3FMCA

Crystal structure of a putative succinylglutamate desuccinylase / aspartoacylase family protein (sama_0604) from shewanella amazonensis sb2b at 1.80 a resolution
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
365
structure length
365
Chain Sequence
b'VDKHEVRVGELAAGQPLSLPVYRFKGKGAGPSVYIQANVHGAEVQGNAVIYQLMKLLEHYELLGDISLVPLANPLGINQKSGEFTLGRFDPITGVNWNREYLDHGFNIEVWYQEHSHLDDDTLITAFRATLVEECARRLNNPWGVTTGHRLAVTLQSMAHRADIVLDLHTGPKSCKHLYCPEYERSAAQYFSIPYTLLIPNSFGGAMDEAAFVPWWTLAEVASSHGRELGVRVSALTLELGSQERIDLDDALEDAEGILAYLSHRGVIAETVLPKPMKRYGCFLKNYRKFHAPKAGMVEYLGKVGVPMKATDPLVNLLRLDLYGTGEELTVLRLPEDGVPILHFASASVHQGTELYKVMTKVFEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative succinylglutamate desuccinylase / aspartoacylase
publication title Crystal structure of putative succinylglutamate desuccinylase / aspartoacylase (YP_926482.1) from Shewanella amazonensis SB2B at 1.80 A resolution
rcsb
source organism Shewanella amazonensis
molecule tags Hydrolase
total genus 112
structure length 365
sequence length 365
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3fmcA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3fmcA01
2C6PA 3FECA 3S9LA 3V38A 5HVHA 3AB9A 3BXMA 2EDGA 4BA1I 4ZY2A 1B9MA 1ZYRC 1CBXA 1Z2LA 1IYUA 3M4YA 2ZENA 1ZKOA 2AUJD 1IY7A 2AWOA 2EJMA 1YW6A 1QMUA 4LQGA 3VH9A 2V4DA 1CX8A 3D4RA 2PJ6A 1FT7A 2R6GA 5LYDA 4NFRA 3PUWA 4JZ0A 3FEEA 2JXMB 3QNVA 2ZOFA 3N6RA 1BPMA 3KR5A 4Q7AA 3KQXA 4DJLA 5JH9A 3BG3A 2FVGA 4NGTA 1Z5RA 3OOCA 4EFDA 1QQ9A 2ZEOA 3EQLC 3PUZA 5K36G 2HC9A 4NJQA 5F09A 2PJ8A 1TU2B 4NGNA 1DTDA 4KKUA 4ZI6A 4RCNA 1K8OA 4BD9A 4JYWA 1HPCA 1LANA 2ZT9C 2BDOA 2DNCA 1Z8LA 5K8PA 3U9SA 5C0XH 4OC4A 4W9YA 3DXJC 3PUVA 2V77A 3KHXA 3I72A 3P20A 2PJ5A 4KSIA 2Q51A 4AXVA 1H9JA 3KZWA 2K33A 2Q43A 2AFOA 3IIBA 4H44C 2PVVA 4P4JA 4ZY0A 2POKA 3IEHA 1XJOA 2QF7A 1ARLA 4WWVA 2XEIA 1TKFA 4EWTA 3VARA 3S9MA 1K8MA 1H8LA 3VR3A 2D5DA 2NN6G 3SI1A 1OBRA 1CI3M 2V8HA 3QJYA 3D4UA 1Y69U 5CBMA 1BDOA 3TX8A 3LMSA 2CTCA 2V8DA 3VA7A 4OMEA 1XMBA 2QYVA 1DCZA 1VF7A 2O53A 1OXVA 4YU9A 4H13C 3I73A 3KI9A 3CPAA 3KLRA 2ZEFA 3H8GA 2ZEMA 4OC3A 3T8WA 1Y8PB 3FH4A 2ZEEA 2PCFB 4TNUA 3WC6A 3FVLA 3D7GA 3IJ3A 3NA6A 2AFXA 5KNBA 4NGSA 2PJAA 3H8FA 4NJRA 1E2WA 3GB0A 4DYOA 1ONLA 5JM6A 3B2YA 3PFEA 5LYIA 4IFDH 3D7FA 3RZAA 3ND8A 2PRQA 2B8GA 1O78A 2IQ6A 3PB4X 2DEAA 2KCCA 1OXSC 1Z6HA 2A69D 2RB7A 1E2ZA 4KHZA 4FUUA 1YW4A 1HEEA 1ELLP 4L8JA 4PXBA 1Q1BA 4X8IA 4GZYC 2CF4A 3WT4A 3VATA 1BLLE 2WZNA 1Y8OB 4RUHA 3JRUA 5D8NA 3A7LA 1XRYA 4OKOA 3QG1A 2AFUA 2IJZA 4X3RA 1Y7EA 2AFWA 3T51B 4R6TA 3M85A 1F2OA 4UEZA 3SE0A 4OC2A 4IHMA 2JEBI 4XTCS 2BA1A 5BN5A 4BA2I 3B7IA 1PMRA 4PXEA 1FR3A 5BN3A 4A38A 1OXUA 4OC5A 5LYLA 1H9RA 2A69C 2I3CA 1KWMA 1XBUA 2IT1A 4IQZA 1DD2A 3KL9A 4ZY1A 1GUTA 2KA7A 4JBWA 5K36H 3D67A 4WJBA 4IAVA 1F2PA 2DNEA 1OXTA 4NGMA 3D68A 1LFWA 3CRLC 3OW7A 3HLPA 3B3SA 1GHJA 3IO1A 2K7VA 4OIWA 5D29A 1TKHA 5THWA 1AYEA 2BCOA 4P4EA 5HVGA 7CPAA 2RFHA 4P4DA 1GUOA 4FAIA 2ABZA 1CP7A 1GUNA 4P44A 4MXUA 1CTMA 4OIDA 5LRJA 5J1QA 1TKJA 5ELYA 2NN6H 5KNCA 3D7DA 3KASA 1Y0RA 2AUKA 3DLJA 3NH8A 3WABA 5HXDA 3KQZA 5CPAA 1M4LA 1Y8NB 1Y0YA 3PEIA 4OO1G 4DUKA 3CDXA 2WYRA 4UEEA 4TWEA 1VHOA 3SI2A 4TKOB 4NGPA 1ZG7A 1DE4C 3K2KA 2F7VA 4UEFA 2PJ9A 3LNNA 4F8ZA 2PIYA 2BA0A 4K3NA 1SMYC 2G9DA 4X2TA 2JBJA 2EVBA 2C6GA 3SI0A 2D62A 3A7AB 2K32A 4NGRA 4UIAA 3DGVA 4LK1C 3IFEA 5LRGA 4P4IA 3BI1A 1LOKA 3SJFA 1ELMP 1TF9A 2JBKA 2V8GA 3MXUA 1CPSA 1FNOA 3VR4A 4KMUC 8CPAA 1ZG9A 2VL1A 4DNTB 4B6ZA 1YLOA 3N5FA 3OPOA 4YWYA 2PJ3A 5IB9A 3D7HA 3IFTA 4EMEA 2ANPA 1H9MA 3B3VA 4H2KA 3PUYA 3L7ZC 2C6CA 2Q8IB 1XFOA 3B35A 4MHNA 2PIZA 4P6YA 3NFZA 4DNRB 4P45A 2BE5D 4ONWA 1DXMA 3NH5A 1Z7TA 2EJGC 4KI0A 2IMOA 1HTPA 3SJGA 5C0XG 1A6XA 3VR2A 4UIBA 2XEGA 4G1PA 3IKJA 3FF3A 2A6ED 1IW7D 2OOTA 1PCAA 3MRUA 2NSMA 2O4HA 3PB9X 1NSAA 5A35A 1YMEA 1EE3P 2GREA 4R76A 1H9SB 3FX6A 2CTBA 2EK8A 1G291 2O5JC 3D31A 3K9TA 3W3AA 3L2NA 1LABA 1YNNC 4G7ZC 3A8IE 4A37A 4HR7B 3H8EA 4IK2A 3IC1A 5LYFA 2CIJA 4TQUS 4MHZA 4XIGS 2BE5C 2V8VA 2E74C 4MHYA 3PBBA 1O7LA 3GD7A 1TF8A 1QJOA 3B3TA 2PJ0A 2L5TA 2A6EC 2PJ1A 3PB7X 1IW7C 2C1CA 2BOAA 3TC8A 4F9UA 1ARMA 3T53B 4OO1H 3B3CA 3CPXA 1R43A 3T56B 2EK9A 3ISXA 2ZELA 2EJFC 5LRKA 1Q12A 5DS0A 5K8MA 4OGQC 2QVPA 5JGFA 3M7NA 2CW0C 2OR4A 4UF4A 4F9VA 3TZUA 1UWYA 3WDNA 2ZEHA 3ISZA 1YNJC 1LAMA 5K8OA 5I4MA 1TKWB 1V43A 3NE5B 1H9KA 3HUVA 2ZEPA 4ZX8A 1Q90A 1F57A 2PJBA 4MCPA 3PB6X 2PJ4A 3FPPA 2F8HA 1JQGA 3A8KE 3D66A 4PXCA 4R8FA 1E2VA 1HDUA 1CP6A 2E75C 2GLJA 3FMCA 4OC1A 3WC5A 4DK0A 4MCRA 2PCUA 3RAMA 4A39A 3GLJA 2YYZA 4KKTA 3VR6A 2JEWA 2QJ8A 2PVWA 3FEDA 2HB6A 3I1UA 3BHXA 1VIXA 3FJUA 3PFOA 1LACA 3BDOA 2GLFA 4P4FA 3QIAA 3A8JE 4OC0A 4MRIA 4FBEA 1ZLIA 5JEAG 1GUGA 4H0LC 2AFMA 2XEFA 2BO9A 1CG2A 4PXDA 1T5EA 1VGYA 1Q1EA 3I4LA 2A68D 5HVFA 1CPXA 1HDQA 6CPAA 1GUSA 4R7MA 3B3WA 4ZYQA 2E76C 4PPZA 5KNDA 2A6HD 2LMCB 4ZX9A 1BPNA 3SJEA 3V7ZA 3HGBA 3CRKC 3PBEA 3KGQA 3WC7A 1H9SA 1VHEA 3SJXA 4KKSA 3GQBA 4DK1A 4P10A 3KR4A 2Q4ZA 3PV0A 4P4BA 1BAVA 1GYTA 3MN8A 2PNRC 2AFZA 1CFMA 2A68C 3ND9A 1GHKA 3PUXA 3PB8X 2NN6I 4LJZC 2JE6I 1TXRA 3CT9A 4I7ZC 4MHPA 2A6HC 3IWWA 4GM5A 1LAPA 3SDZA 4KN4C 1ZG8A 2EWBA 2D2CC 3LWUA 1LCPA 2PJ2A 4JK1C 4NGQA 2ZEGA 4MCSA 4KN7C 1AMPA 2NYQA 4OP4A 1HQMC 2GU2A 1Q7LA 3H94A 2XEJA 2O5IC 1HCZA 4MCQA 2JEAI 4G7HC 3GUXA 4FWUA 2PPBC 1OXXK 3MFYA 1VCIA 2PJCA 1V8QA 2F1MA 2ZEDA 1YSJA 1B9NA 4MMOA 1I6VC 4Z65A 5BN4A 4A94A 2ZOGA 1FYCA 2PJ7A 1VF5C 3KHZA 3PRTA 3VR5A 2PE3A 5K8NA 4PQAA 4PV1C 4O23A 2B8FA 3NH4A 1PYTB 2J9AA 3RBUA 3BI0A 1EWHA 4G7OC 3S9NA 1IYVA 2DN8A 1RTQA 2AFSA 1GJXA 4CPAA 1ZLHA 5JEAH 1VDZA 3RLFA 1IGBA 1R3NA 4IFDG
chains in the Genus database with same CATH superfamily
2C6PA 2UUBQ 2CFMA 2ZW7A 4KLKA 3LODA 3PGZA 3K7AH 3K58A 4IFDI 3JTKA 1CKNB 1PDQA 4A3IG 1I94Q 3HOUG 2DXQA 3T4AC 2JJQA 1IHZA 1ZYRC 1I4HA 1RHPA 4ORFA 1Z2LA 3D0FA 3RD4A 2UXBL 1IYUA 3M4YA 4ILWA 1ENFA 1LT4D 5DNFA 2FXQA 4LQGA 1V1PB 2V4DA 4F7XA 4BBSB 3DLLA 2VUMG 3H5ZA 3H0GG 2PJ6A 5M5YH 1JMCA 3PQIA 1VMPA 2YV5A 3PUWA 4NFRA 2DPTA 4JZ0A 5GAEC 4IN3A 4DV0Q 4LFBL 3SXOA 3FPUB 5AJ3Q 5BR8L 1P0HA 3RZOH 3RUZA 1TWAH 4Q7AA 2FMMA 1JWQA 1EOVA 4NXML 3BG3A 3BZDB 2FVGA 3OOCA 3H3VC 3Q0AA 1PH8A 4EFDA 3RN2A 2UUCQ 4NJQA 1UEBA 5TSSA 2VQEQ 5F09A 2WPWA 1EY5A 3S15B 2B63H 4YCWA 2FIAA 5EBCA 4HCSA 4J3GA 5EPJA 4OO1I 4JJXA 4DR1L 3HKZG 4OC4A 2ZW4A 1K3RA 1S5ED 4C3JH 2Z6KC 3CZXA 5EBDA 2F0MA 4AVAA 5JJLA 1TXYA 1FVIA 2Q43A 4U9ZA 2PQ8A 3IIBA 4H44C 4JI3L 1WYDA 3ZYYX 1N8RC 3TO7A 2POKA 1NR2A 1RTOA 4YGOA 3CMEA 1ARLA 4WWVA 2XEIA 1MJAA 1TKFA 4JI8Q 5I0CA 2EOTA 4ULLA 3S9MA 1JJCB 3VARA 4JBMA 2P6GA 4OIKA 2D5DA 3K9UA 4MFLA 4BY1G 3PIO3 2C27A 3CKIB 1P4NA 5CV4A 2WKDA 3HOWH 3S14B 2JA9A 3QJYA 3LD2A 1ASZA 4XYQA 3BZKA 4XPKA 3IFDA 2KCNA 4FXKC 4YWLA 2VQFQ 2QYVA 3KJOA 1DCZA 1VF7A 2F0WA 2O53A 2I46A 1OXVA 4KLWA 4L5RC 3KK7A 4DR7Q 1QNKA 3KI9A 3CHBD 3CPAA 3KLRA 4Q5VA 2E8GA 2YNCC 2ZEMA 4X64L 4RFBA 5J8CA 1PH3A 3RZDH 2IHEA 2X6LA 1I6HH 4AG9A 1U4PA 3IJ3A 3DWQA 1HJPA 2AFXA 2A5HA 4HSVA 4NDXA 2PJAA 1E2WA 4R4TA 2B2YA 1ONLA 1X55A 3PFEA 1LTAD 3D3SA 1UE1A 3D7FA 3RZAA 2F0DA 1QUQB 2B8GA 4CJ0B 4WORA 1CUKA 3PB4X 3AYHB 1Z6HA 4KHZA 2Q7BA 5LMNL 1GHEA 2N49A 3R95A 3J80i 3WT4A 2EY2A 3LX0A 3S1NH 1BLLE 4B11A 1ICWA 3I8ZA 4IALA 4DKAC 4XQQA 3EC4A 4RUHA 4IPDA 3G3SA 3A7LA 4OKOA 3Q22A 3QG1A 2IJZA 4DNIA 1LM0A 1PZID 3T51B 4DFAA 4EVYA 4UEZA 5FO9B 1HUMA 4LWCA 4JYAQ 4IHMA 3V8IA 1STNA 4BA2I 4DXGA 3B7IA 4FXGC 1U6MA 4I49A 2F3VA 1WTRA 4APVA 2MO0A 3FB3A 1XBUA 4JI6L 2IT1A 3SEBA 1KNAA 4JV5Q 4K0KL 5G21A 3TS2A 4V0BA 3D67A 3S15H 4WJBA 3S1RB 2TSSA 1SYFA 5JJKA 2K5NA 1OXTA 2F4VQ 2AQ1B 3OW7A 4JXQA 1SNDA 3K81C 3HOVH 2WFWA 1BXTA 1EFID 3F8KA 3TCVA 1G2SA 4MY3A 1RJTA 5THWA 1QE6A 2Z8LA 3X3NA 1AYEA 2QIRA 1I3QB 1EY6A 5ISRA 1MGSA 1YITA 2JDDA 4P4EA 1KTKA 1X32A 3S2HH 4GLAC 2HCCA 3PF4A 2NUCA 1ESFA 4P4DA 1D6EC 1A8VA 2PC1A 2ABZA 1QWYA 2EYPA 2B4BA 5I4DA 4M6GA 5F49A 3CCJA 2ATWA 1YHAA 3CP0A 4EX5A 2JA5G 5IYCH 1K73C 3J7A5 1S3OA 1I4RA 3TS0A 1UE5A 3J81L 3F5BA 3DLJA 1BCPF 3P2HA 3C3LA 3STBC 3MC0B 1NTGA 1K8GA 1Y8NB 3MA2B 4BBRH 2B2VA 4UDUC 2EUIA 1NY4A 4R4CA 2B2WC 1BO4A 1MSHA 2GIVA 3NWTA 4A3EH 1VQIA 4CBVA 3OIPA 4HTHA 2OEOA 3CQZH 3NTKA 4TKOB 4DU9A 3F2DA 3D8PA 1ZG7A 1S5CD 2XSCA 4XPLA 4DN4M 2RSNA 2VQYA 3D4DA 4GN5A 1EIYB 2BA0A 1JORA 1SMYC 2G9DA 2I00A 4P2CB 4BY7G 1GOZA 3PMFA 4DAMA 1WD1A 4ODGA 2K32A 4UPAA 4CGLA 4PZ6A 4LK1C 1HNZQ 1EQVA 4DF7A 4L5SA 4FVMA 3SJFA 1K28A 1B2TA 4GS3A 2REFA 3EROA 1CHPD 1PH1A 4PNYA 1YQEA 1A2TA 3HOXG 3S17H 2ZXOA 3MXUA 1KUXA 4FNFA 3FRPB 1WTWA 3H4QA 1AN8A 2RA4A 2B5GB 1XNQQ 1EY8A 2A19A 4IO9A 2E2JB 2J4XA 3OTOQ 1IBLL 4N9TA 1J8IA 5CBEE 3MEHA 3CXQA 4DNTB 3CCUA 1CA6A 1YLOA 2ASBA 5DM73 3U4ZA 4GOPC 4GKJL 4EGVA 5IGBA 3JAME 2PJ3A 5IB9A 4U5YA 2MGSA 3IFTA 5IYDG 4FDBA 1Q81C 4EMEA 4A3BG 1YI2A 1O7IA 1QG7A 3NK9A 1SJHD 4RCOA 3TN2A 1ASYA 4DR5L 2MJ8A 2JA7B 2LXKA 4Z9CB 3K6OA 4P6YA 1ZXTA 4P45A 2IJ0A 4ONWA 1DXMA 5IE8A 1X56A 1CHQD 1M1DA 1J6QA 4Q36A 2JA6H 3L9AX 1PRTF 1AZPA 2WAQG 1IBML 1N33L 5M3MG 3HOZH 4NXYA 4G1PA 4HIDA 1JB3A 1Q2DA 1EL0A 1SNPA 2OOTA 4OELB 2QEJC 4K5WA 2GREA 2CTBA 4YY3Q 1VQMA 3K9TA 1BOSA 5H1SE 4LFCQ 3L2NA 4CRZB 1JWUD 4OIJA 4JCVE 2CIJA 2FJ2A 2GANA 4NXNL 1W6KA 2O4XA 4TQUS 4A3CG 1IBKQ 4JI0L 4MHZA 2BE5C 2E74C 5J22A 2L15A 1HR0L 5FLMH 3PBBA 1YNJD 2L1BA 4C3HG 1Q86C 1XMTA 4K30A 2FSRA 3GDEA 1VQ4A 4ME3A 3ONAB 1TF8A 1QJOA 1EEFD 3B3TA 2ES2A 4H89A 3ITPA 2Z6KA 5ELFA 5C3EB 5IB0A 4MFKA 3BJ7A 1XXGA 5ELCA 4CDFC 4RGMA 5HMNA 5GQOA 1R43A 3ISXA 2Q8TA 2ZELA 1YHQA 1Q12A 1EYDA 1X10A 4XYOA 2Q04A 5CC4A 2Q7SA 4K8IA 1G51A 2E5LQ 4OGQC 4KOWA 1SROA 3D3RA 1TT2A 2CW0C 3I90A 2OR4A 5GROA 4DR6L 4YIJA 3L0OA 4P75A 1WTXA 4L8AA 4HPSA 4GLVB 3WDNA 2K5DA 3VYUA 4DV5L 3ISZA 4B5OA 3EVQA 5K8OA 2QMLA 3TFYA 1S60A 4ZX8A 5IIFA 3I4MB 1Q90A 3N52A 3U50C 1C4QA 3KLWA 2K6AA 5G3LF 3D66A 4R8FA 1LUZA 2N78A 4DK0A 4MCRA 2J8MA 3RAMA 4DAPA 2F0KA 2QW7A 3MXGA 3GLJA 4XT1B 4KKTA 3NELA 1STEA 3FP9A 4ZUIA 2E2JH 3VWEA 3BHXA 4KUBA 3DNSA 2NVTH 2ZM6Q 2DPSA 4KLVA 4J15A 2J8RA 1KXLA 3A8JE 1JWSD 4M85A 4FBEA 1ZLIA 3PO3H 1K0SA 2D0PA 1GUGA 1HZ9A 5EKKA 2XEFA 3GV6A 4C2YA 3CCEA 2BO9A 3FHWA 3C1EA 1RO5A 1PH2A 4KOTA 4A93G 1FD7D 2PMZE 1VHSA 3QB8A 4QUFA 4GKKQ 3EBEA 1J4JA 3IAYA 3B3WA 1Z9UA 5KNDA 1EQQA 3GTPH 2A6HD 3EJIA 2LMCB 2QDLA 2YTXA 1LRZA 3I70A 4XPDC 3ER0A 1SFOH 5E7NA 4JI2Q 2HT1A 2EYOA 3H09A 5AFWA 1MJBA 2GVBA 3PBEA 5E3FA 1JQYD 1BCPD 1EWCA 4P10A 1X54A 3KR4A 4J1MA 1YJNA 1QSNA 2Q4ZA 3PV0A 3NWSA 2EIFA 1TR5A 4C3IH 1CZWA 1EOTA 2MHVA 4XXEA 4DUYQ 1EFWA 4IPGA 4R1JA 3MN8A 3Q23A 1CFMA 2A68C 3CXSA 1SBBB 4LJZC 2R92B 2F03A 2R8VA 3CT9A 4A3FB 4I7ZC 4ONUA 1SYGA 1MHWC 2H4OA 4ZKCB 1CA5A 3S1MB 1PZJD 5LL6S 4GM5A 3KDFA 3SDZA 4FO2A 4KN4C 2VS1A 4PQXA 2EWBA 2XGTA 3TBIB 3IU2A 3NEMA 2WB1G 3LWUA 4YHHL 2PJ2A 4UCNA 5KTCA 3WOEA 3I7FA 1J5EL 1SNQA 2QA4A 2OZUA 2GU2A 4CGOA 1Q7LA 3H94A 2Q44A 2RSOA 2O5IC 2XEJA 1ZEQX 2WKCA 3EFAA 2UXCQ 1WJJA 4PMWA 1Q2CA 1AFPA 3ZJ0A 2KHSA 4KJNA 3ULJA 3MGDA 4DA2A 2B2TA 3IU1A 3NE7A 3I4MH 2HDMA 1V8QA 5EKLA 2F1MA 1HNWL 2Q4YA 3GTKB 2B2WA 4E8OA 4DV4Q 4Z65A 1E0BA 3PIOA 2AHOB 1KRTA 4KOVA 3J7YW 3RNUA 1FYCA 4JBJA 2E2DC 1VF5C 3KHZA 1XTCD 2PE3A 4CJ2C 1KDAA 1UE7A 1WCMB 2HCIA 4GNXB 2FFKB 4O23A 1D8LA 3FVQA 2B8FA 3A56A 4HMIA 1Z8WA 4LF6Q 5EJWA 2FXFA 3HG9A 4G7OC 4JG2A 5FJ8H 1GKHA 4OLLA 1RTQA 1XPOA 2L0CA 3GIUA 2CCZA 3CC4A 2EYJA 1PRTD 5H84A 5GADC 3EFXD 2R7FA 4MIUA 2FIWA 1IOFA 2XWBB 5EBVA 4IFDG 3CW2C 1VQPA 3P75A 3RYOA 4FP5D 1A2ZA 4V190 4PSWA 4XT3B 4H02A 2VXKA 3R2IA 1YZ6A 5CBAE 4IPHA 3NHHA 2I5LX 1CBXA 3OIQA 1XJVA 2NVQH 4IOCA 4NCZA 3W6XA 4GOPA 2ZENA 1TWFH 2AUJD 4N8X1 2F0OA 3Q8DA 2CQAA 1AP0A 5CV9A 3PIP3 2IWHA 1LTID 2JP1A 3H0GB 1SN8A 4FYDA 5LYDA 3FEEA 5KEEA 4KTAA 5C88A 2ZOFA 2R7ZG 3N6RA 1X3EA 3GTOB 4DJLA 4B3RQ 3J7AF 4A3FH 4NGTA 2Q2TA 2CQOA 1Z5RA 2ZJRA 1QQ9A 2JEVA 2ZEOA 1EY4A 2I0QA 3MVVA 1VQ9A 3G48A 3K7AB 4IUUA 5KYIA 2JA8H 1DTDA 1STGA 4NGNA 4ZI6A 1K8OA 2BDOA 1Z8LA 5K8PA 2OQ0A 1SYDA 3U9SA 2FE7A 4GN4B 5C0XH 4A3MH 4W9YA 1C7YA 4CRYB 2NYZD 1BKBA 3P20A 4X3SA 4OXPA 4KSIA 1LTTD 3KOJA 4JI4Q 1H9JA 2F0SA 1B53A 4RGOS 5IP7H 5G3LD 4DV7Q 3SXHA 5IWAL 2AFOA 3FDTA 5JPNC 3PGPA 2FHTA 3GTQB 1VS0A 3FKIG 5KIXA 1B50A 3DDDA 5EAYA 2AMCB 1TS3A 5ELEA 2YNDA 4EWTA 1P16A 4NMZA 1KUVA 1L2FA 1K8MA 3NTHA 4QUCA 4DV2Q 2NN6G 3SI1A 4QF4A 1LV9A 1TWAB 2V8HA 3DSBA 4BY1B 3WOFA 4IUQA 3G8WA 1Y69U 1XMOL 1BBUA 1PFSA 3TX8A 5C44H 4LF7Q 2OWOA 1XF8A 4LUOA 4OMEA 2KCMA 4E6IA 1HA6A 1QZHA 2B63B 4YU9A 3BDLA 1YHBA 1WCMH 4OX9Q 3H8GA 1SE3A 2BDNA 1Y1VH 4OEMB 1Y8PB 3C26A 1U4MA 5C4JH 1VQEA 1M4IA 3FH4A 4C3JB 2ZEEA 3RNZA 4CGYB 1RCVD 2GFQA 4A3JG 3J7AV 3D7GA 3NA6A 1STYA 2I79A 1TIID 2EXZA 4DAYA 3PO2G 1M44A 3H8FA 4NGSA 1D1KA 4EVOA 3LGJA 4DUZL 1L1OC 1O7YA 1C48A 2NVXH 1YK3A 3ND8A 2UXBQ 1JJGA 3T1YL 1O78A 1NE9A 2DEAA 3J81c 2RB7A 2N3SA 4A3IH 3HOWB 1I12A 4R9MA 3HOUH 4A3LG 1PFNA 2EY1A 4YCVA 2K28A 1C8CA 2BH2A 1YW4A 1W3SA 4L8JA 3UDFA 3G6EA 1NMTA 4CDDC 4X8IA 2R98A 1VQAA 2WZNA 3S24A 1CKMA 3JRUA 3T1HL 2P6FA 4OL7A 3SGIA 2AFUA 2OH1A 1LTRD 4LFBQ 4X3RA 2MO1A 2F4IA 4IFDJ 1JOQA 1F2OA 2ARHA 2VUMH 3H0GH 2YTVA 2Z3LA 2BEIA 2J0TD 4XTCS 3DWPA 3RZDB 5BN5A 1A63A 1I6HB 1IYLA 5ELNA 4PXEA 5C5MA 4A38A 1WK4A 1HZCA 5M5XH 3I56A 2PW7A 2A69C 3CC2A 5C4XG 4H6UA 1PFBA 1KWMA 2ZJPA 4L89A 1WTVA 1PVOA 1DD2A 3KL9A 4X66Q 1QVCA 5ISVA 2KA7A 3OWFA 1JCKB 4IAVA 3T90A 2PQAB 1XMQL 3D68A 3FXTA 2NVYB 4YWKA 3CRLC 1LFWA 3F2UA 3HLPA 2C35B 1VQ5A 3B3SA 5HGTA 2K7VA 1JT8A 1EU3A 3S1NB 3SHPA 5LMUL 4AVBA 1A62A 2X7BA 1HNXL 1PTOF 2NTTA 1LTSD 2GVAA 2KQ3A 2R93G 2RFHA 7CPAA 5HVGA 1PH9A 1GUOA 3DM3A 2DY8A 3DM1A 3GTQH 2FCKA 2WPXA 1S5DD 4CDCC 3H15A 1AH9A 1GUNA 2I5HA 4PZ7A 4MXUA 1KD1C 3I4NG 4A33A 2VW9A 1IXRA 5LRJA 1TKJA 5ELYA 2PZWA 5I2YA 5KNCA 3D7DA 3FYNA 4BY1H 4A30A 4RS2A 4A3DG 5HXDA 2DF5A 4NW2A 4K5XA 3KQZA 5CPAA 2OT2A 4X64Q 4O0AA 2CVRA 3K8AA 3K57A 1SYEA 4A31A 1JR0D 3PEIA 2EYLA 1X6OA 1AE3A 3UY5A 4IURA 1HQRD 2KHIA 2K5WA 2EYHA 4G57A 3K5NA 4GLXA 5AGEA 3HOVB 4Y52H 4KOUA 1EZ8A 4C2ZA 3K5OA 1VHOA 1E7ZA 3SI2A 4NGPA 3TDQA 4UEFA 2PJ9A 3S2HB 4X3UA 3LNNA 1D7QA 2B58A 4F8ZA 1KHIA 4Y49B 2B2UC 4K3NA 1AZQA 4X2TA 5EC4A 2JBJA 4CAWA 2EVBA 3M4QA 3L2PA 2D62A 1RL2A 2Z9HA 1DZ1A 3R1KA 4DAVA 2UXDL 3IFEA 5G22A 5LMNQ 1TS5A 5EKIA 2ZTDA 1QUQA 1LOKA 5G20A 4JI7L 1VQGA 3KBGA 5IGFA 3PSIA 2JBKA 4TVAB 5EQ0A 4KV6A 3BVGA 2L9HA 4IZ8A 3M4PA 4LW1A 3ULPA 2Z3OA 1TWGH 1Y1WG 3HOXB 1FNOA 4CDEC 5J3BA 5HGQA 4BBRB 1G2TA 1EIGA 1EWIA 4KMUC 4RG1A 4MY0A 8CPAA 1HA5A 4A3EB 4RGNA 4B6ZA 4B3SL 1YLEA 2QGQA 3CQZB 3MEFA 4HKFA 3VYSA 3DEPA 3D7HA 3NQIA 2PRBA 4NEXA 3V2TA 1SRUA 1TQOA 5ELBA 3W1BA 4E2AA 4K0KQ 1TS2A 1YNND 4GN3B 2ANPA 4QMGA 1VQJA 3G4SA 3L7ZC 2C6CA 2DY7A 1QSTA 4UHVA 1ILQA 1Q2YA 3TREA 4O2DA 2VI7A 2PIZA 4PMBA 4EQNA 3I91A 1Z7TA 4DK3C 1PUAA 1HTPA 1S7NA 1GVPA 3SJGA 5M5WH 1MIUA 1A6XA 2NVYH 2WAQB 2WIIB 1R57A 1SNMA 3T16A 2AQ2B 5C0XI 3FF3A 5M3FG 4IPCA 3S17B 4E0AA 1IW7D 2JYOA 4X3KA 4X5KA 4QC6A 4ZYSA 2O4HA 1EE3P 4TSSA 4R76A 3FX6A 4KY7A 4AYBB 2O5JC 3J81j 3D31A 3S6HA 1PH4A 2EVNA 1Q7YC 2K5VA 4K5VA 3SK6A 4IK2A 2F0NA 2ALYB 3UDXA 3X3MA 2JA5H 1AEXA 1YIJA 1QILA 3VYRA 2V8VA 3GP7A 4IUPA 3BVMA 4JWPA 1WI5A 1O7LA 2MQHA 4JI8L 4C3HB 4LUAA 2PJ0A 4XNHC 4B13A 3PB7X 2A6EC 4H7BA 3TC8A 1I5FA 5CV7A 2JA6B 5L37A 1VQ8A 2FT0A 3B3CA 3HOZB 2EK9A 5LRKA 5DS0A 5F48A 1I50H 5IGEA 1B6BA 1S7LA 1YBYA 2L11A 5I6WA 1VQ6A 3M7NA 2QVPA 3TZUA 2JQOA 4KD3A 1UWYA 2F0TA 4GNXC 3BYYB 2OTJA 3NXWA 1R9TB 2F0JA 4RH6A 1LAMA 4DR4L 4BY7H 3QO2A 4CAVA 4N8FA 2N55A 2RBMA 4U673 2WUUA 1R4PB 1F2YA 1YREA 2PJBA 2REEA 1EZ6A 1ML0D 2PYKA 2KJXA 4UAIA 3A8KE 1E2VA 1IBLQ 1L0CA 3R9FA 3WC5A 3FMCA 4IJHA 3HOXH 4A39A 3G7LA 4DV3L 2B29A 4AYBE 4BBSG 2B2TC 2F0GA 5JJZA 3S1QB 2JEWA 2QJ8A 1SNCA 5EPKA 4L63B 2PVWA 1M4VA 1RF2D 4JC0A 3O13A 2HB6A 2SNMA 4A3GG 4KVXA 2K03A 1VIXA 2ENBA 4DR2L 1Z9FA 1L1OA 2GLFA 3NUCA 3QWNA 3C2PA 5D3DA 1G6ZA 4ZLTF 4HJ7A 4MTNA 2AFMA 2RF4A 3JAMi 4A3BH 2HUZA 1CG2A 1IBMQ 3A5ZB 1T5EA 4QBJA 4HMJA 3E3XA 4CHTB 3U9OA 2EE1A 1PTOD 1JJ2A 4ZK9B 3GTGB 2IX0A 4A93B 4ID6A 4R7MA 4K14A 4JI1Q 2E2IH 1TY2A 4A75A 4LF4L 4JV5L 2AE6A 4MFQA 3E5SA 5M3MH 1BPNA 2IY5B 3R9EA 3SJEA 4IJLA 2K14A 1DYQA 5JVH3 3CRKC 4ABNA 3BVZA 2JN4A 4NXNQ 4UY8C 1VHEA 4C1NK 3G6JB 5CV6A 4DK1A 1FNWA 1HR0Q 2XRSD 4I65A 3OSOA 1Z47A 2H5MA 2NVTB 1B1ZA 4CAFA 3AU7A 1JWMD 4A3CH 4ZCKA 3PO3B 5E1FA 4B9XA 2UUAL 3HP3A 1KL9A 4C3HH 4JI5L 4MHPA 3IWWA 3J81E 4RI1A 2Q2UA 3TE4A 3NQTA 3CCQA 4B5PA 2Z1CA 4C56C 3RLOA 2Z3MA 4QB9A 4PV6A 1M90C 4DR6Q 1LCPA 1U4RA 3GTPB 2ZEGA 4A2ZA 1SFOB 1FNUA 1AMPA 4DV5Q 3I4OA 3VYTA 4X3TA 2NBFA 1BOBA 3NE8A 4OP4A 1EQRA 4ME5A 4KS9A 1HQMC 2F3WA 3ERQA 3CCVA 2XRQD 3J7ZC 1JB7A 2ZXVA 4PSXA 1LT3D 1R9TH 2JEAI 3GUXA 1SDFA 4MCQA 3GTLB 1CQFA 3P7JA 4FWUA 4C3IB 2PPBC 2VNUD 2R1IA 3T13A 1QB5D 3SK4A 1OXXK 1B87A 1RXTA 2PJCA 4QUSA 1D5MC 4X6AH 5C3WA 4Y7NB 1XYIA 5KTAA 2KENA 4KK7A 2L55A 2YNEA 4OADA 4CYNA 1K0RA 3S1QH 1ZYRD 4RKLA 5FO7B 2D4PA 4PV1C 2FINB 2EO8A 2HIVA 2B2UA 1G6PA 2HV2A 2F0UA 1Y9KA 5IX3A 1XNQL 2J9AA 5D14A 1EWHA 3I2ZA 3OTOL 1IYVA 2DN8A 3RO0A 1F9RA 3QB3A 3K7UC 4WJWA 5CV5A 1ZLHA 2F0EA 1PYWD 2RDHA 3GTMH 4CGPA 1RKNA 1JE4A 1UE6A 1WTQA 3V38A 1G8ZD 2AWNA 1VQLA 3E0JA 3AB9A 3GTGH 5IGGA 1TWHH 4A93H 4ZY2A 1B9MA 2FMCA 2IX1A 2A74C 1BR9A 2PZUA 4J6HA 1I1DA 5J39A 1ZKOA 3WWVA 1IY7A 2EJMA 4M8AA 1OTCA 1PTOH 4ZRZA 1CX8A 3D4RA 3QAHA 1CM9A 4LF5Q 1VQFA 2B39A 3D2PA 4HNWB 1FT7A 1CT1D 1N36L 2R6GA 3WR7A 1KLUD 2L4NA 4NKLA 2QDBA 4YY3L 4CAXA 1LO5D 4FF2A 5AG7A 2ZTCA 2BH8A 1CZGA 3KR5A 5DLQE 3KQXA 3MHBA 2R7ZB 5DWMA 5JH9A 1IBKL 2GN5A 3HS0C 3V96A 4YHHQ 2CH4A 3EQLC 5K36G 4A76A 1L0YB 2PJ8A 1TU2B 4MBUA 1T9HA 4BD9A 4JVZA 1LANA 2ZT9C 2Q0YA 5E96A 2I5MX 4K8JA 2UU9L 2K5TA 4LQ6A 2NVQB 1YGHA 1R4QB 2Q2IA 1A2UA 3DXJC 4LF8L 2O2LD 3I72A 2V77A 1TWFB 4IUVA 4DV6L 2Q51A 1HTLD 2HHHL 4FD7A 4AXVA 4CYQA 3KZWA 3DMUA 2PVVA 4R4QA 4ZY0A 1HNWQ 2PI2E 2G9HD 3IEHA 2QF7A 3GTLH 4RGTA 2CKZB 1B3AA 1BUVT 2K01A 3DHQA 5C3XA 1KUYA 2Z3PA 3W91A 1V1OA 2ZPAA 1I4PA 1OBRA 1CI3M 4PK3A 1JICA 1HZAA 3D4UA 3ZJYC 5CBMA 1BDOA 2HQEA 4Y7NH 1BCPB 2CTCA 3K5MA 2V8DA 1LTLA 3KLSX 2OU2A 3GTJH 2JA8B 4AQYL 3KLSA 1ESRA 1F9PA 1VQCA 4H13C 3I73A 1VQBA 1HUNA 3S2DB 2V1CC 2NZOA 1N32L 2B3GA 2ZEFA 4GNXA 4OC3A 4C7IA 4POFA 5IGCA 2F52A 1VQKA 4RAUC 3GY9A 4A3MB 1SLJA 2VB2X 4TNUA 1B4OA 4B12A 2TMPA 1ENCA 4BS9A 2JA7G 3BU2A 4L5TA 2CY2A 4NJRA 4RHRA 4R8NA 3PO2B 2IPKD 4UFVA 5JM6A 4QJFA 3OWEB 2K4KA 5FLXc 4DR3L 1A0IA 4IFDH 5LYIA 2PRQA 1ET6A 2Y0SB 2IQ6A 4BINA 1XX8A 4KHVA 2NWGA 1WWZA 1OXSC 4O1NA 2D9UA 4FUUA 2D4OA 1S5BD 4BXXG 4HIKA 4MHEA 5HH1A 3NP8A 1Q1BA 5C44B 2E2HH 4GKKL 3VATA 3I9SA 4MI4A 5D8NA 1KDBA 1S5KA 4EQ5A 1KIXA 1XRYA 3E9HA 1Y7EA 4O42A 1KLGD 4JI2L 2H5XA 3M85A 3SE0A 4M6HA 1Y1VB 3NBHB 2KECA 2JEBI 3H3VH 5C4JB 2JSOA 2BA1A 4M6IA 4UA3A 1PMRA 1NR4A 1FR3A 1NNXA 1OXUA 1X65A 2R7ZH 1H95A 1EYGA 1VQDA 2PR1A 4DUYL 2I3CA 4LF9L 5C4XB 5C3EG 3KDFB 4IQZA 4KHPQ 4UFXA 1X3PA 2NVXB 2ZW6A 3DWAA 1GUTA 4JBWA 1UUPA 3Q6SA 1N34L 4AH6A 5IGDA 1BNZA 1AE2A 2OF1A 4NGMA 4A3IB 3DR6A 2P6EA 3STBD 3HOUB 1PRTB 5CGKA 4LFAQ 5D29A 2LY7A 1IYJB 5IWAQ 3EY5A 5FO8B 2P5ZX 3K59A 1SMXA 2DJGC 5CV8A 2G0BA 4DGZA 4B3TQ 4FAIA 1O7ZA 2VUMB 1F2LA 4X62Q 1HHVA 4IF5A 4UCPA 3BJUA 2L12A 2Y0SE 3FKIH 1XMOQ 2BOSA 5KTDA 5T1IA 1CTMA 4HN7A 3UE0A 1YJWA 5I6YA 1F2ZA 1SMYD 1ENAA 3W1GA 2XNAC 3SVMA 1PU9A 2NN6H 2J8NA 5J1QA 4CJ1B 1TS4A 1B44D 5HURA 3ICEA 2ATRA 3J80c 5M5XB 2VY3A 4OWTB 3NH8A 1Q8KA 4BBHA 2ID0A 3R2TA 1HFNA 1SR3A 1XE4A 5M9OA 4DV4L 3C1FA 4OO1G 3S2DH 1FJGL 2FL4A 2PR8A 2WINB 5A27A 4UEEA 3SHLA 3R96A 1JOKA 3VWDA 5JQ4A 3HOYG 2IHFA 4J8QA 1DE4C 3HKZB 2C9OA 3Q24A 3K2KA 2F0IA 1VQ7A 5GAGC 4A3JH 5C4ZA 1BBWA 2B4DB 1SYCA 3CC7A 3T1YQ 3PCOB 5DEHA 3A7AB 3PO2H 2K5QA 4UIAA 2PSWA 3DGVA 3MFGA 4P4IA 4XDXA 3BI1A 2Z4HA 2RDGA 1CM0A 5AG5A 1ELMP 4OWWB 3CCSA 3T1HQ 3TQYA 5IODA 4OHJA 4B3MQ 2Z3KA 2EPBA 4GOPB 4A3LH 1CPSA 2G3TA 2IX3A 1Y1WB 2B3VA 3IWEA 5CMDA 3GV3A 4ZQ3A 2VBQA 3UE1A 3UDGA 1ZG9A 2WACA 2M9VA 2RCFA 3SK5A 3OPOA 2ODFA 2PDOA 4YWYA 2CWPA 1TIQA 2R92G 2A73B 1AW7A 4WJ4A 1H9MA 2KEEA 3PUYA 1KZFA 2Q8IB 1XFOA 3CXPA 4UBRA 5KGUA 4Q38A 5C4XH 1PA6A 3B35A 4MFPA 1YVOA 4DNRB 1CSPA 1LT6D 2BE5D 4BMHA 1D5XC 4DV1L 4KJOA 4KSAA 4YFJA 1D1IA 2A1AA 4OONA 1CKNA 2PQAA 5LMUQ 3NBIA 2K1BA 2IMOA 3TO6A 2EQSA 1IL2A 4DNCA 5C0XG 3VR2A 1WTPA 4JXRA 4FF3A 3HKZE 2BSWA 5AG4A 5C6AA 1TWGB 5M3FB 3MRUA 1S40A 3TOAA 2N88A 5IYBG 1NSAA 5A35A 1IOIA 1H9SB 2MFIA 1G291 2R93H 1V1PA 3TP6A 2VZZA 4CGNA 1LABA 5BR8Q 2PQEA 3A8IE 4HR7B 5LMNW 3H8EA 4JI4L 4CGMA 1JE5A 4R4OA 3IC1A 1I4GA 2CW0D 3NSWA 4NXMQ 1ZO0A 3OW2A 3B6YA 4PG3A 4XIGS 1ON0A 4MHYA 2WSAA 2ZJQA 1CK1A 1L0XB 3I4NH 1MKHA 2WV6D 1WVLA 1IYKA 1Y9WA 4A3DH 2CXAA 4KZTA 3I3GA 1S7KA 4JLYA 2XIWA 2L5TA 2VB3X 2PJ1A 1FL0A 1M4DA 4DR1Q 3D2MA 2BOAA 3JVNA 4WRDA 1XOVA 3PP9A 3S6GA 4F9UA 1E1OA 1F77A 1ARMA 4F87A 1KNEA 1U4LA 5M5WB 3T56B 1SYBA 2X69A 5K8MA 1YNXA 4JOIC 3U58A 4JI3Q 1IIDA 3MXNB 5EPLA 3PF5A 3KF6B 5IP9G 4UF4A 4DK6C 3KF8B 1NMGA 4DAYB 4X65L 1WTHA 4Q0FA 4JI7Q 1YNJC 3DR8A 2I07B 3EA6A 1TKWB 2R3ZA 1B8AA 2XN9C 3TEHB 1M1KC 1H9KA 1XNRL 2JA5B 5FLXL 2ZEPA 1PH5A 4MCPA 2EY5A 3PB6X 2PJ4A 3FPPA 1DOMA 1QVGA 2F8HA 4OWXB 1E22A 1YX0A 3NTIA 3MAQA 1CP6A 4OC1A 2GLJA 4A3KG 2XVSA 2JLMA 1NSNS 4B3SQ 1Y1WH 1NAPA 3VR6A 2IL8A 5GAHC 3IL8A 3CU7A 2SDFA 3H3VI 4A3GB 2KCWA 1I50B 3PFOA 2XTIA 1LACA 3BDOA 4P4FA 3QIAA 5FOBB 1KAWA 5J1ZA 1AUGA 4NPSA 5JEAG 5JOBA 3RMHA 4H0LC 2EZVA 4XPDB 3CCMA 4AIMA 1RODA 1YVKA 1RD9D 4PXDA 4BY7B 1NMFA 1VMCA 2A68D 2XWJB 1U0LA 4HIOA 5HVFA 1T5XD 2ICIA 1CPXA 1PHJA 1A3UA 1BO0A 1GUSA 2QCPX 4GXHA 4ZYQA 3S16B 1I4XA 2UUBL 4MN3A 4X66L 3S6KA 4KVME 1B70B 1RTNA 3V7ZA 1ET9A 1F9QA 3HGBA 4NB3A 5M3FH 1I94L 3IWGA 4FF1A 4B08A 5KRUA 3WC7A 4A32A 1HRJA 2KHJA 3GQBA 1DM0B 3NPPA 4KKSA 4ZKBB 4AB7A 5I9OA 3QOLA 4RHSA 1MJEA 2ICEC 3MZ5A 1WTOA 3F0AA 2K04A 1DJRD 2MP1A 1SNOA 4PZ8A 1BAVA 1II3A 3CXCA 2F3IA 3NENA 5C0XJ 4JI6Q 3PB8X 3ND9A 3PUXA 2AQ3B 4GS4A 2NN6I 3CPWA 5FLXE 3FIXA 4A3BB 4UWIA 4DV0L 4KD4A 2O28A 3J80L 5AJ3L 2A6HC 1F9SA 2B63G 1LAPA 5KYLA 1ZG8A 3N7ZA 4QGUA 1Q8IA 1STBA 4B10A 2E2IB 1G91A 2UUCL 2VQEL 1S7FA 1N9WA 4C3JG 1KQSA 5M3MB 3LACA 1BCPC 1MD2D 1PYBA 4M3SA 2F0VA 2NYQA 5A2QL 4DR4Q 1WD0A 3BYTB 3OMCA 1FGBD 4MFJA 2RVLA 1L0WA 1HCZA 3TMEA 1V9PA 2EY6A 2OB0A 4A4IA 3KYHC 4ZBGA 2QKIC 2K5HA 3MFYA 2P0WA 1VCIA 1UEAB 3HOWG 2B3UA 4DV3Q 1IB1E 5JPMC 4IOAA 2HQYA 2M00A 4MMOA 1Q82C 1B3QA 4A94A 5BWAB 3JC66 2ZOGA 1J9OA 2QILA 4JPBW 1IU8A 4DR2Q 2EXDA 5K8NA 4BBSH 1HR0W 4HNYB 3L3OC 1MSGA 2DGYA 1BF4A 2AJ6A 4R4IA 4UWJA 3NH4A 2VQFL 2RHSB 1PYTB 4A3GH 3RBUA 1YEZA 3A55A 3S9NA 1MK4A 4DR7L 4PK2A 1PYSB 4C68A 1NSLA 1DGSA 4ZGYB 4CPAA 1I4QA 3VA5A 1Y7RA 2VXWA 4R8IA 3U4VA 5FVJA 1U9RA 3RLFA 1IGBA 5F46A 3F1ZA 2RC4A 1CKOA 4LF4Q 3FECA 1X3FA 5C82A 3S9LA 1DOLA 3A74A 5HVHA 1KRSA 2EBJA 1VQNA 4UCMA 3KBXA 3J80E 3BXMA 2EDGA 2OTLA 5FK9C 4BA1I 1W2BA 1E1TA 1QVFA 2R7DA 2VZAA 2WAQE 3T9YA 2EYMA 3F2CA 5DM63 3S16H 4FXDA 5G1ZA 5JAVA 4IUNA 4EQOA 1S4ZA 4P72A 3HFZB 1K83B 2PZTA 5JEAJ 4FD4A 2ZXPA 2AWOA 3HZXA 4HJ9A 1QMUA 1YW6A 4GKJQ 3VH9A 2B5GA 4QVTA 4EQPA 2GA4B 5A2QE 3JAML 1UNSA 1PRTC 2UUAQ 3FNCA 2JXMB 2X6GA 5DWNA 4DR5Q 2K05A 1HFGA 3QNVA 4JI5Q 1FNVA 4KORA 4FD6A 4CS0B 1RDPD 1BPMA 3R93A 4JYAL 5IYDH 3K80C 3S14H 1NE3A 3GYAA 4NSQA 4LMQD 3UI2A 3GTMB 1N33Q 1SQHA 1PH6A 3PUZA 2HC9A 1ILPA 1VKCA 4CKBA 2OQKA 1SXTA 2G3AA 2QEXA 3V05A 3M4OB 4KKUA 5IT9c 4HJAA 4RCNA 1MJ9A 1TWHB 4JYWA 1HPCA 1SEBD 3HOVG 2DNCA 3J81i 3P1HA 4S3SA 2KUMA 4C7HA 3EIVA 2Q4VA 3PUVA 3KHXA 3GO5A 3TO9A 2CNTA 1EEID 4HJ5A 2F4VL 2PJ5A 3OYYA 1GO3E 1GUWA 1PTOB 3M7GA 2K33A 3QOJA 1C0AA 1QSRA 3ZZIA 4JI0Q 4RN7A 4P4JA 2LSSA 5IYCG 2C5CA 4CKEA 3PIPA 1IICA 2D0OA 1XJOA 5AG6A 1E24A 1H8LA 1EYCA 3VR3A 5I2XA 1IL8A 1SAPA 1BVSA 1BQQT 1DOKA 2KBNA 5DAUA 4R3KA 4F6AA 3TP8A 3LMSA 4XQJA 1N71A 1W6JA 2K75A 3TP5A 3A5UA 4JOIA 4BBRG 4YCUA 3VA7A 1XMBA 3KKWA 2CH4W 4A3EG 2KEDA 4RKBA 3T8WA 2WB1B 5F2DA 1QCBD 4F8MA 2F0LA 1L1OB 1MBYA 2PCFB 5D3IB 3WC6A 3FVLA 2EYFA 2Z6BA 4U68A 3OHXC 3TZDA 4F0YA 4K6LA 2SEBD 5KNBA 3BJ8A 3GB0A 4DYOA 4G4KA 3B2YA 3AEVA 1K9MC 1WOCA 2PI2A 4HEDA 4KOSA 3S1RH 4NF1A 4DPGA 3KJPA 3A9LA 4KOXA 3OWCA 5K5PA 5J8FA 2KCCA 1WFQA 2A69D 1D2BA 1A15A 1D5ZC 1E2ZA 4LUVA 2MUYA 4CAEA 1HNZL 1HEEA 1ELLP 1GM5A 4DXFA 1IZ6A 4PXBA 4GZYC 2CF4A 1I3QH 1K83H 1N36Q 4AYBG 1Y8OB 1HZBA 3GTJB 2NTSA 4JI1L 1OO9B 2OCEA 1I21A 1SE4A 1PV4A 1M4GA 3SXNA 1XPRA 3SR1A 2AFWA 4R6TA 4OC2A 3PZJA 1Z4RA 3BZCA 3TP7A 1X3QA 3EN2A 4YRHA 2ZXRA 2YGWA 5BN3A 4LX9A 4OC5A 4R9WA 3CCLA 2A4NA 5LYLA 1H9RA 4XQNA 2LFNA 1X9NA 2YU9B 4HCEA 2UU9Q 4ZY1A 4B5PB 3CMAA 5K36H 2JA6G 4YWMA 4LF8Q 4F88A 1F2PA 3M4OH 2DNEA 2WB1E 3HOZG 4DV6Q 2PMZB 2RDFA 2BL1A 2HHHQ 1EUJA 3MTSA 2G5DA 1GHJA 2WP8J 3IO1A 4OIWA 2PW5A 1TKHA 1KC8C 4PMCA 1LTBD 2E2HB 2BCOA 2KVMA 5ELDA 3H91A 4R3LA 2LXJA 4KOYA 2ZTEA 5HY6A 1S72A 1CP7A 4KVOE 1K3BC 2HUGA 4RMFA 3G71A 4P44A 5FLMG 1UAPA 4LFCL 4L5QA 4MHDA 4OIDA 3DUZA 2HD3A 3K0XA 1YVCA 3KASA 3H6MA 4AQYQ 1Y0RA 2YNCA 4U9YA 2AUKA 5JVG3 3WABA 4AVCA 1N32Q 1HXYD 1M4LA 3FEWX 4P73A 3W5OA 4B9WA 1Y0YA 4HJ8A 1K4JA 1GD7A 2J7ZA 4KY6A 1STAA 3TRZA 4DUKA 1PFMA 3AQQA 1J5EQ 3CDXA 2WYRA 3KUPA 3IGRA 2OXPA 1Z4EA 1U5KA 4TWEA 1SSOA 5C5LA 2R61A 2OZHA 5LHY1 3HOYB 2HDLA 1SE2A 2F7VA 3TSSA 4DR3Q 3HEJA 1PZKD 2PIYA 3AMUA 1A3VA 2PNHA 5E4XA 2E5LL 2JA7H 2C6GA 3SI0A 1LT5D 4NGRA 3M3YB 2Z11A 3BDCA 3FKIB 3E0KA 3ERSX 4LNQA 1HH2P 2NZHA 3D8GA 4K2LA 3R8BA 2GE3A 1MJCA 5LRGA 5CNPA 5COYA 4NP5A 1EQTA 1TF9A 3CAMA 4Y49C 2V8GA 3CCRA 3MWYW 2A8VA 2NB0A 2DJFC 5CORA 4BXXH 3VR4A 2KOLA 1OZPA 3W2DA 3F8TA 2BUEA 1BBXC 2VL1A 2RCNA 1NJIC 1DONA 3N5FA 3NBHA 4UP7A 4IUTA 2VEZA 4LF9Q 3PO3G 4LF5L 2VL6A 2Z0ZA 3RR5A 1CSQA 2RHQB 4A3JB 3B3VA 4H2KA 2ZM6L 1N34Q 2LKVA 5JPHA 2YU9H 4MHNA 4JD6A 3NFZA 5IY0A 1EU4A 5C3EH 1K8AC 1EY9A 2RKSA 5D65A 3NH5A 4HNXB 2EJGC 5H86A 4KI0A 3D6WA 2Q8RE 4QY7A 1EIFA 5IT9L 2SNSA 2XEGA 1PH7A 1S3ZA 3JUWA 4UIBA 3IKJA 1XPUA 2H1EA 2A6ED 1YR0A 2KCTA 3LWEA 3QR8A 1PCAA 2NSMA 3CD6A 3TT2A 3PB9X 1YMEA 3E9IA 2EK8A 5CYUA 4QIWB 3EO4A 1NCVA 4P71A 2Z3NA 3W3AA 3AFQA 4II9A 1YNNC 4G7ZC 1UFHA 4C3IG 4A37A 3A0JA 2K52A 1EIHA 5LYFA 4XNHB 1NBWA 3URYA 1SE8A 1IKMA 2MNAA 4CYPA 4QQBX 3B8GA 3GD7A 4KUAA 1KAAA 2DUDA 2MPMA 3OMGA 3K0YA 4BWGB 2JK8A 1FJGQ 1QSMA 2QECA 2ZW5A 4KY5A 4JBKA 1IW7C 2C1CA 3D4WA 4ZUJA 3KFUA 3T53B 1FY7A 1XIXA 4OO1H 1MI2A 3CPXA 1LLRD 2EJFC 2IW3A 2JDCA 3FRMA 3BS1A 4UFWA 1ICFB 2F0QA 4CYOA 5JGFA 3HOYH 1XWEA 1NUCA 4F9VA 1C9OA 4H6ZA 1FGUA 1JOOA 2R93B 4QCLA 2ZEHA 2B4DA 2LS01 1EY0A 4C2MB 1XTDA 5I4MA 3M3YH 1V43A 3I4MG 3NE5B 2F0FA 3HUVA 1RIPA 1F57A 5T1GA 4F0XA 3I4NB 1JQGA 2UXCL 4PXCA 5A28A 2B2YC 1HDUA 2IL4A 2E75C 4A3DB 3QAYA 3TTHA 5IT9E 5JJIA 2PCUA 1X3GA 4FF4A 4A3KB 2NMTA 5E4WC 4QIWE 2YYZA 5FKAC 3R9GA 1TWCB 3SK8A 3GKRA 4MJ8A 3E0EA 4LAAA 3FEDA 4QL5A 3I1UA 3AFPA 2Y0MA 3FJUA 5FJ8G 1V0CA 2YTYA 3E6ZX 4MTKA 1EYAA 3RN5A 4DUZQ 4OC0A 4MRIA 3TOBA 3IRBA 4LF6L 4DV1Q 2R92H 2RQXA 1V1QA 5ELOA 4ZAIA 3S1MH 1VGYA 1QZGA 1Q1EA 3I4LA 1VQOA 4HAEA 1UWVA 4L6TB 2OZGA 1B7YB 1HDQA 6CPAA 1IKLA 4KHPL 2E76C 3K5LA 4PPZA 1Z8TA 2HQLA 4ZX9A 1F2MA 3RLNA 5LL6X 2CNSA 2Z4IA 5I9PA 3EXNA 3KGQA 5IYBH 4LFAL 1H9SA 2F5IA 3SJXA 4OAEA 5M5YB 4B14A 1M8AA 4UP8A 5CR3A 4FD5A 1KABA 1LYLA 4B3TL 4P4BA 2AKWB 5NUCA 1Q46A 4N9PA 4C2XA 1P8LA 1GYTA 2PNRC 4X62L 1PTOC 2AFZA 3RZOB 1GHKA 3W6SA 3S9WA 3GTKH 4A3FG 1QNUA 2JE6I 2SOBA 4WFN3 1TXRA 4LUZA 2CWAA 3HRZC 3R3OA 3FBUA 1XMQQ 2JA8G 4C1NI 5IV0A 4IUSA 4CKCA 3CF5A 4MFZA 3HKSA 3M9BA 4QB4A 4B3RL 1EY7A 2PO4A 1TY0A 2D2CC 2K50A 1QSOA 2CHBD 1HNXQ 4A3MG 4JK1C 1YJ9A 4NGQA 4RA8A 4MCSA 4X65Q 1GXDC 1PXUA 4KN7C 2N8NA 3BLNA 5C4HA 3MXNA 1STHA 2B2VC 4UP9A 3KF6A 5IP7G 3KF8A 5IP9H 1X12A 2Z0SA 3JAMc 5F47A 1XNRQ 2CNMA 3F2BA 1Y14B 4G7HC 4MNOA 2VZYA 4C2MH 1LTGD 4I7AA 3CPFA 2Y0SG 3P2FA 2HIXA 1Q3LA 5GCNA 4DV7L 4M1UB 2M2LA 1O80A 1Z8XA 4JW0A 4R87A 3I55A 4WJ3M 2ZEDA 1YSJA 4ALPA 3I3CA 5IOCA 1B9NA 1I6VC 5BN4A 5C44G 3MXPA 4AG7A 4DV2L 1QOHA 3A54A 2PJ7A 1XEBA 1KDCA 4A3KH 1CQVA 1S5FD 4K2KA 2Q2HA 3ULLA 3VR5A 4B3ML 3PRTA 1WCMG 4MZ9A 4TRDA 1PLFA 5EGTA 1TWCH 1A3TA 4POGA 1CJWA 3UDIA 1Y1VG 4PQAA 4HSPA 2FS5A 4KSFA 2NZ1D 4K6DA 4LF7L 3C46A 4HIMA 1VQHA 2F0HA 3S6FA 1TVXA 2F0PA 4P74A 1SJED 3BI0A 4OX9L 4RWSC 3VDYA 2AFSA 2UXDQ 1GJXA 3DEOA 3GTOH 1E3PA 3D6CA 2Z10A 4A95A 5JEAH 1VDZA 2R7HA 1JC7A 4R57A 5EMIA 1R3NA
chains in the Genus database with same CATH topology
2C6PA 3K58A 4IFDI 1PDQA 3T4AC 1IHZA 1ZYRC 1I4HA 1RHPA 1Z2LA 3RD4A 1IYUA 3M4YA 4ILWA 1ENFA 1LT4D 5DNFA 4LQGA 1V1PB 2V4DA 4F7XA 4BBSB 2PJ6A 1VMPA 4NFRA 3PUWA 4JZ0A 4IN3A 3FPUB 3RUZA 4Q7AA 2FMMA 3BG3A 3BZDB 2FVGA 3OOCA 3H3VC 3Q0AA 4EFDA 4NJQA 5TSSA 5F09A 1EY5A 3S15B 5EBCA 4HCSA 5EPJA 4OO1I 4OC4A 1S5ED 5EBDA 2F0MA 2Q43A 3IIBA 4H44C 3ZYYX 2POKA 1NR2A 1RTOA 1ARLA 4WWVA 2XEIA 1TKFA 2EOTA 4ULLA 3S9MA 3VARA 4OIKA 2D5DA 3PIO3 3CKIB 5CV4A 2WKDA 3S14B 3QJYA 4XYQA 3IFDA 2KCNA 4FXKC 2QYVA 1DCZA 1VF7A 2F0WA 2O53A 2I46A 1OXVA 3KK7A 3KI9A 1QNKA 3CHBD 3CPAA 3KLRA 4Q5VA 2ZEMA 4RFBA 2X6LA 1U4PA 3IJ3A 3DWQA 2AFXA 2A5HA 4HSVA 4NDXA 2PJAA 1E2WA 2B2YA 1ONLA 3PFEA 1LTAD 3D7FA 3RZAA 2F0DA 2B8GA 4CJ0B 4WORA 3PB4X 1Z6HA 4KHZA 3WT4A 2EY2A 3LX0A 1BLLE 1ICWA 3I8ZA 4IALA 4RUHA 4XQQA 3A7LA 4OKOA 3Q22A 3QG1A 2IJZA 1PZID 3T51B 4DFAA 4UEZA 5FO9B 1HUMA 4IHMA 1STNA 4BA2I 4DXGA 3B7IA 4FXGC 2F3VA 1WTRA 1XBUA 2IT1A 3SEBA 1KNAA 4V0BA 3D67A 4WJBA 3S1RB 2TSSA 1SYFA 1OXTA 2AQ1B 3OW7A 1SNDA 1BXTA 1EFID 1G2SA 1RJTA 5THWA 1QE6A 2Z8LA 3X3NA 1AYEA 1I3QB 1EY6A 5ISRA 1MGSA 4P4EA 1KTKA 1X32A 2HCCA 2NUCA 1ESFA 4P4DA 1D6EC 2ABZA 1QWYA 2EYPA 5I4DA 1I4RA 3J81L 3DLJA 1BCPF 3C3LA 3MC0B 1Y8NB 3MA2B 2B2VA 4UDUC 2B2WC 1MSHA 3NWTA 4CBVA 3OIPA 4HTHA 2OEOA 3NTKA 4TKOB 4DU9A 1ZG7A 1S5CD 2XSCA 4DN4M 2RSNA 3D4DA 2BA0A 1JORA 1SMYC 2G9DA 4P2CB 1GOZA 3PMFA 1WD1A 4ODGA 2K32A 4LK1C 1EQVA 4DF7A 4FVMA 3SJFA 1B2TA 3EROA 1CHPD 4PNYA 1A2TA 2ZXOA 3MXUA 4FNFA 3FRPB 1WTWA 1AN8A 2RA4A 1EY8A 2E2JB 2J4XA 1J8IA 4N9TA 5CBEE 3MEHA 4DNTB 1CA6A 1YLOA 5DM73 4EGVA 5IGBA 3JAME 2PJ3A 5IB9A 2MGSA 3IFTA 4EMEA 1QG7A 3NK9A 4RCOA 1SJHD 3TN2A 2MJ8A 2JA7B 4Z9CB 3K6OA 4P6YA 1ZXTA 4P45A 2IJ0A 4ONWA 1DXMA 1CHQD 3L9AX 1PRTF 1AZPA 4G1PA 1JB3A 1EL0A 1SNPA 2OOTA 2QEJC 4K5WA 2GREA 2CTBA 3K9TA 1BOSA 3L2NA 1JWUD 4OIJA 2CIJA 2FJ2A 1W6KA 2O4XA 4TQUS 4MHZA 2BE5C 2E74C 5J22A 3PBBA 1YNJD 2L1BA 4C3HG 3ONAB 1TF8A 1QJOA 1EEFD 3B3TA 3ITPA 5ELFA 5C3EB 1XXGA 5ELCA 4RGMA 1R43A 3ISXA 2Q8TA 2ZELA 1Q12A 1EYDA 4XYOA 5CC4A 4K8IA 4OGQC 3D3RA 1TT2A 2CW0C 3I90A 2OR4A 4YIJA 1WTXA 3WDNA 2K5DA 3VYUA 3ISZA 3EVQA 5K8OA 4ZX8A 5IIFA 3I4MB 1Q90A 3N52A 1C4QA 2K6AA 5G3LF 3D66A 4R8FA 4DK0A 4MCRA 3RAMA 4DAPA 2F0KA 3MXGA 3GLJA 4XT1B 4KKTA 1STEA 4ZUIA 3BHXA 3A8JE 1JWSD 4FBEA 1ZLIA 1GUGA 5EKKA 2XEFA 3GV6A 2BO9A 3C1EA 1FD7D 4QUFA 3IAYA 3B3WA 5KNDA 2A6HD 3EJIA 2LMCB 3I70A 2EYOA 3H09A 5AFWA 3PBEA 5E3FA 1JQYD 1BCPD 1EWCA 4P10A 3KR4A 4J1MA 2Q4ZA 3PV0A 3NWSA 1TR5A 1CZWA 1EOTA 2MHVA 4XXEA 3MN8A 3Q23A 1CFMA 2A68C 1SBBB 4LJZC 2R92B 2F03A 3CT9A 4A3FB 4I7ZC 1SYGA 4ZKCB 2H4OA 1CA5A 3S1MB 4GM5A 1PZJD 5LL6S 3SDZA 4FO2A 4KN4C 4PQXA 2EWBA 3TBIB 3LWUA 2PJ2A 3WOEA 1SNQA 2GU2A 1Q7LA 3H94A 2RSOA 2O5IC 2XEJA 1ZEQX 2WKCA 4PMWA 1AFPA 2KHSA 4KJNA 4DA2A 2B2TA 2HDMA 1V8QA 5EKLA 2F1MA 3GTKB 2B2WA 4Z65A 1E0BA 3J7YW 1FYCA 2E2DC 1VF5C 3KHZA 1XTCD 2PE3A 4CJ2C 1KDAA 1WCMB 2HCIA 2FFKB 4O23A 3FVQA 2B8FA 3A56A 4HMIA 5EJWA 3HG9A 4G7OC 1RTQA 2L0CA 2EYJA 1PRTD 3EFXD 4MIUA 2XWBB 4IFDG 3P75A 4FP5D 4V190 4XT3B 3R2IA 5CBAE 3NHHA 1CBXA 3OIQA 2ZENA 2AUJD 2F0OA 2CQAA 1AP0A 5CV9A 3PIP3 2IWHA 1LTID 2JP1A 3H0GB 4FYDA 5LYDA 3FEEA 5KEEA 4KTAA 2ZOFA 3N6RA 3GTOB 4DJLA 3J7AF 4NGTA 1Z5RA 1QQ9A 2ZEOA 1EY4A 3MVVA 3K7AB 4IUUA 5KYIA 4NGNA 1DTDA 1STGA 4ZI6A 1K8OA 2BDOA 1Z8LA 5K8PA 1SYDA 3U9SA 5C0XH 4W9YA 2NYZD 3P20A 4X3SA 4KSIA 1LTTD 1H9JA 2F0SA 1B53A 4RGOS 5G3LD 3SXHA 2AFOA 3FDTA 5JPNC 2FHTA 3GTQB 5KIXA 1B50A 1TS3A 5ELEA 4EWTA 4NMZA 1K8MA 3NTHA 4QUCA 2NN6G 3SI1A 4QF4A 1LV9A 1TWAB 2V8HA 4BY1B 3WOFA 4IUQA 1Y69U 3TX8A 4OMEA 4E6IA 1HA6A 2B63B 4YU9A 3BDLA 3H8GA 1SE3A 2BDNA 1Y8PB 1U4MA 3FH4A 4C3JB 2ZEEA 4CGYB 1RCVD 3J7AV 3D7GA 3NA6A 1STYA 1TIID 2EXZA 4DAYA 4NGSA 3H8FA 1D1KA 4EVOA 1O7YA 1C48A 3ND8A 1O78A 2DEAA 2RB7A 3HOWB 1PFNA 2EY1A 1C8CA 2K28A 1YW4A 4L8JA 4X8IA 2WZNA 3JRUA 4OL7A 4X3RA 2AFUA 1LTRD 2F4IA 4IFDJ 1JOQA 1F2OA 2J0TD 4XTCS 3DWPA 3RZDB 5BN5A 1I6HB 4PXEA 5C5MA 4A38A 2PW7A 2A69C 1PFBA 1KWMA 1WTVA 1DD2A 3KL9A 2KA7A 3OWFA 1JCKB 4IAVA 3D68A 2NVYB 1LFWA 3CRLC 3F2UA 3HLPA 3B3SA 5HGTA 2K7VA 1EU3A 3S1NB 1PTOF 2NTTA 1LTSD 2KQ3A 2RFHA 7CPAA 5HVGA 1GUOA 2DY8A 3DM1A 1S5DD 1GUNA 4MXUA 5LRJA 1TKJA 5ELYA 2PZWA 5I2YA 5KNCA 3D7DA 5HXDA 3KQZA 4NW2A 4K5XA 5CPAA 2OT2A 2CVRA 3K57A 1SYEA 1JR0D 3PEIA 2EYLA 4IURA 1HQRD 2K5WA 2EYHA 4G57A 3K5NA 3HOVB 1EZ8A 3K5OA 1VHOA 3SI2A 4NGPA 3TDQA 4UEFA 2PJ9A 3S2HB 4X3UA 3LNNA 4F8ZA 2B2UC 4K3NA 1AZQA 4X2TA 2JBJA 2EVBA 2D62A 1DZ1A 4DAVA 3IFEA 1TS5A 5EKIA 1LOKA 3KBGA 5IGFA 2JBKA 5EQ0A 4KV6A 3BVGA 2L9HA 4IZ8A 3HOXB 1FNOA 4BBRB 1G2TA 1EIGA 4KMUC 8CPAA 1HA5A 4A3EB 4RGNA 4B6ZA 3CQZB 3VYSA 3DEPA 3D7HA 3NQIA 3V2TA 1TQOA 5ELBA 1TS2A 1YNND 2ANPA 4QMGA 2C6CA 3L7ZC 2DY7A 1ILQA 2PIZA 4PMBA 4EQNA 3I91A 1Z7TA 1HTPA 3SJGA 1A6XA 2WAQB 2WIIB 1SNMA 3T16A 2AQ2B 5C0XI 3FF3A 3S17B 1IW7D 2JYOA 4X3KA 4ZYSA 2O4HA 1EE3P 4TSSA 4R76A 3FX6A 4KY7A 4AYBB 2O5JC 3D31A 4K5VA 3SK6A 4IK2A 2F0NA 3X3MA 1AEXA 1QILA 3VYRA 2V8VA 3GP7A 4IUPA 3BVMA 1O7LA 4C3HB 2PJ0A 3PB7X 2A6EC 4H7BA 3TC8A 5CV7A 2JA6B 3B3CA 3HOZB 2EK9A 5LRKA 5DS0A 5IGEA 2L11A 5I6WA 2QVPA 3M7NA 3TZUA 4KD3A 1UWYA 2F0TA 3BYYB 3NXWA 1R9TB 2F0JA 4RH6A 1LAMA 3QO2A 4U673 2N55A 2RBMA 1R4PB 1F2YA 2PJBA 1EZ6A 1ML0D 2PYKA 2KJXA 4UAIA 3A8KE 1E2VA 3WC5A 3FMCA 4A39A 3G7LA 2B2TC 2F0GA 5JJZA 3S1QB 2JEWA 2QJ8A 1SNCA 5EPKA 4L63B 2PVWA 1M4VA 1RF2D 3O13A 2HB6A 2SNMA 2K03A 1VIXA 2ENBA 2GLFA 3NUCA 3QWNA 3C2PA 5D3DA 1G6ZA 4ZLTF 2AFMA 1CG2A 1T5EA 4HMJA 4CHTB 3U9OA 2EE1A 1PTOD 4ZK9B 3GTGB 2IX0A 4A93B 4ID6A 4R7MA 4K14A 1TY2A 3E5SA 1BPNA 3SJEA 1DYQA 5JVH3 3CRKC 4ABNA 3BVZA 1VHEA 4C1NK 3G6JB 5CV6A 4DK1A 1FNWA 2XRSD 4I65A 3OSOA 1Z47A 2NVTB 1B1ZA 3AU7A 1JWMD 3PO3B 5E1FA 4B9XA 3HP3A 4MHPA 3IWWA 3J81E 3NQTA 2Z1CA 4C56C 1LCPA 1U4RA 3GTPB 2ZEGA 1SFOB 1FNUA 1AMPA 3VYTA 4X3TA 2NBFA 4OP4A 4ME5A 1HQMC 2F3WA 3ERQA 2XRQD 1LT3D 4MCQA 2JEAI 3GUXA 1SDFA 3GTLB 1CQFA 3P7JA 4FWUA 4C3IB 2PPBC 2VNUD 3T13A 1QB5D 3SK4A 1OXXK 2PJCA 1D5MC 5C3WA 4Y7NB 1XYIA 4KK7A 2L55A 1ZYRD 4RKLA 5FO7B 4PV1C 2FINB 2B2UA 2F0UA 2J9AA 5D14A 1EWHA 1IYVA 2DN8A 1F9RA 3QB3A 4WJWA 5CV5A 1ZLHA 2F0EA 1PYWD 2RDHA 1RKNA 1JE4A 1WTQA 3V38A 1G8ZD 2AWNA 3E0JA 3AB9A 5IGGA 4ZY2A 1B9MA 2FMCA 2IX1A 2A74C 1BR9A 2PZUA 4J6HA 5J39A 1ZKOA 1IY7A 2EJMA 4M8AA 1PTOH 4ZRZA 1CX8A 3D4RA 1CM9A 2B39A 1FT7A 1CT1D 2R6GA 1KLUD 2L4NA 4NKLA 2QDBA 1LO5D 4FF2A 1CZGA 3KR5A 3KQXA 3MHBA 2R7ZB 5JH9A 3HS0C 3V96A 3EQLC 5K36G 1L0YB 2PJ8A 1TU2B 4BD9A 1LANA 2ZT9C 4K8JA 2NVQB 1R4QB 3DXJC 1A2UA 2V77A 2O2LD 3I72A 1TWFB 4IUVA 2Q51A 1HTLD 4AXVA 3KZWA 3DMUA 2PVVA 4ZY0A 2G9HD 3IEHA 2QF7A 4RGTA 1B3AA 1BUVT 2K01A 3DHQA 5C3XA 1V1OA 1I4PA 1OBRA 1CI3M 1JICA 3D4UA 5CBMA 1BDOA 2HQEA 1BCPB 2CTCA 3K5MA 2V8DA 3KLSX 2JA8B 3KLSA 1ESRA 1F9PA 1HUNA 4H13C 3I73A 3S2DB 2ZEFA 4OC3A 5IGCA 4RAUC 4A3MB 2VB2X 4TNUA 1B4OA 2TMPA 1ENCA 4BS9A 4NJRA 4RHRA 4R8NA 3PO2B 2IPKD 5JM6A 3OWEB 5LYIA 4IFDH 2PRQA 1ET6A 2Y0SB 2IQ6A 1XX8A 4KHVA 2NWGA 1OXSC 4O1NA 2D9UA 4FUUA 1S5BD 4MHEA 3NP8A 1Q1BA 5C44B 3VATA 5D8NA 1KDBA 1XRYA 1Y7EA 4O42A 1KLGD 3M85A 3SE0A 1Y1VB 2KECA 2JEBI 5C4JB 2JSOA 2BA1A 1PMRA 1NR4A 1FR3A 1OXUA 2I3CA 5C4XB 4IQZA 1X3PA 2NVXB 3DWAA 1GUTA 4JBWA 1UUPA 3Q6SA 1BNZA 5IGDA 2OF1A 4NGMA 4A3IB 3HOUB 1PRTB 5CGKA 5D29A 2LY7A 5FO8B 3K59A 5CV8A 4DGZA 4FAIA 1O7ZA 2VUMB 1F2LA 1HHVA 2L12A 2BOSA 5T1IA 1CTMA 4HN7A 5I6YA 1F2ZA 1SMYD 1ENAA 3SVMA 2XNAC 5J1QA 2NN6H 4CJ1B 1TS4A 1B44D 5HURA 5M5XB 3NH8A 2ID0A 3R2TA 1HFNA 5M9OA 3C1FA 4OO1G 2WINB 4UEEA 3SHLA 1JOKA 4J8QA 1DE4C 3HKZB 2C9OA 3Q24A 3K2KA 2F0IA 5C4ZA 1SYCA 5DEHA 3A7AB 2K5QA 4UIAA 3DGVA 3MFGA 4P4IA 4XDXA 3BI1A 2Z4HA 2RDGA 1ELMP 5IODA 4OHJA 2EPBA 1CPSA 2IX3A 1Y1WB 5CMDA 3GV3A 4ZQ3A 1ZG9A 2WACA 2M9VA 3SK5A 3OPOA 4YWYA 2A73B 1AW7A 1H9MA 2KEEA 3PUYA 2Q8IB 1XFOA 5KGUA 3B35A 4DNRB 2BE5D 1LT6D 1D5XC 4KJOA 1D1IA 2IMOA 3NBIA 2K1BA 5C0XG 3VR2A 1WTPA 4FF3A 5C6AA 1TWGB 5M3FB 3MRUA 2N88A 1NSAA 5A35A 1H9SB 1G291 1V1PA 3TP6A 1LABA 2PQEA 3A8IE 4HR7B 3H8EA 3IC1A 1I4GA 2CW0D 3NSWA 4XIGS 4MHYA 1CK1A 1L0XB 2WV6D 1WVLA 2XIWA 2L5TA 2VB3X 2PJ1A 2BOAA 4F9UA 4WRDA 1F77A 1ARMA 4F87A 1KNEA 1U4LA 5M5WB 3T56B 1SYBA 2X69A 5K8MA 5EPLA 4UF4A 4Q0FA 1YNJC 2I07B 3EA6A 1TKWB 2R3ZA 2XN9C 1H9KA 2JA5B 2ZEPA 5FLXL 4MCPA 2EY5A 3PB6X 2PJ4A 3FPPA 1DOMA 2F8HA 3NTIA 3MAQA 1CP6A 4OC1A 2GLJA 2XVSA 1NSNS 1NAPA 3VR6A 2IL8A 3IL8A 3CU7A 2SDFA 4A3GB 1I50B 3PFOA 1LACA 3BDOA 4P4FA 3QIAA 5FOBB 5J1ZA 5JEAG 5JOBA 3RMHA 4H0LC 2EZVA 1RODA 4PXDA 1RD9D 4BY7B 1VMCA 2A68D 2XWJB 5HVFA 1T5XD 2ICIA 1CPXA 1A3UA 1BO0A 1GUSA 2QCPX 4ZYQA 3S16B 1I4XA 4MN3A 1RTNA 3V7ZA 1ET9A 1F9QA 3HGBA 4FF1A 4B08A 5KRUA 3WC7A 1HRJA 4KKSA 3GQBA 1DM0B 3NPPA 4ZKBB 5I9OA 3QOLA 4RHSA 2ICEC 3MZ5A 1WTOA 2K04A 1DJRD 2MP1A 1SNOA 1BAVA 1II3A 5C0XJ 3PB8X 3ND9A 3PUXA 2AQ3B 2NN6I 5FLXE 4A3BB 4KD4A 3J80L 2A6HC 1F9SA 1LAPA 5KYLA 1ZG8A 1Q8IA 1STBA 2E2IB 1G91A 4C3JG 5M3MB 1BCPC 1MD2D 2F0VA 2NYQA 5A2QL 1WD0A 3BYTB 3OMCA 1FGBD 2RVLA 1HCZA 3TMEA 2EY6A 2QKIC 3MFYA 1VCIA 1UEAB 5JPMC 4MMOA 2M00A 4A94A 2ZOGA 1J9OA 2QILA 5K8NA 1MSGA 3L3OC 1BF4A 3NH4A 1PYTB 3RBUA 3A55A 3S9NA 4CPAA 1I4QA 3VA5A 2VXWA 4R8IA 1U9RA 3RLFA 1IGBA 3FECA 3S9LA 1DOLA 5HVHA 3KBXA 3J80E 3BXMA 2EDGA 5FK9C 4BA1I 2EYMA 5DM63 4FXDA 5JAVA 4IUNA 4EQOA 1S4ZA 1K83B 2PZTA 5JEAJ 2ZXPA 2AWOA 3HZXA 1YW6A 1QMUA 3VH9A 4EQPA 2GA4B 5A2QE 3JAML 1UNSA 1PRTC 2JXMB 2X6GA 2K05A 1HFGA 3QNVA 1FNVA 1RDPD 1BPMA 3R93A 4LMQD 3UI2A 3GTMB 3PUZA 2HC9A 1ILPA 4CKBA 1SXTA 3V05A 3M4OB 4KKUA 4RCNA 1TWHB 4JYWA 1HPCA 1SEBD 2DNCA 3P1HA 4S3SA 2KUMA 3PUVA 3KHXA 3GO5A 1EEID 2PJ5A 1GUWA 1PTOB 3M7GA 2K33A 3QOJA 4P4JA 2C5CA 4CKEA 1XJOA 1H8LA 1EYCA 3VR3A 5I2XA 1IL8A 1SAPA 1BQQT 1DOKA 5DAUA 3TP8A 3LMSA 4XQJA 1W6JA 3TP5A 3VA7A 1XMBA 2KEDA 4RKBA 3T8WA 2WB1B 5F2DA 1QCBD 4F8MA 2F0LA 1MBYA 2PCFB 5D3IB 3WC6A 3FVLA 2EYFA 4U68A 3OHXC 3TZDA 4K6LA 2SEBD 5KNBA 3GB0A 4DYOA 4G4KA 3B2YA 4HEDA 5K5PA 2KCCA 2A69D 1D2BA 1A15A 1D5ZC 1E2ZA 2MUYA 1HEEA 1ELLP 4DXFA 4PXBA 4GZYC 2CF4A 1Y8OB 3GTJB 2NTSA 1OO9B 1SE4A 3SR1A 2AFWA 4R6TA 4OC2A 3TP7A 1X3QA 2ZXRA 5BN3A 4OC5A 4R9WA 5LYLA 1H9RA 4XQNA 2LFNA 2YU9B 4HCEA 4ZY1A 5K36H 1F2PA 4F88A 2DNEA 2PMZB 2RDFA 3MTSA 1GHJA 2WP8J 3IO1A 4OIWA 2PW5A 1TKHA 4PMCA 1LTBD 2E2HB 2BCOA 2KVMA 5ELDA 3H91A 1CP7A 2HUGA 4P44A 1UAPA 4OIDA 3DUZA 3KASA 3H6MA 1Y0RA 2AUKA 5JVG3 3WABA 1HXYD 1M4LA 3FEWX 4B9WA 1Y0YA 2J7ZA 4KY6A 1STAA 4DUKA 1PFMA 3CDXA 2WYRA 3KUPA 2OXPA 4TWEA 1SSOA 5C5LA 2R61A 5LHY1 3HOYB 2HDLA 1SE2A 2F7VA 3TSSA 3HEJA 1PZKD 2PIYA 3AMUA 1A3VA 5E4XA 2C6GA 3SI0A 1LT5D 4NGRA 3M3YB 3BDCA 3FKIB 5LRGA 3D8GA 4K2LA 3R8BA 5COYA 4NP5A 1EQTA 1TF9A 2V8GA 3MWYW 2NB0A 5CORA 3VR4A 2KOLA 3W2DA 1BBXC 2VL1A 1DONA 3N5FA 3NBHA 4IUTA 4A3JB 3B3VA 4H2KA 2LKVA 4MHNA 3NFZA 1EU4A 1EY9A 2RKSA 5D65A 3NH5A 2EJGC 4KI0A 3D6WA 2Q8RE 5IT9L 2SNSA 2XEGA 4UIBA 3IKJA 2H1EA 2A6ED 3LWEA 1PCAA 2NSMA 3PB9X 1YMEA 2EK8A 5CYUA 4QIWB 1NCVA 3W3AA 1YNNC 4G7ZC 4C3IG 4A37A 1EIHA 5LYFA 3URYA 1IKMA 3GD7A 1KAAA 2MPMA 3OMGA 3K0YA 4BWGB 4KY5A 1IW7C 2C1CA 3D4WA 4ZUJA 3T53B 4OO1H 1MI2A 3CPXA 1LLRD 2EJFC 2IW3A 3BS1A 2F0QA 5JGFA 1XWEA 1NUCA 4F9VA 1JOOA 2R93B 4QCLA 2ZEHA 2LS01 1EY0A 4C2MB 5I4MA 1V43A 3NE5B 2F0FA 3HUVA 1F57A 5T1GA 3I4NB 1JQGA 4PXCA 2B2YC 1HDUA 2E75C 4A3DB 5IT9E 2PCUA 4FF4A 4A3KB 5E4WC 2YYZA 5FKAC 1TWCB 3SK8A 4LAAA 3FEDA 3I1UA 3FJUA 3E6ZX 1EYAA 4OC0A 4MRIA 2RQXA 4ZAIA 1VGYA 1Q1EA 3I4LA 4HAEA 4L6TB 1HDQA 6CPAA 1IKLA 2E76C 3K5LA 4PPZA 4ZX9A 1F2MA 5LL6X 2Z4IA 5I9PA 3KGQA 1H9SA 3SJXA 5M5YB 1M8AA 5CR3A 1KABA 4P4BA 5NUCA 4N9PA 1GYTA 2PNRC 1PTOC 2AFZA 3RZOB 1GHKA 3S9WA 1QNUA 2JE6I 2SOBA 4WFN3 1TXRA 3HRZC 3R3OA 4C1NI 4CKCA 4QB4A 1EY7A 2PO4A 1TY0A 2D2CC 2CHBD 4JK1C 4NGQA 4RA8A 4MCSA 1GXDC 1PXUA 4KN7C 5C4HA 3MXNA 1STHA 2B2VC 3KF8A 4G7HC 1LTGD 1Q3LA 4M1UB 2M2LA 1O80A 2ZEDA 1YSJA 3I3CA 5IOCA 1B9NA 1I6VC 5BN4A 3MXPA 1QOHA 3A54A 2PJ7A 1KDCA 1CQVA 1S5FD 4K2KA 3PRTA 3VR5A 4TRDA 1PLFA 5EGTA 4PQAA 1A3TA 4HSPA 2NZ1D 4K6DA 3C46A 2F0HA 1TVXA 2F0PA 3BI0A 1SJED 4RWSC 2AFSA 1GJXA 3DEOA 3D6CA 5JEAH 1VDZA 1JC7A 1R3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C6P A;  3FEC A;  3S9L A;  3V38 A;  5HVH A;  3AB9 A;  3BXM A;  2EDG A;  4BA1 I;  4ZY2 A;  1B9M A;  1ZYR C;  1CBX A;  1Z2L A;  1IYU A;  3M4Y A;  2ZEN A;  1ZKO A;  2AUJ D;  1IY7 A;  2AWO A;  2EJM A;  1YW6 A;  1QMU A;  4LQG A;  3VH9 A;  2V4D A;  1CX8 A;  3D4R A;  2PJ6 A;  1FT7 A;  2R6G A;  5LYD A;  4NFR A;  3PUW A;  4JZ0 A;  3FEE A;  2JXM B;  3QNV A;  2ZOF A;  3N6R A;  1BPM A;  3KR5 A;  4Q7A A;  3KQX A;  4DJL A;  5JH9 A;  3BG3 A;  2FVG A;  4NGT A;  1Z5R A;  3OOC A;  4EFD A;  1QQ9 A;  2ZEO A;  3EQL C;  3PUZ A;  5K36 G;  2HC9 A;  4NJQ A;  5F09 A;  2PJ8 A;  1TU2 B;  4NGN A;  1DTD A;  4KKU A;  4ZI6 A;  4RCN A;  1K8O A;  4BD9 A;  4JYW A;  1HPC A;  1LAN A;  2ZT9 C;  2BDO A;  2DNC A;  1Z8L A;  5K8P A;  3U9S A;  5C0X H;  4OC4 A;  4W9Y A;  3DXJ C;  3PUV A;  2V77 A;  3KHX A;  3I72 A;  3P20 A;  2PJ5 A;  4KSI A;  2Q51 A;  4AXV A;  1H9J A;  3KZW A;  2K33 A;  2Q43 A;  2AFO A;  3IIB A;  4H44 C;  2PVV A;  4P4J A;  4ZY0 A;  2POK A;  3IEH A;  1XJO A;  2QF7 A;  1ARL A;  4WWV A;  2XEI A;  1TKF A;  4EWT A;  3VAR A;  3S9M A;  1K8M A;  1H8L A;  3VR3 A;  2D5D A;  2NN6 G;  3SI1 A;  1OBR A;  1CI3 M;  2V8H A;  3QJY A;  3D4U A;  1Y69 U;  5CBM A;  1BDO A;  3TX8 A;  3LMS A;  2CTC A;  2V8D A;  3VA7 A;  4OME A;  1XMB A;  2QYV A;  1DCZ A;  1VF7 A;  2O53 A;  1OXV A;  4YU9 A;  4H13 C;  3I73 A;  3KI9 A;  3CPA A;  3KLR A;  2ZEF A;  3H8G A;  2ZEM A;  4OC3 A;  3T8W A;  1Y8P B;  3FH4 A;  2ZEE A;  2PCF B;  4TNU A;  3WC6 A;  3FVL A;  3D7G A;  3IJ3 A;  3NA6 A;  2AFX A;  5KNB A;  4NGS A;  2PJA A;  3H8F A;  4NJR A;  1E2W A;  3GB0 A;  4DYO A;  1ONL A;  5JM6 A;  3B2Y A;  3PFE A;  5LYI A;  4IFD H;  3D7F A;  3RZA A;  3ND8 A;  2PRQ A;  2B8G A;  1O78 A;  2IQ6 A;  3PB4 X;  2DEA A;  2KCC A;  1OXS C;  1Z6H A;  2A69 D;  2RB7 A;  1E2Z A;  4KHZ A;  4FUU A;  1YW4 A;  1HEE A;  1ELL P;  4L8J A;  4PXB A;  1Q1B A;  4X8I A;  4GZY C;  2CF4 A;  3WT4 A;  3VAT A;  1BLL E;  2WZN A;  1Y8O B;  4RUH A;  3JRU A;  5D8N A;  3A7L A;  1XRY A;  4OKO A;  3QG1 A;  2AFU A;  2IJZ A;  4X3R A;  1Y7E A;  2AFW A;  3T51 B;  4R6T A;  3M85 A;  1F2O A;  4UEZ A;  3SE0 A;  4OC2 A;  4IHM A;  2JEB I;  4XTC S;  2BA1 A;  5BN5 A;  4BA2 I;  3B7I A;  1PMR A;  4PXE A;  1FR3 A;  5BN3 A;  4A38 A;  1OXU A;  4OC5 A;  5LYL A;  1H9R A;  2A69 C;  2I3C A;  1KWM A;  1XBU A;  2IT1 A;  4IQZ A;  1DD2 A;  3KL9 A;  4ZY1 A;  1GUT A;  2KA7 A;  4JBW A;  5K36 H;  3D67 A;  4WJB A;  4IAV A;  1F2P A;  2DNE A;  1OXT A;  4NGM A;  3D68 A;  1LFW A;  3CRL C;  3OW7 A;  3HLP A;  3B3S A;  1GHJ A;  3IO1 A;  2K7V A;  4OIW A;  5D29 A;  1TKH A;  5THW A;  1AYE A;  2BCO A;  4P4E A;  5HVG A;  7CPA A;  2RFH A;  4P4D A;  1GUO A;  4FAI A;  2ABZ A;  1CP7 A;  1GUN A;  4P44 A;  4MXU A;  1CTM A;  4OID A;  5LRJ A;  5J1Q A;  1TKJ A;  5ELY A;  2NN6 H;  5KNC A;  3D7D A;  3KAS A;  1Y0R A;  2AUK A;  3DLJ A;  3NH8 A;  3WAB A;  5HXD A;  3KQZ A;  5CPA A;  1M4L A;  1Y8N B;  1Y0Y A;  3PEI A;  4OO1 G;  4DUK A;  3CDX A;  2WYR A;  4UEE A;  4TWE A;  1VHO A;  3SI2 A;  4TKO B;  4NGP A;  1ZG7 A;  1DE4 C;  3K2K A;  2F7V A;  4UEF A;  2PJ9 A;  3LNN A;  4F8Z A;  2PIY A;  2BA0 A;  4K3N A;  1SMY C;  2G9D A;  4X2T A;  2JBJ A;  2EVB A;  2C6G A;  3SI0 A;  2D62 A;  3A7A B;  2K32 A;  4NGR A;  4UIA A;  3DGV A;  4LK1 C;  3IFE A;  5LRG A;  4P4I A;  3BI1 A;  1LOK A;  3SJF A;  1ELM P;  1TF9 A;  2JBK A;  2V8G A;  3MXU A;  1CPS A;  1FNO A;  3VR4 A;  4KMU C;  8CPA A;  1ZG9 A;  2VL1 A;  4DNT B;  4B6Z A;  1YLO A;  3N5F A;  3OPO A;  4YWY A;  2PJ3 A;  5IB9 A;  3D7H A;  3IFT A;  4EME A;  2ANP A;  1H9M A;  3B3V A;  4H2K A;  3PUY A;  3L7Z C;  2C6C A;  2Q8I B;  1XFO A;  3B35 A;  4MHN A;  2PIZ A;  4P6Y A;  3NFZ A;  4DNR B;  4P45 A;  2BE5 D;  4ONW A;  1DXM A;  3NH5 A;  1Z7T A;  2EJG C;  4KI0 A;  2IMO A;  1HTP A;  3SJG A;  5C0X G;  1A6X A;  3VR2 A;  4UIB A;  2XEG A;  4G1P A;  3IKJ A;  3FF3 A;  2A6E D;  1IW7 D;  2OOT A;  1PCA A;  3MRU A;  2NSM A;  2O4H A;  3PB9 X;  1NSA A;  5A35 A;  1YME A;  1EE3 P;  2GRE A;  4R76 A;  1H9S B;  3FX6 A;  2CTB A;  2EK8 A;  1G29 1;  2O5J C;  3D31 A;  3K9T A;  3W3A A;  3L2N A;  1LAB A;  1YNN C;  4G7Z C;  3A8I E;  4A37 A;  4HR7 B;  3H8E A;  4IK2 A;  3IC1 A;  5LYF A;  2CIJ A;  4TQU S;  4MHZ A;  4XIG S;  2BE5 C;  2V8V A;  2E74 C;  4MHY A;  3PBB A;  1O7L A;  3GD7 A;  1TF8 A;  1QJO A;  3B3T A;  2PJ0 A;  2L5T A;  2A6E C;  2PJ1 A;  3PB7 X;  1IW7 C;  2C1C A;  2BOA A;  3TC8 A;  4F9U A;  1ARM A;  3T53 B;  4OO1 H;  3B3C A;  3CPX A;  1R43 A;  3T56 B;  2EK9 A;  3ISX A;  2ZEL A;  2EJF C;  5LRK A;  1Q12 A;  5DS0 A;  5K8M A;  4OGQ C;  2QVP A;  5JGF A;  3M7N A;  2CW0 C;  2OR4 A;  4UF4 A;  4F9V A;  3TZU A;  1UWY A;  3WDN A;  2ZEH A;  3ISZ A;  1YNJ C;  1LAM A;  5K8O A;  5I4M A;  1TKW B;  1V43 A;  3NE5 B;  1H9K A;  3HUV A;  2ZEP A;  4ZX8 A;  1Q90 A;  1F57 A;  2PJB A;  4MCP A;  3PB6 X;  2PJ4 A;  3FPP A;  2F8H A;  1JQG A;  3A8K E;  3D66 A;  4PXC A;  4R8F A;  1E2V A;  1HDU A;  1CP6 A;  2E75 C;  2GLJ A;  3FMC A;  4OC1 A;  3WC5 A;  4DK0 A;  4MCR A;  2PCU A;  3RAM A;  4A39 A;  3GLJ A;  2YYZ A;  4KKT A;  3VR6 A;  2JEW A;  2QJ8 A;  2PVW A;  3FED A;  2HB6 A;  3I1U A;  3BHX A;  1VIX A;  3FJU A;  3PFO A;  1LAC A;  3BDO A;  2GLF A;  4P4F A;  3QIA A;  3A8J E;  4OC0 A;  4MRI A;  4FBE A;  1ZLI A;  5JEA G;  1GUG A;  4H0L C;  2AFM A;  2XEF A;  2BO9 A;  1CG2 A;  4PXD A;  1T5E A;  1VGY A;  1Q1E A;  3I4L A;  2A68 D;  5HVF A;  1CPX A;  1HDQ A;  6CPA A;  1GUS A;  4R7M A;  3B3W A;  4ZYQ A;  2E76 C;  4PPZ A;  5KND A;  2A6H D;  2LMC B;  4ZX9 A;  1BPN A;  3SJE A;  3V7Z A;  3HGB A;  3CRK C;  3PBE A;  3KGQ A;  3WC7 A;  1H9S A;  1VHE A;  3SJX A;  4KKS A;  3GQB A;  4DK1 A;  4P10 A;  3KR4 A;  2Q4Z A;  3PV0 A;  4P4B A;  1BAV A;  1GYT A;  3MN8 A;  2PNR C;  2AFZ A;  1CFM A;  2A68 C;  3ND9 A;  1GHK A;  3PUX A;  3PB8 X;  2NN6 I;  4LJZ C;  2JE6 I;  1TXR A;  3CT9 A;  4I7Z C;  4MHP A;  2A6H C;  3IWW A;  4GM5 A;  1LAP A;  3SDZ A;  4KN4 C;  1ZG8 A;  2EWB A;  2D2C C;  3LWU A;  1LCP A;  2PJ2 A;  4JK1 C;  4NGQ A;  2ZEG A;  4MCS A;  4KN7 C;  1AMP A;  2NYQ A;  4OP4 A;  1HQM C;  2GU2 A;  1Q7L A;  3H94 A;  2XEJ A;  2O5I C;  1HCZ A;  4MCQ A;  2JEA I;  4G7H C;  3GUX A;  4FWU A;  2PPB C;  1OXX K;  3MFY A;  1VCI A;  2PJC A;  1V8Q A;  2F1M A;  2ZED A;  1YSJ A;  1B9N A;  4MMO A;  1I6V C;  4Z65 A;  5BN4 A;  4A94 A;  2ZOG A;  1FYC A;  2PJ7 A;  1VF5 C;  3KHZ A;  3PRT A;  3VR5 A;  2PE3 A;  5K8N A;  4PQA A;  4PV1 C;  4O23 A;  2B8F A;  3NH4 A;  1PYT B;  2J9A A;  3RBU A;  3BI0 A;  1EWH A;  4G7O C;  3S9N A;  1IYV A;  2DN8 A;  1RTQ A;  2AFS A;  1GJX A;  4CPA A;  1ZLH A;  5JEA H;  1VDZ A;  3RLF A;  1IGB A;  1R3N A;  4IFD G; 
#chains in the Genus database with same CATH topology
 2C6P A;  2UUB Q;  2CFM A;  2ZW7 A;  4KLK A;  3LOD A;  3PGZ A;  3K7A H;  3K58 A;  4IFD I;  3JTK A;  1CKN B;  1PDQ A;  4A3I G;  1I94 Q;  3HOU G;  2DXQ A;  3T4A C;  2JJQ A;  1IHZ A;  1ZYR C;  1I4H A;  1RHP A;  4ORF A;  1Z2L A;  3D0F A;  3RD4 A;  2UXB L;  1IYU A;  3M4Y A;  4ILW A;  1ENF A;  1LT4 D;  5DNF A;  2FXQ A;  4LQG A;  1V1P B;  2V4D A;  4F7X A;  4BBS B;  3DLL A;  2VUM G;  3H5Z A;  3H0G G;  2PJ6 A;  5M5Y H;  1JMC A;  3PQI A;  1VMP A;  2YV5 A;  3PUW A;  4NFR A;  2DPT A;  4JZ0 A;  5GAE C;  4IN3 A;  4DV0 Q;  4LFB L;  3SXO A;  3FPU B;  5AJ3 Q;  5BR8 L;  1P0H A;  3RZO H;  3RUZ A;  1TWA H;  4Q7A A;  2FMM A;  1JWQ A;  1EOV A;  4NXM L;  3BG3 A;  3BZD B;  2FVG A;  3OOC A;  3H3V C;  3Q0A A;  1PH8 A;  4EFD A;  3RN2 A;  2UUC Q;  4NJQ A;  1UEB A;  5TSS A;  2VQE Q;  5F09 A;  2WPW A;  1EY5 A;  3S15 B;  2B63 H;  4YCW A;  2FIA A;  5EBC A;  4HCS A;  4J3G A;  5EPJ A;  4OO1 I;  4JJX A;  4DR1 L;  3HKZ G;  4OC4 A;  2ZW4 A;  1K3R A;  1S5E D;  4C3J H;  2Z6K C;  3CZX A;  5EBD A;  2F0M A;  4AVA A;  5JJL A;  1TXY A;  1FVI A;  2Q43 A;  4U9Z A;  2PQ8 A;  3IIB A;  4H44 C;  4JI3 L;  1WYD A;  3ZYY X;  1N8R C;  3TO7 A;  2POK A;  1NR2 A;  1RTO A;  4YGO A;  3CME A;  1ARL A;  4WWV A;  2XEI A;  1MJA A;  1TKF A;  4JI8 Q;  5I0C A;  2EOT A;  4ULL A;  3S9M A;  1JJC B;  3VAR A;  4JBM A;  2P6G A;  4OIK A;  2D5D A;  3K9U A;  4MFL A;  4BY1 G;  3PIO 3;  2C27 A;  3CKI B;  1P4N A;  5CV4 A;  2WKD A;  3HOW H;  3S14 B;  2JA9 A;  3QJY A;  3LD2 A;  1ASZ A;  4XYQ A;  3BZK A;  4XPK A;  3IFD A;  2KCN A;  4FXK C;  4YWL A;  2VQF Q;  2QYV A;  3KJO A;  1DCZ A;  1VF7 A;  2F0W A;  2O53 A;  2I46 A;  1OXV A;  4KLW A;  4L5R C;  3KK7 A;  4DR7 Q;  1QNK A;  3KI9 A;  3CHB D;  3CPA A;  3KLR A;  4Q5V A;  2E8G A;  2YNC C;  2ZEM A;  4X64 L;  4RFB A;  5J8C A;  1PH3 A;  3RZD H;  2IHE A;  2X6L A;  1I6H H;  4AG9 A;  1U4P A;  3IJ3 A;  3DWQ A;  1HJP A;  2AFX A;  2A5H A;  4HSV A;  4NDX A;  2PJA A;  1E2W A;  4R4T A;  2B2Y A;  1ONL A;  1X55 A;  3PFE A;  1LTA D;  3D3S A;  1UE1 A;  3D7F A;  3RZA A;  2F0D A;  1QUQ B;  2B8G A;  4CJ0 B;  4WOR A;  1CUK A;  3PB4 X;  3AYH B;  1Z6H A;  4KHZ A;  2Q7B A;  5LMN L;  1GHE A;  2N49 A;  3R95 A;  3J80 i;  3WT4 A;  2EY2 A;  3LX0 A;  3S1N H;  1BLL E;  4B11 A;  1ICW A;  3I8Z A;  4IAL A;  4DKA C;  4XQQ A;  3EC4 A;  4RUH A;  4IPD A;  3G3S A;  3A7L A;  4OKO A;  3Q22 A;  3QG1 A;  2IJZ A;  4DNI A;  1LM0 A;  1PZI D;  3T51 B;  4DFA A;  4EVY A;  4UEZ A;  5FO9 B;  1HUM A;  4LWC A;  4JYA Q;  4IHM A;  3V8I A;  1STN A;  4BA2 I;  4DXG A;  3B7I A;  4FXG C;  1U6M A;  4I49 A;  2F3V A;  1WTR A;  4APV A;  2MO0 A;  3FB3 A;  1XBU A;  4JI6 L;  2IT1 A;  3SEB A;  1KNA A;  4JV5 Q;  4K0K L;  5G21 A;  3TS2 A;  4V0B A;  3D67 A;  3S15 H;  4WJB A;  3S1R B;  2TSS A;  1SYF A;  5JJK A;  2K5N A;  1OXT A;  2F4V Q;  2AQ1 B;  3OW7 A;  4JXQ A;  1SND A;  3K81 C;  3HOV H;  2WFW A;  1BXT A;  1EFI D;  3F8K A;  3TCV A;  1G2S A;  4MY3 A;  1RJT A;  5THW A;  1QE6 A;  2Z8L A;  3X3N A;  1AYE A;  2QIR A;  1I3Q B;  1EY6 A;  5ISR A;  1MGS A;  1YIT A;  2JDD A;  4P4E A;  1KTK A;  1X32 A;  3S2H H;  4GLA C;  2HCC A;  3PF4 A;  2NUC A;  1ESF A;  4P4D A;  1D6E C;  1A8V A;  2PC1 A;  2ABZ A;  1QWY A;  2EYP A;  2B4B A;  5I4D A;  4M6G A;  5F49 A;  3CCJ A;  2ATW A;  1YHA A;  3CP0 A;  4EX5 A;  2JA5 G;  5IYC H;  1K73 C;  3J7A 5;  1S3O A;  1I4R A;  3TS0 A;  1UE5 A;  3J81 L;  3F5B A;  3DLJ A;  1BCP F;  3P2H A;  3C3L A;  3STB C;  3MC0 B;  1NTG A;  1K8G A;  1Y8N B;  3MA2 B;  4BBR H;  2B2V A;  4UDU C;  2EUI A;  1NY4 A;  4R4C A;  2B2W C;  1BO4 A;  1MSH A;  2GIV A;  3NWT A;  4A3E H;  1VQI A;  4CBV A;  3OIP A;  4HTH A;  2OEO A;  3CQZ H;  3NTK A;  4TKO B;  4DU9 A;  3F2D A;  3D8P A;  1ZG7 A;  1S5C D;  2XSC A;  4XPL A;  4DN4 M;  2RSN A;  2VQY A;  3D4D A;  4GN5 A;  1EIY B;  2BA0 A;  1JOR A;  1SMY C;  2G9D A;  2I00 A;  4P2C B;  4BY7 G;  1GOZ A;  3PMF A;  4DAM A;  1WD1 A;  4ODG A;  2K32 A;  4UPA A;  4CGL A;  4PZ6 A;  4LK1 C;  1HNZ Q;  1EQV A;  4DF7 A;  4L5S A;  4FVM A;  3SJF A;  1K28 A;  1B2T A;  4GS3 A;  2REF A;  3ERO A;  1CHP D;  1PH1 A;  4PNY A;  1YQE A;  1A2T A;  3HOX G;  3S17 H;  2ZXO A;  3MXU A;  1KUX A;  4FNF A;  3FRP B;  1WTW A;  3H4Q A;  1AN8 A;  2RA4 A;  2B5G B;  1XNQ Q;  1EY8 A;  2A19 A;  4IO9 A;  2E2J B;  2J4X A;  3OTO Q;  1IBL L;  4N9T A;  1J8I A;  5CBE E;  3MEH A;  3CXQ A;  4DNT B;  3CCU A;  1CA6 A;  1YLO A;  2ASB A;  5DM7 3;  3U4Z A;  4GOP C;  4GKJ L;  4EGV A;  5IGB A;  3JAM E;  2PJ3 A;  5IB9 A;  4U5Y A;  2MGS A;  3IFT A;  5IYD G;  4FDB A;  1Q81 C;  4EME A;  4A3B G;  1YI2 A;  1O7I A;  1QG7 A;  3NK9 A;  1SJH D;  4RCO A;  3TN2 A;  1ASY A;  4DR5 L;  2MJ8 A;  2JA7 B;  2LXK A;  4Z9C B;  3K6O A;  4P6Y A;  1ZXT A;  4P45 A;  2IJ0 A;  4ONW A;  1DXM A;  5IE8 A;  1X56 A;  1CHQ D;  1M1D A;  1J6Q A;  4Q36 A;  2JA6 H;  3L9A X;  1PRT F;  1AZP A;  2WAQ G;  1IBM L;  1N33 L;  5M3M G;  3HOZ H;  4NXY A;  4G1P A;  4HID A;  1JB3 A;  1Q2D A;  1EL0 A;  1SNP A;  2OOT A;  4OEL B;  2QEJ C;  4K5W A;  2GRE A;  2CTB A;  4YY3 Q;  1VQM A;  3K9T A;  1BOS A;  5H1S E;  4LFC Q;  3L2N A;  4CRZ B;  1JWU D;  4OIJ A;  4JCV E;  2CIJ A;  2FJ2 A;  2GAN A;  4NXN L;  1W6K A;  2O4X A;  4TQU S;  4A3C G;  1IBK Q;  4JI0 L;  4MHZ A;  2BE5 C;  2E74 C;  5J22 A;  2L15 A;  1HR0 L;  5FLM H;  3PBB A;  1YNJ D;  2L1B A;  4C3H G;  1Q86 C;  1XMT A;  4K30 A;  2FSR A;  3GDE A;  1VQ4 A;  4ME3 A;  3ONA B;  1TF8 A;  1QJO A;  1EEF D;  3B3T A;  2ES2 A;  4H89 A;  3ITP A;  2Z6K A;  5ELF A;  5C3E B;  5IB0 A;  4MFK A;  3BJ7 A;  1XXG A;  5ELC A;  4CDF C;  4RGM A;  5HMN A;  5GQO A;  1R43 A;  3ISX A;  2Q8T A;  2ZEL A;  1YHQ A;  1Q12 A;  1EYD A;  1X10 A;  4XYO A;  2Q04 A;  5CC4 A;  2Q7S A;  4K8I A;  1G51 A;  2E5L Q;  4OGQ C;  4KOW A;  1SRO A;  3D3R A;  1TT2 A;  2CW0 C;  3I90 A;  2OR4 A;  5GRO A;  4DR6 L;  4YIJ A;  3L0O A;  4P75 A;  1WTX A;  4L8A A;  4HPS A;  4GLV B;  3WDN A;  2K5D A;  3VYU A;  4DV5 L;  3ISZ A;  4B5O A;  3EVQ A;  5K8O A;  2QML A;  3TFY A;  1S60 A;  4ZX8 A;  5IIF A;  3I4M B;  1Q90 A;  3N52 A;  3U50 C;  1C4Q A;  3KLW A;  2K6A A;  5G3L F;  3D66 A;  4R8F A;  1LUZ A;  2N78 A;  4DK0 A;  4MCR A;  2J8M A;  3RAM A;  4DAP A;  2F0K A;  2QW7 A;  3MXG A;  3GLJ A;  4XT1 B;  4KKT A;  3NEL A;  1STE A;  3FP9 A;  4ZUI A;  2E2J H;  3VWE A;  3BHX A;  4KUB A;  3DNS A;  2NVT H;  2ZM6 Q;  2DPS A;  4KLV A;  4J15 A;  2J8R A;  1KXL A;  3A8J E;  1JWS D;  4M85 A;  4FBE A;  1ZLI A;  3PO3 H;  1K0S A;  2D0P A;  1GUG A;  1HZ9 A;  5EKK A;  2XEF A;  3GV6 A;  4C2Y A;  3CCE A;  2BO9 A;  3FHW A;  3C1E A;  1RO5 A;  1PH2 A;  4KOT A;  4A93 G;  1FD7 D;  2PMZ E;  1VHS A;  3QB8 A;  4QUF A;  4GKK Q;  3EBE A;  1J4J A;  3IAY A;  3B3W A;  1Z9U A;  5KND A;  1EQQ A;  3GTP H;  2A6H D;  3EJI A;  2LMC B;  2QDL A;  2YTX A;  1LRZ A;  3I70 A;  4XPD C;  3ER0 A;  1SFO H;  5E7N A;  4JI2 Q;  2HT1 A;  2EYO A;  3H09 A;  5AFW A;  1MJB A;  2GVB A;  3PBE A;  5E3F A;  1JQY D;  1BCP D;  1EWC A;  4P10 A;  1X54 A;  3KR4 A;  4J1M A;  1YJN A;  1QSN A;  2Q4Z A;  3PV0 A;  3NWS A;  2EIF A;  1TR5 A;  4C3I H;  1CZW A;  1EOT A;  2MHV A;  4XXE A;  4DUY Q;  1EFW A;  4IPG A;  4R1J A;  3MN8 A;  3Q23 A;  1CFM A;  2A68 C;  3CXS A;  1SBB B;  4LJZ C;  2R92 B;  2F03 A;  2R8V A;  3CT9 A;  4A3F B;  4I7Z C;  4ONU A;  1SYG A;  1MHW C;  2H4O A;  4ZKC B;  1CA5 A;  3S1M B;  1PZJ D;  5LL6 S;  4GM5 A;  3KDF A;  3SDZ A;  4FO2 A;  4KN4 C;  2VS1 A;  4PQX A;  2EWB A;  2XGT A;  3TBI B;  3IU2 A;  3NEM A;  2WB1 G;  3LWU A;  4YHH L;  2PJ2 A;  4UCN A;  5KTC A;  3WOE A;  3I7F A;  1J5E L;  1SNQ A;  2QA4 A;  2OZU A;  2GU2 A;  4CGO A;  1Q7L A;  3H94 A;  2Q44 A;  2RSO A;  2O5I C;  2XEJ A;  1ZEQ X;  2WKC A;  3EFA A;  2UXC Q;  1WJJ A;  4PMW A;  1Q2C A;  1AFP A;  3ZJ0 A;  2KHS A;  4KJN A;  3ULJ A;  3MGD A;  4DA2 A;  2B2T A;  3IU1 A;  3NE7 A;  3I4M H;  2HDM A;  1V8Q A;  5EKL A;  2F1M A;  1HNW L;  2Q4Y A;  3GTK B;  2B2W A;  4E8O A;  4DV4 Q;  4Z65 A;  1E0B A;  3PIO A;  2AHO B;  1KRT A;  4KOV A;  3J7Y W;  3RNU A;  1FYC A;  4JBJ A;  2E2D C;  1VF5 C;  3KHZ A;  1XTC D;  2PE3 A;  4CJ2 C;  1KDA A;  1UE7 A;  1WCM B;  2HCI A;  4GNX B;  2FFK B;  4O23 A;  1D8L A;  3FVQ A;  2B8F A;  3A56 A;  4HMI A;  1Z8W A;  4LF6 Q;  5EJW A;  2FXF A;  3HG9 A;  4G7O C;  4JG2 A;  5FJ8 H;  1GKH A;  4OLL A;  1RTQ A;  1XPO A;  2L0C A;  3GIU A;  2CCZ A;  3CC4 A;  2EYJ A;  1PRT D;  5H84 A;  5GAD C;  3EFX D;  2R7F A;  4MIU A;  2FIW A;  1IOF A;  2XWB B;  5EBV A;  4IFD G;  3CW2 C;  1VQP A;  3P75 A;  3RYO A;  4FP5 D;  1A2Z A;  4V19 0;  4PSW A;  4XT3 B;  4H02 A;  2VXK A;  3R2I A;  1YZ6 A;  5CBA E;  4IPH A;  3NHH A;  2I5L X;  1CBX A;  3OIQ A;  1XJV A;  2NVQ H;  4IOC A;  4NCZ A;  3W6X A;  4GOP A;  2ZEN A;  1TWF H;  2AUJ D;  4N8X 1;  2F0O A;  3Q8D A;  2CQA A;  1AP0 A;  5CV9 A;  3PIP 3;  2IWH A;  1LTI D;  2JP1 A;  3H0G B;  1SN8 A;  4FYD A;  5LYD A;  3FEE A;  5KEE A;  4KTA A;  5C88 A;  2ZOF A;  2R7Z G;  3N6R A;  1X3E A;  3GTO B;  4DJL A;  4B3R Q;  3J7A F;  4A3F H;  4NGT A;  2Q2T A;  2CQO A;  1Z5R A;  2ZJR A;  1QQ9 A;  2JEV A;  2ZEO A;  1EY4 A;  2I0Q A;  3MVV A;  1VQ9 A;  3G48 A;  3K7A B;  4IUU A;  5KYI A;  2JA8 H;  1DTD A;  1STG A;  4NGN A;  4ZI6 A;  1K8O A;  2BDO A;  1Z8L A;  5K8P A;  2OQ0 A;  1SYD A;  3U9S A;  2FE7 A;  4GN4 B;  5C0X H;  4A3M H;  4W9Y A;  1C7Y A;  4CRY B;  2NYZ D;  1BKB A;  3P20 A;  4X3S A;  4OXP A;  4KSI A;  1LTT D;  3KOJ A;  4JI4 Q;  1H9J A;  2F0S A;  1B53 A;  4RGO S;  5IP7 H;  5G3L D;  4DV7 Q;  3SXH A;  5IWA L;  2AFO A;  3FDT A;  5JPN C;  3PGP A;  2FHT A;  3GTQ B;  1VS0 A;  3FKI G;  5KIX A;  1B50 A;  3DDD A;  5EAY A;  2AMC B;  1TS3 A;  5ELE A;  2YND A;  4EWT A;  1P16 A;  4NMZ A;  1KUV A;  1L2F A;  1K8M A;  3NTH A;  4QUC A;  4DV2 Q;  2NN6 G;  3SI1 A;  4QF4 A;  1LV9 A;  1TWA B;  2V8H A;  3DSB A;  4BY1 B;  3WOF A;  4IUQ A;  3G8W A;  1Y69 U;  1XMO L;  1BBU A;  1PFS A;  3TX8 A;  5C44 H;  4LF7 Q;  2OWO A;  1XF8 A;  4LUO A;  4OME A;  2KCM A;  4E6I A;  1HA6 A;  1QZH A;  2B63 B;  4YU9 A;  3BDL A;  1YHB A;  1WCM H;  4OX9 Q;  3H8G A;  1SE3 A;  2BDN A;  1Y1V H;  4OEM B;  1Y8P B;  3C26 A;  1U4M A;  5C4J H;  1VQE A;  1M4I A;  3FH4 A;  4C3J B;  2ZEE A;  3RNZ A;  4CGY B;  1RCV D;  2GFQ A;  4A3J G;  3J7A V;  3D7G A;  3NA6 A;  1STY A;  2I79 A;  1TII D;  2EXZ A;  4DAY A;  3PO2 G;  1M44 A;  3H8F A;  4NGS A;  1D1K A;  4EVO A;  3LGJ A;  4DUZ L;  1L1O C;  1O7Y A;  1C48 A;  2NVX H;  1YK3 A;  3ND8 A;  2UXB Q;  1JJG A;  3T1Y L;  1O78 A;  1NE9 A;  2DEA A;  3J81 c;  2RB7 A;  2N3S A;  4A3I H;  3HOW B;  1I12 A;  4R9M A;  3HOU H;  4A3L G;  1PFN A;  2EY1 A;  4YCV A;  2K28 A;  1C8C A;  2BH2 A;  1YW4 A;  1W3S A;  4L8J A;  3UDF A;  3G6E A;  1NMT A;  4CDD C;  4X8I A;  2R98 A;  1VQA A;  2WZN A;  3S24 A;  1CKM A;  3JRU A;  3T1H L;  2P6F A;  4OL7 A;  3SGI A;  2AFU A;  2OH1 A;  1LTR D;  4LFB Q;  4X3R A;  2MO1 A;  2F4I A;  4IFD J;  1JOQ A;  1F2O A;  2ARH A;  2VUM H;  3H0G H;  2YTV A;  2Z3L A;  2BEI A;  2J0T D;  4XTC S;  3DWP A;  3RZD B;  5BN5 A;  1A63 A;  1I6H B;  1IYL A;  5ELN A;  4PXE A;  5C5M A;  4A38 A;  1WK4 A;  1HZC A;  5M5X H;  3I56 A;  2PW7 A;  2A69 C;  3CC2 A;  5C4X G;  4H6U A;  1PFB A;  1KWM A;  2ZJP A;  4L89 A;  1WTV A;  1PVO A;  1DD2 A;  3KL9 A;  4X66 Q;  1QVC A;  5ISV A;  2KA7 A;  3OWF A;  1JCK B;  4IAV A;  3T90 A;  2PQA B;  1XMQ L;  3D68 A;  3FXT A;  2NVY B;  4YWK A;  3CRL C;  1LFW A;  3F2U A;  3HLP A;  2C35 B;  1VQ5 A;  3B3S A;  5HGT A;  2K7V A;  1JT8 A;  1EU3 A;  3S1N B;  3SHP A;  5LMU L;  4AVB A;  1A62 A;  2X7B A;  1HNX L;  1PTO F;  2NTT A;  1LTS D;  2GVA A;  2KQ3 A;  2R93 G;  2RFH A;  7CPA A;  5HVG A;  1PH9 A;  1GUO A;  3DM3 A;  2DY8 A;  3DM1 A;  3GTQ H;  2FCK A;  2WPX A;  1S5D D;  4CDC C;  3H15 A;  1AH9 A;  1GUN A;  2I5H A;  4PZ7 A;  4MXU A;  1KD1 C;  3I4N G;  4A33 A;  2VW9 A;  1IXR A;  5LRJ A;  1TKJ A;  5ELY A;  2PZW A;  5I2Y A;  5KNC A;  3D7D A;  3FYN A;  4BY1 H;  4A30 A;  4RS2 A;  4A3D G;  5HXD A;  2DF5 A;  4NW2 A;  4K5X A;  3KQZ A;  5CPA A;  2OT2 A;  4X64 Q;  4O0A A;  2CVR A;  3K8A A;  3K57 A;  1SYE A;  4A31 A;  1JR0 D;  3PEI A;  2EYL A;  1X6O A;  1AE3 A;  3UY5 A;  4IUR A;  1HQR D;  2KHI A;  2K5W A;  2EYH A;  4G57 A;  3K5N A;  4GLX A;  5AGE A;  3HOV B;  4Y52 H;  4KOU A;  1EZ8 A;  4C2Z A;  3K5O A;  1VHO A;  1E7Z A;  3SI2 A;  4NGP A;  3TDQ A;  4UEF A;  2PJ9 A;  3S2H B;  4X3U A;  3LNN A;  1D7Q A;  2B58 A;  4F8Z A;  1KHI A;  4Y49 B;  2B2U C;  4K3N A;  1AZQ A;  4X2T A;  5EC4 A;  2JBJ A;  4CAW A;  2EVB A;  3M4Q A;  3L2P A;  2D62 A;  1RL2 A;  2Z9H A;  1DZ1 A;  3R1K A;  4DAV A;  2UXD L;  3IFE A;  5G22 A;  5LMN Q;  1TS5 A;  5EKI A;  2ZTD A;  1QUQ A;  1LOK A;  5G20 A;  4JI7 L;  1VQG A;  3KBG A;  5IGF A;  3PSI A;  2JBK A;  4TVA B;  5EQ0 A;  4KV6 A;  3BVG A;  2L9H A;  4IZ8 A;  3M4P A;  4LW1 A;  3ULP A;  2Z3O A;  1TWG H;  1Y1W G;  3HOX B;  1FNO A;  4CDE C;  5J3B A;  5HGQ A;  4BBR B;  1G2T A;  1EIG A;  1EWI A;  4KMU C;  4RG1 A;  4MY0 A;  8CPA A;  1HA5 A;  4A3E B;  4RGN A;  4B6Z A;  4B3S L;  1YLE A;  2QGQ A;  3CQZ B;  3MEF A;  4HKF A;  3VYS A;  3DEP A;  3D7H A;  3NQI A;  2PRB A;  4NEX A;  3V2T A;  1SRU A;  1TQO A;  5ELB A;  3W1B A;  4E2A A;  4K0K Q;  1TS2 A;  1YNN D;  4GN3 B;  2ANP A;  4QMG A;  1VQJ A;  3G4S A;  3L7Z C;  2C6C A;  2DY7 A;  1QST A;  4UHV A;  1ILQ A;  1Q2Y A;  3TRE A;  4O2D A;  2VI7 A;  2PIZ A;  4PMB A;  4EQN A;  3I91 A;  1Z7T A;  4DK3 C;  1PUA A;  1HTP A;  1S7N A;  1GVP A;  3SJG A;  5M5W H;  1MIU A;  1A6X A;  2NVY H;  2WAQ B;  2WII B;  1R57 A;  1SNM A;  3T16 A;  2AQ2 B;  5C0X I;  3FF3 A;  5M3F G;  4IPC A;  3S17 B;  4E0A A;  1IW7 D;  2JYO A;  4X3K A;  4X5K A;  4QC6 A;  4ZYS A;  2O4H A;  1EE3 P;  4TSS A;  4R76 A;  3FX6 A;  4KY7 A;  4AYB B;  2O5J C;  3J81 j;  3D31 A;  3S6H A;  1PH4 A;  2EVN A;  1Q7Y C;  2K5V A;  4K5V A;  3SK6 A;  4IK2 A;  2F0N A;  2ALY B;  3UDX A;  3X3M A;  2JA5 H;  1AEX A;  1YIJ A;  1QIL A;  3VYR A;  2V8V A;  3GP7 A;  4IUP A;  3BVM A;  4JWP A;  1WI5 A;  1O7L A;  2MQH A;  4JI8 L;  4C3H B;  4LUA A;  2PJ0 A;  4XNH C;  4B13 A;  3PB7 X;  2A6E C;  4H7B A;  3TC8 A;  1I5F A;  5CV7 A;  2JA6 B;  5L37 A;  1VQ8 A;  2FT0 A;  3B3C A;  3HOZ B;  2EK9 A;  5LRK A;  5DS0 A;  5F48 A;  1I50 H;  5IGE A;  1B6B A;  1S7L A;  1YBY A;  2L11 A;  5I6W A;  1VQ6 A;  3M7N A;  2QVP A;  3TZU A;  2JQO A;  4KD3 A;  1UWY A;  2F0T A;  4GNX C;  3BYY B;  2OTJ A;  3NXW A;  1R9T B;  2F0J A;  4RH6 A;  1LAM A;  4DR4 L;  4BY7 H;  3QO2 A;  4CAV A;  4N8F A;  2N55 A;  2RBM A;  4U67 3;  2WUU A;  1R4P B;  1F2Y A;  1YRE A;  2PJB A;  2REE A;  1EZ6 A;  1ML0 D;  2PYK A;  2KJX A;  4UAI A;  3A8K E;  1E2V A;  1IBL Q;  1L0C A;  3R9F A;  3WC5 A;  3FMC A;  4IJH A;  3HOX H;  4A39 A;  3G7L A;  4DV3 L;  2B29 A;  4AYB E;  4BBS G;  2B2T C;  2F0G A;  5JJZ A;  3S1Q B;  2JEW A;  2QJ8 A;  1SNC A;  5EPK A;  4L63 B;  2PVW A;  1M4V A;  1RF2 D;  4JC0 A;  3O13 A;  2HB6 A;  2SNM A;  4A3G G;  4KVX A;  2K03 A;  1VIX A;  2ENB A;  4DR2 L;  1Z9F A;  1L1O A;  2GLF A;  3NUC A;  3QWN A;  3C2P A;  5D3D A;  1G6Z A;  4ZLT F;  4HJ7 A;  4MTN A;  2AFM A;  2RF4 A;  3JAM i;  4A3B H;  2HUZ A;  1CG2 A;  1IBM Q;  3A5Z B;  1T5E A;  4QBJ A;  4HMJ A;  3E3X A;  4CHT B;  3U9O A;  2EE1 A;  1PTO D;  1JJ2 A;  4ZK9 B;  3GTG B;  2IX0 A;  4A93 B;  4ID6 A;  4R7M A;  4K14 A;  4JI1 Q;  2E2I H;  1TY2 A;  4A75 A;  4LF4 L;  4JV5 L;  2AE6 A;  4MFQ A;  3E5S A;  5M3M H;  1BPN A;  2IY5 B;  3R9E A;  3SJE A;  4IJL A;  2K14 A;  1DYQ A;  5JVH 3;  3CRK C;  4ABN A;  3BVZ A;  2JN4 A;  4NXN Q;  4UY8 C;  1VHE A;  4C1N K;  3G6J B;  5CV6 A;  4DK1 A;  1FNW A;  1HR0 Q;  2XRS D;  4I65 A;  3OSO A;  1Z47 A;  2H5M A;  2NVT B;  1B1Z A;  4CAF A;  3AU7 A;  1JWM D;  4A3C H;  4ZCK A;  3PO3 B;  5E1F A;  4B9X A;  2UUA L;  3HP3 A;  1KL9 A;  4C3H H;  4JI5 L;  4MHP A;  3IWW A;  3J81 E;  4RI1 A;  2Q2U A;  3TE4 A;  3NQT A;  3CCQ A;  4B5P A;  2Z1C A;  4C56 C;  3RLO A;  2Z3M A;  4QB9 A;  4PV6 A;  1M90 C;  4DR6 Q;  1LCP A;  1U4R A;  3GTP B;  2ZEG A;  4A2Z A;  1SFO B;  1FNU A;  1AMP A;  4DV5 Q;  3I4O A;  3VYT A;  4X3T A;  2NBF A;  1BOB A;  3NE8 A;  4OP4 A;  1EQR A;  4ME5 A;  4KS9 A;  1HQM C;  2F3W A;  3ERQ A;  3CCV A;  2XRQ D;  3J7Z C;  1JB7 A;  2ZXV A;  4PSX A;  1LT3 D;  1R9T H;  2JEA I;  3GUX A;  1SDF A;  4MCQ A;  3GTL B;  1CQF A;  3P7J A;  4FWU A;  4C3I B;  2PPB C;  2VNU D;  2R1I A;  3T13 A;  1QB5 D;  3SK4 A;  1OXX K;  1B87 A;  1RXT A;  2PJC A;  4QUS A;  1D5M C;  4X6A H;  5C3W A;  4Y7N B;  1XYI A;  5KTA A;  2KEN A;  4KK7 A;  2L55 A;  2YNE A;  4OAD A;  4CYN A;  1K0R A;  3S1Q H;  1ZYR D;  4RKL A;  5FO7 B;  2D4P A;  4PV1 C;  2FIN B;  2EO8 A;  2HIV A;  2B2U A;  1G6P A;  2HV2 A;  2F0U A;  1Y9K A;  5IX3 A;  1XNQ L;  2J9A A;  5D14 A;  1EWH A;  3I2Z A;  3OTO L;  1IYV A;  2DN8 A;  3RO0 A;  1F9R A;  3QB3 A;  3K7U C;  4WJW A;  5CV5 A;  1ZLH A;  2F0E A;  1PYW D;  2RDH A;  3GTM H;  4CGP A;  1RKN A;  1JE4 A;  1UE6 A;  1WTQ A;  3V38 A;  1G8Z D;  2AWN A;  1VQL A;  3E0J A;  3AB9 A;  3GTG H;  5IGG A;  1TWH H;  4A93 H;  4ZY2 A;  1B9M A;  2FMC A;  2IX1 A;  2A74 C;  1BR9 A;  2PZU A;  4J6H A;  1I1D A;  5J39 A;  1ZKO A;  3WWV A;  1IY7 A;  2EJM A;  4M8A A;  1OTC A;  1PTO H;  4ZRZ A;  1CX8 A;  3D4R A;  3QAH A;  1CM9 A;  4LF5 Q;  1VQF A;  2B39 A;  3D2P A;  4HNW B;  1FT7 A;  1CT1 D;  1N36 L;  2R6G A;  3WR7 A;  1KLU D;  2L4N A;  4NKL A;  2QDB A;  4YY3 L;  4CAX A;  1LO5 D;  4FF2 A;  5AG7 A;  2ZTC A;  2BH8 A;  1CZG A;  3KR5 A;  5DLQ E;  3KQX A;  3MHB A;  2R7Z B;  5DWM A;  5JH9 A;  1IBK L;  2GN5 A;  3HS0 C;  3V96 A;  4YHH Q;  2CH4 A;  3EQL C;  5K36 G;  4A76 A;  1L0Y B;  2PJ8 A;  1TU2 B;  4MBU A;  1T9H A;  4BD9 A;  4JVZ A;  1LAN A;  2ZT9 C;  2Q0Y A;  5E96 A;  2I5M X;  4K8J A;  2UU9 L;  2K5T A;  4LQ6 A;  2NVQ B;  1YGH A;  1R4Q B;  2Q2I A;  1A2U A;  3DXJ C;  4LF8 L;  2O2L D;  3I72 A;  2V77 A;  1TWF B;  4IUV A;  4DV6 L;  2Q51 A;  1HTL D;  2HHH L;  4FD7 A;  4AXV A;  4CYQ A;  3KZW A;  3DMU A;  2PVV A;  4R4Q A;  4ZY0 A;  1HNW Q;  2PI2 E;  2G9H D;  3IEH A;  2QF7 A;  3GTL H;  4RGT A;  2CKZ B;  1B3A A;  1BUV T;  2K01 A;  3DHQ A;  5C3X A;  1KUY A;  2Z3P A;  3W91 A;  1V1O A;  2ZPA A;  1I4P A;  1OBR A;  1CI3 M;  4PK3 A;  1JIC A;  1HZA A;  3D4U A;  3ZJY C;  5CBM A;  1BDO A;  2HQE A;  4Y7N H;  1BCP B;  2CTC A;  3K5M A;  2V8D A;  1LTL A;  3KLS X;  2OU2 A;  3GTJ H;  2JA8 B;  4AQY L;  3KLS A;  1ESR A;  1F9P A;  1VQC A;  4H13 C;  3I73 A;  1VQB A;  1HUN A;  3S2D B;  2V1C C;  2NZO A;  1N32 L;  2B3G A;  2ZEF A;  4GNX A;  4OC3 A;  4C7I A;  4POF A;  5IGC A;  2F52 A;  1VQK A;  4RAU C;  3GY9 A;  4A3M B;  1SLJ A;  2VB2 X;  4TNU A;  1B4O A;  4B12 A;  2TMP A;  1ENC A;  4BS9 A;  2JA7 G;  3BU2 A;  4L5T A;  2CY2 A;  4NJR A;  4RHR A;  4R8N A;  3PO2 B;  2IPK D;  4UFV A;  5JM6 A;  4QJF A;  3OWE B;  2K4K A;  5FLX c;  4DR3 L;  1A0I A;  4IFD H;  5LYI A;  2PRQ A;  1ET6 A;  2Y0S B;  2IQ6 A;  4BIN A;  1XX8 A;  4KHV A;  2NWG A;  1WWZ A;  1OXS C;  4O1N A;  2D9U A;  4FUU A;  2D4O A;  1S5B D;  4BXX G;  4HIK A;  4MHE A;  5HH1 A;  3NP8 A;  1Q1B A;  5C44 B;  2E2H H;  4GKK L;  3VAT A;  3I9S A;  4MI4 A;  5D8N A;  1KDB A;  1S5K A;  4EQ5 A;  1KIX A;  1XRY A;  3E9H A;  1Y7E A;  4O42 A;  1KLG D;  4JI2 L;  2H5X A;  3M85 A;  3SE0 A;  4M6H A;  1Y1V B;  3NBH B;  2KEC A;  2JEB I;  3H3V H;  5C4J B;  2JSO A;  2BA1 A;  4M6I A;  4UA3 A;  1PMR A;  1NR4 A;  1FR3 A;  1NNX A;  1OXU A;  1X65 A;  2R7Z H;  1H95 A;  1EYG A;  1VQD A;  2PR1 A;  4DUY L;  2I3C A;  4LF9 L;  5C4X B;  5C3E G;  3KDF B;  4IQZ A;  4KHP Q;  4UFX A;  1X3P A;  2NVX B;  2ZW6 A;  3DWA A;  1GUT A;  4JBW A;  1UUP A;  3Q6S A;  1N34 L;  4AH6 A;  5IGD A;  1BNZ A;  1AE2 A;  2OF1 A;  4NGM A;  4A3I B;  3DR6 A;  2P6E A;  3STB D;  3HOU B;  1PRT B;  5CGK A;  4LFA Q;  5D29 A;  2LY7 A;  1IYJ B;  5IWA Q;  3EY5 A;  5FO8 B;  2P5Z X;  3K59 A;  1SMX A;  2DJG C;  5CV8 A;  2G0B A;  4DGZ A;  4B3T Q;  4FAI A;  1O7Z A;  2VUM B;  1F2L A;  4X62 Q;  1HHV A;  4IF5 A;  4UCP A;  3BJU A;  2L12 A;  2Y0S E;  3FKI H;  1XMO Q;  2BOS A;  5KTD A;  5T1I A;  1CTM A;  4HN7 A;  3UE0 A;  1YJW A;  5I6Y A;  1F2Z A;  1SMY D;  1ENA A;  3W1G A;  2XNA C;  3SVM A;  1PU9 A;  2NN6 H;  2J8N A;  5J1Q A;  4CJ1 B;  1TS4 A;  1B44 D;  5HUR A;  3ICE A;  2ATR A;  3J80 c;  5M5X B;  2VY3 A;  4OWT B;  3NH8 A;  1Q8K A;  4BBH A;  2ID0 A;  3R2T A;  1HFN A;  1SR3 A;  1XE4 A;  5M9O A;  4DV4 L;  3C1F A;  4OO1 G;  3S2D H;  1FJG L;  2FL4 A;  2PR8 A;  2WIN B;  5A27 A;  4UEE A;  3SHL A;  3R96 A;  1JOK A;  3VWD A;  5JQ4 A;  3HOY G;  2IHF A;  4J8Q A;  1DE4 C;  3HKZ B;  2C9O A;  3Q24 A;  3K2K A;  2F0I A;  1VQ7 A;  5GAG C;  4A3J H;  5C4Z A;  1BBW A;  2B4D B;  1SYC A;  3CC7 A;  3T1Y Q;  3PCO B;  5DEH A;  3A7A B;  3PO2 H;  2K5Q A;  4UIA A;  2PSW A;  3DGV A;  3MFG A;  4P4I A;  4XDX A;  3BI1 A;  2Z4H A;  2RDG A;  1CM0 A;  5AG5 A;  1ELM P;  4OWW B;  3CCS A;  3T1H Q;  3TQY A;  5IOD A;  4OHJ A;  4B3M Q;  2Z3K A;  2EPB A;  4GOP B;  4A3L H;  1CPS A;  2G3T A;  2IX3 A;  1Y1W B;  2B3V A;  3IWE A;  5CMD A;  3GV3 A;  4ZQ3 A;  2VBQ A;  3UE1 A;  3UDG A;  1ZG9 A;  2WAC A;  2M9V A;  2RCF A;  3SK5 A;  3OPO A;  2ODF A;  2PDO A;  4YWY A;  2CWP A;  1TIQ A;  2R92 G;  2A73 B;  1AW7 A;  4WJ4 A;  1H9M A;  2KEE A;  3PUY A;  1KZF A;  2Q8I B;  1XFO A;  3CXP A;  4UBR A;  5KGU A;  4Q38 A;  5C4X H;  1PA6 A;  3B35 A;  4MFP A;  1YVO A;  4DNR B;  1CSP A;  1LT6 D;  2BE5 D;  4BMH A;  1D5X C;  4DV1 L;  4KJO A;  4KSA A;  4YFJ A;  1D1I A;  2A1A A;  4OON A;  1CKN A;  2PQA A;  5LMU Q;  3NBI A;  2K1B A;  2IMO A;  3TO6 A;  2EQS A;  1IL2 A;  4DNC A;  5C0X G;  3VR2 A;  1WTP A;  4JXR A;  4FF3 A;  3HKZ E;  2BSW A;  5AG4 A;  5C6A A;  1TWG B;  5M3F B;  3MRU A;  1S40 A;  3TOA A;  2N88 A;  5IYB G;  1NSA A;  5A35 A;  1IOI A;  1H9S B;  2MFI A;  1G29 1;  2R93 H;  1V1P A;  3TP6 A;  2VZZ A;  4CGN A;  1LAB A;  5BR8 Q;  2PQE A;  3A8I E;  4HR7 B;  5LMN W;  3H8E A;  4JI4 L;  4CGM A;  1JE5 A;  4R4O A;  3IC1 A;  1I4G A;  2CW0 D;  3NSW A;  4NXM Q;  1ZO0 A;  3OW2 A;  3B6Y A;  4PG3 A;  4XIG S;  1ON0 A;  4MHY A;  2WSA A;  2ZJQ A;  1CK1 A;  1L0X B;  3I4N H;  1MKH A;  2WV6 D;  1WVL A;  1IYK A;  1Y9W A;  4A3D H;  2CXA A;  4KZT A;  3I3G A;  1S7K A;  4JLY A;  2XIW A;  2L5T A;  2VB3 X;  2PJ1 A;  1FL0 A;  1M4D A;  4DR1 Q;  3D2M A;  2BOA A;  3JVN A;  4WRD A;  1XOV A;  3PP9 A;  3S6G A;  4F9U A;  1E1O A;  1F77 A;  1ARM A;  4F87 A;  1KNE A;  1U4L A;  5M5W B;  3T56 B;  1SYB A;  2X69 A;  5K8M A;  1YNX A;  4JOI C;  3U58 A;  4JI3 Q;  1IID A;  3MXN B;  5EPL A;  3PF5 A;  3KF6 B;  5IP9 G;  4UF4 A;  4DK6 C;  3KF8 B;  1NMG A;  4DAY B;  4X65 L;  1WTH A;  4Q0F A;  4JI7 Q;  1YNJ C;  3DR8 A;  2I07 B;  3EA6 A;  1TKW B;  2R3Z A;  1B8A A;  2XN9 C;  3TEH B;  1M1K C;  1H9K A;  1XNR L;  2JA5 B;  5FLX L;  2ZEP A;  1PH5 A;  4MCP A;  2EY5 A;  3PB6 X;  2PJ4 A;  3FPP A;  1DOM A;  1QVG A;  2F8H A;  4OWX B;  1E22 A;  1YX0 A;  3NTI A;  3MAQ A;  1CP6 A;  4OC1 A;  2GLJ A;  4A3K G;  2XVS A;  2JLM A;  1NSN S;  4B3S Q;  1Y1W H;  1NAP A;  3VR6 A;  2IL8 A;  5GAH C;  3IL8 A;  3CU7 A;  2SDF A;  3H3V I;  4A3G B;  2KCW A;  1I50 B;  3PFO A;  2XTI A;  1LAC A;  3BDO A;  4P4F A;  3QIA A;  5FOB B;  1KAW A;  5J1Z A;  1AUG A;  4NPS A;  5JEA G;  5JOB A;  3RMH A;  4H0L C;  2EZV A;  4XPD B;  3CCM A;  4AIM A;  1ROD A;  1YVK A;  1RD9 D;  4PXD A;  4BY7 B;  1NMF A;  1VMC A;  2A68 D;  2XWJ B;  1U0L A;  4HIO A;  5HVF A;  1T5X D;  2ICI A;  1CPX A;  1PHJ A;  1A3U A;  1BO0 A;  1GUS A;  2QCP X;  4GXH A;  4ZYQ A;  3S16 B;  1I4X A;  2UUB L;  4MN3 A;  4X66 L;  3S6K A;  4KVM E;  1B70 B;  1RTN A;  3V7Z A;  1ET9 A;  1F9Q A;  3HGB A;  4NB3 A;  5M3F H;  1I94 L;  3IWG A;  4FF1 A;  4B08 A;  5KRU A;  3WC7 A;  4A32 A;  1HRJ A;  2KHJ A;  3GQB A;  1DM0 B;  3NPP A;  4KKS A;  4ZKB B;  4AB7 A;  5I9O A;  3QOL A;  4RHS A;  1MJE A;  2ICE C;  3MZ5 A;  1WTO A;  3F0A A;  2K04 A;  1DJR D;  2MP1 A;  1SNO A;  4PZ8 A;  1BAV A;  1II3 A;  3CXC A;  2F3I A;  3NEN A;  5C0X J;  4JI6 Q;  3PB8 X;  3ND9 A;  3PUX A;  2AQ3 B;  4GS4 A;  2NN6 I;  3CPW A;  5FLX E;  3FIX A;  4A3B B;  4UWI A;  4DV0 L;  4KD4 A;  2O28 A;  3J80 L;  5AJ3 L;  2A6H C;  1F9S A;  2B63 G;  1LAP A;  5KYL A;  1ZG8 A;  3N7Z A;  4QGU A;  1Q8I A;  1STB A;  4B10 A;  2E2I B;  1G91 A;  2UUC L;  2VQE L;  1S7F A;  1N9W A;  4C3J G;  1KQS A;  5M3M B;  3LAC A;  1BCP C;  1MD2 D;  1PYB A;  4M3S A;  2F0V A;  2NYQ A;  5A2Q L;  4DR4 Q;  1WD0 A;  3BYT B;  3OMC A;  1FGB D;  4MFJ A;  2RVL A;  1L0W A;  1HCZ A;  3TME A;  1V9P A;  2EY6 A;  2OB0 A;  4A4I A;  3KYH C;  4ZBG A;  2QKI C;  2K5H A;  3MFY A;  2P0W A;  1VCI A;  1UEA B;  3HOW G;  2B3U A;  4DV3 Q;  1IB1 E;  5JPM C;  4IOA A;  2HQY A;  2M00 A;  4MMO A;  1Q82 C;  1B3Q A;  4A94 A;  5BWA B;  3JC6 6;  2ZOG A;  1J9O A;  2QIL A;  4JPB W;  1IU8 A;  4DR2 Q;  2EXD A;  5K8N A;  4BBS H;  1HR0 W;  4HNY B;  3L3O C;  1MSG A;  2DGY A;  1BF4 A;  2AJ6 A;  4R4I A;  4UWJ A;  3NH4 A;  2VQF L;  2RHS B;  1PYT B;  4A3G H;  3RBU A;  1YEZ A;  3A55 A;  3S9N A;  1MK4 A;  4DR7 L;  4PK2 A;  1PYS B;  4C68 A;  1NSL A;  1DGS A;  4ZGY B;  4CPA A;  1I4Q A;  3VA5 A;  1Y7R A;  2VXW A;  4R8I A;  3U4V A;  5FVJ A;  1U9R A;  3RLF A;  1IGB A;  5F46 A;  3F1Z A;  2RC4 A;  1CKO A;  4LF4 Q;  3FEC A;  1X3F A;  5C82 A;  3S9L A;  1DOL A;  3A74 A;  5HVH A;  1KRS A;  2EBJ A;  1VQN A;  4UCM A;  3KBX A;  3J80 E;  3BXM A;  2EDG A;  2OTL A;  5FK9 C;  4BA1 I;  1W2B A;  1E1T A;  1QVF A;  2R7D A;  2VZA A;  2WAQ E;  3T9Y A;  2EYM A;  3F2C A;  5DM6 3;  3S16 H;  4FXD A;  5G1Z A;  5JAV A;  4IUN A;  4EQO A;  1S4Z A;  4P72 A;  3HFZ B;  1K83 B;  2PZT A;  5JEA J;  4FD4 A;  2ZXP A;  2AWO A;  3HZX A;  4HJ9 A;  1QMU A;  1YW6 A;  4GKJ Q;  3VH9 A;  2B5G A;  4QVT A;  4EQP A;  2GA4 B;  5A2Q E;  3JAM L;  1UNS A;  1PRT C;  2UUA Q;  3FNC A;  2JXM B;  2X6G A;  5DWN A;  4DR5 Q;  2K05 A;  1HFG A;  3QNV A;  4JI5 Q;  1FNV A;  4KOR A;  4FD6 A;  4CS0 B;  1RDP D;  1BPM A;  3R93 A;  4JYA L;  5IYD H;  3K80 C;  3S14 H;  1NE3 A;  3GYA A;  4NSQ A;  4LMQ D;  3UI2 A;  3GTM B;  1N33 Q;  1SQH A;  1PH6 A;  3PUZ A;  2HC9 A;  1ILP A;  1VKC A;  4CKB A;  2OQK A;  1SXT A;  2G3A A;  2QEX A;  3V05 A;  3M4O B;  4KKU A;  5IT9 c;  4HJA A;  4RCN A;  1MJ9 A;  1TWH B;  4JYW A;  1HPC A;  1SEB D;  3HOV G;  2DNC A;  3J81 i;  3P1H A;  4S3S A;  2KUM A;  4C7H A;  3EIV A;  2Q4V A;  3PUV A;  3KHX A;  3GO5 A;  3TO9 A;  2CNT A;  1EEI D;  4HJ5 A;  2F4V L;  2PJ5 A;  3OYY A;  1GO3 E;  1GUW A;  1PTO B;  3M7G A;  2K33 A;  3QOJ A;  1C0A A;  1QSR A;  3ZZI A;  4JI0 Q;  4RN7 A;  4P4J A;  2LSS A;  5IYC G;  2C5C A;  4CKE A;  3PIP A;  1IIC A;  2D0O A;  1XJO A;  5AG6 A;  1E24 A;  1H8L A;  1EYC A;  3VR3 A;  5I2X A;  1IL8 A;  1SAP A;  1BVS A;  1BQQ T;  1DOK A;  2KBN A;  5DAU A;  4R3K A;  4F6A A;  3TP8 A;  3LMS A;  4XQJ A;  1N71 A;  1W6J A;  2K75 A;  3TP5 A;  3A5U A;  4JOI A;  4BBR G;  4YCU A;  3VA7 A;  1XMB A;  3KKW A;  2CH4 W;  4A3E G;  2KED A;  4RKB A;  3T8W A;  2WB1 B;  5F2D A;  1QCB D;  4F8M A;  2F0L A;  1L1O B;  1MBY A;  2PCF B;  5D3I B;  3WC6 A;  3FVL A;  2EYF A;  2Z6B A;  4U68 A;  3OHX C;  3TZD A;  4F0Y A;  4K6L A;  2SEB D;  5KNB A;  3BJ8 A;  3GB0 A;  4DYO A;  4G4K A;  3B2Y A;  3AEV A;  1K9M C;  1WOC A;  2PI2 A;  4HED A;  4KOS A;  3S1R H;  4NF1 A;  4DPG A;  3KJP A;  3A9L A;  4KOX A;  3OWC A;  5K5P A;  5J8F A;  2KCC A;  1WFQ A;  2A69 D;  1D2B A;  1A15 A;  1D5Z C;  1E2Z A;  4LUV A;  2MUY A;  4CAE A;  1HNZ L;  1HEE A;  1ELL P;  1GM5 A;  4DXF A;  1IZ6 A;  4PXB A;  4GZY C;  2CF4 A;  1I3Q H;  1K83 H;  1N36 Q;  4AYB G;  1Y8O B;  1HZB A;  3GTJ B;  2NTS A;  4JI1 L;  1OO9 B;  2OCE A;  1I21 A;  1SE4 A;  1PV4 A;  1M4G A;  3SXN A;  1XPR A;  3SR1 A;  2AFW A;  4R6T A;  4OC2 A;  3PZJ A;  1Z4R A;  3BZC A;  3TP7 A;  1X3Q A;  3EN2 A;  4YRH A;  2ZXR A;  2YGW A;  5BN3 A;  4LX9 A;  4OC5 A;  4R9W A;  3CCL A;  2A4N A;  5LYL A;  1H9R A;  4XQN A;  2LFN A;  1X9N A;  2YU9 B;  4HCE A;  2UU9 Q;  4ZY1 A;  4B5P B;  3CMA A;  5K36 H;  2JA6 G;  4YWM A;  4LF8 Q;  4F88 A;  1F2P A;  3M4O H;  2DNE A;  2WB1 E;  3HOZ G;  4DV6 Q;  2PMZ B;  2RDF A;  2BL1 A;  2HHH Q;  1EUJ A;  3MTS A;  2G5D A;  1GHJ A;  2WP8 J;  3IO1 A;  4OIW A;  2PW5 A;  1TKH A;  1KC8 C;  4PMC A;  1LTB D;  2E2H B;  2BCO A;  2KVM A;  5ELD A;  3H91 A;  4R3L A;  2LXJ A;  4KOY A;  2ZTE A;  5HY6 A;  1S72 A;  1CP7 A;  4KVO E;  1K3B C;  2HUG A;  4RMF A;  3G71 A;  4P44 A;  5FLM G;  1UAP A;  4LFC L;  4L5Q A;  4MHD A;  4OID A;  3DUZ A;  2HD3 A;  3K0X A;  1YVC A;  3KAS A;  3H6M A;  4AQY Q;  1Y0R A;  2YNC A;  4U9Y A;  2AUK A;  5JVG 3;  3WAB A;  4AVC A;  1N32 Q;  1HXY D;  1M4L A;  3FEW X;  4P73 A;  3W5O A;  4B9W A;  1Y0Y A;  4HJ8 A;  1K4J A;  1GD7 A;  2J7Z A;  4KY6 A;  1STA A;  3TRZ A;  4DUK A;  1PFM A;  3AQQ A;  1J5E Q;  3CDX A;  2WYR A;  3KUP A;  3IGR A;  2OXP A;  1Z4E A;  1U5K A;  4TWE A;  1SSO A;  5C5L A;  2R61 A;  2OZH A;  5LHY 1;  3HOY B;  2HDL A;  1SE2 A;  2F7V A;  3TSS A;  4DR3 Q;  3HEJ A;  1PZK D;  2PIY A;  3AMU A;  1A3V A;  2PNH A;  5E4X A;  2E5L L;  2JA7 H;  2C6G A;  3SI0 A;  1LT5 D;  4NGR A;  3M3Y B;  2Z11 A;  3BDC A;  3FKI B;  3E0K A;  3ERS X;  4LNQ A;  1HH2 P;  2NZH A;  3D8G A;  4K2L A;  3R8B A;  2GE3 A;  1MJC A;  5LRG A;  5CNP A;  5COY A;  4NP5 A;  1EQT A;  1TF9 A;  3CAM A;  4Y49 C;  2V8G A;  3CCR A;  3MWY W;  2A8V A;  2NB0 A;  2DJF C;  5COR A;  4BXX H;  3VR4 A;  2KOL A;  1OZP A;  3W2D A;  3F8T A;  2BUE A;  1BBX C;  2VL1 A;  2RCN A;  1NJI C;  1DON A;  3N5F A;  3NBH A;  4UP7 A;  4IUT A;  2VEZ A;  4LF9 Q;  3PO3 G;  4LF5 L;  2VL6 A;  2Z0Z A;  3RR5 A;  1CSQ A;  2RHQ B;  4A3J B;  3B3V A;  4H2K A;  2ZM6 L;  1N34 Q;  2LKV A;  5JPH A;  2YU9 H;  4MHN A;  4JD6 A;  3NFZ A;  5IY0 A;  1EU4 A;  5C3E H;  1K8A C;  1EY9 A;  2RKS A;  5D65 A;  3NH5 A;  4HNX B;  2EJG C;  5H86 A;  4KI0 A;  3D6W A;  2Q8R E;  4QY7 A;  1EIF A;  5IT9 L;  2SNS A;  2XEG A;  1PH7 A;  1S3Z A;  3JUW A;  4UIB A;  3IKJ A;  1XPU A;  2H1E A;  2A6E D;  1YR0 A;  2KCT A;  3LWE A;  3QR8 A;  1PCA A;  2NSM A;  3CD6 A;  3TT2 A;  3PB9 X;  1YME A;  3E9I A;  2EK8 A;  5CYU A;  4QIW B;  3EO4 A;  1NCV A;  4P71 A;  2Z3N A;  3W3A A;  3AFQ A;  4II9 A;  1YNN C;  4G7Z C;  1UFH A;  4C3I G;  4A37 A;  3A0J A;  2K52 A;  1EIH A;  5LYF A;  4XNH B;  1NBW A;  3URY A;  1SE8 A;  1IKM A;  2MNA A;  4CYP A;  4QQB X;  3B8G A;  3GD7 A;  4KUA A;  1KAA A;  2DUD A;  2MPM A;  3OMG A;  3K0Y A;  4BWG B;  2JK8 A;  1FJG Q;  1QSM A;  2QEC A;  2ZW5 A;  4KY5 A;  4JBK A;  1IW7 C;  2C1C A;  3D4W A;  4ZUJ A;  3KFU A;  3T53 B;  1FY7 A;  1XIX A;  4OO1 H;  1MI2 A;  3CPX A;  1LLR D;  2EJF C;  2IW3 A;  2JDC A;  3FRM A;  3BS1 A;  4UFW A;  1ICF B;  2F0Q A;  4CYO A;  5JGF A;  3HOY H;  1XWE A;  1NUC A;  4F9V A;  1C9O A;  4H6Z A;  1FGU A;  1JOO A;  2R93 B;  4QCL A;  2ZEH A;  2B4D A;  2LS0 1;  1EY0 A;  4C2M B;  1XTD A;  5I4M A;  3M3Y H;  1V43 A;  3I4M G;  3NE5 B;  2F0F A;  3HUV A;  1RIP A;  1F57 A;  5T1G A;  4F0X A;  3I4N B;  1JQG A;  2UXC L;  4PXC A;  5A28 A;  2B2Y C;  1HDU A;  2IL4 A;  2E75 C;  4A3D B;  3QAY A;  3TTH A;  5IT9 E;  5JJI A;  2PCU A;  1X3G A;  4FF4 A;  4A3K B;  2NMT A;  5E4W C;  4QIW E;  2YYZ A;  5FKA C;  3