3FMCA

Crystal structure of a putative succinylglutamate desuccinylase / aspartoacylase family protein (sama_0604) from shewanella amazonensis sb2b at 1.80 a resolution
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
365
structure length
365
Chain Sequence
VDKHEVRVGELAAGQPLSLPVYRFKGKGAGPSVYIQANVHGAEVQGNAVIYQLMKLLEHYELLGDISLVPLANPLGINQKSGEFTLGRFDPITGVNWNREYLDHGFNIEVWYQEHSHLDDDTLITAFRATLVEECARRLNNPWGVTTGHRLAVTLQSMAHRADIVLDLHTGPKSCKHLYCPEYERSAAQYFSIPYTLLIPNSFGGAMDEAAFVPWWTLAEVASSHGRELGVRVSALTLELGSQERIDLDDALEDAEGILAYLSHRGVIAETVLPKPMKRYGCFLKNYRKFHAPKAGMVEYLGKVGVPMKATDPLVNLLRLDLYGTGEELTVLRLPEDGVPILHFASASVHQGTELYKVMTKVFEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative succinylglutamate desuccinylase / aspartoacylase (YP_926482.1) from Shewanella amazonensis SB2B at 1.80 A resolution
rcsb
source organism Shewanella amazonensis
molecule tags Hydrolase
molecule keywords Putative succinylglutamate desuccinylase / aspartoacylase
total genus 112
structure length 365
sequence length 365
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3fmcA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3fmcA01
1LACA 4DK0A 4XIGS 4P44A 2PJ2A 3TX8A 3SJEA 3S9LA 4TNUA 3VR3A 4GZYC 4ZX9A 4IFDG 4KKTA 5C0XH 3A7AB 2Q43A 4A37A 2A6EC 2V77A 3QNVA 3IJ3A 5K36H 1HEEA 2PJAA 2ANPA 2JEBI 2BA0A 3IEHA 5K8NA 3FPPA 3WC5A 1Q12A 2V8GA 5BN4A 3NH4A 3D7DA 3RAMA 2BCOA 4MCSA 5D29A 3CRKC 2Q51A 2QVPA 4P4IA 4UEEA 4PV1C 3WC7A 1E2VA 3A8KE 2A6HD 4DNTB 3B2YA 1EE3P 4G1PA 4KN4C 5LRGA 3TZUA 2A6ED 2L5TA 1ZG9A 4DNRB 1M4LA 3ISZA 2CTCA 4FUUA 4OKOA 3DXJC 1B9NA 3QIAA 2PIZA 2ZEOA 7CPAA 1YSJA 4O23A 4PXEA 4A38A 2PNRC 4X8IA 3VR6A 4UEZA 1VDZA 1Z2LA 2XEFA 4OC2A 2YYZA 3KR4A 2A69D 1UWYA 3PUZA 2IMOA 3WT4A 3VR4A 4G7HC 4A39A 2CTBA 4KKSA 4H44C 3K2KA 3FVLA 4KN7C 2A68C 3WC6A 2AFOA 1GUGA 3IKJA 3B3VA 4CPAA 4R6TA 3PFOA 5LRJA 2ZEEA 4ZY1A 3SE0A 2R6GA 3L7ZC 1R43A 3QG1A 3KLRA 5JM6A 1E2ZA 2B8FA 4XTCS 2A68D 1LANA 4OO1G 1HDUA 4ZY2A 4KMUC 4ZY0A 3KR5A 1PMRA 4GM5A 3A8IE 4R7MA 1O78A 1QMUA 3KL9A 4ONWA 2VL1A 4YU9A 4LK1C 2EJFC 5D8NA 3N6RA 3M4YA 3D4RA 3SI0A 2C1CA 3PB7X 1F2OA 1VGYA 1ONLA 1ELMP 4G7ZC 1TF9A 2ZEMA 3V7ZA 1HCZA 4OMEA 1Y8OB 3NH5A 2JEWA 2PE3A 4PPZA 2G9DA 1K8MA 1RTQA 5BN5A 2C6PA 1HTPA 2JBJA 3T8WA 3PFEA 1LABA 3GLJA 3RZAA 3HGBA 4P4BA 3VATA 4EMEA 5LRKA 3MXUA 1ARMA 3B35A 3FEDA 4H0LC 2OR4A 5JH9A 3PUYA 3KQXA 2BDOA 1KWMA 2ZEDA 4NGPA 5ELYA 3FMCA 3U9SA 5IB9A 2D62A 5HXDA 2BOAA 3BDOA 1H9KA 3T56B 2FVGA 2ZELA 4PQAA 4F8ZA 1DXMA 3FEEA 2ZEHA 3DLJA 1GHKA 1Z5RA 2JEAI 5CPAA 2PJCA 1EWHA 1YW6A 2F8HA 4KSIA 1ARLA 2RFHA 3KI9A 4NFRA 4NGRA 1BPMA 2WYRA 2JBKA 4H2KA 4OP4A 1VCIA 4X2TA 3SI2A 3RBUA 2XEIA 2DNEA 3AB9A 1CTMA 1GYTA 2PJ4A 4UIBA 3PB6X 1LFWA 3PUWA 4OIWA 1F2PA 5LYFA 3KQZA 1Y0RA 3SDZA 4R76A 2QJ8A 2V8VA 2BO9A 1FYCA 1T5EA 4KKUA 1BLLE 3ISXA 3KGQA 3OOCA 5A35A 1H9JA 2LMCB 3PB8X 1TKWB 4Z65A 3GUXA 1CPSA 4EWTA 2PJ5A 2EJGC 5HVHA 3GB0A 3KASA 2AUJD 3CT9A 4OC3A 3BG3A 2KCCA 1SMYC 4P4DA 1V8QA 3OW7A 2Q8IB 2GREA 1GJXA 1IW7D 4LJZC 1CBXA 3JRUA 1Z6HA 3PUVA 2O5IC 2PJ9A 3B3SA 2NSMA 4ZX8A 3VR5A 3IFTA 5BN3A 1E2WA 2DNCA 3LMSA 5LYLA 2CF4A 4L8JA 1CP6A 2PJ0A 1DTDA 2EDGA 3PUXA 3S9MA 1JQGA 4DJLA 2Q4ZA 1YW4A 1K8OA 3D7GA 5THWA 1ZLHA 4NJQA 5K8OA 1TKFA 2EVBA 2JE6I 4RUHA 3PB9X 5DS0A 3WDNA 2K7VA 4MHNA 4P4EA 2XEGA 3VR2A 1Y69U 1I6VC 3IWWA 1LAMA 1V43A 1XRYA 1HQMC 2B8GA 2D2CC 1DD2A 5LYIA 2XEJA 3IC1A 2AFMA 1ZG7A 1LOKA 1ZYRC 3A7LA 2GU2A 2NN6I 3IO1A 5JEAG 4I7ZC 1Y8PB 5LYDA 2ZEFA 2PCUA 4TWEA 4DUKA 4H13C 2DN8A 1ZLIA 3VH9A 2NYQA 3IFEA 3LWUA 1Z8LA 4ZYQA 3I1UA 1XMBA 5HVFA 1A6XA 3IIBA 4UEFA 3QJYA 3FECA 1CX8A 4NGSA 1YLOA 1HPCA 5I4MA 2E75C 3KZWA 4P45A 2O5JC 3PBEA 2PPBC 1AYEA 1B9MA 1Z7TA 1XFOA 3CPXA 4MHYA 1ZKOA 3SJFA 1CFMA 3I4LA 1G291 2IT1A 4WWVA 2JXMB 1F57A 2I3CA 1R3NA 2HC9A 3VARA 5HVGA 1OXSC 4DYOA 5F09A 1ELLP 1LAPA 1AMPA 3SJXA 4BA2I 2K33A 3SJGA 3PB4X 3D67A 2EK9A 4OC1A 1FR3A 3W3AA 4NGNA 3BI0A 2PIYA 5K8MA 4TQUS 3FF3A 4Q7AA 2V8HA 3PRTA 1BPNA 1H9SB 4IQZA 2IJZA 3TC8A 1CI3M 8CPAA 4EFDA 2D5DA 1VF5C 5KNDA 3RLFA 4F9VA 4IK2A 4TKOB 2AFZA 2PJ1A 3CDXA 3CPAA 4K3NA 3LNNA 1QQ9A 2CW0C 1PCAA 3NH8A 3HLPA 4MCRA 4MHZA 6CPAA 4PXDA 2NN6H 3ND8A 3BHXA 3S9NA 4FAIA 2J9AA 5JGFA 2C6GA 1GUTA 2EJMA 4JBWA 2A69C 3VA7A 1NSAA 3T51B 1Q7LA 1TU2B 3K9TA 3B7IA 2BE5C 1FNOA 2PCFB 4MMOA 2E76C 3V38A 3N5FA 1Y8NB 3DGVA 2C6CA 4FWUA 2AUKA 4P4FA 4P6YA 5K8PA 4A94A 1YNNC 2PJBA 1LCPA 3PEIA 2F1MA 3MRUA 2K32A 4R8FA 1DCZA 3MFYA 2ZOFA 1TXRA 4NGQA 3H94A 3H8FA 1OBRA 3NFZA 3BI1A 4OC0A 4WJBA 3P20A 1ZG8A 2EWBA 4IFDH 2PVVA 1Y0YA 1BDOA 4P10A 5C0XG 1TF8A 4KI0A 1TKHA 1Q1EA 2AWOA 1FT7A 1VHOA 2PJ7A 4IHMA 4W9YA 4FBEA 1TKJA 4OGQC 3ND9A 2ZT9C 3PBBA 3D31A 1O7LA 4YWYA 1CPXA 3A8JE 2DEAA 4AXVA 1CP7A 5KNCA 1CG2A 1Y7EA 2GLJA 2QF7A 1VF7A 3D7FA 1GHJA 2BA1A 3HUVA 1GUSA 5J1QA 3D7HA 4IAVA 3L2NA 4UF4A 3D66A 3CRLC 5JEAH 2PJ8A 2E74C 1BAVA 2AFXA 4B6ZA 1XJOA 4PXBA 4NGMA 4OC5A 3GQBA 2A6HC 1OXVA 1VHEA 2WZNA 1H9MA 2KA7A 3D4UA 4PXCA 2F7VA 2QYVA 2AFSA 2O53A 2ZEPA 3KHXA 5K36G 2NN6G 4OC4A 1OXUA 1H9RA 4OIDA 3M7NA 2ABZA 4NGTA 3SI1A 3H8EA 4HR7B 3FX6A 1YNJC 1IY7A 4MRIA 2PVWA 4P4JA 1Q1BA 3OPOA 3NE5B 1IW7C 4X3RA 1DE4C 2RB7A 4JYWA 2O4HA 2HB6A 4MHPA 1VIXA 4MXUA 4RCNA 2CIJA 4NJRA 1GUOA 2IQ6A 2V8DA 1IYVA 4BD9A 1IGBA 1Q90A 4UIAA 1OXXK 1IYUA 2BE5D 3D68A 3NA6A 3MN8A 3B3WA 1XBUA 3PV0A 5CBMA 3M85A 4JK1C 4KHZA 4DK1A 1H8LA 2ZEGA 4MCQA 1QJOA 2OOTA 3EQLC 2PJ3A 2V4DA 3FJUA 1OXTA 4G7OC 2ZENA 1YMEA 5KNBA 2PJ6A 2GLFA 4F9UA 2ZOGA 3B3CA 4BA1I 3WABA 4ZI6A 4MCPA 2AFWA 3KHZA 4JZ0A 1PYTB 2PRQA 3B3TA 3BXMA 3FH4A 2EK8A 3T53B 1GUNA 2AFUA 4LQGA 1H9SA 4OO1H 3GD7A 3I72A 3I73A 1HDQA 2POKA 3H8GA
chains in the Genus database with same CATH superfamily
4P44A 3RZOH 1HZBA 3URYA 4TNUA 1E1OA 1KDCA 4DR6Q 5EKIA 4IURA 2AKWB 3HOXH 1G51A 4A37A 2Z3KA 4B3SL 3H3VC 3QNVA 2TSSA 3H91A 1NJIC 1LO5D 1SDFA 3IEHA 4KSAA 4WRDA 1AP0A 3RAMA 1N32L 1I50B 4LMQD 1VQ8A 2VNUD 4K6LA 2PDOA 2Q51A 4XPKA 1XF8A 2AWNA 3E9HA 4RFBA 1VQCA 3A8KE 3BU2A 4DNTB 3B2YA 4F6AA 3D4DA 3QAHA 4G1PA 2NYZD 5KTDA 5LRGA 3DWQA 3QWNA 4H89A 4X5KA 3ZJ0A 1S5KA 4BY7H 2RDFA 4OKOA 4FUUA 3DXJC 2OU2A 4FF2A 5IY0A 1D5ZC 1L1OC 4PMBA 1X65A 4OWXB 4O23A 4A38A 1P4NA 4KHVA 3MC0B 5C3EH 2R92G 4UEZA 4X3UA 1N36L 2MJ8A 1PFBA 2X69A 3KR4A 2LS01 3PUZA 5KEEA 3ZYYX 2F4VL 4CJ2C 4GOPB 4JYAQ 4ONUA 3JC66 4IFDJ 4KKSA 5IYDH 1KNEA 1I4HA 1SYGA 2F0OA 1X9NA 3WC6A 4AVAA 2AFOA 2BH8A 3IKJA 2N8NA 1JICA 1WD1A 1DM0B 1A8VA 1JWMD 3QR8A 4QMGA 4YIJA 3S6FA 4R6TA 1SN8A 1S7KA 1BOSA 4YY3L 1R43A 4MJ8A 2JA5H 2B29A 3CHBD 2B8FA 1U5KA 3HOVG 1B44D 2A68D 4OO1G 1HZ9A 2IWHA 5EBVA 1BVSA 2XNAC 4JI4Q 5FLMG 1QMUA 5CV6A 3V2TA 3KL9A 2I46A 1AW7A 2E2HB 2Q04A 3GP7A 1WTPA 1VQEA 2WB1G 3N6RA 3GV6A 3D0FA 3SI0A 2DGYA 4OX9Q 5BWAB 4KZTA 4OIKA 4YGOA 4Y49C 4A3DB 4HJ8A 4G7ZC 2Q4VA 4CAEA 3SK8A 2D0PA 1I6HH 3V7ZA 2WACA 3M4PA 2SDFA 2K75A 4DU9A 4OMEA 2EE1A 2FHTA 4RKLA 5IGCA 2UUAL 1Q3LA 4PPZA 4MFLA 2X7BA 3QO2A 2G9DA 2WKCA 5FLXc 4F0XA 1RTQA 3EFXD 4X62L 2EVNA 2PYKA 2P6EA 5LL6S 3T8WA 3MGDA 1LABA 4DV4Q 4YFJA 1HR0Q 2EYHA 4N9TA 5FOBB 3G8WA 5IIFA 2G0BA 1SYEA 1SYDA 2ICIA 2JEVA 3TP5A 1K83H 4H0LC 2JA7G 4UP9A 1WCMG 3NTIA 1G2SA 1G2TA 2EYOA 4L8AA 1N33L 1Y1WG 2NMTA 5JH9A 1WTOA 5C44H 1Z9UA 3OWEB 4R8NA 2BDOA 4UP7A 2GA4B 5EPJA 2PQAA 3AQQA 4NGPA 3U9SA 1IBKL 4PZ6A 2F5IA 3FDTA 4O2DA 2KCTA 4F8ZA 1H9KA 4KSFA 1M4IA 2PO4A 2I79A 3PIO3 1GHKA 4L89A 4DAYA 1YW6A 4UHVA 3TSSA 2JN4A 3CCQA 1IBLQ 2F8HA 2OB0A 4KSIA 2FL4A 3R2IA 1TIID 2MPMA 3EIVA 5IGGA 4NFRA 5JVH3 4NGRA 2WYRA 5IP7G 1IOFA 3PIPA 2IL4A 3SI2A 4DV0L 3TRZA 4AQYL 1STEA 4DV5Q 3J7AV 1Z8WA 1CHQD 2K5WA 1VMCA 2VQFQ 4QIWE 4DV1Q 4JJXA 1CKOA 1SE4A 3PB6X 1LFWA 1SYBA 4OIWA 1EY8A 1P8LA 4DAPA 1KHIA 2M2LA 4BBSH 3SDZA 1SMYD 4A30A 3FKIB 4IPCA 2B2WC 4NP5A 1RO5A 4KKUA 2JA8G 2MQHA 3OOCA 3DR6A 4CAFA 3T13A 4GOPC 3PB8X 1RJTA 3H3VI 4ZBGA 5JPNC 3J81E 3GUXA 1K0RA 3KASA 1BUVT 5C6AA 3RZOB 4C7HA 4A3JG 4JOIC 4R9WA 3CT9A 5AG6A 2WB1B 1X54A 2VUMB 2IPKD 1UE7A 3OW7A 3CC4A 3RZDH 3PO2B 5E7NA 5M3MB 1IW7D 5AJ3Q 4IOCA 2DUDA 4IUUA 3HOVH 2XGTA 3JRUA 2UUCL 1PLFA 2PJ9A 4LUOA 3K58A 2F3IA 3HOYB 2NSMA 2PI2E 1KRTA 2DNCA 4B9WA 3M4OB 5FLMH 1CP6A 2PJ0A 4DUZL 1JWSD 3EVQA 4JBJA 4HJAA 5G20A 4KOVA 4LF7L 2C5CA 1HA5A 3S9MA 5I9OA 4ZCKA 2DJFC 2JA6H 3AEVA 1TWAB 1YNXA 1MJBA 3SVMA 4OADA 2VQFL 3FKIH 1PH6A 1Z8XA 4AQYQ 2KEDA 1TKFA 1MGSA 4RUHA 1HZAA 1SNCA 4Q36A 4G57A 2HDMA 2K28A 2R7DA 3P2HA 2WAQB 4GKKL 4P4EA 2NVQB 1LAMA 2F0HA 2ASBA 5IYCH 3CF5A 3GDEA 4RN7A 1XEBA 5COYA 1A3TA 1TS2A 1STNA 2XEJA 3IC1A 4CGOA 1LT4D 2AFMA 1LOKA 1ZYRC 2NN6I 1RCVD 1Y8PB 1UUPA 3ERSX 1N8RC 2ZEFA 1GM5A 1YJNA 3V05A 2GE3A 1HA6A 3S17H 3SXOA 3VH9A 4QC6A 3IFEA 2HHHQ 2NVTB 3LWUA 4ZUJA 4ZYQA 4C3JH 1A6XA 3DWAA 1WCMH 1GO3E 5FK9C 5M5WH 4A3IG 2GFQA 4NGSA 4A2ZA 1YLOA 2EY6A 4DAMA 5I4MA 5C44G 3IWGA 1XOVA 1NBWA 1WTRA 1G6ZA 3KZWA 4GLAC 4EGVA 2KCNA 2E5LL 4MY0A 4JI2Q 3G6JB 2E8GA 4X64Q 1BCPB 5C4JH 2LKVA 1S72A 1B9MA 4KY5A 4C3IH 1RTNA 1XNQQ 1S3OA 2HIVA 1RXTA 5KIXA 3BYTB 3MWYW 3MFGA 1PYSB 2JXMB 2P6FA 1XJVA 2YNCC 1R3NA 3S14H 4ABNA 1V1QA 1LAPA 3SJXA 1AMPA 1XTDA 2PZUA 1I4PA 4HIKA 3BI0A 3ER0A 1VQNA 3SHLA 4KLVA 2RHQB 4BS9A 1H9SB 1TWCH 4BWGB 3GTLB 4B5PA 5C4JB 2Z3NA 4EFDA 2D5DA 5KNDA 3RLFA 2F0GA 3JAMc 1HFNA 4LF9Q 4IK2A 5IGBA 1HXYD 1J5EL 2AFZA 2YNEA 1ML0D 4A76A 2Z0ZA 3CPAA 3LNNA 1QQ9A 5M5YB 4OWWB 1V9PA 6CPAA 2GVAA 4LFCQ 5E4WC 3KKWA 2AQ1B 3PGPA 3I4MH 2B58A 1IOIA 1NSAA 1UEAB 1M8AA 1PZKD 2ICEC 2N78A 3B7IA 4OO1I 2PCFB 4MMOA 2E76C 1ESFA 2QEXA 3T1HQ 1E24A 4IPDA 1AEXA 3G4SA 1I1DA 1WWZA 5KTCA 1S5CD 4P6YA 1XNQL 4A94A 3PO3G 1TR5A 2F1MA 3MRUA 2J7ZA 1KAWA 4WJ3M 2ZOFA 4JI5L 3NFZA 1LLRD 4NW2A 5FO8B 1NMTA 1Q2YA 4CRYB 3DSBA 5CNPA 1A63A 3H09A 4JV5Q 4U68A 4JCVE 1GXDC 1IL8A 1Y0YA 1EWCA 1EWIA 4FXDA 4DKAC 1U6MA 3SXNA 1TKHA 3HFZB 4KJNA 4HJ5A 2WPXA 1TKJA 1XNRL 3ND9A 5FVJA 1A2TA 4A3KH 4EQOA 3TO9A 4LF8L 3STBD 3J81j 2ZW4A 5J8CA 2EBJA 3JTKA 2F4VQ 2F0WA 1CPXA 2TMPA 4AXVA 1WYDA 2KHJA 5KNCA 2ZJQA 1EL0A 1X55A 2KECA 1G6PA 1GHJA 3NQTA 1Y1VB 4EVOA 5J1QA 4NXNL 2IX3A 3DUZA 3L2NA 4IAVA 4P75A 4UF4A 2NZOA 4L5QA 4UAIA 1L0WA 1PVOA 2PJ8A 4KOUA 3A74A 5GAEC 1BAVA 3HG9A 3CW2C 4JI1Q 4DV4L 3K7AH 3KF8B 4NGMA 3MTSA 5M3FH 2R92B 1PYWD 4X3KA 4DV2L 4CYPA 4JW0A 2A6HC 1OXVA 4AG9A 2QDLA 2WZNA 3T9YA 1H9MA 3D4UA 2KBNA 4GNXC 2R7ZH 4JXRA 1CKNB 1Y14B 3QOJA 3PF4A 3J7AF 2L0CA 1KC8C 1EYDA 3PQIA 2OH1A 2ZEPA 4IALA 2DY7A 3IRBA 4OC4A 2M00A 3FRPB 5J8FA 3LX0A 3I3CA 4A93B 4POFA 3M7NA 4JPBW 2XRSD 3H8EA 3NTKA 4O1NA 2F0LA 5DLQE 1IY7A 3DM3A 4DR1Q 1Q1BA 4IFDI 3NE5B 5C5LA 2OT2A 2Z3MA 4AVCA 2PI2A 2F0FA 2ZW6A 3D2MA 2QCPX 2FINB 4B3RQ 4LF7Q 2B5GB 1VIXA 1RL2A 2LSSA 1XNRQ 2OTJA 2V8DA 2IQ6A 1EY5A 1BF4A 4B3MQ 2OTLA 2GVBA 4QJFA 4GNXA 1O7IA 4N8FA 4BXXH 1MBYA 5LMUL 2A74C 2MO0A 2MP1A 3GYAA 2ZPAA 3PV0A 1IZ6A 2EZVA 2VS1A 3NBIA 1YVKA 4KHZA 3HOZB 4JYAL 1H8LA 3ULPA 1NSLA 2CKZB 4DR4L 2D0OA 3M3YH 4A3LG 2O28A 3W91A 4YHHQ 1OXTA 4ZRZA 3I4MG 2XTIA 2N88A 4LX9A 2F0EA 3UDXA 2GLFA 4CDEC 4F9UA 3Q24A 4APVA 4B3SQ 3K0XA 2QA4A 1PH9A 4ZAIA 2AFWA 3F5BA 3I2ZA 3MXNA 3J81L 3CC2A 1IICA 3NQIA 2PRQA 2HIXA 2PC1A 3BXMA 2QGQA 2AJ6A 2FE7A 3SGIA 1WK4A 1GUNA 3FH4A 2AFUA 1XMOQ 2JLMA 1D1IA 1H9SA 5J39A 2B2YA 2HUGA 4OO1H 2ZXVA 1VQGA 3GD7A 3I72A 1WTHA 2Q7BA 3K80C 3H0GG 5JJKA 5C88A 1LACA 2Z6KC 1CQVA 3E0EA 2JJQA 3FIXA 1VQ6A 2PJ2A 1S5FD 3PGZA 3TX8A 2FMCA 4C7IA 4LQ6A 4A3CH 3GTKH 2VZYA 3E3XA 1QOHA 4KKTA 2HV2A 4HNWB 5EGTA 5C0XH 4ZLTF 3A7AB 1OO9B 4Y7NB 2Q43A 3FBUA 4I65A 4A3BB 4DR1L 2QIRA 1I50H 2L11A 1EQQA 3HOUH 1HEEA 2FXQA 2B4BA 3CQZB 5FJ8H 2ZM6L 3S2HH 2RC4A 3WC5A 1JR0D 3NH4A 2Q2HA 2C35B 3TO6A 3HKSA 5D29A 4A3DG 1BR9A 4I7AA 2Y0SG 1ZXTA 4DAVA 1R9TB 4UEEA 1WOCA 2FIAA 4CKBA 2CNMA 1EE3P 4B3TL 1PUAA 2UUBL 5IP7H 1XPOA 3HKZE 3RLOA 3TZUA 3F2CA 1X3FA 2P6GA 3I7FA 2L5TA 3CPFA 4ID6A 3GTGH 3J81i 3A55A 3X3MA 4DNRB 1M4LA 1TS3A 4DK3C 2PIZA 2JK8A 4U9YA 1BBUA 1CHPD 4RGMA 2UXDQ 4JI7L 5I2XA 4DV3Q 1RHPA 1QWYA 2PMZE 1M1KC 1VQAA 2NVTH 1VQDA 3VR6A 2JA7H 2NVYB 1Z2LA 2YYZA 4KD3A 3WT4A 1UWYA 5J1ZA 2G9HD 1X3EA 1NSNS 2YTYA 3UE0A 1ICWA 2PNHA 4FDBA 2VB3X 2EYLA 3I4NB 2CTBA 4H44C 4MZ9A 1HNXQ 3CXQA 3FVLA 2FT0A 2JP1A 2K5HA 2A68C 4IUTA 4KN7C 2F0KA 4CHTB 4J3GA 4XQJA 1F9SA 1JMCA 3B3VA 1OZPA 1DOLA 1EYCA 3BVZA 1EIYB 3HOZH 3WWVA 1LYLA 4Q5VA 1KLUD 3VDYA 1SEBD 4CPAA 5FKAC 3PFOA 4OX9L 1HQRD 2ZEEA 4II9A 3SE0A 3L7ZC 5IT9L 4BY1B 2I5HA 2D4OA 3VWDA 4A95A 4CYNA 3QG1A 5KGUA 1F2YA 4R4CA 1YHQA 2RA4A 5JM6A 4XTCS 2YNCA 1LANA 5DEHA 4ZY2A 2QILA 4KMUC 4MBUA 4ZY0A 3KR5A 2MO1A 2VL6A 1TWGH 4R7MA 4X62Q 4A3FH 1HNWL 3T1YL 3IGRA 4A3CG 4HJ7A 4UP8A 1ET9A 2EJFC 2NVYH 4A3GG 2JA8H 4PV6A 4JWPA 3PB7X 1I4GA 1F2OA 5J3BA 1ONLA 1TF9A 1ELMP 4LUAA 2F3WA 4HSVA 1YQEA 5F47A 3H0GB 4BY7B 4A3LH 2NUCA 1PH8A 4MTKA 3KDFA 3KYHC 3HOUB 3CXSA 1CM0A 3TE4A 1JB3A 1K8MA 4C3HG 4KS9A 3I8ZA 1Q8KA 1VS0A 2NVXB 1G91A 1TQOA 2OQKA 5BR8L 1HR0W 3MHBA 1I4QA 1HTPA 4A3BG 4HMJA 3S1NH 2N55A 3F0AA 4FD6A 3HGBA 1PH3A 3VATA 4R4QA 1U4LA 3R2TA 5LRKA 3T16A 3VYTA 1ARMA 3W6XA 2FCKA 1XIXA 3FEDA 4DAYB 4C3JG 1YJWA 2B2UA 2JA9A 3P7JA 4CBVA 1KRSA 1MHWC 4V0BA 4JD6A 5JAVA 3PUYA 3KQXA 3DWPA 3S2DB 4LF5L 1MSGA 3UI2A 1KD1C 4C3IB 4RMFA 1J8IA 2PRBA 4QVTA 5CYUA 2BOAA 3T56B 5C3WA 2ZELA 1HRJA 4B10A 3FEEA 5G3LF 1PH2A 1CKMA 3PCOB 3DLJA 4HNYB 3H3VH 2KHIA 2Q8RE 5CPAA 2PJCA 1DOKA 1BKBA 4R87A 1LTLA 2KOLA 3HOWH 1MI2A 1ARLA 3T1YQ 4A3MB 5ELEA 4AG7A 1AE2A 2B2VA 3R93A 1PZJD 4JOIA 1CUKA 4PMWA 2ZXRA 3FB3A 1LUZA 1Q2DA 2DNEA 1S7NA 4UIBA 3AU7A 1ESRA 3BVGA 1XMTA 1C0AA 5LYFA 1AN8A 5EKKA 1LTSD 5A2QL 1Y0RA 2QDBA 3KQZA 3W1BA 2QJ8A 2V8VA 1M4GA 2IHEA 1PDQA 1T5EA 4GOPA 1SYCA 2RKSA 4WFN3 1X3GA 2B4DA 3ISXA 5A35A 3IU1A 3I3GA 5EMIA 3NE8A 2B3VA 1MJCA 2LMCB 1VQFA 5DM63 3CMEA 3FXTA 1CPSA 1ENAA 3MXNB 3BLNA 4EWTA 4L6TB 3MVVA 5HVHA 3GB0A 4QCLA 2H4OA 2X6GA 4CYQA 2VI7A 4AVBA 1I94L 5KYIA 4XQNA 1YZ6A 1SMYC 2L15A 2P5ZX 3CCVA 2J0TD 4A3BH 2GREA 2VUMH 1GJXA 4BBHA 2B2VC 2ZXOA 1RIPA 4FD5A 4LJZC 5H84A 1ENCA 3KBXA 4KLKA 1A62A 4ZUIA 1AE3A 1CM9A 1PFMA 1Z6HA 3BYYB 4IUVA 3VA5A 1QSMA 4IUPA 4ZX8A 1KNAA 3NSWA 1QCBD 4XXEA 5LYLA 2HQLA 2CF4A 2UUBQ 5EBDA 2EDGA 4UCPA 3PUXA 4NPSA 3KF6B 4DR5L 3U9OA 1C7YA 4NXML 1JQGA 2Q4ZA 1YW4A 3F8KA 1Z9FA 3D4WA 5THWA 1JJ2A 1ZLHA 5NUCA 2EVBA 4EQPA 1EU3A 4HIMA 2JE6I 3CCRA 2BDNA 3WDNA 4JI7Q 2K7VA 3VYSA 4B11A 4JI3Q 2B2UC 3CP0A 3VR2A 1Y69U 3E9IA 3KLWA 1V43A 2F52A 4UPAA 1TXYA 1JE4A 1R4PB 1SBBB 4BBSB 1DD2A 3U4ZA 4H7BA 2EYFA 4UBRA 3K81C 3CXPA 1VMPA 3L0OA 1MKHA 3D6WA 1ZG7A 1HFGA 2HCCA 2NB0A 3GTOB 2DF5A 4KVME 4E8OA 5IGFA 4I7ZC 3BZCA 4KTAA 4TWEA 4DUKA 4K2LA 5AJ3L 1ZLIA 3S15B 1PRTD 5C3EB 5M3FG 1JORA 3B8GA 3F2DA 4U5YA 1HUMA 4HSPA 3DDDA 4M6HA 4N9PA 5HVFA 1XMBA 3J80i 3IIBA 4UEFA 4JI4L 3QJYA 1O7ZA 2B5GA 4JI8L 1EU4A 1NR4A 1F77A 2AMCB 2QW7A 2E75C 1AZQA 1BCPD 2XWBB 2UU9L 3DHQA 2OWOA 4P45A 5IT9E 2O5JC 1IYJB 4DN4M 1B3QA 2F0QA 3R9FA 4UA3A 3L9AX 2K01A 3PBEA 3EBEA 1PFNA 5LMNL 1FNUA 2H5XA 3QB3A 3AYHB 1Z7TA 5C5MA 2PPBC 1S7FA 4R9MA 3J7YW 4MHYA 4JC0A 1G291 2IT1A 4WWVA 4X66Q 3HOWG 1F57A 1YK3A 1F2ZA 4P72A 1FVIA 3NEMA 4RCOA 3SK6A 3VARA 3UY5A 4JV5L 2JA6B 3S1RH 5F09A 1HTLD 3DLLA 1SMXA 1ELLP 3PZJA 5CGKA 2KUMA 2EK9A 3UDFA 1FR3A 2YTVA 5C4HA 4NGNA 2PIYA 5K8MA 1MD2D 1Q7YC 4TQUS 1PH5A 4RHSA 3SK4A 1C48A 2ZTEA 5IWAQ 3PRTA 3Q23A 2HT1A 1LT3D 1PH1A 2NVXH 1SNMA 4J15A 4M85A 5M5XB 4LF4L 1YITA 1O80A 4TKOB 2Q4YA 3G48A 3K5LA 2CW0C 2RSOA 5CV9A 1KZFA 3TP6A 4MCRA 4CGNA 1D7QA 1FNVA 4BMHA 2Z3PA 3ND8A 1IHZA 3D8PA 3FPUB 5ELDA 5JGFA 2C6GA 1GUTA 2F4IA 4JBWA 4CYOA 3VA7A 3I9SA 4YWLA 1D8LA 1Q7LA 4DV2Q 1STGA 2A1AA 2BE5C 1FNOA 3J7A5 1AZPA 2K5QA 3N5FA 4CGLA 1LV9A 1Y8NB 4ORFA 5M5WB 3UE1A 4GKJL 2C6CA 2QMLA 2AUKA 4FWUA 4P4FA 1I6HB 5K8PA 1LCPA 4OL7A 2K32A 4O0AA 5T1IA 3WR7A 4NGQA 4JVZA 4GNXB 4DPGA 3GIUA 4OC0A 3KDFB 4LAAA 3TS0A 1VQKA 4IFDH 1BDOA 1E3PA 4IN3A 5C0XG 2VEZA 1TF8A 1RD9D 1VKCA 3TP8A 2REFA 4CRZB 2SOBA 2J8MA 1VHOA 1SAPA 4B12A 5IOCA 1SNOA 3D6CA 5JPMC 1X3QA 3I90A 3J80E 3IWEA 4XNHB 3HKZG 3D31A 3G3SA 1O7LA 5JJIA 5LMNQ 1CP7A 2IY5B 1F9PA 4KY6A 1V1PB 1EOVA 2QF7A 2DPTA 3MEHA 4QL5A 3HUVA 1NE3A 3CRLC 1HNWQ 4PQXA 4HCEA 1JE5A 5C82A 4JXQA 3FP9A 5H86A 2KHSA 4DUZQ 2XWJB 4OC5A 1HZCA 1NMGA 2NTSA 1PH7A 1VHEA 2HUZA 1C4QA 2OZUA 4C56C 4PXCA 1KUYA 5IT9c 4IPHA 2F7VA 4MY3A 3WOEA 1SNQA 1WI5A 5ELCA 3R9EA 3CCLA 4AYBE 4K2KA 2QYVA 1CA5A 4GKKQ 1C8CA 1CZGA 4IZ8A 4OIDA 4Y7NH 2ABZA 3OWFA 1PTOC 4A3DH 4CDDC 3ZZIA 4NGTA 1T9HA 1XWEA 4HR7B 3SEBA 1K0SA 4R57A 3R9GA 2Q8TA 1XMQQ 3OSOA 3FNCA 2PVWA 4YCVA 3TOAA 3F2UA 4X3RA 3S6HA 2JA5G 3PO3H 4A3FB 2VQYA 1VQPA 5FO7B 2RB7A 2O4HA 4GKJQ 3TOBA 3E6ZX 1YIJA 4AYBB 2PR8A 2KENA 1A2UA 2NZ1D 3BVMA 4FNFA 2JA8B 1EQRA 5IGDA 2R93H 1YJ9A 4A3GB 4BD9A 1IGBA 4DR7Q 4WJ4A 4DV0Q 3MN8A 4EX5A 3B3WA 1XBUA 4NDXA 4XT3B 2WPWA 1I3QH 4A3JB 1N32Q 4JK1C 3EN2A 5IYDG 5IYBG 2JA7B 5E1FA 1YNND 3RNUA 2ZEGA 4MCQA 1QJOA 2PJ3A 2V4DA 3F8TA 3FJUA 1GOZA 1F2MA 1SLJA 2NTTA 3TZDA 1YMEA 1FJGL 4KOWA 5EKLA 3B3CA 3W5OA 1DJRD 5AFWA 3EFAA 1PA6A 2JYOA 3WABA 4ZI6A 4K5XA 4DV3L 4MTNA 1TS5A 1QSOA 1EEFD 1SRUA 3B3TA 1L1OB 2Q0YA 3PMFA 2HCIA 1WJJA 3TMEA 2EK8A 1GKHA 4LQGA 4MIUA 4ZYSA 1IU8A 1CJWA 4NCZA 4OLLA 3R96A 3H8GA 2POKA 1KL9A 4A3EH 4DK0A 1P0HA 3STBC 5CV4A 3SJEA 3EROA 2FIWA 3VR3A 2RDGA 1VQ7A 4K30A 4IFDG 4C3HB 4Y52H 4MFQA 4UCMA 1IBLL 1VQBA 2YU9H 2A6EC 4GS4A 1K83B 2F0PA 5KYLA 1J4JA 3S1MB 1I5FA 5K36H 2PJAA 2Z6KA 2JEBI 2BA0A 3KOJA 3RD4A 2ANPA 3FPPA 3W1GA 4F87A 2V8GA 2WINB 1CQFA 5BN4A 1B2TA 3D7DA 2CFMA 4NMZA 4DV6L 4MCSA 4WJWA 2EY5A 2VZAA 1V0CA 3M4QA 2QVPA 2K50A 3MA2B 3WC7A 4DR7L 2A6HD 1R9TH 3HEJA 1X32A 3C1FA 4KN4C 3OMCA 2CQAA 4FD7A 4AYBG 2JSOA 2Y0SE 3TREA 1SE8A 4OIJA 3QAYA 1B87A 4XQQA 4C1NI 3S2HB 3FRMA 4IF5A 1NTGA 3S1MH 2CTCA 3ISZA 3QIAA 3GTPB 1SJHD 2QECA 7CPAA 5I4DA 1P16A 3FEWX 4LF4Q 1Y1VH 2MHVA 1YSJA 1KTKA 1BO0A 1S40A 2A69D 4L5TA 3GO5A 3K57A 3TTHA 2AHOB 4BBRB 5BR8Q 1B70B 3VR4A 4G7HC 4A3KB 4A39A 4P73A 3K2KA 5LMUQ 3N52A 4DNCA 5A28A 4CKCA 1CA6A 1GUGA 1I3QB 4A3JH 5CV8A 3NENA 3EY5A 4DR2L 4C2MB 2K1BA 4KOTA 4XYOA 1WTQA 4LFBL 4ZY1A 2GIVA 4E2AA 4NXYA 2R93B 2R6GA 1D6EC 3U58A 3TS2A 3C26A 1QZHA 2E2IB 4X3TA 1SFOB 4HIOA 1XYIA 1HDUA 2I00A 4JI8Q 2OXPA 2ES2A 2L4NA 5GAHC 1WTVA 1M1DA 1O78A 5LHY1 4DV7Q 3TCVA 3K0YA 3RN2A 4JI0Q 4YU9A 4LK1C 2RCNA 3D4RA 4B13A 3JVNA 3BZDB 1VGYA 4KVOE 1K9MC 1ON0A 2R61A 2BH2A 1HCZA 3S9WA 4FXKC 3RR5A 4KJOA 3FYNA 2CH4A 1D5MC 1Z8TA 3NH5A 1N33Q 1RTOA 2B2TA 3TT2A 2R8VA 1YHBA 2FJ2A 1Q86C 4LF9L 2B63G 4AIMA 5F2DA 1B53A 4JBKA 4GN5A 3I91A 2UXBL 2YGWA 4XNHC 1U4MA 4MHDA 2ZJPA 3PFEA 3RZAA 4EMEA 4DUYL 3Q8DA 1BXTA 2WP8J 3BZKA 1Y1VG 3B35A 4CGPA 4MNOA 4B3ML 2R7ZB 4EQ5A 3P2FA 1QSRA 2EIFA 3A5ZB 1JWQA 4KHPL 2UUAQ 1UE5A 4GN4B 1NR2A 1KWMA 2ZEDA 4BY1H 3CPWA 3CAMA 1IB1E 4B5PB 4QIWB 5C0XJ 5IB9A 2D62A 5HXDA 3BDOA 1PU9A 1TVXA 4PQAA 1SSOA 2A19A 1EEID 1HH2P 4RAUC 1FJGQ 2ZEHA 4B5OA 1EY0A 5DM73 3PP9A 1EZ6A 4JI0L 1KABA 4B9XA 5CR3A 4QGUA 3NHHA 4J1MA 3GTPH 4DV7L 4U9ZA 2RFHA 3KI9A 2UXCL 3S16B 2H1EA 1F2LA 4H2KA 3R95A 3RO0A 1VHSA 1VCIA 3E5SA 2A5HA 5M9OA 4X2TA 1YBYA 2AQ3B 5DAUA 3J7ZC 1ASYA 3OTOL 2XEIA 3AB9A 1CTMA 1E0BA 2PJ4A 1RKNA 3IU2A 1SR3A 3R3OA 2IW3A 4DK6C 4B3TQ 1F2PA 1TS4A 4P2CB 4RGNA 1YR0A 2OEOA 4ZKCB 5AG7A 2G3TA 1FGUA 1BBXC 5E96A 1QUQB 4RGOS 1A2ZA 1H9JA 4CJ1B 1WTWA 2NVQH 2CNTA 5AG4A 2EXDA 1QE6A 4R4TA 3S1QH 2L9HA 5HGQA 3QB8A 4LNQA 4PNYA 2ZM6Q 2E2JH 2AUJD 4DV5L 2GANA 4N8X1 5DWMA 4OC3A 1PTOF 3BG3A 2WIIB 3T90A 5T1GA 3JAML 2WB1E 4L63B 3I4MB 5G1ZA 2OCEA 2BUEA 1KDAA 4LF5Q 1GVPA 3CCUA 2O5IC 5HY6A 4CKEA 3B3SA 2REEA 2R3ZA 3VR5A 1X56A 5BN3A 1E2WA 3S1QB 1E1TA 1UWVA 2PQ8A 4HPSA 5F48A 1DTDA 2Q44A 2KCMA 2IX0A 1AFPA 4PZ8A 4JLYA 1C9OA 4FYDA 1K8OA 1S4ZA 2N3SA 4NJQA 1U9RA 1L1OA 4LFAQ 2UXCQ 3PB9X 4CAWA 4XYQA 2F0IA 5K5PA 1AUGA 2KQ3A 4YWKA 1ZO0A 2XEGA 1I94Q 2ZXPA 3S15H 3D2PA 1HQMC 3CD6A 2VQEL 1TWHH 3M9BA 2D2CC 5IWAL 3J81c 5LYIA 3IAYA 4PSWA 1W2BA 3A56A 2OF1A 5IP9G 2Z4HA 3A7LA 5JJLA 4FF1A 2CNSA 2GU2A 3IO1A 5F46A 3BJUA 4FF3A 4KVXA 3RNZA 2CQOA 2PCUA 4H13C 3G7LA 2DN8A 4QF4A 5A2QE 3GTOH 3IL8A 2VBQA 2UUCQ 1EY7A 3RN5A 1LTRD 4HJ9A 4OELB 3H15A 2B3GA 1HPCA 1WD0A 3NXWA 4WORA 5C4ZA 1HR0L 3CKIB 1IL2A 5IE8A 1NUCA 4Y49B 5FO9B 4OAEA 4MHEA 1VQ9A 4A93G 1EIFA 1UE6A 3C2PA 1X10A 4UWIA 2L12A 1AYEA 3VWEA 3BDLA 1VQHA 4R4OA 3OYYA 5F49A 1QILA 3I4LA 4P71A 4A75A 2K5DA 2F0VA 2I3CA 2NZHA 4S3SA 1EY6A 2SNSA 1EYGA 5HVGA 1OXSC 3A54A 1LTTD 3SJGA 4BA2I 1IBMQ 4HMIA 1I4XA 2MNAA 3D67A 1GD7A 3U4VA 3S6KA 4OC1A 3W3AA 1EY9A 3MAQA 2Z1CA 3CU7A 2RHSB 4RA8A 3V96A 1YLEA 3FF3A 1K8AC 2MUYA 5LL6X 1BNZA 4Q7AA 2VZZA 2K52A 3HOVB 4UDUC 4A33A 1TY2A 1MJEA 4YRHA 8CPAA 4YWMA 5AGEA 1HJPA 2I5MX 3I4NG 1VF5C 2HHHL 4F9VA 5C4XG 4NSQA 2WV6D 2PMZB 4BXXG 3K5OA 4K5WA 3M4OH 2K5VA 2PJ1A 2B2WA 5HMNA 5CV7A 4DGZA 2YU9B 3BHXA 4ZQ3A 4HTHA 3S9NA 1XX8A 2XVSA 1SYFA 4Q0FA 5IYCG 3PO2H 2EJMA 1LTID 2A69C 3T51B 3TQYA 3NWTA 3K9TA 3K6OA 3KUPA 1Q82C 1BOBA 2MFIA 1DYQA 4IPGA 3OW2A 1Y1WB 2VUMG 4K6DA 1H95A 3C46A 3I4OA 3UDIA 1YX0A 1YNNC 2PJBA 4DV6Q 5JOBA 3EXNA 1UE1A 1VQ4A 2JA5B 3H94A 4J6HA 2R7HA 3H8FA 1PZID 2YV5A 4WJBA 2RDHA 3P20A 4A3IH 2PVVA 3WOFA 2YTXA 4M1UB 3ICEA 2OZHA 5EJWA 3F1ZA 4X66L 4ZK9B 3HOXG 4P10A 3M3YB 4POGA 4DF7A 4IUNA 2PJ7A 1FT7A 2FMMA 4IHMA 4W9YA 4OEMB 3PF5A 1ICFB 3PBBA 2Y0SB 2K03A 4YWYA 1PH4A 1QG7A 1Y7EA 1PFSA 3GTQB 5IX3A 2BA1A 1GUSA 3D7HA 2R1IA 3VYRA 3D66A 2F03A 4JI6Q 5GAGC 2Z3LA 2EY1A 1D1KA 1RDPD 5EPKA 1VQ5A 4BY7G 1IYKA 2AFXA 1W3SA 4BBRH 1XJOA 1J9OA 2HD3A 3GQBA 3GTMH 1MJAA 4QBJA 2HDLA 3TP7A 4K0KQ 5ISRA 2JDDA 1JT8A 3RZDB 1SROA 2ALYB 3JAME 4XDXA 3GTJB 1M90C 2KVMA 3D8GA 1NE9A 1TWCB 2O53A 3S14B 3KHXA 4A3EB 2NN6G 2XSCA 5C3XA 2NWGA 2ZTCA 2K6AA 3S1NB 1NCVA 2PR1A 3HOYG 3I55A 1ILPA 4HNXB 1NY4A 1CKNA 3SI1A 1MIUA 3S1RB 4LFAL 1I12A 2PQEA 4MRIA 3TBIB 5ISVA 4DR5Q 2F0SA 4CS0B 1IW7C 3Q6SA 4IUQA 3S16H 3I70A 4KUBA 5FLXE 3W2DA 3G6EA 4GN3B 4Q38A 1ASZA 3EJIA 4MHPA 1Z47A 3KK7A 3U50C 2FXFA 4KK7A 2CIJA 4MXUA 2WAQE 2Z3OA 1GUOA 1E22A 2MGSA 3R8BA 1X3PA 1ILQA 3CCEA 3I4NH 3DEOA 4A31A 1E7ZA 1Q90A 3D68A 3NA6A 2BE5D 3NPPA 3J80L 5JEAJ 3PSIA 3HS0C 3CC7A 3A5UA 3HOWB 3M85A 3OWCA 4C3JB 4O42A 3LODA 1FNWA 5E3FA 2OOTA 1Y9WA 4KOYA 5J22A 4GLVB 2SEBD 1V1OA 2EQSA 2SNMA 2LXJA 4PSXA 4KOXA 3PO2G 3O13A 4J8QA 3RUZA 1JJGA 2ZOGA 3GTGB 4UWJA 3HZXA 4MCPA 1VQLA 3KHZA 4JZ0A 1PYTB 1R4QB 4C2XA 2LY7A 1SQHA 1EY4A 5M3MH 3TO7A 1TWAH 2JQOA 3T53B 1YREA 4ZGYB 2RBMA 5IV0A 4RGTA 2BEIA 1EIHA 4E6IA 4IUSA 2BL1A 5M5XH 4RS2A 2PZTA 1HDQA 1YHAA 3I56A 1WTXA 1CK1A 4XIGS 4XT1B 1LRZA 4B3RL 2I07B 3S9LA 4GZYC 1EFID 4ZX9A 4CJ0B 4L5SA 1DZ1A 5I9PA 4QB9A 3FHWA 2DPSA 3K8AA 4HEDA 4JBMA 1HNZL 2V77A 3IJ3A 3GTMB 1KUVA 3DEPA 3NBHA 2JDCA 5K8NA 2K05A 1Q12A 2CXAA 3GTJH 2BCOA 2LXKA 4C2YA 1PYBA 3CRKC 3N7ZA 3T4AC 3JAMi 4P4IA 2BOSA 4PV1C 1E2VA 2F0NA 1YEZA 4C3HH 5I6WA 1QSTA 1J6QA 1EFWA 1FD7D 3K9UA 2P0WA 4MI4A 1CSQA 4L5RC 4RWSC 1Y9KA 2A6ED 1ZG9A 3NUCA 2ID0A 3OMGA 3CCMA 1TWGB 1B9NA 1BBWA 3KF8A 4BBRG 1KDBA 2O2LD 2ZEOA 1ENFA 4LWCA 3ZJYC 2RF4A 4PXEA 1W6KA 2PNRC 4X8IA 4CGMA 4BBSG 1PTOB 4MN3A 1VDZA 4YCUA 2XEFA 3A9LA 4OC2A 4QUFA 4XPLA 1ZYRD 1XPRA 1JCKB 2IMOA 4C1NK 1IXRA 1L2FA 1LTAD 3NTHA 4LUVA 2R7ZG 2EO8A 2Z11A 2UXBQ 3K7UC 4EVYA 3X3NA 3GV3A 4RI1A 3V8IA 2I5LX 3SHPA 4H02A 1JOKA 3MZ5A 4G4KA 3K59A 2R98A 2F3VA 1PRTF 4LF8Q 2J8NA 3DR8A 4YCWA 5LRJA 2WSAA 2ZJRA 2B63B 1FL0A 5D14A 5I2YA 4K5VA 2DY8A 2Q2TA 4PG3A 4KHPQ 4X64L 4JI2L 1UAPA 3CZXA 1PTOH 4V190 3KLRA 1E2ZA 1BQQT 2K14A 5ELOA 1PMRA 5JJZA 4IJLA 4GM5A 1LM0A 4E0AA 2RVLA 3A8IE 4DR6L 4F0YA 3PO3B 2Z6BA 3PIP3 4K14A 4ONWA 3A0JA 2VL1A 3G71A 1DONA 3OIPA 4CAVA 4K8JA 4FF4A 2JA6G 1B4OA 3S2DH 1HUNA 5D8NA 2IX1A 2CH4W 1Q8IA 5HGTA 3M4YA 4MFKA 4H6ZA 2K5TA 4GXHA 3D3RA 2C1CA 5DNFA 4EQNA 4HKFA 2CWPA 2Q7SA 5EBCA 2LFNA 2A4NA 2ZEMA 5FJ8G 2N49A 4DR2Q 1Y8OB 5E4XA 2JEWA 1DGSA 4TSSA 2VW9A 4DR3L 2PE3A 3D3SA 1D5XC 1FY7A 1JC7A 1ZEQX 4R4IA 4MFPA 4KORA 2FFKB 2F0JA 3ULJA 4DFAA 5BN5A 2C6PA 4ME3A 3C1EA 2KJXA 4XPDC 3DMUA 1IIDA 2JBJA 2J8RA 3GLJA 3DM1A 3GTKB 4P4BA 3LGJA 1SE3A 2UU9Q 4DXFA 3K5NA 3DNSA 1B3AA 3MXUA 1RF2D 1N36Q 3H0GH 4CAXA 1CZWA 1STAA 4YY3Q 4C2ZA 2OR4A 1A3UA 3AMUA 3FVQA 4RH6A 1STHA 1K3RA 4X65L 1IBML 2FS5A 4PK2A 4UCNA 1QVCA 1KIXA 2F0MA 3FMCA 5ELYA 5KTAA 4LF6Q 5JPHA 3OIQA 2FVGA 1SJED 1DXMA 1SNDA 4KY7A 3SXHA 2DXQA 3SK5A 1Z5RA 1YVCA 2JEAI 4YHHL 1LTBD 1EWHA 3ERQA 1LT6D 2F0DA 4DR4Q 3TDQA 1II3A 2IJ0A 4F7XA 1U4PA 4DXGA 1BPMA 2JBKA 4OP4A 3S6GA 3T1HL 3B6YA 4Z9CB 1LTGD 3RBUA 1SE2A 2HQYA 2A73B 2R7FA 3VYUA 3C3LA 1GYTA 2WFWA 3LD2A 1YVOA 1HHVA 1XMOL 5GROA 1V1PA 3PUWA 4QQBX 4TRDA 4A3FG 4LFCL 5DWNA 4NEXA 1XXGA 4C68A 4IOAA 4R76A 1MJ9A 4QB4A 1TY0A 1PXUA 4X3SA 2VXWA 5JVG3 2BO9A 4A3GH 1FYCA 3CQZH 4RKBA 1BLLE 1EQTA 3KGQA 4RG1A 3KJOA 1F9RA 1TKWB 4UY8C 1X12A 4JI1L 4Z65A 5D3IB 1QZGA 5KRUA 2PJ5A 4A93H 2EJGC 5M5YH 2F0TA 2RSNA 2ZW7A 3BJ7A 2ODFA 4LUZA 2KCWA 2CWAA 3HOZG 4CDFC 3KF6A 4GLXA 2KCCA 3NWSA 3TEHB 4P4DA 3M7GA 1K28A 1V8QA 1Q81C 2Q2UA 2UXDL 1TIQA 2ENBA 2G5DA 2Q8IB 1QVGA 1K73C 5C4XB 3RYOA 5I0CA 1IBKQ 1CSPA 3HKZB 4FD4A 2QKIC 5L37A 3GTQH 2Y0MA 1CBXA 1PV4A 4IO9A 2EYPA 3PUVA 4UFVA 4NF1A 5C0XI 4K0KL 1GHEA 5G22A 5TSSA 3IFTA 1XPUA 3LMSA 3R1KA 2RCFA 4L8JA 1I4RA 3LWEA 1EZ8A 1TT2A 1PRTC 3H4QA 3LACA 1NMFA 3P75A 2C9OA 3HOXB 4DJLA 4A4IA 4ZKBB 4JI6L 1SFOH 4QUCA 3D7GA 4X65Q 1S3ZA 5EQ0A 2E2IH 5K8OA 3KBGA 2GN5A 1N34L 5ELFA 4FO2A 2K04A 5DS0A 2ARHA 1VQMA 4MHNA 2PQAB 1R57A 1S60A 1UEBA 1N9WA 1I6VC 3IWWA 5FLXL 3S17B 1XRYA 4M6IA 3QOLA 2DJGC 2B8GA 3KJPA 1DOMA 4ULLA 2Z0SA 1T5XD 4IJHA 4ALPA 4F88A 1SNPA 1U4RA 4LFBQ 1WVLA 1IKLA 1S5ED 3OHXC 4NXMQ 2B2TC 1AH9A 5JEAG 4B14A 3PIOA 5LYDA 4ME5A 1VQOA 1B1ZA 4M8AA 2CVRA 3K5MA 2NYQA 3TN2A 1Z8LA 1XMQL 1D2BA 2XIWA 1J5EQ 3I1UA 3NELA 3MXPA 3FECA 4DNIA 3NP8A 1RODA 1JOQA 1PHJA 1CX8A 5CBAE 1WCMB 5CV5A 1Y1WH 3EC4A 1A0IA 3Q22A 2ZTDA 4K8IA 1O7YA 2HQEA 4BY1G 4M6GA 1YI2A 1KQSA 5GQOA 2B4DB 1VQIA 1VQJA 4AH6A 2YNDA 1K4JA 2H5MA 4KUAA 1XFOA 4A3KG 1Z4RA 4A3MH 3HOYH 5H1SE 2J4XA 3CPXA 1ZKOA 2L1BA 3SJFA 1CFMA 1L0YB 1SXTA 4PMCA 3BDCA 2O4XA 4U673 3CMAA 2HC9A 2D9UA 4DYOA 1EYAA 2PW5A 4FP5D 4M3SA 3BJ8A 2K33A 4KD4A 4QUSA 1JOOA 3PB4X 4R3LA 4F8MA 4TVAB 4KLWA 3GTLH 4PZ7A 1I21A 1ET6A 1NNXA 3H5ZA 3AFQA 2E5LQ 2OQ0A 5ELBA 1S5DD 5G3LD 4LW1A 2V8HA 1BPNA 4ILWA 2F0UA 1WFQA 4IQZA 2IJZA 3TC8A 3TFYA 1CI3M 2B3UA 2K5NA 2XN9C 2CY2A 1QUQA 4NXNQ 3FKIG 1K3BC 4RHRA 3CDXA 2AQ2B 4K3NA 1PCAA 1BO4A 3NH8A 3HLPA 3UDGA 4JG2A 1S7LA 4MHZA 4PXDA 2NN6H 1BCPC 2WKDA 5D65A 1B8AA 2CCZA 5CBEE 1K8GA 4FAIA 2J9AA 4AB7A 1PRTB 1QNUA 4R8IA 4DV1L 3EA6A 4HN7A 1TU2B 4MFZA 3L2PA 2FSRA 3ONAB 3JUWA 2XRQD 4UFXA 3V38A 2VQEQ 3EO4A 1B6BA 2I0QA 4NB3A 3RMHA 5IP9H 1KUXA 4R3KA 3DGVA 1MK4A 3NK9A 5M3MG 4CDCC 3PEIA 4OWTB 4FXGC 1Z4EA 4P74A 4R8FA 1DCZA 3ITPA 4A3IB 5IODA 1TWFH 3MFYA 4KV6A 1TXRA 4I49A 5LMNW 1OBRA 1UFHA 3BI1A 5EPLA 5CMDA 3E0JA 1Q2CA 3Q0AA 1Y7RA 1ZG8A 2EWBA 4GS3A 3KFUA 3MEFA 2R93G 2KEEA 1UNSA 2CW0D 2EY2A 2EXZA 1MSHA 4LF6L 3GKRA 1A15A 4KI0A 2EYJA 1Q1EA 2AWOA 4FBEA 3HOUG 2G3AA 1EUJA 1GUWA 5IYBH 5GCNA 4OGQC 5ELNA 2B2YC 4OHJA 2ZT9C 1EQVA 1QNKA 2B39A 2L55A 4C3IG 1HNXL 1M4DA 1S5BD 1JWUD 3SR1A 2C27A 4KOSA 3W6SA 4B08A 2V1CC 3A8JE 3KLSX 2DEAA 4FVMA 1CG2A 5C44B 4DA2A 2GLJA 1PTOD 1VF7A 3D7FA 1NAPA 3P1HA 3MXGA 3ULLA 4NKLA 2VXKA 5JQ4A 4H6UA 1JB7A 5JEAH 2RQXA 3CCSA 2E74C 1N71A 4B6ZA 4PXBA 4X6AH 5IB0A 4BINA 5HURA 5HH1A 1JQYD 4A3EG 1M4VA 2PZWA 5C3EG 5M3FB 2R92H 3K7AB 1M44A 2WUUA 5C4XH 2A8VA 2KA7A 5CORA 4HCSA 4DR3Q 2BSWA 2ZW5A 3CXCA 3HP3A 1STYA 2E2HH 2AFSA 4OONA 1EOTA 2EUIA 3GY9A 2Z4IA 5K36G 4JI5Q 1OXUA 1H9RA 1KAAA 2PW7A 4R1JA 4A32A 4A3MG 1STBA 4JI3L 2K4KA 2E2DC 2IL8A 5AG5A 2PSWA 3RLNA 1N34Q 5D3DA 2Q2IA 3FX6A 1YNJC 3HRZC 2M9VA 5EC4A 3F2BA 4P4JA 1X6OA 4HAEA 2EOTA 3OPOA 4DUYQ 3E0KA 1F9QA 1DE4C 1CT1D 3BS1A 4HIDA 2VB2X 2E2JB 1XE4A 1QSNA 1KXLA 1JJCB 4JYWA 3NE7A 1A3VA 5I6YA 4XPDB 2HB6A 4QY7A 2Z9HA 5EAYA 4RCNA 3NBHB 4NJRA 1G8ZD 2WAQG 1IYVA 1QB5D 1XTCD 2EYMA 4UFWA 3S24A 5CC4A 3CCJA 1L0XB 1B50A 5G21A 4UIAA 1OXXK 1IYUA 3IFDA 1Q46A 1IKMA 2IHFA 2ATRA 3OTOQ 4C2MH 5CBMA 2Z8LA 1FGBD 2AE6A 2D4PA 4DK1A 2X6LA 2CHBD 1TWHB 2QEJC 1W6JA 3EQLC 1LT5D 2EPBA 2VY3A 3J80c 1OTCA 4G7OC 2ZENA 1B7YB 5KNBA 2OZGA 1EIGA 1QVFA 2ATWA 1IYLA 2NBFA 3L3OC 2PJ6A 2B63H 4BA1I 2Z10A 1HNZQ 1YGHA 4OXPA 1TWFB 3H6MA 4PK3A 5A27A 3AFPA 1L0CA 5IGEA 4ODGA 1U0LA 1YNJD 1KLGD 5GADC 3KLSA 3I73A 1BCPF 4CGYB 4MFJA
chains in the Genus database with same CATH topology
4P44A 3URYA 4TNUA 1KDCA 5EKIA 4IURA 4A37A 3H3VC 3QNVA 2TSSA 3H91A 1LO5D 1SDFA 3IEHA 4WRDA 1AP0A 3RAMA 1I50B 4LMQD 2VNUD 4K6LA 2Q51A 2AWNA 4RFBA 3A8KE 3B2YA 4DNTB 3D4DA 4G1PA 2NYZD 5LRGA 3DWQA 3QWNA 2RDFA 4OKOA 4FUUA 3DXJC 4FF2A 1D5ZC 4PMBA 4O23A 4A38A 4KHVA 3MC0B 4UEZA 4X3UA 2MJ8A 1PFBA 2X69A 3KR4A 2LS01 3PUZA 5KEEA 3ZYYX 4CJ2C 4IFDJ 4KKSA 1KNEA 1I4HA 1SYGA 2F0OA 3WC6A 2AFOA 3IKJA 1JICA 1WD1A 1DM0B 1JWMD 4QMGA 4YIJA 4R6TA 1BOSA 1R43A 3CHBD 2B8FA 1B44D 2A68D 4OO1G 2IWHA 2XNAC 1QMUA 5CV6A 3V2TA 3KL9A 2I46A 1AW7A 2E2HB 3GP7A 1WTPA 3N6RA 3GV6A 3SI0A 4OIKA 4A3DB 4G7ZC 3SK8A 3V7ZA 2WACA 2SDFA 4DU9A 4OMEA 2EE1A 2FHTA 4RKLA 5IGCA 1Q3LA 4PPZA 3QO2A 2G9DA 2WKCA 1RTQA 3EFXD 2PYKA 5LL6S 3T8WA 1LABA 2EYHA 4N9TA 5FOBB 5IIFA 1SYEA 1SYDA 2ICIA 3TP5A 4H0LC 3NTIA 1G2SA 1G2TA 2EYOA 5JH9A 1WTOA 3OWEB 4R8NA 2BDOA 5EPJA 2GA4B 4NGPA 3U9SA 3FDTA 4F8ZA 1H9KA 2PO4A 3PIO3 1GHKA 4DAYA 1YW6A 3TSSA 2F8HA 4KSIA 3R2IA 1TIID 2MPMA 5IGGA 4NFRA 5JVH3 4NGRA 2WYRA 3SI2A 1STEA 3J7AV 1CHQD 2K5WA 1VMCA 1SE4A 3PB6X 1LFWA 1SYBA 4OIWA 1EY8A 4DAPA 2M2LA 3SDZA 1SMYD 3FKIB 4NP5A 2B2WC 4KKUA 3OOCA 3T13A 3PB8X 1RJTA 5JPNC 3J81E 3GUXA 3KASA 1BUVT 5C6AA 3RZOB 4R9WA 3CT9A 2WB1B 2VUMB 2IPKD 3OW7A 3PO2B 5M3MB 1IW7D 4IUUA 3JRUA 1PLFA 2PJ9A 3K58A 3HOYB 2NSMA 2DNCA 4B9WA 3M4OB 1CP6A 2PJ0A 1JWSD 3EVQA 2C5CA 1HA5A 3S9MA 5I9OA 1TWAB 3SVMA 2KEDA 1TKFA 1MGSA 4RUHA 1SNCA 4G57A 2HDMA 2K28A 4P4EA 2WAQB 2NVQB 1LAMA 2F0HA 5COYA 1A3TA 1TS2A 1STNA 2XEJA 3IC1A 1LT4D 2AFMA 1LOKA 1ZYRC 2NN6I 1RCVD 1Y8PB 1UUPA 2ZEFA 3V05A 3VH9A 1HA6A 3IFEA 2NVTB 3LWUA 4ZUJA 4ZYQA 1A6XA 3DWAA 5FK9C 4NGSA 1YLOA 2EY6A 5I4MA 1WTRA 1G6ZA 3KZWA 4EGVA 2KCNA 3G6JB 1BCPB 2LKVA 1B9MA 4KY5A 1RTNA 5KIXA 3BYTB 3MWYW 3MFGA 2JXMB 1R3NA 4ABNA 1LAPA 3SJXA 1AMPA 2PZUA 1I4PA 3BI0A 3SHLA 4BS9A 1H9SB 4BWGB 3GTLB 5C4JB 4EFDA 2D5DA 5KNDA 3RLFA 2F0GA 1HFNA 4IK2A 5IGBA 1HXYD 2AFZA 1ML0D 3CPAA 3LNNA 1QQ9A 5M5YB 6CPAA 5E4WC 2AQ1B 1NSAA 1UEAB 1M8AA 1PZKD 2ICEC 3B7IA 4OO1I 2PCFB 4MMOA 2E76C 1ESFA 1AEXA 1S5CD 4P6YA 4A94A 1TR5A 2F1MA 3MRUA 2J7ZA 2ZOFA 3NFZA 1LLRD 4NW2A 5FO8B 3H09A 4U68A 1GXDC 1IL8A 1Y0YA 1EWCA 4FXDA 1TKHA 4KJNA 1TKJA 3ND9A 1A2TA 4EQOA 2F0WA 1CPXA 2TMPA 4AXVA 5KNCA 1EL0A 2KECA 1GHJA 3NQTA 1Y1VB 4EVOA 5J1QA 2IX3A 3DUZA 3L2NA 4IAVA 4UF4A 4UAIA 2PJ8A 1BAVA 3HG9A 4NGMA 3MTSA 2R92B 1PYWD 4X3KA 2A6HC 1OXVA 2WZNA 1H9MA 3D4UA 3QOJA 3J7AF 2L0CA 1EYDA 2ZEPA 4IALA 2DY7A 4OC4A 2M00A 3FRPB 3LX0A 3I3CA 4A93B 3M7NA 2XRSD 3H8EA 3NTKA 4O1NA 2F0LA 1IY7A 1Q1BA 4IFDI 3NE5B 5C5LA 2OT2A 2F0FA 2QCPX 2FINB 1VIXA 2V8DA 2IQ6A 1EY5A 1BF4A 1MBYA 2A74C 2MP1A 3PV0A 2EZVA 3NBIA 4KHZA 3HOZB 1H8LA 1OXTA 4ZRZA 2N88A 2F0EA 2GLFA 4F9UA 3Q24A 4ZAIA 2AFWA 3MXNA 3J81L 2PRQA 3NQIA 3BXMA 3FH4A 1GUNA 2AFUA 1D1IA 1H9SA 5J39A 2B2YA 2HUGA 4OO1H 3GD7A 3I72A 1LACA 1CQVA 2PJ2A 1S5FD 3TX8A 2FMCA 1QOHA 4KKTA 5EGTA 5C0XH 4ZLTF 3A7AB 1OO9B 4Y7NB 2Q43A 4I65A 4A3BB 2L11A 1HEEA 3CQZB 3WC5A 1JR0D 3NH4A 5D29A 1BR9A 1ZXTA 4DAVA 1R9TB 4UEEA 4CKBA 1EE3P 3TZUA 2L5TA 4ID6A 3A55A 3X3MA 4DNRB 1M4LA 1TS3A 2PIZA 1CHPD 4RGMA 5I2XA 1RHPA 1QWYA 3VR6A 2NVYB 1Z2LA 2YYZA 4KD3A 3WT4A 1UWYA 5J1ZA 2G9HD 1NSNS 1ICWA 2VB3X 2EYLA 3I4NB 2CTBA 4H44C 3FVLA 2JP1A 4IUTA 2A68C 4KN7C 2F0KA 4CHTB 4XQJA 1F9SA 3B3VA 1DOLA 1EYCA 3BVZA 4Q5VA 1KLUD 4CPAA 1SEBD 5FKAC 3PFOA 1HQRD 2ZEEA 3SE0A 3L7ZC 5IT9L 4BY1B 3QG1A 5KGUA 1F2YA 2RA4A 5JM6A 4XTCS 1LANA 5DEHA 4ZY2A 2QILA 4KMUC 4ZY0A 3KR5A 4R7MA 1ET9A 2EJFC 3PB7X 1I4GA 1F2OA 1ONLA 1TF9A 1ELMP 2F3WA 4HSVA 3H0GB 4BY7B 2NUCA 3HOUB 1JB3A 1K8MA 4C3HG 3I8ZA 2NVXB 1G91A 1TQOA 3MHBA 1I4QA 1HTPA 4HMJA 2N55A 3HGBA 3VATA 1U4LA 3R2TA 5LRKA 3T16A 3VYTA 1ARMA 3FEDA 4C3JG 2B2UA 3P7JA 4CBVA 4V0BA 5JAVA 3PUYA 3KQXA 3DWPA 3S2DB 1MSGA 3UI2A 4C3IB 1J8IA 5CYUA 2BOAA 3T56B 5C3WA 2ZELA 1HRJA 3FEEA 5G3LF 3DLJA 2Q8RE 5CPAA 2PJCA 1DOKA 2KOLA 1MI2A 1ARLA 4A3MB 5ELEA 2B2VA 3R93A 1PZJD 4PMWA 2ZXRA 2DNEA 4UIBA 3AU7A 1ESRA 3BVGA 5LYFA 1AN8A 5EKKA 1LTSD 5A2QL 1Y0RA 2QDBA 3KQZA 2QJ8A 2V8VA 1PDQA 1T5EA 1SYCA 2RKSA 4WFN3 3ISXA 5A35A 2LMCB 5DM63 1CPSA 1ENAA 4EWTA 4L6TB 3MVVA 5HVHA 3GB0A 4QCLA 2H4OA 2X6GA 5KYIA 4XQNA 1SMYC 2J0TD 2GREA 1GJXA 2B2VC 2ZXOA 4LJZC 1ENCA 3KBXA 4ZUIA 1CM9A 1PFMA 1Z6HA 3BYYB 4IUVA 3VA5A 4IUPA 4ZX8A 1KNAA 3NSWA 1QCBD 4XXEA 5LYLA 2CF4A 5EBDA 2EDGA 3PUXA 3U9OA 1JQGA 2Q4ZA 1YW4A 3D4WA 5THWA 1ZLHA 5NUCA 2EVBA 4EQPA 1EU3A 2JE6I 2BDNA 3WDNA 2K7VA 3VYSA 2B2UC 3VR2A 1Y69U 1V43A 1JE4A 1R4PB 1SBBB 4BBSB 1DD2A 4H7BA 2EYFA 1VMPA 3D6WA 1ZG7A 1HFGA 2HCCA 2NB0A 3GTOB 5IGFA 4I7ZC 4KTAA 4TWEA 4DUKA 4K2LA 1ZLIA 3S15B 1PRTD 5C3EB 1JORA 1HUMA 4HSPA 4N9PA 5HVFA 1XMBA 3IIBA 4UEFA 3QJYA 1O7ZA 1EU4A 1NR4A 1F77A 2E75C 1AZQA 1BCPD 2XWBB 3DHQA 4P45A 5IT9E 2O5JC 4DN4M 2F0QA 3L9AX 2K01A 3PBEA 1PFNA 1FNUA 3QB3A 2PPBC 1Z7TA 5C5MA 3J7YW 4MHYA 1G291 2IT1A 4WWVA 1F57A 1F2ZA 4RCOA 3SK6A 3VARA 2JA6B 5F09A 1HTLD 1ELLP 5CGKA 2KUMA 2EK9A 1FR3A 5C4HA 4NGNA 2PIYA 5K8MA 1MD2D 4TQUS 4RHSA 3SK4A 1C48A 3PRTA 3Q23A 1LT3D 1SNMA 5M5XB 1O80A 4TKOB 3K5LA 2CW0C 2RSOA 5CV9A 3TP6A 4MCRA 1FNVA 3ND8A 1IHZA 3FPUB 5ELDA 5JGFA 2C6GA 1GUTA 2F4IA 4JBWA 3VA7A 1Q7LA 1STGA 2BE5C 1FNOA 1AZPA 2K5QA 3N5FA 1LV9A 1Y8NB 5M5WB 4FWUA 2C6CA 2AUKA 4P4FA 5K8PA 1I6HB 1LCPA 4OL7A 2K32A 5T1IA 4NGQA 4OC0A 4LAAA 4IFDH 1BDOA 4IN3A 5C0XG 1TF8A 1RD9D 3TP8A 2SOBA 1VHOA 1SAPA 5IOCA 1SNOA 3D6CA 5JPMC 1X3QA 3I90A 3J80E 3D31A 1O7LA 1CP7A 1F9PA 4KY6A 1V1PB 2QF7A 3MEHA 3HUVA 3CRLC 4PQXA 4HCEA 2KHSA 2XWJB 4OC5A 2NTSA 1VHEA 1C4QA 4C56C 4PXCA 2F7VA 3WOEA 1SNQA 5ELCA 4K2KA 2QYVA 1CA5A 1C8CA 1CZGA 4IZ8A 4OIDA 2ABZA 3OWFA 1PTOC 4NGTA 1XWEA 4HR7B 3SEBA 2Q8TA 3OSOA 2PVWA 3F2UA 4X3RA 4A3FB 5FO7B 2RB7A 2O4HA 3E6ZX 4AYBB 1A2UA 2NZ1D 3BVMA 4FNFA 2JA8B 5IGDA 4A3GB 4BD9A 1IGBA 3MN8A 3B3WA 1XBUA 4NDXA 4XT3B 4A3JB 4JK1C 2JA7B 5E1FA 1YNND 2ZEGA 4MCQA 1QJOA 2PJ3A 2V4DA 3FJUA 1GOZA 1F2MA 2NTTA 3TZDA 1YMEA 5EKLA 3B3CA 1DJRD 5AFWA 2JYOA 3WABA 4ZI6A 4K5XA 1TS5A 1EEFD 3B3TA 3PMFA 2HCIA 3TMEA 2EK8A 4LQGA 4MIUA 4ZYSA 3H8GA 2POKA 4DK0A 5CV4A 3SJEA 3EROA 3VR3A 2RDGA 4IFDG 4C3HB 2A6EC 1K83B 2F0PA 5KYLA 3S1MB 5K36H 2PJAA 2ANPA 2JEBI 2BA0A 3RD4A 3FPPA 4F87A 2V8GA 2WINB 1CQFA 5BN4A 1B2TA 3D7DA 4NMZA 4MCSA 4WJWA 2EY5A 2QVPA 3MA2B 3WC7A 2A6HD 3HEJA 1X32A 3C1FA 4KN4C 3OMCA 2CQAA 2JSOA 4OIJA 4XQQA 4C1NI 3S2HB 3ISZA 2CTCA 3QIAA 3GTPB 1SJHD 7CPAA 5I4DA 3FEWX 2MHVA 1YSJA 1KTKA 1BO0A 2A69D 3GO5A 3K57A 4BBRB 3VR4A 4G7HC 4A39A 4A3KB 3K2KA 3N52A 4CKCA 1CA6A 1GUGA 1I3QB 5CV8A 4C2MB 2K1BA 4XYOA 1WTQA 4ZY1A 2R93B 2R6GA 1D6EC 2E2IB 4X3TA 1SFOB 1XYIA 1HDUA 2OXPA 2L4NA 1WTVA 1O78A 5LHY1 3K0YA 4YU9A 4LK1C 3D4RA 3BZDB 1VGYA 2R61A 1HCZA 3S9WA 4FXKC 4KJOA 1D5MC 3NH5A 1RTOA 2B2TA 2FJ2A 5F2DA 1B53A 3I91A 1U4MA 3PFEA 3RZAA 4EMEA 1BXTA 2WP8J 3B35A 2R7ZB 1NR2A 1KWMA 2ZEDA 4QIWB 5C0XJ 5IB9A 2D62A 5HXDA 3BDOA 1TVXA 4PQAA 1SSOA 1EEID 4RAUC 2ZEHA 1EY0A 5DM73 1EZ6A 1KABA 4B9XA 5CR3A 3NHHA 4J1MA 2RFHA 3KI9A 3S16B 2H1EA 1F2LA 4H2KA 1VCIA 3E5SA 2A5HA 5M9OA 4X2TA 2AQ3B 5DAUA 2XEIA 3AB9A 1CTMA 1E0BA 2PJ4A 1RKNA 3R3OA 2IW3A 1F2PA 1TS4A 4P2CB 4RGNA 2OEOA 4ZKCB 1BBXC 4RGOS 1H9JA 4CJ1B 1WTWA 1QE6A 2L9HA 4PNYA 2AUJD 4OC3A 1PTOF 3BG3A 2WIIB 5T1GA 3JAML 4L63B 3I4MB 1KDAA 2O5IC 4CKEA 3B3SA 2R3ZA 3VR5A 5BN3A 3S1QB 1E2WA 1DTDA 2IX0A 1AFPA 4FYDA 1K8OA 1S4ZA 4NJQA 1U9RA 3PB9X 4XYQA 2F0IA 5K5PA 2KQ3A 2XEGA 2ZXPA 1HQMC 2D2CC 5LYIA 3IAYA 3A56A 2OF1A 2Z4HA 3A7LA 2GU2A 4FF1A 3IO1A 4FF3A 2PCUA 4H13C 3G7LA 2DN8A 4QF4A 5A2QE 3IL8A 1EY7A 1LTRD 1HPCA 1WD0A 3NXWA 4WORA 5C4ZA 3CKIB 1NUCA 5FO9B 4MHEA 3C2PA 2L12A 1AYEA 3BDLA 1QILA 3I4LA 2K5DA 2F0VA 2I3CA 4S3SA 1EY6A 2SNSA 5HVGA 1OXSC 3A54A 1LTTD 3SJGA 4BA2I 4HMIA 1I4XA 3D67A 4OC1A 3W3AA 1EY9A 3MAQA 2Z1CA 3CU7A 4RA8A 3V96A 3FF3A 2MUYA 5LL6X 1BNZA 4Q7AA 3HOVB 4UDUC 1TY2A 8CPAA 1VF5C 4F9VA 2WV6D 2PMZB 3K5OA 4K5WA 2PJ1A 2B2WA 5CV7A 4DGZA 2YU9B 3BHXA 4ZQ3A 4HTHA 3S9NA 1XX8A 2XVSA 1SYFA 4Q0FA 2EJMA 1LTID 2A69C 3T51B 3NWTA 3K9TA 3K6OA 3KUPA 1DYQA 1Y1WB 4K6DA 3C46A 1YNNC 2PJBA 5JOBA 2JA5B 3H94A 4J6HA 3H8FA 1PZID 4WJBA 2RDHA 3P20A 2PVVA 3WOFA 4P10A 4M1UB 5EJWA 4ZK9B 3M3YB 4DF7A 4IUNA 2PJ7A 1FT7A 2FMMA 4IHMA 4W9YA 3PBBA 2Y0SB 2K03A 4YWYA 1QG7A 1Y7EA 3GTQB 2BA1A 1GUSA 3D7HA 3VYRA 3D66A 2F03A 2EY1A 1D1KA 1RDPD 5EPKA 2AFXA 1XJOA 1J9OA 3GQBA 2HDLA 3TP7A 5ISRA 3RZDB 3JAME 4XDXA 3GTJB 2KVMA 3D8GA 2O53A 1TWCB 3S14B 3KHXA 4A3EB 2NN6G 2XSCA 5C3XA 2NWGA 2K6AA 3S1NB 1NCVA 1ILPA 3SI1A 3S1RB 2PQEA 4MRIA 3TBIB 2F0SA 1IW7C 3Q6SA 4IUQA 3I70A 5FLXE 3W2DA 3EJIA 4MHPA 1Z47A 3KK7A 4MXUA 4KK7A 2CIJA 1GUOA 2MGSA 3R8BA 1X3PA 1ILQA 3DEOA 1Q90A 3D68A 3NA6A 2BE5D 3NPPA 3J80L 5JEAJ 3HS0C 3HOWB 3M85A 4C3JB 4O42A 1FNWA 5E3FA 2OOTA 5J22A 2SEBD 1V1OA 2SNMA 3O13A 4J8QA 3RUZA 2ZOGA 3GTGB 3HZXA 4MCPA 3KHZA 4JZ0A 1PYTB 1R4QB 2LY7A 1EY4A 3T53B 2RBMA 4RGTA 1EIHA 4E6IA 2PZTA 1HDQA 1WTXA 1CK1A 4XIGS 4XT1B 2I07B 3S9LA 4GZYC 1EFID 4ZX9A 4CJ0B 1DZ1A 5I9PA 4HEDA 2V77A 3IJ3A 3GTMB 3DEPA 3NBHA 5K8NA 2K05A 1Q12A 2BCOA 3CRKC 3T4AC 4P4IA 2BOSA 4PV1C 1E2VA 2F0NA 5I6WA 1FD7D 4RWSC 2A6ED 1ZG9A 3NUCA 2ID0A 3OMGA 1TWGB 1B9NA 3KF8A 2ZEOA 1KDBA 2O2LD 1ENFA 4PXEA 1W6KA 2PNRC 4X8IA 1PTOB 4MN3A 1VDZA 2XEFA 4OC2A 4QUFA 1ZYRD 2IMOA 1JCKB 4C1NK 1LTAD 3NTHA 3X3NA 3GV3A 1JOKA 3MZ5A 4G4KA 3K59A 2F3VA 1PRTF 5LRJA 2B63B 5D14A 5I2YA 4K5VA 2DY8A 1UAPA 1PTOH 4V190 3KLRA 1E2ZA 1BQQT 1PMRA 5JJZA 4GM5A 2RVLA 3A8IE 3PO3B 3PIP3 4K14A 4ONWA 2VL1A 1DONA 3OIPA 4K8JA 4FF4A 1HUNA 1B4OA 5D8NA 2IX1A 1Q8IA 5HGTA 3M4YA 3D3RA 2C1CA 5DNFA 4EQNA 5EBCA 2LFNA 2ZEMA 1Y8OB 5E4XA 2JEWA 4TSSA 2PE3A 1D5XC 1JC7A 1ZEQX 2FFKB 2F0JA 4DFAA 5BN5A 2C6PA 3C1EA 2KJXA 3DMUA 2JBJA 3GLJA 3DM1A 3GTKB 4P4BA 1SE3A 4DXFA 3K5NA 1B3AA 3MXUA 1RF2D 1CZWA 1STAA 2OR4A 1A3UA 3AMUA 3FVQA 4RH6A 1STHA 2F0MA 3FMCA 5ELYA 3OIQA 2FVGA 1SJED 1DXMA 1SNDA 4KY7A 3SXHA 3SK5A 1Z5RA 2JEAI 1LTBD 1EWHA 3ERQA 1LT6D 2F0DA 3TDQA 1II3A 2IJ0A 4F7XA 1U4PA 4DXGA 1BPMA 2JBKA 4OP4A 4Z9CB 1LTGD 3RBUA 1SE2A 2A73B 3VYUA 3C3LA 1GYTA 1HHVA 1V1PA 3PUWA 4TRDA 1XXGA 4R76A 4QB4A 1TY0A 1PXUA 4X3SA 2VXWA 5JVG3 2BO9A 1FYCA 4RKBA 1BLLE 1EQTA 3KGQA 1F9RA 1TKWB 4Z65A 5D3IB 5KRUA 2PJ5A 2EJGC 2F0TA 2RSNA 2KCCA 3NWSA 4P4DA 3M7GA 1V8QA 2ENBA 2Q8IB 5C4XB 3HKZB 2QKIC 1CBXA 2EYPA 3PUVA 5C0XI 5TSSA 3IFTA 3LMSA 4L8JA 1I4RA 3LWEA 1EZ8A 1TT2A 1PRTC 3P75A 2C9OA 3HOXB 4DJLA 4ZKBB 4QUCA 3D7GA 5EQ0A 5K8OA 3KBGA 5ELFA 4FO2A 2K04A 5DS0A 4MHNA 1I6VC 3IWWA 5FLXL 3S17B 1XRYA 3QOLA 2B8GA 1DOMA 4ULLA 1T5XD 4F88A 1SNPA 1U4RA 1WVLA 1IKLA 1S5ED 3OHXC 2B2TC 5JEAG 5LYDA 4ME5A 1B1ZA 4M8AA 2CVRA 3K5MA 2NYQA 3TN2A 1Z8LA 1D2BA 2XIWA 3I1UA 3MXPA 3FECA 1JOQA 3NP8A 1RODA 1CX8A 5CBAE 1WCMB 5CV5A 3Q22A 4K8IA 1O7YA 2HQEA 1XFOA 3CPXA 2J4XA 1ZKOA 2L1BA 3SJFA 1CFMA 1L0YB 1SXTA 4PMCA 3BDCA 2O4XA 4U673 2HC9A 2D9UA 4DYOA 1EYAA 2PW5A 4FP5D 2K33A 4KD4A 1JOOA 3PB4X 4F8MA 1ET6A 5ELBA 1S5DD 5G3LD 2V8HA 1BPNA 4ILWA 2F0UA 4IQZA 2IJZA 3TC8A 1CI3M 2XN9C 4RHRA 3CDXA 2AQ2B 4K3NA 1PCAA 3NH8A 3HLPA 4MHZA 4PXDA 2NN6H 1BCPC 2WKDA 5D65A 5CBEE 4FAIA 2J9AA 1PRTB 1QNUA 4R8IA 3EA6A 4HN7A 1TU2B 3ONAB 2XRQD 3V38A 3RMHA 3DGVA 3NK9A 3PEIA 4FXGC 4R8FA 1DCZA 3ITPA 4A3IB 5IODA 4KV6A 3MFYA 1TXRA 1OBRA 3BI1A 5EPLA 5CMDA 3E0JA 3Q0AA 1ZG8A 2EWBA 2KEEA 1UNSA 2CW0D 2EY2A 2EXZA 1MSHA 1A15A 4KI0A 2EYJA 1Q1EA 2AWOA 4FBEA 1GUWA 4OGQC 2B2YC 2ZT9C 1EQVA 1QNKA 2B39A 2L55A 4OHJA 4C3IG 1S5BD 1JWUD 3SR1A 4B08A 3A8JE 3KLSX 2DEAA 4FVMA 1CG2A 5C44B 4DA2A 2GLJA 1PTOD 1VF7A 3D7FA 1NAPA 3P1HA 3MXGA 4NKLA 5JEAH 2RQXA 2E74C 4B6ZA 4PXBA 5HURA 1JQYD 1M4VA 2PZWA 5M3FB 3K7AB 2KA7A 5CORA 4HCSA 3HP3A 1STYA 2AFSA 1EOTA 2Z4IA 5K36G 1OXUA 1H9RA 1KAAA 2PW7A 1STBA 2E2DC 2IL8A 5D3DA 3FX6A 1YNJC 3HRZC 2M9VA 4P4JA 2EOTA 3OPOA 4HAEA 1F9QA 1DE4C 1CT1D 3BS1A 2VB2X 2E2JB 4JYWA 1A3VA 5I6YA 2HB6A 4RCNA 4NJRA 1G8ZD 1IYVA 1QB5D 1XTCD 2EYMA 5CC4A 1B50A 1L0XB 4UIAA 1OXXK 1IYUA 3IFDA 1IKMA 5CBMA 2Z8LA 1FGBD 4DK1A 2X6LA 2CHBD 1TWHB 2QEJC 1W6JA 3EQLC 1LT5D 2EPBA 4G7OC 2ZENA 5KNBA 1EIGA 2NBFA 3L3OC 2PJ6A 4BA1I 1TWFB 3H6MA 5IGEA 4ODGA 1YNJD 1KLGD 3KLSA 3I73A 1BCPF 4CGYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LAC A;  4DK0 A;  4XIG S;  4P44 A;  2PJ2 A;  3TX8 A;  3SJE A;  3S9L A;  4TNU A;  3VR3 A;  4GZY C;  4ZX9 A;  4IFD G;  4KKT A;  5C0X H;  3A7A B;  2Q43 A;  4A37 A;  2A6E C;  2V77 A;  3QNV A;  3IJ3 A;  5K36 H;  1HEE A;  2PJA A;  2ANP A;  2JEB I;  2BA0 A;  3IEH A;  5K8N A;  3FPP A;  3WC5 A;  1Q12 A;  2V8G A;  5BN4 A;  3NH4 A;  3D7D A;  3RAM A;  2BCO A;  4MCS A;  5D29 A;  3CRK C;  2Q51 A;  2QVP A;  4P4I A;  4UEE A;  4PV1 C;  3WC7 A;  1E2V A;  3A8K E;  2A6H D;  4DNT B;  3B2Y A;  1EE3 P;  4G1P A;  4KN4 C;  5LRG A;  3TZU A;  2A6E D;  2L5T A;  1ZG9 A;  4DNR B;  1M4L A;  3ISZ A;  2CTC A;  4FUU A;  4OKO A;  3DXJ C;  1B9N A;  3QIA A;  2PIZ A;  2ZEO A;  7CPA A;  1YSJ A;  4O23 A;  4PXE A;  4A38 A;  2PNR C;  4X8I A;  3VR6 A;  4UEZ A;  1VDZ A;  1Z2L A;  2XEF A;  4OC2 A;  2YYZ A;  3KR4 A;  2A69 D;  1UWY A;  3PUZ A;  2IMO A;  3WT4 A;  3VR4 A;  4G7H C;  4A39 A;  2CTB A;  4KKS A;  4H44 C;  3K2K A;  3FVL A;  4KN7 C;  2A68 C;  3WC6 A;  2AFO A;  1GUG A;  3IKJ A;  3B3V A;  4CPA A;  4R6T A;  3PFO A;  5LRJ A;  2ZEE A;  4ZY1 A;  3SE0 A;  2R6G A;  3L7Z C;  1R43 A;  3QG1 A;  3KLR A;  5JM6 A;  1E2Z A;  2B8F A;  4XTC S;  2A68 D;  1LAN A;  4OO1 G;  1HDU A;  4ZY2 A;  4KMU C;  4ZY0 A;  3KR5 A;  1PMR A;  4GM5 A;  3A8I E;  4R7M A;  1O78 A;  1QMU A;  3KL9 A;  4ONW A;  2VL1 A;  4YU9 A;  4LK1 C;  2EJF C;  5D8N A;  3N6R A;  3M4Y A;  3D4R A;  3SI0 A;  2C1C A;  3PB7 X;  1F2O A;  1VGY A;  1ONL A;  1ELM P;  4G7Z C;  1TF9 A;  2ZEM A;  3V7Z A;  1HCZ A;  4OME A;  1Y8O B;  3NH5 A;  2JEW A;  2PE3 A;  4PPZ A;  2G9D A;  1K8M A;  1RTQ A;  5BN5 A;  2C6P A;  1HTP A;  2JBJ A;  3T8W A;  3PFE A;  1LAB A;  3GLJ A;  3RZA A;  3HGB A;  4P4B A;  3VAT A;  4EME A;  5LRK A;  3MXU A;  1ARM A;  3B35 A;  3FED A;  4H0L C;  2OR4 A;  5JH9 A;  3PUY A;  3KQX A;  2BDO A;  1KWM A;  2ZED A;  4NGP A;  5ELY A;  3FMC A;  3U9S A;  5IB9 A;  2D62 A;  5HXD A;  2BOA A;  3BDO A;  1H9K A;  3T56 B;  2FVG A;  2ZEL A;  4PQA A;  4F8Z A;  1DXM A;  3FEE A;  2ZEH A;  3DLJ A;  1GHK A;  1Z5R A;  2JEA I;  5CPA A;  2PJC A;  1EWH A;  1YW6 A;  2F8H A;  4KSI A;  1ARL A;  2RFH A;  3KI9 A;  4NFR A;  4NGR A;  1BPM A;  2WYR A;  2JBK A;  4H2K A;  4OP4 A;  1VCI A;  4X2T A;  3SI2 A;  3RBU A;  2XEI A;  2DNE A;  3AB9 A;  1CTM A;  1GYT A;  2PJ4 A;  4UIB A;  3PB6 X;  1LFW A;  3PUW A;  4OIW A;  1F2P A;  5LYF A;  3KQZ A;  1Y0R A;  3SDZ A;  4R76 A;  2QJ8 A;  2V8V A;  2BO9 A;  1FYC A;  1T5E A;  4KKU A;  1BLL E;  3ISX A;  3KGQ A;  3OOC A;  5A35 A;  1H9J A;  2LMC B;  3PB8 X;  1TKW B;  4Z65 A;  3GUX A;  1CPS A;  4EWT A;  2PJ5 A;  2EJG C;  5HVH A;  3GB0 A;  3KAS A;  2AUJ D;  3CT9 A;  4OC3 A;  3BG3 A;  2KCC A;  1SMY C;  4P4D A;  1V8Q A;  3OW7 A;  2Q8I B;  2GRE A;  1GJX A;  1IW7 D;  4LJZ C;  1CBX A;  3JRU A;  1Z6H A;  3PUV A;  2O5I C;  2PJ9 A;  3B3S A;  2NSM A;  4ZX8 A;  3VR5 A;  3IFT A;  5BN3 A;  1E2W A;  2DNC A;  3LMS A;  5LYL A;  2CF4 A;  4L8J A;  1CP6 A;  2PJ0 A;  1DTD A;  2EDG A;  3PUX A;  3S9M A;  1JQG A;  4DJL A;  2Q4Z A;  1YW4 A;  1K8O A;  3D7G A;  5THW A;  1ZLH A;  4NJQ A;  5K8O A;  1TKF A;  2EVB A;  2JE6 I;  4RUH A;  3PB9 X;  5DS0 A;  3WDN A;  2K7V A;  4MHN A;  4P4E A;  2XEG A;  3VR2 A;  1Y69 U;  1I6V C;  3IWW A;  1LAM A;  1V43 A;  1XRY A;  1HQM C;  2B8G A;  2D2C C;  1DD2 A;  5LYI A;  2XEJ A;  3IC1 A;  2AFM A;  1ZG7 A;  1LOK A;  1ZYR C;  3A7L A;  2GU2 A;  2NN6 I;  3IO1 A;  5JEA G;  4I7Z C;  1Y8P B;  5LYD A;  2ZEF A;  2PCU A;  4TWE A;  4DUK A;  4H13 C;  2DN8 A;  1ZLI A;  3VH9 A;  2NYQ A;  3IFE A;  3LWU A;  1Z8L A;  4ZYQ A;  3I1U A;  1XMB A;  5HVF A;  1A6X A;  3IIB A;  4UEF A;  3QJY A;  3FEC A;  1CX8 A;  4NGS A;  1YLO A;  1HPC A;  5I4M A;  2E75 C;  3KZW A;  4P45 A;  2O5J C;  3PBE A;  2PPB C;  1AYE A;  1B9M A;  1Z7T A;  1XFO A;  3CPX A;  4MHY A;  1ZKO A;  3SJF A;  1CFM A;  3I4L A;  1G29 1;  2IT1 A;  4WWV A;  2JXM B;  1F57 A;  2I3C A;  1R3N A;  2HC9 A;  3VAR A;  5HVG A;  1OXS C;  4DYO A;  5F09 A;  1ELL P;  1LAP A;  1AMP A;  3SJX A;  4BA2 I;  2K33 A;  3SJG A;  3PB4 X;  3D67 A;  2EK9 A;  4OC1 A;  1FR3 A;  3W3A A;  4NGN A;  3BI0 A;  2PIY A;  5K8M A;  4TQU S;  3FF3 A;  4Q7A A;  2V8H A;  3PRT A;  1BPN A;  1H9S B;  4IQZ A;  2IJZ A;  3TC8 A;  1CI3 M;  8CPA A;  4EFD A;  2D5D A;  1VF5 C;  5KND A;  3RLF A;  4F9V A;  4IK2 A;  4TKO B;  2AFZ A;  2PJ1 A;  3CDX A;  3CPA A;  4K3N A;  3LNN A;  1QQ9 A;  2CW0 C;  1PCA A;  3NH8 A;  3HLP A;  4MCR A;  4MHZ A;  6CPA A;  4PXD A;  2NN6 H;  3ND8 A;  3BHX A;  3S9N A;  4FAI A;  2J9A A;  5JGF A;  2C6G A;  1GUT A;  2EJM A;  4JBW A;  2A69 C;  3VA7 A;  1NSA A;  3T51 B;  1Q7L A;  1TU2 B;  3K9T A;  3B7I A;  2BE5 C;  1FNO A;  2PCF B;  4MMO A;  2E76 C;  3V38 A;  3N5F A;  1Y8N B;  3DGV A;  2C6C A;  4FWU A;  2AUK A;  4P4F A;  4P6Y A;  5K8P A;  4A94 A;  1YNN C;  2PJB A;  1LCP A;  3PEI A;  2F1M A;  3MRU A;  2K32 A;  4R8F A;  1DCZ A;  3MFY A;  2ZOF A;  1TXR A;  4NGQ A;  3H94 A;  3H8F A;  1OBR A;  3NFZ A;  3BI1 A;  4OC0 A;  4WJB A;  3P20 A;  1ZG8 A;  2EWB A;  4IFD H;  2PVV A;  1Y0Y A;  1BDO A;  4P10 A;  5C0X G;  1TF8 A;  4KI0 A;  1TKH A;  1Q1E A;  2AWO A;  1FT7 A;  1VHO A;  2PJ7 A;  4IHM A;  4W9Y A;  4FBE A;  1TKJ A;  4OGQ C;  3ND9 A;  2ZT9 C;  3PBB A;  3D31 A;  1O7L A;  4YWY A;  1CPX A;  3A8J E;  2DEA A;  4AXV A;  1CP7 A;  5KNC A;  1CG2 A;  1Y7E A;  2GLJ A;  2QF7 A;  1VF7 A;  3D7F A;  1GHJ A;  2BA1 A;  3HUV A;  1GUS A;  5J1Q A;  3D7H A;  4IAV A;  3L2N A;  4UF4 A;  3D66 A;  3CRL C;  5JEA H;  2PJ8 A;  2E74 C;  1BAV A;  2AFX A;  4B6Z A;  1XJO A;  4PXB A;  4NGM A;  4OC5 A;  3GQB A;  2A6H C;  1OXV A;  1VHE A;  2WZN A;  1H9M A;  2KA7 A;  3D4U A;  4PXC A;  2F7V A;  2QYV A;  2AFS A;  2O53 A;  2ZEP A;  3KHX A;  5K36 G;  2NN6 G;  4OC4 A;  1OXU A;  1H9R A;  4OID A;  3M7N A;  2ABZ A;  4NGT A;  3SI1 A;  3H8E A;  4HR7 B;  3FX6 A;  1YNJ C;  1IY7 A;  4MRI A;  2PVW A;  4P4J A;  1Q1B A;  3OPO A;  3NE5 B;  1IW7 C;  4X3R A;  1DE4 C;  2RB7 A;  4JYW A;  2O4H A;  2HB6 A;  4MHP A;  1VIX A;  4MXU A;  4RCN A;  2CIJ A;  4NJR A;  1GUO A;  2IQ6 A;  2V8D A;  1IYV A;  4BD9 A;  1IGB A;  1Q90 A;  4UIA A;  1OXX K;  1IYU A;  2BE5 D;  3D68 A;  3NA6 A;  3MN8 A;  3B3W A;  1XBU A;  3PV0 A;  5CBM A;  3M85 A;  4JK1 C;  4KHZ A;  4DK1 A;  1H8L A;  2ZEG A;  4MCQ A;  1QJO A;  2OOT A;  3EQL C;  2PJ3 A;  2V4D A;  3FJU A;  1OXT A;  4G7O C;  2ZEN A;  1YME A;  5KNB A;  2PJ6 A;  2GLF A;  4F9U A;  2ZOG A;  3B3C A;  4BA1 I;  3WAB A;  4ZI6 A;  4MCP A;  2AFW A;  3KHZ A;  4JZ0 A;  1PYT B;  2PRQ A;  3B3T A;  3BXM A;  3FH4 A;  2EK8 A;  3T53 B;  1GUN A;  2AFU A;  4LQG A;  1H9S A;  4OO1 H;  3GD7 A;  3I72 A;  3I73 A;  1HDQ A;  2POK A;  3H8G A; 
#chains in the Genus database with same CATH topology
 4P44 A;  3RZO H;  1HZB A;  3URY A;  4TNU A;  1E1O A;  1KDC A;  4DR6 Q;  5EKI A;  4IUR A;  2AKW B;  3HOX H;  1G51 A;  4A37 A;  2Z3K A;  4B3S L;  3H3V C;  3QNV A;  2TSS A;  3H91 A;  1NJI C;  1LO5 D;  1SDF A;  3IEH A;  4KSA A;  4WRD A;  1AP0 A;  3RAM A;  1N32 L;  1I50 B;  4LMQ D;  1VQ8 A;  2VNU D;  4K6L A;  2PDO A;  2Q51 A;  4XPK A;  1XF8 A;  2AWN A;  3E9H A;  4RFB A;  1VQC A;  3A8K E;  3BU2 A;  4DNT B;  3B2Y A;  4F6A A;  3D4D A;  3QAH A;  4G1P A;  2NYZ D;  5KTD A;  5LRG A;  3DWQ A;  3QWN A;  4H89 A;  4X5K A;  3ZJ0 A;  1S5K A;  4BY7 H;  2RDF A;  4OKO A;  4FUU A;  3DXJ C;  2OU2 A;  4FF2 A;  5IY0 A;  1D5Z C;  1L1O C;  4PMB A;  1X65 A;  4OWX B;  4O23 A;  4A38 A;  1P4N A;  4KHV A;  3MC0 B;  5C3E H;  2R92 G;  4UEZ A;  4X3U A;  1N36 L;  2MJ8 A;  1PFB A;  2X69 A;  3KR4 A;  2LS0 1;  3PUZ A;  5KEE A;  3ZYY X;  2F4V L;  4CJ2 C;  4GOP B;  4JYA Q;  4ONU A;  3JC6 6;  4IFD J;  4KKS A;  5IYD H;  1KNE A;  1I4H A;  1SYG A;  2F0O A;  1X9N A;  3WC6 A;  4AVA A;  2AFO A;  2BH8 A;  3IKJ A;  2N8N A;  1JIC A;  1WD1 A;  1DM0 B;  1A8V A;  1JWM D;  3QR8 A;  4QMG A;  4YIJ A;  3S6F A;  4R6T A;  1SN8 A;  1S7K A;  1BOS A;  4YY3 L;  1R43 A;  4MJ8 A;  2JA5 H;  2B29 A;  3CHB D;  2B8F A;  1U5K A;  3HOV G;  1B44 D;  2A68 D;  4OO1 G;  1HZ9 A;  2IWH A;  5EBV A;  1BVS A;  2XNA C;  4JI4 Q;  5FLM G;  1QMU A;  5CV6 A;  3V2T A;  3KL9 A;  2I46 A;  1AW7 A;  2E2H B;  2Q04 A;  3GP7 A;  1WTP A;  1VQE A;  2WB1 G;  3N6R A;  3GV6 A;  3D0F A;  3SI0 A;  2DGY A;  4OX9 Q;  5BWA B;  4KZT A;  4OIK A;  4YGO A;  4Y49 C;  4A3D B;  4HJ8 A;  4G7Z C;  2Q4V A;  4CAE A;  3SK8 A;  2D0P A;  1I6H H;  3V7Z A;  2WAC A;  3M4P A;  2SDF A;  2K75 A;  4DU9 A;  4OME A;  2EE1 A;  2FHT A;  4RKL A;  5IGC A;  2UUA L;  1Q3L A;  4PPZ A;  4MFL A;  2X7B A;  3QO2 A;  2G9D A;  2WKC A;  5FLX c;  4F0X A;  1RTQ A;  3EFX D;  4X62 L;  2EVN A;  2PYK A;  2P6E A;  5LL6 S;  3T8W A;  3MGD A;  1LAB A;  4DV4 Q;  4YFJ A;  1HR0 Q;  2EYH A;  4N9T A;  5FOB B;  3G8W A;  5IIF A;  2G0B A;  1SYE A;  1SYD A;  2ICI A;  2JEV A;  3TP5 A;  1K83 H;  4H0L C;  2JA7 G;  4UP9 A;  1WCM G;  3NTI A;  1G2S A;  1G2T A;  2EYO A;  4L8A A;  1N33 L;  1Y1W G;  2NMT A;  5JH9 A;  1WTO A;  5C44 H;  1Z9U A;  3OWE B;  4R8N A;  2BDO A;  4UP7 A;  2GA4 B;  5EPJ A;  2PQA A;  3AQQ A;  4NGP A;  3U9S A;  1IBK L;  4PZ6 A;  2F5I A;  3FDT A;  4O2D A;  2KCT A;  4F8Z A;  1H9K A;  4KSF A;  1M4I A;  2PO4 A;  2I79 A;  3PIO 3;  1GHK A;  4L89 A;  4DAY A;  1YW6 A;  4UHV A;  3TSS A;  2JN4 A;  3CCQ A;  1IBL Q;  2F8H A;  2OB0 A;  4KSI A;  2FL4 A;  3R2I A;  1TII D;  2MPM A;  3EIV A;  5IGG A;  4NFR A;  5JVH 3;  4NGR A;  2WYR A;  5IP7 G;  1IOF A;  3PIP A;  2IL4 A;  3SI2 A;  4DV0 L;  3TRZ A;  4AQY L;  1STE A;  4DV5 Q;  3J7A V;  1Z8W A;  1CHQ D;  2K5W A;  1VMC A;  2VQF Q;  4QIW E;  4DV1 Q;  4JJX A;  1CKO A;  1SE4 A;  3PB6 X;  1LFW A;  1SYB A;  4OIW A;  1EY8 A;  1P8L A;  4DAP A;  1KHI A;  2M2L A;  4BBS H;  3SDZ A;  1SMY D;  4A30 A;  3FKI B;  4IPC A;  2B2W C;  4NP5 A;  1RO5 A;  4KKU A;  2JA8 G;  2MQH A;  3OOC A;  3DR6 A;  4CAF A;  3T13 A;  4GOP C;  3PB8 X;  1RJT A;  3H3V I;  4ZBG A;  5JPN C;  3J81 E;  3GUX A;  1K0R A;  3KAS A;  1BUV T;  5C6A A;  3RZO B;  4C7H A;  4A3J G;  4JOI C;  4R9W A;  3CT9 A;  5AG6 A;  2WB1 B;  1X54 A;  2VUM B;  2IPK D;  1UE7 A;  3OW7 A;  3CC4 A;  3RZD H;  3PO2 B;  5E7N A;  5M3M B;  1IW7 D;  5AJ3 Q;  4IOC A;  2DUD A;  4IUU A;  3HOV H;  2XGT A;  3JRU A;  2UUC L;  1PLF A;  2PJ9 A;  4LUO A;  3K58 A;  2F3I A;  3HOY B;  2NSM A;  2PI2 E;  1KRT A;  2DNC A;  4B9W A;  3M4O B;  5FLM H;  1CP6 A;  2PJ0 A;  4DUZ L;  1JWS D;  3EVQ A;  4JBJ A;  4HJA A;  5G20 A;  4KOV A;  4LF7 L;  2C5C A;  1HA5 A;  3S9M A;  5I9O A;  4ZCK A;  2DJF C;  2JA6 H;  3AEV A;  1TWA B;  1YNX A;  1MJB A;  3SVM A;  4OAD A;  2VQF L;  3FKI H;  1PH6 A;  1Z8X A;  4AQY Q;  2KED A;  1TKF A;  1MGS A;  4RUH A;  1HZA A;  1SNC A;  4Q36 A;  4G57 A;  2HDM A;  2K28 A;  2R7D A;  3P2H A;  2WAQ B;  4GKK L;  4P4E A;  2NVQ B;  1LAM A;  2F0H A;  2ASB A;  5IYC H;  3CF5 A;  3GDE A;  4RN7 A;  1XEB A;  5COY A;  1A3T A;  1TS2 A;  1STN A;  2XEJ A;  3IC1 A;  4CGO A;  1LT4 D;  2AFM A;  1LOK A;  1ZYR C;  2NN6 I;  1RCV D;  1Y8P B;  1UUP A;  3ERS X;  1N8R C;  2ZEF A;  1GM5 A;  1YJN A;  3V05 A;  2GE3 A;  1HA6 A;  3S17 H;  3SXO A;  3VH9 A;  4QC6 A;  3IFE A;  2HHH Q;  2NVT B;  3LWU A;  4ZUJ A;  4ZYQ A;  4C3J H;  1A6X A;  3DWA A;  1WCM H;  1GO3 E;  5FK9 C;  5M5W H;  4A3I G;  2GFQ A;  4NGS A;  4A2Z A;  1YLO A;  2EY6 A;  4DAM A;  5I4M A;  5C44 G;  3IWG A;  1XOV A;  1NBW A;  1WTR A;  1G6Z A;  3KZW A;  4GLA C;  4EGV A;  2KCN A;  2E5L L;  4MY0 A;  4JI2 Q;  3G6J B;  2E8G A;  4X64 Q;  1BCP B;  5C4J H;  2LKV A;  1S72 A;  1B9M A;  4KY5 A;  4C3I H;  1RTN A;  1XNQ Q;  1S3O A;  2HIV A;  1RXT A;  5KIX A;  3BYT B;  3MWY W;  3MFG A;  1PYS B;  2JXM B;  2P6F A;  1XJV A;  2YNC C;  1R3N A;  3S14 H;  4ABN A;  1V1Q A;  1LAP A;  3SJX A;  1AMP A;  1XTD A;  2PZU A;  1I4P A;  4HIK A;  3BI0 A;  3ER0 A;  1VQN A;  3SHL A;  4KLV A;  2RHQ B;  4BS9 A;  1H9S B;  1TWC H;  4BWG B;  3GTL B;  4B5P A;  5C4J B;  2Z3N A;  4EFD A;  2D5D A;  5KND A;  3RLF A;  2F0G A;  3JAM c;  1HFN A;  4LF9 Q;  4IK2 A;  5IGB A;  1HXY D;  1J5E L;  2AFZ A;  2YNE A;  1ML0 D;  4A76 A;  2Z0Z A;  3CPA A;  3LNN A;  1QQ9 A;  5M5Y B;  4OWW B;  1V9P A;  6CPA A;  2GVA A;  4LFC Q;  5E4W C;  3KKW A;  2AQ1 B;  3PGP A;  3I4M H;  2B58 A;  1IOI A;  1NSA A;  1UEA B;  1M8A A;  1PZK D;  2ICE C;  2N78 A;  3B7I A;  4OO1 I;  2PCF B;  4MMO A;  2E76 C;  1ESF A;  2QEX A;  3T1H Q;  1E24 A;  4IPD A;  1AEX A;  3G4S A;  1I1D A;  1WWZ A;  5KTC A;  1S5C D;  4P6Y A;  1XNQ L;  4A94 A;  3PO3 G;  1TR5 A;  2F1M A;  3MRU A;  2J7Z A;  1KAW A;  4WJ3 M;  2ZOF A;  4JI5 L;  3NFZ A;  1LLR D;  4NW2 A;  5FO8 B;  1NMT A;  1Q2Y A;  4CRY B;  3DSB A;  5CNP A;  1A63 A;  3H09 A;  4JV5 Q;  4U68 A;  4JCV E;  1GXD C;  1IL8 A;  1Y0Y A;  1EWC A;  1EWI A;  4FXD A;  4DKA C;  1U6M A;  3SXN A;  1TKH A;  3HFZ B;  4KJN A;  4HJ5 A;  2WPX A;  1TKJ A;  1XNR L;  3ND9 A;  5FVJ A;  1A2T A;  4A3K H;  4EQO A;  3TO9 A;  4LF8 L;  3STB D;  3J81 j;  2ZW4 A;  5J8C A;  2EBJ A;  3JTK A;  2F4V Q;  2F0W A;  1CPX A;  2TMP A;  4AXV A;  1WYD A;  2KHJ A;  5KNC A;  2ZJQ A;  1EL0 A;  1X55 A;  2KEC A;  1G6P A;  1GHJ A;  3NQT A;  1Y1V B;  4EVO A;  5J1Q A;  4NXN L;  2IX3 A;  3DUZ A;  3L2N A;  4IAV A;  4P75 A;  4UF4 A;  2NZO A;  4L5Q A;  4UAI A;  1L0W A;  1PVO A;  2PJ8 A;  4KOU A;  3A74 A;  5GAE C;  1BAV A;  3HG9 A;  3CW2 C;  4JI1 Q;  4DV4 L;  3K7A H;  3KF8 B;  4NGM A;  3MTS A;  5M3F H;  2R92 B;  1PYW D;  4X3K A;  4DV2 L;  4CYP A;  4JW0 A;  2A6H C;  1OXV A;  4AG9 A;  2QDL A;  2WZN A;  3T9Y A;  1H9M A;  3D4U A;  2KBN A;  4GNX C;  2R7Z H;  4JXR A;  1CKN B;  1Y14 B;  3QOJ A;  3PF4 A;  3J7A F;  2L0C A;  1KC8 C;  1EYD A;  3PQI A;  2OH1 A;  2ZEP A;  4IAL A;  2DY7 A;  3IRB A;  4OC4 A;  2M00 A;  3FRP B;  5J8F A;  3LX0 A;  3I3C A;  4A93 B;  4POF A;  3M7N A;  4JPB W;  2XRS D;  3H8E A;  3NTK A;  4O1N A;  2F0L A;  5DLQ E;  1IY7 A;  3DM3 A;  4DR1 Q;  1Q1B A;  4IFD I;  3NE5 B;  5C5L A;  2OT2 A;  2Z3M A;  4AVC A;  2PI2 A;  2F0F A;  2ZW6 A;  3D2M A;  2QCP X;  2FIN B;  4B3R Q;  4LF7 Q;  2B5G B;  1VIX A;  1RL2 A;  2LSS A;  1XNR Q;  2OTJ A;  2V8D A;  2IQ6 A;  1EY5 A;  1BF4 A;  4B3M Q;  2OTL A;  2GVB A;  4QJF A;  4GNX A;  1O7I A;  4N8F A;  4BXX H;  1MBY A;  5LMU L;  2A74 C;  2MO0 A;  2MP1 A;  3GYA A;  2ZPA A;  3PV0 A;  1IZ6 A;  2EZV A;  2VS1 A;  3NBI A;  1YVK A;  4KHZ A;  3HOZ B;  4JYA L;  1H8L A;  3ULP A;  1NSL A;  2CKZ B;  4DR4 L;  2D0O A;  3M3Y H;  4A3L G;  2O28 A;  3W91 A;  4YHH Q;  1OXT A;  4ZRZ A;  3I4M G;  2XTI A;  2N88 A;  4LX9 A;  2F0E A;  3UDX A;  2GLF A;  4CDE C;  4F9U A;  3Q24 A;  4APV A;  4B3S Q;  3K0X A;  2QA4 A;  1PH9 A;  4ZAI A;  2AFW A;  3F5B A;  3I2Z A;  3MXN A;  3J81 L;  3CC2 A;  1IIC A;  3NQI A;  2PRQ A;  2HIX A;  2PC1 A;  3BXM A;  2QGQ A;  2AJ6 A;  2FE7 A;  3SGI A;  1WK4 A;  1GUN A;  3FH4 A;  2AFU A;  1XMO Q;  2JLM A;  1D1I A;  1H9S A;  5J39 A;  2B2Y A;  2HUG A;  4OO1 H;  2ZXV A;  1VQG A;  3GD7 A;  3I72 A;  1WTH A;  2Q7B A;  3K80 C;  3H0G G;  5JJK A;  5C88 A;  1LAC A;  2Z6K C;  1CQV A;  3E0E A;  2JJQ A;  3FIX A;  1VQ6 A;  2PJ2 A;  1S5F D;  3PGZ A;  3TX8 A;  2FMC A;  4C7I A;  4LQ6 A;  4A3C H;  3GTK H;  2VZY A;  3E3X A;  1QOH A;  4KKT A;  2HV2 A;  4HNW B;  5EGT A;  5C0X H;  4ZLT F;  3A7A B;  1OO9 B;  4Y7N B;  2Q43 A;  3FBU A;  4I65 A;  4A3B B;  4DR1 L;  2QIR A;  1I50 H;  2L11 A;  1EQQ A;  3HOU H;  1HEE A;  2FXQ A;  2B4B A;  3CQZ B;  5FJ8 H;  2ZM6 L;  3S2H H;  2RC4 A;  3WC5 A;  1JR0 D;  3NH4 A;  2Q2H A;  2C35 B;  3TO6 A;  3HKS A;  5D29 A;  4A3D G;  1BR9 A;  4I7A A;  2Y0S G;  1ZXT A;  4DAV A;  1R9T B;  4UEE A;  1WOC A;  2FIA A;  4CKB A;  2CNM A;  1EE3 P;  4B3T L;  1PUA A;  2UUB L;  5IP7 H;  1XPO A;  3HKZ E;  3RLO A;  3TZU A;  3F2C A;  1X3F A;  2P6G A;  3I7F A;  2L5T A;  3CPF A;  4ID6 A;  3GTG H;  3J81 i;  3A55 A;  3X3M A;  4DNR B;  1M4L A;  1TS3 A;  4DK3 C;  2PIZ A;  2JK8 A;  4U9Y A;  1BBU A;  1CHP D;  4RGM A;  2UXD Q;  4JI7 L;  5I2X A;  4DV3 Q;  1RHP A;  1QWY A;  2PMZ E;  1M1K C;  1VQA A;  2NVT H;  1VQD A;  3VR6 A;  2JA7 H;  2NVY B;  1Z2L A;  2YYZ A;  4KD3 A;  3WT4 A;  1UWY A;  5J1Z A;  2G9H D;  1X3E A;  1NSN S;  2YTY A;  3UE0 A;  1ICW A;  2PNH A;  4FDB A;  2VB3 X;  2EYL A;  3I4N B;  2CTB A;  4H44 C;  4MZ9 A;  1HNX Q;  3CXQ A;  3FVL A;  2FT0 A;  2JP1 A;  2K5H A;  2A68 C;  4IUT A;  4KN7 C;  2F0K A;  4CHT B;  4J3G A;  4XQJ A;  1F9S A;  1JMC A;  3B3V A;  1OZP A;  1DOL A;  1EYC A;  3BVZ A;  1EIY B;  3HOZ H;  3WWV A;  1LYL A;  4Q5V A;  1KLU D;  3VDY A;  1SEB D;  4CPA A;  5FKA C;  3PFO A;  4OX9 L;  1HQR D;  2ZEE A;  4II9 A;  3SE0 A;  3L7Z C;  5IT9 L;  4BY1 B;  2I5H A;  2D4O A;  3VWD A;  4A95 A;  4CYN A;  3QG1 A;  5KGU A;  1F2Y A;  4R4C A;  1YHQ A;  2RA4 A;  5JM6 A;  4XTC S;  2YNC A;  1LAN A;  5DEH A;  4ZY2 A;  2QIL A;  4KMU C;  4MBU A;  4ZY0 A;  3KR5 A;  2MO1 A;  2VL6 A;  1TWG H;  4R7M A;  4X62 Q;  4A3F H;  1HNW L;  3T1Y L;  3IGR A;  4A3C G;  4HJ7 A;  4UP8 A;  1ET9 A;  2EJF C;  2NVY H;  4A3G G;  2JA8 H;  4PV6 A;  4JWP A;  3PB7 X;  1I4G A;  1F2O A;  5J3B A;  1ONL A;  1TF9 A;  1ELM P;  4LUA A;  2F3W A;  4HSV A;  1YQE A;  5F47 A;  3H0G B;  4BY7 B;  4A3L H;  2NUC A;  1PH8 A;  4MTK A;  3KDF A;  3KYH C;  3HOU B;  3CXS A;  1CM0 A;  3TE4 A;  1JB3 A;  1K8M A;  4C3H G;  4KS9 A;  3I8Z A;  1Q8K A;  1VS0 A;  2NVX B;  1G91 A;  1TQO A;  2OQK A;  5BR8 L;  1HR0 W;  3MHB A;  1I4Q A;  1HTP A;  4A3B G;  4HMJ A;  3S1N H;  2N55 A;  3F0A A;  4FD6 A;  3HGB A;  1PH3 A;  3VAT A;  4R4Q A;  1U4L A;  3R2T A;  5LRK A;  3T16 A;  3VYT A;  1ARM A;  3W6X A;  2FCK A;  1XIX A;  3FED A;  4DAY B;  4C3J G;  1YJW A;  2B2U A;  2JA9 A;  3P7J A;  4CBV A;  1KRS A;  1MHW C;  4V0B A;  4JD6 A;  5JAV A;  3PUY A;  3KQX A;  3DWP A;  3S2D B;  4LF5 L;  1MSG A;  3UI2 A;  1KD1 C;  4C3I B;  4RMF A;  1J8I A;  2PRB A;  4QVT A;  5CYU A;  2BOA A;  3T56 B;  5C3W A;  2ZEL A;  1HRJ A;  4B10 A;  3FEE A;  5G3L F;  1PH2 A;  1CKM A;  3PCO B;  3DLJ A;  4HNY B;  3H3V H;  2KHI A;  2Q8R E;  5CPA A;  2PJC A;  1DOK A;  1BKB A;  4R87 A;  1LTL A;  2KOL A;  3HOW H;  1MI2 A;  1ARL A;  3T1Y Q;  4A3M B;  5ELE A;  4AG7 A;  1AE2 A;  2B2V A;  3R93 A;  1PZJ D;  4JOI A;  1CUK A;  4PMW A;  2ZXR A;  3FB3 A;  1LUZ A;  1Q2D A;  2DNE A;  1S7N A;  4UIB A;  3AU7 A;  1ESR A;  3BVG A;  1XMT A;  1C0A A;  5LYF A;  1AN8 A;  5EKK A;  1LTS D;  5A2Q L;  1Y0R A;  2QDB A;  3KQZ A;  3W1B A;  2QJ8 A;  2V8V A;  1M4G A;  2IHE A;  1PDQ A;  1T5E A;  4GOP A;  1SYC A;  2RKS A;  4WFN 3;  1X3G A;  2B4D A;  3ISX A;  5A35 A;  3IU1 A;  3I3G A;  5EMI A;  3NE8 A;  2B3V A;  1MJC A;  2LMC B;  1VQF A;  5DM6 3;  3CME A;  3FXT A;  1CPS A;  1ENA A;  3MXN B;  3BLN A;  4EWT A;  4L6T B;  3MVV A;  5HVH A;  3GB0 A;  4QCL A;  2H4O A;  2X6G A;  4CYQ A;  2VI7 A;  4AVB A;  1I94 L;  5KYI A;  4XQN A;  1YZ6 A;  1SMY C;  2L15 A;  2P5Z X;  3CCV A;  2J0T D;  4A3B H;  2GRE A;  2VUM H;  1GJX A;  4BBH A;  2B2V C;  2ZXO A;  1RIP A;  4FD5 A;  4LJZ C;  5H84 A;  1ENC A;  3KBX A;  4KLK A;  1A62 A;  4ZUI A;  1AE3 A;  1CM9 A;  1PFM A;  1Z6H A;  3BYY B;  4IUV A;  3VA5 A;  1QSM A;  4IUP A;  4ZX8 A;  1KNA A;  3NSW A;  1QCB D;  4XXE A;  5LYL A;  2HQL A;  2CF4 A;  2UUB Q;  5EBD A;  2EDG A;  4UCP A;  3PUX A;  4NPS A;  3KF6 B;  4DR5 L;  3U9O A;  1C7Y A;  4NXM L;  1JQG A;  2Q4Z A;  1YW4 A;  3F8K A;  1Z9F A;  3D4W A;  5THW A;  1JJ2 A;  1ZLH A;  5NUC A;  2EVB A;  4EQP A;  1EU3 A;  4HIM A;  2JE6 I;  3CCR A;  2BDN A;  3WDN A;  4JI7 Q;  2K7V A;  3VYS A;  4B11 A;  4JI3 Q;  2B2U C;  3CP0 A;  3VR2 A;  1Y69 U;  3E9I A;  3KLW A;  1V43 A;  2F52 A;  4UPA A;  1TXY A;  1JE4 A;  1R4P B;  1SBB B;  4BBS B;  1DD2 A;  3U4Z A;  4H7B A;  2EYF A;  4UBR A;  3K81 C;  3CXP A;  1VMP A;  3L0O A;  1MKH A;  3D6W A;  1ZG7 A;  1HFG A;  2HCC A;  2NB0 A;  3GTO B;  2DF5 A;  4KVM E;  4E8O A;  5IGF A;  4I7Z C;  3BZC A;  4KTA A;  4TWE A;  4DUK A;  4K2L A;  5AJ3 L;  1ZLI A;  3S15 B;  1PRT D;  5C3E B;  5M3F G;  1JOR A;  3B8G A;  3F2D A;  4U5Y A;  1HUM A;  4HSP A;  3DDD A;  4M6H A;  4N9P A;  5HVF A;  1XMB A;  3J80 i;  3IIB A;  4UEF A;  4JI4 L;  3QJY A;  1O7Z A;  2B5G A;  4JI8 L;  1EU4 A;  1NR4 A;  1F77 A;  2AMC B;  2QW7 A;  2E75 C;  1AZQ A;  1BCP D;  2XWB B;  2UU9 L;  3DHQ A;  2OWO A;  4P45 A;  5IT9 E;  2O5J C;  1IYJ B;  4DN4 M;  1B3Q A;  2F0Q A;  3R9F A;  4UA3 A;  3L9A X;  2K01 A;  3PBE A;  3EBE A;  1PFN A;  5LMN L;  1FNU A;  2H5X A;  3QB3 A;  3AYH B;  1Z7T A;  5C5M A;  2PPB C;  1S7F A;  4R9M A;  3J7Y W;  4MHY A;  4JC0 A;  1G29 1;  2IT1 A;  4WWV A;  4X66 Q;  3HOW G;  1F57 A;  1YK3 A;  1F2Z A;  4P72 A;  1FVI A;  3NEM A;  4RCO A;  3SK6 A;  3VAR A;  3UY5 A;  4JV5 L;  2JA6 B;  3S1R H;  5F09 A;  1HTL D;  3DLL A;  1SMX A;  1ELL P;  3PZJ A;  5CGK A;  2KUM A;  2EK9 A;  3UDF A;  1FR3 A;  2YTV A;  5C4H A;  4NGN A;  2PIY A;  5K8M A;  1MD2 D;  1Q7Y C;  4TQU S;  1PH5 A;  4RHS A;  3SK4 A;  1C48 A;  2ZTE A;  5IWA Q;  3PRT A;  3Q23 A;  2HT1 A;  1LT3 D;  1PH1 A;  2NVX H;  1SNM A;  4J15 A;  4M85 A;  5M5X B;  4LF4 L;  1YIT A;  1O80 A;  4TKO B;  2Q4Y A;  3G48 A;  3K5L A;  2CW0 C;  2RSO A;  5CV9 A;  1KZF A;  3TP6 A;  4MCR A;  4CGN A;  1D7Q A;  1FNV A;  4BMH A;  2Z3P A;  3ND8 A;  1IHZ A;  3D8P A;  3FPU B;  5ELD A;  5JGF A;  2C6G A;  1GUT A;  2F4I A;  4JBW A;  4CYO A;  3VA7 A;  3I9S A;  4YWL A;  1D8L A;  1Q7L A;  4DV2 Q;  1STG A;  2A1A A;  2BE5 C;  1FNO A;  3J7A 5;  1AZP A;  2K5Q A;  3N5F A;  4CGL A;  1LV9 A;  1Y8N B;  4ORF A;  5M5W B;  3UE1 A;  4GKJ L;  2C6C A;  2QML A;  2AUK A;  4FWU A;  4P4F A;  1I6H B;  5K8P A;  1LCP A;  4OL7 A;  2K32 A;  4O0A A;  5T1I A;  3WR7 A;  4NGQ A;  4JVZ A;  4GNX B;  4DPG A;  3GIU A;  4OC0 A;  3KDF B;  4LAA A;  3TS0 A;  1VQK A;  4IFD H;  1BDO A;  1E3P A;  4IN3 A;  5C0X G;  2VEZ A;  1TF8 A;  1RD9 D;  1VKC A;  3TP8 A;  2REF A;  4CRZ B;  2SOB A;  2J8M A;  1VHO A;  1SAP A;  4B12 A;  5IOC A;  1SNO A;  3D6C A;  5JPM C;  1X3Q A;  3I90 A;  3J80 E;  3IWE A;  4XNH B;  3HKZ G;  3D31 A;  3G3S A;  1O7L A;  5JJI A;  5LMN Q;  1CP7 A;  2IY5 B;  1F9P A;  4KY6 A;  1V1P B;  1EOV A;  2QF7 A;  2DPT A;  3MEH A;  4QL5 A;  3HUV A;  1NE3 A;  3CRL C;  1HNW Q;  4PQX A;  4HCE A;  1JE5 A;  5C82 A;  4JXQ A;  3FP9 A;  5H86 A;  2KHS A;  4DUZ Q;  2XWJ B;  4OC5 A;  1HZC A;  1NMG A;  2NTS A;  1PH7 A;  1VHE A;  2HUZ A;  1C4Q A;  2OZU A;  4C56 C;  4PXC A;  1KUY A;  5IT9 c;  4IPH A;  2F7V A;  4MY3 A;  3WOE A;  1SNQ A;  1WI5 A;  5ELC A;  3R9E A;  3CCL A;  4AYB E;  4K2K A;  2QYV A;  1CA5 A;  4GKK Q;  1C8C A;  1CZG A;  4IZ8 A;  4OID A;  4Y7N H;  2ABZ A;  3OWF A;  1PTO C;  4A3D H;  4CDD C;  3ZZI A;  4NGT A;  1T9H A;  1XWE A;  4HR7 B;  3SEB A;  1K0S A;  4R57 A;  3R9G A;  2Q8T A;  1XMQ Q;  3OSO A;  3FNC A;  2PVW A;  4YCV A;  3TOA A;  3F2U A;  4X3R A;  3S6H A;  2JA5 G;  3PO3 H;  4A3F B;  2VQY A;  1VQP A;  5FO7 B;  2RB7 A;  2O4H A;  4GKJ Q;  3TOB A;  3E6Z X;  1YIJ A;  4AYB B;  2PR8 A;  2KEN A;  1A2U A;  2NZ1 D;  3BVM A;  4FNF A;  2JA8 B;  1EQR A;  5IGD A;  2R93 H;  1YJ9 A;  4A3G B;  4BD9 A;  1IGB A;  4DR7 Q;  4WJ4 A;  4DV0 Q;  3MN8 A;  4EX5 A;  3B3W A;  1XBU A;  4NDX A;  4XT3 B;  2WPW A;  1I3Q H;  4A3J B;  1N32 Q;  4JK1 C;  3EN2 A;  5IYD G;  5IYB G;  2JA7 B;  5E1F A;  1YNN D;  3RNU A;  2ZEG A;  4MCQ A;  1QJO A;  2PJ3 A;  2V4D A;  3F8T A;  3FJU A;  1GOZ A;  1F2M A;  1SLJ A;  2NTT A;  3TZD A;  1YME A;  1FJG L;  4KOW A;  5EKL A;  3B3C A;  3W5O A;  1DJR D;  5AFW A;  3EFA A;  1PA6 A;  2JYO A;  3WAB A;  4ZI6 A;  4K5X A;  4DV3 L;  4MTN A;  1TS5 A;  1QSO A;  1EEF D;  1SRU A;  3B3T A;  1L1O B;  2Q0Y A;  3PMF A;  2HCI A;  1WJJ A;  3TME A;  2EK8 A;  1GKH A;  4LQG A;  4MIU A;  4ZYS A;  1IU8 A;  1CJW A;  4NCZ A;  4OLL A;  3R96 A;  3H8G A;  2POK A;  1KL9 A;  4A3E H;  4DK0 A;  1P0H A;  3STB C;  5CV4 A;  3SJE A;  3ERO A;  2FIW A;  3VR3 A;  2RDG A;  1VQ7 A;  4K30 A;  4IFD G;  4C3H B;  4Y52 H;  4MFQ A;  4UCM A;  1IBL L;  1VQB A;  2YU9 H;  2A6E C;  4GS4 A;  1K83 B;  2F0P A;  5KYL A;  1J4J A;  3S1M B;  1I5F A;  5K36 H;  2PJA A;  2Z6K A;  2JEB I;  2BA0 A;  3KOJ A;  3RD4 A;  2ANP A;  3FPP A;  3W1G A;  4F87 A;  2V8G A;  2WIN B;  1CQF A;  5BN4 A;  1B2T A;  3D7D A;  2CFM A;  4NMZ A;  4DV6 L;  4MCS A;  4WJW A;  2EY5 A;  2VZA A;  1V0C A;  3M4Q A;  2QVP A;  2K50 A;  3MA2 B;  3WC7 A;  4DR7 L;  2A6H D;  1R9T H;  3HEJ A;  1X32 A;  3C1F A;  4KN4 C;  3OMC A;  2CQA A;  4FD7 A;  4AYB G;  2JSO A;  2Y0S E;  3TRE A;  1SE8 A;  4OIJ A;  3QAY A;  1B87 A;  4XQQ A;  4C1N I;  3S2H B;  3FRM A;  4IF5 A;  1NTG A;  3S1M H;  2CTC A;  3ISZ A;  3QIA A;  3GTP B;  1SJH D;  2QEC A;  7CPA A;  5I4D A;  1P16 A;  3FEW X;  4LF4 Q;  1Y1V H;  2MHV A;  1YSJ A;  1KTK A;  1BO0 A;  1S40 A;  2A69 D;  4L5T A;  3GO5 A;  3K57 A;  3TTH A;  2AHO B;  4BBR B;  5BR8 Q;  1B70 B;  3VR4 A;  4G7H C;  4A3K B;  4A39 A;  4P73 A;  3K2K A;  5LMU Q;  3N52 A;  4DNC A;  5A28 A;  4CKC A;  1CA6 A;  1GUG A;  1I3Q B;  4A3J H;  5CV8 A;  3NEN A;  3EY5 A;  4DR2 L;  4C2M B;  2K1B A;  4KOT A;  4XYO A;  1WTQ A;  4LFB L;  4ZY1 A;  2GIV A;  4E2A A;  4NXY A;  2R93 B;  2R6G A;  1D6E C;  3U58 A;  3TS2 A;  3C26 A;  1QZH A;  2E2I B;  4X3T A;  1SFO B;  4HIO A;  1XYI A;  1HDU A;  2I00 A;  4JI8 Q;  2OXP A;  2ES2 A;  2L4N A;  5GAH C;  1WTV A;  1M1D A;  1O78 A;  5LHY 1;  4DV7 Q;  3TCV A;  3K0Y A;  3RN2 A;  4JI0 Q;  4YU9 A;  4LK1 C;  2RCN A;  3D4R A;  4B13 A;  3JVN A;  3BZD B;  1VGY A;  4KVO E;  1K9M C;  1ON0 A;  2R61 A;  2BH2 A;  1HCZ A;  3S9W A;  4FXK C;  3RR5 A;  4KJO A;  3FYN A;  2CH4 A;  1D5M C;  1Z8T A;  3NH5 A;  1N33 Q;  1RTO A;  2B2T A;  3TT2 A;  2R8V A;  1YHB A;  2FJ2 A;  1Q86 C;  4LF9 L;  2B63 G;  4AIM A;  5F2D A;  1B53 A;  4JBK A;  4GN5 A;  3I91 A;  2UXB L;  2YGW A;  4XNH C;  1U4M A;  4MHD A;  2ZJP A;  3PFE A;  3RZA A;  4EME A;  4DUY L;  3Q8D A;  1BXT A;  2WP8 J;  3BZK A;  1Y1V G;  3B35 A;  4CGP A;  4MNO A;  4B3M L;  2R7Z B;  4EQ5 A;  3P2F A;  1QSR A;  2EIF A;  3A5Z B;  1JWQ A;  4KHP L;  2UUA Q;  1UE5 A;  4GN4 B;  1NR2 A;  1KWM A;  2ZED A;  4BY1 H;  3CPW A;  3CAM A;  1IB1 E;  4B5P B;  4QIW B;  5C0X J;  5IB9 A;  2D62 A;  5HXD A;  3BDO A;  1PU9 A;  1TVX A;  4PQA A;  1SSO A;  2A19 A;  1EEI D;  1HH2 P;  4RAU C;  1FJG Q;  2ZEH A;  4B5O A;  1EY0 A;  5DM7 3;  3PP9 A;  1EZ6 A;  4JI0 L;  1KAB A;  4B9X A;  5CR3 A;  4QGU A;  3NHH A;  4J1M A;  3GTP H;  4DV7 L;  4U9Z A;  2RFH A;  3KI9 A;  2UXC L;  3S16 B;  2H1E A;  1F2L A;  4H2K A;  3R95 A;  3RO0 A;  1VHS A;  1VCI A;  3E5S A;  2A5H A;  5M9O A;  4X2T A;  1YBY A;  2AQ3 B;  5DAU A;  3J7Z C;  1ASY A;  3OTO L;  2XEI A;  3AB9 A;  1CTM A;  1E0B A;  2PJ4 A;  1RKN A;  3IU2 A;  1SR3 A;  3R3O A;  2IW3 A;  4DK6 C;  4B3T Q;  1F2P A;  1TS4 A;  4P2C B;  4RGN A;  1YR0 A;  2OEO A;  4ZKC B;  5AG7 A;  2G3T A;  1FGU A;  1BBX C;  5E96 A;  1QUQ B;  4RGO S;  1A2Z A;  1H9J A;  4CJ1 B;  1WTW A;  2NVQ H;  2CNT A;  5AG4 A;  2EXD A;  1QE6 A;  4R4T A;  3S1Q H;  2L9H A;  5HGQ A;  3QB8 A;  4LNQ A;  4PNY A;  2ZM6 Q;  2E2J H;  2AUJ D;  4DV5 L;  2GAN A;  4N8X 1;  5DWM A;  4OC3 A;  1PTO F;  3BG3 A;  2WII B;  3T90 A;  5T1G A;  3JAM L;  2WB1 E;  4L63 B;  3I4M B;  5G1Z A;  2OCE A;  2BUE A;  1KDA A;  4LF5 Q;  1GVP A;  3CCU A;  2O5I C;  5HY6 A;  4CKE A;  3B3S A;  2REE A;  2R3Z A;  3VR5 A;  1X56 A;  5BN3 A;  1E2W A;  3S1Q B;  1E1T A;  1UWV A;  2PQ8 A;  4HPS A;  5F48 A;  1DTD A;  2Q44 A;  2KCM A;  2IX0 A;  1AFP A;  4PZ8 A;  4JLY A;  1C9O A;  4FYD A;  1K8O A;  1S4Z A;  2N3S A;  4NJQ A;  1U9R A;  1L1O A;  4LFA Q;  2UXC Q;  3PB9 X;  4CAW A;  4XYQ A;  2F0I A;  5K5P A;  1AUG A;  2KQ3 A;  4YWK A;  1ZO0 A;  2XEG A;  1I94 Q;  2ZXP A;  3S15 H;  3D2P A;  1HQM C;  3CD6 A;  2VQE L;  1TWH H;  3M9B A;  2D2C C;  5IWA L;  3J81 c;  5LYI A;  3IAY A;  4PSW A;  1W2B A;  3A56 A;  2OF1 A;  5IP9 G;  2Z4H A;  3A7L A;  5JJL A;  4FF1 A;  2CNS A;  2GU2 A;  3IO1 A;  5F46 A;  3BJU A;  4FF3 A;  4KVX A;  3RNZ A;  2CQO A;  2PCU A;  4H13 C;  3G7L A;  2DN8 A;  4QF4 A;  5A2Q E;  3GTO H;  3IL8 A;  2VBQ A;  2UUC Q;  1EY7 A;  3RN5 A;  1LTR D;  4HJ9 A;  4OEL B;  3H15 A;  2B3G A;  1HPC A;  1WD0 A;  3NXW A;  4WOR A;  5C4Z A;  1HR0 L;  3CKI B;  1IL2 A;  5IE8 A;  1NUC A;  4Y49 B;  5FO9 B;  4OAE A;  4MHE A;  1VQ9 A;  4A93 G;  1EIF A;  1UE6 A;  3C2P A;  1X10 A;  4UWI A;  2L12 A;  1AYE A;  3VWE A;  3BDL A;  1VQH A;  4R4O A;  3OYY A;  5F49 A;  1QIL A;  3I4L A;  4P71 A;  4A75 A;  2K5D A;  2F0V A;  2I3C A;  2NZH A;  4S3S A;  1EY6 A;  2SNS A;  1EYG A;  5HVG A;  1OXS C;  3A54 A;  1LTT D;  3SJG A;  4BA2 I;  1IBM Q;  4HMI A;  1I4X A;  2MNA A;  3D67 A;  1GD7 A;  3U4V A;  3S6K A;  4OC1 A;  3W3A A;  1EY9 A;  3MAQ A;  2Z1C A;  3CU7 A;  2RHS B;  4RA8 A;  3V96 A;  1YLE A;  3FF3 A;  1K8A C;  2MUY A;  5LL6 X;  1BNZ A;  4Q7A A;  2VZZ A;  2K52 A;  3HOV B;  4UDU C;  4A33 A;  1TY2 A;  1MJE A;  4YRH A;  8CPA A;  4YWM A;  5AGE A;  1HJP A;  2I5M X;  3I4N G;  1VF5 C;  2HHH L;  4F9V A;  5C4X G;  4NSQ A;  2WV6 D;  2PMZ B;  4BXX G;  3K5O A;  4K5W A;  3M4O H;  2K5V A;  2PJ1 A;  2B2W A;  5HMN A;  5CV7 A;  4DGZ A;  2YU9 B;  3BHX A;  4ZQ3 A;  4HTH A;  3S9N A;  1XX8 A;  2XVS A;  1SYF A;  4Q0F A;  5IYC G;  3PO2 H;  2EJM A;  1LTI D;  2A69 C;  3T51 B;  3TQY A;  3NWT A;  3K9T A;  3K6O A;  3KUP A;  1Q82 C;  1BOB A;  2MFI A;  1DYQ A;  4IPG A;  3OW2 A;  1Y1W B;  2VUM G;  4K6D A;  1H95 A;  3C46 A;  3I4O A;  3UDI A;  1YX0 A;  1YNN C;  2PJB A;  4DV6 Q;  5JOB A;  3EXN A;  1UE1 A;  1VQ4 A;  2JA5 B;  3H94 A;  4J6H A;  2R7H A;  3H8F A;  1PZI D;  2YV5 A;  4WJB A;  2RDH A;  3P20 A;  4A3I H;  2PVV A;  3WOF A;  2YTX A;  4M1U B;  3ICE A;  2OZH A;  5EJW A;  3F1Z A;  4X66 L;  4ZK9 B;  3HOX G;  4P10 A;  3M3Y B;  4POG A;  4DF7 A;  4IUN A;  2PJ7 A;  1FT7 A;  2FMM A;  4IHM A;  4W9Y A;  4OEM B;  3PF5 A;  1ICF B;  3PBB A;  2Y0S B;  2K03 A;  4YWY A;  1PH4 A;  1QG7 A;  1Y7E A;  1PFS A;  3GTQ B;  5IX3 A;  2BA1 A;  1GUS A;  3D7H A;  2R1I A;  3VYR A;  3D66 A;  2F03 A;  4JI6 Q;  5GAG C;  2Z3L A;  2EY1 A;  1D1K A;  1RDP D;  5EPK A;  1VQ5 A;  4BY7 G;  1IYK A;  2AFX A;  1W3S A;  4BBR H;  1XJO A;  1J9O A;  2HD3 A;  3GQB A;  3GTM H;  1MJA A;  4QBJ A;  2HDL A;  3TP7 A;  4K0K Q;  5ISR A;  2JDD A;  1JT8 A;  3RZD B;  1SRO A;  2ALY B;  3JAM E;  4XDX A;  3GTJ B;  1M90 C;  2KVM A;  3D8G A;  1NE9 A;  1TWC B;  2O53 A;  3S14 B;  3KHX A;  4A3E B;  2NN6 G;  2XSC A;  5C3X A;  2NWG A;  2ZTC A;  2K6A A;  3S1N B;  1NCV A;  2PR1 A;  3HOY G;  3I55 A;  1ILP A;  4HNX B;  1NY4 A;  1CKN A;  3SI1 A;  1MIU A;  3S1R B;  4LFA L;  1I12 A;  2PQE A;  4MRI A;  3TBI B;  5ISV A;  4DR5 Q;  2F0S A;  4CS0 B;  1IW7 C;  3Q6S A;  4IUQ A;  3S16 H;  3I70 A;  4KUB A;  5FLX E;  3W2D A;  3G6E A;  4GN3 B;  4Q38 A;  1ASZ A;  3EJI A;  4MHP A;  1Z47 A;  3KK7 A;  3U50 C;  2FXF A;  4KK7 A;  2CIJ A;  4MXU A;  2WAQ E;  2Z3O A;  1GUO A;  1E22 A;  2MGS A;  3R8B A;  1X3P A;  1ILQ A;  3CCE A;  3I4N H;  3DEO A;  4A31 A;  1E7Z A;  1Q90 A;  3D68 A;  3NA6 A;  2BE5 D;  3NPP A;  3J80 L;  5JEA J;  3PSI A;  3HS0 C;  3CC7 A;  3A5U A;  3HOW B;  3M85 A;  3OWC A;  4C3J B;  4O42 A;  3LOD A;  1FNW A;  5E3F A;  2OOT A;  1Y9W A;  4KOY A;  5J22 A;  4GLV B;  2SEB D;  1V1O A;  2EQS A;  2SNM A;  2LXJ A;  4PSX A;  4KOX A;  3PO2 G;  3O13 A;  4J8Q A;  3RUZ A;  1JJG A;  2ZOG A;  3GTG B;  4UWJ A;  3HZX A;  4MCP A;  1VQL A;  3KHZ A;  4JZ0 A;  1PYT B;  1R4Q B;  4C2X A;  2LY7 A;  1SQH A;  1EY4 A;  5M3M H;  3TO7 A;  1TWA H;  2JQO A;  3T53 B;  1YRE A;  4ZGY B;  2RBM A;  5IV0 A;  4RGT A;  2BEI A;  1EIH A;  4E6I A;  4IUS A;  2BL1 A;  5M5X H;  4RS2 A;  2PZT A;  1HDQ A;  1YHA A;  3I56 A;  1WTX A;  1CK1 A;  4XIG S;  4XT1 B;  1LRZ A;  4B3R L;  2I07 B;  3S9L A;  4GZY C;  1EFI D;  4ZX9 A;  4CJ0 B;  4L5S A;  1DZ1 A;  5I9P A;  4QB9 A;  3FHW A;  2DPS A;  3K8A A;  4HED A;  4JBM A;  1HNZ L;  2V77 A;  3IJ3 A;  3GTM B;  1KUV A;  3DEP A;  3NBH A;  2JDC A;  5K8N A;  2K05 A;  1Q12 A;  2CXA A;  3GTJ H;  2BCO A;  2LXK A;  4C2Y A;  1PYB A;  3CRK C;  3N7Z A;  3T4A C;  3JAM i;  4P4I A;  2BOS A;  4PV1 C;  1E2V A;  2F0N A;  1YEZ A;  4C3H H;  5I6W A;  1QST A;  1J6Q A;  1EFW A;  1FD7 D;  3K9U A;  2P0W A;  4MI4 A;  1CSQ A;  4L5R C;  4RWS C;  1Y9K A;  2A6E D;  1ZG9 A;  3NUC A;  2ID0 A;  3OMG A;  3CCM A;  1TWG B;  1B9N A;  1BBW A;  3KF8 A;  4BBR G;  1KDB A;  2O2L D;  2ZEO A;  1ENF A;  4LWC A;  3ZJY C;  2RF4 A;  4PXE A;  1W6K A;  2PNR C;  4X8I A;  4CGM A;  4BBS G;  1PTO B;  4MN3 A;  1VDZ A;  4YCU A;  2XEF A;  3A9L A;  4OC2 A;  4QUF A;  4XPL A;  1ZYR D;  1XPR A;  1JCK B;  2IMO A;  4C1N K;  1IXR A;  1L2F A;  1LTA D;  3NTH A;  4LUV A;  2R7Z G;  2EO8 A;  2Z11 A;  2UXB Q;  3K7U C;  4EVY A;  3X3N A;  3GV3 A;  4RI1 A;  3V8I A;  2I5L X;  3SHP A;  4H02 A;  1JOK A;  3MZ5 A;  4G4K A;  3K59 A;  2R98 A;  2F3V A;  1PRT F;  4LF8 Q;  2J8N A;  3DR8 A;  4YCW A;  5LRJ A;  2WSA A;  2ZJR A;  2B63 B;  1FL0 A;  5D14 A;  5I2Y A;  4K5V A;  2DY8 A;  2Q2T A;  4PG3 A;  4KHP Q;  4X64 L;  4JI2 L;  1UAP A;  3CZX A;  1PTO H;  4V19 0;  3KLR A;  1E2Z A;  1BQQ T;  2K14 A;  5ELO A;  1PMR A;  5JJZ A;  4IJL A;  4GM5 A;  1LM0 A;  4E0A A;  2RVL A;  3A8I E;  4DR6 L;  4F0Y A;  3PO3 B;  2Z6B A;  3PIP 3;  4K14 A;  4ONW A;  3A0J A;  2VL1 A;  3G71 A;  1DON A;  3OIP A;  4CAV A;  4K8J A;  4FF4 A;  2JA6 G;  1B4O A;  3S2D H;  1HUN A;  5D8N A;  2IX1 A;  2CH4 W;  1Q8I A;  5HGT A;  3M4Y A;  4MFK A;  4H6Z A;  2K5T A;  4GXH A;  3D3R A;  2C1C A;  5DNF A;  4EQN A;  4HKF A;  2CWP A;  2Q7S A;  5EBC A;  2LFN A;  2A4N A;  2ZEM A;  5FJ8 G;  2N49 A;  4DR2 Q;  1Y8O B;  5E4X A;  2JEW A;  1DGS A;  4TSS A;  2VW9 A;  4DR3 L;  2PE3 A;  3D3S A;  1D5X C;  1FY7 A;  1JC7 A;  1ZEQ X;  4R4I A;  4MFP A;  4KOR A;  2FFK B;  2F0J A;  3ULJ A;  4DFA A;  5BN5 A;  2C6P A;  4ME3 A;  3C1E A;  2KJX A;  4XPD C;  3DMU A;  1IID A;  2JBJ A;  2J8R A;  3GLJ A;  3DM1 A;  3GTK B;  4P4B A;  3LGJ A;  1SE3 A;  2UU9 Q;  4DXF A;  3K5N A;  3DNS A;  1B3A A;  3MXU A;  1RF2 D;  1N36 Q;  3H0G H;  4CAX A;  1CZW A;  1STA A;  4YY3 Q;  4C2Z A;  2OR4 A;  1A3U A;  3AMU A;  3FVQ A;  4RH6 A;  1STH A;  1K3R A;  4X65 L;  1IBM L;  2FS5 A;  4PK2 A;  4UCN A;  1QVC A;  1KIX A;  2F0M A;  3FMC A;  5ELY A;  5KTA A;  4LF6 Q;  5JPH A;  3OIQ A;  2FVG A;  1SJE D;  1DXM A;  1SND A;  4KY7 A;  3SXH A;  2DXQ A;  3SK5 A;  1Z5R A;  1YVC A;  2JEA I;  4YHH L;  1LTB D;  1EWH A;  3ERQ A;  1LT6 D;  2F0D A;  4DR4 Q;  3TDQ A;  1II3 A;  2IJ0 A;  4F7X A;  1U4P A;  4DXG A;  1BPM A;  2JBK A;  4OP4 A;  3S6G A;  3T1H L;  3B6Y A;  4Z9C B;  1LTG D;  3RBU A;  1SE2 A;  2HQY A;  2A73 B;  2R7F A;  3VYU A;  3C3L A;  1GYT A;  2WFW A;  3LD2 A;  1YVO A;  1HHV A;  1XMO L;  5GRO A;  1V1P A;  3PUW A;  4QQB X;  4TRD A;  4A3F G;  4LFC L;  5DWN A;  4NEX A;  1XXG A;  4C68 A;  4IOA A;  4R76 A;  1MJ9 A;  4QB4 A;  1TY0 A;  1PXU A;  4X3S A;  2VXW A;  5JVG 3;  2BO9 A;  4A3G H;  1FYC A;  3CQZ H;  4RKB A;  1BLL E;  1EQT A;  3KGQ A;  4RG1 A;  3KJO A;  1F9R A;  1TKW B;  4UY8 C;  1X12 A;  4JI1 L;  4Z65 A;  5D3I B;  1QZG A;  5KRU A;  2PJ5 A;  4A93 H;  2EJG C;  5M5Y H;  2F0T A;  2RSN A;  2ZW7 A;  3BJ7 A;  2ODF A;  4LUZ A;  2KCW A;  2CWA A;  3HOZ G;  4CDF C;  3KF6 A;  4GLX A;  2KCC A;  3NWS A;  3TEH B;  4P4D A;  3M7G A;  1K28 A;  1V8Q A;  1Q81 C;  2Q2U A;  2UXD L;  1TIQ A;  2ENB A;  2G5D A;  2Q8I B;  1QVG A;  1K73 C;  5C4X B;  3RYO A;  5I0C A;  1IBK Q;  1CSP A;  3HKZ B;  4FD4 A;  2QKI C;  5L37 A;  3GTQ H;  2Y0M A;  1CBX A;  1PV4 A;  4IO9 A;  2EYP A;  3PUV A;  4UFV A;  4NF1 A;  5C0X I;  4K0K L;  1GHE A;  5G22 A;  5TSS A;  3IFT A;  1XPU A;  3LMS A;  3R1K A;  2RCF A;  4L8J A;  1I4R A;  3LWE A;  1EZ8 A;  1TT2 A;  1PRT C;  3H4Q A;  3LAC A;  1NMF A;  3P75 A;  2C9O A;  3HOX B;  4DJL A;  4A4I A;  4ZKB B;  4JI6 L;  1SFO H;  4QUC A;  3D7G A;  4X65 Q;  1S3Z A;  5EQ0 A;  2E2I H;  5K8O A;  3KBG A;  2GN5 A;  1N34 L;  5ELF A;  4FO2 A;  2K04 A;  5DS0 A;  2ARH A;  1VQM A;  4MHN A;  2PQA B;  1R57 A;  1S60 A;  1UEB A;  1N9W A;  1I6V C;  3IWW A;  5FLX L;  3S17 B;  1XRY A;  4M6I A;  3QOL A;  2DJG C;  2B8G A;  3KJP A;  1DOM A;  4ULL A;  2Z0S A;  1T5X D;  4IJH A;  4ALP A;  4F88 A;  1SNP A;  1U4R A;  4LFB Q;  1WVL A;  1IKL A;  1S5E D;  3OHX C;  4NXM Q;  2B2T C;  1AH9 A;  5JEA G;  4B14 A;  3PIO A;  5LYD A;  4ME5 A;  1VQO A;  1B1Z A;  4M8A A;  2CVR A;  3K5M A;  2NYQ A;  3TN2 A;  1Z8L A;  1XMQ L;  1D2B A;  2XIW A;  1J5E Q;  3I1U A;  3NEL A;  3MXP A;  3FEC A;  4DNI A;  3NP8 A;  1ROD A;  1JOQ A;  1PHJ A;  1CX8 A;  5CBA E;  1WCM B;  5CV5 A;  1Y1W H;  3EC4 A;  1A0I A;  3Q22 A;  2ZTD A;  4K8I A;  1O7Y A;  2HQE A;  4BY1 G;  4M6G A;  1YI2 A;  1KQS A;  5GQO A;  2B4D B;  1VQI A;  1VQJ A;  4AH6 A;  2YND A;  1K4J A;  2H5M A;  4KUA A;  1XFO A;  4A3K G;  1Z4R A;  4A3M H;  3HOY H;  5H1S E;  2J4X A;  3CPX A;  1ZKO A;  2L1B A;  3SJF A;  1CFM A;  1L0Y B;  1SXT A;  4PMC A;  3BDC A;  2O4X A;  4U67 3;  3CMA A;  2HC9 A;  2D9U A;  4DYO A;  1EYA A;  2PW5 A;  4FP5 D;  4M3S A;  3BJ8 A;  2K33 A;  4KD4 A;  4QUS A;  1JOO A;  3PB4 X;  4R3L A;  4F8M A;  4TVA B;  4KLW A;  3GTL H;  4PZ7 A;  1I21 A;  1ET6 A;  1NNX A;  3H5Z A;  3AFQ A;  2E5L Q;  2OQ0 A;  5ELB A;  1S5D D;  5G3L D;  4LW1 A;  2V8H A;  1BPN A;  4ILW A;  2F0U A;  1WFQ A;  4IQZ A;  2IJZ A;  3TC8 A;  3TFY A;  1CI3 M;  2B3U A;  2K5N A;  2XN9 C;  2CY2 A;  1QUQ A;  4NXN Q;  3FKI G;  1K3B C;  4RHR A;  3CDX A;  2AQ2 B;  4K3N A;  1PCA A;  1BO4 A;  3NH8 A;  3HLP A;  3UDG A;  4JG2 A;  1S7L A;  4MHZ A;  4PXD A;  2NN6 H;  1BCP C;  2WKD A;  5D65 A;  1B8A A;  2CCZ A;  5CBE E;  1K8G A;  4FAI A;  2J9A A;  4AB7 A;  1PRT B;  1QNU A;  4R8I A;  4DV1 L;  3EA6 A;  4HN7 A;  1TU2 B;  4MFZ A;  3L2P A;  2FSR A;  3ONA B;  3JUW A;  2XRQ D;  4UFX A;  3V38 A;  2VQE Q;  3EO4 A;  1B6B A;  2I0Q A;  4NB3 A;  3RMH A;  5IP9 H;  1KUX A;  4R3K A;  3DGV A;  1MK4 A;  3NK9 A;  5M3M G;  4CDC C;  3PEI A;  4OWT B;  4FXG C;  1Z4E A;  4P74 A;  4R8F A;  1DCZ A;  3ITP A;  4A3I B;  5IOD A;  1TWF H;  3MFY A;  4KV6 A;  1TXR A;  4I49 A;  5LMN W;  1OBR A;  1UFH A;  3BI1 A;  5EPL A