3FMCA

Crystal structure of a putative succinylglutamate desuccinylase / aspartoacylase family protein (sama_0604) from shewanella amazonensis sb2b at 1.80 a resolution
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
365
structure length
365
Chain Sequence
VDKHEVRVGELAAGQPLSLPVYRFKGKGAGPSVYIQANVHGAEVQGNAVIYQLMKLLEHYELLGDISLVPLANPLGINQKSGEFTLGRFDPITGVNWNREYLDHGFNIEVWYQEHSHLDDDTLITAFRATLVEECARRLNNPWGVTTGHRLAVTLQSMAHRADIVLDLHTGPKSCKHLYCPEYERSAAQYFSIPYTLLIPNSFGGAMDEAAFVPWWTLAEVASSHGRELGVRVSALTLELGSQERIDLDDALEDAEGILAYLSHRGVIAETVLPKPMKRYGCFLKNYRKFHAPKAGMVEYLGKVGVPMKATDPLVNLLRLDLYGTGEELTVLRLPEDGVPILHFASASVHQGTELYKVMTKVFEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative succinylglutamate desuccinylase / aspartoacylase (YP_926482.1) from Shewanella amazonensis SB2B at 1.80 A resolution
rcsb
source organism Shewanella amazonensis
molecule tags Hydrolase
molecule keywords Putative succinylglutamate desuccinylase / aspartoacylase
total genus 112
structure length 365
sequence length 365
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3fmcA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3fmcA01
4R6TA 4MCPA 3WC5A 3QG1A 2CTBA 4NGPA 2AFXA 2EK8A 1O78A 1GHKA 1UWYA 4TQUS 3CT9A 5HXDA 3D66A 5LYFA 4MMOA 1Y0RA 4BA2I 1XFOA 3T53B 2JEWA 5HVGA 3MN8A 4KKSA 3KHXA 3QJYA 2ABZA 1V8QA 2ZEHA 4G1PA 3KQZA 3PBBA 5HVHA 2IT1A 4YU9A 2XEGA 2O4HA 2PJCA 1Q90A 1BDOA 3L2NA 3FMCA 1XMBA 4H44C 2AUJD 3P20A 4O23A 1ZLHA 1CPSA 4EFDA 2B8FA 1Z2LA 2V8DA 3PUVA 1ZG8A 2GLJA 3M85A 1ZG9A 5JGFA 4FBEA 1XBUA 2AFMA 1HDUA 2NN6H 4LK1C 1TF9A 2CIJA 5I4MA 2KCCA 2PCUA 5JM6A 5LYIA 1FYCA 2C6GA 4RCNA 3T51B 4ZYQA 1EE3P 1FNOA 4MCQA 4EMEA 4PXEA 4IHMA 3N6RA 3K9TA 1IW7C 3DLJA 3RBUA 1OXSC 2V8VA 4OO1H 3K2KA 2ZOGA 3BXMA 2BDOA 2JEBI 3EQLC 4ZY1A 2AWOA 3SJGA 2PRQA 4JZ0A 1TKJA 3I1UA 1E2ZA 1ELMP 4TKOB 4IAVA 2PJ7A 3H8FA 2A6HC 4FUUA 5DS0A 5F09A 1VDZA 1DE4C 3SJEA 1ZG7A 3D4UA 4BD9A 4OO1G 1VCIA 2F7VA 1TXRA 1BPNA 1M4LA 4A94A 1AYEA 1KWMA 2BE5C 4B6ZA 2B8GA 3GUXA 3D4RA 8CPAA 1Z5RA 5LRGA 3PUZA 1DD2A 3BHXA 2F1MA 3SJXA 4CPAA 2BE5D 4PQAA 4RUHA 5IB9A 4R7MA 1LANA 4OIDA 4H13C 4IQZA 3B35A 4H2KA 2CW0C 1ZKOA 1E2VA 3CPAA 5J1QA 1ELLP 3CDXA 4OP4A 1XRYA 4GZYC 2R6GA 3M7NA 3PUYA 4PXCA 3BI1A 2DEAA 2PVWA 3I72A 3PFEA 4TWEA 4OGQC 4W9YA 4P4JA 4OIWA 4JBWA 2L5TA 1K8OA 4NJQA 3V38A 3MXUA 4P4DA 3VR4A 3AB9A 2O5JC 1ZYRC 3CPXA 4R76A 3T8WA 4NGTA 3PV0A 5LYDA 4NGSA 1YMEA 3IFEA 1OXVA 1LAMA 3SI1A 4MXUA 1A6XA 2WZNA 2JBKA 1VF7A 1BLLE 2CTCA 1BPMA 4MRIA 4UEFA 5K8NA 5JEAH 3KI9A 1FR3A 2XEJA 4UIBA 3RZAA 5K8PA 1Z6HA 2AFZA 5KNCA 4A39A 3ND8A 3VR2A 3B2YA 2IMOA 4KN7C 4NJRA 1GUSA 3PB4X 3MRUA 1Q1BA 3A7LA 3FH4A 3GLJA 1QJOA 2PJ1A 2C6CA 4P10A 4KMUC 4XIGS 2EVBA 1GJXA 4WWVA 3IKJA 3VH9A 2A69C 2XEFA 1CP7A 2ZEEA 3N5FA 1OXTA 5A35A 1Y8NB 3D68A 5D29A 2QYVA 2OOTA 4KI0A 2ZEFA 4IK2A 3IJ3A 3U9SA 2D62A 2LMCB 2V8HA 2ZEGA 3CRLC 4IFDH 1CTMA 2JXMB 4OC2A 1TF8A 2JE6I 4EWTA 4MCRA 3FPPA 3V7ZA 4GM5A 2PJBA 1DCZA 4NGRA 1TKFA 5BN5A 2POKA 3DXJC 3PEIA 5CBMA 4Q7AA 1H9SB 3KL9A 2PIZA 3W3AA 3FEEA 1Z7TA 2RB7A 3D67A 4G7OC 4I7ZC 2A68D 1Q1EA 1VHEA 2E76C 4ZI6A 4P4IA 2PJ0A 1AMPA 1Y0YA 2CF4A 1GHJA 6CPAA 1HQMC 1QMUA 5C0XG 4X8IA 3D7HA 2ZOFA 2EK9A 3VR6A 3A8KE 3OPOA 4HR7B 4ZX8A 3IEHA 5K36G 3WC7A 1Y7EA 2A6ED 2KA7A 3FECA 1Q12A 1HCZA 3I73A 3QIAA 4OC5A 3A7AB 1FT7A 4NGMA 1YW6A 3A8IE 4MHNA 1O7LA 1CI3M 2WYRA 3OW7A 2C1CA 2PNRC 1PCAA 3B3CA 5D8NA 4L8JA 3HGBA 3I4LA 2XEIA 5LRKA 2EJFC 3S9NA 4MHZA 3WC6A 2HB6A 1HDQA 3PBEA 3WT4A 2PJ4A 4NFRA 1Y8OB 4UEZA 1LOKA 2K32A 3B3VA 3VARA 1V43A 3BG3A 5ELYA 2ANPA 1CPXA 2HC9A 1H9KA 2A69D 3IIBA 1F57A 3L7ZC 3WABA 2D5DA 2AFWA 3SE0A 2PPBC 1ARLA 5LYLA 2OR4A 2Q43A 3GQBA 4P4EA 4ZY0A 3H8GA 4KN4C 3NH8A 3KHZA 1SMYC 3SJFA 4F8ZA 5KNBA 3IC1A 3SI0A 4KSIA 4ZX9A 3B3SA 3LNNA 4TNUA 2PIYA 2E75C 2J9AA 3HLPA 1G291 3NA6A 3NE5B 3KZWA 2O5IC 4MCSA 2DNEA 2EDGA 2BCOA 3PB8X 5JH9A 1YSJA 1CP6A 4UEEA 5K8MA 2EJMA 1T5EA 1F2OA 2BA1A 1PMRA 3KR5A 2V4DA 3TZUA 4H0LC 2ZELA 4A38A 1XJOA 1VIXA 4P6YA 2PCFB 3S9LA 3OOCA 3VR5A 2AUKA 1HTPA 1YNJC 2Q8IB 4KHZA 1YNNC 3FX6A 1VHOA 5THWA 4BA1I 2VL1A 3A8JE 3IO1A 4P45A 3VA7A 1I6VC 1YLOA 2PJ8A 4X2TA 3NFZA 4IFDG 4A37A 2IJZA 4OC4A 1OXUA 1ZLIA 4JYWA 5CPAA 1HPCA 3FVLA 4NGQA 3RAMA 4AXVA 4DUKA 2NN6G 3SI2A 2V77A 3T56B 1H9RA 2JEAI 2PJ5A 4ZY2A 5BN3A 2BOAA 5HVFA 2DN8A 2GU2A 3PRTA 2NN6I 2AFSA 1OXXK 1TKWB 3CRKC 3FJUA 2AFOA 1CBXA 3H8EA 2Q51A 1GUTA 2JBJA 1R3NA 4OKOA 4UIAA 1GUNA 4YWYA 3LWUA 3RLFA 1K8MA 2C6PA 4XTCS 3PUWA 3KQXA 3ISXA 2RFHA 3KASA 1EWHA 2PJ6A 1H8LA 3SDZA 2I3CA 3B3TA 2F8HA 1F2PA 5K36H 1BAVA 1GYTA 4OC3A 2PJAA 3MFYA 2QJ8A 4F9VA 1R43A 1IW7D 2G9DA 3PB6X 1VGYA 1TKHA 3PUXA 4KKTA 4OC0A 1IYVA 2GLFA 2QVPA 4NGNA 4MHPA 5KNDA 2PJ9A 1H9MA 3BI0A 4FAIA 2O53A 3JRUA 5K8OA 4G7HC 7CPAA 3VATA 3IFTA 4ONWA 4OC1A 3S9MA 1Y8PB 2A6HD 4X3RA 2A6EC 4WJBA 3PB7X 2PJ3A 4DYOA 1B9NA 1Q7LA 4PXBA 4DNTB 3NH4A 1GUGA 1VF5C 2IQ6A 4MHYA 1Y69U 1DTDA 3FF3A 5C0XH 4DNRB 2PE3A 3M4YA 1YW4A 2FVGA 3D7DA 4K3NA 1GUOA 3KGQA 4F9UA 2NSMA 2EJGC 4KKUA 2PVVA 1QQ9A 1B9MA 3GB0A 1JQGA 3FEDA 2BA0A 2D2CC 2A68C 3WDNA 3D7FA 5JEAG 3D31A 4DK0A 2ZEMA 4R8FA 1E2WA 4P44A 4PXDA 3LMSA 1LFWA 3PFOA 2DNCA 3B3WA 2GREA 1CX8A 3GD7A 5LRJA 1NSAA 1Z8LA 2BO9A 2V8GA 2QF7A 2YYZA 3IWWA 1CFMA 3ND9A 3DGVA 4LJZC 3PB9X 1LCPA 4G7ZC 4PPZA 4FWUA 3TC8A 1LACA 1DXMA 1RTQA 1TU2B 2ZEDA 5BN4A 1ONLA 1IY7A 4LQGA 4P4FA 4P4BA 1H9SA 2PJ2A 2ZENA 1HEEA 3VR3A 1IGBA 3HUVA 2EWBA 3KLRA 3KR4A 3D7GA 4PV1C 1PYTB 3TX8A 1IYUA 2E74C 4DK1A 4Z65A 1LAPA 3BDOA 1H9JA 4OMEA 2Q4ZA 3QNVA 2K33A 3H94A 1CG2A 2AFUA 2ZEOA 4UF4A 1OBRA 2ZEPA 4DJLA 2NYQA 3NH5A 3ISZA 1ARMA 2ZT9C 1LABA 4JK1C 3B7IA 2K7VA
chains in the Genus database with same CATH superfamily
4G4KA 4MNOA 4ZLTF 4MCPA 3WC5A 2JA8B 3A5ZB 3R2TA 3IAYA 4WORA 4WJ4A 2EK8A 4F87A 1QZHA 3I4MH 4K0KL 4MJ8A 4UCPA 1XFOA 4PG3A 2E8GA 1A8VA 2VL6A 3NBIA 4QMGA 3KHXA 1NNXA 2R7FA 1EIGA 4ZQ3A 3T1HQ 1U6MA 2ABZA 1V8QA 3NENA 1RO5A 2CXAA 2Q7BA 1PH8A 1WTVA 4X6AH 3KQZA 4L89A 3PBBA 5HVHA 1OZPA 2GN5A 4OIJA 2UXCL 2UXBL 2PJCA 1PUAA 4IOAA 1BDOA 1VQDA 4LX9A 1IBKL 1XMBA 4DAYB 3KKWA 4H44C 4UWIA 3VDYA 2B8FA 2V8DA 2QA4A 4A32A 3PUVA 1IBKQ 1S5FD 4FBEA 1IBMQ 2RKSA 3S1MB 1YNJD 3PIOA 3CCMA 3OMCA 5JPNC 4IFDJ 1N33Q 4E2AA 4F0XA 4MY0A 1ESRA 1XNRQ 2C6GA 1YVOA 4I65A 3N6RA 4HSVA 4JWPA 1VQHA 2XWBB 3HOXG 3DLJA 1N36Q 2Q8RE 4J15A 4UA3A 2JN4A 2ZOGA 4ZY1A 2BDOA 1E24A 1TS5A 3M3YH 5JOBA 2AWOA 4JI8L 3I7FA 2JA6H 4LF4Q 4KK7A 3DEPA 2K75A 3CXSA 1RIPA 2OTLA 1E2ZA 5KYIA 4K5VA 2VZYA 3I55A 1EY0A 3JVNA 4OAEA 4YWMA 3G48A 2FXQA 4LNQA 4NMZA 4DV1Q 1N32Q 1DOKA 2QDBA 2HHHL 4K0KQ 1EL0A 1IU8A 1IYKA 1ZG7A 3D4UA 2QGQA 2F7VA 1TXRA 2R7HA 1KWMA 8CPAA 1QUQA 2F0PA 3CCSA 2P6FA 5G3LD 5AG6A 2F4VQ 2F1MA 4CPAA 4OEMB 4KUAA 4PQAA 5IB9A 4QB4A 4J8QA 1VQ6A 4NSQA 4OIDA 2VI7A 4DR3Q 1CZGA 5KTCA 3HS0C 1E2VA 1Z8WA 5J1QA 1ELLP 3CDXA 3Q22A 1BKBA 2XTIA 1I1DA 3PUYA 2WKCA 4PXCA 3UDFA 4A76A 3I72A 2K05A 4P72A 4TWEA 3U50C 3CZXA 4W9YA 4JBWA 1JB3A 5IGCA 3E3XA 4ZYSA 3R9GA 2F0MA 3CKIB 3DWQA 1TWAB 2Q7SA 4P4DA 3VR4A 1ZYRC 3CPXA 3HOYH 3S1RH 1KL9A 3ICEA 1LT3D 3H0GG 1D7QA 4A3CH 3DWPA 1UWVA 4C56C 4WJ3M 2NWGA 2RCFA 5EJWA 3J80E 2JBKA 4GNXB 5COYA 1ML0D 2MHVA 3OIPA 3S2HH 4UEFA 4DF7A 3JUWA 4CDFC 1U4PA 5L37A 4Z9CB 5K8NA 3I8ZA 3EXNA 2XEJA 4EQNA 1PVOA 2RDGA 4B13A 3NE8A 2ZW6A 3QAHA 5KNCA 3A5UA 3ND8A 3VR2A 1RXTA 4ORFA 4C3IG 1C4QA 5NUCA 4BBRH 2E5LL 2IMOA 4A95A 5C4XG 1GUSA 4MFPA 4LFCL 4LW1A 3PB4X 3MRUA 1XTDA 3FH4A 3GLJA 5IY0A 4DV2Q 1QJOA 4LF6Q 4JI7Q 3A74A 1ILPA 4NCZA 2C6CA 1B1ZA 1HRJA 4XT1B 4G57A 4XIGS 1I50B 2GFQA 1QE6A 2D9UA 3OTOL 3VYSA 1TWCB 2G3AA 2XEFA 2ZEEA 2NVYH 3D68A 2OOTA 4GLXA 4LF9Q 2H4OA 4IK2A 2DUDA 4RMFA 2Z0ZA 2IX0A 5H84A 3TOBA 4CAVA 2D62A 2ICIA 3K5LA 1VQ4A 2HUZA 4BXXH 4K5WA 4A3KH 3CRLC 1B3AA 2AQ3B 5I9PA 1JT8A 4FP5D 4OC2A 1N34Q 3RMHA 4F0YA 4EWTA 1N8RC 3R1KA 3V7ZA 4IFDI 1G2TA 1GUWA 1M4GA 2Q0YA 3K5OA 1I4HA 3NBHA 1WK4A 1JJCB 2B2WC 5BN5A 1P0HA 1QWYA 3DXJC 3TS0A 2N8NA 4Q7AA 1H9SB 2EYLA 3D3SA 5IT9E 2PIZA 2MJ8A 4DKAC 1MK4A 1X54A 1K28A 4DAPA 3IRBA 1YIJA 1UUPA 1Q1EA 1SE2A 4FF2A 4A33A 3NTKA 1BO0A 4B10A 4NXYA 2PJ0A 1ET6A 4X3KA 4J3GA 3RLOA 4JYAL 3ZJ0A 5IP9G 4RH6A 3QWNA 1S5CD 1K83B 4FXDA 4JI0L 3MXPA 1XPOA 2CF4A 1TS4A 4CGYB 4A3FG 1PZJD 2KOLA 3WOEA 2BL1A 2VS1A 2EYOA 1EIHA 1SSOA 4DUZL 4POFA 4YGOA 3C2PA 2KA7A 3T13A 1Q12A 1CSPA 1HCZA 2KEEA 3I73A 4DAYA 1SQHA 3CQZH 1RHPA 4RGMA 4NGMA 1JICA 1LT5D 1UEBA 3BYTB 3A8IE 3LODA 3K0YA 4DR7Q 5C82A 4JBMA 5FKAC 2VW9A 3JC66 2YNEA 1JR0D 1O7LA 3F1ZA 4ALPA 3GTLH 5IYDG 1PCAA 3B3CA 2R93H 5D8NA 3RR5A 4L8JA 1PH1A 2XEIA 4II9A 3PIO3 3PBEA 2IL4A 3VWDA 2F0GA 4C3HH 2K32A 3CW2C 2KCNA 4RN7A 4K2KA 2WSAA 5KYLA 2WACA 2Q2TA 1MIUA 3HOZG 4C2ZA 1QVGA 1VQ7A 1LYLA 4IO9A 1F57A 1Z8XA 3IIBA 3T1YQ 4UDUC 4EQOA 2RSOA 2ATWA 1G6ZA 1LTAD 3IWEA 2OR4A 3C1FA 4JC0A 1EZ8A 2DGYA 1B53A 1WTPA 1TS3A 2X6LA 4A93H 1PTOH 3HEJA 2MNAA 1Y9WA 1HFGA 3A0JA 3PIP3 1QCBD 3KDFA 4F8ZA 2Z9HA 1CUKA 1VQFA 1LTRD 4A3FB 4R8IA 4KORA 1X3FA 1TWHH 3GTMH 3BDLA 5JAVA 3B3SA 3LNNA 2C5CA 4A4IA 2PIYA 5KTDA 4XNHC 1D2BA 2J9AA 4Q36A 1G291 3NA6A 3NE5B 2GVBA 3GTMB 4LQ6A 2JA7H 2O5IC 2EDGA 2BCOA 2YU9H 3CPFA 3PB8X 3URYA 4POGA 1Z8TA 1X65A 2EJMA 1EY6A 1PZID 4YY3Q 5I2YA 2QILA 1Q86C 4H0LC 3FYNA 3HFZB 5GROA 5M3FH 1XMOL 3VR5A 4HKFA 4LF5Q 1K9MC 4QB9A 2K01A 5AG7A 2Z3KA 1VHOA 5THWA 2KVMA 2F3WA 1LTBD 3I9SA 1EUJA 3H3VI 2NZ1D 2F03A 5DLQE 2FCKA 1F2ZA 1A3TA 4NXNL 2IWHA 1KD1C 1FY7A 2PJ8A 4A37A 1OXUA 2DY7A 3FRPB 5K5PA 1ZLIA 4JYWA 4NGQA 5CPAA 1QVFA 1XX8A 4CHTB 5BWAB 1CKNB 1BBXC 1KUYA 4J6HA 4JXRA 2C9OA 1XXGA 4ZY2A 2PJ5A 3BVGA 2ZXOA 3E9HA 1VQLA 1KC8C 1R4PB 3STBD 4PSWA 3LX0A 2QKIC 3FJUA 1CHPD 1EQRA 4DUYQ 4A93G 1CBXA 1YVKA 3I91A 3GTKH 3KBGA 3PMFA 4ZCKA 2L11A 1YGHA 4H6ZA 2M2LA 1O7IA 2N49A 2CCZA 1L0WA 4IF5A 2JBJA 4U9ZA 4CKEA 3HOVG 1GUNA 1A62A 4JD6A 1PFSA 1JWMD 2VY3A 5G3LF 4IPDA 4CDCC 3M4OH 2JSOA 4LFBL 2R93G 1BVSA 3ISXA 4KS9A 4L5RC 1KDCA 3NEMA 4XPDC 4ZUIA 2XRQD 4KY7A 5EBCA 3B3TA 1QSMA 2UUAL 1HHVA 2IY5B 4QBJA 1KLGD 3PP9A 4E8OA 2F0FA 5FJ8H 3F2BA 1GYTA 4UBRA 4GKJL 2CH4A 1IYJB 4B08A 1S7FA 3MFYA 3ULJA 2PJAA 4DV4Q 4UP8A 3W5OA 5IWAQ 5CNPA 1A3VA 2VQFQ 4M6GA 1PYWD 3AFPA 4A3JB 4R4IA 4N8X1 2FL4A 1R4QB 4S3SA 4KKTA 1IYVA 5LMNQ 2PSWA 4BXXG 1I4XA 2FHTA 3OW2A 3L0OA 3R8BA 2ZJQA 3JRUA 1XWEA 4G7HC 1S7LA 1TR5A 3J7ZC 1SLJA 3S17B 4OC1A 3S9MA 4UFVA 4B12A 3PB7X 1Q7LA 4PXBA 1MSGA 4DNTB 2CWPA 1KABA 1A3UA 2PQAA 1EYAA 1UE1A 4A3FH 2KJXA 1JOOA 1UE6A 3SXOA 1YW4A 3S16B 2UU9L 4B3ML 1EU3A 2Q4VA 1OO9B 3S1QH 4A93B 1CKMA 1EY8A 2IHFA 4PV6A 1QQ9A 2WV6D 2A73B 2D2CC 3FEDA 2DPSA 1PA6A 3GTPB 1X32A 5M3FG 4IJLA 5H1SE 3NTHA 1VQPA 1PRTB 3L2PA 2ZEMA 3FP9A 1W2BA 2E2DC 1B7YB 4A3BB 3QAYA 4PXDA 3MEHA 5HGQA 2ZM6L 3DR6A 1TIQA 1C9OA 1M4IA 2JA5H 3HOVB 3MVVA 5EKLA 1JWQA 3I3GA 5LRJA 4DAMA 3J7AV 4QQBX 2KCTA 3UDIA 4FVMA 2F0DA 2PI2A 2PQAB 2QF7A 4X65Q 3K5MA 3IWWA 1IICA 4ZKCB 2CHBD 1CFMA 2PW5A 3ND9A 4LJZC 3TT2A 3S1RB 3J81L 1LCPA 1QNUA 2F4IA 4K8IA 3TC8A 3AU7A 2N78A 3M4QA 2IPKD 3I4MB 5TSSA 1TWAH 1IZ6A 2LKVA 3CP0A 3TP7A 4DXGA 5C4XB 4LQGA 4X3TA 2ZENA 2K5HA 1HEEA 3RN2A 4L8AA 1N9WA 3D7GA 2CH4W 1U9RA 1FNVA 3EFAA 1PRTF 3E5SA 5CBEE 5JVH3 2SNMA 2I00A 1IYUA 1MSHA 2JQOA 2E74C 2KCMA 3BLNA 4QY7A 4LFBQ 1LAPA 3OTOQ 2L4NA 2IW3A 1ENFA 3CMAA 3RUZA 2K33A 3H94A 4A3GG 2AFUA 3Q8DA 2HQEA 5C3EH 4X64L 3HOUB 3I90A 1QSOA 3CXQA 1PTOC 1TS2A 2NYQA 1HR0L 2G3TA 1RDPD 5M5YH 3Q23A 3ISZA 1SNMA 4CAEA 3IL8A 5GAHC 3FRMA 3GDEA 4JK1C 5IYCH 1WWZA 3B7IA 2K7VA 1YHAA 3W1GA 3KF6A 1B8AA 2WAQB 2ES2A 5EQ0A 4GKKL 4NGPA 2AFXA 1O78A 4TQUS 1YNXA 4BY1G 1I4QA 3D66A 2G5DA 4MMOA 4A2ZA 4BA2I 3KDFB 3M3YB 4QJFA 5JQ4A 4C3HG 3T53B 1XOVA 2OT2A 2JEWA 3DSBA 2BUEA 1WTOA 1FJGQ 2OEOA 5IGEA 4CAXA 2ZEHA 3HOVH 3KLWA 1RODA 5M5XB 2B5GB 2OU2A 3S24A 4O42A 3I3CA 2I07B 3H5ZA 4YU9A 2NVXH 1CKOA 5EPKA 1CM9A 4R1JA 2AUJD 4O23A 2VQFL 1PH7A 1W6JA 1PH6A 1CPSA 3HOXH 2ZJPA 2BH8A 2LSSA 1GM5A 4AVAA 1KRTA 2GLJA 1ZG9A 5JGFA 2AMCB 4DV3Q 1XBUA 5EGTA 2RA4A 2Z3PA 2NN6H 4LK1C 2CIJA 4PMWA 1I6HB 1EQTA 1SRUA 2FT0A 2K5TA 1MD2D 5EKKA 4C1NK 3HOXB 2A8VA 4I7AA 4QF4A 3T51B 4QUFA 4ZYQA 1EE3P 4MCQA 3H6MA 2IX3A 3BJ7A 1EY5A 4KOWA 3K7UC 2NVXB 4FDBA 3RBUA 3CCUA 4A3MB 2K5VA 2ZXVA 1N33L 2V8VA 4NXMQ 1W3SA 2Z4IA 4OO1H 1AW7A 3EQLC 4UPAA 3S17H 3S6GA 5M5XH 2EYFA 3SJGA 3NQTA 2UXDQ 2CY2A 1K3RA 4LF8L 2RSNA 3KJPA 1I4PA 3I1UA 2HCCA 4H89A 3FVQA 1HZ9A 1KQSA 4FUUA 3S1NH 1PRTC 4JI8Q 5J39A 2PNHA 1VDZA 4XNHB 2R7ZB 4OO1G 5C4JH 4ODGA 4TSSA 1I94Q 1BBUA 3ONAB 5C4ZA 1M4LA 3H4QA 4RAUC 2BE5C 4B6ZA 2HCIA 1C48A 1V0CA 5IGDA 5FVJA 1DD2A 2X69A 4RUHA 3DMUA 3S6KA 3RO0A 1I94L 1WCMG 1OTCA 1KLUD 4R3LA 2OQ0A 2XGTA 2FS5A 3B35A 4H2KA 2CW0C 4LFAL 4UCMA 4ULLA 1KNAA 4GZYC 2AWNA 1BCPC 2F0QA 2L15A 3F2CA 3I4NB 4XT3B 2F52A 3PZJA 4Y52H 5AG4A 2BOSA 3K81C 4P4JA 4OIWA 2WAQE 2L5TA 5DM63 2EY6A 2AKWB 2Z4HA 3D6CA 4NF1A 1SAPA 1HNXQ 3V38A 1WVLA 2MP1A 3AB9A 2O5JC 4HNWB 4U68A 4JV5Q 3TEHB 2F0TA 4M3SA 1M8AA 4NGTA 2RDHA 1X55A 1A63A 2REFA 4HMJA 3R9FA 3M7GA 2GA4B 1YMEA 3IFEA 3SI1A 2CQAA 1WJJA 4MXUA 1X12A 5C88A 4KHPQ 2OZUA 2JA6G 3PF4A 2CTCA 1S5DD 2F3IA 3K57A 4A3MH 2R7ZG 5J8FA 2R7DA 4RGOS 2Q2HA 4DV3L 4BINA 2VQEQ 4B9XA 2F0VA 4BWGB 2AFZA 4A3EB 1YEZA 3K7AH 4A3IG 3GIUA 4H6UA 3SVMA 3MAQA 3CMEA 3F8TA 5CGKA 2HUGA 5FK9C 4R3KA 2K5QA 3S1MH 1WD0A 3S1QB 3MTSA 1Y1VG 3TRZA 1CQFA 1SJHD 4HEDA 1YHQA 5M9OA 4K8JA 2EVBA 1GJXA 5C0XI 4WWVA 1LTGD 1HUNA 1VQJA 1OXTA 5A35A 1Y8NB 3JTKA 1GD7A 1TWHB 5IP7H 2SOBA 4AB7A 1PH5A 2JA9A 5G20A 2LMCB 5IYBG 2FMCA 5FO8B 5T1GA 4JI6L 1AE3A 2RC4A 1CTMA 1YZ6A 1BQQT 1J9OA 4CJ0B 1TF8A 2VUMG 4EGVA 1E0BA 3AFQA 1HNZQ 1EIFA 4AG7A 4CAWA 4A3DG 2UU9Q 1SYEA 2POKA 3PEIA 5CBMA 3V2TA 1UFHA 4M6IA 2CFMA 1ESFA 2R92B 3CHBD 3KL9A 5DWMA 3UE0A 5C3EG 4M85A 3BZCA 1KDAA 5CV9A 2RB7A 5IYBH 1BO4A 1VS0A 2A68D 2OCEA 1WYDA 3GTGB 1QUQB 5I6WA 3K8AA 4HNXB 4H02A 4OWTB 4ZI6A 3TO9A 4F7XA 5M5YB 1S5BD 3HOWH 5A28A 2XN9C 5IE8A 1AMPA 5FOBB 3FXTA 3MXGA 5IT9c 1HTLD 4DV0L 5C3EB 1GHJA 1I3QH 6CPAA 3BZKA 4BY1B 1HQMC 3D7HA 1M4VA 3RNZA 3VR6A 1CKNA 4L5QA 3ZYYX 5K36G 2X7BA 3M4OB 2VUMB 4L5SA 1M4DA 3TO6A 3BU2A 1Z4EA 1EQVA 2PDOA 3J7AF 4HAEA 1GXDC 2KECA 1VQKA 1YK3A 1ICWA 3QIAA 4C3JG 2E2IH 5JJLA 1YW6A 4KOTA 3R96A 1M1KC 2EYJA 1TWGH 1BCPD 3CCEA 2DY8A 2J0TD 4A3LG 5IV0A 1S5ED 4DV7L 4XXEA 2SEBD 2I5LX 1CI3M 1AP0A 4AVBA 2NB0A 4JVZA 3CD6A 1EWIA 2JA5G 4QCLA 1PH4A 4OXPA 2KBNA 2I46A 4IPHA 4Q5VA 2HB6A 2PJ4A 3HOWB 1J5EL 4IALA 4UEZA 1EOVA 2EYHA 2EPBA 4DR6Q 3B3VA 1N32L 3VARA 2CNSA 1NY4A 1V43A 4A3IB 4JI2Q 3BG3A 4A3EG 2ANPA 5J1ZA 4A3DH 1J5EQ 4ZK9B 1CPXA 4CRZB 2HC9A 2A69D 3L7ZC 2BDNA 5F47A 3JAMc 4N9TA 3SE0A 4LMQD 4KLVA 5EKIA 5KGUA 1ARLA 5LYLA 3H0GH 1D1KA 4OLLA 3V05A 3I56A 5ELCA 2NUCA 2Y0SG 1MHWC 3TP8A 3H8GA 2M00A 4KN4C 3NH8A 1D6EC 1SMYC 3K5NA 3SJFA 1LM0A 2R8VA 3SI0A 4ME3A 4KSIA 1PHJA 1DONA 4TNUA 4AG9A 4PNYA 4RI1A 1J6QA 4KY5A 1KAWA 1LTLA 2E75C 3I4MG 2BEIA 3RZDH 3KZWA 2EYPA 1BBWA 4R9MA 4FF4A 4DR3L 4GOPA 3J80L 1CP6A 4OONA 2Z0SA 4FNFA 2F4VL 4QC6A 2XSCA 3F2UA 2BA1A 3NHHA 4EX5A 1VQOA 4HCEA 3TZUA 2ZELA 2WFWA 1MJAA 4YHHQ 3ER0A 2AUKA 4QUSA 1YNJC 4JBKA 2UUAQ 4ZKBB 2ICEC 3ZJYC 3C46A 5ELFA 2I0QA 4BA1I 4HJ8A 3FKIB 4BY7B 3R9EA 2K14A 2E5LQ 1WTRA 4UAIA 1PTOF 4RGTA 2OH1A 2R1IA 4DUKA 2NN6G 4YRHA 5DWNA 3SI2A 1JOKA 1KIXA 2V77A 3ULPA 3P75A 3NE7A 1S4ZA 1TWGB 2MUYA 4DV0Q 5HVFA 3NSWA 4XPDB 3BVZA 3R3OA 4IPGA 2F0IA 1WOCA 2AFSA 4JG2A 5JJKA 5CV4A 3CCRA 1TKWB 3HKZG 5DNFA 4PK3A 4Y49C 2L55A 4A3MG 2AFOA 5IODA 3NELA 3H8EA 1HA5A 2B2VA 3RZOB 4KHVA 4RWSC 2DPTA 1WCMH 1AN8A 1XPRA 1HNXL 5LL6S 2PZUA 3KLSX 1SXTA 3HKSA 4DV6L 1EYGA 4FF1A 4XTCS 5HY6A 4C3IH 3NK9A 3G6EA 3MC0B 3A54A 2F0OA 4PZ6A 1R9TH 4AQYL 4DR4Q 1JORA 5J8CA 2HD3A 1L0XB 1F2PA 3N52A 1XMTA 3W91A 2VB2X 4QIWE 2XRSD 2YNCA 2VB3X 4B5OA 5FLXc 4BY7G 4F9VA 1MJCA 3P1HA 3TQYA 5ELNA 4MFJA 5AJ3L 2NYZD 3RN5A 1VMPA 3D4DA 1TWFH 1VGYA 2EBJA 1SYCA 4RHSA 4OC0A 2K5NA 3TFYA 4LFAQ 2QVPA 4NGNA 4MHPA 4FD5A 2NVTB 4C7HA 2OQKA 4FAIA 1JC7A 7CPAA 2DXQA 1VQ5A 2CVRA 4ONWA 3J80c 4JYAQ 4MFLA 4X3RA 1LO5D 4WJBA 1FVIA 1B9NA 3Q0AA 3J81i 1GUGA 1LV9A 2NZHA 2QMLA 2UXDL 4IURA 4M1UB 1MI2A 3KLSA 4UP9A 1B3QA 3BS1A 1M1DA 1XMQQ 3KFUA 1GO3E 2Z8LA 5C0XH 5BR8L 2PE3A 2RHSB 4NDXA 3I70A 4DK3C 1STHA 3D7DA 4K3NA 4AYBG 2QW7A 4DR5Q 2NSMA 1IOIA 2EJGC 3E0EA 4PQXA 5LHY1 4GLAC 4KOSA 5GADC 1B9MA 1XNRL 1MJBA 3EC4A 3CPWA 3FF3A 4A3EH 4X5KA 5DEHA 3EVQA 4KOXA 5CBAE 3T90A 1V1PA 1EZ6A 5I6YA 3JAML 2EY5A 4DK0A 4ZBGA 2JP1A 1BOSA 4AVCA 4Q0FA 1JJGA 4KZTA 2KCWA 1S72A 2ZW5A 1Z47A 2VEZA 2B29A 4OADA 4HPSA 5G21A 1BCPB 3VYUA 1NBWA 3SR1A 5FJ8G 1YNND 4CGOA 2BO9A 2F0EA 2JA7G 2YYZA 4FD4A 4JXQA 4XDXA 2VXKA 2XNAC 2HDLA 4G7ZC 4FWUA 2E2JH 3OMGA 1LACA 1DXMA 1F2MA 2B4DA 4R4CA 4BBSB 3P2FA 3T9YA 5BN4A 1IY7A 2EXZA 1S40A 3VWEA 4FXGC 1UE5A 2JA8H 3DWAA 1Q3LA 5HMNA 3VR3A 1QNKA 1CT1D 4LUVA 1IGBA 3KR4A 1FGUA 2Z3OA 2FXFA 3CC7A 3ZZIA 1PYTB 4C1NI 1EOTA 4R9WA 5HH1A 4DK1A 5D3IB 5M3MB 1A2ZA 2UUBL 4Z65A 1NE3A 1IBLQ 4CDEC 1P16A 1D8LA 3DNSA 1L1OA 3BDOA 3GTQB 4IUVA 3QNVA 4BY1H 2YGWA 1CG2A 5JJIA 5E4XA 3WWVA 2ZEOA 1STGA 3S2DH 1OBRA 1RTOA 2ZEPA 5E96A 1Q2YA 3I4OA 4GKKQ 3NH5A 2WB1G 1NR4A 4DV5L 4DR2L 4LUAA 3GTGH 2JYOA 1J8IA 3D8PA 4R6TA 3PGPA 2B2UA 3G3SA 1RL2A 1X3EA 1AFPA 2HIVA 5GAEC 4A3BG 1LTTD 1NJIC 3KOJA 1G2SA 4X66L 5HXDA 5LYFA 1S7NA 2ZW4A 5JPHA 1IIDA 1Y0RA 4E6IA 1VHSA 3GTJB 5CV5A 4CYQA 3SHPA 5HVGA 4LFCQ 3MN8A 2D4PA 2ASBA 4F6AA 4OX9Q 4G1PA 2Z6KA 1CA6A 3J81E 1UNSA 3GTOH 3EA6A 2NTTA 4A3BH 4B3SL 1Q90A 2Z10A 1CZWA 1X6OA 1DJRD 4C2MB 3FMCA 3L2NA 1HZCA 1B44D 1DOLA 1JCKB 5F2DA 4BBRG 1NUCA 2IHEA 1X9NA 1Z2LA 5FLMH 3R93A 4U5YA 1E22A 1ZG8A 1RJTA 2F0LA 3E9IA 5I4MA 1TF9A 5I4DA 4CGPA 3HKZE 2AQ1B 2K03A 5JM6A 1N36L 3K7AB 4CBVA 1FYCA 5LYIA 2REEA 4RCNA 3HOZH 4EMEA 4PXEA 3K9TA 4BMHA 1IW7C 4C2MH 1OXSC 2O4XA 4UCNA 3T4AC 4A3KG 3BXMA 1EY9A 3GTJH 3U9OA 4C2XA 1EYCA 1B6BA 4HN7A 4OHJA 3AMUA 4DXFA 4KD4A 2LXKA 1PH9A 4RKBA 4JZ0A 4OX9L 4MBUA 2N3SA 1PZKD 1ELMP 1YQEA 4LF9L 4IAVA 2PJ7A 3PO3G 4RS2A 2A6HC 3Q6SA 3AEVA 3MZ5A 4KLKA 4UP7A 1G51A 1LUZA 2I5MX 1HNWQ 5F09A 2VBQA 3I2ZA 2CWAA 4RKLA 4BD9A 1W6KA 1BPNA 1NMGA 1TT2A 4HSPA 2K5WA 4A94A 1AYEA 3GUXA 1DZ1A 3I4NH 4O2DA 1Z5RA 1IBLL 3BHXA 4OWXB 4IUPA 3SJXA 2BE5D 2B5GA 1O7YA 3OWEB 4AYBE 2VNUD 4R4TA 2J7ZA 5EPLA 1LANA 3W6SA 3J80i 1LTID 4H13C 2Q44A 4GKJQ 3S14B 5M3MH 1HJPA 1D5MC 4OELB 3T16A 1NMTA 3CPAA 4PMBA 3X3NA 1VQBA 4CGLA 4OP4A 5CR3A 1WCMB 3LWEA 3M7NA 1EY7A 4CJ2C 4YWKA 3P7JA 1STAA 3BI1A 2DEAA 2PVWA 1IKMA 5J22A 1EFID 2RVLA 4IN3A 2B4BA 4Q38A 1I4GA 2HIXA 4OIKA 2KHJA 2KENA 1I12A 1NSLA 1ICFB 2G0BA 1Y9KA 3DR8A 2NVQH 4A3LH 2B2YA 2B2WA 1EIYB 1XPUA 1T9HA 3KYHC 3FIXA 4MFZA 2C27A 4LWCA 3ERSX 4KD3A 1CJWA 3PV0A 4LUZA 4DR4L 5JPMC 1QZGA 5C4XH 2EIFA 4KSAA 4NGSA 1LAMA 1E1TA 4AYBB 5IWAL 1A6XA 4XPKA 2WZNA 2EXDA 4EQPA 1VF7A 4JCVE 3J81j 4BY7H 2NMTA 4MRIA 4B11A 2UXCQ 1LRZA 2JJQA 5JVG3 2QIRA 1Z6HA 4WJWA 3HOZB 1XF8A 5C6AA 1XJVA 2WUUA 4BBHA 4KN7C 3TDQA 1WTQA 2NTSA 5IB0A 1VQMA 2PZWA 2WB1E 2PJ1A 4KMUC 4MTNA 5E7NA 1ASYA 1ZEQX 3T1HL 2J8RA 2HQYA 5AGEA 1LT4D 1HXYD 3EROA 3SHLA 1SNQA 5D29A 4DNIA 3TOAA 4XQJA 5IYDH 2ODFA 1SEBD 2D0OA 1Q82C 2L0CA 1PV4A 4DR7L 4TRDA 4LF4L 1L1OC 4IFDH 1HNWL 1STNA 2JXMB 4UHVA 1PFNA 2B3VA 3OHXC 1Z9UA 3RYOA 4GM5A 1KAAA 2PJBA 5IYCG 4EVOA 1TKFA 2B63H 2Z3LA 4XYOA 4L6TB 2DJGC 4ZAIA 1DOMA 4A3DB 3FEEA 3W2DA 3KBXA 2ZTCA 4A3JH 1XMOQ 1SR3A 4I7ZC 5E1FA 2WPXA 4AQYQ 2MPMA 2LFNA 3C1EA 1RD9D 2E76C 4CYPA 4MHDA 1XTCD 1ASZA 3S2DB 4YCWA 1Y1WB 4B5PB 4IUTA 4X8IA 1SNPA 3GTQH 2P6GA 4A3GB 2EK9A 3A8KE 4TVAB 4ZX8A 4DFAA 3IEHA 4L63B 1PRTD 3S15H 1RF2D 3WC7A 4CYOA 1Y7EA 1G6PA 4DR1L 4IUQA 3UDGA 3JAMi 2E2HB 2B2TC 2F0JA 2VZAA 3TP5A 4LF7L 4GS4A 1KXLA 4OC5A 4PK2A 2YV5A 4XPLA 1K0SA 1FT7A 4YCVA 3J7A5 2Y0SE 2F0UA 2RHQB 3G6JB 5FLXL 4CGNA 4M6HA 4LF5L 1PYSB 5CV7A 2XIWA 4JOIC 4RG1A 2Z3MA 2C1CA 1KTKA 4BBSH 2O2LD 3VYRA 4HIOA 1IXRA 1SYDA 3I4LA 4MI4A 3S9NA 1BR9A 3WC6A 1GKHA 1HDQA 4KVOE 2KEDA 1DYQA 3F8KA 4BS9A 1HA6A 3PQIA 3PO2B 1SDFA 4FYDA 4LAAA 2HV2A 3MXNA 4JI0Q 2H5XA 4JI3L 1H9KA 4JI4Q 3WABA 1Q46A 3PO3B 2JLMA 3KF8B 3F5BA 4CYNA 2A5HA 2PPBC 4XYQA 4C7IA 5A27A 4DV7Q 2Q43A 3GQBA 1NMFA 3K9UA 4F88A 3H3VC 4A3KB 4MN3A 2H1EA 2F0HA 4HJAA 1CSQA 3S16H 3KHZA 4IPCA 1U4RA 1AZQA 2SDFA 4U9YA 1SMYD 3KJOA 1NTGA 1MBYA 2EYMA 1PTOB 1A2TA 2M9VA 3SEBA 3HLPA 1PH3A 4YCUA 3HZXA 2LY7A 4GN5A 2DNEA 5E3FA 2YTXA 1STEA 3TS2A 2PO4A 4IUSA 4UEEA 5EAYA 4B9WA 1V1QA 2RQXA 1F2OA 3HKZB 1PMRA 1S5KA 4QVTA 2V4DA 3A56A 2K28A 1XJOA 3H0GB 4P6YA 2PCFB 3S9LA 3OOCA 4IJHA 1PTOD 1SN8A 3LGJA 2ZPAA 2GVAA 4KHZA 1U4MA 1YNNC 1FNUA 1F9QA 3FX6A 3H09A 5GAGC 2G9HD 5C44H 3A8JE 4R87A 3IO1A 1KZFA 5E4WC 1SBBB 2WPWA 1HNZL 1HH2P 4IUUA 2P6EA 1YBYA 3NFZA 1K3BC 1JQYD 2IJZA 2HHHQ 1HPCA 4MTKA 5CC4A 1XNQQ 1O7ZA 3RAMA 3FKIG 2CNMA 3GV3A 1ET9A 4P71A 4QGUA 2L9HA 1B87A 3T56B 1QVCA 4HJ7A 2JEAI 4A30A 2DN8A 1F2YA 5LL6X 4A75A 4DR1Q 2B4DB 3K59A 4R8NA 2PR8A 3PRTA 2NN6I 1OXXK 1NAPA 1S3OA 2YTVA 2PRBA 3S15B 3NQIA 3QOLA 1UE7A 5D65A 5JEAJ 2Q51A 2Q4YA 1Q81C 4MHEA 3CQZB 1Q2DA 3IWGA 1R3NA 3LWUA 3RLFA 1K8MA 1X10A 2AJ6A 1HQRD 3PUWA 1S7KA 2BH2A 4BBSG 4KV6A 1RTNA 3KQXA 3TTHA 3U4VA 3KASA 5KEEA 5ISVA 2PJ6A 1ENAA 1NCVA 2PW7A 2K52A 1G91A 1H8LA 3G8WA 2I3CA 4JI5L 3O13A 2F8HA 2PI2E 3TSSA 1I3QB 2N88A 4GNXA 5C0XJ 1SYBA 4L5TA 2R98A 1M44A 5C4JB 4HIKA 2XVSA 3EN2A 4JLYA 4GNXC 2K04A 2ARHA 2JK8A 3S1NB 2G9DA 3Q24A 2F0WA 3DLLA 1BUVT 4JI1Q 3CC2A 3MGDA 3TN2A 4KY6A 3TMEA 3ULLA 1VQGA 4FD7A 4KOVA 5KNDA 2PJ9A 3BI0A 5C4HA 1Y1VB 1I21A 5K8OA 3VATA 3GP7A 3IFTA 3TO7A 2DJFC 5CMDA 1Y8PB 2YU9B 4IUNA 2A6EC 1HUMA 2PJ3A 4DYOA 3HOUG 4ZGYB 3NH4A 2EY2A 4ZRZA 2A4NA 2VQEL 4ZUJA 2IQ6A 2PC1A 5EBDA 1XMQL 1RCVD 1Y69U 4MHYA 1FD7D 4DUYL 2VXWA 1F77A 3M9BA 4B3RQ 1ZXTA 3SGIA 5ELDA 4P74A 4DNRB 1I6HH 3M4YA 3OIQA 3HP3A 3NBHB 5GQOA 2FVGA 2PQEA 2EY1A 3H15A 1GUOA 3KGQA 4F9UA 1I50H 3NTIA 2PVVA 4K2LA 3GB0A 1E3PA 1TY2A 2BA0A 2GIVA 4KUBA 2A68C 2B39A 3WDNA 1PFMA 3EY5A 2C35B 1Q8IA 1P8LA 3S6FA 1Y14B 1D5XC 5C5MA 4K30A 5JEAG 3D31A 2K6AA 4P44A 3S2HB 4NXNQ 2JA8G 1LFWA 3PFOA 4A3IH 2DNCA 2GREA 2OXPA 1BF4A 3I4NG 1Z8LA 3D2MA 2F0NA 4KSFA 5F48A 2V8GA 1RKNA 3MXNB 3FNCA 4JW0A 2AHOB 2ZXRA 4X62L 3DGVA 3PB9X 2B63G 4P75A 3SK4A 4PPZA 5EMIA 4Y7NB 1V9PA 1TU2B 2NVQB 2ZEDA 4HJ5A 3PGZA 4MY3A 1ONLA 4CGMA 3BJ8A 5A2QE 4P4FA 1TY0A 1MGSA 3EJIA 2EZVA 1CA5A 5CV6A 2EWBA 3KLRA 4DNCA 4IZ8A 3OWFA 1BCPF 4PV1C 3FBUA 1VQ9A 3TX8A 2WINB 3E6ZX 3FPUB 4QUCA 3HOUH 3SK8A 1VKCA 1UAPA 4E0AA 3AYHB 4EVYA 5CYUA 1H9JA 4OMEA 3CCQA 4DV6Q 5LMUL 5C44G 2UUCL 4M8AA 4UF4A 3FEWX 3K58A 3H91A 5AG5A 3D2PA 3STBC 3KUPA 5LMUQ 3ERQA 5CORA 2QEXA 3K6OA 2ZT9C 1LABA 4R7MA 1II3A 3WR7A 4LF8Q 4CJ1B 3KF6B 2P5ZX 1C7YA 3S6HA 2FSRA 2CKZB 2MO1A 4DAVA 3QG1A 2CTBA 4GXHA 1L0YB 1GHKA 1UWYA 3CT9A 3RD4A 2B63B 4Y7NH 4RFBA 4DR6L 2E2JB 3SXHA 4I49A 3J81c 2B3GA 4FXKC 1MKHA 4DU9A 4C68A 4RGNA 1EFWA 3G71A 4JI1L 4Y49B 1SE8A 2KUMA 1GOZA 1B50A 1CM0A 4KKSA 3MWYW 3QJYA 2PMZE 2OZHA 2JA6B 1A0IA 3CU7A 2ID0A 1SROA 1C8CA 2UXBQ 5C3XA 4JI7L 2IT1A 1VQAA 4X62Q 4YHHL 2O4HA 2XEGA 4GN4B 1SYFA 3F0AA 2RCNA 2L12A 5M3MG 5GCNA 2Q8TA 1A15A 3P20A 1YVCA 3NUCA 4CS0B 1PH2A 1ZLHA 3B6YA 2MGSA 4EFDA 4DUZQ 1WTXA 3PO2G 1IB1E 3M85A 4A31A 1EU4A 3OSOA 3QOJA 1EQQA 2AFMA 5KTAA 4YIJA 1VQ8A 1HDUA 5IGFA 5DAUA 4X65L 2KCCA 2PCUA 1S3ZA 4KTAA 3CCJA 2Z1CA 2P0WA 5EPJA 3QR8A 1FNOA 3VA5A 2IL8A 4IHMA 3UI2A 1E7ZA 5G22A 1N71A 3V8IA 2QECA 3K2KA 4NPSA 4B3RL 2JEBI 4C2YA 4B3SQ 1SNCA 1CK1A 2B2YC 4OO1I 1KNEA 3ITPA 2PRQA 3U58A 1TKJA 5HURA 2VQYA 4TKOB 3HG9A 1I5FA 3BZDB 2HQLA 4V0BA 4JI3Q 2IJ0A 3H8FA 2OZGA 5DS0A 1KUXA 4QL5A 1X3QA 1KHIA 4APVA 1Y1WG 1DE4C 3SJEA 4F8MA 1Q7YC 4O1NA 1VCIA 4OWWB 1VQIA 3L9AX 2B8GA 3D4RA 4JPBW 2MFIA 3HOWG 5LRGA 3PUZA 1U5KA 4X3SA 5FO7B 4R57A 2EOTA 3NPPA 3R2IA 2Z6BA 1YJNA 4KJNA 2LS01 1TXYA 1EEID 2ZJRA 4IQZA 3HOYG 1EWCA 1HR0Q 3CCVA 1AEXA 1JE5A 1ZKOA 4GOPB 4ONUA 3AQQA 3TREA 1XRYA 3B8GA 2R6GA 3DDDA 4FO2A 5FLMG 1MJEA 3CC4A 1SJED 1B70B 3PFEA 3A55A 5M5WH 4OGQC 4YFJA 2ZM6Q 1A2UA 2FMMA 4RCOA 1K8OA 1ON0A 3TE4A 2PR1A 4NJQA 3FHWA 2XWJB 3MXUA 2KHSA 2GE3A 3V96A 2K5DA 3OYYA 4R76A 3T8WA 3UE1A 1FGBD 4RHRA 5LYDA 1IOFA 2EO8A 3EO4A 1AE2A 1OXVA 3MFGA 4ILWA 1GHEA 1F2LA 1YJ9A 4WFN3 2Q04A 3L3OC 1BLLE 3CXPA 4X3UA 1ENCA 4JJXA 3FKIH 1BPMA 1H95A 4X66Q 5KIXA 2FIAA 5JEAH 3KI9A 4DPGA 1IL8A 1FR3A 5CV8A 5IOCA 3P2HA 4UIBA 3RZAA 4CRYB 2BSWA 5K8PA 3EIVA 3GTPH 5F49A 2YNDA 4A39A 2FJ2A 3B2YA 3GO5A 5I2XA 4NJRA 3HRZC 5DM73 1Q1BA 2ZTEA 3A7LA 1STYA 4U673 5ELBA 1WI5A 1PFBA 2UUCQ 4LF6L 4P10A 2JA7B 2EVNA 3RZDB 3MHBA 3IKJA 3VH9A 2A69C 1CP7A 3N5FA 4ID6A 1KRSA 4AH6A 4UY8C 2GANA 2QYVA 4KI0A 2ZEFA 3GTOB 3IJ3A 3U9SA 5IGBA 4B3TQ 1BNZA 2WIIB 4AIMA 3D8GA 2V8HA 2ZEGA 1Y1VH 3DHQA 1GVPA 3TZDA 1K0RA 2RBMA 2JE6I 4YY3L 1CQVA 1U4LA 4MCRA 3FPPA 4HTHA 4NW2A 1TWFB 1XEBA 2V1CC 4FF3A 1DCZA 3SK6A 4NGRA 1AUGA 3EFXD 3PO3H 2A74C 1HFNA 2NVTH 1SE3A 1IKLA 3W3AA 4JOIA 3GYAA 4JV5L 1Z7TA 3SK5A 2J4XA 4HCSA 5FLXE 4NXML 4LUOA 1QB5D 3D67A 4G7OC 1Q8KA 5LMNL 1D5ZC 3PO2H 1LT6D 1WTHA 1VHEA 1YR0A 3SXNA 4P4IA 1R9TB 2ENBA 2R3ZA 2PMZB 4XQQA 1Y0YA 1Y7RA 1YX0A 1CHQD 1XIXA 1SYGA 4C3IB 2D0PA 4KLWA 1K73C 2KQ3A 2Q2IA 1QMUA 4N9PA 5C0XG 2ZOFA 3GTLB 1JB7A 3OPOA 1TQOA 4HR7B 3RZOH 3UY5A 3GTKB 3PSIA 1WTWA 4P73A 2Y0SB 2I5HA 2A6ED 1FNWA 5A2QL 3W1BA 5C3WA 3FECA 3DUZA 4CKBA 5IX3A 3A7AB 3IGRA 1BOBA 4MHNA 1STBA 5I0CA 1T5XD 3G4SA 2VZZA 4MFQA 3FDTA 2Z3NA 2WYRA 1DGSA 4A3GH 1ZO0A 3OW7A 4UFXA 1ILQA 2PNRC 4WRDA 3UDXA 2AQ2B 2FIWA 1LLRD 3HGBA 2OF1A 2EE1A 5LMNW 2EJFC 5LRKA 4KOUA 4MHZA 1ZYRD 3WT4A 4NFRA 4NP5A 1Y8OB 3MA2B 4NKLA 1LOKA 3GY9A 3CAMA 2FE7A 2CNTA 1PYBA 1WFQA 4J1MA 2JA5B 5ELYA 3EBEA 1SFOB 4KJOA 4V190 2JDDA 1WD1A 2KHIA 2A19A 1K8AC 5C44B 3KK7A 2D5DA 1Z9FA 2X6GA 4KOYA 1YI2A 1EYDA 2Z11A 2AFWA 3BJUA 4A3JG 4C3JB 1QSNA 1Q2CA 1NE9A 4X64Q 2IX1A 1R57A 2CW0D 4P4EA 4ZY0A 4CDDC 3T1YL 1QILA 1IYLA 5KNBA 3CCLA 3IC1A 1QG7A 1YJWA 4ZX9A 4B5PA 1U0LA 2AE6A 3F2DA 2D4OA 1AH9A 2OB0A 4XQNA 1Z4RA 2QCPX 4DGZA 1S60A 2O28A 3TBIB 3MEFA 1I4RA 4MCSA 4ME5A 2NBFA 1PXUA 1JWSD 2B2TA 5EC4A 5JH9A 4KVME 4C3JH 1YSJA 5K8MA 3QB3A 3U4ZA 2WB1B 1T5EA 4K5XA 2R92G 4JI2L 3KR5A 1YITA 1XYIA 5EBVA 4ABNA 3DM1A 3JAME 3TP6A 4A38A 1VIXA 1F9PA 3CF5A 1HTPA 2Q8IB 4RA8A 4B3TL 2B3UA 4JI5Q 4MFKA 4QIWB 3PF5A 2VL1A 4P45A 1B4OA 3VA7A 4KVXA 1I6VC 2R61A 1YLOA 1IHZA 3A9LA 2J8NA 3R95A 1V1OA 1K4JA 3NWSA 4NEXA 4NB3A 4HNYB 4X2TA 1L1OB 4IFDG 1O80A 1P4NA 5ELEA 2OWOA 3K80C 1UEAB 4PZ7A 4C3HB 4OC4A 3FVLA 4AXVA 1YLEA 5IT9L 1QOHA 1XNQL 3IU1A 4MZ9A 2TSSA 1H9RA 1F9RA 3NXWA 5HGTA 4K6DA 3HOYB 5BN3A 2BOAA 3D4WA 2E2IB 5FO9B 2TMPA 2WAQG 2GU2A 3VYTA 2PYKA 3CXCA 3DEOA 2ALYB 3E0KA 5ELOA 3CRKC 2VUMH 1YREA 4IOCA 5JJZA 2HT1A 1PLFA 1LTSD 1J4JA 2L1BA 1GUTA 4OKOA 4DV2L 5IGGA 4UIAA 4YWYA 4PMCA 2C6PA 2E2HH 1KUVA 2J8MA 2PQ8A 3D6WA 1K83H 1TIID 2RFHA 2UUBQ 5I9OA 1JE4A 1EWHA 1SMXA 2K4KA 4PSXA 3SDZA 3LD2A 4R4QA 5K36H 1Y1WH 1BAVA 2PZTA 4DK6C 1NSNS 1F9SA 5KRUA 2LXJA 2OTJA 2QEJC 4OC3A 3GKRA 4GN3B 1VQEA 1M90C 5IIFA 2R92H 2QJ8A 2SNSA 1HZAA 1SNOA 3NP8A 1R43A 3LACA 2NZOA 1FJGL 1IW7D 3KF8A 4GLVB 1JMCA 1DM0B 5ISRA 1N34L 5D3DA 3PB6X 1TKHA 4K6LA 3PUXA 3D0FA 4OL7A 5M3FB 2GLFA 4UFWA 3IFDA 4DN4M 1VQCA 1H9MA 3BDCA 2O53A 1YHBA 4CAFA 1QSTA 4HMIA 3QB8A 2A6HD 3DM3A 3D3RA 2CQOA 1X3PA 4JI4L 1PDQA 2FINB 2NVYB 3J7YW 2B2VC 1PU9A 4DV5Q 4DR2Q 3TCVA 3RLNA 1VF5C 2JEVA 2B2UC 1MJ9A 3S9WA 1DTDA 2Q2UA 1B2TA 2DF5A 2F5IA 4O0AA 2YTYA 1VQNA 2Z6KC 1JOQA 1L2FA 4N8FA 1JJ2A 4HIDA 4LF7Q 3RNUA 1L0CA 2H5MA 1TWCH 3M4PA 1IL2A 4KKUA 2A1AA 3N7ZA 3QO2A 1G8ZD 1NR2A 4BBRB 1JQGA 1EEFD 1V1PB 3D7FA 4UWJA 1SNDA 2RF4A 4YWLA 4JI6Q 4FD6A 4P2CB 4R8FA 1QSRA 5IP7G 5C5LA 4DV1L 3OWCA 2N55A 1SE4A 1E2WA 2WP8J 2MO0A 5T1IA 2WKDA 1VMCA 1TVXA 4K14A 3LMSA 3NWTA 1SFOH 3G7LA 3WOFA 3B3WA 1CX8A 3GD7A 4JBJA 3PIPA 4DV4L 4GS3A 3E0JA 2QDLA 1HZBA 4MIUA 2RDFA 3K0XA 1NSAA 1EY4A 1JWUD 2K50A 1HR0W 4EQ5A 5H86A 5IP9H 1RTQA 2R93B 5AJ3Q 1K8GA 2EUIA 4P4BA 1H9SA 4CKCA 2PJ2A 4PZ8A 5D14A 2F0KA 1C0AA 2EQSA 2ZW7A 4A3CG 1FL0A 1E1OA 3HUVA 1KDBA 1BXTA 5AFWA 2YNCC 2ZTDA 2Y0MA 4H7BA 3H3VH 2ZXPA 1IBML 1X3GA 5G1ZA 4KHPL 2JDCA 5M5WB 2FFKB 5F46A 3BVMA 4DA2A 1D1IA 2I79A 4B14A 4DR5L 3X3MA 2F0SA 2B58A 2Q4ZA 2MQHA 4B3MQ 4GOPC 3GV6A 5BR8Q 4HJ9A 1AZPA 2K1BA 3S14H 3W6XA 3FB3A 4DJLA 3IU2A 2ATRA 2HDMA 2R7ZH 3PCOB 5J3BA 3C26A 1XE4A 3C3LA 1ARMA 3BYYB 1X56A 4R4OA 4HIMA 2F3VA
chains in the Genus database with same CATH topology
4G4KA 4ZLTF 4MCPA 3WC5A 2JA8B 3R2TA 3IAYA 4WORA 2EK8A 4F87A 1XFOA 3NBIA 4QMGA 3KHXA 4ZQ3A 2ABZA 1EIGA 1V8QA 1WTVA 3KQZA 3PBBA 5HVHA 4OIJA 2PJCA 1BDOA 1XMBA 4H44C 2B8FA 2V8DA 3PUVA 1S5FD 4FBEA 2RKSA 3S1MB 1YNJD 3OMCA 5JPNC 4IFDJ 1ESRA 2C6GA 4I65A 3N6RA 4HSVA 2XWBB 3DLJA 2Q8RE 2ZOGA 4ZY1A 2BDOA 1TS5A 5JOBA 2AWOA 4KK7A 3DEPA 1E2ZA 5KYIA 4K5VA 1EY0A 4NMZA 1DOKA 2QDBA 1EL0A 1ZG7A 3D4UA 2F7VA 1TXRA 1KWMA 8CPAA 2F0PA 5G3LD 2F1MA 4CPAA 4PQAA 5IB9A 4QB4A 4J8QA 4OIDA 1CZGA 3HS0C 1E2VA 5J1QA 1ELLP 3CDXA 3Q22A 3PUYA 2WKCA 4PXCA 3I72A 2K05A 4TWEA 4W9YA 4JBWA 1JB3A 5IGCA 4ZYSA 2F0MA 3CKIB 3DWQA 1TWAB 4P4DA 3VR4A 1ZYRC 3CPXA 1LT3D 3DWPA 4C56C 2NWGA 5EJWA 3J80E 2JBKA 5COYA 1ML0D 2MHVA 3OIPA 4UEFA 4DF7A 1U4PA 5K8NA 4Z9CB 3I8ZA 2XEJA 4EQNA 2RDGA 5KNCA 3ND8A 3VR2A 4C3IG 1C4QA 5NUCA 2IMOA 1GUSA 3PB4X 3MRUA 3FH4A 3GLJA 1QJOA 1ILPA 2C6CA 1B1ZA 1HRJA 4XT1B 4G57A 4XIGS 1I50B 1QE6A 2D9UA 3VYSA 1TWCB 2XEFA 2ZEEA 3D68A 2OOTA 2H4OA 4IK2A 2IX0A 2D62A 2ICIA 3K5LA 4K5WA 3CRLC 1B3AA 2AQ3B 5I9PA 4FP5D 4OC2A 3RMHA 4EWTA 3V7ZA 4IFDI 1G2TA 1GUWA 3K5OA 1I4HA 3NBHA 2B2WC 5BN5A 1QWYA 3DXJC 4Q7AA 1H9SB 2EYLA 5IT9E 2PIZA 2MJ8A 4DAPA 1UUPA 1Q1EA 1SE2A 4FF2A 3NTKA 1BO0A 2PJ0A 1ET6A 4X3KA 4RH6A 3QWNA 1S5CD 1K83B 4FXDA 2CF4A 3MXPA 1TS4A 4CGYB 1PZJD 2KOLA 3WOEA 2EYOA 1EIHA 1SSOA 3C2PA 2KA7A 3T13A 1Q12A 1HCZA 4DAYA 2KEEA 3I73A 1RHPA 4RGMA 4NGMA 1JICA 1LT5D 3BYTB 3A8IE 3K0YA 5FKAC 1JR0D 1O7LA 1PCAA 3B3CA 5D8NA 4L8JA 2XEIA 3PIO3 3PBEA 2F0GA 2K32A 2KCNA 4K2KA 5KYLA 2WACA 3IIBA 1F57A 4UDUC 4EQOA 2RSOA 1G6ZA 1LTAD 2OR4A 3C1FA 1EZ8A 1WTPA 1B53A 1TS3A 2X6LA 1PTOH 3HEJA 1HFGA 3PIP3 1QCBD 4F8ZA 4A3FB 1LTRD 4R8IA 3BDLA 5JAVA 3B3SA 3LNNA 2C5CA 2PIYA 1D2BA 2J9AA 1G291 3NA6A 3NE5B 3GTMB 2O5IC 2EDGA 2BCOA 3PB8X 3URYA 2EJMA 1EY6A 1PZID 5I2YA 2QILA 4H0LC 3VR5A 2K01A 1VHOA 5THWA 2KVMA 2F3WA 1LTBD 2NZ1D 2F03A 1F2ZA 1A3TA 2IWHA 2PJ8A 4A37A 1OXUA 2DY7A 3FRPB 5K5PA 1ZLIA 4JYWA 4NGQA 5CPAA 1XX8A 4CHTB 1BBXC 4J6HA 2C9OA 1XXGA 4ZY2A 2PJ5A 3BVGA 2ZXOA 1R4PB 3LX0A 2QKIC 3FJUA 1CHPD 1CBXA 3I91A 3KBGA 3PMFA 2L11A 2M2LA 2JBJA 4CKEA 1GUNA 1JWMD 5G3LF 2JSOA 3ISXA 1KDCA 4ZUIA 2XRQD 4KY7A 5EBCA 3B3TA 1HHVA 1KLGD 2F0FA 1GYTA 4B08A 2PJAA 3MFYA 1A3VA 1PYWD 4A3JB 1R4QB 4S3SA 4KKTA 1IYVA 1I4XA 2FHTA 3R8BA 3JRUA 1XWEA 4G7HC 1TR5A 3S17B 4OC1A 3S9MA 3PB7X 1Q7LA 4PXBA 1MSGA 4DNTB 1KABA 1A3UA 1EYAA 2KJXA 1JOOA 1YW4A 3S16B 1EU3A 1OO9B 4A93B 1EY8A 1QQ9A 2WV6D 2A73B 2D2CC 3FEDA 3GTPB 1X32A 3NTHA 1PRTB 2ZEMA 2E2DC 4A3BB 4PXDA 3MEHA 3HOVB 3MVVA 5EKLA 5LRJA 3J7AV 4FVMA 2F0DA 2QF7A 3K5MA 3IWWA 4ZKCB 2CHBD 1CFMA 2PW5A 3ND9A 4LJZC 3S1RB 3J81L 1LCPA 1QNUA 2F4IA 4K8IA 3TC8A 3AU7A 3I4MB 2IPKD 5TSSA 2LKVA 3TP7A 4DXGA 5C4XB 4LQGA 4X3TA 2ZENA 1HEEA 3D7GA 1U9RA 1FNVA 1PRTF 3E5SA 5CBEE 5JVH3 2SNMA 1IYUA 1MSHA 2E74C 1LAPA 2L4NA 2IW3A 1ENFA 3RUZA 2K33A 3H94A 2AFUA 2HQEA 3HOUB 3I90A 1PTOC 1TS2A 2NYQA 1RDPD 3ISZA 3Q23A 1SNMA 3IL8A 4JK1C 3B7IA 2K7VA 2WAQB 5EQ0A 4NGPA 2AFXA 1O78A 4TQUS 1I4QA 3D66A 4MMOA 4BA2I 3M3YB 4C3HG 3T53B 2OT2A 2JEWA 1WTOA 2OEOA 5IGEA 2ZEHA 1RODA 5M5XB 4O42A 3I3CA 2I07B 4YU9A 5EPKA 1CM9A 2AUJD 4O23A 1W6JA 1CPSA 2GLJA 1ZG9A 5JGFA 1XBUA 5EGTA 2RA4A 2NN6H 4LK1C 2CIJA 4PMWA 1I6HB 1EQTA 1MD2D 5EKKA 4C1NK 3HOXB 4QF4A 3T51B 4QUFA 4ZYQA 1EE3P 4MCQA 3H6MA 2IX3A 1EY5A 2NVXB 3RBUA 4A3MB 2V8VA 4OO1H 2Z4IA 1AW7A 3EQLC 2EYFA 3SJGA 3NQTA 2RSNA 1I4PA 3I1UA 2HCCA 3FVQA 4FUUA 1PRTC 5J39A 1VDZA 2R7ZB 4OO1G 4ODGA 4TSSA 3ONAB 5C4ZA 1M4LA 4RAUC 2BE5C 4B6ZA 2HCIA 1C48A 5IGDA 1DD2A 2X69A 4RUHA 3DMUA 1KLUD 3B35A 4H2KA 2CW0C 4ULLA 1KNAA 4GZYC 2AWNA 1BCPC 2F0QA 3I4NB 4XT3B 2BOSA 4P4JA 4OIWA 2L5TA 5DM63 2EY6A 2Z4HA 3D6CA 1SAPA 3V38A 1WVLA 2MP1A 3AB9A 2O5JC 4U68A 2F0TA 1M8AA 4NGTA 2RDHA 4HMJA 3M7GA 2GA4B 1YMEA 3IFEA 3SI1A 2CQAA 4MXUA 2CTCA 1S5DD 3K57A 4RGOS 4B9XA 2F0VA 4BWGB 2AFZA 4A3EB 3SVMA 3MAQA 5CGKA 2HUGA 5FK9C 2K5QA 1WD0A 3S1QB 3MTSA 1CQFA 1SJHD 4HEDA 5M9OA 4K8JA 2EVBA 1GJXA 5C0XI 4WWVA 1LTGD 1HUNA 1OXTA 5A35A 1Y8NB 1TWHB 2SOBA 2LMCB 2FMCA 5FO8B 5T1GA 1CTMA 1BQQT 1J9OA 4CJ0B 1TF8A 4EGVA 1E0BA 1SYEA 2POKA 3PEIA 5CBMA 3V2TA 1ESFA 2R92B 3CHBD 3KL9A 1KDAA 5CV9A 2RB7A 2A68D 3GTGB 5I6WA 4ZI6A 4F7XA 5M5YB 1S5BD 2XN9C 1AMPA 5FOBB 3MXGA 1HTLD 5C3EB 1GHJA 6CPAA 4BY1B 1HQMC 3D7HA 1M4VA 3VR6A 3ZYYX 5K36G 3M4OB 2VUMB 1EQVA 3J7AF 1GXDC 2KECA 4HAEA 1ICWA 3QIAA 4C3JG 1YW6A 2EYJA 1BCPD 2DY8A 2J0TD 1S5ED 4XXEA 2SEBD 1CI3M 1AP0A 2NB0A 4QCLA 2I46A 4Q5VA 2HB6A 2PJ4A 3HOWB 4IALA 4UEZA 2EYHA 2EPBA 3B3VA 3VARA 1V43A 4A3IB 3BG3A 2ANPA 5J1ZA 4ZK9B 1CPXA 2HC9A 2A69D 3L7ZC 2BDNA 4N9TA 3SE0A 4LMQD 5EKIA 5KGUA 1ARLA 5LYLA 1D1KA 3V05A 5ELCA 2NUCA 3TP8A 3H8GA 2M00A 4KN4C 3NH8A 1D6EC 1SMYC 3K5NA 3SJFA 3SI0A 4KSIA 1DONA 4TNUA 4PNYA 4KY5A 2E75C 3KZWA 2EYPA 4FF4A 3J80L 1CP6A 4FNFA 2XSCA 3F2UA 2BA1A 3NHHA 4HCEA 3TZUA 2ZELA 2AUKA 1YNJC 4ZKBB 2ICEC 3C46A 5ELFA 4BA1I 3FKIB 4BY7B 1WTRA 4UAIA 1PTOF 4RGTA 4DUKA 2NN6G 3SI2A 1JOKA 2V77A 3P75A 1S4ZA 1TWGB 2MUYA 5HVFA 3NSWA 3BVZA 3R3OA 2F0IA 2AFSA 5CV4A 1TKWB 5DNFA 2L55A 2AFOA 5IODA 3H8EA 1HA5A 2B2VA 3RZOB 4KHVA 4RWSC 1AN8A 5LL6S 2PZUA 3KLSX 1SXTA 4FF1A 4XTCS 3NK9A 3MC0B 3A54A 2F0OA 1JORA 1L0XB 1F2PA 3N52A 2VB2X 2XRSD 2VB3X 4F9VA 3P1HA 2NYZD 1VMPA 3D4DA 1VGYA 1SYCA 4RHSA 4OC0A 2QVPA 4NGNA 4MHPA 2NVTB 4FAIA 1JC7A 7CPAA 2CVRA 4ONWA 4X3RA 1LO5D 4WJBA 1B9NA 3Q0AA 1GUGA 1LV9A 4IURA 4M1UB 1MI2A 3KLSA 3BS1A 2Z8LA 5C0XH 2PE3A 3I70A 4NDXA 1STHA 3D7DA 4K3NA 2NSMA 2EJGC 4PQXA 5LHY1 1B9MA 5DEHA 3EVQA 5CBAE 1V1PA 1EZ6A 5I6YA 3JAML 2EY5A 4DK0A 2JP1A 1BOSA 4Q0FA 1Z47A 1BCPB 3VYUA 3SR1A 1YNND 2BO9A 2F0EA 2YYZA 4XDXA 2XNAC 2HDLA 4G7ZC 4FWUA 3OMGA 1LACA 1DXMA 1F2MA 4BBSB 5BN4A 1IY7A 2EXZA 4FXGC 3DWAA 1Q3LA 3VR3A 1QNKA 1CT1D 1IGBA 3KR4A 1PYTB 4C1NI 1EOTA 4R9WA 4DK1A 5D3IB 5M3MB 4Z65A 3BDOA 3GTQB 4IUVA 3QNVA 1CG2A 5E4XA 2ZEOA 1STGA 1OBRA 1RTOA 2ZEPA 3NH5A 1NR4A 2JYOA 1J8IA 4R6TA 2B2UA 1AFPA 1LTTD 1G2SA 5HXDA 5LYFA 1Y0RA 4E6IA 3GTJB 5CV5A 5HVGA 3MN8A 4G1PA 1CA6A 3J81E 1UNSA 3EA6A 2NTTA 1Q90A 1CZWA 4C2MB 1DJRD 3L2NA 3FMCA 1B44D 1DOLA 1JCKB 5F2DA 1NUCA 1Z2LA 3R93A 1ZG8A 1RJTA 2F0LA 5I4MA 1TF9A 5I4DA 2AQ1B 2K03A 5JM6A 3K7AB 4CBVA 1FYCA 5LYIA 4RCNA 4EMEA 4PXEA 3K9TA 1IW7C 1OXSC 2O4XA 3T4AC 3BXMA 1EY9A 3U9OA 1EYCA 4HN7A 4OHJA 3AMUA 4DXFA 4KD4A 4RKBA 4JZ0A 1PZKD 1ELMP 4IAVA 2PJ7A 2A6HC 3Q6SA 3MZ5A 5F09A 4RKLA 4BD9A 1W6KA 1BPNA 1TT2A 4HSPA 2K5WA 4A94A 1AYEA 3GUXA 1DZ1A 1Z5RA 3BHXA 4IUPA 3SJXA 2BE5D 1O7YA 3OWEB 2VNUD 1LANA 2J7ZA 5EPLA 1LTID 4H13C 3S14B 1D5MC 3T16A 3CPAA 4PMBA 3X3NA 4OP4A 5CR3A 1WCMB 3LWEA 3M7NA 1EY7A 4CJ2C 3P7JA 1STAA 3BI1A 2DEAA 2PVWA 1IKMA 5J22A 1EFID 2RVLA 4IN3A 1I4GA 4OIKA 2B2YA 2B2WA 4KD3A 3PV0A 5JPMC 4NGSA 1LAMA 4AYBB 1A6XA 2WZNA 4EQPA 1VF7A 4MRIA 5JVG3 1Z6HA 4WJWA 3HOZB 5C6AA 4KN7C 3TDQA 1WTQA 2NTSA 2PZWA 2PJ1A 4KMUC 1ZEQX 1LT4D 1HXYD 3EROA 3SHLA 1SNQA 5D29A 4XQJA 1SEBD 2L0CA 4TRDA 4IFDH 1STNA 2JXMB 1PFNA 3OHXC 4GM5A 1KAAA 2PJBA 4EVOA 1TKFA 4XYOA 4L6TB 4ZAIA 1DOMA 4A3DB 3FEEA 3W2DA 3KBXA 5E1FA 4I7ZC 2MPMA 2LFNA 3C1EA 1RD9D 2E76C 1XTCD 3S2DB 1Y1WB 4IUTA 4X8IA 1SNPA 4A3GB 2EK9A 3A8KE 4ZX8A 4DFAA 3IEHA 4L63B 1PRTD 1RF2D 3WC7A 1Y7EA 4IUQA 2E2HB 2B2TC 2F0JA 3TP5A 4OC5A 1FT7A 5FLXL 2F0UA 3G6JB 5CV7A 2XIWA 2C1CA 1KTKA 2O2LD 3VYRA 1SYDA 3I4LA 3S9NA 1BR9A 3WC6A 1HDQA 2KEDA 1DYQA 4BS9A 1HA6A 3PO2B 1SDFA 4FYDA 4LAAA 3MXNA 1H9KA 3WABA 3PO3B 2A5HA 2PPBC 4XYQA 2Q43A 3GQBA 4F88A 3H3VC 4A3KB 4MN3A 2H1EA 2F0HA 3KHZA 1U4RA 1AZQA 2SDFA 1SMYD 1MBYA 2EYMA 1PTOB 1A2TA 2M9VA 3SEBA 3HLPA 3HZXA 2LY7A 2DNEA 5E3FA 1STEA 2PO4A 4UEEA 4B9WA 2RQXA 1F2OA 3HKZB 1PMRA 2V4DA 3A56A 2K28A 1XJOA 3H0GB 4P6YA 2PCFB 3S9LA 3OOCA 1PTOD 4KHZA 1U4MA 1YNNC 1FNUA 1F9QA 3FX6A 3H09A 2G9HD 3A8JE 3IO1A 5E4WC 1SBBB 4IUUA 3NFZA 1JQYD 2IJZA 1HPCA 5CC4A 3RAMA 1O7ZA 3GV3A 1ET9A 2L9HA 3T56B 2JEAI 2DN8A 1F2YA 5LL6X 3K59A 4R8NA 3PRTA 2NN6I 1OXXK 1NAPA 3S15B 3NQIA 3QOLA 5JEAJ 5D65A 2Q51A 4MHEA 3CQZB 1R3NA 3LWUA 3RLFA 1K8MA 1HQRD 3PUWA 3KQXA 4KV6A 1RTNA 3KASA 5KEEA 2PJ6A 1ENAA 1NCVA 2PW7A 1H8LA 1G91A 2I3CA 2F8HA 3O13A 3TSSA 1I3QB 2N88A 5C0XJ 1SYBA 5C4JB 2XVSA 2K04A 3S1NB 2G9DA 3Q24A 2F0WA 1BUVT 3TN2A 4KY6A 3TMEA 5KNDA 2PJ9A 3BI0A 5C4HA 1Y1VB 5K8OA 3VATA 3GP7A 3IFTA 5CMDA 1Y8PB 2YU9B 4IUNA 2A6EC 1HUMA 2PJ3A 4DYOA 3NH4A 2EY2A 4ZRZA 4ZUJA 2IQ6A 5EBDA 1RCVD 1Y69U 4MHYA 1FD7D 2VXWA 1F77A 3FF3A 1ZXTA 4DNRB 5ELDA 3M4YA 3OIQA 3HP3A 2FVGA 2PQEA 2EY1A 1GUOA 3KGQA 4F9UA 3NTIA 2PVVA 4K2LA 3GB0A 1TY2A 2BA0A 2A68C 2B39A 3WDNA 1PFMA 1Q8IA 1D5XC 5C5MA 5JEAG 3D31A 2K6AA 4P44A 3S2HB 1LFWA 3PFOA 2DNCA 2GREA 2OXPA 1BF4A 1Z8LA 2F0NA 2V8GA 1RKNA 2ZXRA 3DGVA 3PB9X 3SK4A 4PPZA 4Y7NB 1TU2B 2NVQB 2ZEDA 1ONLA 5A2QE 4P4FA 1TY0A 1MGSA 3EJIA 2EZVA 1CA5A 5CV6A 2EWBA 3KLRA 4IZ8A 3OWFA 1BCPF 4PV1C 3TX8A 2WINB 3E6ZX 3FPUB 4QUCA 3SK8A 1UAPA 5CYUA 1H9JA 4OMEA 4M8AA 4UF4A 3FEWX 3K58A 3H91A 3KUPA 3ERQA 5CORA 3K6OA 2ZT9C 1LABA 4R7MA 1II3A 4CJ1B 4DAVA 3QG1A 2CTBA 1L0YB 1GHKA 1UWYA 3CT9A 3RD4A 2B63B 4RFBA 2E2JB 3SXHA 4FXKC 4DU9A 4RGNA 2KUMA 1GOZA 1B50A 4KKSA 3MWYW 3QJYA 2JA6B 3CU7A 2ID0A 1C8CA 5C3XA 2IT1A 2XEGA 2O4HA 1SYFA 2L12A 2Q8TA 1A15A 3P20A 3NUCA 1ZLHA 2MGSA 4EFDA 1WTXA 3M85A 1EU4A 3OSOA 3QOJA 2AFMA 4YIJA 1HDUA 5IGFA 5DAUA 2KCCA 2PCUA 4KTAA 2Z1CA 5EPJA 1FNOA 3VA5A 2IL8A 4IHMA 3UI2A 3K2KA 2JEBI 1SNCA 1CK1A 2B2YC 4OO1I 1KNEA 3ITPA 2PRQA 1TKJA 5HURA 4TKOB 3HG9A 3BZDB 4V0BA 3H8FA 2IJ0A 5DS0A 1X3QA 1DE4C 3SJEA 4F8MA 4O1NA 1VCIA 3L9AX 2B8GA 3D4RA 5LRGA 3PUZA 4X3SA 5FO7B 2EOTA 3NPPA 3R2IA 4KJNA 2LS01 1EEID 4IQZA 1EWCA 1AEXA 1ZKOA 1XRYA 2R6GA 4FO2A 1SJED 3PFEA 3A55A 4OGQC 1A2UA 2FMMA 4RCOA 1K8OA 4NJQA 2XWJB 3MXUA 2KHSA 3V96A 2K5DA 4R76A 3T8WA 1FGBD 4RHRA 5LYDA 1OXVA 3MFGA 4ILWA 1F2LA 4WFN3 3L3OC 1BLLE 4X3UA 1ENCA 1BPMA 5KIXA 5JEAH 3KI9A 1IL8A 1FR3A 5CV8A 5IOCA 4UIBA 3RZAA 5K8PA 4A39A 2FJ2A 3B2YA 3GO5A 5I2XA 4NJRA 3HRZC 5DM73 1Q1BA 3A7LA 1STYA 4U673 5ELBA 1PFBA 4P10A 2JA7B 3RZDB 3MHBA 3IKJA 3VH9A 2A69C 1CP7A 3N5FA 4ID6A 2QYVA 4KI0A 2ZEFA 3GTOB 3IJ3A 3U9SA 5IGBA 1BNZA 2WIIB 2V8HA 3D8GA 2ZEGA 3DHQA 3TZDA 2RBMA 2JE6I 1CQVA 1U4LA 4MCRA 3FPPA 4HTHA 4NW2A 1TWFB 4FF3A 1DCZA 3SK6A 4NGRA 3EFXD 2A74C 1HFNA 1SE3A 1IKLA 3W3AA 1Z7TA 3SK5A 2J4XA 4HCSA 5FLXE 1QB5D 3D67A 4G7OC 1D5ZC 1LT6D 1VHEA 4P4IA 1R9TB 2ENBA 2R3ZA 2PMZB 4XQQA 1Y0YA 1CHQD 1SYGA 4C3IB 2KQ3A 1QMUA 4N9PA 5C0XG 2ZOFA 3GTLB 3OPOA 1TQOA 4HR7B 3GTKB 1WTWA 2Y0SB 2A6ED 1FNWA 5A2QL 5C3WA 3FECA 3DUZA 4CKBA 3A7AB 4MHNA 1STBA 1T5XD 3FDTA 2WYRA 3OW7A 1ILQA 2PNRC 4WRDA 2AQ2B 1LLRD 3HGBA 2OF1A 2EE1A 5LRKA 2EJFC 4MHZA 1ZYRD 3WT4A 4NFRA 4NP5A 1Y8OB 3MA2B 4NKLA 1LOKA 4J1MA 2JA5B 5ELYA 1SFOB 4KJOA 4V190 1WD1A 5C44B 3KK7A 2D5DA 2X6GA 1EYDA 2AFWA 4C3JB 2IX1A 2CW0D 4P4EA 4ZY0A 1QILA 5KNBA 3IC1A 1QG7A 4ZX9A 4XQNA 2QCPX 4DGZA 3TBIB 1I4RA 4MCSA 4ME5A 2NBFA 1PXUA 1JWSD 2B2TA 5JH9A 1YSJA 5K8MA 3QB3A 2WB1B 1T5EA 4K5XA 3KR5A 1XYIA 4ABNA 3DM1A 3JAME 3TP6A 4A38A 1VIXA 1F9PA 1HTPA 2Q8IB 4RA8A 4QIWB 2VL1A 4P45A 1B4OA 3VA7A 1I6VC 2R61A 1YLOA 1IHZA 1V1OA 3NWSA 4X2TA 4IFDG 1O80A 5ELEA 4OC4A 1UEAB 4C3HB 3FVLA 4AXVA 5IT9L 1QOHA 2TSSA 3HOYB 1H9RA 1F9RA 5HGTA 3NXWA 4K6DA 5BN3A 2BOAA 3D4WA 2E2IB 5FO9B 2TMPA 2GU2A 3VYTA 2PYKA 3DEOA 3CRKC 5JJZA 1PLFA 1LTSD 2L1BA 1GUTA 4OKOA 4UIAA 5IGGA 4YWYA 4PMCA 2C6PA 3D6WA 1TIID 2RFHA 5I9OA 1JE4A 1EWHA 3SDZA 5K36H 1BAVA 2PZTA 1NSNS 1F9SA 5KRUA 2QEJC 4OC3A 5IIFA 2QJ8A 2SNSA 1SNOA 3NP8A 1R43A 1IW7D 3KF8A 1DM0B 5ISRA 3PB6X 5D3DA 1TKHA 4K6LA 3PUXA 4OL7A 5M3FB 2GLFA 3IFDA 4DN4M 1H9MA 3BDCA 2O53A 4HMIA 2A6HD 3D3RA 1X3PA 1PDQA 2FINB 2NVYB 3J7YW 2B2VC 1VF5C 2B2UC 3S9WA 1DTDA 1B2TA 1JOQA 4KKUA 3QO2A 1G8ZD 1NR2A 4BBRB 1JQGA 1EEFD 1V1PB 3D7FA 1SNDA 4P2CB 4R8FA 5C5LA 2N55A 1SE4A 1E2WA 2WP8J 5T1IA 2WKDA 1VMCA 1TVXA 4K14A 3LMSA 3NWTA 3G7LA 3WOFA 3B3WA 1CX8A 3GD7A 3E0JA 2RDFA 4MIUA 1NSAA 1EY4A 1JWUD 1RTQA 2R93B 4P4BA 4CKCA 1H9SA 2PJ2A 5D14A 2F0KA 3HUVA 1KDBA 1BXTA 5AFWA 4H7BA 2ZXPA 5M5WB 2FFKB 3BVMA 4DA2A 1D1IA 3X3MA 2F0SA 2Q4ZA 3GV6A 1AZPA 2K1BA 4DJLA 2HDMA 3C3LA 1ARMA 3BYYB 2F3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R6T A;  4MCP A;  3WC5 A;  3QG1 A;  2CTB A;  4NGP A;  2AFX A;  2EK8 A;  1O78 A;  1GHK A;  1UWY A;  4TQU S;  3CT9 A;  5HXD A;  3D66 A;  5LYF A;  4MMO A;  1Y0R A;  4BA2 I;  1XFO A;  3T53 B;  2JEW A;  5HVG A;  3MN8 A;  4KKS A;  3KHX A;  3QJY A;  2ABZ A;  1V8Q A;  2ZEH A;  4G1P A;  3KQZ A;  3PBB A;  5HVH A;  2IT1 A;  4YU9 A;  2XEG A;  2O4H A;  2PJC A;  1Q90 A;  1BDO A;  3L2N A;  3FMC A;  1XMB A;  4H44 C;  2AUJ D;  3P20 A;  4O23 A;  1ZLH A;  1CPS A;  4EFD A;  2B8F A;  1Z2L A;  2V8D A;  3PUV A;  1ZG8 A;  2GLJ A;  3M85 A;  1ZG9 A;  5JGF A;  4FBE A;  1XBU A;  2AFM A;  1HDU A;  2NN6 H;  4LK1 C;  1TF9 A;  2CIJ A;  5I4M A;  2KCC A;  2PCU A;  5JM6 A;  5LYI A;  1FYC A;  2C6G A;  4RCN A;  3T51 B;  4ZYQ A;  1EE3 P;  1FNO A;  4MCQ A;  4EME A;  4PXE A;  4IHM A;  3N6R A;  3K9T A;  1IW7 C;  3DLJ A;  3RBU A;  1OXS C;  2V8V A;  4OO1 H;  3K2K A;  2ZOG A;  3BXM A;  2BDO A;  2JEB I;  3EQL C;  4ZY1 A;  2AWO A;  3SJG A;  2PRQ A;  4JZ0 A;  1TKJ A;  3I1U A;  1E2Z A;  1ELM P;  4TKO B;  4IAV A;  2PJ7 A;  3H8F A;  2A6H C;  4FUU A;  5DS0 A;  5F09 A;  1VDZ A;  1DE4 C;  3SJE A;  1ZG7 A;  3D4U A;  4BD9 A;  4OO1 G;  1VCI A;  2F7V A;  1TXR A;  1BPN A;  1M4L A;  4A94 A;  1AYE A;  1KWM A;  2BE5 C;  4B6Z A;  2B8G A;  3GUX A;  3D4R A;  8CPA A;  1Z5R A;  5LRG A;  3PUZ A;  1DD2 A;  3BHX A;  2F1M A;  3SJX A;  4CPA A;  2BE5 D;  4PQA A;  4RUH A;  5IB9 A;  4R7M A;  1LAN A;  4OID A;  4H13 C;  4IQZ A;  3B35 A;  4H2K A;  2CW0 C;  1ZKO A;  1E2V A;  3CPA A;  5J1Q A;  1ELL P;  3CDX A;  4OP4 A;  1XRY A;  4GZY C;  2R6G A;  3M7N A;  3PUY A;  4PXC A;  3BI1 A;  2DEA A;  2PVW A;  3I72 A;  3PFE A;  4TWE A;  4OGQ C;  4W9Y A;  4P4J A;  4OIW A;  4JBW A;  2L5T A;  1K8O A;  4NJQ A;  3V38 A;  3MXU A;  4P4D A;  3VR4 A;  3AB9 A;  2O5J C;  1ZYR C;  3CPX A;  4R76 A;  3T8W A;  4NGT A;  3PV0 A;  5LYD A;  4NGS A;  1YME A;  3IFE A;  1OXV A;  1LAM A;  3SI1 A;  4MXU A;  1A6X A;  2WZN A;  2JBK A;  1VF7 A;  1BLL E;  2CTC A;  1BPM A;  4MRI A;  4UEF A;  5K8N A;  5JEA H;  3KI9 A;  1FR3 A;  2XEJ A;  4UIB A;  3RZA A;  5K8P A;  1Z6H A;  2AFZ A;  5KNC A;  4A39 A;  3ND8 A;  3VR2 A;  3B2Y A;  2IMO A;  4KN7 C;  4NJR A;  1GUS A;  3PB4 X;  3MRU A;  1Q1B A;  3A7L A;  3FH4 A;  3GLJ A;  1QJO A;  2PJ1 A;  2C6C A;  4P10 A;  4KMU C;  4XIG S;  2EVB A;  1GJX A;  4WWV A;  3IKJ A;  3VH9 A;  2A69 C;  2XEF A;  1CP7 A;  2ZEE A;  3N5F A;  1OXT A;  5A35 A;  1Y8N B;  3D68 A;  5D29 A;  2QYV A;  2OOT A;  4KI0 A;  2ZEF A;  4IK2 A;  3IJ3 A;  3U9S A;  2D62 A;  2LMC B;  2V8H A;  2ZEG A;  3CRL C;  4IFD H;  1CTM A;  2JXM B;  4OC2 A;  1TF8 A;  2JE6 I;  4EWT A;  4MCR A;  3FPP A;  3V7Z A;  4GM5 A;  2PJB A;  1DCZ A;  4NGR A;  1TKF A;  5BN5 A;  2POK A;  3DXJ C;  3PEI A;  5CBM A;  4Q7A A;  1H9S B;  3KL9 A;  2PIZ A;  3W3A A;  3FEE A;  1Z7T A;  2RB7 A;  3D67 A;  4G7O C;  4I7Z C;  2A68 D;  1Q1E A;  1VHE A;  2E76 C;  4ZI6 A;  4P4I A;  2PJ0 A;  1AMP A;  1Y0Y A;  2CF4 A;  1GHJ A;  6CPA A;  1HQM C;  1QMU A;  5C0X G;  4X8I A;  3D7H A;  2ZOF A;  2EK9 A;  3VR6 A;  3A8K E;  3OPO A;  4HR7 B;  4ZX8 A;  3IEH A;  5K36 G;  3WC7 A;  1Y7E A;  2A6E D;  2KA7 A;  3FEC A;  1Q12 A;  1HCZ A;  3I73 A;  3QIA A;  4OC5 A;  3A7A B;  1FT7 A;  4NGM A;  1YW6 A;  3A8I E;  4MHN A;  1O7L A;  1CI3 M;  2WYR A;  3OW7 A;  2C1C A;  2PNR C;  1PCA A;  3B3C A;  5D8N A;  4L8J A;  3HGB A;  3I4L A;  2XEI A;  5LRK A;  2EJF C;  3S9N A;  4MHZ A;  3WC6 A;  2HB6 A;  1HDQ A;  3PBE A;  3WT4 A;  2PJ4 A;  4NFR A;  1Y8O B;  4UEZ A;  1LOK A;  2K32 A;  3B3V A;  3VAR A;  1V43 A;  3BG3 A;  5ELY A;  2ANP A;  1CPX A;  2HC9 A;  1H9K A;  2A69 D;  3IIB A;  1F57 A;  3L7Z C;  3WAB A;  2D5D A;  2AFW A;  3SE0 A;  2PPB C;  1ARL A;  5LYL A;  2OR4 A;  2Q43 A;  3GQB A;  4P4E A;  4ZY0 A;  3H8G A;  4KN4 C;  3NH8 A;  3KHZ A;  1SMY C;  3SJF A;  4F8Z A;  5KNB A;  3IC1 A;  3SI0 A;  4KSI A;  4ZX9 A;  3B3S A;  3LNN A;  4TNU A;  2PIY A;  2E75 C;  2J9A A;  3HLP A;  1G29 1;  3NA6 A;  3NE5 B;  3KZW A;  2O5I C;  4MCS A;  2DNE A;  2EDG A;  2BCO A;  3PB8 X;  5JH9 A;  1YSJ A;  1CP6 A;  4UEE A;  5K8M A;  2EJM A;  1T5E A;  1F2O A;  2BA1 A;  1PMR A;  3KR5 A;  2V4D A;  3TZU A;  4H0L C;  2ZEL A;  4A38 A;  1XJO A;  1VIX A;  4P6Y A;  2PCF B;  3S9L A;  3OOC A;  3VR5 A;  2AUK A;  1HTP A;  1YNJ C;  2Q8I B;  4KHZ A;  1YNN C;  3FX6 A;  1VHO A;  5THW A;  4BA1 I;  2VL1 A;  3A8J E;  3IO1 A;  4P45 A;  3VA7 A;  1I6V C;  1YLO A;  2PJ8 A;  4X2T A;  3NFZ A;  4IFD G;  4A37 A;  2IJZ A;  4OC4 A;  1OXU A;  1ZLI A;  4JYW A;  5CPA A;  1HPC A;  3FVL A;  4NGQ A;  3RAM A;  4AXV A;  4DUK A;  2NN6 G;  3SI2 A;  2V77 A;  3T56 B;  1H9R A;  2JEA I;  2PJ5 A;  4ZY2 A;  5BN3 A;  2BOA A;  5HVF A;  2DN8 A;  2GU2 A;  3PRT A;  2NN6 I;  2AFS A;  1OXX K;  1TKW B;  3CRK C;  3FJU A;  2AFO A;  1CBX A;  3H8E A;  2Q51 A;  1GUT A;  2JBJ A;  1R3N A;  4OKO A;  4UIA A;  1GUN A;  4YWY A;  3LWU A;  3RLF A;  1K8M A;  2C6P A;  4XTC S;  3PUW A;  3KQX A;  3ISX A;  2RFH A;  3KAS A;  1EWH A;  2PJ6 A;  1H8L A;  3SDZ A;  2I3C A;  3B3T A;  2F8H A;  1F2P A;  5K36 H;  1BAV A;  1GYT A;  4OC3 A;  2PJA A;  3MFY A;  2QJ8 A;  4F9V A;  1R43 A;  1IW7 D;  2G9D A;  3PB6 X;  1VGY A;  1TKH A;  3PUX A;  4KKT A;  4OC0 A;  1IYV A;  2GLF A;  2QVP A;  4NGN A;  4MHP A;  5KND A;  2PJ9 A;  1H9M A;  3BI0 A;  4FAI A;  2O53 A;  3JRU A;  5K8O A;  4G7H C;  7CPA A;  3VAT A;  3IFT A;  4ONW A;  4OC1 A;  3S9M A;  1Y8P B;  2A6H D;  4X3R A;  2A6E C;  4WJB A;  3PB7 X;  2PJ3 A;  4DYO A;  1B9N A;  1Q7L A;  4PXB A;  4DNT B;  3NH4 A;  1GUG A;  1VF5 C;  2IQ6 A;  4MHY A;  1Y69 U;  1DTD A;  3FF3 A;  5C0X H;  4DNR B;  2PE3 A;  3M4Y A;  1YW4 A;  2FVG A;  3D7D A;  4K3N A;  1GUO A;  3KGQ A;  4F9U A;  2NSM A;  2EJG C;  4KKU A;  2PVV A;  1QQ9 A;  1B9M A;  3GB0 A;  1JQG A;  3FED A;  2BA0 A;  2D2C C;  2A68 C;  3WDN A;  3D7F A;  5JEA G;  3D31 A;  4DK0 A;  2ZEM A;  4R8F A;  1E2W A;  4P44 A;  4PXD A;  3LMS A;  1LFW A;  3PFO A;  2DNC A;  3B3W A;  2GRE A;  1CX8 A;  3GD7 A;  5LRJ A;  1NSA A;  1Z8L A;  2BO9 A;  2V8G A;  2QF7 A;  2YYZ A;  3IWW A;  1CFM A;  3ND9 A;  3DGV A;  4LJZ C;  3PB9 X;  1LCP A;  4G7Z C;  4PPZ A;  4FWU A;  3TC8 A;  1LAC A;  1DXM A;  1RTQ A;  1TU2 B;  2ZED A;  5BN4 A;  1ONL A;  1IY7 A;  4LQG A;  4P4F A;  4P4B A;  1H9S A;  2PJ2 A;  2ZEN A;  1HEE A;  3VR3 A;  1IGB A;  3HUV A;  2EWB A;  3KLR A;  3KR4 A;  3D7G A;  4PV1 C;  1PYT B;  3TX8 A;  1IYU A;  2E74 C;  4DK1 A;  4Z65 A;  1LAP A;  3BDO A;  1H9J A;  4OME A;  2Q4Z A;  3QNV A;  2K33 A;  3H94 A;  1CG2 A;  2AFU A;  2ZEO A;  4UF4 A;  1OBR A;  2ZEP A;  4DJL A;  2NYQ A;  3NH5 A;  3ISZ A;  1ARM A;  2ZT9 C;  1LAB A;  4JK1 C;  3B7I A;  2K7V A; 
#chains in the Genus database with same CATH topology
 4G4K A;  4MNO A;  4ZLT F;  4MCP A;  3WC5 A;  2JA8 B;  3A5Z B;  3R2T A;  3IAY A;  4WOR A;  4WJ4 A;  2EK8 A;  4F87 A;  1QZH A;  3I4M H;  4K0K L;  4MJ8 A;  4UCP A;  1XFO A;  4PG3 A;  2E8G A;  1A8V A;  2VL6 A;  3NBI A;  4QMG A;  3KHX A;  1NNX A;  2R7F A;  1EIG A;  4ZQ3 A;  3T1H Q;  1U6M A;  2ABZ A;  1V8Q A;  3NEN A;  1RO5 A;  2CXA A;  2Q7B A;  1PH8 A;  1WTV A;  4X6A H;  3KQZ A;  4L89 A;  3PBB A;  5HVH A;  1OZP A;  2GN5 A;  4OIJ A;  2UXC L;  2UXB L;  2PJC A;  1PUA A;  4IOA A;  1BDO A;  1VQD A;  4LX9 A;  1IBK L;  1XMB A;  4DAY B;  3KKW A;  4H44 C;  4UWI A;  3VDY A;  2B8F A;  2V8D A;  2QA4 A;  4A32 A;  3PUV A;  1IBK Q;  1S5F D;  4FBE A;  1IBM Q;  2RKS A;  3S1M B;  1YNJ D;  3PIO A;  3CCM A;  3OMC A;  5JPN C;  4IFD J;  1N33 Q;  4E2A A;  4F0X A;  4MY0 A;  1ESR A;  1XNR Q;  2C6G A;  1YVO A;  4I65 A;  3N6R A;  4HSV A;  4JWP A;  1VQH A;  2XWB B;  3HOX G;  3DLJ A;  1N36 Q;  2Q8R E;  4J15 A;  4UA3 A;  2JN4 A;  2ZOG A;  4ZY1 A;  2BDO A;  1E24 A;  1TS5 A;  3M3Y H;  5JOB A;  2AWO A;  4JI8 L;  3I7F A;  2JA6 H;  4LF4 Q;  4KK7 A;  3DEP A;  2K75 A;  3CXS A;  1RIP A;  2OTL A;  1E2Z A;  5KYI A;  4K5V A;  2VZY A;  3I55 A;  1EY0 A;  3JVN A;  4OAE A;  4YWM A;  3G48 A;  2FXQ A;  4LNQ A;  4NMZ A;  4DV1 Q;  1N32 Q;  1DOK A;  2QDB A;  2HHH L;  4K0K Q;  1EL0 A;  1IU8 A;  1IYK A;  1ZG7 A;  3D4U A;  2QGQ A;  2F7V A;  1TXR A;  2R7H A;  1KWM A;  8CPA A;  1QUQ A;  2F0P A;  3CCS A;  2P6F A;  5G3L D;  5AG6 A;  2F4V Q;  2F1M A;  4CPA A;  4OEM B;  4KUA A;  4PQA A;  5IB9 A;  4QB4 A;  4J8Q A;  1VQ6 A;  4NSQ A;  4OID A;  2VI7 A;  4DR3 Q;  1CZG A;  5KTC A;  3HS0 C;  1E2V A;  1Z8W A;  5J1Q A;  1ELL P;  3CDX A;  3Q22 A;  1BKB A;  2XTI A;  1I1D A;  3PUY A;  2WKC A;  4PXC A;  3UDF A;  4A76 A;  3I72 A;  2K05 A;  4P72 A;  4TWE A;  3U50 C;  3CZX A;  4W9Y A;  4JBW A;  1JB3 A;  5IGC A;  3E3X A;  4ZYS A;  3R9G A;  2F0M A;  3CKI B;  3DWQ A;  1TWA B;  2Q7S A;  4P4D A;  3VR4 A;  1ZYR C;  3CPX A;  3HOY H;  3S1R H;  1KL9 A;  3ICE A;  1LT3 D;  3H0G G;  1D7Q A;  4A3C H;  3DWP A;  1UWV A;  4C56 C;  4WJ3 M;  2NWG A;  2RCF A;  5EJW A;  3J80 E;  2JBK A;  4GNX B;  5COY A;  1ML0 D;  2MHV A;  3OIP A;  3S2H H;  4UEF A;  4DF7 A;  3JUW A;  4CDF C;  1U4P A;  5L37 A;  4Z9C B;  5K8N A;  3I8Z A;  3EXN A;  2XEJ A;  4EQN A;  1PVO A;  2RDG A;  4B13 A;  3NE8 A;  2ZW6 A;  3QAH A;  5KNC A;  3A5U A;  3ND8 A;  3VR2 A;  1RXT A;  4ORF A;  4C3I G;  1C4Q A;  5NUC A;  4BBR H;  2E5L L;  2IMO A;  4A95 A;  5C4X G;  1GUS A;  4MFP A;  4LFC L;  4LW1 A;  3PB4 X;  3MRU A;  1XTD A;  3FH4 A;  3GLJ A;  5IY0 A;  4DV2 Q;  1QJO A;  4LF6 Q;  4JI7 Q;  3A74 A;  1ILP A;  4NCZ A;  2C6C A;  1B1Z A;  1HRJ A;  4XT1 B;  4G57 A;  4XIG S;  1I50 B;  2GFQ A;  1QE6 A;  2D9U A;  3OTO L;  3VYS A;  1TWC B;  2G3A A;  2XEF A;  2ZEE A;  2NVY H;  3D68 A;  2OOT A;  4GLX A;  4LF9 Q;  2H4O A;  4IK2 A;  2DUD A;  4RMF A;  2Z0Z A;  2IX0 A;  5H84 A;  3TOB A;  4CAV A;  2D62 A;  2ICI A;  3K5L A;  1VQ4 A;  2HUZ A;  4BXX H;  4K5W A;  4A3K H;  3CRL C;  1B3A A;  2AQ3 B;  5I9P A;  1JT8 A;  4FP5 D;  4OC2 A;  1N34 Q;  3RMH A;  4F0Y A;  4EWT A;  1N8R C;  3R1K A;  3V7Z A;  4IFD I;  1G2T A;  1GUW A;  1M4G A;  2Q0Y A;  3K5O A;  1I4H A;  3NBH A;  1WK4 A;  1JJC B;  2B2W C;  5BN5 A;  1P0H A;  1QWY A;  3DXJ C;  3TS0 A;  2N8N A;  4Q7A A;  1H9S B;  2EYL A;  3D3S A;  5IT9 E;  2PIZ A;  2MJ8 A;  4DKA C;  1MK4 A;  1X54 A;  1K28 A;  4DAP A;  3IRB A;  1YIJ A;  1UUP A;  1Q1E A;  1SE2 A;  4FF2 A;  4A33 A;  3NTK A;  1BO0 A;  4B10 A;  4NXY A;  2PJ0 A;  1ET6 A;  4X3K A;  4J3G A;  3RLO A;  4JYA L;  3ZJ0 A;  5IP9 G;  4RH6 A;  3QWN A;  1S5C D;  1K83 B;  4FXD A;  4JI0 L;  3MXP A;  1XPO A;  2CF4 A;  1TS4 A;  4CGY B;  4A3F G;  1PZJ D;  2KOL A;  3WOE A;  2BL1 A;  2VS1 A;  2EYO A;  1EIH A;  1SSO A;  4DUZ L;  4POF A;  4YGO A;  3C2P A;  2KA7 A;  3T13 A;  1Q12 A;  1CSP A;  1HCZ A;  2KEE A;  3I73 A;  4DAY A;  1SQH A;  3CQZ H;  1RHP A;  4RGM A;  4NGM A;  1JIC A;  1LT5 D;  1UEB A;  3BYT B;  3A8I E;  3LOD A;  3K0Y A;  4DR7 Q;  5C82 A;  4JBM A;  5FKA C;  2VW9 A;  3JC6 6;  2YNE A;  1JR0 D;  1O7L A;  3F1Z A;  4ALP A;  3GTL H;  5IYD G;  1PCA A;  3B3C A;  2R93 H;  5D8N A;  3RR5 A;  4L8J A;  1PH1 A;  2XEI A;  4II9 A;  3PIO 3;  3PBE A;  2IL4 A;  3VWD A;  2F0G A;  4C3H H;  2K32 A;  3CW2 C;  2KCN A;  4RN7 A;  4K2K A;  2WSA A;  5KYL A;  2WAC A;  2Q2T A;  1MIU A;  3HOZ G;  4C2Z A;  1QVG A;  1VQ7 A;  1LYL A;  4IO9 A;  1F57 A;  1Z8X A;  3IIB A;  3T1Y Q;  4UDU C;  4EQO A;  2RSO A;  2ATW A;  1G6Z A;  1LTA D;  3IWE A;  2OR4 A;  3C1F A;  4JC0 A;  1EZ8 A;  2DGY A;  1B53 A;  1WTP A;  1TS3 A;  2X6L A;  4A93 H;  1PTO H;  3HEJ A;  2MNA A;  1Y9W A;  1HFG A;  3A0J A;  3PIP 3;  1QCB D;  3KDF A;  4F8Z A;  2Z9H A;  1CUK A;  1VQF A;  1LTR D;  4A3F B;  4R8I A;  4KOR A;  1X3F A;  1TWH H;  3GTM H;  3BDL A;  5JAV A;  3B3S A;  3LNN A;  2C5C A;  4A4I A;  2PIY A;  5KTD A;  4XNH C;  1D2B A;  2J9A A;  4Q36 A;  1G29 1;  3NA6 A;  3NE5 B;  2GVB A;  3GTM B;  4LQ6 A;  2JA7 H;  2O5I C;  2EDG A;  2BCO A;  2YU9 H;  3CPF A;  3PB8 X;  3URY A;  4POG A;  1Z8T A;  1X65 A;  2EJM A;  1EY6 A;  1PZI D;  4YY3 Q;  5I2Y A;  2QIL A;  1Q86 C;  4H0L C;  3FYN A;  3HFZ B;  5GRO A;  5M3F H;  1XMO L;  3VR5 A;  4HKF A;  4LF5 Q;  1K9M C;  4QB9 A;  2K01 A;  5AG7 A;  2Z3K A;  1VHO A;  5THW A;  2KVM A;  2F3W A;  1LTB D;  3I9S A;  1EUJ A;  3H3V I;  2NZ1 D;  2F03 A;  5DLQ E;  2FCK A;  1F2Z A;  1A3T A;  4NXN L;  2IWH A;  1KD1 C;  1FY7 A;  2PJ8 A;  4A37 A;  1OXU A;  2DY7 A;  3FRP B;  5K5P A;  1ZLI A;  4JYW A;  4NGQ A;  5CPA A;  1QVF A;  1XX8 A;  4CHT B;  5BWA B;  1CKN B;  1BBX C;  1KUY A;  4J6H A;  4JXR A;  2C9O A;  1XXG A;  4ZY2 A;  2PJ5 A;  3BVG A;  2ZXO A;  3E9H A;  1VQL A;  1KC8 C;  1R4P B;  3STB D;  4PSW A;  3LX0 A;  2QKI C;  3FJU A;  1CHP D;  1EQR A;  4DUY Q;  4A93 G;  1CBX A;  1YVK A;  3I91 A;  3GTK H;  3KBG A;  3PMF A;  4ZCK A;  2L11 A;  1YGH A;  4H6Z A;  2M2L A;  1O7I A;  2N49 A;  2CCZ A;  1L0W A;  4IF5 A;  2JBJ A;  4U9Z A;  4CKE A;  3HOV G;  1GUN A;  1A62 A;  4JD6 A;  1PFS A;  1JWM D;  2VY3 A;  5G3L F;  4IPD A;  4CDC C;  3M4O H;  2JSO A;  4LFB L;  2R93 G;  1BVS A;  3ISX A;  4KS9 A;  4L5R C;  1KDC A;  3NEM A;  4XPD C;  4ZUI A;  2XRQ D;  4KY7 A;  5EBC A;  3B3T A;  1QSM A;  2UUA L;  1HHV A;  2IY5 B;  4QBJ A;  1KLG D;  3PP9 A;  4E8O A;  2F0F A;  5FJ8 H;  3F2B A;  1GYT A;  4UBR A;  4GKJ L;  2CH4 A;  1IYJ B;  4B08 A;  1S7F A;  3MFY A;  3ULJ A;  2PJA A;  4DV4 Q;  4UP8 A;  3W5O A;  5IWA Q;  5CNP A;  1A3V A;  2VQF Q;  4M6G A;  1PYW D;  3AFP A;  4A3J B;  4R4I A;  4N8X 1;  2FL4 A;  1R4Q B;  4S3S A;  4KKT A;  1IYV A;  5LMN Q;  2PSW A;  4BXX G;  1I4X A;  2FHT A;  3OW2 A;  3L0O A;  3R8B A;  2ZJQ A;  3JRU A;  1XWE A;  4G7H C;  1S7L A;  1TR5 A;  3J7Z C;  1SLJ A;  3S17 B;  4OC1 A;  3S9M A;  4UFV A;  4B12 A;  3PB7 X;  1Q7L A;  4PXB A;  1MSG A;  4DNT B;  2CWP A;  1KAB A;  1A3U A;  2PQA A;  1EYA A;  1UE1 A;  4A3F H;  2KJX A;  1JOO A;  1UE6 A;  3SXO A;  1YW4 A;  3S16 B;  2UU9 L;  4B3M L;  1EU3 A;  2Q4V A;  1OO9 B;  3S1Q H;  4A93 B;  1CKM A;  1EY8 A;  2IHF A;  4PV6 A;  1QQ9 A;  2WV6 D;  2A73 B;  2D2C C;  3FED A;  2DPS A;  1PA6 A;  3GTP B;  1X32 A;  5M3F G;  4IJL A;  5H1S E;  3NTH A;  1VQP A;  1PRT B;  3L2P A;  2ZEM A;  3FP9 A;  1W2B A;  2E2D C;  1B7Y B;  4A3B B;  3QAY A;  4PXD A;  3MEH A;  5HGQ A;  2ZM6 L;  3DR6 A;  1TIQ A;  1C9O A;  1M4I A;  2JA5 H;  3HOV B;  3MVV A;  5EKL A;  1JWQ A;  3I3G A;  5LRJ A;  4DAM A;  3J7A V;  4QQB X;  2KCT A;  3UDI A;  4FVM A;  2F0D A;  2PI2 A;  2PQA B;  2QF7 A;  4X65 Q;  3K5M A;  3IWW A;  1IIC A;  4ZKC B;  2CHB D;  1CFM A;  2PW5 A;  3ND9 A;  4LJZ C;  3TT2 A;  3S1R B;  3J81 L;  1LCP A;  1QNU A;  2F4I A;  4K8I A;  3TC8 A;  3AU7 A;  2N78 A;  3M4Q A;  2IPK D;  3I4M B;  5TSS A;  1TWA H;  1IZ6 A;  2LKV A;  3CP0 A;  3TP7 A;  4DXG A;  5C4X B;  4LQG A;  4X3T A;  2ZEN A;  2K5H A;  1HEE A;  3RN2 A;  4L8A A;  1N9W A;  3D7G A;  2CH4 W;  1U9R A;  1FNV A;  3EFA A;  1PRT F;  3E5S A;  5CBE E;  5JVH 3;  2SNM A;  2I00 A;  1IYU A;  1MSH A;  2JQO A;  2E74 C;  2KCM A;  3BLN A;  4QY7 A;  4LFB Q;  1LAP A;  3OTO Q;  2L4N A;  2IW3 A;  1ENF A;  3CMA A;  3RUZ A;  2K33 A;  3H94 A;  4A3G G;  2AFU A;  3Q8D A;  2HQE A;  5C3E H;  4X64 L;  3HOU B;  3I90 A;  1QSO A;  3CXQ A;  1PTO C;  1TS2 A;  2NYQ A;  1HR0 L;  2G3T A;  1RDP D;  5M5Y H;  3Q23 A;  3ISZ A;  1SNM A;  4CAE A;  3IL8 A;  5GAH C;  3FRM A;  3GDE A;  4JK1 C;  5IYC H;  1WWZ A;  3B7I A;  2K7V A;  1YHA A;  3W1G A;  3KF6 A;  1B8A A;  2WAQ B;  2ES2 A;  5EQ0 A;  4GKK L;  4NGP A;  2AFX A;  1O78 A;  4TQU S;  1YNX A;  4BY1 G;  1I4Q A;  3D66 A;  2G5D A;  4MMO A;  4A2Z A;  4BA2 I;  3KDF B;  3M3Y B;  4QJF A;  5JQ4 A;  4C3H G;  3T53 B;  1XOV A;  2OT2 A;  2JEW A;  3DSB A;  2BUE A;  1WTO A;  1FJG Q;  2OEO A;  5IGE A;  4CAX A;  2ZEH A;  3HOV H;  3KLW A;  1ROD A;  5M5X B;  2B5G B;  2OU2 A;  3S24 A;  4O42 A;  3I3C A;  2I07 B;  3H5Z A;  4YU9 A;  2NVX H;  1CKO A;  5EPK A;  1CM9 A;  4R1J A;  2AUJ D;  4O23 A;  2VQF L;  1PH7 A;  1W6J A;  1PH6 A;  1CPS A;  3HOX H;  2ZJP A;  2BH8 A;  2LSS A;  1GM5 A;  4AVA A;  1KRT A;  2GLJ A;  1ZG9 A;  5JGF A;  2AMC B;  4DV3 Q;  1XBU A;  5EGT A;  2RA4 A;  2Z3P A;  2NN6 H;  4LK1 C;  2CIJ A;  4PMW A;  1I6H B;  1EQT A;  1SRU A;  2FT0 A;  2K5T A;  1MD2 D;  5EKK A;  4C1N K;  3HOX B;  2A8V A;  4I7A A;  4QF4 A;  3T51 B;  4QUF A;  4ZYQ A;  1EE3 P;  4MCQ A;  3H6M A;  2IX3 A;  3BJ7 A;  1EY5 A;  4KOW A;  3K7U C;  2NVX B;  4FDB A;  3RBU A;  3CCU A;  4A3M B;  2K5V A;  2ZXV A;  1N33 L;  2V8V A;  4NXM Q;  1W3S A;  2Z4I A;  4OO1 H;  1AW7 A;  3EQL C;  4UPA A;  3S17 H;  3S6G A;  5M5X H;  2EYF A;  3SJG A;  3NQT A;  2UXD Q;  2CY2 A;  1K3R A;  4LF8 L;  2RSN A;  3KJP A;  1I4P A;  3I1U A;  2HCC A;  4H89 A;  3FVQ A;  1HZ9 A;  1KQS A;  4FUU A;  3S1N H;  1PRT C;  4JI8 Q;  5J39 A;  2PNH A;  1VDZ A;  4XNH B;  2R7Z B;  4OO1 G;  5C4J H;  4ODG A;  4TSS A;  1I94 Q;  1BBU A;  3ONA B;  5C4Z A;  1M4L A;  3H4Q A;  4RAU C;  2BE5 C;  4B6Z A;  2HCI A;  1C48 A;  1V0C A;  5IGD A;  5FVJ A;  1DD2 A;  2X69 A;  4RUH A;  3DMU A;  3S6K A;  3RO0 A;  1I94 L;  1WCM G;  1OTC A;  1KLU D;  4R3L A;  2OQ0 A;  2XGT A;  2FS5 A;  3B35 A;  4H2K A;  2CW0 C;  4LFA L;  4UCM A;  4ULL A;  1KNA A;  4GZY C;  2AWN A;  1BCP C;  2F0Q A;  2L15 A;  3F2C A;  3I4N B;  4XT3 B;  2F52 A;  3PZJ A;  4Y52 H;  5AG4 A;  2BOS A;  3K81 C;  4P4J A;  4OIW A;  2WAQ E;  2L5T A;  5DM6 3;  2EY6 A;  2AKW B;  2Z4H A;  3D6C A;  4NF1 A;  1SAP A;  1HNX Q;  3V38 A;  1WVL A;  2MP1 A;  3AB9 A;  2O5J C;  4HNW B;  4U68 A;  4JV5 Q;  3TEH B;  2F0T A;  4M3S A;  1M8A A;  4NGT A;  2RDH A;  1X55 A;  1A63 A;  2REF A;  4HMJ A;  3R9F A;  3M7G A;  2GA4 B;  1YME A;  3IFE A;  3SI1 A;  2CQA A;  1WJJ A;  4MXU A;  1X12 A;  5C88 A;  4KHP Q;  2OZU A;  2JA6 G;  3PF4 A;  2CTC A;  1S5D D;  2F3I A;  3K57 A;  4A3M H;  2R7Z G;  5J8F A;  2R7D A;  4RGO S;  2Q2H A;  4DV3 L;  4BIN A;  2VQE Q;  4B9X A;  2F0V A;  4BWG B;  2AFZ A;  4A3E B;  1YEZ A;  3K7A H;  4A3I G;  3GIU A;  4H6U A;  3SVM A;  3MAQ A;  3CME A;  3F8T A;  5CGK A;  2HUG A;  5FK9 C;  4R3K A;  2K5Q A;  3S1M H;  1WD0 A;  3S1Q B;  3MTS A;  1Y1V G;  3TRZ A;  1CQF A;  1SJH D;  4HED A;  1YHQ A;  5M9O A;  4K8J A;  2EVB A;  1GJX A;  5C0X I;  4WWV A;  1LTG D;  1HUN A;  1VQJ A;  1OXT A;  5A35 A;  1Y8N B;  3JTK A;  1GD7 A;  1TWH B;  5IP7 H;  2SOB A;  4AB7 A;  1PH5 A;  2JA9 A;  5G20 A;  2LMC B;  5IYB G;  2FMC A;  5FO8 B;  5T1G A;  4JI6 L;  1AE3 A;  2RC4 A;  1CTM A;  1YZ6 A;  1BQQ T;  1J9O A;  4CJ0 B;  1TF8 A;  2VUM G;  4EGV A;  1E0B A;  3AFQ A;  1HNZ Q;  1EIF A;  4AG7 A;  4CAW A;  4A3D G;  2UU9 Q;  1SYE A;  2POK A;  3PEI A;  5CBM A;  3V2T A;  1UFH A;  4M6I A;  2CFM A;  1ESF A;  2R92 B;  3CHB D;  3KL9 A;  5DWM A;  3UE0 A;  5C3E G;  4M85 A;  3BZC A;  1KDA A;  5CV9 A;  2RB7 A;  5IYB H;  1BO4 A;  1VS0 A;  2A68 D;  2OCE A;  1WYD A;  3GTG B;  1QUQ B;  5I6W A;  3K8A A;  4HNX B;  4H02 A;  4OWT B;  4ZI6 A;  3TO9 A;  4F7X A;  5M5Y B;  1S5B D;  3HOW H;  5A28 A;  2XN9 C;  5IE8 A;  1AMP A;  5FOB B;  3FXT A;  3MXG A;  5IT9 c;  1HTL D;  4DV0 L;  5C3E B;  1GHJ A;  1I3Q H;  6CPA A;  3BZK A;  4BY1 B;  1HQM C;  3D7H A;  1M4V A;  3RNZ A;  3VR6 A;  1CKN A;  4L5Q A;  3ZYY X;  5K36 G;  2X7B A;  3M4O B;  2VUM B;  4L5S A;  1M4D A;  3TO6 A;  3BU2 A;  1Z4E A;  1EQV A;  2PDO A;  3J7A F;  4HAE A;  1GXD C;  2KEC A;  1VQK A;  1YK3 A;  1ICW A;  3QIA A;  4C3J G;  2E2I H;  5JJL A;  1YW6 A;  4KOT A;  3R96 A;  1M1K C;  2EYJ A;  1TWG H;  1BCP D;  3CCE A;  2DY8 A;  2J0T D;  4A3L G;  5IV0 A;  1S5E D;  4DV7 L;  4XXE A;  2SEB D;  2I5L X;  1CI3 M;  1AP0 A;  4AVB A;  2NB0 A;  4JVZ A;  3CD6 A;  1EWI A;  2JA5 G;  4QCL A;  1PH4 A;  4OXP A;  2KBN A;  2I46 A;  4IPH A;  4Q5V A;  2HB6 A;  2PJ4 A;  3HOW B;  1J5E L;  4IAL A;  4UEZ A;  1EOV A;  2EYH A;  2EPB A;  4DR6 Q;  3B3V A;  1N32 L;  3VAR A;  2CNS A;  1NY4 A;  1V43 A;  4A3I B;  4JI2 Q;  3BG3 A;  4A3E G;  2ANP A;  5J1Z A;  4A3D H;  1J5E Q;  4ZK9 B;  1CPX A;  4CRZ B;  2HC9 A;  2A69 D;  3L7Z C;  2BDN A;  5F47 A;  3JAM c;  4N9T A;  3SE0 A;  4LMQ D;  4KLV A;  5EKI A;  5KGU A;  1ARL A;  5LYL A;  3H0G H;  1D1K A;  4OLL A;  3V05 A;  3I56 A;  5ELC A;  2NUC A;  2Y0S G;  1MHW C;  3TP8 A;  3H8G A;  2M00 A;  4KN4 C;  3NH8 A;  1D6E C;  1SMY C;  3K5N A;  3SJF A;  1LM0 A;  2R8V A;  3SI0 A;  4ME3 A;  4KSI A;  1PHJ A;  1DON A;  4TNU A;  4AG9 A;  4PNY A;  4RI1 A;  1J6Q A;  4KY5 A;  1KAW A;  1LTL A;  2E75 C;  3I4M G;  2BEI A;  3RZD H;  3KZW A;  2EYP A;  1BBW A;  4R9M A;  4FF4 A;  4DR3 L;  4GOP A;  3J80 L;  1CP6 A;  4OON A;  2Z0S A;  4FNF A;  2F4V L;  4QC6 A;  2XSC A;  3F2U A;  2BA1 A;  3NHH A;  4EX5 A;  1VQO A;  4HCE A;  3TZU A;  2ZEL A;  2WFW A;  1MJA A;  4YHH Q;  3ER0 A;  2AUK A;  4QUS A;  1YNJ C;  4JBK A;  2UUA Q;  4ZKB B;  2ICE C;  3ZJY C;  3C46 A;  5ELF A;  2I0Q A;  4BA1 I;  4HJ8 A;  3FKI B;  4BY7 B;  3R9E A;  2K14 A;  2E5L Q;  1WTR A;  4UAI A;  1PTO F;  4RGT A;  2OH1 A;  2R1I A;  4DUK A;  2NN6 G;  4YRH A;  5DWN A;  3SI2 A;  1JOK A;  1KIX A;  2V77 A;  3ULP A;  3P75 A;  3NE7 A;  1S4Z A;  1TWG B;  2MUY A;  4DV0 Q;  5HVF A;  3NSW A;  4XPD B;  3BVZ A;  3R3O A;  4IPG A;  2F0I A;  1WOC A;  2AFS A;  4JG2 A;  5JJK A;  5CV4 A;  3CCR A;  1TKW B;  3HKZ G;  5DNF A;  4PK3 A;  4Y49 C;  2L55 A;  4A3M G;  2AFO A;  5IOD A;  3NEL A;  3H8E A;  1HA5 A;  2B2V A;  3RZO B;  4KHV A;  4RWS C;  2DPT A;  1WCM H;  1AN8 A;  1XPR A;  1HNX L;  5LL6 S;  2PZU A;  3KLS X;  1SXT A;  3HKS A;  4DV6 L;  1EYG A;  4FF1 A;  4XTC S;  5HY6 A;  4C3I H;  3NK9 A;  3G6E A;  3MC0 B;  3A54 A;  2F0O A;  4PZ6 A;  1R9T H;  4AQY L;  4DR4 Q;  1JOR A;  5J8C A;  2HD3 A;  1L0X B;  1F2P A;  3N52 A;  1XMT A;  3W91 A;  2VB2 X;  4QIW E;  2XRS D;  2YNC A;  2VB3 X;  4B5O A;  5FLX c;  4BY7 G;  4F9V A;  1MJC A;  3P1H A;  3TQY A;  5ELN A;  4MFJ A;  5AJ3 L;  2NYZ D;  3RN5 A;  1VMP A;  3D4D A;  1TWF H;  1VGY A;  2EBJ A;  1SYC A;  4RHS A;  4OC0 A;  2K5N A;  3TFY A;  4LFA Q;  2QVP A;  4NGN A;  4MHP A;  4FD5 A;  2NVT B;  4C7H A;  2OQK A;  4FAI A;  1JC7 A;  7CPA A;  2DXQ A;  1VQ5 A;  2CVR A;  4ONW A;  3J80 c;  4JYA Q;  4MFL A;  4X3R A;  1LO5 D;  4WJB A;  1FVI A;  1B9N A;  3Q0A A;  3J81 i;  1GUG A;  1LV9 A;  2NZH A;  2QML A;  2UXD L;  4IUR A;  4M1U B;  1MI2 A;  3KLS A;  4UP9 A;  1B3Q A;  3BS1 A;  1M1D A;  1XMQ Q;  3KFU A;  1GO3 E;  2Z8L A;  5C0X H;  5BR8 L;  2PE3 A;  2RHS B;  4NDX A;  3I70 A;  4DK3 C;  1STH A;  3D7D A;  4K3N A;  4AYB G;  2QW7 A;  4DR5 Q;  2NSM A;  1IOI A;  2EJG C;  3E0E A;  4PQX A;  5LHY 1;  4GLA C;  4KOS A;  5GAD C;  1B9M A;  1XNR L;  1MJB A;  3EC4 A;  3CPW A;  3FF3 A;  4A3E H;  4X5K A;  5DEH A;  3EVQ A;  4KOX A;  5CBA E;  3T90 A;  1V1P A;  1EZ6 A;  5I6Y A;  3JAM L;  2EY5 A;  4DK0 A;  4ZBG A;  2JP1 A;  1BOS A;  4AVC A;  4Q0F A;  1JJG A;  4KZT A;  2KCW A;  1S72 A;  2ZW5 A;  1Z47 A;  2VEZ A;  2B29 A;  4OAD A;  4HPS A;  5G21 A;  1BCP B;  3VYU A;  1NBW A;  3SR1 A;  5FJ8 G;  1YNN D;  4CGO A;  2BO9 A;  2F0E A;  2JA7 G;  2YYZ A;  4FD4 A;  4JXQ A;  4XDX A;  2VXK A;  2XNA C;  2HDL A;  4G7Z C;  4FWU A;  2E2J H;  3OMG A;  1LAC A;  1DXM A;  1F2M A;  2B4D A;  4R4C A;  4BBS B;  3P2F A;  3T9Y A;  5BN4 A;  1IY7 A;  2EXZ A;  1S40 A;  3VWE A;  4FXG C;  1UE5 A;  2JA8 H;  3DWA A;  1Q3L A;  5HMN A;  3VR3 A;  1QNK A;  1CT1 D;  4LUV A;  1IGB A;  3KR4 A;  1FGU A;  2Z3O A;  2FXF A;  3CC7 A;  3ZZI A;  1PYT B;  4C1N I;  1EOT A;  4R9W A;  5HH1 A;  4DK1 A;  5D3I B;  5M3M B;  1A2Z A;  2UUB L;  4Z65 A;  1NE3 A;  1IBL Q;  4CDE C;  1P16 A;  1D8L A;  3DNS A;  1L1O A;  3BDO A;  3GTQ B;  4IUV A;  3QNV A;  4BY1 H;  2YGW A;  1CG2 A;  5JJI A;  5E4X A;  3WWV A;  2ZEO A;  1STG A;  3S2D H;  1OBR A;  1RTO A;  2ZEP A;  5E96 A;  1Q2Y A;  3I4O A;  4GKK Q;  3NH5 A;  2WB1 G;  1NR4 A;  4DV5 L;  4DR2 L;  4LUA A;  3GTG H;  2JYO A;  1J8I A;  3D8P A;  4R6T A;  3PGP A;  2B2U A;  3G3S A;  1RL2 A;  1X3E A;  1AFP A;  2HIV A;  5GAE C;  4A3B G;  1LTT D;  1NJI C;  3KOJ A;  1G2S A;  4X66 L;  5HXD A;  5LYF A;  1S7N A;  2ZW4 A;  5JPH A;  1IID A;  1Y0R A;  4E6I A;  1VHS A;  3GTJ B;  5CV5 A;  4CYQ A;  3SHP A;  5HVG A;  4LFC Q;  3MN8 A;  2D4P A;  2ASB A;  4F6A A;  4OX9 Q;  4G1P A;  2Z6K A;  1CA6 A;  3J81 E;  1UNS A;  3GTO H;  3EA6 A;  2NTT A;  4A3B H;  4B3S L;  1Q90 A;  2Z10 A;  1CZW A;  1X6O A;  1DJR D;  4C2M B;  3FMC A;  3L2N A;  1HZC A;  1B44 D;  1DOL A;  1JCK B;  5F2D A;  4BBR G;  1NUC A;  2IHE A;  1X9N A;  1Z2L A;  5FLM H;  3R93 A;  4U5Y A;  1E22 A;  1ZG8 A;  1RJT A;  2F0L A;  3E9I A;  5I4M A;  1TF9 A;  5I4D A;  4CGP A;  3HKZ E;  2AQ1 B;  2K03 A;  5JM6 A;  1N36 L;  3K7A B;  4CBV A;  1FYC A;  5LYI A;  2REE A;  4RCN A;  3HOZ H;  4EME A;  4PXE A;  3K9T A;  4BMH A;  1IW7 C;  4C2M H;  1OXS C;  2O4X A;  4UCN A;  3T4A C;  4A3K G;  3BXM A;  1EY9 A;  3GTJ H;  3U9O A;  4C2X A;  1EYC A;  1B6B A;  4HN7 A;  4OHJ A;  3AMU A;  4DXF A;  4KD4 A;  2LXK A;  1PH9 A;  4RKB A;  4JZ0 A;  4OX9 L;  4MBU A;  2N3S A;  1PZK D;  1ELM P;  1YQE A;  4LF9 L;  4IAV A;  2PJ7 A;  3PO3 G;  4RS2 A;  2A6H C;  3Q6S A;  3AEV A;  3MZ5 A;  4KLK A;  4UP7 A;  1G51 A;  1LUZ A;  2I5M X;  1HNW Q;  5F09 A;  2VBQ A;  3I2Z A;  2CWA A;  4RKL A;  4BD9 A;  1W6K A;  1BPN A;  1NMG A;  1TT2 A;  4HSP A;  2K5W A;  4A94 A;  1AYE A;  3GUX A;  1DZ1 A;  3I4N H;  4O2D A;  1Z5R A;  1IBL L;  3BHX A;  4OWX B;  4IUP A;  3SJX A;  2BE5 D;  2B5G A;  1O7Y A;  3OWE B;  4AYB E;  2VNU D;  4R4T A;  2J7Z A;  5EPL A;  1LAN A;  3W6S A;  3J80 i;  1LTI D;  4H13 C;  2Q44 A;  4GKJ Q;  3S14 B;  5M3M H;  1HJP A;  1D5M C;  4OEL B;  3T16 A;  1NMT A;  3CPA A;  4PMB A;  3X3N A;  1VQB A;  4CGL A;  4OP4 A;  5CR3 A;  1WCM B;  3LWE A;  3M7N A;  1EY7 A;  4CJ2 C;  4YWK A;  3P7J A;  1STA A;  3BI1 A;  2DEA A;  2PVW A;  1IKM A;  5J22 A;  1EFI D;  2RVL A;  4IN3 A;  2B4B A;  4Q38 A;  1I4G A;  2HIX A;  4OIK A;  2KHJ A;  2KEN A;  1I12 A;  1NSL A;  1ICF B;  2G0B A;  1Y9K A;  3DR8 A;  2NVQ H;  4A3L H;  2B2Y A;  2B2W A;  1EIY B;  1XPU A;  1T9H A;  3KYH C;  3FIX A;  4MFZ A;  2C27 A;  4LWC A;  3ERS X;  4KD3 A;  1CJW A;  3PV0 A;  4LUZ A;  4DR4 L;  5JPM C;  1QZG A;  5C4X H;  2EIF A;  4KSA A;  4NGS A;  1LAM A;  1E1T A;  4AYB B;  5IWA L;  1A6X A;  4XPK A;  2WZN A;  2EXD A;  4EQP A;  1VF7 A;  4JCV E;  3J81 j;  4BY7 H;  2NMT A;  4MRI A;  4B11 A;  2UXC Q;  1LRZ A;  2JJQ A;  5JVG 3;  2QIR A;  1Z6H A;  4WJW A;  3HOZ B;  1XF8 A;  5C6A A;  1XJV A;  2WUU A;  4BBH A;  4KN7 C;  3TDQ A;  1WTQ A;  2NTS A;  5IB0 A;  1VQM A;  2PZW A;  2WB1 E;  2PJ1 A;  4KMU C;  4MTN A;  5E7N A;  1ASY A;  1ZEQ X;  3T1H L;  2J8R A;  2HQY A;  5AGE A;  1LT4 D;  1HXY D;  3ERO A;  3SHL A;  1SNQ A;  5D29 A;  4DNI A;  3TOA A;  4XQJ A;  5IYD H;  2ODF A;  1SEB D;  2D0O A;  1Q82 C;  2L0C A;  1PV4 A;  4DR7 L;  4TRD A;  4LF4 L;  1L1O C;  4IFD H;  1HNW L;  1STN A;  2JXM B;  4UHV A;  1PFN A;  2B3V A;  3OHX C;  1Z9U A;  3RYO A;  4GM5 A;  1KAA A;  2PJB A;  5IYC G;  4EVO A;  1TKF A;  2B63 H;  2Z3L A;  4XYO A;  4L6T B;  2DJG C;  4ZAI A;  1DOM A;  4A3D B;  3FEE A;  3W2D A;  3KBX A;  2ZTC A;  4A3J H;  1XMO Q;  1SR3 A;  4I7Z C;  5E1F A;  2WPX A;  4AQY Q;  2MPM A;  2LFN A;  3C1E A;  1RD9 D;  2E76 C;  4CYP A;  4MHD A;  1XTC D;  1ASZ A;  3S2D B;  4YCW A;  1Y1W B;  4B5P B;  4IUT A;  4X8I A;  1SNP A;  3GTQ H;  2P6G A;  4A3G B;  2EK9 A;  3A8K E;  4TVA B;  4ZX8 A;  4DFA A;  3IEH A;  4L63 B;  1PRT D;  3S15 H;  1RF2 D;  3WC7 A;  4CYO A;  1Y7E A;  1G6P A;  4DR1 L;  4IUQ A;  3UDG A;  3JAM i;  2E2H B;  2B2T C;  2F0J A;  2VZA A;  3TP5 A;  4LF7 L;  4GS4 A;  1KXL A;  4OC5 A;  4PK2 A;  2YV5 A;  4XPL A;  1K0S A;  1FT7 A;  4YCV A;  3J7A 5;  2Y0S E;  2F0U A;  2RHQ B;  3G6J B;  5FLX L;  4CGN A;  4M6H A;  4LF5 L;  1PYS B;  5CV7 A;  2XIW A;  4JOI C;  4RG1 A;  2Z3M A;  2C1C A;  1KTK A;  4BBS H;  2O2L D;  3VYR A;  4HIO A;  1IXR A;  1SYD A;  3I4L A;  4MI4 A;  3S9N A;  1BR9 A;  3WC6 A;  1GKH A;  1HDQ A;  4KVO E;  2KED A;  1DYQ A;  3F8K A;  4BS9 A;  1HA6 A;  3PQI A;  3PO2 B;  1SDF A;  4FYD A;  4LAA A;  2HV2 A;  3MXN A;  4JI0 Q;  2H5X A;  4JI3 L;  1H9K A;  4JI4 Q;  3WAB A;  1Q46 A;  3PO3 B;  2JLM A;  3KF8 B;  3F5B A;  4CYN A;  2A5H A;  2PPB C;  4XYQ A;  4C7I A;  5A27 A;  4DV7 Q;  2Q43 A;  3GQB A;  1NMF A;  3K9U A;  4F88 A;  3H3V C;  4A3K B;  4MN3 A;  2H1E A;  2F0H A;  4HJA A;  1CSQ A;  3S16 H;  3KHZ A;  4IPC A;  1U4R A;  1AZQ A;  2SDF A;  4U9Y A;  1SMY D;  3KJO A;  1NTG A;  1MBY A;  2EYM A;  1PTO B;  1A2T A;  2M9V A;  3SEB A;  3HLP A;  1PH3 A;  4YCU A;  3HZX A;  2LY7 A;  4GN5 A;  2DNE A;  5E3F A;  2YTX A;  1STE A;  3TS2 A;  2PO4 A;  4IUS A;  4UEE A;  5EAY A;  4B9W A;  1V1Q A;  2RQX A;  1F2O A;  3HKZ B;  1PMR A;  1S5K A;  4QVT A;  2V4D A;  3A56 A;  2K28 A;  1XJO A;  3H0G B;  4P6Y A;  2PCF B;  3S9L A;  3OOC A;  4IJH A;  1PTO D;  1SN8 A;  3LGJ A;  2ZPA A;  2GVA A;  4KHZ A;  1U4M A;  1YNN C;  1FNU A;  1F9Q A;  3FX6 A;  3H09 A;  5GAG C;  2G9H D;  5C44 H;  3A8J E;  4R87 A;  3IO1 A;  1KZF A;  5E4W C;  1SBB B;  2WPW A;  1HNZ L;  1HH2 P;  4IUU A;  2P6E A;  1YBY A;  3NFZ A;  1K3B C;  1JQY D;  2IJZ A;  2HHH Q;  1HPC A;  4MTK A;  5CC4 A;  1XNQ Q;  1O7Z A;  3RAM A;  3FKI G;  2CNM A;  3GV3 A;  1ET9 A;  4P71 A;  4QGU A;  2L9H A;  1B87 A;  3T56 B;  1QVC A;  4HJ7 A;  2JEA I;  4A30 A;  2DN8 A;  1F2Y A;  5LL6 X;  4A75 A;  4DR1 Q;  2B4D B;  3K59 A;  4R8N A;  2PR8 A;  3PRT A;  2NN6 I;  1OXX K;  1NAP A;  1S3O A;  2YTV A;  2PRB A;  3S15 B;  3NQI A;  3QOL A;  1UE7 A;  5D65 A;  5JEA J;  2Q51 A;  2Q4Y A;  1Q81 C;  4MHE A;  3CQZ B;  1Q2D A;  3IWG A;  1R3N A;  3LWU A;  3RLF A;  1K8M A;  1X10 A;  2AJ6 A;  1HQR D;  3PUW A;  1S7K A;  2BH2 A;  4BBS G;  4KV6 A;  1RTN A;  3KQX A;  3TTH A;  3U4V A;  3KAS A;  5KEE A;  5ISV A;  2PJ6 A;  1ENA A;  1NCV A;  2PW7 A;  2K52 A;  1G91 A;  1H8L A;  3G8W A;  2I3C A;  4JI5 L;  3O13 A;  2F8H A;  2PI2 E;  3TSS A;  1I3Q B;  2N88 A;  4GNX A;  5C0X J;  1SYB A;  4L5T A;  2R98 A;  1M44 A;  5C4J B;  4HIK A;  2XVS A;  3EN2 A;  4JLY A;  4GNX C;  2K04 A;  2ARH A;  2JK8 A;  3S1N B;  2G9D A;  3Q24 A;  2F0W A;  3DLL A;  1BUV T;  4JI1 Q;  3CC2 A;  3MGD A;  3TN2 A;  4KY6 A;  3TME A;  3ULL A;  1VQG A;  4FD7 A;  4KOV A;  5KND A;  2PJ9 A;  3BI0 A;  5C4H A;  1Y1V B;  1I21 A;  5K8O A;  3VAT A;  3GP7 A;  3IFT A;  3TO7 A;  2DJF C;  5CMD A;  1Y8P B;  2YU9 B;  4IUN A;  2A6E C;  1HUM A;  2PJ3 A;  4DYO A;  3HOU G;  4ZGY B;  3NH4 A;  2EY2 A;  4ZRZ A;  2A4N A;  2VQE L;  4ZUJ A;  2IQ6 A;  2PC1 A;  5EBD A;  1XMQ L;  1RCV D;  1Y69 U;  4MHY A;  1FD7 D;  4DUY L;  2VXW A;  1F77 A;  3M9B A;  4B3R Q;  1ZXT A;  3SGI A;  5ELD A;  4P74 A;  4DNR B;  1I6H H;  3M4Y A;  3OIQ A;  3HP3 A;  3NBH B;  5GQO A;  2FVG A;  2PQE A;  2EY1 A;  3H15 A;  1GUO A;  3KGQ A;  4F9U A;  1I50 H;  3NTI A;  2PVV A;  4K2L A;  3GB0 A;  1E3P A;  1TY2 A;  2BA0 A;  2GIV A;  4KUB A;  2A68 C;  2B39 A;  3WDN A;  1PFM A;  3EY5 A;  2C35 B;  1Q8I A;  1P8L A;  3S6F A;  1Y14 B;  1D5X C;  5C5M A;  4K30 A;  5JEA G;  3D31 A;  2K6A A;  4P44 A;  3S2H B;  4NXN Q;  2JA8 G;  1LFW A;  3PFO A;  4A3I H;  2DNC A;  2GRE A;  2OXP A;  1BF4 A;  3I4N G;  1Z8L A;  3D2M A;  2F0N A;  4KSF A;  5F48 A;  2V8G A;  1RKN A;  3MXN B;  3FNC A;  4JW0 A;  2AHO B;  2ZXR A;  4X62 L;  3DGV A;  3PB9 X;  2B63 G;  4P75 A;  3SK4 A;  4PPZ A;  5EMI A;  4Y7N B;  1V9P A;  1TU2 B;  2NVQ B;  2ZED A;  4HJ5 A;  3PGZ A;  4MY3 A;  1ONL A;  4CGM A;  3BJ8 A;  5A2Q E;  4P4F A;  1TY0 A;  1MGS A;  3EJI A;  2EZV A;  1CA5 A;  5CV6 A;  2EWB A;  3KLR A;  4DNC A;  4IZ8 A;  3OWF A;  1BCP F;  4PV1 C;  3FBU A;  1VQ9 A;  3TX8 A;  2WIN B;  3E6Z X;  3FPU B;  4QUC A;  3HOU H;  3SK8 A;  1VKC A;  1UAP A;  4E0A A;  3AYH B;  4EVY A;  5CYU A;  1H9J A;  4OME A;  3CCQ A;  4DV6 Q;  5LMU L;  5C44 G;  2UUC L;  4M8A A;  4UF4 A;  3FEW X;  3K58 A;  3H91 A;  5AG5 A;  3D2P A;  3STB C;  3KUP A;  5LMU Q;  3ERQ A;  5COR A;  2QEX A;  3K6O A;  2ZT9 C;  1LAB A;  4R7M A;  1II3 A;  3WR7 A;  4LF8 Q;  4CJ1 B;  3KF6 B;  2P5Z X;  1C7Y A;  3S6H A;  2FSR A;  2CKZ B;  2MO1 A;  4DAV A;  3QG1 A;  2CTB A;  4GXH A;  1L0Y B;  1GHK A;  1UWY A;  3CT9 A;  3RD4 A;  2B63 B;  4Y7N H;  4RFB A;  4DR6 L;  2E2J B;  3SXH A;  4I49 A;  3J81 c;  2B3G A;  4FXK C;  1MKH A;  4DU9 A;  4C68 A;  4RGN A;  1EFW A;  3G71 A;  4JI1 L;  4Y49 B;  1SE8 A;  2KUM A;  1GOZ A;  1B50 A;  1CM0 A;  4KKS A;  3MWY W;  3QJY A;  2PMZ E;  2OZH A;  2JA6 B;  1A0I A;  3CU7 A;  2ID0 A;  1SRO A;  1C8C A;  2UXB Q;  5C3X A;  4JI7 L;  2IT1 A;  1VQA A;  4X62 Q;  4YHH L;  2O4H A;  2XEG A;  4GN4 B;  1SYF A;  3F0A A;  2RCN A;  2L12 A;  5M3M G;  5GCN A;  2Q8T A;  1A15 A;  3P20 A;  1YVC A;  3NUC A;  4CS0 B;  1PH2 A;  1ZLH A;  3B6Y A;  2MGS A;  4EFD A;  4DUZ Q;  1WTX A;  3PO2 G;  1IB1 E;  3M85 A;  4A31 A;  1EU4 A;  3OSO A;  3QOJ A;  1EQQ A;  2AFM A;  5KTA A;  4YIJ A;  1VQ8 A;  1HDU A;  5IGF A;  5DAU A;  4X65 L;  2KCC A;  2PCU A;  1S3Z A;  4KTA A;  3CCJ A;  2Z1C A;  2P0W A;  5EPJ A;  3QR8 A;  1FNO A;  3VA5 A;  2IL8 A;  4IHM A;  3UI2 A;  1E7Z A;  5G22 A;  1N71 A;  3V8I A;  2QEC A;  3K2K A;  4NPS A;  4B3R L;  2JEB I;  4C2Y A;  4B3S Q;  1SNC A;  1CK1 A;  2B2Y C;  4OO1 I;  1KNE A;  3ITP A;  2PRQ A;  3U58 A;  1TKJ A;  5HUR A;  2VQY A;  4TKO B;  3HG9 A;  1I5F A;  3BZD B;  2HQL A;  4V0B A;  4JI3 Q;  2IJ0 A;  3H8F A;  2OZG A;  5DS0 A;  1KUX A;  4QL5 A;  1X3Q A;  1KHI A;  4APV A;  1Y1W G;  1DE4 C;  3SJE A;  4F8M A;  1Q7Y C;  4O1N A;  1VCI A;  4OWW B;  1VQI A;  3L9A X;  2B8G A;  3D4R A;  4JPB W;  2MFI A;  3HOW G;  5LRG A;  3PUZ A;  1U5K A;  4X3S A;  5FO7 B;  4R57 A;  2EOT A;  3NPP A;  3R2I A;  2Z6B A;  1YJN A;  4KJN A;  2LS0 1;  1TXY A;  1EEI D;  2ZJR A;  4IQZ A;  3HOY G;  1EWC A;  1HR0 Q;  3CCV A;  1AEX A;  1JE5 A;  1ZKO A;  4GOP B;  4ONU A;  3AQQ A;  3TRE A;  1XRY A;  3B8G A;  2R6G A;  3DDD A;  4FO2 A;  5FLM G;  1MJE A;  3CC4 A;  1SJE D;  1B70 B;  3PFE A;  3A55 A;  5M5W H;  4OGQ C;  4YFJ A;  2ZM6 Q;  1A2U A;  2FMM A;  4RCO A;  1K8O A;  1ON0 A;  3TE4 A;  2PR1 A;  4NJQ A;  3FHW A;  2XWJ B;  3MXU A;  2KHS A;  2GE3 A;  3V96 A;  2K5D A;  3OYY A;  4R76 A;  3T8W A;  3UE1 A;  1FGB D;  4RHR A;  5LYD A;  1IOF A;  2EO8 A;  3EO4 A;  1AE2 A;  1OXV A;  3MFG A;  4ILW A;  1GHE A;  1F2L A;  1YJ9 A;  4WFN 3;  2Q04 A;  3L3O C;  1BLL E;  3CXP A;  4X3U A;  1ENC A;  4JJX A;  3FKI H;  1BPM A;  1H95 A;  4X66 Q;  5KIX A;  2FIA A;  5JEA H;  3KI9 A;  4DPG A;  1IL8 A;  1FR3 A;  5CV8 A;  5IOC A;  3P2H A;  4UIB A;  3RZA A;  4CRY B;  2BSW A;  5K8P A;  3EIV A;  3GTP H;  5F49 A;  2YND A;  4A39 A;  2FJ2 A;  3B2Y A;  3GO5 A;  5I2X A;  4NJR A;  3HRZ C;  5DM7 3;  1Q1B A;  2ZTE A;  3A7L A;  1STY A;  4U67 3;  5ELB A;  1WI5 A;  1PFB A;  2UUC Q;  4LF6 L;  4P10 A;  2JA7 B;  2EVN A;  3RZD B;  3MHB A;  3IKJ A;  3VH9 A;  2A69 C;  1CP7 A;  3N5F A;  4ID6 A;  1KRS A;  4AH6 A;  4UY8 C;  2GAN A;  2QYV A;  4KI0 A;  2ZEF A;  3GTO B;  3IJ3 A;  3U9S A;  5IGB A;  4B3T Q;  1BNZ A;  2WII B;  4AIM A;  3D8G A;  2V8H A;  2ZEG A;  1Y1V H;  3DHQ A;  1GVP A;  3TZD A;  1K0R A;  2RBM A;  2JE6 I;  4YY3 L;  1CQV A;  1U4L A;  4MCR A;  3FPP A;  4HTH A;  4NW2 A;  1TWF B;  1XEB A;  2V1C C;  4FF3 A;  1DCZ A;  3SK6 A;  4NGR A;  1AUG A;  3EFX D;  3PO3 H;  2A74 C;  1HFN A;  2NVT H;  1SE3 A;  1IKL A;  3W3A A;  4JOI A;  3GYA A;  4JV5 L;  1Z7T A;  3SK5 A;  2J4X A;  4HCS A;  5FLX E;  4NXM L;  4LUO A;  1QB5 D;  3D67 A;  4G7O C;  1Q8K A;  5LMN L;  1D5Z C;  3PO2 H;  1LT6 D;  1WTH A;  1VHE A;  1YR0 A;  3SXN A;  4P4I A;  1R9T B;  2ENB A;  2R3Z A;  2PMZ B;  4XQQ A;  1Y0Y A;  1Y7R A;  1YX0 A;  1CHQ D;  1XIX A;  1SYG A;  4C3I B;  2D0P A;  4KLW A;  1K73 C;  2KQ3 A;  2Q2I A;  1QMU A;  4N9P A;  5C0X G;  2ZOF A;  3GTL B;  1JB7 A;  3OPO A;  1TQO A;  4HR7 B;  3RZO H;  3UY5 A;  3GTK B;  3PSI A;  1WTW A;  4P73 A;  2Y0S B;  2I5H A;  2A6E D;  1FNW A;  5A2Q L;  3W1B A;  5C3W A;  3FEC A;  3DUZ A;  4CKB A;  5IX3 A;  3A7A B;  3IGR A;  1BOB A;  4MHN A;  1STB A;  5I0C A;  1T5X D;  3G4S A;  2VZZ A;  4MFQ A;  3FDT A;  2Z3N A;  2WYR A;  1DGS A;  4A3G H;  1ZO0 A;  3OW7 A;  4UFX A;  1ILQ A;  2PNR C;  4WRD A;  3UDX A;  2AQ2 B;  2FIW A;  1LLR D;  3HGB A;  2OF1 A;  2EE1 A;  5LMN W;  2EJF C;  5LRK A;  4KOU A;  4MHZ A;  1ZYR D;  3WT4 A;  4NFR A;  4NP5 A;  1Y8O B;  3MA2 B;  4NKL A;  1LOK A;  3GY9 A;  3CAM A;  2FE7 A;  2CNT A;  1PYB A;  1WFQ A;  4J1M A;  2JA5 B;  5ELY A;  3EBE A;  1SFO B;  4KJO A;  4V19 0;  2JDD A;  1WD1 A;  2KHI A;  2A19 A;  1K8A C;  5C44 B;  3KK7 A;  2D5D A;  1Z9F A;  2X6G A;  4KOY A;  1YI2 A;  1EYD A;  2Z11 A;  2AFW A;  3BJU A;  4A3J G;  4C3J B;  1QSN A;  1Q2C A;  1NE9 A;  4X64 Q;  2IX1 A;  1R57 A;  2CW0 D;  4P4E A;  4ZY0 A;  4CDD C;  3T1Y L;  1QIL A;  1IYL A;  5KNB A;  3CCL A;  3IC1 A;  1QG7 A;  1YJW A;  4ZX9 A;  4B5P A;  1U0L A;  2AE6 A;  3F2D A;  2D4O A;  1AH9 A;  2OB0 A;  4XQN A;  1Z4R A;  2QCP X;  4DGZ A;  1S60 A;  2O28 A;  3TBI B;  3MEF A;  1I4R A;  4MCS A;  4ME5 A;  2NBF A;  1PXU A;  1JWS D;  2B2T A;  5EC4 A;  5JH9 A;  4KVM E;  4C3J H;  1YSJ A;  5K8M A;  3QB3 A;  3U4Z A;  2WB1 B;  1T5E A;  4K5X A;  2R92 G;  4JI2 L;  3KR5 A;  1YIT A;  1XYI A;  5EBV A;  4ABN A;  3DM1 A;  3JAM E;  3TP6 A;  4A38 A;  1VIX A;  1F9P A;  3CF5 A;  1HTP A;  2Q8I B;  4RA8 A;  4B3T L;  2B3U A;  4JI5 Q;  4MFK A;  4QIW B;  3PF5 A;  2VL1 A;  4P45 A;  1B4O A;  3VA7 A;  4KVX A;  1I6V C;  2R61 A;  1YLO A;  1IHZ A;  3A9L A;  2J8N A;  3R95 A;  1V1O A;  1K4J A;  3NWS A;  4NEX A;  4NB3 A;  4HNY B;  4X2T A;  1L1O B;  4IFD G;  1O80 A;  1P4N A;  5ELE A;  2OWO A;  3K80 C;  1UEA B;  4PZ7 A;  4C3H B;  4OC4 A;  3FVL A;  4AXV A;  1YLE A;  5IT9 L;  1QOH A;  1XNQ L;  3IU1 A;  4MZ9 A;  2TSS A;  1H9R A;  1F9R A;  3NXW A;  5HGT A;  4K6D A;  3HOY B;  5BN3 A;  2BOA A;  3D4W A;  2E2I B;  5FO9 B;  2TMP A;  2WAQ G;  2GU2 A;  3VYT A;  2PYK A;  3CXC A;  3DEO A;  2ALY B;  3E0K A;  5ELO A;  3CRK C;  2VUM H;  1YRE A;  4IOC A;  5JJZ A;  2HT1 A;  1PLF A;  1LTS D;  1J4J A;  2L1B A;  1GUT A;  4OKO A;  4DV2 L;  5IGG A;  4UIA A;  4YWY A;  4PMC A;  2C6P A;  2E2H H;  1KUV A;  2J8M A;  2PQ8 A;  3D6W A;  1K83 H