RA 4ZYSA 1GUGA 3S2DB 1DYQA 2XIWA 1G2TA 3IKJA 1H9RA 3RZDB 1X32A 1TS2A 3S9MA 2F4IA 3FDTA 3TP7A 2XEGA 5KRUA 4DAYA 3Q6SA 3MXGA 5C3EB 1B2TA 4TQUS 3L9AX 5LYDA 3HEJA 2RSOA 4OIJA 2NN6G 1QE6A 1B50A 4CKEA 5EKIA 2F0UA 3TZDA 1HFGA 1GUSA 1JE4A 3EROA 3B7IA 5JM6A 2PJCA 1EU4A 2V4DA 3CKIB 3DEPA 2EY1A 5FK9C 4IUUA 5K36G 1LV9A 2BA1A 1NR4A 2VL1A 4MHNA 5EBDA 3BZDB 2ZXOA 1CX8A 4CJ2C 5K8MA 4OC0A 4OMEA 1WVLA 4CGYB 4KV6A 1SDFA 1EY4A 2JE6I 4JK1C 3M7NA 4MIUA 1OO9B 1T5EA 4BBSB 1CZGA 1GUTA 1VF5C 5CV8A 5HXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PVW A;  4KSI A;  4G7O C;  4TNU A;  2NN6 I;  2OOT A;  2BO9 A;  4MRI A;  2PJ6 A;  4OIW A;  1DTD A;  4EME A;  3KAS A;  1HDQ A;  1YNJ C;  3BXM A;  4LJZ C;  1YW4 A;  2WYR A;  3K2K A;  5ELY A;  3DGV A;  4KI0 A;  3JRU A;  3QNV A;  4KHZ A;  4R6T A;  2F1M A;  3PFO A;  2BE5 C;  4RCN A;  4X3R A;  3I73 A;  2CTB A;  4F9U A;  1YSJ A;  3LMS A;  5BN4 A;  3KQZ A;  1PCA A;  4HR7 B;  3K9T A;  4KN7 C;  1CTM A;  3PUX A;  3T51 B;  1CP7 A;  4OC4 A;  1O78 A;  4OO1 H;  2WZN A;  2ZEO A;  5LYL A;  2PCF B;  1Y0Y A;  5BN3 A;  1TU2 B;  3BHX A;  5HVF A;  2O5J C;  1R3N A;  4IAV A;  2PJ4 A;  4A38 A;  1XBU A;  2EJF C;  3FF3 A;  3I1U A;  1XRY A;  3H8E A;  2PNR C;  2ABZ A;  2AFM A;  2QF7 A;  3GB0 A;  2BOA A;  5D29 A;  5KND A;  1LOK A;  3PUV A;  3VAR A;  3L2N A;  3PUY A;  2D2C C;  2ANP A;  3CT9 A;  2V77 A;  1RTQ A;  2PVV A;  1Q12 A;  3MN8 A;  3IIB A;  1AMP A;  4Q7A A;  1BLL E;  4NGQ A;  3WC5 A;  3ND9 A;  4NGR A;  5KNB A;  2A68 C;  1ZG9 A;  2AWO A;  3M4Y A;  1Y8O B;  3BG3 A;  3H8F A;  3MRU A;  4H13 C;  1JQG A;  1BDO A;  4PXE A;  3A8J E;  3OW7 A;  3LWU A;  4F9V A;  2E75 C;  5F09 A;  3FJU A;  3OOC A;  1Y8N B;  4NJR A;  3B2Y A;  2JBK A;  3QIA A;  3B3V A;  3VH9 A;  1H8L A;  4ZY0 A;  1HDU A;  5BN5 A;  1Z6H A;  5C0X H;  4ZI6 A;  3TX8 A;  2Q8I B;  4GZY C;  2NSM A;  1Y69 U;  2PE3 A;  3I4L A;  4GM5 A;  1VGY A;  2I3C A;  4KMU C;  1H9J A;  4NGS A;  1F57 A;  3ND8 A;  4P4F A;  2RB7 A;  1UWY A;  2C6P A;  3WT4 A;  3PUW A;  4OO1 G;  5JEA H;  1VHO A;  4FWU A;  1CPS A;  4FUU A;  2A6E D;  3PUZ A;  1BPM A;  4UIB A;  3HUV A;  4A37 A;  4I7Z C;  4H2K A;  3SI2 A;  4P44 A;  1Z7T A;  3FEC A;  1B9M A;  2PJ0 A;  2EJM A;  4X8I A;  3OPO A;  1TKH A;  2GRE A;  3SI1 A;  4ONW A;  4P4J A;  4OC2 A;  3DXJ C;  3IO1 A;  2PJ9 A;  1VF7 A;  2EDG A;  2YYZ A;  4NFR A;  1GYT A;  3NFZ A;  4WJB A;  4PPZ A;  3SJG A;  4P6Y A;  6CPA A;  5IB9 A;  5J1Q A;  4P4E A;  4MCQ A;  3TZU A;  3VAT A;  1YLO A;  2ZEF A;  2A6H D;  1R43 A;  4IFD H;  2QVP A;  2JXM B;  3SJE A;  1HCZ A;  3VR5 A;  3AB9 A;  3VR6 A;  2B8G A;  3MXU A;  4PXC A;  3S9N A;  1VHE A;  3CPA A;  2IJZ A;  3WAB A;  4MCR A;  1Z2L A;  2DNC A;  1IW7 C;  1QJO A;  3PB4 X;  5C0X G;  3A8I E;  4CPA A;  5K8O A;  1I6V C;  3NH8 A;  2OR4 A;  2ZOG A;  4PV1 C;  1ZG7 A;  3H94 A;  2PJ7 A;  4KKS A;  1LAP A;  1ELL P;  3QG1 A;  5LRJ A;  2A68 D;  3FPP A;  1E2V A;  2A69 D;  1ARM A;  3BDO A;  3VA7 A;  1EWH A;  5JEA G;  3PBE A;  4NGP A;  3SJX A;  2BDO A;  1DD2 A;  2ZEN A;  1SMY C;  3GQB A;  1CBX A;  4O23 A;  4RUH A;  2E74 C;  4YU9 A;  2IMO A;  1YNN C;  2PIZ A;  3SDZ A;  1XJO A;  2AFW A;  3ISZ A;  3I72 A;  5JH9 A;  2O5I C;  4AXV A;  2EJG C;  1DXM A;  1V8Q A;  1ARL A;  1CFM A;  1A6X A;  3KR5 A;  2NN6 H;  3A7L A;  1LAM A;  2C1C A;  1GUO A;  3B3W A;  3D7D A;  4OKO A;  1OXX K;  4MCP A;  2XEF A;  4UEF A;  5LRK A;  1TKF A;  3U9S A;  3PEI A;  4MCS A;  2ZT9 C;  2JBJ A;  2PJ1 A;  4IFD G;  4ZY1 A;  2XEI A;  1Z5R A;  1XMB A;  4FAI A;  4MHZ A;  3PB7 X;  4NJQ A;  5K36 H;  4BA2 I;  1ZKO A;  2AUJ D;  3EQL C;  1TF8 A;  4F8Z A;  5KNC A;  4XIG S;  2PJ2 A;  4PXD A;  1GUN A;  2ZEM A;  3H8G A;  1E2Z A;  3N5F A;  1GHK A;  3V38 A;  4LK1 C;  1OXT A;  2BCO A;  1CI3 M;  3D7F A;  3KZW A;  4EWT A;  2V8V A;  3IJ3 A;  4WWV A;  1FT7 A;  2PRQ A;  1OBR A;  4FBE A;  2CF4 A;  1Q90 A;  3GLJ A;  3M85 A;  1FR3 A;  3RAM A;  1Y0R A;  3IC1 A;  1IYU A;  3S9L A;  2Q43 A;  1VDZ A;  3KL9 A;  1B9N A;  3D7G A;  4G1P A;  1GHJ A;  1IY7 A;  4DK1 A;  2F7V A;  2QJ8 A;  1LAB A;  4NGN A;  3T53 B;  2FVG A;  2ZEG A;  1Q1B A;  4NGM A;  4OID A;  1TXR A;  3CPX A;  3VR3 A;  4BA1 I;  7CPA A;  2AFO A;  2PJ5 A;  2PJ8 A;  2IQ6 A;  1TKJ A;  2O53 A;  3IWW A;  4DK0 A;  3V7Z A;  4H0L C;  2Q4Z A;  1TF9 A;  2NYQ A;  4DNT B;  4PQA A;  3KR4 A;  4KKU A;  2BE5 D;  1HEE A;  2F8H A;  2HC9 A;  1QQ9 A;  4OGQ C;  3NH4 A;  4P4I A;  3WC6 A;  2ZEE A;  1ONL A;  1IYV A;  4MHP A;  4P10 A;  4Z65 A;  4DYO A;  3PV0 A;  2ZEP A;  4R76 A;  4TWE A;  3PB8 X;  2K32 A;  2G9D A;  3D66 A;  1CP6 A;  3N6R A;  2PJ3 A;  4DUK A;  3KQX A;  2JEB I;  1K8M A;  3LNN A;  5D8N A;  3IFT A;  4IHM A;  1FNO A;  3CDX A;  5LRG A;  1F2O A;  3L7Z C;  4ZY2 A;  4A39 A;  3W3A A;  5CPA A;  4JZ0 A;  4ZX8 A;  2AFS A;  2RFH A;  2DNE A;  1NSA A;  3RZA A;  4UEE A;  4H44 C;  2PJB A;  4JBW A;  3VR2 A;  2CW0 C;  2EWB A;  3T8W A;  1OXV A;  2Q51 A;  3B3T A;  1LAC A;  2ZOF A;  4UEZ A;  4W9Y A;  3KI9 A;  3FMC A;  3KLR A;  3T56 B;  1H9K A;  3BI1 A;  2V8D A;  1G29 1;  4DNR B;  4UF4 A;  1ZG8 A;  2E76 C;  2K7V A;  3FX6 A;  2D5D A;  5LYF A;  8CPA A;  2DEA A;  2A6E C;  3QJY A;  1HPC A;  2CTC A;  1CPX A;  3B3C A;  4JYW A;  1KWM A;  4OP4 A;  3RLF A;  2KA7 A;  2JEW A;  1O7L A;  3KHX A;  2GU2 A;  2L5T A;  1H9M A;  2EVB A;  4P45 A;  1E2W A;  1F2P A;  3RBU A;  2DN8 A;  1YW6 A;  4OC3 A;  3DLJ A;  1Y8P B;  3MFY A;  1Z8L A;  5THW A;  1HQM C;  3ISX A;  4IK2 A;  2ZEL A;  2EK9 A;  3B35 A;  5A35 A;  3GD7 A;  2EK8 A;  3D68 A;  1BPN A;  3NA6 A;  3FH4 A;  3D67 A;  2POK A;  4L8J A;  2A6H C;  3VR4 A;  4TKO B;  3PRT A;  1FYC A;  2PJA A;  1XFO A;  3IEH A;  4P4D A;  1LFW A;  3P20 A;  4UIA A;  4NGT A;  5K8P A;  2CIJ A;  4KKT A;  1IGB A;  1VIX A;  2GLJ A;  3FEE A;  2LMC B;  3CRK C;  1HTP A;  3PBB A;  1Q1E A;  1H9S A;  3PB9 X;  2V8H A;  3D7H A;  3SI0 A;  1VCI A;  3NH5 A;  3HGB A;  3KGQ A;  4DJL A;  4OC5 A;  2ZEH A;  3BI0 A;  1Y7E A;  1YME A;  2ZED A;  4MHY A;  1ZLI A;  2R6G A;  1QMU A;  1PMR A;  2A69 C;  3PFE A;  4ZYQ A;  4MMO A;  4K3N A;  4R8F A;  5LYI A;  3IFE A;  3PB6 X;  1ZYR C;  5K8N A;  2XEJ A;  3D4R A;  3SE0 A;  1GUG A;  3KHZ A;  1AYE A;  3IKJ A;  1H9R A;  4R7M A;  4MXU A;  3TC8 A;  3S9M A;  2GLF A;  1ZLH A;  1Q7L A;  1CG2 A;  2XEG A;  1TKW B;  4ZX9 A;  2PIY A;  1IW7 D;  1H9S B;  4KN4 C;  1PYT B;  4TQU S;  1LCP A;  5LYD A;  2QYV A;  2PPB C;  1V43 A;  3FED A;  2NN6 G;  5CBM A;  2KCC A;  3CRL C;  1ELM P;  1GUS A;  5DS0 A;  3B7I A;  4YWY A;  5JM6 A;  3B3S A;  2PJC A;  3GUX A;  3HLP A;  2V4D A;  3WDN A;  4LQG A;  2AUK A;  3D4U A;  2HB6 A;  1GJX A;  2IT1 A;  4B6Z A;  2JEA I;  2B8F A;  4G7H C;  1OXS C;  1DE4 C;  2C6G A;  5K36 G;  3FVL A;  1M4L A;  2BA1 A;  5HVG A;  2VL1 A;  3SJF A;  4MHN A;  1K8O A;  2K33 A;  1CX8 A;  5K8M A;  4OC0 A;  4OME A;  3NE5 B;  1LAN A;  2AFU A;  2PCU A;  2V8G A;  5HVH A;  2JE6 I;  3A8K E;  4JK1 C;  4G7Z C;  1OXU A;  3D31 A;  4P4B A;  4IQZ A;  5JGF A;  2J9A A;  4XTC S;  2BA0 A;  3M7N A;  4PXB A;  4A94 A;  2C6C A;  1BAV A;  4BD9 A;  4X2T A;  1T5E A;  5I4M A;  3WC7 A;  1GUT A;  1DCZ A;  1VF5 C;  3A7A B;  4EFD A;  2D62 A;  2O4H A;  2AFX A;  1EE3 P;  4OC1 A;  5HXD A;  2AFZ A; 
#chains in the Genus database with same CATH topology
 5BR8 L;  4KSI A;  4NCZ A;  2EYP A;  1FL0 A;  3K57 A;  3PQI A;  4MNO A;  1XX8 A;  4LFA L;  3GTQ H;  3RMH A;  1BO4 A;  5H86 A;  5IGE A;  1DTD A;  2VW9 A;  3LWE A;  3HOY H;  4JBK A;  1HDQ A;  4LJZ C;  3OTO L;  2B3G A;  1AZP A;  2ATR A;  2WYR A;  3K2K A;  1XWE A;  5ELY A;  3DGV A;  4CS0 B;  5FLM G;  1Z8W A;  1EUJ A;  1Q2Y A;  4ME5 A;  2EYM A;  2LXJ A;  4C2Z A;  4B9X A;  4RCN A;  1NMF A;  1VQB A;  2CTB A;  3GTK B;  3KQZ A;  1SNO A;  2ICI A;  2KHS A;  1P8L A;  1NE3 A;  2J7Z A;  1PRT B;  3N7Z A;  2IPK D;  3T51 B;  4JI8 L;  4OC4 A;  4CDC C;  2QDB A;  1YBY A;  1A0I A;  4KHV A;  1TU2 B;  2OQ0 A;  3NSW A;  3BHX A;  3MWY W;  3K59 A;  1HZC A;  2JYO A;  1BBW A;  4IAV A;  4A38 A;  2HIV A;  2ZW7 A;  4JI2 Q;  3S6F A;  3W6S A;  4KTA A;  1AE3 A;  2PZT A;  4DR4 Q;  4CAE A;  3HP3 A;  3GB0 A;  4POG A;  2BOA A;  1PRT C;  4ILW A;  4B3R Q;  5D29 A;  5KND A;  3T4A C;  1D5M C;  1PFB A;  3I3C A;  1STH A;  1O7Y A;  4QJF A;  3OYY A;  3WOE A;  3S1R H;  3MN8 A;  2R7Z G;  4MFQ A;  4Q7A A;  4OX9 L;  4EQP A;  2KCT A;  2B63 H;  4V19 0;  1BLL E;  2Z3P A;  4A95 A;  5C4J B;  5KNB A;  1K9M C;  1ZG9 A;  2ZW5 A;  4X64 Q;  2TSS A;  2B3U A;  4AVC A;  1LUZ A;  1Z4E A;  1JQG A;  2YU9 B;  1BDO A;  3DM3 A;  2I0Q A;  4BY7 B;  2HUZ A;  4HID A;  3OW7 A;  4DFA A;  2F5I A;  2JA5 H;  3JAM c;  3BVG A;  4BIN A;  1NNX A;  4UAI A;  3GTJ B;  5G1Z A;  2GFQ A;  5ELC A;  2XVS A;  1VQF A;  1EFW A;  4HKF A;  1LTI D;  2Z11 A;  4IUV A;  4B10 A;  3B3V A;  4KD3 A;  3NTH A;  3HKZ B;  4DV2 Q;  3A56 A;  1GD7 A;  1C8C A;  3SXN A;  1MJE A;  1BUV T;  5CV6 A;  1UUP A;  2QGQ A;  4K8I A;  5LMN L;  2PE3 A;  1Y1V B;  1RTN A;  3I4L A;  3CCU A;  4GM5 A;  3J80 E;  1SE4 A;  2PMZ B;  4ODG A;  1YK3 A;  2GIV A;  1NR2 A;  4ZBG A;  2K01 A;  4OIK A;  3OWF A;  3WT4 A;  4DR7 L;  4F8M A;  1EU3 A;  3K5M A;  3T9Y A;  1VHO A;  2JA7 G;  2Y0S G;  5AGE A;  2A6E D;  2OF1 A;  5I9P A;  2AWN A;  3K7A B;  4N9P A;  2DJG C;  3Q22 A;  1U4R A;  1J8I A;  4I7Z C;  2CNM A;  2RCF A;  2EE1 A;  5F47 A;  1RIP A;  4JI5 L;  1EZ6 A;  4R4I A;  1Z7T A;  3FEC A;  1B9M A;  3QR8 A;  4BWG B;  4DNI A;  1MGS A;  3OPO A;  2GRE A;  3L3O C;  1QOH A;  4V0B A;  1X12 A;  1EYA A;  4KS9 A;  4P4J A;  3IO1 A;  4JV5 Q;  4NXN Q;  3AYH B;  1AFP A;  1HZA A;  3ULJ A;  5IY0 A;  3FB3 A;  1FJG L;  3NFZ A;  3S1M H;  1XNR Q;  2YGW A;  5IB9 A;  4Z9C B;  5J1Q A;  4P4E A;  1FNU A;  2ZXV A;  1SMX A;  2SNS A;  4AQY L;  3S16 H;  1LTA D;  2A6H D;  3S15 H;  1R43 A;  1L1O A;  3F8T A;  3R93 A;  4IFD H;  4RGM A;  2B5G B;  4CAF A;  5JQ4 A;  1D1K A;  4BBR G;  1HCZ A;  3VR5 A;  4E0A A;  3AB9 A;  1OTC A;  2REE A;  1VQC A;  4HTH A;  3AQQ A;  2B8G A;  3CXQ A;  5J8F A;  3S9N A;  4Y7N B;  2GN5 A;  2JEV A;  1VHE A;  2VNU D;  3LD2 A;  4MCR A;  3E0K A;  3IFD A;  3KF8 B;  3W2D A;  1U4M A;  3BU2 A;  5IOD A;  5C0X G;  4RAU C;  2PZW A;  4CGP A;  1I6V C;  3NH8 A;  2O2L D;  2OXP A;  4JI0 Q;  2QIL A;  2PJ7 A;  4KKS A;  1K3R A;  3QG1 A;  5LRJ A;  3CPW A;  2L1B A;  2A68 D;  2J8M A;  3CCS A;  1WTW A;  2JDD A;  2VBQ A;  3HFZ B;  1PH8 A;  1N34 Q;  2HHH Q;  1ARM A;  4H6Z A;  1PHJ A;  1EEI D;  2ALY B;  1SYE A;  1ASZ A;  3FIX A;  3NEN A;  2M00 A;  1GHE A;  4XQJ A;  1ZYR D;  2ZTC A;  4YY3 L;  4OWW B;  2JA6 H;  1G6Z A;  2ZEN A;  1YVC A;  1VQG A;  3GQB A;  4U68 A;  3T1H L;  5COY A;  1O7I A;  1XPR A;  1PH9 A;  2R7H A;  4RUH A;  1I4G A;  3I4N G;  2A5H A;  1SNQ A;  3MEH A;  2B3V A;  2MO0 A;  2YV5 A;  2PR8 A;  4L6T B;  1SJH D;  1SQH A;  2AFW A;  3QAH A;  5IYB G;  1VKC A;  5JH9 A;  5DM6 3;  1HHV A;  4AXV A;  3A5Z B;  2EJG C;  1CFM A;  1XMQ Q;  1KAB A;  4GN3 B;  2A19 A;  4DXF A;  4E8O A;  2WV6 D;  2NN6 H;  4K6D A;  5DLQ E;  2MO1 A;  1D2B A;  3D3S A;  2UXB Q;  3B3W A;  3H3V C;  1CJW A;  3IU2 A;  4OKO A;  2R93 G;  1TS4 A;  1HR0 W;  3J7Z C;  2K4K A;  1CA6 A;  4C2M H;  4UEF A;  4FF3 A;  4IUT A;  5IWA Q;  2KJX A;  1N8R C;  1I1D A;  2B2W C;  4JXR A;  2L55 A;  3PEI A;  2ZT9 C;  2PJ1 A;  4MCS A;  1HQR D;  3NE8 A;  4KJN A;  2XWJ B;  3J80 i;  4M6G A;  3SEB A;  4UP8 A;  4FAI A;  3PB7 X;  4NJQ A;  5K36 H;  4JI1 L;  1YJW A;  3V2T A;  2Z0S A;  4XIG S;  4BY1 H;  2PJ2 A;  4K6L A;  3R95 A;  5M3M H;  4JI6 Q;  1PTO H;  3N5F A;  4RKL A;  3VYS A;  2DPT A;  1QB5 D;  1RJT A;  2BH2 A;  1FNW A;  2BCO A;  3D7F A;  1CK1 A;  2YTY A;  1H95 A;  4HPS A;  4BBH A;  4C3J G;  4JCV E;  4X6A H;  5JJL A;  4FD5 A;  2AKW B;  4WWV A;  3NBH B;  3TP5 A;  3UE0 A;  3G48 A;  4FBE A;  2K50 A;  1Q90 A;  1O80 A;  3GLJ A;  4AG7 A;  2OZH A;  1DOL A;  1PU9 A;  1Y0R A;  1XJV A;  2N55 A;  3H0G G;  3HOV B;  2K52 A;  3O13 A;  1VDZ A;  4RHS A;  5D65 A;  3TBI B;  5FJ8 G;  1II3 A;  2F7V A;  2HQY A;  3PO2 H;  4X3T A;  2QJ8 A;  4JI4 Q;  4NGN A;  3T1Y L;  1KDC A;  2FJ2 A;  4PSW A;  2ZEG A;  3GTL B;  1A62 A;  4NGM A;  1GO3 E;  3CPX A;  3NHH A;  4IUP A;  1SJE D;  3CCJ A;  7CPA A;  2PJ8 A;  1ESF A;  4UCN A;  2O53 A;  3IWW A;  3M9B A;  3H91 A;  4RHR A;  4A3M B;  3EFX D;  4DNT B;  3J80 c;  3CP0 A;  5L37 A;  2F0F A;  4QY7 A;  4A3D H;  1A3V A;  1JOR A;  1RHP A;  4FXK C;  2HC9 A;  5AFW A;  4BBR B;  1V1Q A;  4F7X A;  1IYV A;  1G91 A;  2ZEE A;  4KOX A;  4P10 A;  5DWM A;  3PV0 A;  4TWE A;  3PB8 X;  4QC6 A;  1CP6 A;  3J7A 5;  2WB1 G;  3CME A;  4QIW E;  3N6R A;  2PJ3 A;  1B4O A;  2NBF A;  1WI5 A;  5EAY A;  5IIF A;  3FRM A;  3WR7 A;  3LNN A;  4IHM A;  1FNO A;  4ZY2 A;  4A39 A;  3B8G A;  1QSR A;  1MHW C;  1VQ4 A;  4IO9 A;  4DAY B;  2KHJ A;  4B3S L;  1SYC A;  1Q82 C;  2EYF A;  4DUZ Q;  2I07 B;  4WJ3 M;  4LFC Q;  3B3T A;  2R8V A;  4IUS A;  3W1B A;  4XPD B;  1P4N A;  5JJI A;  2V8D A;  2VUM G;  2E5L Q;  4DNR B;  2Z3M A;  3G7L A;  1V1O A;  3I4N B;  1RL2 A;  2ZJQ A;  2D5D A;  4OON A;  1HNX Q;  3GTM B;  1XE4 A;  1HNZ L;  1LRZ A;  5KYI A;  2F3I A;  2OH1 A;  2D0P A;  3TE4 A;  4P74 A;  4JYW A;  3CQZ B;  2HCI A;  1WOC A;  2JEW A;  5IT9 E;  1O7L A;  1R4Q B;  1TS3 A;  4DR2 Q;  2DXQ A;  3KOJ A;  1N32 Q;  4A3B G;  2YNC A;  4ZQ3 A;  2DN8 A;  4LF5 Q;  5FO8 B;  5M5W B;  2PQA B;  1SE8 A;  2J4X A;  3E9H A;  2JQO A;  2RSN A;  2R93 B;  3DLJ A;  1Z8L A;  5F46 A;  3MFG A;  3KDF A;  1PFM A;  4C1N K;  2ZEL A;  5J39 A;  5A35 A;  3GD7 A;  3K6O A;  4FDB A;  1BPN A;  5HXD A;  2F0P A;  3PIO 3;  3UE1 A;  1JR0 D;  3JAM L;  3C1F A;  1VQM A;  4MY3 A;  4TKO B;  3I90 A;  2I5L X;  2JA7 H;  3J81 L;  3IWE A;  2E2I B;  4KOS A;  3EN2 A;  3HOU B;  5EBV A;  4YHH L;  1L0Y B;  1V0C A;  3OIQ A;  2LMC B;  2VEZ A;  2JN4 A;  2V1C C;  4DR5 L;  4B13 A;  1Y9K A;  2IW3 A;  2HUG A;  4K8J A;  2NMT A;  3HOW H;  3S6G A;  2VB3 X;  2EUI A;  4MTK A;  4RI1 A;  1VCI A;  3U9O A;  2FXF A;  1UNS A;  3D6C A;  4C7I A;  3HGB A;  4DJL A;  5HGQ A;  4OC5 A;  2ZED A;  2ICE C;  4MHY A;  3C1E A;  1EYD A;  2H5M A;  1ROD A;  3M4P A;  5CBA E;  2UUA Q;  3NEL A;  3STB C;  2G0B A;  3G71 A;  3PO3 B;  3EXN A;  3EFA A;  1L0C A;  4ZLT F;  4QVT A;  4X65 L;  4Q5V A;  2NVX B;  1HA6 A;  3T13 A;  1C4Q A;  5CMD A;  3Q24 A;  2XN9 C;  2QEX A;  2F3V A;  4R8F A;  2K6A A;  4H6U A;  5K8N A;  2XEJ A;  1LTL A;  1YLE A;  3CXC A;  1IB1 E;  2CCZ A;  1M4G A;  3K58 A;  1AYE A;  3GTP B;  1A3U A;  4XNH B;  1F2M A;  4PMB A;  4WOR A;  2NZH A;  3D8G A;  5JJZ A;  1A2Z A;  4FNF A;  4ZX9 A;  1H9S B;  4LMQ D;  1JE5 A;  1FGB D;  4L63 B;  1PYT B;  5EPK A;  3HRZ C;  2DUD A;  4KY7 A;  2PPB C;  3WOF A;  4XNH C;  1I4X A;  4GOP A;  1FD7 D;  1S5K A;  5C5L A;  3QAY A;  1JIC A;  4KOR A;  1EIH A;  1ELM P;  1Q46 A;  5E7N A;  1ILQ A;  3KLW A;  5DS0 A;  5C3E G;  3GTO B;  1HZ9 A;  5M5X H;  5EQ0 A;  4MZ9 A;  3WDN A;  1EIY B;  1MJC A;  4U9Y A;  2AUK A;  3I2Z A;  5ELD A;  2HB6 A;  2IT1 A;  1HUN A;  4HIO A;  1PH4 A;  2B8F A;  4G57 A;  4H02 A;  1DE4 C;  1NMT A;  2AQ3 B;  3QOJ A;  5IYB H;  2OWO A;  1YEZ A;  2ZM6 L;  3HS0 C;  1N71 A;  1K8O A;  4LF8 L;  3HZX A;  4CJ1 B;  3P75 A;  2I00 A;  4DR3 L;  3ITP A;  2AFU A;  5CV7 A;  1K83 B;  4KLW A;  4CGM A;  5HVH A;  1LTT D;  2K5T A;  1YX0 A;  4MY0 A;  1HUM A;  1JOK A;  2O4X A;  4IQZ A;  4CGO A;  1E1O A;  4XTC S;  4YIJ A;  5TSS A;  2A8V A;  3MAQ A;  3DDD A;  1BAV A;  3IU1 A;  1D5Z C;  2B4D B;  5F48 A;  1XEB A;  1KAW A;  3AMU A;  1DCZ A;  1PTO F;  3TOB A;  2D62 A;  2DY7 A;  3RUZ A;  1QCB D;  1Z8X A;  2KCM A;  4OC1 A;  1Y1W B;  1WD1 A;  2BH8 A;  3BDL A;  1X3Q A;  2AFZ A;  4N8F A;  2PVW A;  1J6Q A;  4G7O C;  2NN6 I;  5BWA B;  1NBW A;  4ORF A;  4MRI A;  3UY5 A;  3GKR A;  3G4S A;  4JI7 L;  3OMG A;  4R4Q A;  4DF7 A;  4OAD A;  2ZTE A;  2KEN A;  5CGK A;  3BXM A;  3QWN A;  2D4P A;  4KI0 A;  4C3J H;  2CH4 W;  3A54 A;  4NEX A;  4YGO A;  3QNV A;  1JC7 A;  5IV0 A;  4R6T A;  2JK8 A;  2RCN A;  3ULL A;  2QEC A;  2Z3N A;  5IGD A;  5HH1 A;  1ICF B;  1HNW L;  2EO8 A;  3FNC A;  4F9U A;  1Q8K A;  1YSJ A;  3LMS A;  3H0G H;  4HR7 B;  2UUC Q;  3K9T A;  1CTM A;  4K2L A;  2BOS A;  5JPM C;  5FJ8 H;  5EMI A;  1X3P A;  2I5M X;  3PUX A;  1CP7 A;  4LF7 Q;  1LM0 A;  1BO0 A;  4P75 A;  2Z3K A;  1R9T B;  1XF8 A;  2PCF B;  4CKC A;  1L1O B;  1Y0Y A;  4GS4 A;  2B2V A;  3S14 B;  2NZ1 D;  3KLS A;  4P2C B;  2DF5 A;  2IX1 A;  2PJ4 A;  3S9W A;  1A15 A;  1XBU A;  2EJF C;  3CC2 A;  3TP8 A;  1UWV A;  4PSX A;  3GP7 A;  4DR1 Q;  3M7G A;  1TWF H;  2WSA A;  3ZJ0 A;  5BR8 Q;  3PUV A;  4LFA Q;  2XRS D;  1L1O C;  2D2C C;  1C0A A;  1KXL A;  2V77 A;  1U5K A;  4IAL A;  3OTO Q;  4L5T A;  3M4Q A;  4DV0 L;  4K0K L;  3NBI A;  4DV5 L;  4MHD A;  4HIM A;  4NKL A;  3WC5 A;  1X3G A;  2A68 C;  2WAQ G;  5C4H A;  1HR0 Q;  3GTQ B;  3MRU A;  4LF6 L;  1BBX C;  1JOQ A;  5IGB A;  4HCE A;  4PXE A;  3IL8 A;  4HMI A;  2E75 C;  4JI8 Q;  4A3I H;  2PW5 A;  4DV3 Q;  1I4Q A;  4B14 A;  3FJU A;  3P2H A;  1Y8N B;  3J80 L;  4LW1 A;  2WP8 J;  3Q0A A;  4CYO A;  1H8L A;  4ZY0 A;  1HDU A;  4BY7 G;  1YGH A;  2ZTD A;  5JEA J;  1U4P A;  3TX8 A;  2PDO A;  5ISR A;  4NW2 A;  2Q8I B;  3EVQ A;  1G8Z D;  4GZY C;  2YND A;  1RF2 D;  2L11 A;  4DV4 L;  1TWG H;  1IBM L;  2VQY A;  2RBM A;  4CJ0 B;  4KMU C;  5EJW A;  2E2J B;  2VUM H;  1JT8 A;  1HTL D;  1VGY A;  1F57 A;  2OQK A;  3HKZ G;  2C6P A;  2F0W A;  3PF5 A;  4OX9 Q;  3T90 A;  4FXG C;  4OO1 G;  2HD3 A;  1WJJ A;  4FWU A;  1S7K A;  1Y1V G;  4FD7 A;  4FUU A;  4DUY L;  1RKN A;  1CKN A;  1YI2 A;  1RXT A;  4UIB A;  1AE2 A;  3HUV A;  4UWI A;  4QIW B;  1Z9F A;  2SEB D;  1F9P A;  1MSG A;  2F0L A;  1IXR A;  5E4X A;  3SR1 A;  4A3B H;  4CGL A;  4B3T Q;  4C68 A;  4GN4 B;  2EJM A;  5KGU A;  1OZP A;  1TKH A;  1R57 A;  2A4N A;  4OC2 A;  1VF7 A;  2ZW4 A;  2JA5 B;  4FF2 A;  1GYT A;  4DU9 A;  1PH5 A;  4PPZ A;  4HAE A;  4P6Y A;  6CPA A;  4IPG A;  5KTD A;  2R7D A;  2PI2 A;  3V96 A;  4MCQ A;  2Q8R E;  5M3F H;  1YLO A;  2A74 C;  5LL6 X;  3F2C A;  1XNQ L;  1K28 A;  1Y14 B;  3CU7 A;  4JD6 A;  3S1N H;  4GLX A;  4DR7 Q;  1MIU A;  1EY8 A;  4PQX A;  3E0J A;  4RG1 A;  3VR6 A;  3MXU A;  1RO5 A;  2JA9 A;  4FXD A;  2EXD A;  1PZJ D;  2B2U C;  1EWI A;  4K5V A;  2E2H H;  2FCK A;  1KUX A;  5IP7 G;  1QJO A;  3OWE B;  4C1N I;  5AG5 A;  4NSQ A;  5C3W A;  5K8O A;  3SXH A;  3UDX A;  2EIF A;  2OR4 A;  3BVZ A;  2HDM A;  4RMF A;  1XOV A;  3DLL A;  3ONA B;  1LAP A;  3CCM A;  2EY6 A;  4CKB A;  1JOO A;  3FRP B;  2AJ6 A;  4OAE A;  1TWH B;  1W6K A;  4L8A A;  3JAM i;  5KEE A;  3STB D;  1X9N A;  1PYS B;  3NQT A;  3J81 i;  1CA5 A;  1FJG Q;  1EWH A;  1SFO B;  4CYQ A;  5JEA G;  1N36 L;  2AHO B;  3D8P A;  1AUG A;  1QST A;  4NGP A;  4AQY Q;  2BDO A;  3KF6 B;  4GKK L;  1CBX A;  4O23 A;  4KUA A;  3CCL A;  1WWZ A;  1LTG D;  2DY8 A;  3BDC A;  4HJ7 A;  4O0A A;  2PIZ A;  1V1P A;  4K2K A;  3SDZ A;  1TWA B;  4ALP A;  3OW2 A;  1I12 A;  3S2D H;  1XJO A;  3DSB A;  1JCK B;  5IYC G;  3ISZ A;  2JJQ A;  4X62 Q;  4A30 A;  2ZJP A;  3S16 B;  3RZD H;  2FFK B;  3S15 B;  2WAQ B;  4A3K G;  3A5U A;  3OSO A;  1AW7 A;  4DR6 Q;  2RDH A;  3I4O A;  1A6X A;  3A7L A;  2L4N A;  2C1C A;  4EVY A;  5FVJ A;  1I6H B;  1VQO A;  2CVR A;  5IP9 G;  3DWQ A;  2PI2 E;  2ASB A;  5EC4 A;  5KIX A;  1KHI A;  3U9S A;  3NXW A;  5C3E H;  3DEO A;  2KED A;  1J9O A;  4ZAI A;  5KYL A;  5LMU L;  5C4X B;  2J8N A;  3RLO A;  5C0X I;  4BXX G;  3E5S A;  2XWB B;  4WRD A;  5E4W C;  4DN4 M;  1YRE A;  1ENC A;  4F6A A;  1YHQ A;  1SBB B;  2EYO A;  1EOT A;  4APV A;  1W6J A;  2VQE L;  4JYA Q;  3FXT A;  4NXM L;  3KKW A;  1IYK A;  4BA2 I;  2PSW A;  3PP9 A;  4F8Z A;  3J81 c;  3H09 A;  2B2T A;  1GUN A;  2ZEM A;  4PZ8 A;  1EQT A;  1JWU D;  2QEJ C;  4JWP A;  4LF4 L;  3V38 A;  3NWS A;  1XTC D;  1TQO A;  1CI3 M;  4EWT A;  2UXD L;  4LX9 A;  3KDF B;  3IJ3 A;  1EFI D;  2B2Y C;  1N33 L;  4UFV A;  1EEF D;  3H4Q A;  3VA5 A;  3TO9 A;  1QVC A;  4B3M Q;  1OBR A;  1VQI A;  4FD6 A;  2I46 A;  2FMM A;  5FLX E;  4P73 A;  3QB8 A;  3RN5 A;  3RAM A;  1R4P B;  3P1H A;  1PH6 A;  2UUB Q;  3H6M A;  4GKJ L;  2H4O A;  3I4M B;  3S9L A;  3KL9 A;  4NB3 A;  3VYU A;  5CNP A;  4A3E G;  2HIX A;  3FKI B;  3K0Y A;  2PYK A;  4ZKC B;  2FVG A;  1S5D D;  1B44 D;  2QDL A;  4OID A;  1TXR A;  5K5P A;  3I3G A;  4BBS H;  3D4D A;  1U4L A;  1O7Z A;  2Q2H A;  1KAA A;  1KC8 C;  3S17 B;  1M1D A;  1WTR A;  3HOV G;  4A3L G;  4JVZ A;  4H89 A;  2I79 A;  3N52 A;  3R2I A;  1WTP A;  4JI1 Q;  1SN8 A;  4KLK A;  2NYQ A;  3Q23 A;  2F0T A;  1BF4 A;  1KZF A;  5HGT A;  2NVT B;  3KR4 A;  1ET6 A;  2F0J A;  1F9Q A;  3WC6 A;  4B9W A;  1QQ9 A;  4QB9 A;  3NH4 A;  1SSO A;  1YIJ A;  4XT1 B;  4MHP A;  1EIF A;  1NY4 A;  4F0X A;  3KBX A;  4A3M G;  2K32 A;  3F8K A;  1IL8 A;  2CWP A;  3S1Q B;  4LQ6 A;  2IHF A;  1GUW A;  1GM5 A;  3GTK H;  4UP7 A;  1K8M A;  2KVM A;  3OIP A;  4P72 A;  3IFT A;  3D2M A;  4UDU C;  3CDX A;  4YWM A;  2Z4I A;  3W3A A;  2F0N A;  5CPA A;  4ZX8 A;  2DNE A;  2WB1 E;  2X7B A;  3TQY A;  3RLN A;  4AH6 A;  4UEE A;  1NCV A;  4H44 C;  1EL0 A;  1PTO C;  2PJB A;  1VHS A;  3LAC A;  1S5B D;  4QF4 A;  1U6M A;  5T1G A;  3DWP A;  2ZOF A;  2XGT A;  3GY9 A;  3KI9 A;  3R3O A;  3FMC A;  4LUV A;  2H1E A;  4GOP B;  1TII D;  3BI1 A;  4KY5 A;  1F2Z A;  3I7F A;  5CV9 A;  4CYP A;  1LO5 D;  4UF4 A;  1J5E L;  2KQ3 A;  3KLS X;  4B5P B;  4EVO A;  2DGY A;  2C9O A;  3GIU A;  1S4Z A;  2CTC A;  2IX0 A;  4K14 A;  2CY2 A;  4B3R L;  5C4J H;  3J7A V;  1JJG A;  3EY5 A;  1KWM A;  4OP4 A;  4UP9 A;  2OT2 A;  4A3K B;  3KHX A;  4GOP C;  3R1K A;  1H9M A;  1PLF A;  2YU9 H;  1X3E A;  4DAV A;  1CHQ D;  2WKC A;  4YCV A;  1F2P A;  2MQH A;  3RBU A;  4HJ5 A;  2MUY A;  3GTJ H;  3MFY A;  1Y8P B;  1SRU A;  3JVN A;  4IK2 A;  3MXN A;  3U50 C;  4M6I A;  5IE8 A;  4AIM A;  2EK9 A;  3B35 A;  2D9U A;  2R7F A;  2NVQ B;  4A3J G;  4B3S Q;  2F0O A;  4R8I A;  1BBU A;  4EQ5 A;  3FH4 A;  4J1M A;  1QUQ A;  4LAA A;  3R8B A;  1EYG A;  1B1Z A;  4UFW A;  3PRT A;  5G21 A;  2OB0 A;  4A3F G;  4CDE C;  5DEH A;  3U4Z A;  1PH2 A;  4FYD A;  3P20 A;  4L5S A;  1LFW A;  3GV3 A;  4JOI A;  2WUU A;  4P4D A;  2CIJ A;  4UIA A;  4DV2 L;  1STG A;  1D5X C;  2XSC A;  1HNZ Q;  3R96 A;  1HH2 P;  1DON A;  1YVK A;  2QIR A;  3HOX B;  3K7U C;  1TXY A;  4L5Q A;  5G3L F;  1BOS A;  3HG9 A;  3K7A H;  4A93 B;  5JPH A;  3ICE A;  2C27 A;  1Q2C A;  4NPS A;  3HOU G;  2P5Z X;  2FIA A;  1KNE A;  2EPB A;  2L9H A;  4YCW A;  4DV6 L;  3BI0 A;  5I9O A;  2H5X A;  4CRY B;  4A3E B;  1YR0 A;  3SK5 A;  3GYA A;  2A69 C;  4KJO A;  3R9F A;  2NVY B;  2MFI A;  4F87 A;  4K3N A;  5LYI A;  2EZV A;  3L2P A;  3IFE A;  3PB6 X;  2K03 A;  4X3K A;  4HIK A;  3D6W A;  4MFP A;  2SDF A;  5I6Y A;  4M8A A;  4DK6 C;  4KOY A;  3PO3 G;  3CW2 C;  3TC8 A;  4ZKB B;  1EZ8 A;  4XXE A;  4YHH Q;  2GA4 B;  4H7B A;  1KQS A;  4NXN L;  5C4Z A;  1W2B A;  3RZO B;  1ZLH A;  3A55 A;  1CG2 A;  4DR5 Q;  4ME3 A;  4ZRZ A;  1PH1 A;  4RWS C;  2VI7 A;  5FO9 B;  3MTS A;  2X6L A;  5GQO A;  1CM0 A;  4Y7N H;  2EYL A;  5FLM H;  1LCP A;  5FLX c;  4AB7 A;  1JWS D;  4HJA A;  1QSO A;  3FED A;  1JQY D;  1I50 B;  2MGS A;  3ERS X;  4KD4 A;  2RDG A;  2KCC A;  5LMN W;  1SYD A;  1CZW A;  4M85 A;  3CRL C;  2NB0 A;  2GVB A;  5FOB B;  1E24 A;  3DHQ A;  4B5O A;  1CQF A;  2JP1 A;  4UBR A;  3TME A;  4X65 Q;  1UE7 A;  3B3S A;  4Y49 B;  2KOL A;  4ABN A;  2F3W A;  2WII B;  1GJX A;  1F77 A;  1NSL A;  1M1K C;  1PZI D;  2JEA I;  3A9L A;  4A31 A;  3FVL A;  3ERQ A;  4HCS A;  2K33 A;  3KK7 A;  1W3S A;  1WTV A;  1B3Q A;  2WAC A;  2LS0 1;  5D3I B;  1I4P A;  4PMW A;  4Y49 C;  1WYD A;  4GNX A;  2HHH L;  1WK4 A;  2UXC L;  2V8G A;  1ENA A;  2HDL A;  5IP9 H;  3A8K E;  2G3A A;  4G7Z C;  1OXU A;  3D31 A;  4P4B A;  4RA8 A;  1VS0 A;  4DK3 C;  1VQ6 A;  2R7Z H;  2F52 A;  4A94 A;  4PXB A;  1E22 A;  4BD9 A;  2RA4 A;  4X2T A;  4BXX H;  5DNF A;  3SXO A;  5I4M A;  4RH6 A;  4IPH A;  2EY5 A;  3CZX A;  3TEH B;  4A75 A;  3R9G A;  4FP5 D;  2P0W A;  3CPF A;  1QIL A;  1HFN A;  2VZY A;  1CKN B;  1PFS A;  1BXT A;  2LY7 A;  2ZPA A;  2OOT A;  3CC7 A;  1SR3 A;  3RYO A;  1HZB A;  2PJ6 A;  4OIW A;  4R57 A;  4A3J B;  3KJO A;  2UXB L;  1TVX A;  1YNJ C;  4II9 A;  4L5R C;  1KUV A;  4M1U B;  4R4T A;  4UHV A;  2F0D A;  2ZM6 Q;  1Y1W G;  3JRU A;  1XPO A;  5EBC A;  4LF8 Q;  3GV6 A;  4K5W A;  4QMG A;  4A3F B;  3PMF A;  1I4H A;  5M5Y H;  5FO7 B;  1E0B A;  1S5E D;  1X55 A;  4KN7 C;  4I49 A;  1KNA A;  2M2L A;  1Q3L A;  1EY6 A;  4RGN A;  3TO6 A;  1BCP F;  1PH3 A;  2WZN A;  5LYL A;  1NMG A;  2B29 A;  1BOB A;  1UE6 A;  3S2H B;  4FVM A;  5CC4 A;  1DJR D;  2N8N A;  2EYH A;  1Q81 C;  3HOZ B;  3FF3 A;  4A3L H;  4C3I G;  3H8E A;  3AEV A;  1SYG A;  3SVM A;  2ABZ A;  3MVV A;  1DOK A;  2M9V A;  4BMH A;  2F0I A;  3IRB A;  1PZK D;  2E8G A;  4JI7 Q;  3GTL H;  2ID0 A;  3BVM A;  3L2N A;  1B87 A;  3CT9 A;  5M9O A;  4DAP A;  3TS0 A;  3CXP A;  1Q12 A;  2EY2 A;  3IIB A;  2KUM A;  1K4J A;  1YQE A;  1KDA A;  1PRT F;  2KCN A;  4A3M H;  4NGQ A;  1VQE A;  3M4Y A;  5C6A A;  1Y8O B;  3BZC A;  1HNW Q;  3H8F A;  3S6H A;  5AJ3 Q;  3C46 A;  3P7J A;  1ICW A;  2EXZ A;  5JPN C;  4F9V A;  3JTK A;  4BBR H;  1M4I A;  2Q4V A;  1UEA B;  3SK4 A;  1IKM A;  2Q04 A;  4N8X 1;  3QO2 A;  4NJR A;  2IY5 B;  3B2Y A;  2JBK A;  3QIA A;  1S7L A;  1BR9 A;  4Q0F A;  1V1P B;  3HOY G;  2R92 B;  3W6X A;  5BN5 A;  5C0X H;  4ZI6 A;  4X66 Q;  3GTG B;  4JPB W;  1PTO D;  1B7Y B;  1IBL L;  1Y69 U;  2PW7 A;  4LFB L;  3DNS A;  5ELN A;  1B53 A;  1I94 Q;  4NXY A;  4XPK A;  4NGS A;  2L12 A;  4J6H A;  3ND8 A;  4FF1 A;  2OZG A;  4MFJ A;  4P4F A;  5I2X A;  4CGN A;  4ZGY B;  2RB7 A;  1N9W A;  1UWY A;  4K0K Q;  2LXK A;  3RNU A;  2CH4 A;  3MGD A;  1TWC B;  4LWC A;  2Q2T A;  5CV4 A;  4PV6 A;  3E6Z X;  4WJW A;  3CC4 A;  3M4O B;  1BPM A;  4LF6 Q;  2R61 A;  4A37 A;  3HKZ E;  4XYQ A;  4E6I A;  3I70 A;  3KF8 A;  3I4N H;  4BS9 A;  3M3Y B;  3SI2 A;  5GCN A;  4P44 A;  3GTM H;  3SHL A;  3NP8 A;  3TN2 A;  2PJ0 A;  4IN3 A;  4O1N A;  4DV7 Q;  5AG6 A;  4X8I A;  4IFD J;  2PMZ E;  3CQZ H;  2AQ2 B;  4ONW A;  3K5L A;  3SI1 A;  5KTA A;  2E5L L;  3CCV A;  1PUA A;  4PK2 A;  1PYB A;  2PJ9 A;  4L89 A;  2EDG A;  2YYZ A;  1Z47 A;  4NFR A;  4UWJ A;  4EX5 A;  1DOM A;  4Q38 A;  4R9M A;  5M5W H;  1KDB A;  5GRO A;  3SJG A;  3PIO A;  2R93 H;  3T16 A;  4DV4 Q;  1IBM Q;  3RD4 A;  3TZU A;  2B2T C;  1VMP A;  2VQF Q;  4XYO A;  1RCV D;  4GS3 A;  1QZH A;  5E3F A;  2RHS B;  2MJ8 A;  5D14 A;  2JXM B;  4AYB E;  4DR2 L;  3SJE A;  4C2X A;  4XDX A;  2RF4 A;  1EY0 A;  4X3S A;  2JA5 G;  1SAP A;  1HRJ A;  1M4V A;  4IPC A;  5JVG 3;  1K8G A;  1ASY A;  2Z3L A;  1A2T A;  4DUY Q;  4A3G B;  2B2W A;  2IJ0 A;  3CPA A;  4RS2 A;  4U9Z A;  2IJZ A;  3WAB A;  2D0O A;  2YTV A;  1S40 A;  2E2I H;  2F4V L;  2Z0Z A;  3TT2 A;  4DAM A;  2DNC A;  1IW7 C;  3HOU H;  1G6P A;  2ZW6 A;  3PB4 X;  3A8I E;  4CPA A;  1STN A;  4OO1 I;  3ER0 A;  1LYL A;  1KTK A;  4F88 A;  4PV1 C;  1ZG7 A;  3H94 A;  1I3Q B;  1DZ1 A;  5E1F A;  1LT3 D;  4HED A;  1Z4R A;  1E1T A;  1I5F A;  1EYC A;  3FPP A;  1E2V A;  1EOV A;  2JA8 B;  4MI4 A;  1STA A;  1CM9 A;  2A69 D;  3BDO A;  3MZ5 A;  2REF A;  2GVA A;  4C3I B;  1WTO A;  5C44 B;  2N78 A;  4KK7 A;  3PBE A;  3SJX A;  1SMY C;  1XNQ Q;  1YZ6 A;  3PO3 H;  3K81 C;  2NWG A;  3D4W A;  5ELE A;  4DKA C;  5IT9 c;  1B70 B;  1ZXT A;  2NVX H;  2FHT A;  1LTR D;  4C3H B;  2IMO A;  3D2P A;  3EA6 A;  1MK4 A;  5A28 A;  1YNN C;  3LGJ A;  5KTC A;  3F1Z A;  5HUR A;  3CCR A;  3QB3 A;  3I72 A;  2O5I C;  4G4K A;  3GTP H;  1DXM A;  1V8Q A;  3KUP A;  4HJ8 A;  3NPP A;  1WCM B;  2FSR A;  3FEW X;  2AE6 A;  1A2U A;  1LAM A;  4DPG A;  4CHT B;  3R9E A;  1GUO A;  3H15 A;  1PXU A;  1NTG A;  4QB4 A;  5A27 A;  2FIW A;  2F0E A;  1VQ9 A;  1OXX K;  4MCP A;  1A63 A;  2XEF A;  1TIQ A;  4OL7 A;  4PG3 A;  3PF4 A;  1TKF A;  4JXQ A;  5LRK A;  3OMC A;  4TRD A;  2HV2 A;  4ZUJ A;  2E2H B;  1YHB A;  3PCO B;  2JBJ A;  4IFD G;  4O42 A;  3C2P A;  4ZY1 A;  1Z9U A;  4NF1 A;  3VDY A;  4CRZ B;  2XEI A;  1Z5R A;  3CCQ A;  3I55 A;  3HOY B;  3J81 j;  1N36 Q;  4MHZ A;  1SYB A;  1QZG A;  1SEB D;  3GTO H;  1ZKO A;  3TO7 A;  1TF8 A;  2PO4 A;  2KHI A;  5KNC A;  5FLX L;  5C4X G;  4YRH A;  4HNX B;  4PXD A;  4U5Y A;  4CAX A;  3H8G A;  1E2Z A;  5T1I A;  1WTX A;  1IID A;  1GHK A;  4MN3 A;  4LK1 C;  1OXT A;  2HT1 A;  3SHP A;  2IL8 A;  5D3D A;  4PK3 A;  3E9I A;  4A2Z A;  3E3X A;  1T5X D;  1FT7 A;  1D6E C;  3VWD A;  2BDN A;  2CF4 A;  4ZK9 B;  3K9U A;  2KBN A;  2MPM A;  3M85 A;  1PA6 A;  2OU2 A;  3BJ7 A;  1F2Y A;  2JLM A;  1K83 H;  1CKO A;  4FD4 A;  1Y9W A;  2Q43 A;  4G1P A;  2G5D A;  2K5D A;  2SNM A;  3SGI A;  1LAB A;  3ZYY X;  1RTO A;  5LMU Q;  4DXG A;  3F5B A;  2ARH A;  3H3V I;  2Q4Y A;  2Z1C A;  1SXT A;  3VR3 A;  1X6O A;  4BA1 I;  2L0C A;  2PJ5 A;  3W5O A;  2IQ6 A;  4NP5 A;  3S1R B;  3I4M G;  1TKJ A;  2VQE Q;  4NXM Q;  4F0Y A;  4H0L C;  1Y1W H;  3FKI G;  2B63 B;  1E3P A;  1YNJ D;  2Y0S E;  1ZO0 A;  2K14 A;  2EYJ A;  3CXS A;  2UU9 L;  2NTS A;  3V05 A;  1C48 A;  5HY6 A;  4LF4 Q;  2F8H A;  1HEE A;  1S60 A;  4OGQ C;  1VQ5 A;  3JUW A;  5EKK A;  3RN2 A;  1PDQ A;  2L15 A;  3X3M A;  3I9S A;  3RO0 A;  1N33 Q;  4DYO A;  4R76 A;  4P71 A;  4A76 A;  5LMN Q;  4PMC A;  2G9D A;  3JC6 6;  3KFU A;  4GN5 A;  2OZU A;  1JB7 A;  4LF9 L;  1LT6 D;  5IX3 A;  1Y7R A;  4R3K A;  1MJ9 A;  4DUK A;  4GKJ Q;  4QBJ A;  2JEB I;  5D8N A;  3WWV A;  1AN8 A;  1F2O A;  3UI2 A;  3TP6 A;  1R9T H;  1AEX A;  2QW7 A;  1QWY A;  3S14 H;  5M3M G;  1NSA A;  2KEE A;  3NEM A;  3VR2 A;  5CR3 A;  3G8W A;  2CW0 C;  4JI5 Q;  5I6W A;  4YCU A;  2K28 A;  2Q51 A;  3HKS A;  4LF7 L;  4UEZ A;  4X5K A;  4W9Y A;  2Z3O A;  1H9K A;  1G29 1;  2VL6 A;  4CDD C;  2B4B A;  1F9S A;  2K7V A;  5LYF A;  2DEA A;  1BCP B;  1KRS A;  3QJY A;  4OEM B;  1IKL A;  3I91 A;  3B3C A;  1E7Z A;  1X56 A;  3SK8 A;  1M4D A;  2BL1 A;  5H1S E;  2F0V A;  2KA7 A;  3MA2 B;  2F0G A;  4TVA B;  4WFN 3;  3J7Y W;  1IBK L;  2Q7B A;  2GU2 A;  2OTL A;  4AVB A;  2EVB A;  2X69 A;  1E2W A;  2NZO A;  2I5H A;  5JJK A;  3DM1 A;  3S1M B;  1UE1 A;  4J8Q A;  1XPU A;  2DJF C;  5EGT A;  1VQD A;  4A3C G;  1BCP C;  1EQV A;  2K04 A;  1YW6 A;  5A2Q E;  2B58 A;  4OC3 A;  5THW A;  2F0S A;  4KOU A;  4A3D G;  4OWT B;  1HR0 L;  2CNS A;  4GNX B;  4QUF A;  1BQQ T;  1Z8T A;  4OXP A;  1QNU A;  3NA6 A;  1CHP D;  3V8I A;  3VWE A;  1I4R A;  3D67 A;  2F0Q A;  1IIC A;  2POK A;  4YWL A;  3VYT A;  4DV3 L;  2G3T A;  4L8J A;  5J1Z A;  1NJI C;  4A33 A;  3VR4 A;  1VQ8 A;  2PJA A;  1XFO A;  2Z4H A;  1KIX A;  1C7Y A;  4I7A A;  1IHZ A;  3K80 C;  2R3Z A;  5CBE E;  1QVG A;  1J5E Q;  1YJ9 A;  2E2J H;  4NGT A;  5K8P A;  4GNX C;  4KKT A;  1IGB A;  4KHP L;  1VIX A;  2GLJ A;  2GE3 A;  1HTP A;  2PNH A;  3PBB A;  1VQK A;  5EPJ A;  3W1G A;  1KUY A;  1F9R A;  4OLL A;  1H9S A;  3PB9 X;  4YY3 Q;  3PIP 3;  4KOW A;  1ZEQ X;  3TTH A;  2BUE A;  3T1H Q;  3GO5 A;  3D7H A;  3SI0 A;  4A4I A;  3CF5 A;  1EQQ A;  3NTK A;  3NK9 A;  3NH5 A;  3SK6 A;  2Q8T A;  1VQA A;  2QKI C;  1YME A;  1KLG D;  3X3N A;  4KVO E;  4JJX A;  1EIG A;  1ZLI A;  2JA6 B;  3HOX G;  4IPD A;  1XIX A;  1ENF A;  1GKH A;  2OCE A;  5C0X J;  4A93 G;  4ULL A;  4R9W A;  3E0E A;  5I4D A;  4C56 C;  3BLN A;  2A73 B;  2YNC C;  1LTS D;  3SE0 A;  3KHZ A;  4B3T L;  1KRT A;  2ENB A;  2QML A;  2FMC A;  5J22 A;  4R7M A;  4JBM A;  4MXU A;  4JI3 L;  1RDP D;  2F0K A;  4UA3 A;  1X54 A;  4B11 A;  2NTT A;  1EQR A;  3MXP A;  4R4C A;  2GLF A;  2VXK A;  4A32 A;  1Q7L A;  1TKW B;  4FF4 A;  2PIY A;  1IW7 D;  4KN4 C;  1UFH A;  2RQX A;  2IWH A;  4C2M B;  2K5H A;  2P6G A;  4DV1 L;  3OHX C;  3DWA A;  3TDQ A;  2QYV A;  1MI2 A;  1VMC A;  1V43 A;  2B4D A;  5CBM A;  2RKS A;  2IHE A;  4DV6 Q;  1QNK A;  1XMO L;  1BNZ A;  1KL9 A;  4XPL A;  1GOZ A;  4PNY A;  5ELB A;  1SNC A;  3F2D A;  1TR5 A;  4YWY A;  1BVS A;  3GUX A;  4BY1 B;  3HLP A;  1TWH H;  3I8Z A;  4LQG A;  1HXY D;  5M3M B;  3D4U A;  1PTO B;  4IJL A;  3EC4 A;  1SMY D;  1WTH A;  4AYB B;  3EJI A;  3LOD A;  4B6Z A;  4U67 3;  1OXS C;  4G7H C;  1QVF A;  1TT2 A;  1SFO H;  2ES2 A;  1ESR A;  2C6G A;  1M4L A;  1U0L A;  5CYU A;  5HVG A;  3HOW G;  1YNN D;  3CD6 A;  3SJF A;  2HCC A;  2MHV A;  2QA4 A;  5J8C A;  1VQN A;  4FO2 A;  3T1Y Q;  1XXG A;  2CQA A;  1YHA A;  3S24 A;  1CQV A;  2WPW A;  3NE5 B;  1LAN A;  5HMN A;  1TY0 A;  1IYJ B;  2FIN B;  2PCU A;  1L2F A;  3FPU B;  1TWA H;  5JGF A;  3PO2 B;  1K3B C;  1ON0 A;  4PZ7 A;  4HN7 A;  2J9A A;  2BA0 A;  2C6C A;  2HQL A;  4NMZ A;  5IT9 L;  3I56 A;  5COR A;  4YWK A;  3WC7 A;  1VQH A;  5G3L D;  1JJ2 A;  3A7A B;  4EFD A;  1I6H H;  2O4H A;  1FNV A;  4JI2 L;  4ID6 A;  2AFX A;  4JC0 A;  1EE3 P;  1PVO A;  4DR4 L;  1EY7 A;  4X62 L;  4JG2 A;  3PIP A;  1EY9 A;  4TNU A;  5C4X H;  1XYI A;  2K5V A;  4PZ6 A;  5EKL A;  2BO9 A;  4A3D B;  2JSO A;  5EPL A;  4DR6 L;  4CYN A;  2B39 A;  2CXA A;  4EME A;  3KAS A;  4BY7 H;  1STE A;  1YW4 A;  1JJC B;  4KHZ A;  1P16 A;  4Q36 A;  5DWN A;  2F1M A;  2IL4 A;  3PFO A;  1SNP A;  2BE5 C;  1S3O A;  4MJ8 A;  4X64 L;  4X3R A;  3I73 A;  2ZXP A;  2NUC A;  2UXC Q;  4R8N A;  1B3A A;  5BN4 A;  1PCA A;  4WJ4 A;  1AH9 A;  1FY7 A;  4JYA L;  1LT5 D;  1O78 A;  4OO1 H;  3U58 A;  5LL6 S;  2ZEO A;  4MFL A;  1Y1V H;  5BN3 A;  5HVF A;  3EIV A;  1PYW D;  2O5J C;  1R3N A;  1MKH A;  3TSS A;  3C3L A;  2Q0Y A;  3I1U A;  1ET9 A;  3I4M H;  1XRY A;  1A3T A;  2PNR C;  4HSP A;  2QF7 A;  2AFM A;  3L0O A;  2R7Z B;  3AFQ A;  3FKI H;  4RFB A;  1LOK A;  2CFM A;  4B3M L;  3VAR A;  3PUY A;  3TS2 A;  3IWG A;  2ANP A;  2NYZ D;  3HOZ G;  5AG4 A;  1GVP A;  3S17 H;  2UUB L;  1RTQ A;  2PVV A;  4KOT A;  1AMP A;  4J3G A;  4YFJ A;  2Q2I A;  1NSN S;  2RHQ B;  1FVI A;  3ND9 A;  3IAY A;  4NGR A;  2AWO A;  3BG3 A;  1LT4 D;  4QGU A;  2RVL A;  4MBU A;  4H13 C;  1S7F A;  2NVT H;  2PQ8 A;  1JMC A;  1UE5 A;  3A8J E;  3LWU A;  4UY8 C;  2CNT A;  1FGU A;  5F09 A;  5I0C A;  2CWA A;  2ZXR A;  3OOC A;  2RC4 A;  3S1Q H;  1G2S A;  3F2U A;  4JW0 A;  1J4J A;  5M5Y B;  3VH9 A;  2VZZ A;  3KJP A;  1SNM A;  3FBU A;  4JV5 L;  5IP7 H;  1AZQ A;  1Z6H A;  1IOI A;  2J0T D;  4AG9 A;  2NSM A;  3CCE A;  1XNR L;  2CW0 D;  2JA7 B;  2Z6K A;  2Y0S B;  5IOC A;  2Y0M A;  1DGS A;  1EWC A;  2B2U A;  1YVO A;  3U4V A;  2I3C A;  2PRB A;  1H9J A;  2B2V C;  3C26 A;  2SOB A;  2CQO A;  2R92 G;  3H5Z A;  1SE2 A;  4IF5 A;  3PUW A;  3K8A A;  3F0A A;  5NUC A;  5JEA H;  3HOW B;  1CPS A;  4LNQ A;  4GLA C;  2VB2 X;  2Q7S A;  4RGO S;  2KEC A;  3D3R A;  3PUZ A;  4UCM A;  5IGC A;  2J8R A;  2P6E A;  3UDG A;  4UPA A;  1XTD A;  4TSS A;  3FYN A;  2LKV A;  4H2K A;  3MC0 B;  1CUK A;  5GAG C;  2C5C A;  5F2D A;  4A3C H;  4QCL A;  5IYC H;  4KVX A;  5IYD G;  4JI0 L;  1LLR D;  5GAD C;  1MD2 D;  1BCP D;  2EQS A;  3DXJ C;  4A3K H;  5JOB A;  3W91 A;  4LUZ A;  2K05 A;  2TMP A;  1X10 A;  3H3V H;  1N34 L;  1AP0 A;  1SYF A;  4DGZ A;  1IBL Q;  4WJB A;  4LFB Q;  3DUZ A;  3VAT A;  1D8L A;  2ZEF A;  3KF6 A;  2NVQ H;  2EVN A;  4RGT A;  2O28 A;  2QVP A;  3NTI A;  5FKA C;  1RD9 D;  1IL2 A;  3IGR A;  3TRZ A;  4A3I G;  4PXC A;  1SRO A;  1HJP A;  2K1B A;  1PRT D;  4NDX A;  4IOA A;  1Z2L A;  1PH7 A;  1XMQ L;  2Z9H A;  2IX3 A;  1L0W A;  2MNA A;  1KLU D;  1PV4 A;  2Z10 A;  1VQJ A;  3K0X A;  2BEI A;  3IEH A;  3LX0 A;  2ZOG A;  3PZJ A;  3DR6 A;  3DR8 A;  2P6F A;  2FL4 A;  4A3G G;  3HOX H;  1QSN A;  1ELL P;  5M5X B;  3URY A;  4CBV A;  4J15 A;  1V9P A;  3VYR A;  5IWA L;  2KCW A;  4A93 H;  2F03 A;  4CAV A;  4DR3 Q;  1PFN A;  3A74 A;  3G6J B;  3VA7 A;  5AG7 A;  4KOV A;  2B2Y A;  1Q86 C;  4A3E H;  3ZJY C;  4RKB A;  1DD2 A;  5JAV A;  2NVY H;  1B6B A;  4XPD C;  5JVH 3;  2JA8 G;  4M6H A;  4RN7 A;  2ZJR A;  2E74 C;  4JI6 L;  2A1A A;  4YU9 A;  4QUC A;  4XT3 B;  1XMT A;  3NE7 A;  3HOV H;  2K5W A;  4R1J A;  4B08 A;  2R98 A;  1TY2 A;  5C44 G;  3TFY A;  1MBY A;  5DM7 3;  3B6Y A;  2F4V Q;  3G3S A;  3ZZI A;  1ARL A;  1IYL A;  1VQL A;  3CAM A;  3Q8D A;  4MHE A;  3KR5 A;  4C3H G;  3RZO H;  1ML0 D;  3D7D A;  5DAU A;  2Q2U A;  1SND A;  4ZCK A;  3BS1 A;  5M3F G;  4JI4 L;  2ODF A;  3J7A F;  1TS5 A;  1Q8I A;  3PSI A;  5F49 A;  1WCM G;  2Z8L A;  1I50 H;  1XMB A;  1S5F D;  3K5O A;  4UCP A;  4C7H A;  4C3J B;  2D4O A;  1IU8 A;  2AUJ D;  3EQL C;  2WAQ E;  3TRE A;  4XQQ A;  1K8A C;  3GDE A;  1X65 A;  4KY6 A;  5J3B A;  4IUQ A;  2DPS A;  3NQI A;  3H0G B;  3KZW A;  3MEF A;  1GXD C;  2PZU A;  3UDF A;  1T9H A;  5C88 A;  2V8V A;  4GXH A;  2HQE A;  1ILP A;  1UAP A;  2K5N A;  3KBG A;  2PRQ A;  4JLY A;  1NAP A;  4I65 A;  1FR3 A;  1EY5 A;  4IJH A;  1CSQ A;  2MP1 A;  3IC1 A;  1JWM D;  3RNZ A;  3S6K A;  1IYU A;  5GAE C;  2B5G A;  1NUC A;  5ELO A;  4DV0 Q;  1B9N A;  3D7G A;  1GHJ A;  1IY7 A;  2FXQ A;  1TWF B;  4DK1 A;  4DV5 Q;  3D0F A;  5C5M A;  1DM0 B;  2AMC B;  3T53 B;  4R87 A;  1Q1B A;  1I21 A;  2EBJ A;  1WD0 A;  1STY A;  3BYY B;  4QQB X;  2AFO A;  1L0X B;  4M3S A;  2VXW A;  4KLV A;  4DK0 A;  4HMJ A;  2F0M A;  3V7Z A;  2FE7 A;  2Q4Z A;  4DUZ L;  4RCO A;  4LFC L;  1TF9 A;  4IFD I;  4KVM E;  4PQA A;  5IGF A;  4GLV B;  2WB1 B;  2AQ1 B;  4XQN A;  2CHB D;  4KKU A;  2BE5 D;  4P4I A;  4A3J H;  1ONL A;  4B5P A;  1HNX L;  4IUR A;  4A3I B;  4Z65 A;  2ATW A;  2ZEP A;  2B63 G;  2LFN A;  5ELF A;  2PQE A;  3D66 A;  4EQN A;  3FHW A;  4A3F H;  5CV5 A;  3KQX A;  1N32 L;  4IUN A;  4EQO A;  4LF5 L;  5LRG A;  4B12 A;  3L7Z C;  2WPX A;  3TCV A;  4JZ0 A;  1TWG B;  2EOT A;  2AFS A;  2RFH A;  5LHY 1;  3S2H H;  2VUM B;  3RZA A;  1D7Q A;  1CT1 D;  3HOZ H;  5ISV A;  4JBW A;  2EWB A;  4O2D A;  3T8W A;  2K75 A;  4K5X A;  1OXV A;  1LAC A;  1M8A A;  3KLR A;  3T56 B;  3G6E A;  5I2Y A;  2UU9 Q;  4S3S A;  1VQP A;  1ZG8 A;  1S5C D;  2E76 C;  5IGG A;  1LTB D;  4KSA A;  1S3Z A;  3FX6 A;  4QUS A;  4HNY B;  3PGZ A;  4A3B B;  8CPA A;  2A6E C;  4Y52 H;  1JB3 A;  1HPC A;  5A2Q L;  1Q2D A;  4HSV A;  2XNA C;  1CPX A;  2F0H A;  4QL5 A;  4LF9 Q;  3RR5 A;  1SLJ A;  2LSS A;  3RLF A;  2PR1 A;  4BBS G;  3BZK A;  1SE3 A;  2CKZ B;  1MJB A;  2VZA A;  2L5T A;  4OWX B;  4P45 A;  4EGV A;  4DNC A;  3MHB A;  2K5Q A;  4R4O A;  4DA2 A;  2FS5 A;  4ONU A;  1U9R A;  2XRQ D;  3R2T A;  5C3X A;  1HQM C;  3TOA A;  2WKD A;  4OHJ A;  3ISX A;  1K73 C;  5M3F B;  2UUA L;  1F2L A;  3NBH A;  2QCP X;  4JBJ A;  4ZUI A;  5AJ3 L;  2EK8 A;  3D68 A;  2R92 H;  3S1