3FMCA

Crystal structure of a putative succinylglutamate desuccinylase / aspartoacylase family protein (sama_0604) from shewanella amazonensis sb2b at 1.80 a resolution
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
365
structure length
365
Chain Sequence
VDKHEVRVGELAAGQPLSLPVYRFKGKGAGPSVYIQANVHGAEVQGNAVIYQLMKLLEHYELLGDISLVPLANPLGINQKSGEFTLGRFDPITGVNWNREYLDHGFNIEVWYQEHSHLDDDTLITAFRATLVEECARRLNNPWGVTTGHRLAVTLQSMAHRADIVLDLHTGPKSCKHLYCPEYERSAAQYFSIPYTLLIPNSFGGAMDEAAFVPWWTLAEVASSHGRELGVRVSALTLELGSQERIDLDDALEDAEGILAYLSHRGVIAETVLPKPMKRYGCFLKNYRKFHAPKAGMVEYLGKVGVPMKATDPLVNLLRLDLYGTGEELTVLRLPEDGVPILHFASASVHQGTELYKVMTKVFEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative succinylglutamate desuccinylase / aspartoacylase
publication title Crystal structure of putative succinylglutamate desuccinylase / aspartoacylase (YP_926482.1) from Shewanella amazonensis SB2B at 1.80 A resolution
rcsb
source organism Shewanella amazonensis
molecule tags Hydrolase
total genus 112
structure length 365
sequence length 365
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3fmcA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3fmcA01
4LQGA 1DCZA 4MCRA 3M85A 1HPCA 2C1CA 3I1UA 1H9SA 3T56B 1ZYRC 3B3VA 3A7LA 3CDXA 5BN3A 2Q43A 4K3NA 4B6ZA 5JEAH 2QVPA 4R7MA 2NN6G 5I4MA 5K8PA 1YNJC 1GYTA 4Z65A 2CW0C 2AFOA 3KHXA 4R76A 4DYOA 1FR3A 1FT7A 4RUHA 4NGMA 1GUGA 2CIJA 4ZY1A 2JEBI 3FPPA 4F9UA 1HDUA 2ABZA 4H0LC 1TKFA 1Q1EA 3H8EA 3FX6A 2AFWA 3PB6X 1K8OA 3ISZA 2OR4A 1B9NA 1YLOA 1VGYA 4KN7C 2POKA 2PJBA 4X3RA 4IK2A 2EWBA 3S9LA 3KLRA 3T8WA 5F09A 4KKTA 4OC4A 2B8GA 3I73A 4MHYA 3OW7A 2Q8IB 4Q7AA 1E2VA 4JYWA 1IW7D 2AWOA 2PVVA 3FF3A 5HVGA 1B9MA 1DD2A 4OO1H 1IGBA 3L2NA 2PJ7A 1Y0YA 2ZEGA 2ZOFA 3MXUA 1ZG9A 2K33A 3HUVA 1BPNA 1HDQA 3FEEA 1OXTA 3A8KE 4ZI6A 5J1QA 2O53A 3BHXA 3SJGA 2EJFC 4WWVA 2E76C 3T51B 1XFOA 3VATA 1HCZA 3GQBA 3WT4A 3IC1A 3PB8X 1H9MA 1AMPA 1E2WA 1VDZA 4YWYA 1FNOA 1O7LA 1ONLA 4NGNA 4OP4A 2GREA 2PJ8A 1H8LA 2GLJA 5JEAG 5LRGA 3LWUA 3KQZA 3PUXA 4OC0A 1QQ9A 3PUYA 1TKJA 4FWUA 3V7ZA 2GLFA 4A94A 3PBEA 3BG3A 3B2YA 1GUSA 1YMEA 3I72A 1GUOA 3A8JE 3N6RA 2PJ6A 4H13C 4FBEA 4DJLA 5K8MA 2EJMA 3PRTA 1VCIA 2C6GA 4WJBA 1ZLHA 2EVBA 4JK1C 1CPXA 3PFEA 1HEEA 3PBBA 2ZT9C 4TQUS 1XBUA 3KI9A 2KCCA 2RFHA 3NA6A 1BDOA 3KZWA 2V77A 4W9YA 2ZEDA 2E74C 4R8FA 2F1MA 4DNRB 2BO9A 2V8VA 2JEWA 3H8FA 4OO1G 3ND9A 4GZYC 2JE6I 1Q12A 2ZELA 3SE0A 5LRKA 5KNCA 3H8GA 1NSAA 2PRQA 1OXUA 1LFWA 4MCSA 2ZENA 1Y7EA 4EWTA 3VR5A 2XEFA 1I6VC 1QJOA 4NGTA 3GD7A 4KMUC 3T53B 3B3SA 3TX8A 4NGPA 2NSMA 5BN4A 4A39A 2ANPA 4GM5A 2AFMA 2O5IC 1TF8A 1Z5RA 2HB6A 3K9TA 1H9KA 1CPSA 1F57A 4MCQA 3K2KA 1GHJA 1K8MA 3SI1A 3RBUA 1TF9A 4IAVA 5K8NA 3IWWA 4NGSA 2A68C 1HQMC 3VR2A 1IY7A 1CP6A 1O78A 5C0XH 1OBRA 4KSIA 3NH8A 5JGFA 4PXBA 1DTDA 1XRYA 4IHMA 4OKOA 4NJQA 3CPXA 2PIYA 5D8NA 1QMUA 2C6CA 4PQAA 2F8HA 3FMCA 1YNNC 1OXSC 1M4LA 5D29A 3VH9A 2PJ4A 4DK1A 4NGRA 4JZ0A 3KQXA 3IO1A 2DNEA 3VR4A 2PVWA 1Y8NB 4ZYQA 4PXDA 2PJ3A 3FJUA 3VA7A 4G7HC 1Y69U 1OXXK 3D31A 3QIAA 5DS0A 3SJFA 3CT9A 1VHEA 3FECA 1CI3M 3GB0A 4X2TA 3DLJA 4P4DA 4UIBA 1IYVA 4TNUA 4ZY0A 2A6HC 1V43A 2ZEMA 5KNDA 2BA1A 4LK1C 2AUJD 1EE3P 3QNVA 2AFXA 2CTBA 4P6YA 4G7ZC 1CFMA 1YW6A 2QYVA 5CBMA 3NFZA 1V8QA 3M7NA 1BLLE 3QG1A 3PUWA 4X8IA 2BE5C 3W3AA 2D2CC 1R3NA 2QF7A 2PJAA 3IJ3A 3V38A 4FUUA 3BDOA 3VR3A 1YW4A 3M4YA 4KI0A 5A35A 4UEEA 2PJCA 4MHZA 4XTCS 4P4JA 4BA1I 5C0XG 1ARLA 1Q7LA 2XEJA 3D66A 2WZNA 3DGVA 2ZEFA 3D7HA 2FVGA 3PV0A 1E2ZA 4EFDA 4EMEA 3PB4X 1IYUA 2K7VA 5HVHA 3B35A 3SI0A 4G1PA 2JBJA 4PXEA 1CP7A 3B3CA 5HXDA 1VHOA 5BN5A 4TKOB 3DXJC 1ELLP 1ARMA 4KN4C 1PCAA 5ELYA 4JBWA 4LJZC 2HC9A 1Z2LA 2K32A 2PIZA 3FEDA 3VARA 3AB9A 1BAVA 2NYQA 3BI0A 1H9RA 2D62A 1Z8LA 2OOTA 2IT1A 1FYCA 3WDNA 4NFRA 1Z7TA 4BD9A 3D68A 4CPAA 1PYTB 1DXMA 1ELMP 3NH5A 2PJ0A 2BOAA 4MHPA 1IW7C 3KASA 2AUKA 3WC7A 5LYLA 3TC8A 2NN6H 5K8OA 1Y0RA 2JEAI 3S9NA 1BPMA 1VF7A 4MRIA 2IMOA 3H94A 2V8HA 1CX8A 4PXCA 3KL9A 3ND8A 3MN8A 2GU2A 5HVFA 4R6TA 2I3CA 2ZEEA 3PUVA 2XEIA 3WABA 4UEFA 5K36H 3KR5A 3BI1A 1TKHA 4FAIA 2J9AA 4OC5A 3OOCA 2G9DA 5LYDA 5KNBA 1PMRA 1DE4C 2A6HD 3IEHA 3B3TA 3RZAA 1TKWB 4DK0A 4XIGS 3A8IE 4O23A 3IKJA 3BXMA 2WYRA 4P45A 5CPAA 2A6EC 4I7ZC 3LNNA 4P4EA 4PV1C 1CG2A 1VIXA 3SJEA 1Y8OB 3KHZA 6CPAA 2DN8A 2F7VA 1YSJA 1TXRA 2O4HA 3D7GA 2BE5D 3N5FA 1GUTA 4KHZA 3MRUA 3FVLA 2AFSA 4L8JA 1ZG8A 4NGQA 2XEGA 2KA7A 1GHKA 5LRJA 3SI2A 3RAMA 1OXVA 1Q1BA 4G7OC 4YU9A 2PNRC 3WC6A 2Q51A 1H9JA 4P10A 1F2PA 1G291 2EK9A 3CRKC 1GUNA 3GUXA 5THWA 4ZX8A 5LYFA 2PJ2A 3S9MA 2L5TA 3IIBA 3PB9X 2YYZA 3RLFA 3LMSA 1F2OA 2PCFB 5K36G 1XJOA 1CBXA 2JBKA 1A6XA 1ZLIA 2RB7A 3NH4A 2A69C 3OPOA 4RCNA 4DNTB 4PPZA 4OC2A 4TWEA 2PJ5A 3IFTA 2D5DA 1LAPA 4A38A 4F9VA 3I4LA 2BDOA 3TZUA 2PJ9A 1LABA 2VL1A 3U9SA 3P20A 1AYEA 1VF5C 4OGQC 3GLJA 1LAMA 3CPAA 3PFOA 2LMCB 3VR6A 3B7IA 2V8DA 4P4BA 2PPBC 4UIAA 3PB7X 4DUKA 4IFDH 2V4DA 5JH9A 3PEIA 1LOKA 2CF4A 4MXUA 2E75C 4ONWA 4H2KA 4BA2I 2R6GA 4MCPA 1EWHA 3A7AB 2PE3A 4ZX9A 2ZEPA 1R43A 4P4IA 2BA0A 1H9SB 1KWMA 2Q4ZA 2BCOA 2PCUA 2EDGA 4OIDA 1LACA 4MHNA 2A68D 3EQLC 5IB9A 4AXVA 3KGQA 2A6ED 1ZG7A 3PUZA 4MMOA 2ZEOA 3MFYA 4UF4A 2PJ1A 1XMBA 3SJXA 4P4FA 1CTMA 2CTCA 1Z6HA 1Q90A 1LCPA 1HTPA 1Y8PB 4H44C 1ZKOA 2EK8A 2IJZA 3KR4A 4IQZA 3B3WA 3D67A 3D4UA 3L7ZC 3IFEA 2ZEHA 3D7FA 4OC1A 2ZOGA 7CPAA 4KKUA 4OIWA 4OMEA 2IQ6A 2O5JC 1T5EA 1GJXA 4A37A 3JRUA 4KKSA 1JQGA 3FH4A 3SDZA 2AFUA 4ZY2A 1LANA 2V8GA 3D7DA 4UEZA 3CRLC 4NJRA 3HGBA 3QJYA 1TU2B 3D4RA 1SMYC 4OC3A 4IFDG 2DNCA 3WC5A 1UWYA 2QJ8A 2EJGC 2AFZA 2DEAA 4P44A 8CPAA 4HR7B 2NN6I 3NE5B 5JM6A 2JXMB 3ISXA 4F8ZA 1RTQA 3HLPA 2A69D 2C6PA 5LYIA 2B8FA
chains in the Genus database with same CATH superfamily
4K14A 1GVPA 2R7DA 1PZKD 4BWGB 2FS5A 2JSOA 2EE1A 2C1CA 2E2DC 3T56B 1ENAA 4DV6L 2CCZA 1KTKA 1K0RA 3A7LA 3S14B 4IJLA 2UXBQ 5H1SE 1WYDA 4DN4M 1PFNA 5CNPA 1O7ZA 4DV0Q 5JEAH 1Z8TA 3A5ZB 2ZJPA 5C0XJ 2HD3A 4FF1A 1GYTA 1ML0D 2CW0C 3KHXA 1FR3A 2KECA 4B9WA 1X3PA 1X3GA 1KLUD 3PZJA 1EQRA 4ZY1A 4OX9L 1UAPA 4UP7A 2B2YA 3NBHB 1TKFA 4JI2L 1HRJA 1YVKA 2OCEA 3DLLA 4NDXA 1AE2A 4OIKA 4XPDC 2B2YC 2OR4A 1YLOA 2EIFA 3L3OC 3VYTA 2PJBA 4ONUA 4X3RA 1TWHB 4XQQA 2JA6G 1M4IA 2J8RA 4BS9A 1A8VA 3J81E 3AMUA 5I9OA 2BH8A 1WOCA 3OHXC 1E2VA 1IW7D 2AWOA 1IBKL 1L1OC 5M9OA 2K14A 1VQNA 1IGBA 3PF4A 2ZEGA 2H5XA 2N78A 1JMCA 3D3SA 4A3KG 4LNQA 4DV3Q 1LUZA 4FD6A 1ZG9A 4GKKQ 1HDQA 3RO0A 4CBVA 3S6KA 1AZQA 1KHIA 3SVMA 4ZI6A 2R93B 2K5VA 1HZAA 5CBEE 5J22A 3FHWA 3R95A 2EJFC 3SJGA 3K7AB 5CR3A 3VATA 2C5CA 2F0TA 1W6JA 5KRUA 4XXEA 3PIP3 1VQOA 2F4IA 1AMPA 3SHPA 3LGJA 4NGNA 4QL5A 4MNOA 1QSRA 5JEAG 4Y7NB 4WORA 4OELB 1SFOH 2PI2A 4O42A 4B5OA 5IYDH 1EYGA 3HOYH 1BXTA 3RN5A 1TKJA 4Y49B 1V1OA 3V7ZA 2J0TD 4ME3A 2JA5H 3BG3A 1QB5D 4H13C 1VQPA 2OWOA 5T1IA 4OO1I 3FNCA 4RN7A 4DJLA 5K8MA 2EJMA 4GOPB 1XNQL 3CXSA 2C35B 2C6GA 1Z47A 1Z4RA 2F0KA 3AYHB 4J1MA 3T4AC 5C4JB 4WJBA 4UCPA 4PV6A 4JK1C 4RGNA 3SHLA 3PFEA 3H91A 1IIDA 4K2KA 5BR8Q 1XBUA 4A3FH 5EKKA 2KCCA 2RA4A 3OW2A 1M4VA 4RMFA 4W9YA 2PYKA 4DUYL 4C3JB 1MJEA 2F1MA 3NTKA 4L5QA 1I12A 3TS0A 3D8PA 2BO9A 2BUEA 2V8VA 2VEZA 1UEBA 1X12A 1Q12A 2JE6I 1VQKA 2EXZA 1EEID 2L12A 4J8QA 4UPAA 1TWFH 3TQYA 1L2FA 3SXHA 1YJ9A 4R4QA 3SE0A 3HOVH 4XYQA 1OXUA 2CH4A 1A2UA 2Q2UA 4UY8C 1LFWA 4K0KL 4KSAA 4X3TA 4MCSA 2ZENA 4EWTA 3SXNA 2PR1A 3UDGA 1Z9UA 4NGTA 1K73C 1BR9A 1I5FA 5AFWA 4KMUC 3B3SA 1FGUA 5D65A 1SR3A 1YI2A 5C4XH 4DR4L 5BN4A 2ODFA 4ZKBB 2VI7A 2AFMA 4XQJA 2O5IC 1Z5RA 4MIUA 2J8MA 2HUGA 3K9TA 4A3EH 3TE4A 3FVQA 1F57A 1HZBA 3MAQA 2VQEQ 4GNXB 1K8MA 3HOYG 4C2XA 3NK9A 3IRBA 5IGCA 4OHJA 3RBUA 2JA5G 3EA6A 1VQ8A 4RKBA 1NTGA 5A2QL 1G6PA 1FNUA 4DR7L 4F8MA 4B13A 3A54A 1OBRA 2IL4A 5HY6A 1R9TH 1S7NA 1VQAA 2CHBD 3I4MH 1Z4EA 2UXDQ 1XRYA 1NUCA 4F7XA 3FEWX 4HEDA 2VUMH 4A3FG 1YVCA 4LF7Q 2XNAC 5D8NA 2A19A 4IALA 2G3TA 1SNPA 1PH1A 4L8AA 4PQAA 5D29A 1M4LA 1F77A 3F2CA 2HDMA 3PO2B 2PI2E 3TT2A 3SK4A 4MN3A 1G8ZD 1FD7D 1EIGA 4LF6L 2CQOA 3VR4A 1HNXL 1Y8NB 2F0PA 1LTLA 2PJ3A 3FJUA 1PH9A 4R8NA 1OXXK 1X54A 3D31A 3HOVG 1EOVA 1SNCA 3SJFA 2EZVA 4FD5A 2L11A 3S1MB 2F0NA 3WR7A 4N9PA 1VMPA 2KENA 1IYVA 1U4PA 3Q23A 2K5WA 2ZJQA 1EL0A 1WTHA 1IB1E 3ZJYC 4ZY0A 2A6HC 4KTAA 1HNWL 2ZM6L 1B8AA 1BKBA 2Z6KC 2BA1A 3DDDA 3IFDA 5F48A 2AUJD 4F88A 4MBUA 2Y0MA 3QB8A 5CORA 2EQSA 2EYLA 1NNXA 3R8BA 1YW6A 2QYVA 5C4XG 1UEAB 1YITA 2NZOA 3M3YB 2QA4A 4K5VA 1EY6A 2NVYB 2BH2A 1HFGA 3H0GH 3QG1A 4WFN3 2MO0A 2KUMA 3V38A 2D2CC 1R3NA 2QF7A 2PJAA 3IJ3A 4PG3A 3M4YA 3IAYA 5A35A 1CQVA 1S7LA 1VMCA 4P4JA 2K5NA 1DZ1A 4U68A 1TY2A 4KJOA 1Q7LA 2ZXVA 1STGA 4UHVA 1WTVA 3S6HA 1UE1A 3A56A 3W2DA 3I4MG 2WZNA 2B2WA 2EO8A 1I1DA 1P16A 1N34L 3PV0A 2VUMG 4EMEA 4TRDA 3TP7A 1IYUA 3PB4X 2YNCC 4DV1Q 2FE7A 2F3WA 1Y9KA 2C9OA 1CP7A 1RCVD 3KOJA 1EQQA 3ERSX 4TKOB 2F03A 3PIPA 4PK2A 2B63H 1ELLP 1NSNS 1CA6A 4A3GB 4JBWA 4LJZC 1B87A 2HC9A 3VARA 3J80c 3KLSX 2NYQA 4FF4A 4JYAL 1LTID 2CNTA 4YY3L 1CKNB 2MFIA 1JOQA 1Z8LA 2R98A 3BI0A 2OOTA 2K52A 3CC2A 3R9EA 2L9HA 2V1CC 3KYHC 4NFRA 1Z7TA 2F0JA 1WD0A 2RCNA 2B4DA 1KD1C 1ZYRD 4HNYB 3D68A 4CPAA 2OTLA 4KY7A 3EFXD 2JYOA 1ELMP 3NP8A 5D14A 5J8FA 2AUKA 3WC7A 2GVAA 2I79A 1BCPB 2KEEA 2P6GA 5K8OA 4UCNA 2FIWA 2JK8A 3S1RH 2UUCQ 3H3VC 1BPMA 1SYBA 2BDNA 2WAQE 1PV4A 4KK7A 4DV5Q 2V8HA 2I5LX 4PXCA 3S24A 3H0GG 2UXCQ 4R4IA 5CMDA 3MN8A 1U4MA 1VQGA 2Q8TA 2ZEEA 3K8AA 3MC0B 3PUVA 4EX5A 4BY1G 2UU9L 4UEFA 3BVZA 3BI1A 4A76A 3PO3H 4A93H 2J9AA 4R3LA 3MTSA 2XIWA 4MY0A 4HAEA 1D5ZC 3HS0C 5KNBA 2E5LQ 1JE4A 2E8GA 2KCTA 2OH1A 4L6TB 2A6HD 2RHSB 4A3CH 3RZAA 2VW9A 5KTAA 3GTQH 1TR5A 2ZW6A 2PMZE 1W3SA 3A8IE 3IKJA 4UP8A 4YIJA 4B3MQ 2A6EC 3KDFB 4N8X1 4GXHA 1KC8C 3DHQA 5EKIA 4MFKA 1PFSA 4Y49C 3X3MA 2B63G 3G4SA 3KHZA 2GN5A 3E9IA 1AUGA 2F7VA 3L2PA 1CK1A 4IOAA 4GOPC 4MFZA 4HNXB 4UAIA 2MHVA 3D3RA 1X10A 4CDDC 2SNSA 2CWAA 4NP5A 4GKJQ 4QCLA 5M3MB 4C2MB 1M4DA 3MRUA 2ZXPA 2E2HB 2J4XA 2WB1G 1ZG8A 4R1JA 3J81L 3HOWH 3J81i 2XEGA 2KA7A 2WKDA 3GTLH 4QF4A 5JEAJ 2AE6A 1EEFD 1GO3E 1OXVA 1D5MC 4YU9A 4C7IA 3WC6A 1HR0L 2REFA 2EK9A 2AMCB 3CRKC 3CQZB 3M9BA 5TSSA 2Z0ZA 2JA9A 5M5YB 2CFMA 4JV5L 5E4WC 1K83B 4NF1A 3CC7A 1Q2YA 4MFQA 1UE6A 5C44B 1XMOL 2L5TA 2IX0A 2K6AA 4LF4Q 3ICEA 3I8ZA 5M5WH 4FNFA 1EYDA 2AQ3B 4JVZA 3GTMB 1SEBD 1QWYA 3LMSA 2X69A 5IODA 1TS2A 3I4NB 4L5RC 3PO3G 4A93G 1A6XA 3W91A 1ZLIA 2PQAB 3NH4A 2A69C 5GAEC 4AB7A 2IHFA 2CNSA 1SYCA 4RAUC 1TWCH 4DF7A 1KQSA 4A3CG 1YJNA 2PJ5A 3IFTA 4A3BH 5EBVA 4F9VA 3I4LA 3TZUA 2PJ9A 5LMUQ 4HJ7A 1GXDC 3KFUA 2ZTDA 2N88A 3J80E 3S6FA 1NY4A 4NEXA 4Q38A 3UY5A 2F4VQ 1C48A 2VL1A 4B3RQ 3CMAA 1VF5C 2PR8A 4OGQC 2OXPA 3CPAA 1I3QH 2LMCB 3B7IA 2V8DA 2WFWA 4NXML 5IY0A 1S5DD 1KXLA 1NMGA 1LOKA 2WPXA 2E75C 1K3BC 2D0OA 1E7ZA 5DM73 2WB1E 1X32A 5EQ0A 4X66Q 2R6GA 3HOWG 4BA2I 4H2KA 4IPCA 3BZCA 3TDQA 3CCVA 2FT0A 1DGSA 2ZEPA 2WKCA 4LW1A 1SXTA 2K5HA 5CV9A 4FP5D 1I6HH 2BEIA 4KSFA 4C3HH 2X7BA 3KGQA 2A6ED 3GTJH 4AXVA 1PFBA 3CCEA 4CGOA 3A9LA 4B3TQ 4RHRA 1XF8A 2A74C 1KAAA 1WCMH 5IT9c 1CTMA 3GTPH 4A3KB 1IBMQ 5C6AA 1EQTA 1EYCA 5GADC 4A3MH 1YNXA 2EK8A 1JT8A 3LX0A 3E5SA 4X3SA 3HP3A 4C2ZA 3KR4A 4IQZA 4IFDI 3SGIA 2PSWA 4ZCKA 3D4UA 3NELA 2TMPA 1SE3A 3D4DA 5I6WA 5M3FH 4A3BG 1D8LA 2ID0A 3B6YA 4KKUA 4LF9L 4BY7H 5IV0A 5EBDA 4OIWA 2IQ6A 1HXYD 1STYA 3NHHA 2VQYA 4KKSA 3K58A 2R92H 4AG9A 4R3KA 3SDZA 2A73B 1K3RA 4ZY2A 1T5XD 4DAVA 2V8GA 3MFGA 4EQ5A 1HUMA 4KLWA 4PZ8A 3QJYA 3BJ8A 4K30A 1N32Q 1KZFA 5EGTA 4OC3A 4M6IA 1S60A 2E2JH 4LF5L 2PW5A 1Q2CA 2AFZA 3NE5B 1SQHA 2JLMA 3KJPA 2K5TA 4JI3Q 3ISXA 3J7AV 1CM9A 2ZTCA 3OMGA 2A69D 2VQFL 3U4ZA 1STEA 2PZUA 1C4QA 2KCNA 2C6PA 5IGEA 4LQGA 1B3QA 4DGZA 5IGDA 3M85A 1K0SA 1H9SA 2EYFA 5IOCA 2NVTH 2F5IA 1DOMA 4LFCQ 1HNZL 5IWAL 1M1DA 1L0CA 4MFLA 3CDXA 2Q43A 3K5NA 5H84A 2QVPA 4A30A 1WCMG 3K59A 2NN6G 1M4GA 1YNJC 2OB0A 2CIJA 1SMXA 4A3MG 4F9UA 3SK5A 4FO2A 1Y1WH 3BYTB 1Q1EA 2EY5A 3RZOH 5C3EH 2AFWA 3PB6X 4YHHQ 3PQIA 4CHTB 1K8OA 5M3FG 5A27A 1K8AC 2KCWA 4BY7G 4KN7C 3HOXH 1VGYA 1D1KA 1EZ6A 1B2TA 3CF5A 3I56A 4IK2A 1TIID 4AYBE 2EWBA 1Y7RA 3T8WA 3Q24A 4OC4A 3I73A 2I5HA 3OW7A 2Q8IB 3FF3A 3HOYB 5FKAC 4OO1H 1Y0YA 5BWAB 2JA5B 1SJHD 3I91A 4K2LA 2K33A 2HT1A 2REEA 4H89A 1BPNA 2GIVA 2K01A 4K5XA 3A8KE 2R61A 3BHXA 1EY4A 3H15A 3A55A 5CV7A 1XXGA 1YHAA 2NVXB 1V9PA 2I5MX 3GQBA 5IGFA 1LT4D 4A3FB 1H9MA 1EIHA 1VDZA 4YWYA 1FNOA 2VB3X 1W6KA 1IICA 3RYOA 1U4RA 4HMIA 2HDLA 2IL8A 3T1HQ 1H8LA 4HIOA 2UUBL 2GE3A 5AG6A 4IPDA 1WJJA 3W1GA 1U6MA 1QQ9A 1Q8IA 2GLFA 1CSPA 1H95A 3I72A 1GUOA 5LMNQ 3HOVB 3C2PA 4FBEA 4CGNA 5J8CA 1Y1WG 2PQ8A 3PSIA 3UDIA 1SAPA 1VCIA 2DPTA 2K4KA 2CY2A 3CAMA 3BJUA 4A3JH 1LTAD 5LL6X 2SNMA 5DAUA 4KJNA 1S72A 3HOXG 2ZT9C 1X3FA 4TQUS 1SE8A 1GUWA 4KS9A 3KI9A 5KIXA 2RFHA 4DR1Q 5C4XB 4JI2Q 1MK4A 3DR6A 3HG9A 3C26A 1BDOA 1S4ZA 4RI1A 3HKSA 1GKHA 2EYOA 4DNRB 4BINA 2JEWA 4ZLTF 2BL1A 3ND9A 4QUFA 4OO1G 4UFXA 3FKIH 1YNJD 2FJ2A 3I4OA 2ZELA 1NMFA 3H8GA 3FBUA 2DJFC 1PYWD 1U4LA 1KUYA 2J8NA 3NWTA 2NZ1D 1BCPD 1NBWA 1I21A 1HZCA 4CAEA 5DNFA 1R9TB 1Y7EA 1KDCA 2KVMA 2F0LA 2PC1A 4DUZQ 2DUDA 1QJOA 1Q81C 1R57A 2XEFA 4A3IH 3R9GA 4DNCA 2B2TC 1X3QA 3HOZH 1L0WA 2VUMB 3S6GA 2PMZB 5DWMA 3TO7A 1V1PA 4KOYA 1WTPA 4JI4L 2RSOA 4NGPA 2MGSA 3V96A 4A39A 4X5KA 1XEBA 4R8IA 2ANPA 2Q8RE 4GM5A 1TF8A 2GA4B 1SDFA 1RF2D 2FL4A 1GHJA 2ATRA 3IWEA 1TF9A 1M44A 4K8IA 1TS5A 4NSQA 1L0YB 1QSMA 1P8LA 1I4GA 3U4VA 3OWCA 4H6UA 4NGSA 1XNRL 2XGTA 3SR1A 3RNUA 1DJRD 2NMTA 1IY7A 1SROA 1CP6A 3KKWA 1JB7A 3Q6SA 1O78A 1S5BD 4ILWA 4KSIA 1CT1D 4EVOA 1BO4A 2VZZA 4U5YA 3E9HA 4M85A 2YGWA 3CPXA 4IURA 1JC7A 1JWQA 5D3IB 1XMTA 3LD2A 3CCRA 2JDDA 1KDBA 1OXSC 1YNNC 2L15A 1G6ZA 2DY8A 2QGQA 3GYAA 3NE7A 4JZ0A 1KABA 4NGRA 4JOIA 4X64L 3H0GB 3IO1A 2P0WA 2DNEA 2PVWA 4CAVA 3HKZG 4ZYQA 1I50B 2F0FA 3FKIG 3X3NA 1QILA 2H1EA 4MY3A 4PXDA 2B4DB 4BY1B 3VA7A 4DPGA 5C3XA 3SXOA 4JI7L 2ICIA 4IO9A 5J39A 3J80i 4CYOA 5GCNA 1PTOD 1S5KA 4YGOA 5JJKA 2L0CA 4ZK9B 2ZEMA 5KNDA 1Q7YC 4LK1C 3R2TA 4V0BA 1U5KA 2LSSA 3GTKH 3HOZG 2CTBA 1CZGA 4CKBA 3NBIA 4KHPL 4OADA 1B4OA 4QUCA 5CBMA 2B63B 2KBNA 1JR0D 4HJAA 3FXTA 3M7NA 2OZGA 1N33L 4X8IA 2G5DA 4B9XA 1DYQA 2BE5C 4M6HA 4LFAQ 2Z4IA 4K8JA 4FUUA 1PA6A 4BMHA 1I94Q 4B5PA 4DR4Q 2EYJA 3TEHB 3VR3A 2H4OA 4KI0A 3TP8A 4C2YA 4M6GA 4DR3L 5FLMH 2WPWA 2ZPAA 2WINB 1E22A 3CMEA 5I6YA 4YWMA 1RJTA 3DGVA 2ZEFA 3W5OA 4LMQD 4QIWB 1S3OA 1E2ZA 1KAWA 2R3ZA 3RN2A 4EFDA 1MKHA 5JPHA 1RL2A 2K7VA 4CJ0B 1EZ8A 3KF6A 2N3SA 3MHBA 2XTIA 1AZPA 3SI0A 5HGQA 2LXKA 3B3CA 5HXDA 4PZ6A 3P2HA 5KEEA 1MGSA 1SYGA 3DMUA 4GLAC 2Z3KA 4KN4C 1A3TA 3AU7A 4X62Q 1TWGH 4TVAB 2Z3LA 3R2IA 2UXBL 2B2VA 3HKZE 1B3AA 3JVNA 1FYCA 3WDNA 4DV0L 4QMGA 1GHEA 1C9OA 5JAVA 4BD9A 4O1NA 3PO3B 4A93B 2HUZA 1S7FA 3GTOH 2LS01 1HNXQ 4FXDA 1ESFA 1AE3A 1EY9A 3KASA 5ISRA 3G8WA 3UDFA 5LYLA 1MJBA 2CW0D 3GTQB 2OQKA 4BBRH 1BO0A 3I9SA 3M4QA 2ASBA 1T9HA 1SYDA 1B70B 2A4NA 5CBAE 1HNWQ 5AG5A 2IMOA 1ASYA 4P74A 1EUJA 1E3PA 1SYEA 4G57A 5G21A 5ELBA 1IXRA 1Y1VB 2CQAA 3E0EA 4XT3B 2QEXA 3RZDH 2I3CA 3E0KA 4LUAA 4UA3A 1I4PA 4M8AA 3J7AF 3WABA 4MTKA 4U9ZA 2NVQH 4ZRZA 4XT1B 3KR5A 4KV6A 5HMNA 4YCWA 4OC5A 4K6DA 2G9DA 1BVSA 4JBKA 4DV3L 2PZWA 1AP0A 1QG7A 5IYDG 3HOWB 5HURA 4GKKL 1PMRA 1FJGL 4JBJA 3G6EA 1Y14B 1SJED 4RA8A 4MJ8A 1Q82C 4ZAIA 4O23A 3BXMA 1FL0A 4RGMA 3R96A 3PP9A 3OIQA 5CV8A 4DR6Q 3SJEA 1Y8OB 2NBFA 4J3GA 1F9SA 1E1TA 4AVBA 4JI0Q 1XMQQ 2KHSA 2DN8A 2CWPA 5HGTA 2JA7H 1TXRA 1YSJA 4DK6C 3K80C 2BE5D 1ET6A 2FFKB 2UUAL 3MXNA 1HA6A 2QMLA 4HCEA 4IUVA 5F2DA 1BF4A 4Y52H 2Q44A 4KLVA 1N9WA 4DV7Q 1LRZA 2XSCA 1B6BA 3JTKA 4CYPA 4L8JA 4ZGYB 4JYAQ 2JN4A 2ZW7A 3RMHA 1JOKA 2F0DA 4A3BB 1TQOA 1WWZA 2DJGC 1EY0A 4CJ1B 3OWFA 4BBRG 4CGYB 1J9OA 1Q1BA 4EQPA 5JQ4A 2Q51A 4HKFA 1ZEQX 1F2PA 1G291 2QDLA 1GUNA 5ELCA 2FMMA 3CP0A 5BR8L 5J1ZA 4RGOS 3STBC 1D6EC 2PJ2A 3TP5A 3T1YQ 2WUUA 5IP9H 3S9MA 1I3QB 4XYOA 4AQYL 4CDCC 2YYZA 3DEPA 4F0XA 3H6MA 3I7FA 4KD3A 3RLFA 2WAQG 4N8FA 4PK3A 3L0OA 2JBKA 2VXWA 2KQ3A 4A3EG 4BBSH 3DWPA 1KNAA 1NR2A 3ERQA 3NSWA 4NXYA 4CRZB 4PPZA 1AN8A 1NR4A 3DM1A 1RTNA 2UU9Q 4TWEA 1HFNA 4ALPA 1LAPA 4GN3B 3GIUA 1QE6A 3NPPA 2BDOA 3TBIB 4FD4A 1LABA 1X56A 2Q4YA 4HJ9A 4LF8L 1AYEA 4BXXH 3GLJA 1F9PA 2P5ZX 2K28A 4IPHA 2JA7G 2F0QA 1RXTA 3PFOA 2E2IB 3VR6A 2PPBC 4UIAA 3PB7X 1QZGA 3KBXA 3AFQA 4DUKA 5IYBH 4IFDH 2B2WC 5JH9A 2VQEL 3HOUH 1C0AA 2CF4A 2M2LA 3PEIA 4A3MB 4MXUA 1DOLA 5FK9C 2QKIC 4X65Q 1TWHH 2MUYA 2WP8J 3S2DH 3UE1A 3DUZA 1EWHA 3A7AB 4V190 3BVMA 4ZX9A 5M3FB 4LQ6A 1BCPF 1U9RA 4EGVA 1QVGA 4BY7B 2BA0A 1H9SB 2VY3A 1WK4A 1AH9A 4QB9A 4U9YA 1VHSA 1NAPA 3I55A 2KEDA 3HRZC 3CCUA 3DWAA 3FRPB 4MHNA 2UXDL 1PRTC 3Q8DA 5IB9A 1O7IA 4MMOA 3RNZA 2HQYA 5FLXc 3D8GA 2PJ1A 1XMBA 4R87A 3SJXA 1VQEA 4P4FA 5I2XA 1WTOA 1HR0Q 1KRSA 3K7AH 5CV6A 2E2JB 1Z8XA 1HTPA 1LCPA 3G3SA 4GLVB 3S2HH 4BBSG 3IU1A 2K1BA 4B12A 3MEFA 3F1ZA 3L7ZC 3IFEA 4II9A 4L5TA 5GAGC 4Y7NH 2ZOGA 3ITPA 5JPMC 3EBEA 1RD9D 5LHY1 4L89A 3KJOA 2ZTEA 5CYUA 1LO5D 1T5EA 4A37A 1K8GA 3JC66 3W1BA 3FH4A 3RUZA 1YX0A 1SYFA 3CXPA 4CGLA 3D7DA 1SN8A 3HGBA 1EY8A 5C4JH 4JI6Q 1N8RC 2BSWA 5IYBG 5G3LD 2DNCA 4IFDG 3HOUG 2EJGC 3R1KA 2VL6A 4LFBQ 1QSOA 3CXQA 3DSBA 5JM6A 1Y1WB 3QOLA 3K9UA 1DOKA 2JA8H 5KTCA 3RZOB 3HLPA 4H7BA 4N9TA 2YNDA 1VQFA 3TZDA 4DAYA 2Z3PA 1EOTA 2L55A 3HOXB 1PTOF 2YU9H 1VQCA 1DCZA 2F0VA 1HPCA 1OO9B 3CCJA 3I1UA 2PDOA 2F3VA 2B39A 1UE5A 1CSQA 1WTWA 3N52A 5EBCA 4CRYB 4B08A 1BUVT 3S1NB 2Y0SG 1AFPA 4K3NA 4DV1L 1LLRD 4NXNQ 4GN5A 5JVG3 4Z65A 4DYOA 3F2UA 2AFOA 4R76A 4DR2Q 1J4JA 1FT7A 3TTHA 1X3EA 2SEBD 4MFPA 1STNA 2JEBI 1NSLA 4H0LC 5T1GA 2HIVA 4IPGA 2KJXA 3ISZA 1XTCD 4DXFA 3S15H 4PMCA 2NTTA 1NE9A 1SSOA 1ENCA 1PH8A 2Q04A 3KLRA 2RVLA 5F09A 3R93A 3TFYA 1EY5A 3K7UC 2B8GA 4MHYA 5E1FA 1IKMA 4ULLA 4Q7AA 5L37A 3BU2A 1SNDA 4DV5L 1QVFA 3L2NA 2UXCL 4IUSA 3MXUA 3EY5A 4OL7A 4NPSA 3HUVA 3IGRA 1D1IA 5D3DA 2JA8G 4KOWA 4DR5Q 4JI1L 1M8AA 1SE4A 1OTCA 2Z3NA 3T13A 5C3WA 4FD7A 4WWVA 2X6LA 3T51B 1Q2DA 1XFOA 1ZXTA 1VQJA 3D2MA 1NMTA 3N7ZA 1MI2A 1HZ9A 2E5LL 1HCZA 1A62A 4JPBW 1Q46A 5FLXE 2F52A 4GNXA 3PB8X 3MGDA 4OP4A 1O7LA 1ONLA 2VQFQ 5LMNW 2PJ8A 2EYMA 2Y0SE 4B3ML 2L4NA 3KQZA 5LRGA 1LTSD 3OMCA 3NE8A 3EO4A 1G2SA 4OC0A 3HKZB 4A94A 3PUYA 3PBEA 3MA2B 1JWMD 1GUSA 2JA6B 1V1QA 3A8JE 3Q22A 1JJ2A 1RHPA 4IUUA 5KYIA 1ICFB 1CKOA 3VDYA 3M3YH 4GKJL 1ZLHA 1E1OA 2EVBA 1WTXA 2OF1A 3CU7A 1ILPA 3HOZB 4JI5L 2HHHQ 1HEEA 3PBBA 3M4OH 3NA6A 4CJ2C 4POGA 3TOBA 3PGPA 1IBLQ 2DY7A 2V77A 3DM3A 2FXFA 2L1BA 2E74C 4R8FA 3GTGH 3GY9A 1RDPD 1QZHA 1WI5A 4ODGA 3S9WA 4LUVA 1KIXA 4GZYC 4AYBG 3BYYB 2R7HA 2JEVA 2B5GA 5KNCA 4LF4L 2B58A 2PRQA 1PU9A 3NENA 2M9VA 1PFMA 1PUAA 4IUTA 4LUOA 2SOBA 4GS3A 4QGUA 1AW7A 4A3GH 1XTDA 3FP9A 2Q7BA 4B10A 4F87A 3F2DA 4IUQA 1J5EL 2HCIA 2K50A 2DXQA 2KCMA 4A31A 4KOSA 1LT3D 2I0QA 1XIXA 4NB3A 5LMUL 1EYAA 2HB6A 1CPSA 4MCQA 2F4VL 1HUNA 3K2KA 4C1NK 4B3RL 1LYLA 2PZTA 1QOHA 3SI1A 4B5PB 1G2TA 2EPBA 5EKLA 4O0AA 1A15A 4C3HG 2K03A 1YHQA 5JVH3 2EY1A 3CHBD 5ELOA 2A68C 4IJHA 4WJWA 3UE0A 1UUPA 3BDLA 5JJZA 3NTIA 2P6EA 5JGFA 3HFZB 4PXBA 3NEMA 3SEBA 4A75A 2ZXRA 3GTKB 5A28A 4X66L 3H09A 1QUQA 4IHMA 4OKOA 4NJQA 2PIYA 4ABNA 4KVME 1QMUA 1S5CD 3CCQA 1N36Q 3FMCA 1EIYB 4DK1A 1U0LA 3KQXA 4TSSA 4KY5A 4F6AA 1UWVA 1PH5A 1IHZA 4C3IH 4M3SA 4HPSA 1BBXC 2P6FA 4JI8Q 3DNSA 3TMEA 2R92G 5IGGA 1XYIA 4G7HC 1TS3A 1Y69U 2CVRA 5AGEA 3FYNA 5DS0A 3CT9A 3OTOL 2AKWB 1CI3M 3GB0A 4E2AA 4X2TA 1D2BA 1RTOA 2Z8LA 2IPKD 1SFOB 5LL6S 2OZHA 1IBML 3DLJA 4UIBA 3CCLA 2EXDA 1V43A 2CKZB 2IX3A 3F0AA 3PCOB 4KOXA 5DM63 5C0XI 1EE3P 3QNVA 4CYNA 3KBGA 2XWJB 3S1QH 4YRHA 1VQLA 2F0OA 2R7ZH 3TRZA 4L5SA 2FIAA 3FIXA 4A32A 2DF5A 5M3MH 4UWJA 5I9PA 5IX3A 1TWGB 5ELNA 1QSNA 3P2FA 2QW7A 1PZID 3RR5A 4AIMA 2YNEA 1PTOH 5IT9E 4UEEA 3U50C 1N32L 1IYJB 2PJCA 4UCMA 2OT2A 1F2MA 3GTOB 4XTCS 2FCKA 3CQZH 2Q2HA 2XEJA 5M5YH 4HNWB 2KHIA 2MO1A 2R7FA 3M4PA 1RODA 1SNMA 3D66A 1TWFB 1EFWA 4JI3L 4DV6Q 1NE3A 2FVGA 5C44H 1WVLA 4BBRB 1VS0A 2ENBA 1ET9A 3S17H 5HVHA 3B35A 1BBWA 1X6OA 2JBJA 2VB2X 1PHJA 2AJ6A 1WD1A 3GTMH 1S7KA 5F49A 4IFDJ 5C3EG 2EY2A 3DXJC 4Z9CB 1IL2A 1PCAA 3CCMA 4X6AH 3FEDA 4C7HA 4C3IG 2K32A 2PIZA 2ZW5A 1BAVA 3MXNB 3G6JB 4OX9Q 3MVVA 1Q3LA 1VQ9A 4UFWA 2NVQB 2WAQB 4B11A 5G3LF 5K5PA 5J3BA 4A3EB 1PYTB 2JDCA 2N55A 4DU9A 3S16H 5IE8A 2BOAA 4MHPA 3E6ZX 1IW7C 2MPMA 4ZUJA 1EU3A 4AG7A 4PSXA 3BVGA 1PZJD 3GV6A 4KY6A 4I65A 4DK3C 4NKLA 4YHHL 1HJPA 2R7ZG 2LKVA 4E6IA 4JWPA 1IBKQ 4QB4A 1JJCB 1VF7A 3I90A 4RG1A 5M5XH 1CA5A 3FDTA 1FGBD 3F8TA 2RC4A 2VZYA 5I4DA 4MRIA 1CX8A 4CAXA 3I4MB 2JA7B 3QO2A 2GU2A 5HVFA 4X3UA 2I46A 4R6TA 4AVAA 4J15A 4HIMA 4FF2A 2XEIA 5EJWA 4HN7A 3EFAA 1F9QA 1EFID 2K5DA 4H02A 4OIJA 5K36H 2B2UA 1UFHA 5ELDA 2M00A 4JD6A 3OOCA 2NTSA 4IF5A 1YEZA 4CDEC 1DE4C 4IUNA 4PSWA 1B53A 5C44G 3B3TA 1TKWB 4KD4A 4DFAA 2RBMA 4DK0A 1W2BA 2Z3OA 4K5WA 4DR3Q 4B3SL 2WYRA 1ICWA 5CPAA 4I7ZC 5IYCH 5CV5A 3EROA 1MSHA 1CG2A 4JXQA 1VIXA 2PRBA 3C3LA 4A3JG 5FO8B 5HH1A 4CS0B 3EJIA 6CPAA 2RCFA 2YV5A 3TO9A 4LUZA 1B1ZA 1JWUD 2PQEA 2O4HA 1BQQT 3T1HL 1XNQQ 4P72A 5C4ZA 1GUTA 4ORFA 1TWAH 1G91A 4JC0A 3GV3A 3MEHA 4BBSB 3ER0A 3U9OA 5LMNL 4NGQA 4IZ8A 1PRTB 2FXQA 3JAMc 1II3A 5GAHC 1YJWA 4RKLA 1GHKA 1YR0A 3A5UA 4HIKA 4JOIC 3MWYW 2B29A 4X3KA 1IL8A 4DUYQ 3LWEA 4P10A 4QBJA 3OIPA 3J80L 3GUXA 2AWNA 1WTRA 1YVOA 5DLQE 4FF3A 3TCVA 3V2TA 4A3IG 4DR1L 2B4BA 3EC4A 3QAYA 3DEOA 3IIBA 1PH7A 3QB3A 3KF8A 1O7YA 3HOUB 3VWEA 4RH6A 4K0KQ 5K36G 4ID6A 1XJOA 1D5XC 1F2LA 5FLXL 1IOFA 4UFVA 1QVCA 2RB7A 1XPUA 1Z9FA 3MXGA 1L1OA 4E8OA 3OPOA 3S2DB 5KGUA 1IYLA 2NYZD 2VS1A 2WSAA 3CXCA 4RFBA 4DV4L 2YTVA 4DV2L 1CHQD 1P4NA 3K57A 2Q0YA 2Z4HA 2RDGA 5IYCG 4DUZL 1SE2A 2N49A 5C82A 4FXGC 2WB1B 4JW0A 1FJGQ 4JLYA 3P20A 3UDXA 2Y0SB 1CUKA 2C27A 4I7AA 4YWLA 5JJIA 3ONAB 2HQLA 3AQQA 1LAMA 2LXJA 2YTXA 5AJ3L 2LY7A 4P4BA 3S1RB 4DR7Q 2XRQD 4CKEA 4GLXA 1PVOA 4JJXA 3S2HB 1KL9A 1KDAA 1B50A 2LFNA 5DEHA 4ONWA 1O80A 1LM0A 4DAYB 2VXKA 3H5ZA 4MCPA 1PH4A 1KNEA 1MJCA 2UUAQ 1R43A 3G7LA 1K4JA 2VNUD 1IZ6A 2MP1A 1KWMA 2Q4ZA 1IKLA 2BCOA 1HR0W 2EUIA 2B2VC 4R4TA 3PF5A 2RQXA 4LF6Q 3EQLC 2D4PA 1ZG7A 3PUZA 4HCSA 1A2TA 4UP9A 1KRTA 3RD4A 4H6ZA 4UF4A 3PGZA 5ISVA 3NUCA 4JBMA 4KZTA 4A3DH 3VYRA 2K75A 4QJFA 3J7YW 4FVMA 2NVXH 5IGBA 3LODA 3BZDB 5EC4A 1Y8PB 4A2ZA 4H44C 1E24A 1MHWC 4FDBA 1M1KC 1YNND 1XX8A 2ZM6Q 2JA8B 3B3WA 3D67A 4UDUC 4AQYQ 2ZEHA 3D7FA 4OC1A 3P7JA 4NMZA 2EOTA 7CPAA 2YU9B 4UWIA 1STAA 5IB0A 3A74A 2F0SA 1YHBA 5FLMG 4WJ4A 2X6GA 2HIXA 1JQGA 2XN9C 4M1UB 3U58A 4KORA 2IJ0A 2PW7A 2AFUA 4EQOA 3GTLB 4NJRA 4KVOE 1TU2B 3D4RA 2QECA 1SMYC 4KVXA 5AG4A 4YFJA 1UWYA 3D6CA 3CPWA 1LTBD 2F3IA 3E3XA 4HR7B 3JAME 1NJIC 3P75A 1RKNA 2OQ0A 4LF8Q 4LFAL 3TP6A 5EPJA 4ZKCB 4R57A 1HHVA 1I94L 5E96A 2ATWA 2FHTA 4C1NI 1N34Q 2Z0SA 2DPSA 4A33A 4RHSA 3MXPA 1JQYD 1P0HA 2G0BA 3LACA 5M5WB 3S15B 4HMJA 1IYKA 2RDFA 2KHJA 1XJVA 1XE4A 2H5MA 4MCRA 4EVYA 2AQ2B 1XPRA 4XNHB 4OWWB 4YWKA 1JWSD 1EQVA 4DNIA 1ZYRC 3B3VA 2EVNA 5BN3A 2K05A 4YY3Q 1TWCB 2IX1A 4B6ZA 4R7MA 3B8GA 1FNVA 4A3DG 5I4MA 5K8PA 4QUSA 1VQIA 2RKSA 4P2CB 3OWEB 4X62L 4AYBB 2B3VA 4RGTA 4NGMA 3TOAA 4RUHA 1GUGA 1NCVA 1TY0A 3DR8A 5E7NA 1KLGD 3D0FA 3FPPA 3GO5A 1HDUA 2ABZA 1F9RA 3H8EA 2A5HA 3BLNA 4HIDA 4LAAA 1Q86C 3F5BA 3FX6A 3OSOA 1B9NA 2POKA 1R4PB 3WOFA 5H86A 3IWGA 2RF4A 3S9LA 4CAWA 1UE7A 2MQHA 4KKTA 5IT9L 4P73A 3S14H 4WRDA 1GD7A 2Z6KA 4JYWA 4OWTB 2PVVA 5HVGA 1B9MA 2JQOA 1DD2A 4JXRA 2PJ7A 2ZOFA 5JOBA 3CZXA 2B5GB 4KHVA 4OXPA 1I6HB 4C3HB 2Z1CA 3OYYA 3KLSA 3GTJB 4MHEA 3FEEA 1OXTA 5J1QA 3K81C 4FXKC 2O53A 1WCMB 2K04A 2ICEC 5F47A 1QNKA 2BOSA 2E76C 3GTPB 4CAFA 2GVBA 5NUCA 2VZAA 3WT4A 3SK8A 1I50H 3D4WA 3M4OB 3IC1A 1E2WA 1B44D 4LX9A 4A95A 4BY1H 1S40A 5JPNC 2GREA 4KOTA 5COYA 4QC6A 2QEJC 1A3VA 3GTGB 2GLJA 1PYSB 2F0EA 3LWUA 2KOLA 4DR6L 5G1ZA 3PUXA 1QNUA 4Q0FA 4PMBA 1VKCA 3H3VH 1YLEA 2WV6D 2YNCA 1SBBB 4FWUA 1A0IA 2WIIB 4Q5VA 4JI0L 5EPLA 1SMYD 1XMQL 2R92B 3N6RA 1YMEA 3B2YA 4Q36A 2PJ6A 1X9NA 4LF7L 1I4RA 3FRMA 5IP9G 4K6LA 3PRTA 4UBRA 2R1IA 3NBHA 2EYHA 4DV7L 2R93H 1MJAA 4DAPA 1VQHA 1QUQB 4PZ7A 1PH2A 1VQMA 1CPXA 2NB0A 3F8KA 1PH6A 2IY5B 2ARHA 2GFQA 3I2ZA 5E3FA 5FO7B 1LTTD 3GKRA 4JV5Q 1MSGA 3JUWA 5EMIA 4WJ3M 3TSSA 1BNZA 3QR8A 1XMOQ 2CH4W 1TXYA 3KZWA 2ZEDA 5FOBB 2G3AA 1JJGA 1ON0A 2VBQA 4CDFC 3H8FA 3EN2A 2G9HD 2NVTB 1YQEA 1JE5A 4G4KA 3T1YL 3C46A 5LRKA 5GQOA 3A0JA 2AHOB 5CV4A 1SNQA 4BXXG 1NSAA 1K28A 1RIPA 2J7ZA 1RO5A 3IL8A 3STBD 4ZYSA 1IOIA 1PLFA 4KOUA 1BOSA 3R3OA 3VR5A 1I6VC 2F0UA 5FVJA 1VQ7A 3UI2A 2N8NA 2IW3A 5CC4A 1BBUA 3GD7A 3H4QA 3QAHA 4JI1Q 3T53B 2HQEA 3TX8A 2NSMA 3GDEA 5C3EB 1CHPD 4OONA 2A8VA 2ES2A 4APVA 4C3JH 4U673 4R4CA 4NXMQ 1H9KA 2Q2IA 4C3IB 3ZYYX 4HJ8A 3EXNA 1EWCA 3TREA 3GP7A 4IAVA 5K8NA 3IWWA 3EVQA 1VQDA 3TS2A 1LTRD 5DWNA 1Z8WA 1HQMC 3VR2A 4A3LH 2Q2TA 3RLNA 2R93G 5C0XH 4GOPA 2OU2A 3NQIA 3NH8A 1DONA 4X65L 3DWQA 1A3UA 1JORA 1DTDA 1VQBA 4NCZA 4BBHA 1MBYA 3K0XA 4CGMA 1ENFA 1Y1VH 2QCPX 3S1QB 1FY7A 4R9MA 3PMFA 2R7ZB 2C6CA 1SLJA 2F8HA 1EY7A 4AVCA 3NTHA 4S3SA 4C56C 3VH9A 2PJ4A 4MI4A 1EIFA 4LWCA 1YBYA 4MFJA 4JI5Q 3K0YA 1L0XB 3QOJA 3CKIB 1EU4A 4CKCA 2IHEA 5EAYA 3ZZIA 1XWEA 1A2ZA 1PTOB 3QIAA 4IUPA 3AFPA 1PRTD 2WACA 1S3ZA 1VHEA 3FECA 3BZKA 2UUCL 2DGYA 1C7YA 4J6HA 4P4DA 4TNUA 4LF9Q 1JICA 1PYBA 2PO4A 3KLWA 1XPOA 1MJ9A 4P71A 4QVTA 4P6YA 2AFXA 3ULPA 3S17B 3J81j 4G7ZC 1CFMA 1VQ4A 3C1FA 5C5LA 3PIO3 5IIFA 3ZJ0A 4C3JG 3I70A 4A3JB 3PO2H 1V8QA 4DAMA 3NFZA 1SRUA 1BLLE 3D6WA 4XPKA 3PUWA 4LF5Q 3CD6A 1K9MC 4ME5A 1V1PB 4CGPA 3W3AA 1J5EQ 1JB3A 1TVXA 3BDOA 4DXGA 1YW4A 1FNWA 4A3LG 4JI6L 2XWBB 4MHZA 1S5ED 2OEOA 3G48A 4GNXC 3S1MH 3D2PA 3E0JA 4DKAC 1I4QA 2Z9HA 4BA1I 5C0XG 1ARLA 1CM0A 3QWNA 1CKMA 3S16B 4LFBL 2OTJA 4XNHC 3V05A 3FKIB 3EIVA 2EY6A 4JG2A 3ULJA 3D7HA 1HNZQ 1Y1VG 5IWAQ 4G1PA 2D9UA 4PXEA 5M5XB 1VHOA 5BN5A 2NVYH 4HSPA 1ARMA 2O28A 5ELYA 3VYUA 4KLKA 3TN2A 4A3IB 4OAEA 1Z2LA 1LTGD 4FYDA 1PDQA 3AB9A 2XVSA 2O4XA 3Q0AA 1ESRA 5AG7A 1H9RA 2D62A 1B7YB 2IT1A 4PQXA 1C8CA 1LT5D 4NW2A 4QIWE 4RWSC 4NXNL 4DA2A 5IP7H 3R9FA 3K6OA 4DR2L 3FB3A 2RHQB 1DXMA 4XDXA 2PJ0A 3NH5A 1F2YA 4KOVA 4PNYA 2SDFA 3L9AX 2NWGA 2NN6H 3H3VI 3TC8A 3VYSA 1MIUA 3OTOQ 2E2IH 2JEAI 1Y0RA 3S9NA 1GOZA 4EQNA 4XPDB 2FINB 3JAML 3PO2G 3JAMi 4ZQ3A 3AEVA 3H94A 3KUPA 5ELFA 1TIQA 1QSTA 3ND8A 3KL9A 1YZ6A 1KUXA 2CNMA 4F0YA 2B3UA 2HV2A 1A63A 4R9WA 3KF8B 1TT2A 5ELEA 1YK3A 1JCKB 5F46A 1TWAB 2I07B 1V0CA 1AEXA 4HSVA 1L1OB 3VA5A 1TKHA 4FAIA 3CCSA 5LYDA 4I49A 2YTYA 5G22A 4DR5L 3IEHA 4KUBA 4KUAA 5CGKA 2QIRA 4XIGS 1PXUA 4YCVA 4RS2A 2TSSA 2ALYB 4P45A 5GROA 4IOCA 3LNNA 4P4EA 2QDBA 4PV1C 2UUBQ 4CYQA 3BS1A 1YGHA 1EWIA 1HQRD 4O2DA 1I4XA 4OEMB 2RSNA 5C88A 4OWXB 3KK7A 3KF6B 2I00A 4E0AA 2F0HA 1QCBD 3D7GA 1JOOA 3N5FA 5IP7G 1CKNA 3W6XA 4KHZA 2GANA 4ZUIA 3HZXA 2B3GA 1CQFA 1DM0B 4MTNA 3NQTA 3FVLA 5KTDA 2AFSA 3K5LA 1PH3A 1YREA 1WTQA 5LRJA 3WOEA 4B3TL 5FO9B 3SI2A 2MNAA 2Q4VA 3RAMA 2F0WA 1CZWA 2D4OA 4G7OC 2PNRC 1H9JA 5A2QE 3BJ7A 1D7QA 3T90A 3J7ZC 3ULLA 2HHHL 5THWA 4ZX8A 2F0GA 1BCPC 1J6QA 5LYFA 2EYPA 4A3GG 4A4IA 1IBLL 3T16A 5E4XA 3PB9X 1HA5A 2MJ8A 2F0MA 2HCCA 4YCUA 4HTHA 1F2OA 2PCFB 4GS4A 1CBXA 2EBJA 5I2YA 2ZW4A 4IN3A 4C2MH 1J8IA 4XQNA 2E2HH 4RCNA 2OZUA 4DNTB 3S1NH 4OC2A 4JI4Q 2Z6BA 3NWSA 2D5DA 4A38A 5FJ8H 2D0PA 1ZO0A 2AQ1B 2CXAA 3CPFA 1LT6D 3K5OA 4ZBGA 2Z3MA 3G71A 3U9SA 3KDFA 1K83H 2PNHA 2QILA 3PIOA 4QQBX 4A3DB 3J81c 4B3SQ 1XNRQ 3V8IA 1VQ5A 2V4DA 1STHA 2ZXOA 3I4NH 2A1AA 3F2BA 4LFCL 4POFA 1I4HA 5KYLA 4JCVE 1E0BA 5EPKA 3RZDB 1KUVA 4R4OA 3BDCA 2PE3A 2NZHA 5I0CA 1GM5A 3P1HA 4P4IA 2F0IA 2R8VA 1HH2P 2PCUA 2EDGA 3C1EA 1LACA 1X65A 2XRSD 4X64Q 4OIDA 4B14A 4OLLA 2A68D 4MZ9A 3TO6A 3FPUB 1F2ZA 1BOBA 1STBA 2K5QA 2ZEOA 3MFYA 1PTOC 2FMCA 1SNOA 1N36L 2ZJRA 2Z11A 4XPLA 4JI7Q 2CTCA 3J7A5 2IWHA 1Q8KA 1CJWA 1Z6HA 1Q90A 2RDHA 3WWVA 1ZKOA 5M3MG 1OZPA 2IJZA 4JI8L 3M7GA 1R4QB 1TS4A 5C5MA 2PQAA 3IU2A 3CW2C 4QY7A 1S5FD 5G20A 4RCOA 4MHDA 4HJ5A 4KHPQ 5FJ8G 1IU8A 1ILQA 2O2LD 4P75A 4OMEA 1Y9WA 2O5JC 1GJXA 2Q7SA 3NXWA 3RLOA 1XOVA 3JRUA 3T9YA 2JA6H 1N33Q 2JP1A 3I3GA 4DV4Q 1ASZA 4DV2Q 2B2UC 4C68A 3MZ5A 1LANA 2B2TA 4UEZA 1HTLD 3CRLC 2NUCA 1X55A 3W6SA 5C4HA 1YIJA 1VQ6A 3WC5A 2JJQA 3VWDA 1MD2D 2QJ8A 2DEAA 4A3KH 1M90C 4PMWA 2FSRA 4P44A 2NN6I 3HEJA 8CPAA 3I4NG 1G51A 2JXMB 3K5MA 5JJLA 4AH6A 1N71A 3URYA 1RTQA 4GN4B 3SK6A 4F8ZA 1FVIA 1UNSA 4L63B 1PRTF 2Z10A 1WFQA 5AJ3Q 1LV9A 3CC4A 5LYIA 3I3CA 3O13A 2B8FA
chains in the Genus database with same CATH topology
4K14A 1PZKD 4BWGB 2JSOA 2EE1A 2C1CA 2E2DC 3T56B 1ENAA 1KTKA 3A7LA 3S14B 4DN4M 1PFNA 1O7ZA 5JEAH 5C0XJ 4FF1A 1GYTA 1ML0D 2CW0C 3KHXA 1FR3A 2KECA 4B9WA 1X3PA 4ZY1A 1KLUD 1UAPA 2B2YA 1TKFA 1HRJA 4NDXA 4OIKA 2B2YC 2OR4A 1YLOA 3L3OC 3VYTA 2PJBA 4X3RA 1TWHB 4XQQA 4BS9A 3J81E 3AMUA 5I9OA 3OHXC 1E2VA 1IW7D 2AWOA 5M9OA 1IGBA 2ZEGA 1ZG9A 1HDQA 4CBVA 1AZQA 3SVMA 4ZI6A 2R93B 5CBEE 5J22A 3SJGA 2EJFC 3K7AB 5CR3A 3VATA 2C5CA 2F0TA 1W6JA 5KRUA 4XXEA 3PIP3 2F4IA 1AMPA 4NGNA 5JEAG 4Y7NB 4WORA 4O42A 1BXTA 1TKJA 3V7ZA 1V1OA 2J0TD 3BG3A 1QB5D 4H13C 4OO1I 5T1IA 4DJLA 5K8MA 2EJMA 2C6GA 1Z47A 2F0KA 4J1MA 3T4AC 5C4JB 4WJBA 4JK1C 4RGNA 3SHLA 3PFEA 3H91A 4K2KA 1XBUA 5EKKA 2KCCA 2RA4A 1M4VA 4W9YA 2PYKA 4C3JB 2F1MA 3NTKA 2BO9A 2V8VA 1Q12A 2JE6I 2EXZA 1EEID 2L12A 4J8QA 3SXHA 3SE0A 4XYQA 1OXUA 1A2UA 1LFWA 4X3TA 4MCSA 2ZENA 4EWTA 4NGTA 1BR9A 5AFWA 4KMUC 3B3SA 5D65A 5BN4A 4ZKBB 2AFMA 4XQJA 2O5IC 1Z5RA 4MIUA 2HUGA 3K9TA 3FVQA 1F57A 3MAQA 1K8MA 3NK9A 3RBUA 5IGCA 4OHJA 3EA6A 4RKBA 5A2QL 1FNUA 4F8MA 3A54A 1OBRA 2CHBD 1XRYA 1NUCA 4F7XA 3FEWX 4HEDA 2XNAC 5D8NA 4IALA 1SNPA 4PQAA 5D29A 1M4LA 1F77A 2HDMA 3PO2B 3SK4A 4MN3A 1G8ZD 1FD7D 1EIGA 3VR4A 1Y8NB 2F0PA 2PJ3A 3FJUA 4R8NA 1OXXK 3D31A 1SNCA 3SJFA 2EZVA 2L11A 3S1MB 2F0NA 4N9PA 1VMPA 1IYVA 1U4PA 3Q23A 2K5WA 1EL0A 4ZY0A 2A6HC 4KTAA 2BA1A 3IFDA 2AUJD 4F88A 5CORA 2EYLA 3R8BA 1YW6A 2QYVA 1UEAB 3M3YB 4K5VA 1EY6A 2NVYB 1HFGA 3QG1A 4WFN3 2KUMA 3V38A 2D2CC 1R3NA 2QF7A 2PJAA 3IJ3A 3M4YA 3IAYA 5A35A 1CQVA 1VMCA 4P4JA 1DZ1A 4U68A 1TY2A 4KJOA 1Q7LA 1STGA 1WTVA 3A56A 3W2DA 2WZNA 2B2WA 3PV0A 4EMEA 4TRDA 3TP7A 1IYUA 3PB4X 2F3WA 2C9OA 1CP7A 1RCVD 4TKOB 2F03A 1ELLP 1NSNS 1CA6A 4A3GB 4JBWA 4LJZC 2HC9A 3VARA 3KLSX 2NYQA 4FF4A 1LTID 1JOQA 3BI0A 1Z8LA 2OOTA 2L9HA 4NFRA 1Z7TA 2F0JA 1WD0A 1ZYRD 3D68A 4CPAA 4KY7A 3EFXD 2JYOA 1ELMP 3NP8A 5D14A 2AUKA 3WC7A 1BCPB 2KEEA 5K8OA 3H3VC 1BPMA 1SYBA 2BDNA 4KK7A 2V8HA 4PXCA 5CMDA 3MN8A 1U4MA 2Q8TA 2ZEEA 3MC0B 3PUVA 4UEFA 3BVZA 3BI1A 2J9AA 3MTSA 2XIWA 4HAEA 1D5ZC 3HS0C 5KNBA 1JE4A 4L6TB 2A6HD 3RZAA 1TR5A 3A8IE 4YIJA 3IKJA 2A6EC 3DHQA 5EKIA 3X3MA 3KHZA 2F7VA 1CK1A 4UAIA 2MHVA 3D3RA 2SNSA 4NP5A 4QCLA 5M3MB 4C2MB 3MRUA 2ZXPA 2E2HB 2J4XA 1ZG8A 3J81L 2XEGA 2KA7A 2WKDA 4QF4A 5JEAJ 1EEFD 1OXVA 1D5MC 4YU9A 3WC6A 2EK9A 3CRKC 3CQZB 5TSSA 5M5YB 5E4WC 1K83B 5C44B 2L5TA 2IX0A 2K6AA 3I8ZA 4FNFA 1EYDA 2AQ3B 3GTMB 1SEBD 1QWYA 3LMSA 2X69A 5IODA 1TS2A 3I4NB 1A6XA 1ZLIA 3NH4A 2A69C 1SYCA 4RAUC 4DF7A 2PJ5A 3IFTA 4F9VA 3I4LA 3TZUA 2PJ9A 1GXDC 2N88A 3J80E 2VL1A 1C48A 1VF5C 4OGQC 2OXPA 3CPAA 2LMCB 3B7IA 2V8DA 1S5DD 1LOKA 2E75C 5DM73 4H2KA 1X32A 5EQ0A 4BA2I 2R6GA 3TDQA 2ZEPA 2WKCA 1SXTA 5CV9A 4FP5D 4AXVA 3KGQA 2A6ED 1PFBA 4RHRA 2A74C 1KAAA 1CTMA 4A3KB 5C6AA 1EQTA 1EYCA 2EK8A 3LX0A 3E5SA 4X3SA 3HP3A 3KR4A 4IQZA 4IFDI 3D4UA 2TMPA 1SE3A 3D4DA 5I6WA 2ID0A 4KKUA 5EBDA 4OIWA 2IQ6A 1HXYD 1STYA 3NHHA 4KKSA 3K58A 3SDZA 2A73B 4ZY2A 1T5XD 4DAVA 2V8GA 3MFGA 1HUMA 3QJYA 5EGTA 4OC3A 2PW5A 2AFZA 3NE5B 3ISXA 3J7AV 1CM9A 3OMGA 2A69D 1STEA 2PZUA 1C4QA 2KCNA 2C6PA 5IGEA 4LQGA 4DGZA 5IGDA 3M85A 1H9SA 2EYFA 5IOCA 1DOMA 3CDXA 2Q43A 3K5NA 2QVPA 3K59A 2NN6G 1YNJC 2CIJA 4F9UA 3SK5A 4FO2A 3BYTB 1Q1EA 2EY5A 3PB6X 2AFWA 4CHTB 1K8OA 1VGYA 4KN7C 1D1KA 1EZ6A 1B2TA 4IK2A 1TIID 2EWBA 3T8WA 3Q24A 4OC4A 3I73A 3OW7A 2Q8IB 3FF3A 3HOYB 5FKAC 4OO1H 1Y0YA 2JA5B 1SJHD 3I91A 4K2LA 2K33A 1BPNA 2K01A 4K5XA 3A8KE 2R61A 3BHXA 1EY4A 3A55A 5CV7A 1XXGA 2NVXB 3GQBA 5IGFA 1LT4D 4A3FB 1H9MA 1EIHA 1VDZA 4YWYA 1FNOA 2VB3X 1W6KA 1U4RA 4HMIA 2HDLA 2IL8A 1H8LA 1QQ9A 1Q8IA 2GLFA 3I72A 1GUOA 3HOVB 4FBEA 3C2PA 1SAPA 1VCIA 1LTAD 5LL6X 2SNMA 5DAUA 4KJNA 2ZT9C 4TQUS 1GUWA 3KI9A 5KIXA 2RFHA 5C4XB 3HG9A 1BDOA 1S4ZA 2EYOA 4DNRB 2JEWA 4ZLTF 3ND9A 4QUFA 4OO1G 1YNJD 2FJ2A 2ZELA 3H8GA 1PYWD 1U4LA 3NWTA 2NZ1D 1BCPD 5DNFA 1R9TB 1Y7EA 1KDCA 2KVMA 2F0LA 2XEFA 1QJOA 2B2TC 1X3QA 2VUMB 2PMZB 1V1PA 1WTPA 2RSOA 4NGPA 2MGSA 3V96A 4A39A 2ANPA 4R8IA 4GM5A 2Q8RE 1TF8A 2GA4B 1SDFA 1RF2D 1GHJA 1TF9A 4K8IA 1TS5A 1L0YB 1I4GA 4NGSA 3SR1A 1DJRD 1IY7A 1CP6A 3Q6SA 1O78A 1S5BD 4ILWA 4KSIA 1CT1D 4EVOA 3CPXA 4IURA 1JC7A 5D3IB 1KDBA 1OXSC 1YNNC 1G6ZA 2DY8A 4NGRA 4JZ0A 1KABA 3H0GB 3IO1A 2DNEA 2PVWA 4ZYQA 1I50B 2F0FA 3X3NA 4PXDA 1QILA 2H1EA 4BY1B 3VA7A 5C3XA 2ICIA 5J39A 1PTOD 2L0CA 4ZK9B 2ZEMA 5KNDA 4LK1C 3R2TA 4V0BA 2CTBA 1CZGA 4CKBA 3NBIA 1B4OA 4QUCA 5CBMA 2B63B 1JR0D 3M7NA 4X8IA 4B9XA 1DYQA 2BE5C 2Z4IA 4K8JA 4FUUA 2EYJA 3VR3A 2H4OA 4KI0A 3TP8A 2WINB 5I6YA 1RJTA 3DGVA 2ZEFA 4LMQD 4QIWB 1E2ZA 2R3ZA 4EFDA 2K7VA 4CJ0B 1EZ8A 3SI0A 3MHBA 1AZPA 3B3CA 5HXDA 5KEEA 1MGSA 1SYGA 3DMUA 4KN4C 1A3TA 3AU7A 3R2IA 2B2VA 1B3AA 1FYCA 3WDNA 4QMGA 5JAVA 4BD9A 4O1NA 3PO3B 4A93B 2LS01 4FXDA 1ESFA 1EY9A 3KASA 5ISRA 5LYLA 2CW0D 3GTQB 1BO0A 1SYDA 5CBAE 2IMOA 1SYEA 4G57A 5ELBA 1Y1VB 2CQAA 4XT3B 2I3CA 1I4PA 4M8AA 3J7AF 3WABA 4ZRZA 4XT1B 3KR5A 4KV6A 4OC5A 4K6DA 2G9DA 2PZWA 1AP0A 1QG7A 3HOWB 5HURA 1PMRA 1SJED 4RA8A 4ZAIA 4O23A 3BXMA 4RGMA 3OIQA 5CV8A 3SJEA 1Y8OB 2NBFA 1F9SA 2KHSA 2DN8A 5HGTA 1TXRA 1YSJA 2BE5D 1ET6A 2FFKB 1HA6A 3MXNA 4HCEA 4IUVA 5F2DA 1BF4A 2XSCA 4L8JA 3RMHA 1JOKA 2F0DA 4A3BB 1TQOA 1EY0A 4CJ1B 3OWFA 4CGYB 1J9OA 1Q1BA 4EQPA 2Q51A 1ZEQX 1F2PA 1G291 1GUNA 5ELCA 2FMMA 5J1ZA 4RGOS 1D6EC 2PJ2A 3TP5A 3S9MA 1I3QB 4XYOA 2YYZA 3DEPA 3H6MA 4KD3A 3RLFA 2JBKA 2VXWA 2KQ3A 3DWPA 1KNAA 1NR2A 3ERQA 3NSWA 4PPZA 1AN8A 1NR4A 3DM1A 1RTNA 4TWEA 1HFNA 1LAPA 1QE6A 3NPPA 2BDOA 3TBIB 1LABA 1AYEA 3GLJA 1F9PA 2K28A 2F0QA 3PFOA 2E2IB 3VR6A 2PPBC 4UIAA 3PB7X 4DUKA 3KBXA 4IFDH 2B2WC 5JH9A 3PEIA 2CF4A 2M2LA 4MXUA 4A3MB 1DOLA 5FK9C 2QKIC 2MUYA 2WP8J 3DUZA 1EWHA 3A7AB 4V190 3BVMA 4ZX9A 5M3FB 1BCPF 1U9RA 4EGVA 4BY7B 2BA0A 1H9SB 1NAPA 2KEDA 3HRZC 4MHNA 3DWAA 3FRPB 1PRTC 5IB9A 4MMOA 3D8GA 2PJ1A 1XMBA 3SJXA 4P4FA 5I2XA 1WTOA 5CV6A 2E2JB 1HTPA 1LCPA 2K1BA 3L7ZC 3IFEA 2ZOGA 3ITPA 5JPMC 1RD9D 5LHY1 5CYUA 1LO5D 1T5EA 4A37A 3FH4A 3RUZA 1SYFA 3D7DA 3HGBA 1EY8A 5G3LD 2DNCA 4IFDG 2EJGC 5JM6A 1Y1WB 3QOLA 1DOKA 3RZOB 3HLPA 4H7BA 4N9TA 3TZDA 4DAYA 1EOTA 2L55A 3HOXB 1PTOF 1DCZA 2F0VA 1HPCA 1OO9B 3I1UA 2F3VA 2B39A 1WTWA 3N52A 5EBCA 4B08A 1BUVT 3S1NB 1AFPA 4K3NA 1LLRD 5JVG3 4Z65A 4DYOA 3F2UA 2AFOA 4R76A 1FT7A 2SEBD 1STNA 2JEBI 4H0LC 5T1GA 2KJXA 3ISZA 1XTCD 4DXFA 4PMCA 2NTTA 1SSOA 1ENCA 3KLRA 2RVLA 5F09A 3R93A 1EY5A 2B8GA 4MHYA 5E1FA 1IKMA 4ULLA 4Q7AA 1SNDA 3L2NA 3MXUA 4OL7A 3HUVA 1D1IA 5D3DA 1M8AA 1SE4A 3T13A 5C3WA 4WWVA 2X6LA 3T51B 1XFOA 1ZXTA 1MI2A 1HCZA 5FLXE 3PB8X 4OP4A 1O7LA 1ONLA 2PJ8A 2EYMA 5LRGA 2L4NA 3KQZA 1LTSD 3OMCA 1G2SA 4OC0A 3HKZB 4A94A 3PUYA 3PBEA 3MA2B 1JWMD 1GUSA 2JA6B 3A8JE 3Q22A 1RHPA 4IUUA 5KYIA 1ZLHA 2EVBA 1WTXA 2OF1A 3CU7A 1ILPA 3HOZB 1HEEA 3PBBA 3NA6A 4CJ2C 2DY7A 2V77A 2L1BA 2E74C 4R8FA 1RDPD 4ODGA 3S9WA 4GZYC 3BYYB 5KNCA 2PRQA 2M9VA 1PFMA 4IUTA 2SOBA 1AW7A 4F87A 4IUQA 2HCIA 1LT3D 1EYAA 2HB6A 1CPSA 4MCQA 1HUNA 3K2KA 4C1NK 2PZTA 1QOHA 3SI1A 1G2TA 2EPBA 5EKLA 1A15A 4C3HG 2K03A 5JVH3 2EY1A 3CHBD 2A68C 4WJWA 1UUPA 3BDLA 5JJZA 3NTIA 5JGFA 4PXBA 3SEBA 2ZXRA 3GTKB 3H09A 4IHMA 4OKOA 4NJQA 2PIYA 4ABNA 1QMUA 1S5CD 3FMCA 4DK1A 3KQXA 4TSSA 4KY5A 1IHZA 1BBXC 3TMEA 5IGGA 1XYIA 4G7HC 1TS3A 1Y69U 2CVRA 5DS0A 3CT9A 3GB0A 1CI3M 4X2TA 1D2BA 1RTOA 2Z8LA 2IPKD 1SFOB 5LL6S 3DLJA 4UIBA 2IX3A 1V43A 5DM63 5C0XI 1EE3P 3QNVA 3KBGA 2XWJB 2F0OA 5I9PA 1TWGB 1PZID 1PTOH 5IT9E 4UEEA 2PJCA 2OT2A 1F2MA 3GTOB 4XTCS 2XEJA 1RODA 1SNMA 3D66A 1TWFB 2FVGA 1WVLA 4BBRB 2ENBA 1ET9A 5HVHA 3B35A 2JBJA 2VB2X 1WD1A 4IFDJ 2EY2A 3DXJC 4Z9CB 1PCAA 3FEDA 4C3IG 2K32A 2PIZA 1BAVA 3G6JB 3MVVA 1Q3LA 2NVQB 2WAQB 5G3LF 5K5PA 4A3EB 1PYTB 2N55A 4DU9A 2BOAA 4MHPA 3E6ZX 1IW7C 2MPMA 4ZUJA 1EU3A 3BVGA 1PZJD 3GV6A 4KY6A 4I65A 4NKLA 2LKVA 4E6IA 4QB4A 1VF7A 3I90A 1CA5A 4MRIA 3FDTA 1FGBD 5I4DA 1CX8A 3I4MB 2JA7B 3QO2A 2GU2A 5HVFA 4X3UA 2I46A 4R6TA 4FF2A 2XEIA 5EJWA 4HN7A 1F9QA 1EFID 2K5DA 4OIJA 5K36H 2B2UA 5ELDA 2M00A 3OOCA 2NTSA 1DE4C 4IUNA 1B53A 3B3TA 1TKWB 4KD4A 4DFAA 4DK0A 2RBMA 4K5WA 2WYRA 1ICWA 5CPAA 4I7ZC 5CV5A 3EROA 1MSHA 1CG2A 1VIXA 3C3LA 5FO8B 3EJIA 6CPAA 1B1ZA 1JWUD 2PQEA 2O4HA 1BQQT 5C4ZA 1GUTA 1G91A 3GV3A 3MEHA 4BBSB 3U9OA 4NGQA 4IZ8A 1PRTB 1II3A 1GHKA 4RKLA 3MWYW 4X3KA 1IL8A 3LWEA 4P10A 3OIPA 3J80L 3GUXA 2AWNA 1WTRA 4FF3A 3V2TA 3DEOA 3IIBA 3QB3A 3KF8A 1O7YA 3HOUB 4RH6A 5K36G 4ID6A 1XJOA 1D5XC 1F2LA 5FLXL 2RB7A 3MXGA 3OPOA 3S2DB 5KGUA 2NYZD 4RFBA 1CHQD 3K57A 2Z4HA 2RDGA 1SE2A 4FXGC 2WB1B 3P20A 2Y0SB 3ONAB 1LAMA 2LY7A 4P4BA 3S1RB 2XRQD 4CKEA 3S2HB 1KDAA 1B50A 2LFNA 5DEHA 4ONWA 1O80A 4MCPA 1KNEA 1R43A 3G7LA 2VNUD 2MP1A 1KWMA 2Q4ZA 1IKLA 2BCOA 2B2VC 2RQXA 3EQLC 1ZG7A 3PUZA 4HCSA 1A2TA 3RD4A 4UF4A 3NUCA 3VYRA 3J7YW 4FVMA 5IGBA 3BZDB 1Y8PB 4H44C 1YNND 1XX8A 2JA8B 3B3WA 3D67A 4UDUC 2ZEHA 3D7FA 4OC1A 3P7JA 4NMZA 2EOTA 7CPAA 2YU9B 1STAA 2F0SA 2X6GA 1JQGA 2XN9C 4M1UB 2IJ0A 2PW7A 2AFUA 4EQOA 3GTLB 4NJRA 1TU2B 3D4RA 1SMYC 1UWYA 3D6CA 1LTBD 4HR7B 3JAME 3P75A 1RKNA 3TP6A 5EPJA 4ZKCB 1HHVA 2FHTA 4C1NI 4RHSA 3MXPA 1JQYD 5M5WB 3S15B 4HMJA 2RDFA 4MCRA 2AQ2B 1JWSD 1EQVA 1ZYRC 3B3VA 5BN3A 2K05A 1TWCB 2IX1A 4B6ZA 4R7MA 1FNVA 5I4MA 5K8PA 4P2CB 2RKSA 3OWEB 4AYBB 4RUHA 4RGTA 4NGMA 1GUGA 1NCVA 1TY0A 1KLGD 3FPPA 3GO5A 1HDUA 2ABZA 1F9RA 3H8EA 2A5HA 3FX6A 4LAAA 3OSOA 1B9NA 2POKA 1R4PB 3WOFA 3S9LA 4KKTA 5IT9L 4WRDA 4JYWA 2PVVA 5HVGA 1B9MA 1DD2A 2PJ7A 2ZOFA 5JOBA 4KHVA 1I6HB 4C3HB 2Z1CA 3KLSA 3GTJB 4MHEA 3FEEA 1OXTA 5J1QA 4FXKC 2O53A 1WCMB 2K04A 2ICEC 1QNKA 2BOSA 2E76C 3GTPB 5NUCA 3WT4A 3SK8A 3IC1A 3D4WA 3M4OB 1E2WA 1B44D 5JPNC 2GREA 5COYA 2QEJC 1A3VA 3GTGB 2GLJA 2F0EA 3LWUA 2KOLA 3PUXA 1QNUA 4Q0FA 4PMBA 2WV6D 4FWUA 1SBBB 2WIIB 4Q5VA 5EPLA 1SMYD 2R92B 1YMEA 3N6RA 3B2YA 2PJ6A 1I4RA 3PRTA 4K6LA 3NBHA 2EYHA 4DAPA 1CPXA 2NB0A 5E3FA 5FO7B 1LTTD 1MSGA 3TSSA 1BNZA 3KZWA 2ZEDA 5FOBB 3H8FA 2G9HD 2NVTB 4G4KA 3C46A 5LRKA 5CV4A 1SNQA 1NSAA 2J7ZA 3IL8A 4ZYSA 1PLFA 1BOSA 3R3OA 3VR5A 1I6VC 2F0UA 3UI2A 2IW3A 5CC4A 3GD7A 3T53B 2HQEA 3TX8A 2NSMA 5C3EB 1CHPD 4U673 1H9KA 4C3IB 3ZYYX 1EWCA 3GP7A 4IAVA 5K8NA 3IWWA 3EVQA 1LTRD 1HQMC 3VR2A 5C0XH 3NQIA 3NH8A 1DONA 3DWQA 1A3UA 1JORA 1DTDA 1MBYA 1ENFA 3S1QB 2QCPX 3PMFA 2R7ZB 2C6CA 2F8HA 1EY7A 3NTHA 4S3SA 4C56C 3VH9A 2PJ4A 3K0YA 1L0XB 3QOJA 3CKIB 1EU4A 4CKCA 1XWEA 1PTOB 3QIAA 4IUPA 1PRTD 2WACA 1VHEA 3FECA 4P4DA 4J6HA 4TNUA 1JICA 2PO4A 4P6YA 2AFXA 3S17B 4G7ZC 1CFMA 3C1FA 5C5LA 3PIO3 5IIFA 4C3JG 3I70A 4A3JB 3NFZA 1V8QA 1BLLE 3D6WA 3PUWA 4ME5A 1V1PB 3W3AA 1JB3A 1TVXA 3BDOA 4DXGA 1YW4A 1FNWA 2XWBB 4MHZA 1S5ED 2OEOA 3E0JA 1I4QA 4BA1I 5C0XG 1ARLA 3QWNA 3S16B 3V05A 3FKIB 2EY6A 3D7HA 4G1PA 2D9UA 4PXEA 5M5XB 1VHOA 5BN5A 4HSPA 1ARMA 5ELYA 3VYUA 3TN2A 4A3IB 1Z2LA 1LTGD 4FYDA 1PDQA 3AB9A 2XVSA 2O4XA 3Q0AA 1ESRA 1H9RA 2D62A 2IT1A 4PQXA 1C8CA 1LT5D 4NW2A 4RWSC 4DA2A 3K6OA 1DXMA 4XDXA 2PJ0A 3NH5A 1F2YA 4PNYA 2SDFA 3L9AX 2NWGA 2NN6H 3TC8A 3VYSA 1Y0RA 2JEAI 3S9NA 1GOZA 4EQNA 2FINB 3JAML 4ZQ3A 3H94A 3KUPA 5ELFA 3KL9A 3ND8A 4R9WA 1TT2A 5ELEA 1JCKB 1TWAB 2I07B 1AEXA 4HSVA 3VA5A 1TKHA 4FAIA 5LYDA 3IEHA 5CGKA 4XIGS 1PXUA 2TSSA 4P45A 3LNNA 4P4EA 2QDBA 4PV1C 3BS1A 1HQRD 1I4XA 2RSNA 3KK7A 2F0HA 1QCBD 3D7GA 1JOOA 3N5FA 4KHZA 4ZUIA 3HZXA 1CQFA 1DM0B 3NQTA 3FVLA 2AFSA 3K5LA 1WTQA 5LRJA 3WOEA 5FO9B 3SI2A 3RAMA 2F0WA 1CZWA 4G7OC 2PNRC 1H9JA 5A2QE 5THWA 4ZX8A 2F0GA 1BCPC 5LYFA 2EYPA 3T16A 5E4XA 3PB9X 1HA5A 2MJ8A 2F0MA 2HCCA 4HTHA 1F2OA 2PCFB 1CBXA 5I2YA 4IN3A 1J8IA 4XQNA 4RCNA 4DNTB 4OC2A 3NWSA 2D5DA 4A38A 2AQ1B 1LT6D 3K5OA 3U9SA 2QILA 4A3DB 2V4DA 1STHA 2ZXOA 1I4HA 5KYLA 1E0BA 5EPKA 3RZDB 3BDCA 2PE3A 3P1HA 4P4IA 2F0IA 2PCUA 2EDGA 3C1EA 1LACA 4OIDA 2XRSD 2A68D 3FPUB 1F2ZA 1STBA 2K5QA 2ZEOA 3MFYA 1PTOC 2FMCA 1SNOA 2CTCA 2IWHA 1Z6HA 1Q90A 2RDHA 1ZKOA 2IJZA 3M7GA 1R4QB 1TS4A 5C5MA 1S5FD 4RCOA 1ILQA 2O2LD 4OMEA 2O5JC 1GJXA 3NXWA 3JRUA 2JP1A 2B2UC 3MZ5A 1LANA 2B2TA 4UEZA 1HTLD 3CRLC 2NUCA 5C4HA 3WC5A 1MD2D 2QJ8A 2DEAA 4P44A 4PMWA 8CPAA 2NN6I 3HEJA 2JXMB 3K5MA 3URYA 1RTQA 3SK6A 4F8ZA 1UNSA 4L63B 1PRTF 1LV9A 5LYIA 3I3CA 3O13A 2B8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LQG A;  1DCZ A;  4MCR A;  3M85 A;  1HPC A;  2C1C A;  3I1U A;  1H9S A;  3T56 B;  1ZYR C;  3B3V A;  3A7L A;  3CDX A;  5BN3 A;  2Q43 A;  4K3N A;  4B6Z A;  5JEA H;  2QVP A;  4R7M A;  2NN6 G;  5I4M A;  5K8P A;  1YNJ C;  1GYT A;  4Z65 A;  2CW0 C;  2AFO A;  3KHX A;  4R76 A;  4DYO A;  1FR3 A;  1FT7 A;  4RUH A;  4NGM A;  1GUG A;  2CIJ A;  4ZY1 A;  2JEB I;  3FPP A;  4F9U A;  1HDU A;  2ABZ A;  4H0L C;  1TKF A;  1Q1E A;  3H8E A;  3FX6 A;  2AFW A;  3PB6 X;  1K8O A;  3ISZ A;  2OR4 A;  1B9N A;  1YLO A;  1VGY A;  4KN7 C;  2POK A;  2PJB A;  4X3R A;  4IK2 A;  2EWB A;  3S9L A;  3KLR A;  3T8W A;  5F09 A;  4KKT A;  4OC4 A;  2B8G A;  3I73 A;  4MHY A;  3OW7 A;  2Q8I B;  4Q7A A;  1E2V A;  4JYW A;  1IW7 D;  2AWO A;  2PVV A;  3FF3 A;  5HVG A;  1B9M A;  1DD2 A;  4OO1 H;  1IGB A;  3L2N A;  2PJ7 A;  1Y0Y A;  2ZEG A;  2ZOF A;  3MXU A;  1ZG9 A;  2K33 A;  3HUV A;  1BPN A;  1HDQ A;  3FEE A;  1OXT A;  3A8K E;  4ZI6 A;  5J1Q A;  2O53 A;  3BHX A;  3SJG A;  2EJF C;  4WWV A;  2E76 C;  3T51 B;  1XFO A;  3VAT A;  1HCZ A;  3GQB A;  3WT4 A;  3IC1 A;  3PB8 X;  1H9M A;  1AMP A;  1E2W A;  1VDZ A;  4YWY A;  1FNO A;  1O7L A;  1ONL A;  4NGN A;  4OP4 A;  2GRE A;  2PJ8 A;  1H8L A;  2GLJ A;  5JEA G;  5LRG A;  3LWU A;  3KQZ A;  3PUX A;  4OC0 A;  1QQ9 A;  3PUY A;  1TKJ A;  4FWU A;  3V7Z A;  2GLF A;  4A94 A;  3PBE A;  3BG3 A;  3B2Y A;  1GUS A;  1YME A;  3I72 A;  1GUO A;  3A8J E;  3N6R A;  2PJ6 A;  4H13 C;  4FBE A;  4DJL A;  5K8M A;  2EJM A;  3PRT A;  1VCI A;  2C6G A;  4WJB A;  1ZLH A;  2EVB A;  4JK1 C;  1CPX A;  3PFE A;  1HEE A;  3PBB A;  2ZT9 C;  4TQU S;  1XBU A;  3KI9 A;  2KCC A;  2RFH A;  3NA6 A;  1BDO A;  3KZW A;  2V77 A;  4W9Y A;  2ZED A;  2E74 C;  4R8F A;  2F1M A;  4DNR B;  2BO9 A;  2V8V A;  2JEW A;  3H8F A;  4OO1 G;  3ND9 A;  4GZY C;  2JE6 I;  1Q12 A;  2ZEL A;  3SE0 A;  5LRK A;  5KNC A;  3H8G A;  1NSA A;  2PRQ A;  1OXU A;  1LFW A;  4MCS A;  2ZEN A;  1Y7E A;  4EWT A;  3VR5 A;  2XEF A;  1I6V C;  1QJO A;  4NGT A;  3GD7 A;  4KMU C;  3T53 B;  3B3S A;  3TX8 A;  4NGP A;  2NSM A;  5BN4 A;  4A39 A;  2ANP A;  4GM5 A;  2AFM A;  2O5I C;  1TF8 A;  1Z5R A;  2HB6 A;  3K9T A;  1H9K A;  1CPS A;  1F57 A;  4MCQ A;  3K2K A;  1GHJ A;  1K8M A;  3SI1 A;  3RBU A;  1TF9 A;  4IAV A;  5K8N A;  3IWW A;  4NGS A;  2A68 C;  1HQM C;  3VR2 A;  1IY7 A;  1CP6 A;  1O78 A;  5C0X H;  1OBR A;  4KSI A;  3NH8 A;  5JGF A;  4PXB A;  1DTD A;  1XRY A;  4IHM A;  4OKO A;  4NJQ A;  3CPX A;  2PIY A;  5D8N A;  1QMU A;  2C6C A;  4PQA A;  2F8H A;  3FMC A;  1YNN C;  1OXS C;  1M4L A;  5D29 A;  3VH9 A;  2PJ4 A;  4DK1 A;  4NGR A;  4JZ0 A;  3KQX A;  3IO1 A;  2DNE A;  3VR4 A;  2PVW A;  1Y8N B;  4ZYQ A;  4PXD A;  2PJ3 A;  3FJU A;  3VA7 A;  4G7H C;  1Y69 U;  1OXX K;  3D31 A;  3QIA A;  5DS0 A;  3SJF A;  3CT9 A;  1VHE A;  3FEC A;  1CI3 M;  3GB0 A;  4X2T A;  3DLJ A;  4P4D A;  4UIB A;  1IYV A;  4TNU A;  4ZY0 A;  2A6H C;  1V43 A;  2ZEM A;  5KND A;  2BA1 A;  4LK1 C;  2AUJ D;  1EE3 P;  3QNV A;  2AFX A;  2CTB A;  4P6Y A;  4G7Z C;  1CFM A;  1YW6 A;  2QYV A;  5CBM A;  3NFZ A;  1V8Q A;  3M7N A;  1BLL E;  3QG1 A;  3PUW A;  4X8I A;  2BE5 C;  3W3A A;  2D2C C;  1R3N A;  2QF7 A;  2PJA A;  3IJ3 A;  3V38 A;  4FUU A;  3BDO A;  3VR3 A;  1YW4 A;  3M4Y A;  4KI0 A;  5A35 A;  4UEE A;  2PJC A;  4MHZ A;  4XTC S;  4P4J A;  4BA1 I;  5C0X G;  1ARL A;  1Q7L A;  2XEJ A;  3D66 A;  2WZN A;  3DGV A;  2ZEF A;  3D7H A;  2FVG A;  3PV0 A;  1E2Z A;  4EFD A;  4EME A;  3PB4 X;  1IYU A;  2K7V A;  5HVH A;  3B35 A;  3SI0 A;  4G1P A;  2JBJ A;  4PXE A;  1CP7 A;  3B3C A;  5HXD A;  1VHO A;  5BN5 A;  4TKO B;  3DXJ C;  1ELL P;  1ARM A;  4KN4 C;  1PCA A;  5ELY A;  4JBW A;  4LJZ C;  2HC9 A;  1Z2L A;  2K32 A;  2PIZ A;  3FED A;  3VAR A;  3AB9 A;  1BAV A;  2NYQ A;  3BI0 A;  1H9R A;  2D62 A;  1Z8L A;  2OOT A;  2IT1 A;  1FYC A;  3WDN A;  4NFR A;  1Z7T A;  4BD9 A;  3D68 A;  4CPA A;  1PYT B;  1DXM A;  1ELM P;  3NH5 A;  2PJ0 A;  2BOA A;  4MHP A;  1IW7 C;  3KAS A;  2AUK A;  3WC7 A;  5LYL A;  3TC8 A;  2NN6 H;  5K8O A;  1Y0R A;  2JEA I;  3S9N A;  1BPM A;  1VF7 A;  4MRI A;  2IMO A;  3H94 A;  2V8H A;  1CX8 A;  4PXC A;  3KL9 A;  3ND8 A;  3MN8 A;  2GU2 A;  5HVF A;  4R6T A;  2I3C A;  2ZEE A;  3PUV A;  2XEI A;  3WAB A;  4UEF A;  5K36 H;  3KR5 A;  3BI1 A;  1TKH A;  4FAI A;  2J9A A;  4OC5 A;  3OOC A;  2G9D A;  5LYD A;  5KNB A;  1PMR A;  1DE4 C;  2A6H D;  3IEH A;  3B3T A;  3RZA A;  1TKW B;  4DK0 A;  4XIG S;  3A8I E;  4O23 A;  3IKJ A;  3BXM A;  2WYR A;  4P45 A;  5CPA A;  2A6E C;  4I7Z C;  3LNN A;  4P4E A;  4PV1 C;  1CG2 A;  1VIX A;  3SJE A;  1Y8O B;  3KHZ A;  6CPA A;  2DN8 A;  2F7V A;  1YSJ A;  1TXR A;  2O4H A;  3D7G A;  2BE5 D;  3N5F A;  1GUT A;  4KHZ A;  3MRU A;  3FVL A;  2AFS A;  4L8J A;  1ZG8 A;  4NGQ A;  2XEG A;  2KA7 A;  1GHK A;  5LRJ A;  3SI2 A;  3RAM A;  1OXV A;  1Q1B A;  4G7O C;  4YU9 A;  2PNR C;  3WC6 A;  2Q51 A;  1H9J A;  4P10 A;  1F2P A;  1G29 1;  2EK9 A;  3CRK C;  1GUN A;  3GUX A;  5THW A;  4ZX8 A;  5LYF A;  2PJ2 A;  3S9M A;  2L5T A;  3IIB A;  3PB9 X;  2YYZ A;  3RLF A;  3LMS A;  1F2O A;  2PCF B;  5K36 G;  1XJO A;  1CBX A;  2JBK A;  1A6X A;  1ZLI A;  2RB7 A;  3NH4 A;  2A69 C;  3OPO A;  4RCN A;  4DNT B;  4PPZ A;  4OC2 A;  4TWE A;  2PJ5 A;  3IFT A;  2D5D A;  1LAP A;  4A38 A;  4F9V A;  3I4L A;  2BDO A;  3TZU A;  2PJ9 A;  1LAB A;  2VL1 A;  3U9S A;  3P20 A;  1AYE A;  1VF5 C;  4OGQ C;  3GLJ A;  1LAM A;  3CPA A;  3PFO A;  2LMC B;  3VR6 A;  3B7I A;  2V8D A;  4P4B A;  2PPB C;  4UIA A;  3PB7 X;  4DUK A;  4IFD H;  2V4D A;  5JH9 A;  3PEI A;  1LOK A;  2CF4 A;  4MXU A;  2E75 C;  4ONW A;  4H2K A;  4BA2 I;  2R6G A;  4MCP A;  1EWH A;  3A7A B;  2PE3 A;  4ZX9 A;  2ZEP A;  1R43 A;  4P4I A;  2BA0 A;  1H9S B;  1KWM A;  2Q4Z A;  2BCO A;  2PCU A;  2EDG A;  4OID A;  1LAC A;  4MHN A;  2A68 D;  3EQL C;  5IB9 A;  4AXV A;  3KGQ A;  2A6E D;  1ZG7 A;  3PUZ A;  4MMO A;  2ZEO A;  3MFY A;  4UF4 A;  2PJ1 A;  1XMB A;  3SJX A;  4P4F A;  1CTM A;  2CTC A;  1Z6H A;  1Q90 A;  1LCP A;  1HTP A;  1Y8P B;  4H44 C;  1ZKO A;  2EK8 A;  2IJZ A;  3KR4 A;  4IQZ A;  3B3W A;  3D67 A;  3D4U A;  3L7Z C;  3IFE A;  2ZEH A;  3D7F A;  4OC1 A;  2ZOG A;  7CPA A;  4KKU A;  4OIW A;  4OME A;  2IQ6 A;  2O5J C;  1T5E A;  1GJX A;  4A37 A;  3JRU A;  4KKS A;  1JQG A;  3FH4 A;  3SDZ A;  2AFU A;  4ZY2 A;  1LAN A;  2V8G A;  3D7D A;  4UEZ A;  3CRL C;  4NJR A;  3HGB A;  3QJY A;  1TU2 B;  3D4R A;  1SMY C;  4OC3 A;  4IFD G;  2DNC A;  3WC5 A;  1UWY A;  2QJ8 A;  2EJG C;  2AFZ A;  2DEA A;  4P44 A;  8CPA A;  4HR7 B;  2NN6 I;  3NE5 B;  5JM6 A;  2JXM B;  3ISX A;  4F8Z A;  1RTQ A;  3HLP A;  2A69 D;  2C6P A;  5LYI A;  2B8F A; 
#chains in the Genus database with same CATH topology
 4K14 A;  1GVP A;  2R7D A;  1PZK D;  4BWG B;  2FS5 A;  2JSO A;  2EE1 A;  2C1C A;  2E2D C;  3T56 B;  1ENA A;  4DV6 L;  2CCZ A;  1KTK A;  1K0R A;  3A7L A;  3S14 B;  4IJL A;  2UXB Q;  5H1S E;  1WYD A;  4DN4 M;  1PFN A;  5CNP A;  1O7Z A;  4DV0 Q;  5JEA H;  1Z8T A;  3A5Z B;  2ZJP A;  5C0X J;  2HD3 A;  4FF1 A;  1GYT A;  1ML0 D;  2CW0 C;  3KHX A;  1FR3 A;  2KEC A;  4B9W A;  1X3P A;  1X3G A;  1KLU D;  3PZJ A;  1EQR A;  4ZY1 A;  4OX9 L;  1UAP A;  4UP7 A;  2B2Y A;  3NBH B;  1TKF A;  4JI2 L;  1HRJ A;  1YVK A;  2OCE A;  3DLL A;  4NDX A;  1AE2 A;  4OIK A;  4XPD C;  2B2Y C;  2OR4 A;  1YLO A;  2EIF A;  3L3O C;  3VYT A;  2PJB A;  4ONU A;  4X3R A;  1TWH B;  4XQQ A;  2JA6 G;  1M4I A;  2J8R A;  4BS9 A;  1A8V A;  3J81 E;  3AMU A;  5I9O A;  2BH8 A;  1WOC A;  3OHX C;  1E2V A;  1IW7 D;  2AWO A;  1IBK L;  1L1O C;  5M9O A;  2K14 A;  1VQN A;  1IGB A;  3PF4 A;  2ZEG A;  2H5X A;  2N78 A;  1JMC A;  3D3S A;  4A3K G;  4LNQ A;  4DV3 Q;  1LUZ A;  4FD6 A;  1ZG9 A;  4GKK Q;  1HDQ A;  3RO0 A;  4CBV A;  3S6K A;  1AZQ A;  1KHI A;  3SVM A;  4ZI6 A;  2R93 B;  2K5V A;  1HZA A;  5CBE E;  5J22 A;  3FHW A;  3R95 A;  2EJF C;  3SJG A;  3K7A B;  5CR3 A;  3VAT A;  2C5C A;  2F0T A;  1W6J A;  5KRU A;  4XXE A;  3PIP 3;  1VQO A;  2F4I A;  1AMP A;  3SHP A;  3LGJ A;  4NGN A;  4QL5 A;  4MNO A;  1QSR A;  5JEA G;  4Y7N B;  4WOR A;  4OEL B;  1SFO H;  2PI2 A;  4O42 A;  4B5O A;  5IYD H;  1EYG A;  3HOY H;  1BXT A;  3RN5 A;  1TKJ A;  4Y49 B;  1V1O A;  3V7Z A;  2J0T D;  4ME3 A;  2JA5 H;  3BG3 A;  1QB5 D;  4H13 C;  1VQP A;  2OWO A;  5T1I A;  4OO1 I;  3FNC A;  4RN7 A;  4DJL A;  5K8M A;  2EJM A;  4GOP B;  1XNQ L;  3CXS A;  2C35 B;  2C6G A;  1Z47 A;  1Z4R A;  2F0K A;  3AYH B;  4J1M A;  3T4A C;  5C4J B;  4WJB A;  4UCP A;  4PV6 A;  4JK1 C;  4RGN A;  3SHL A;  3PFE A;  3H91 A;  1IID A;  4K2K A;  5BR8 Q;  1XBU A;  4A3F H;  5EKK A;  2KCC A;  2RA4 A;  3OW2 A;  1M4V A;  4RMF A;  4W9Y A;  2PYK A;  4DUY L;  4C3J B;  1MJE A;  2F1M A;  3NTK A;  4L5Q A;  1I12 A;  3TS0 A;  3D8P A;  2BO9 A;  2BUE A;  2V8V A;  2VEZ A;  1UEB A;  1X12 A;  1Q12 A;  2JE6 I;  1VQK A;  2EXZ A;  1EEI D;  2L12 A;  4J8Q A;  4UPA A;  1TWF H;  3TQY A;  1L2F A;  3SXH A;  1YJ9 A;  4R4Q A;  3SE0 A;  3HOV H;  4XYQ A;  1OXU A;  2CH4 A;  1A2U A;  2Q2U A;  4UY8 C;  1LFW A;  4K0K L;  4KSA A;  4X3T A;  4MCS A;  2ZEN A;  4EWT A;  3SXN A;  2PR1 A;  3UDG A;  1Z9U A;  4NGT A;  1K73 C;  1BR9 A;  1I5F A;  5AFW A;  4KMU C;  3B3S A;  1FGU A;  5D65 A;  1SR3 A;  1YI2 A;  5C4X H;  4DR4 L;  5BN4 A;  2ODF A;  4ZKB B;  2VI7 A;  2AFM A;  4XQJ A;  2O5I C;  1Z5R A;  4MIU A;  2J8M A;  2HUG A;  3K9T A;  4A3E H;  3TE4 A;  3FVQ A;  1F57 A;  1HZB A;  3MAQ A;  2VQE Q;  4GNX B;  1K8M A;  3HOY G;  4C2X A;  3NK9 A;  3IRB A;  5IGC A;  4OHJ A;  3RBU A;  2JA5 G;  3EA6 A;  1VQ8 A;  4RKB A;  1NTG A;  5A2Q L;  1G6P A;  1FNU A;  4DR7 L;  4F8M A;  4B13 A;  3A54 A;  1OBR A;  2IL4 A;  5HY6 A;  1R9T H;  1S7N A;  1VQA A;  2CHB D;  3I4M H;  1Z4E A;  2UXD Q;  1XRY A;  1NUC A;  4F7X A;  3FEW X;  4HED A;  2VUM H;  4A3F G;  1YVC A;  4LF7 Q;  2XNA C;  5D8N A;  2A19 A;  4IAL A;  2G3T A;  1SNP A;  1PH1 A;  4L8A A;  4PQA A;  5D29 A;  1M4L A;  1F77 A;  3F2C A;  2HDM A;  3PO2 B;  2PI2 E;  3TT2 A;  3SK4 A;  4MN3 A;  1G8Z D;  1FD7 D;  1EIG A;  4LF6 L;  2CQO A;  3VR4 A;  1HNX L;  1Y8N B;  2F0P A;  1LTL A;  2PJ3 A;  3FJU A;  1PH9 A;  4R8N A;  1OXX K;  1X54 A;  3D31 A;  3HOV G;  1EOV A;  1SNC A;  3SJF A;  2EZV A;  4FD5 A;  2L11 A;  3S1M B;  2F0N A;  3WR7 A;  4N9P A;  1VMP A;  2KEN A;  1IYV A;  1U4P A;  3Q23 A;  2K5W A;  2ZJQ A;  1EL0 A;  1WTH A;  1IB1 E;  3ZJY C;  4ZY0 A;  2A6H C;  4KTA A;  1HNW L;  2ZM6 L;  1B8A A;  1BKB A;  2Z6K C;  2BA1 A;  3DDD A;  3IFD A;  5F48 A;  2AUJ D;  4F88 A;  4MBU A;  2Y0M A;  3QB8 A;  5COR A;  2EQS A;  2EYL A;  1NNX A;  3R8B A;  1YW6 A;  2QYV A;  5C4X G;  1UEA B;  1YIT A;  2NZO A;  3M3Y B;  2QA4 A;  4K5V A;  1EY6 A;  2NVY B;  2BH2 A;  1HFG A;  3H0G H;  3QG1 A;  4WFN 3;  2MO0 A;  2KUM A;  3V38 A;  2D2C C;  1R3N A;  2QF7 A;  2PJA A;  3IJ3 A;  4PG3 A;  3M4Y A;  3IAY A;  5A35 A;  1CQV A;  1S7L A;  1VMC A;  4P4J A;  2K5N A;  1DZ1 A;  4U68 A;  1TY2 A;  4KJO A;  1Q7L A;  2ZXV A;  1STG A;  4UHV A;  1WTV A;  3S6H A;  1UE1 A;  3A56 A;  3W2D A;  3I4M G;  2WZN A;  2B2W A;  2EO8 A;  1I1D A;  1P16 A;  1N34 L;  3PV0 A;  2VUM G;  4EME A;  4TRD A;  3TP7 A;  1IYU A;  3PB4 X;  2YNC C;  4DV1 Q;  2FE7 A;  2F3W A;  1Y9K A;  2C9O A;  1CP7 A;  1RCV D;  3KOJ A;  1EQQ A;  3ERS X;  4TKO B;  2F03 A;  3PIP A;  4PK2 A;  2B63 H;  1ELL P;  1NSN S;  1CA6 A;  4A3G B;  4JBW A;  4LJZ C;  1B87 A;  2HC9 A;  3VAR A;  3J80 c;  3KLS X;  2NYQ A;  4FF4 A;  4JYA L;  1LTI D;  2CNT A;  4YY3 L;  1CKN B;  2MFI A;  1JOQ A;  1Z8L A;  2R98 A;  3BI0 A;  2OOT A;  2K52 A;  3CC2 A;  3R9E A;  2L9H A;  2V1C C;  3KYH C;  4NFR A;  1Z7T A;  2F0J A;  1WD0 A;  2RCN A;  2B4D A;  1KD1 C;  1ZYR D;  4HNY B;  3D68 A;  4CPA A;  2OTL A;  4KY7 A;  3EFX D;  2JYO A;  1ELM P;  3NP8 A;  5D14 A;  5J8F A;  2AUK A;  3WC7 A;  2GVA A;  2I79 A;  1BCP B;  2KEE A;  2P6G A;  5K8O A;  4UCN A;  2FIW A;  2JK8 A;  3S1R H;  2UUC Q;  3H3V C;  1BPM A;  1SYB A;  2BDN A;  2WAQ E;  1PV4 A;  4KK7 A;  4DV5 Q;  2V8H A;  2I5L X;  4PXC A;  3S24 A;  3H0G G;  2UXC Q;  4R4I A;  5CMD A;  3MN8 A;  1U4M A;  1VQG A;  2Q8T A;  2ZEE A;  3K8A A;  3MC0 B;  3PUV A;  4EX5 A;  4BY1 G;  2UU9 L;  4UEF A;  3BVZ A;  3BI1 A;  4A76 A;  3PO3 H;  4A93 H;  2J9A A;  4R3L A;  3MTS A;  2XIW A;  4MY0 A;  4HAE A;  1D5Z C;  3HS0 C;  5KNB A;  2E5L Q;  1JE4 A;  2E8G A;  2KCT A;  2OH1 A;  4L6T B;  2A6H D;  2RHS B;  4A3C H;  3RZA A;  2VW9 A;  5KTA A;  3GTQ H;  1TR5 A;  2ZW6 A;  2PMZ E;  1W3S A;  3A8I E;  3IKJ A;  4UP8 A;  4YIJ A;  4B3M Q;  2A6E C;  3KDF B;  4N8X 1;  4GXH A;  1KC8 C;  3DHQ A;  5EKI A;  4MFK A;  1PFS A;  4Y49 C;  3X3M A;  2B63 G;  3G4S A;  3KHZ A;  2GN5 A;  3E9I A;  1AUG A;  2F7V A;  3L2P A;  1CK1 A;  4IOA A;  4GOP C;  4MFZ A;  4HNX B;  4UAI A;  2MHV A;  3D3R A;  1X10 A;  4CDD C;  2SNS A;  2CWA A;  4NP5 A;  4GKJ Q;  4QCL A;  5M3M B;  4C2M B;  1M4D A;  3MRU A;  2ZXP A;  2E2H B;  2J4X A;  2WB1 G;  1ZG8 A;  4R1J A;  3J81 L;  3HOW H;  3J81 i;  2XEG A;  2KA7 A;  2WKD A;  3GTL H;  4QF4 A;  5JEA J;  2AE6 A;  1EEF D;  1GO3 E;  1OXV A;  1D5M C;  4YU9 A;  4C7I A;  3WC6 A;  1HR0 L;  2REF A;  2EK9 A;  2AMC B;  3CRK C;  3CQZ B;  3M9B A;  5TSS A;  2Z0Z A;  2JA9 A;  5M5Y B;  2CFM A;  4JV5 L;  5E4W C;  1K83 B;  4NF1 A;  3CC7 A;  1Q2Y A;  4MFQ A;  1UE6 A;  5C44 B;  1XMO L;  2L5T A;  2IX0 A;  2K6A A;  4LF4 Q;  3ICE A;  3I8Z A;  5M5W H;  4FNF A;  1EYD A;  2AQ3 B;  4JVZ A;  3GTM B;  1SEB D;  1QWY A;  3LMS A;  2X69 A;  5IOD A;  1TS2 A;  3I4N B;  4L5R C;  3PO3 G;  4A93 G;  1A6X A;  3W91 A;  1ZLI A;  2PQA B;  3NH4 A;  2A69 C;  5GAE C;  4AB7 A;  2IHF A;  2CNS A;  1SYC A;  4RAU C;  1TWC H;  4DF7 A;  1KQS A;  4A3C G;  1YJN A;  2PJ5 A;  3IFT A;  4A3B H;  5EBV A;  4F9V A;  3I4L A;  3TZU A;  2PJ9 A;  5LMU Q;  4HJ7 A;  1GXD C;  3KFU A;  2ZTD A;  2N88 A;  3J80 E;  3S6F A;  1NY4 A;  4NEX A;  4Q38 A;  3UY5 A;  2F4V Q;  1C48 A;  2VL1 A;  4B3R Q;  3CMA A;  1VF5 C;  2PR8 A;  4OGQ C;  2OXP A;  3CPA A;  1I3Q H;  2LMC B;  3B7I A;  2V8D A;  2WFW A;  4NXM L;  5IY0 A;  1S5D D;  1KXL A;  1NMG A;  1LOK A;  2WPX A;  2E75 C;  1K3B C;  2D0O A;  1E7Z A;  5DM7 3;  2WB1 E;  1X32 A;  5EQ0 A;  4X66 Q;  2R6G A;  3HOW G;  4BA2 I;  4H2K A;  4IPC A;  3BZC A;  3TDQ A;  3CCV A;  2FT0 A;  1DGS A;  2ZEP A;  2WKC A;  4LW1 A;  1SXT A;  2K5H A;  5CV9 A;  4FP5 D;  1I6H H;  2BEI A;  4KSF A;  4C3H H;  2X7B A;  3KGQ A;  2A6E D;  3GTJ H;  4AXV A;  1PFB A;  3CCE A;  4CGO A;  3A9L A;  4B3T Q;  4RHR A;  1XF8 A;  2A74 C;  1KAA A;  1WCM H;  5IT9 c;  1CTM A;  3GTP H;  4A3K B;  1IBM Q;  5C6A A;  1EQT A;  1EYC A;  5GAD C;  4A3M H;  1YNX A;  2EK8 A;  1JT8 A;  3LX0 A;  3E5S A;  4X3S A;  3HP3 A;  4C2Z A;  3KR4 A;  4IQZ A;  4IFD I;  3SGI A;  2PSW A;  4ZCK A;  3D4U A;  3NEL A;  2TMP A;  1SE3 A;  3D4D A;  5I6W A;  5M3F H;  4A3B G;  1D8L A;  2ID0 A;  3B6Y A;  4KKU A;  4LF9 L;  4BY7 H;  5IV0 A;  5EBD A;  4OIW A;  2IQ6 A;  1HXY D;  1STY A;  3NHH A;  2VQY A;  4KKS A;  3K58 A;  2R92 H;  4AG9 A;  4R3K A;  3SDZ A;  2A73 B;  1K3R A;  4ZY2 A;  1T5X D;  4DAV A;  2V8G A;  3MFG A;  4EQ5 A;  1HUM A;  4KLW A;  4PZ8 A;  3QJY A;  3BJ8 A;  4K30 A;  1N32 Q;  1KZF A;  5EGT A;  4OC3 A;  4M6I A;  1S60 A;  2E2J H;  4LF5 L;  2PW5 A;  1Q2C A;  2AFZ A;  3NE5 B;  1SQH A;  2JLM A;  3KJP A;  2K5T A;  4JI3 Q;  3ISX A;  3J7A V;  1CM9 A;  2ZTC A;  3OMG A;  2A69 D;  2VQF L;  3U4Z A;  1STE A;  2PZU A;  1C4Q A;  2KCN A;  2C6P A;  5IGE A;  4LQG A;  1B3Q A;  4DGZ A;  5IGD A;  3M85 A;  1K0S A;  1H9S A;  2EYF A;  5IOC A;  2NVT H;  2F5I A;  1DOM A;  4LFC Q;  1HNZ L;  5IWA L;  1M1D A;  1L0C A;  4MFL A;  3CDX A;  2Q43 A;  3K5N A;  5H84 A;  2QVP A;  4A30 A;  1WCM G;  3K59 A;  2NN6 G;  1M4G A;  1YNJ C;  2OB0 A;  2CIJ A;  1SMX A;  4A3M G;  4F9U A;  3SK5 A;  4FO2 A;  1Y1W H;  3BYT B;  1Q1E A;  2EY5 A;  3RZO H;  5C3E H;  2AFW A;  3PB6 X;  4YHH Q;  3PQI A;  4CHT B;  1K8O A;  5M3F G;  5A27 A;  1K8A C;  2KCW A;  4BY7 G;  4KN7 C;  3HOX H;  1VGY A;  1D1K A;  1EZ6 A;  1B2T A;  3CF5 A;  3I56 A;  4IK2 A;  1TII D;  4AYB E;  2EWB A;  1Y7R A;  3T8W A;  3Q24 A;  4OC4 A;  3I73 A;  2I5H A;  3OW7 A;  2Q8I B;  3FF3 A;  3HOY B;  5FKA C;  4OO1 H;  1Y0Y A;  5BWA B;  2JA5 B;  1SJH D;  3I91 A;  4K2L A;  2K33 A;  2HT1 A;  2REE A;  4H89 A;  1BPN A;  2GIV A;  2K01 A;  4K5X A;  3A8K E;  2R61 A;  3BHX A;  1EY4 A;  3H15 A;  3A55 A;  5CV7 A;  1XXG A;  1YHA A;  2NVX B;  1V9P A;  2I5M X;  3GQB A;  5IGF A;  1LT4 D;  4A3F B;  1H9M A;  1EIH A;  1VDZ A;  4YWY A;  1FNO A;  2VB3 X;  1W6K A;  1IIC A;  3RYO A;  1U4R A;  4HMI A;  2HDL A;  2IL8 A;  3T1H Q;  1H8L A;  4HIO A;  2UUB L;  2GE3 A;  5AG6 A;  4IPD A;  1WJJ A;  3W1G A;  1U6M A;  1QQ9 A;  1Q8I A;  2GLF A;  1CSP A;  1H95 A;  3I72 A;  1GUO A;  5LMN Q;  3HOV B;  3C2P A;  4FBE A;  4CGN A;  5J8C A;  1Y1W G;  2PQ8 A;  3PSI A;  3UDI A;  1SAP A;  1VCI A;  2DPT A;  2K4K A;  2CY2 A;  3CAM A;  3BJU A;  4A3J H;  1LTA D;  5LL6 X;  2SNM A;  5DAU A;  4KJN A;  1S72 A;  3HOX G;  2ZT9 C;  1X3F A;  4TQU S;  1SE8 A;  1GUW A;  4KS9 A;  3KI9 A;  5KIX A;  2RFH A;  4DR1 Q;  5C4X B;  4JI2 Q;  1MK4 A;  3DR6 A;  3HG9 A;  3C26 A;  1BDO A;  1S4Z A;  4RI1 A;  3HKS A;  1GKH A;  2EYO A;  4DNR B;  4BIN A;  2JEW A;  4ZLT F;  2BL1 A;  3ND9 A;  4QUF A;  4OO1 G;  4UFX A;  3FKI H;  1YNJ D;  2FJ2 A;  3I4O A;  2ZEL A;  1NMF A;  3H8G A;  3FBU A;  2DJF C;  1PYW D;  1U4L A;  1KUY A;  2J8N A;  3NWT A;  2NZ1 D;  1BCP D;  1NBW A;  1I21 A;  1HZC A;  4CAE A;  5DNF A;  1R9T B;  1Y7E A;  1KDC A;  2KVM A;  2F0L A;  2PC1 A;  4DUZ Q;  2DUD A;  1QJO A;  1Q81 C;  1R57 A;  2XEF A;  4A3I H;  3R9G A;  4DNC A;  2B2T C;  1X3Q A;  3HOZ H;  1L0W A;  2VUM B;  3S6G A;  2PMZ B;  5DWM A;  3TO7 A;  1V1P A;  4KOY A;  1WTP A;  4JI4 L;  2RSO A;  4NGP A;  2MGS A;  3V96 A;  4A39 A;  4X5K A;  1XEB A;  4R8I A;  2ANP A;  2Q8R E;  4GM5 A;  1TF8 A;  2GA4 B;  1SDF A;  1RF2 D;  2FL4 A;  1GHJ A;  2ATR A;  3IWE A;  1TF9 A;  1M44 A;  4K8I A;  1TS5 A;  4NSQ A;  1L0Y B;  1QSM A;  1P8L A;  1I4G A;  3U4V A;  3OWC A;  4H6U A;  4NGS A;  1XNR L;  2XGT A;  3SR1 A;  3RNU A;  1DJR D;  2NMT A;  1IY7 A;  1SRO A;  1CP6 A;  3KKW A;  1JB7 A;  3Q6S A;  1O78 A;  1S5B D;  4ILW A;  4KSI A;  1CT1 D;  4EVO A;  1BO4 A;  2VZZ A;  4U5Y A;  3E9H A;  4M85 A;  2YGW A;  3CPX A;  4IUR A;  1JC7 A;  1JWQ A;  5D3I B;  1XMT A;  3LD2 A;  3CCR A;  2JDD A;  1KDB A;  1OXS C;  1YNN C;  2L15 A;  1G6Z A;  2DY8 A;  2QGQ A;  3GYA A;  3NE7 A;  4JZ0 A;  1KAB A;  4NGR A;  4JOI A;  4X64 L;  3H0G B;  3IO1 A;  2P0W A;  2DNE A;  2PVW A;  4CAV A;  3HKZ G;  4ZYQ A;  1I50 B;  2F0F A;  3FKI G;  3X3N A;  1QIL A;  2H1E A;  4MY3 A;  4PXD A;  2B4D B;  4BY1 B;  3VA7 A;  4DPG A;  5C3X A;  3SXO A;  4JI7 L;  2ICI A;  4IO9 A;  5J39 A;  3J80 i;  4CYO A;  5GCN A;  1PTO D;  1S5K A;  4YGO A;  5JJK A;  2L0C A;  4ZK9 B;  2ZEM A;  5KND A;  1Q7Y C;  4LK1 C;  3R2T A;  4V0B A;  1U5K A;  2LSS A;  3GTK H;  3HOZ G;  2CTB A;  1CZG A;  4CKB A;  3NBI A;  4KHP L;  4OAD A;  1B4O A;  4QUC A;  5CBM A;  2B63 B;  2KBN A;  1JR0 D;  4HJA A;  3FXT A;  3M7N A;  2OZG A;  1N33 L;  4X8I A;  2G5D A;  4B9X A;  1DYQ A;  2BE5 C;  4M6H A;  4LFA Q;  2Z4I A;  4K8J A;  4FUU A;  1PA6 A;  4BMH A;  1I94 Q;  4B5P A;  4DR4 Q;  2EYJ A;  3TEH B;  3VR3 A;  2H4O A;  4KI0 A;  3TP8 A;  4C2Y A;  4M6G A;  4DR3 L;  5FLM H;  2WPW A;  2ZPA A;  2WIN B;  1E22 A;  3CME A;  5I6Y A;  4YWM A;  1RJT A;  3DGV A;  2ZEF A;  3W5O A;  4LMQ D;  4QIW B;  1S3O A;  1E2Z A;  1KAW A;  2R3Z A;  3RN2 A;  4EFD A;  1MKH A;  5JPH A;  1RL2 A;  2K7V A;  4CJ0 B;  1EZ8 A;  3KF6 A;  2N3S A;  3MHB A;  2XTI A;  1AZP A;  3SI0 A;  5HGQ A;  2LXK A;  3B3C A;  5HXD A;  4PZ6 A;  3P2H A;  5KEE A;  1MGS A;  1SYG A;  3DMU A;  4GLA C;  2Z3K A;  4KN4 C;  1A3T A;  3AU7 A;  4X62 Q;  1TWG H;  4TVA B;  2Z3L A;  3R2I A;  2UXB L;  2B2V A;  3HKZ E;  1B3A A;  3JVN A;  1FYC A;  3WDN A;  4DV0 L;  4QMG A;  1GHE A;  1C9O A;  5JAV A;  4BD9 A;  4O1N A;  3PO3 B;  4A93 B;  2HUZ A;  1S7F A;  3GTO H;  2LS0 1;  1HNX Q;  4FXD A;  1ESF A;  1AE3 A;  1EY9 A;  3KAS A;  5ISR A;  3G8W A;  3UDF A;  5LYL A;  1MJB A;  2CW0 D;  3GTQ B;  2OQK A;  4BBR H;  1BO0 A;  3I9S A;  3M4Q A;  2ASB A;  1T9H A;  1SYD A;  1B70 B;  2A4N A;  5CBA E;  1HNW Q;  5AG5 A;  2IMO A;  1ASY A;  4P74 A;  1EUJ A;  1E3P A;  1SYE A;  4G57 A;  5G21 A;  5ELB A;  1IXR A;  1Y1V B;  2CQA A;  3E0E A;  4XT3 B;  2QEX A;  3RZD H;  2I3C A;  3E0K A;  4LUA A;  4UA3 A;  1I4P A;  4M8A A;  3J7A F;  3WAB A;  4MTK A;  4U9Z A;  2NVQ H;  4ZRZ A;  4XT1 B;  3KR5 A;  4KV6 A;  5HMN A;  4YCW A;  4OC5 A;  4K6D A;  2G9D A;  1BVS A;  4JBK A;  4DV3 L;  2PZW A;  1AP0 A;  1QG7 A;  5IYD G;  3HOW B;  5HUR A;  4GKK L;  1PMR A;  1FJG L;  4JBJ A;  3G6E A;  1Y14 B;  1SJE D;  4RA8 A;  4MJ8 A;  1Q82 C;  4ZAI A;  4O23 A;  3BXM A;  1FL0 A;  4RGM A;  3R96 A;  3PP9 A;  3OIQ A;  5CV8 A;  4DR6 Q;  3SJE A;  1Y8O B;  2NBF A;  4J3G A;  1F9S A;  1E1T A;  4AVB A;  4JI0 Q;  1XMQ Q;  2KHS A;  2DN8 A;  2CWP A;  5HGT A;  2JA7 H;  1TXR A;  1YSJ A;  4DK6 C;  3K80 C;  2BE5 D;  1ET6 A;  2FFK B;  2UUA L;  3MXN A;  1HA6 A;  2QML A;  4HCE A;  4IUV A;  5F2D A;  1BF4 A;  4Y52 H;  2Q44 A;  4KLV A;  1N9W A;  4DV7 Q;  1LRZ A;  2XSC A;  1B6B A;  3JTK A;  4CYP A;  4L8J A;  4ZGY B;  4JYA Q;  2JN4 A;  2ZW7 A;  3RMH A;  1JOK A;  2F0D A;  4A3B B;  1TQO A;  1WWZ A;  2DJG C;  1EY0 A;  4CJ1 B;  3OWF A;  4BBR G;  4CGY B;  1J9O A;  1Q1B A;  4EQP A;  5JQ4 A;  2Q51 A;  4HKF A;  1ZEQ X;  1F2P A;  1G29 1;  2QDL A;  1GUN A;  5ELC A;  2FMM A;  3CP0 A;  5BR8 L;  5J1Z A;  4RGO S;  3STB C;  1D6E C;  2PJ2 A;  3TP5 A;  3T1Y Q;  2WUU A;  5IP9 H;  3S9M A;  1I3Q B;  4XYO A;  4AQY L;  4CDC C;  2YYZ A;  3DEP A;  4F0X A;  3H6M A;  3I7F A;  4KD3 A;  3RLF A;  2WAQ G;  4N8F A;  4PK3 A;  3L0O A;  2JBK A;  2VXW A;  2KQ3 A;  4A3E G;  4BBS H;  3DWP A;  1KNA A;  1NR2 A;  3ERQ A;  3NSW A;  4NXY A;  4CRZ B;  4PPZ A;  1AN8 A;  1NR4 A;  3DM1 A;  1RTN A;  2UU9 Q;  4TWE A;  1HFN A;  4ALP A;  1LAP A;  4GN3 B;  3GIU A;  1QE6 A;  3NPP A;  2BDO A;  3TBI B;  4FD4 A;  1LAB A;  1X56 A;  2Q4Y A;  4HJ9 A;  4LF8 L;  1AYE A;  4BXX H;  3GLJ A;  1F9P A;  2P5Z X;  2K28 A;  4IPH A;  2JA7 G;  2F0Q A;  1RXT A;  3PFO A;  2E2I B;  3VR6 A;  2PPB C;  4UIA A;  3PB7 X;  1QZG A;  3KBX A;  3AFQ A;  4DUK A;  5IYB H;  4IFD H;  2B2W C;  5JH9 A;  2VQE L;  3HOU H;  1C0A A;  2CF4 A;  2M2L A;  3PEI A;  4A3M B;  4MXU A;  1DOL A;  5FK9 C;  2QKI C;  4X65 Q;  1TWH H;  2MUY A;  2WP8 J;  3S2D H;  3UE1 A;  3DUZ A;  1EWH A;  3A7A B;  4V19 0;  3BVM A;  4ZX9 A;  5M3F B;  4LQ6 A;  1BCP F;  1U9R A;  4EGV A;  1QVG A;  4BY7 B;  2BA0 A;  1H9S B;  2VY3 A;  1WK4 A;  1AH9 A;  4QB9 A;  4U9Y A;  1VHS A;  1NAP A;  3I55 A;  2KED A;  3HRZ C;  3CCU A;  3DWA A;  3FRP B;  4MHN A;  2UXD L;  1PRT C;  3Q8D A;  5IB9 A;  1O7I A;  4MMO A;  3RNZ A;  2HQY A;  5FLX c;  3D8G A;  2PJ1 A;  1XMB A;  4R87 A;  3SJX A;  1VQE A;  4P4F A;  5I2X A;  1WTO A;  1HR0 Q;  1KRS A;  3K7A H;  5CV6 A;  2E2J B;  1Z8X A;  1HTP A;  1LCP A;  3G3S A;  4GLV B;  3S2H H;  4BBS G;  3IU1 A;  2K1B A;  4B12 A;  3MEF A;  3F1Z A;  3L7Z C;  3IFE A;  4II9 A;  4L5T A;  5GAG C;  4Y7N H;  2ZOG A;  3ITP A;  5JPM C;  3EBE A;  1RD9 D;  5LHY 1;  4L89 A;  3KJO A;  2ZTE A;  5CYU A;  1LO5 D;  1T5E A;  4A37 A;  1K8G A;  3JC6 6;  3W1B A;  3FH4 A;  3RUZ A;  1YX0 A;  1SYF A;  3CXP A;  4CGL A;  3D7D A;  1SN8 A;  3HGB A;  1EY8 A;  5C4J H;  4JI6 Q;  1N8R C;  2BSW A;  5IYB G;  5G3L D;  2DNC A;  4IFD G;  3HOU G;  2EJG C;  3R1K A;  2VL6 A;  4LFB Q;  1QSO A;  3CXQ A;  3DSB A;  5JM6 A;  1Y1W B;  3QOL A;  3K9U A;  1DOK A;  2JA8 H;  5KTC A;  3RZO B;  3HLP A;  4H7B A;  4N9T A;  2YND A;  1VQF A;  3TZD A;  4DAY A;  2Z3P A;  1EOT A;  2L55 A;  3HOX B;  1PTO F;  2YU9 H;  1VQC A;  1DCZ A;  2F0V A;  1HPC A;  1OO9 B;  3CCJ A;  3I1U A;  2PDO A;  2F3V A;  2B39 A;  1UE5 A;  1CSQ A;  1WTW A;  3N52 A;  5EBC A;  4CRY B;  4B08 A;  1BUV T;  3S1N B;  2Y0S G;  1AFP A;  4K3N A;  4DV1 L;  1LLR D;  4NXN Q;  4GN5 A;  5JVG 3;  4Z65 A;  4DYO A;  3F2U A;  2AFO A;  4R76 A;  4DR2 Q;  1J4J A;  1FT7 A;  3TTH A;  1X3E A;  2SEB D;  4MFP A;  1STN A;  2JEB I;  1NSL A;  4H0L C;  5T1G A;  2HIV A;  4IPG A;  2KJX A;  3ISZ A;  1XTC D;  4DXF A;  3S15 H;  4PMC A;  2NTT A;  1NE9 A;  1SSO A;  1ENC A;  1PH8 A;  2Q04 A;  3KLR A;  2RVL A;  5F09 A;  3R93 A;  3TFY A;  1EY5 A;  3K7U C;  2B8G A;  4MHY A;  5E1F A;  1IKM A;  4ULL A;  4Q7A A;  5L37 A;  3BU2 A;  1SND A;  4DV5 L;  1QVF A;  3L2N A;  2UXC L;  4IUS A;  3MXU A;  3EY5 A;  4OL7 A;  4NPS A;  3HUV A;  3IGR A;  1D1I A;  5D3D A;  2JA8 G;  4KOW A;  4DR5 Q;  4JI1 L;  1M8A A;  1SE4 A;  1OTC A;  2Z3N A;  3T13 A;  5C3W A;  4FD7 A;  4WWV A;  2X6L A;  3T51 B;  1Q2D A;  1XFO A;  1ZXT A;  1VQJ A;  3D2M A;  1NMT A;  3N7Z A;  1MI2 A;  1HZ9 A;  2E5L L;  1HCZ A;  1A62 A;  4JPB W;  1Q46 A;  5FLX E;  2F52 A;  4GNX A;  3PB8 X;  3MGD A;  4OP4 A;  1O7L A;  1ONL A;  2VQF Q;  5LMN W;  2PJ8 A;  2EYM A;  2Y0S E;  4B3M L;  2L4N A;  3KQZ A;  5LRG A;  1LTS D;  3OMC A;  3NE8 A;  3EO4 A;  1G2S A;  4OC0 A;  3HKZ B;  4A94 A;  3PUY A;  3PBE A;  3MA2 B;  1JWM D;  1GUS A;  2JA6 B;  1V1Q A;  3A8J E;  3Q22 A;  1JJ2 A;  1RHP A;  4IUU A;  5KYI A;  1ICF B;  1CKO A;  3VDY A;  3M3Y H;  4GKJ L;  1ZLH A;  1E1O A;  2EVB A;  1WTX A;  2OF1 A;  3CU7 A;  1ILP A;  3HOZ B;  4JI5 L;  2HHH Q;  1HEE A;  3PBB A;  3M4O H;  3NA6 A;  4CJ2 C;  4POG A;  3TOB A;  3PGP A;  1IBL Q;  2DY7 A;  2V77 A;  3DM3 A;  2FXF A;  2L1B A;  2E74 C;  4R8F A;  3GTG H;  3GY9 A;  1RDP D;  1QZH A;  1WI5 A;  4ODG A;  3S9W A;  4LUV A;  1KIX A;  4GZY C;  4AYB G;  3BYY B;  2R7H A;  2JEV A;  2B5G A;  5KNC A;  4LF4 L;  2B58 A;  2PRQ A;  1PU9 A;  3NEN A;  2M9V A;  1PFM A;  1PUA A;  4IUT A;  4LUO A;  2SOB A;  4GS3 A;  4QGU A;  1AW7 A;  4A3G H;  1XTD A;  3FP9 A;  2Q7B A;  4B10 A;  4F87 A;  3F2D A;  4IUQ A;  1J5E L;  2HCI A;  2K50 A;  2DXQ A;  2KCM A;  4A31 A;  4KOS A;  1LT3 D;  2I0Q A;  1XIX A;  4NB3 A;  5LMU L;  1EYA A;  2HB6 A;  1CPS A;  4MCQ A;  2F4V L;  1HUN A;  3K2K A;  4C1N K;  4B3R L;  1LYL A;  2PZT A;  1QOH A;  3SI1 A;  4B5P B;  1G2T A;  2EPB A;  5EKL A;  4O0A A;  1A15 A;  4C3H G;  2K03 A;  1YHQ A;  5JVH 3;  2EY1 A;  3CHB D;  5ELO A;  2A68 C;  4IJH A;  4WJW A;  3UE0 A;  1UUP A;  3BDL A;  5JJZ A;  3NTI A;  2P6E A;  5JGF A;  3HFZ B;  4PXB A;  3NEM A;  3SEB A;  4A75 A;  2ZXR A;  3GTK B;  5A28 A;  4X66 L;  3H09 A;  1QUQ A;  4IHM A;  4OKO A;  4NJQ A;  2PIY A;  4ABN A;  4KVM E;  1QMU A;  1S5C D;  3CCQ A;  1N36 Q;  3FMC A;  1EIY B;  4DK1 A;  1U0L A;  3KQX A;  4TSS A;  4KY5 A;  4F6A A;  1UWV A;  1PH5 A;  1IHZ A;  4C3I H;  4M3S A;  4HPS A;  1BBX C;  2P6F A;  4JI8 Q;  3DNS A;  3TME A;  2R92 G;  5IGG A;  1XYI A;  4G7H C;  1TS3 A;  1Y69 U;  2CVR A;  5AGE A;  3FYN A;  5DS0 A;  3CT9 A;  3OTO L;  2AKW B;  1CI3 M;  3GB0 A;  4E2A A;  4X2T A;  1D2B A;  1RTO A;  2Z8L A;  2IPK D;  1SFO B;  5LL6 S;  2OZH A;  1IBM L;  3DLJ A;  4UIB A;  3CCL A;  2EXD A;  1V43 A;  2CKZ B;  2IX3 A;  3F0A A;  3PCO B;  4KOX A;  5DM6 3;  5C0X I;  1EE3 P;  3QNV A;  4CYN A;  3KBG A;  2XWJ B;  3S1Q H;  4YRH A;  1VQL A;  2F0O A;  2R7Z H;  3TRZ A;  4L5S A;  2FIA A;  3FIX A;  4A32 A;  2DF5 A;  5M3M H;  4UWJ A;  5I9P A;  5IX3 A;  1TWG B;  5ELN A;  1QSN A;  3P2F A;  2QW7 A;  1PZI D;  3RR5 A;  4AIM A;  2YNE A;  1PTO H;  5IT9 E;  4UEE A;  3U50 C;  1N32 L;  1IYJ B;  2PJC A;  4UCM A;  2OT2 A;  1F2M A;  3GTO B;  4XTC S;  2FCK A;  3CQZ H;  2Q2H A;  2XEJ A;  5M5Y H;  4HNW B;  2KHI A;  2MO1 A;  2R7F A;  3M4P A;  1ROD A;  1SNM A;  3D66 A;  1TWF B;  1EFW A;  4JI3 L;  4DV6 Q;  1NE3 A;  2FVG A;  5C44 H;  1WVL A;  4BBR B;  1VS0 A;  2ENB A;  1ET9 A;  3S17 H;  5HVH A;  3B35 A;  1BBW A;  1X6O A;  2JBJ A;  2VB2 X;  1PHJ A;  2AJ6 A;  1WD1 A;  3GTM H;  1S7K A;  5F49 A;  4IFD J;  5C3E G;  2EY2 A;  3DXJ C;  4Z9C B;  1IL2 A;  1PCA A;  3CCM A;  4X6A H;  3FED A;  4C7H A;  4C3I G;  2K32 A;  2PIZ A;  2ZW5 A;  1BAV A;  3MXN B;  3G6J B;  4OX9 Q;  3MVV A;  1Q3L A;  1VQ9 A;  4UFW A;  2NVQ B;  2WAQ B;  4B11 A;  5G3L F;  5K5P A;  5J3B A;  4A3E B;  1PYT B;  2JDC A;  2N55 A;  4DU9 A;  3S16 H;  5IE8 A;  2BOA A;  4MHP A;  3E6Z X;  1IW7 C;  2MPM A;  4ZUJ A;  1EU3 A;  4AG7 A;  4PSX A;  3BVG A;  1PZJ D;  3GV6 A;  4KY6 A;  4I65 A;  4DK3 C;  4NKL A;  4YHH L;  1HJP A;  2R7Z G;  2LKV A;  4E6I A;  4JWP A;  1IBK Q;  4QB4 A;  1JJC B;  1VF7 A;  3I90 A;  4RG1 A;  5M5X H;  1CA5 A;  3FDT A;  1FGB D;  3F8T A;  2RC4 A;  2VZY A;  5I4D A;  4MRI A;  1CX8 A;  4CAX A;  3I4M B;  2JA7 B;  3QO2 A;  2GU2 A;  5HVF A;  4X3U A;  2I46 A;  4R6T A;  4AVA A;  4J15 A;  4HIM A;  4FF2 A;  2XEI A;  5EJW A;  4HN7 A;  3EFA A;  1F9Q A;  1EFI D;  2K5D A;  4H02 A;  4OIJ A;  5K36 H;  2B2U A;  1UFH A;  5ELD A;  2M00 A;  4JD6 A;  3OOC A;  2NTS A;  4IF5 A;  1YEZ A;  4CDE C;  1DE4 C;  4IUN A;  4PSW A;  1B53 A;  5C44 G;  3B3T A;  1TKW B;  4KD4 A;  4DFA A;  2RBM A;  4DK0 A;  1W2B A;  2Z3O A;  4K5W A;  4DR3 Q;  4B3S L;  2WYR A;  1ICW A;  5CPA A;  4I7Z C;  5IYC H;  5CV5 A;  3ERO A;  1MSH A;  1CG2 A;  4JXQ A;  1VIX A;  2PRB A;  3C3L A;  4A3J G;  5FO8 B;  5HH1 A;  4CS0 B;  3EJI A;  6CPA A;  2RCF A;  2YV5 A;  3TO9 A;  4LUZ A;  1B1Z A;  1JWU D;  2PQE A;  2O4H A;  1BQQ T;  3T1H L;  1XNQ Q;  4P72 A;  5C4Z A;  1GUT A;  4ORF A;  1TWA H;  1G91 A;  4JC0 A;  3GV3 A;  3MEH A;  4BBS B;  3ER0 A;  3U9O A;  5LMN L;  4NGQ A;  4IZ8 A;  1PRT B;  2FXQ A;  3JAM c;  1II3 A;  5GAH C;  1YJW A;  4RKL A;  1GHK A;  1YR0 A;  3A5U A;  4HIK A;  4JOI C;  3MWY W;  2B29 A;  4X3K A;  1IL8 A;  4DUY Q;  3LWE A;  4P10 A;  4QBJ A;  3OIP A;  3J80 L;  3GUX A;  2AWN A;  1WTR A;  1YVO A;  5DLQ E;  4FF3 A;  3TCV A;  3V2T A;  4A3I G;  4DR1 L;  2B4B A;  3EC4 A;  3QAY A;  3DEO A;  3IIB A;  1PH7 A;  3QB3 A;  3KF8 A;  1O7Y A;  3HOU B;  3VWE A;  4RH6 A;  4K0K Q;  5K36 G;  4ID6 A;  1XJO A;  1D5X C;  1F2L A;  5FLX L;  1IOF A;  4UFV A;  1QVC A;  2RB7 A;  1XPU A;  1Z9F A;  3MXG A;  1L1O A;  4E8O A;  3OPO A;  3S2D B;  5KGU A;  1IYL A;  2NYZ D;  2VS1 A;  2WSA A;  3CXC A;  4RFB A;  4DV4 L;  2YTV A;  4DV2 L;  1CHQ D;  1P4N A;  3K57 A;  2Q0Y A;  2Z4H A;  2RDG A;  5IYC G;  4DUZ L;  1SE2 A;  2N49 A;  5C82 A;  4FXG C;  2WB1 B;  4JW0 A;  1FJG Q;  4JLY A;  3P20 A;  3UDX A;  2Y0S B;  1CUK A;  2C27 A;  4I7A A;  4YWL A;  5JJI A;  3ONA B;  2HQL A;  3AQQ A;  1LAM A;  2LXJ A;  2YTX A;  5AJ3 L;  2LY7 A;  4P4B A;  3S1R B;  4DR7 Q;  2XRQ D;  4CKE A;  4GLX A;  1PVO A;  4JJX A;  3S2H B;  1KL9 A;  1KDA A;  1B50 A;  2LFN A;  5DEH A;  4ONW A;  1O80 A;  1LM0 A;  4DAY B;  2VXK A;  3H5Z A;  4MCP A;  1PH4 A;  1KNE A;  1MJC A;  2UUA Q;  1R43 A;  3G7L A;  1K4J A;  2VNU D;  1IZ6 A;  2MP1 A;  1KWM A;  2Q4Z A;  1IKL A;  2BCO A;  1HR0 W;  2EUI A;  2B2V C;  4R4T A;  3PF5 A;  2RQX A;  4LF6 Q;  3EQL C;  2D4P A;  1ZG7 A;  3PUZ A;  4HCS A;  1A2T A;  4UP9 A;  1KRT A;  3RD4 A;  4H6Z A;  4UF4 A;  3PGZ A;  5ISV A;  3NUC A;  4JBM A;  4KZT A;  4A3D H;  3VYR A;  2K75 A;  4QJF A;  3J7Y W;  4FVM A;  2NVX H;  5IGB A;  3LOD A;  3BZD B;  5EC4 A;  1Y8P B;  4A2Z A;  4H44 C;  1E24 A;  1MHW C;  4FDB A;  1M1K C;  1YNN D;  1XX8 A;  2ZM6 Q;  2JA8 B;  3B3W A;  3D67 A;  4UDU C;  4AQY Q;  2ZEH A;  3D7F A;  4OC1 A;  3P7J A;  4NMZ A;  2EOT A;  7CPA A;  2YU9 B;  4UWI A;  1STA A;  5IB0 A;  3A74 A;  2F0S A;  1YHB A;  5FLM G;  4WJ4 A;  2X6G A;  2HIX A;  1JQG A;  2XN9 C;  4M1U B;  3U58 A;  4KOR A;  2IJ0 A;  2PW7 A;  2AFU A;  4EQO A;  3GTL B;  4NJR A;  4KVO E;  1TU2 B;  3D4R A;  2QEC A;  1SMY C;  4KVX A;  5AG4 A;  4YFJ A;  1UWY A;  3D6C A;  3CPW A;  1LTB D;  2F3I A;  3E3X A;  4HR7 B;  3JAM E;  1NJI C;  3P75 A;  1RKN A;  2OQ0 A;  4LF8 Q;  4LFA L;  3TP6 A;  5EPJ A;  4ZKC B;  4R57 A;  1HHV A;  1I94 L;  5E96 A;  2ATW A;  2FHT A;  4C1N I;  1N34 Q;  2Z0S A;  2DPS A;  4A33 A;  4RHS A;  3MXP A;  1JQY D;  1P0H A;  2G0B A;  3LAC A;  5M5W B;  3S15 B;  4HMJ A;  1IYK A;  2RDF A;  2KHJ A;  1XJV A;  1XE4 A;  2H5M A;  4MCR A;  4EVY A;  2AQ2 B;  1XPR A;  4XNH B;  4OWW B;  4YWK A;  1JWS D;  1EQV A;  4DNI A;  1ZYR C;  3B3V A;  2EVN A;  5BN3 A;  2K05 A;  4YY3 Q;  1TWC B;  2IX1 A;  4B6Z A;  4R7M A;  3B8G A;  1FNV A;  4A3D G;  5I4M A;  5K8P A;  4QUS A;  1VQI A;  2RKS A;  4P2C B;  3OWE B;  4X62 L;  4AYB B;  2B3V A;  4RGT A;  4NGM A;  3TOA A;  4RUH A;  1GUG A;  1NCV A;  1TY0 A;  3DR8 A;  5E7N A;  1KLG D;  3D0F A;  3FPP A;  3GO5 A;  1HDU A;  2ABZ A;  1F9R A;  3H8E A;  2A5H A;  3BLN A;  4HID A;  4LAA A;  1Q86 C;  3F5B A;  3FX6 A;  3OSO A;  1B9N A;  2POK A;  1R4P B;  3WOF A;  5H86 A;  3IWG A;  2RF4 A;  3S9L A;  4CAW A;  1UE7 A;  2MQH A;  4KKT A;  5IT9 L;  4P73 A;  3S14 H;  4WRD A;  1GD7 A;  2Z6K A;  4JYW A;  4OWT B;  2PVV A;  5HVG A;  1B9M A;  2JQO A;  1DD2 A;  4JXR A;  2PJ7 A;  2ZOF A;  5JOB A;  3CZX A;  2B5G B;  4KHV A;  4OXP A;  1I6H B;  4C3H B;  2Z1C A;  3OYY A;  3KLS A;  3GTJ B;  4MHE A;  3FEE A;  1OXT A;  5J1Q A;  3K81 C;  4FXK C;  2O53 A;  1WCM B;  2K04 A;  2ICE C;  5F47 A;  1QNK A;  2BOS A;  2E76 C;  3GTP B;  4CAF A;  2GVB A;  5NUC A;  2VZA A;  3WT4 A;  3SK8 A;  1I50 H;  3D4W A;  3M4O B;  3IC1 A;  1E2W A;  1B44 D;  4LX9 A;  4A95 A;  4BY1 H;  1S40 A;  5JPN C;  2GRE A;  4KOT A;  5COY A;  4QC6 A;  2QEJ C;  1A3V A;  3GTG B;  2GLJ A;  1PYS B;  2F0E A;  3LWU A;  2KOL A;  4DR6 L;  5G1Z A;  3PUX A;  1QNU A;  4Q0F A;  4PMB A;  1VKC A;  3H3V H;  1YLE A;  2WV6 D;  2YNC A;  1SBB B;  4FWU A;  1A0I A;  2WII B;  4Q5V A;  4JI0 L;  5EPL A;  1SMY D;  1XMQ L;  2R92 B;  3N6R A;  1YME A;  3B2Y A;  4Q36 A;  2PJ6 A;  1X9N A;  4LF7 L;  1I4R A;  3FRM A;  5IP9 G;  4K6L A;  3PRT A;  4UBR A;  2R1I A;  3NBH A;  2EYH A;  4DV7 L;  2R93 H;  1MJA A;  4DAP A;  1VQH A;  1QUQ B;  4PZ7 A;  1PH2 A;  1VQM A;  1CPX A;  2NB0 A;  3F8K A;  1PH6 A;  2IY5 B;  2ARH A;  2GFQ A;  3I2Z A;  5E3F A;  5FO7 B;  1LTT D;  3GKR A;  4JV5 Q;  1MSG A;  3JUW A;  5EMI A;  4WJ3 M;  3TSS A;  1BNZ A;  3QR8 A;  1XMO Q;  2CH4 W;  1TXY A;  3KZW A;  2ZED A;  5FOB B;  2G3A A;  1JJG A;  1ON0 A;  2VBQ A;  4CDF C;  3H8F A;  3EN2 A;  2G9H D;  2NVT B;  1YQE A;  1JE5 A;  4G4K A;  3T1Y L;  3C46 A;  5LRK A;  5GQO A;  3A0J A;  2AHO B;  5CV4 A;  1SNQ A;  4BXX G;  1NSA A;  1K28 A;  1RIP A;  2J7Z A;  1RO5 A;  3IL8 A;  3STB D;  4ZYS A;  1IOI A;  1PLF A;  4KOU A;  1BOS A;  3R3O A;  3VR5 A;  1I6V C;  2F0U A;  5FVJ A;  1VQ7 A;  3UI2 A;  2N8N A;  2IW3 A;  5CC4 A;  1BBU A;  3GD7 A;  3H4Q A;  3QAH A;  4JI1 Q;  3T53 B;  2HQE A;  3TX8 A;  2NSM A;  3GDE A;  5C3E B;  1CHP D;  4OON A;  2A8V A;  2ES2 A;  4APV A;  4C3J H;  4U67 3;  4R4C A;  4NXM Q;  1H9K A;  2Q2I A;  4C3I B;  3ZYY X;  4HJ8 A;  3EXN A;  1EWC A;  3TRE A;  3GP7 A;  4IAV A;  5K8N A;  3IWW A;  3EVQ A;  1VQD A;  3TS2 A;  1LTR D;  5DWN A;  1Z8W A;  1HQM C;  3VR2 A;  4A3L H;  2Q2T A;  3RLN A;  2R93 G;  5C0X H;  4GOP A;  2OU2 A;  3NQI A;  3NH8 A;  1DON A;  4X65 L;  3DWQ A;  1A3U A;  1JOR A;  1DTD A;  1VQB A;  4NCZ A;  4BBH A;  1MBY A;  3K0X A;  4CGM A;  1ENF A;  1Y1V H;  2QCP X;  3S1Q B;  1FY7 A;  4R9M A;  3PMF A;  2R7Z B;  2C6C A;  1SLJ A;  2F8H A;  1EY7 A;  4AVC A;  3NTH A;  4S3S A;  4C56 C;  3VH9 A;  2PJ4 A;  4MI4 A;  1EIF A;  4LWC A;  1YBY A;  4MFJ A;  4JI5 Q;  3K0Y A;  1L0X B;  3QOJ A;  3CKI B;  1EU4 A;  4CKC A;  2IHE A;  5EAY A;  3ZZI A;  1XWE A;  1A2Z A;  1PTO B;  3QIA A;  4IUP A;  3AFP A;  1PRT D;  2WAC A;  1S3Z A;  1VHE A;  3FEC A;  3BZK A;  2UUC L;  2DGY A;  1C7Y A;  4J6H A;  4P4D A;  4TNU A;  4LF9 Q;  1JIC A;  1PYB A;  2PO4 A;  3KLW A;  1XPO A;  1MJ9 A;  4P71 A;  4QVT A;  4P6Y A;  2AFX A;  3ULP A;  3S17 B;  3J81 j;  4G7Z C;  1CFM A;  1VQ4 A;  3C1F A;  5C5L A;  3PIO 3;  5IIF A;  3ZJ0 A;  4C3J G;  3I70 A;  4A3J B;  3PO2 H;  1V8Q A;  4DAM A;  3NFZ A;  1SRU A;  1BLL E;  3D6W A;  4XPK A;  3PUW A;  4LF5 Q;  3CD6 A;  1K9M C;  4ME5 A;  1V1P B;  4CGP A;  3W3A A;  1J5E Q;  1JB3 A;  1TVX A;  3BDO A;  4DXG A;  1YW4 A;  1FNW A;  4A3L G;  4JI6 L;  2XWB B;  4MHZ A;  1S5E D;  2OEO A;  3G48 A;  4GNX C;  3S1M H;  3D2P A;  3E0J A;  4DKA C;  1I4Q A;  2Z9H A;  4BA1 I;  5C0X G;  1ARL A;  1CM0 A;  3QWN A;  1CKM A;  3S16 B;  4LFB L;  2OTJ A;  4XNH C;  3V05 A;  3FKI B;  3EIV A;  2EY6 A;  4JG2 A;  3ULJ A;  3D7H A;  1HNZ Q;  1Y1V G;  5IWA Q;  4G1P A;  2D9U A;  4PXE A;  5M5X B;  1VHO A;  5BN5 A;  2NVY H;  4HSP A;  1ARM A;  2O28 A;  5ELY A;  3VYU A;  4KLK A;  3TN2 A;  4A3I B;  4OAE A;  1Z2L A;  1LTG D;  4FYD A;  1PDQ A;  3AB9 A;  2XVS A;  2O4X A;  3Q0A A;  1ESR A;  5AG7 A;  1H9R A;  2D62 A;  1B7Y B;  2IT1 A;  4PQX A;  1C8C A;  1LT5 D;  4NW2 A;  4QIW E;  4RWS C;  4NXN L;  4DA2 A;  5IP7 H;  3R9F A;  3K6O A;  4DR2 L;  3FB3 A;  2RHQ B;  1DXM A;  4XDX A;  2PJ0 A;  3NH5 A;  1F2Y A;  4KOV A;  4PNY A;  2SDF A;  3L9A X;  2NWG A;  2NN6 H;  3H3V I;  3TC8 A;  3VYS A;  1MIU A;  3OTO Q;  2E2I H;  2JEA I;  1Y0R A;  3S9N A;  1GOZ A;  4EQN A;  4XPD B;  2FIN B;  3JAM L;  3PO2 G;  3JAM i;  4ZQ3 A;  3AEV A;  3H94 A;  3KUP A;  5ELF A;  1TIQ A;  1QST A;  3ND8 A;  3KL9 A;  1YZ6 A;  1KUX A;  2CNM A;  4F0Y A;  2B3U A;  2HV2 A;  1A63 A;  4R9W A;  3KF8 B;  1TT2 A;  5ELE A;  1YK3 A;  1JCK B;  5F46 A;  1TWA B;  2I07 B;  1V0C A;  1AEX A;  4HSV A;  1L1O B;  3VA5 A;  1TKH A;  4FAI A;  3CCS A;  5LYD A;  4I49 A;  2YTY A;  5G22 A;  4DR5 L;  3IEH A;  4KUB A;  4KUA A;  5CGK A;  2QIR A;  4XIG S;  1PXU A;  4YCV A;  4RS2 A;  2TSS A;  2ALY B;  4P45 A;  5GRO A;  4IOC A;  3LNN A;  4P4E A;  2QDB A;  4PV1 C;  2UUB Q;  4CYQ A;  3BS1 A;  1YGH A;  1EWI A;  1HQR D;  4O2D A;  1I4X A;  4OEM B;  2RSN A;  5C88 A;  4OWX B;  3KK7 A;  3KF6 B;  2I00 A;  4E0A A;  2F0H A;  1QCB D;  3D7G A;  1JOO A;  3N5F A;  5IP7 G;  1CKN A;  3W6X A;  4KHZ A;  2GAN A;  4ZUI A;  3HZX A;  2B3G A;  1CQF A;  1DM0 B;  4MTN A;  3NQT A;  3FVL A;  5KTD A;  2AFS A;  3K5L A;  1PH