4A30A

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a pyrazole sulphonamide ligand
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Discovery of a novel class of orally active trypanocidal N-myristoyltransferase inhibitors.
pubmed doi rcsb
source organism Leishmania major
total genus 124
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4a30A00
4UCMA 4A31A 4UFWA 4CGOA 4C2YA 4CYNA 5AG4A 4UCNA 2YNDA 5G22A 4B14A 4BBHA 4CGLA 4UCPA 3IU2A 4A30A 4CGMA 2WUUA 4UFXA 5AG5A 5G21A 5G20A 4CAFA 4UFVA 2YNCA 4C2ZA 2YNCC 3IU1A 4A2ZA 4B13A 5A27A 5A28A 4C2XA 4A95A 4CAEA 4A33A 3JTKA 4CYPA 4CGNA 5AG7A 5AG6A 4B11A 4C68A 4CGPA 4A32A 4B12A 4CYQA 3H5ZA 3IWEA 2WSAA 5AGEA 2YNEA 5G1ZA 4B10A 4C7IA 4C7HA 4CYOA
chains in the Genus database with same CATH superfamily
1CPSA 2X7BA 4C2YA 4Z65A 2I79A 4UCNA 4ZY0A 2DXQA 5CPAA 4EMEA 3LWUA 4EVYA 3I9SA 4QB9A 5HVFA 1QSRA 2AJ6A 2AFSA 4PK2A 2OU2A 2Q4ZA 1YSJA 1YGHA 3VWEA 3N5FA 4P4BA 2PQ8A 2O4HA 2Q4VA 4II9A 3N7ZA 3GIUA 1XE4A 3BHXA 2PJ6A 3GB0A 4I49A 4K30A 4ZYQA 3W6XA 1YX0A 4AVCA 3UY5A 4JXRA 1TKHA 2PR8A 1CM0A 1ON0A 1QSOA 2ZW4A 2OOTA 2P6FA 3PGPA 3RBUA 1LAPA 2CXAA 2FT0A 3IC1A 5BWAB 2QECA 1NSLA 1TF8A 2G3TA 4PXCA 1V0CA 4BMHA 3H4QA 3CPXA 1BO4A 2GANA 4MY0A 4WWVA 3FECA 2J8MA 3GUXA 3VARA 3JRUA 3P2HA 1ZLIA 2F8HA 3PB6X 4PPZA 2R7HA 2GLFA 1BPNA 3GLJA 3KGQA 3EY5A 3ZZIA 3H8EA 3B3WA 3IO1A 3JUWA 4HNXB 3S9LA 1Q2CA 3SI0A 1VHEA 2PJBA 1HEEA 4C68A 3TFYA 3S6GA 4AG7A 4CYQA 3MRUA 4NGNA 2RC4A 3WC6A 3LMSA 1ARLA 4R9MA 2G9DA 5JQ4A 2HC9A 1YMEA 1WK4A 2WPWA 5JH9A 2NSMA 1QQ9A 1ZG9A 1YLEA 5JM6A 4B14A 1F57A 4DNCA 4ZY1A 4NGTA 4FD6A 4KUBA 4CAFA 3I1UA 4CAWA 4OADA 2BUEA 5I4MA 5J8CA 2ABZA 4R7MA 3FMCA 1S3ZA 4KSIA 3NFZA 3TOBA 4CRYB 1S60A 4F8ZA 4P4JA 4CYPA 1Z8TA 4JJXA 2GFQA 2R8VA 4UBRA 5AG6A 2Z11A 4CGPA 3R96A 3RAMA 4H6UA 1F2OA 2OZHA 5KTAA 2VEZA 1XMBA 2REFA 4UIBA 4KOVA 4ZBGA 3PRTA 3CZXA 4A31A 3LODA 4OC5A 2GU2A 4Y49B 4ZX9A 4MHNA 3P2FA 2V8VA 4OC1A 5H86A 1RXTA 3SXNA 3WC5A 1R3NA 2YNDA 2D4PA 4MCSA 2O53A 1PUAA 3IU2A 4CAVA 1U6MA 1RO5A 2FVGA 4OAEA 4IAVA 4FBEA 5AG5A 4PSWA 3DDDA 2QJ8A 2PVWA 3PEIA 4GS4A 4JZ0A 3EC4A 2QVPA 2HV2A 1YK3A 5C88A 4XPDC 4CAEA 4A33A 3DSBA 3SJEA 1M4LA 4DJLA 4MJ8A 3R1KA 5F48A 2F5IA 3D7GA 1XIXA 3JVNA 1R43A 2ZEPA 4ZX8A 3IFEA 1KUVA 2WSAA 2JDDA 1IOIA 1YVOA 1IICA 2Q0YA 3SJXA 4A37A 3B3SA 3DLJA 3L2NA 1DTDA 3FF3A 4MHYA 1SQHA 4MXUA 4UEZA 1IGBA 3PZJA 3RYOA 2Q7SA 4BBHA 2CF4A 1TKFA 2Q04A 4A30A 3PB8X 1Z4RA 4MFKA 3B8GA 2EWBA 1X10A 3CXQA 3TO6A 2JLMA 4Q38A 2EVNA 4B5PB 5HH1A 1HDUA 1JWQA 2PJ8A 3F8KA 4FWUA 2IMOA 3B7IA 4B11A 2C6PA 2VI7A 2FE7A 1YR0A 2QIRA 1IYLA 1X12A 2FCKA 3NH4A 2P6EA 2V8GA 2D4OA 3DNSA 1Y9KA 5HXDA 3KQXA 3GYAA 4OC0A 1YW4A 3T90A 4X5KA 2P0WA 1QMUA 1LOKA 4U9ZA 1Q2YA 3FNCA 3ISZA 3PP9A 4F9VA 4PXDA 1BPMA 1XMTA 3DR8A 2VBQA 5EC4A 5EMIA 3IIBA 2ZW6A 1ARMA 1Q2DA 1WWZA 4NFRA 4P45A 2WZNA 1VIXA 4MHPA 2AFZA 3NA6A 1I21A 1CX8A 3V8IA 3PFEA 3BI0A 2PJ7A 4CRZB 4LQGA 4CGNA 3OWCA 3FX6A 3D67A 4XNHC 3W91A 1TKJA 5FVJA 4NF1A 4EWTA 3D3SA 2CNMA 3H5ZA 4OIWA 1LFWA 2IJZA 2NYQA 2PJ4A 3FBUA 3B2YA 4QC6A 4RN7A 1IY7A 3LACA 3FRMA 4OC2A 2R1IA 2ZW5A 4R6TA 1MJ9A 3GKRA 1LAMA 3FYNA 2HUZA 1M44A 2B3UA 3D2MA 4OC3A 5E96A 4MMOA 4P10A 5JGFA 2EO8A 4PK3A 2ZW7A 1Z2LA 5G20A 2H5MA 4XPKA 4B6ZA 4JWPA 1GHEA 1YLOA 2B4BA 3QB8A 3T9YA 4C2ZA 2XEIA 5HVGA 1YW6A 1Z8WA 2PJ3A 2ZOGA 4ZI6A 2JBJA 2ZEGA 5LYFA 2FL4A 4CPAA 3KHZA 4GM5A 4OC4A 1ZG7A 2Y0MA 1BOBA 1Z8XA 3E0KA 1YVKA 3IJ3A 1F2PA 3CT9A 4P4FA 4BD9A 2PC1A 2PSWA 1M4IA 1MJBA 4RI1A 4C7HA 2J8NA 2VL1A 4KVME 4KOUA 5D29A 4B5PA 4M6GA 3TCVA 5AG4A 2GLJA 4MCRA 3W6SA 4E8OA 4WJBA 3MN8A 4IF5A 4NGRA 3BJ7A 3SI2A 4B5OA 1XRYA 4EFDA 1TXRA 2ZOFA 2ARHA 4ORFA 4P4DA 3K9UA 2C6GA 2WUUA 4X8IA 4P4IA 1UWYA 2PJ9A 5G21A 1I1DA 4H2KA 4H89A 3HLPA 4KORA 4M85A 3R9FA 3PB7X 1PCAA 3DGVA 3WC7A 4AG9A 2ZXVA 4KSFA 3VWDA 2Q51A 3NE7A 4MCPA 4A95A 4FAIA 4OIDA 3FEEA 4HPSA 1Z9UA 4HKFA 4Q7AA 4UIAA 2PRQA 5K8MA 4TWEA 4F6AA 1ELLP 4C7IA 4UWIA 3CPAA 1NSAA 1Y7RA 2REEA 3KR5A 1TIQA 1H8LA 3TC8A 1LRZA 1Z5RA 3BJ8A 5IX3A 3F5BA 2XEGA 2EK9A 3QAYA 3WT4A 2CTBA 4KS9A 5K8NA 3QAHA 3KZWA 1IB1E 3PBEA 2PJCA 5J1QA 2NMTA 2DPSA 3RZAA 4AB7A 1JQGA 2ATRA 4R3LA 3D7HA 3S6HA 2Q44A 4MHZA 2C6CA 4A2ZA 3RO0A 3RNZA 2PCUA 4JXQA 4PV6A 1Z4EA 2O28A 5AG7A 4H6ZA 1M1DA 4AVBA 2Z3KA 4NCZA 1XJOA 2CIJA 2DPTA 2B5GA 2PE3A 4QUSA 2OZGA 4NJRA 1HDQA 1MK4A 1EE3P 3C26A 5G1ZA 4RUHA 3SI1A 2AFUA 4CYNA 2G0BA 4NGSA 3H8FA 3D4UA 4L89A 4PQAA 4IUSA 5I0CA 4XPLA 1VKCA 3TT2A 4U9YA 1Y0YA 5G22A 3DR6A 1AUGA 5EBVA 1LANA 1Y7EA 2C27A 2EUIA 4MRIA 1KUXA 4YGOA 2AE6A 4RS2A 2KCWA 4A38A 1B87A 1CPXA 1GYTA 1Q7LA 1L0CA 2BOAA 5LRJA 3TOAA 1BLLE 1MJAA 1AMPA 4MFQA 3ISXA 2P6GA 4P6YA 4E2AA 2Z0ZA 4X3RA 3F0AA 3BLNA 4YU9A 4ONWA 3FIXA 2BSWA 4JYWA 3QNVA 4P4EA 1DE4C 4YRHA 3R95A 4B12A 1ELMP 4KOTA 3PFOA 2ZEOA 3B3TA 5D8NA 4KLWA 2AFOA 3CXPA 3NE8A 2A4NA 3V38A 4NSQA 5F46A 1B6BA 4OP4A 3PB4X 3B3VA 3FVLA 3B3CA 4KOWA 4IHMA 2HQYA 4L8AA 3K2KA 1PU9A 4LUAA 4MCQA 2FS5A 4R87A 4LQ6A 2YNCC 4W9YA 4CS0B 4B13A 1NE9A 2FXFA 4BINA 3JTKA 2PIYA 1IOFA 1RTQA 2Z3LA 1M4DA 4R57A 2K5TA 7CPAA 2C1CA 4OLLA 3FB3A 4UA3A 4X2TA 5AGEA 2YNEA 4KLVA 5KTDA 1QSMA 4MI4A 4E0AA 5KTCA 4UFWA 2V8DA 3H8GA 1J4JA 4XPDB 3FEDA 4MHDA 5HMNA 1LCPA 2V77A 2BL1A 3D7DA 1CP6A 2PR1A 3T8WA 4KOXA 4NEXA 4CGMA 1CBXA 3KKWA 2B4DA 1PYTB 1Y9WA 3LD2A 4M6IA 4R3KA 2AFMA 4UFVA 3D68A 5CNPA 4A39A 4F9UA 2B5GB 4K3NA 4M6HA 2DEAA 3IU1A 2CNSA 4Y49C 4ZY2A 3S6KA 3SJFA 4UWJA 2B3VA 2PIZA 2ODFA 4NJQA 2PVVA 4UEFA 3K9TA 4KVXA 1FNOA 1KWMA 3NH8A 5DWNA 3D2PA 2FIWA 3WABA 2GE3A 2F7VA 2HB6A 2PDOA 2WPXA 4HNYB 1P0HA 2PJAA 2AFWA 5THWA 3PBBA 1Y0RA 1N71A 3MGDA 1UFHA 4O23A 2ZEFA 2BO9A 4JLYA 1I12A 2BEIA 4CGOA 5ISVA 3I3GA 4R76A 3SJGA 4OKOA 4R8FA 1A2ZA 2ZELA 4J3GA 4MFLA 4IK2A 2OZUA 5LYLA 2OR4A 2OH1A 1KUYA 5GCNA 1XF8A 1ZO0A 3S9MA 5CBMA 3R9EA 5LYIA 3SHPA 2WYRA 4KOSA 5HVHA 1XBUA 1M4GA 2XEJA 5A27A 4C2XA 4NGQA 5DWMA 4ZGYB 3KHXA 3TX8A 2QYVA 4UF4A 4FUUA 4KUAA 2VQYA 1IYKA 3S6FA 3IWEA 2PRBA 4F0YA 3KASA 4NXYA 4PXBA 4CAXA 5A28A 5LRKA 3D7FA 2EBJA 4MFPA 2G3AA 5ELYA 4Q36A 4OMEA 4JD6A 2JEVA 2GREA 2ZPAA 4FD4A 1IIDA 4XNHB 2R98A 4QVTA 4CGLA 5F09A 2PJ5A 3S9NA 5JPHA 1IU8A 4UFXA 2RB7A 4A94A 3EXNA 1XFOA 2GIVA 2ZEEA 1AYEA 2Q7BA 4AXVA 1P4NA 2POKA 8CPAA 2B58A 1VGYA 4QBJA 1ZG8A 5IB0A 3TE4A 2JBKA 4LX9A 2Q4YA 3IWGA 2I00A 2Z3MA 4UEEA 2Z3PA 3D8PA 5H84A 3TO7A 5K8PA 6CPAA 3ZJ0A 4GXHA 2PJ2A 5J8FA 2JDCA 1FT7A 2DF5A 3EO4A 3TTHA 3A9LA 4F0XA 4NGPA 3NH5A 2IL4A 3B35A 3SXOA 2B4DB 1XEBA 1S7NA 4UCMA 1TF9A 4G1PA 1YREA 1ZLHA 1S7LA 4HNWB 4PSXA 1S7KA 3EFAA 2OB0A 2Z10A 1OBRA 2JEWA 2IQ6A 4KOYA 2AFXA 2Z3NA 5DS0A 1CJWA 2I3CA 3D66A 4FD7A 1FY7A 1XOVA 4MY3A 5F47A 3IEHA 4DUKA 4YFJA 2Z3OA 1YQEA 3WR7A 4KSAA 1K4JA 3KL9A 3VATA 2ZEHA 3R9GA 5IV0A 4M3SA 3CDXA 2V8HA 3KR4A 4U5YA 2VZZA 2PJ1A 2ZEDA 1R57A 3IWWA 5LYDA 5F49A 3PB9X 4CYOA 3CXSA 1S7FA 2FSRA 1VHSA 4DYOA 4PXEA 2EK8A 4KZTA 1VHOA 1BAVA 2BCOA 2J8RA 2QMLA 1OZPA 3BI1A 3GY9A 4NGMA 4FD5A 1S5KA 4TNUA 2ANPA 4MBUA 4UCPA 2CY2A 2YGWA 3VH9A 2RFHA 5IB9A 5LRGA 1CP7A 5C82A 2CNTA 2J9AA 2Q43A 2VZYA 3G8WA 2CTCA 3KI9A 1KZFA 3FJUA 2VXKA 2YNCA 4KVOE 4MFJA 4AVAA 2ZEMA 3FH4A 4YWYA 5K8OA 2PJ0A 1QSNA 3V7ZA 1NMTA 4ONUA 2FIAA 3HUVA 3IGRA 2XEFA 1CG2A 4A32A 3G3SA 1Z8LA 2ZENA 3KQZA 3BXMA 3FXTA 1QSTA 4P44A 3TO9A 4B10A 4MFZA
chains in the Genus database with same CATH topology
2X7BA 4C2YA 2I79A 4UCNA 2DXQA 4EVYA 3I9SA 4QB9A 1QSRA 2AJ6A 4PK2A 2OU2A 1YGHA 3VWEA 2PQ8A 4II9A 2Q4VA 3N7ZA 1XE4A 4I49A 4K30A 3W6XA 1YX0A 4AVCA 3UY5A 4JXRA 2PR8A 1CM0A 1ON0A 1QSOA 2ZW4A 2P6FA 3PGPA 2CXAA 2FT0A 5BWAB 2QECA 1NSLA 2G3TA 1V0CA 4BMHA 3H4QA 1BO4A 2GANA 4MY0A 2J8MA 3P2HA 2R7HA 3EY5A 3JUWA 4HNXB 1Q2CA 4C68A 3TFYA 3S6GA 4AG7A 4CYQA 2RC4A 4R9MA 5JQ4A 1WK4A 2WPWA 1YLEA 4B14A 4DNCA 4FD6A 4KUBA 4CAFA 4CAWA 4OADA 2BUEA 5J8CA 1S3ZA 3TOBA 4CRYB 1S60A 4CYPA 4JJXA 2R8VA 4UBRA 5AG6A 2Z11A 4CGPA 3R96A 4H6UA 2OZHA 5KTAA 2VEZA 2REFA 4KOVA 4ZBGA 4A31A 3LODA 5H86A 4Y49B 3SXNA 3P2FA 1RXTA 2YNDA 2D4PA 1PUAA 3IU2A 4CAVA 1U6MA 1RO5A 4OAEA 5AG5A 4PSWA 3DDDA 4GS4A 3EC4A 2HV2A 1YK3A 5C88A 4XPDC 4CAEA 4A33A 3DSBA 4MJ8A 3R1KA 5F48A 2F5IA 1XIXA 3JVNA 1KUVA 2WSAA 2JDDA 1YVOA 1IICA 2Q0YA 1SQHA 3PZJA 3RYOA 4BBHA 2Q04A 4A30A 1Z4RA 4MFKA 3B8GA 3CXQA 3TO6A 2JLMA 4Q38A 2EVNA 4B5PB 5HH1A 3F8KA 4B11A 2VI7A 2FE7A 1YR0A 2QIRA 1IYLA 2FCKA 2P6EA 2D4OA 3DNSA 1Y9KA 3GYAA 4X5KA 2P0WA 4U9ZA 1Q2YA 3FNCA 3PP9A 1XMTA 3DR8A 2VBQA 5EC4A 2ZW6A 1Q2DA 1WWZA 1I21A 3V8IA 4CRZB 4CGNA 3OWCA 4XNHC 3W91A 5FVJA 4NF1A 3D3SA 2CNMA 3H5ZA 3FBUA 4QC6A 3FRMA 2R1IA 2ZW5A 1MJ9A 3GKRA 3FYNA 2HUZA 1M44A 2B3UA 3D2MA 5E96A 4PK3A 2ZW7A 5G20A 2H5MA 4XPKA 4JWPA 1GHEA 3QB8A 2B4BA 3T9YA 4C2ZA 2FL4A 2Y0MA 1BOBA 3E0KA 1YVKA 2PC1A 2PSWA 1M4IA 1MJBA 4RI1A 4C7HA 2J8NA 4KVME 4KOUA 4B5PA 3TCVA 5AG4A 4E8OA 3W6SA 4IF5A 4B5OA 3BJ7A 2ARHA 4ORFA 3K9UA 2WUUA 5G21A 1I1DA 4H89A 4KORA 4M85A 3R9FA 4AG9A 2ZXVA 4KSFA 3VWDA 3NE7A 4A95A 1Z9UA 4HKFA 4F6AA 4C7IA 4UWIA 1Y7RA 2REEA 1TIQA 1LRZA 3BJ8A 5IX3A 3F5BA 4KS9A 3QAHA 1IB1E 2NMTA 2DPSA 4AB7A 2ATRA 4R3LA 3S6HA 2Q44A 4A2ZA 4JXQA 4PV6A 1Z4EA 2O28A 5AG7A 4H6ZA 1M1DA 4AVBA 2Z3KA 4NCZA 4QUSA 2DPTA 3T90A 2B5GA 5G1ZA 3ZZIA 2OZGA 1MK4A 3C26A 4CYNA 2G0BA 4L89A 4IUSA 5I0CA 4XPLA 1VKCA 3TT2A 4U9YA 5G22A 3DR6A 5EBVA 2C27A 4YGOA 2EUIA 1KUXA 2AE6A 4RS2A 2KCWA 1B87A 3TOAA 1L0CA 1MJAA 4MFQA 2P6GA 4E2AA 2Z0ZA 3F0AA 3BLNA 3FIXA 2BSWA 4YRHA 3R95A 4B12A 4KOTA 4KLWA 3CXPA 2A4NA 4NSQA 5F46A 1B6BA 4KOWA 2HQYA 4L8AA 1PU9A 4LUAA 2FS5A 4R87A 2YNCC 4CS0B 4B13A 1NE9A 2FXFA 3JTKA 2Z3LA 1M4DA 4R57A 2K5TA 4OLLA 3FB3A 4UA3A 5AGEA 2YNEA 4KLVA 5KTDA 1QSMA 4MI4A 4E0AA 5KTCA 4UFWA 1J4JA 4XPDB 4MHDA 5HMNA 2BL1A 2PR1A 4KOXA 4NEXA 4CGMA 3KKWA 2B4DA 1Y9WA 3LD2A 4R3KA 4UFVA 5CNPA 5IV0A 2B5GB 3IU1A 3S6KA 2CNSA 4Y49C 4UWJA 2B3VA 4KVXA 5DWNA 3D2PA 2FIWA 2GE3A 2PDOA 2WPXA 4HNYB 1P0HA 1N71A 3MGDA 1UFHA 4JLYA 1I12A 2BEIA 4CGOA 5ISVA 3I3GA 4J3GA 4MFLA 2OZUA 2OH1A 1KUYA 5GCNA 1XF8A 1ZO0A 3R9EA 3SHPA 4KOSA 1M4GA 5A27A 4C2XA 5DWMA 4ZGYB 4KUAA 2VQYA 1IYKA 3S6FA 3IWEA 2PRBA 4F0YA 4NXYA 4CAXA 5A28A 4MFPA 2G3AA 4Q36A 4JD6A 2JEVA 2ZPAA 4FD4A 1IIDA 4XNHB 2R98A 4QVTA 4CGLA 5JPHA 4UFXA 3EXNA 2GIVA 2Q7BA 1P4NA 2B58A 5IB0A 3TE4A 4LX9A 2Q4YA 3IWGA 2I00A 2Z3MA 2Z3PA 3D8PA 5H84A 3TO7A 3ZJ0A 5J8FA 2JDCA 3EO4A 3TTHA 4F0XA 3A9LA 2IL4A 3SXOA 2B4DB 1XEBA 1S7NA 4UCMA 1YREA 1S7LA 4HNWB 4PSXA 1S7KA 3EFAA 2OB0A 2Z10A 4QBJA 4KOYA 2Z3NA 1CJWA 4FD7A 4MY3A 5F47A 1FY7A 4YFJA 2Z3OA 3WR7A 4KSAA 1K4JA 3R9GA 4M3SA 4U5YA 2VZZA 1R57A 5F49A 4CYOA 3CXSA 1S7FA 2FSRA 1VHSA 4KZTA 2J8RA 2QMLA 1OZPA 3GY9A 4FD5A 1S5KA 4MBUA 4UCPA 2CY2A 2YGWA 5C82A 2CNTA 2VZYA 3G8WA 1KZFA 2VXKA 2YNCA 4KVOE 4MFJA 4AVAA 1QSNA 1NMTA 4ONUA 2FIAA 3IGRA 4A32A 3G3SA 3FXTA 1QSTA 3TO9A 4B10A 4MFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UCM A;  4A31 A;  4UFW A;  4CGO A;  4C2Y A;  4CYN A;  5AG4 A;  4UCN A;  2YND A;  5G22 A;  4B14 A;  4BBH A;  4CGL A;  4UCP A;  3IU2 A;  4A30 A;  4CGM A;  2WUU A;  4UFX A;  5AG5 A;  5G21 A;  5G20 A;  4CAF A;  4UFV A;  2YNC A;  4C2Z A;  2YNC C;  3IU1 A;  4A2Z A;  4B13 A;  5A27 A;  5A28 A;  4C2X A;  4A95 A;  4CAE A;  4A33 A;  3JTK A;  4CYP A;  4CGN A;  5AG7 A;  5AG6 A;  4B11 A;  4C68 A;  4CGP A;  4A32 A;  4B12 A;  4CYQ A;  3H5Z A;  3IWE A;  2WSA A;  5AGE A;  2YNE A;  5G1Z A;  4B10 A;  4C7I A;  4C7H A;  4CYO A; 
#chains in the Genus database with same CATH topology
 1CPS A;  2X7B A;  4C2Y A;  4Z65 A;  2I79 A;  4UCN A;  4ZY0 A;  2DXQ A;  5CPA A;  4EME A;  3LWU A;  4EVY A;  3I9S A;  4QB9 A;  5HVF A;  1QSR A;  2AJ6 A;  2AFS A;  4PK2 A;  2OU2 A;  2Q4Z A;  1YSJ A;  1YGH A;  3VWE A;  3N5F A;  4P4B A;  2PQ8 A;  2O4H A;  2Q4V A;  4II9 A;  3N7Z A;  3GIU A;  1XE4 A;  3BHX A;  2PJ6 A;  3GB0 A;  4I49 A;  4K30 A;  4ZYQ A;  3W6X A;  1YX0 A;  4AVC A;  3UY5 A;  4JXR A;  1TKH A;  2PR8 A;  1CM0 A;  1ON0 A;  1QSO A;  2ZW4 A;  2OOT A;  2P6F A;  3PGP A;  3RBU A;  1LAP A;  2CXA A;  2FT0 A;  3IC1 A;  5BWA B;  2QEC A;  1NSL A;  1TF8 A;  2G3T A;  4PXC A;  1V0C A;  4BMH A;  3H4Q A;  3CPX A;  1BO4 A;  2GAN A;  4MY0 A;  4WWV A;  3FEC A;  2J8M A;  3GUX A;  3VAR A;  3JRU A;  3P2H A;  1ZLI A;  2F8H A;  3PB6 X;  4PPZ A;  2R7H A;  2GLF A;  1BPN A;  3GLJ A;  3KGQ A;  3EY5 A;  3ZZI A;  3H8E A;  3B3W A;  3IO1 A;  3JUW A;  4HNX B;  3S9L A;  1Q2C A;  3SI0 A;  1VHE A;  2PJB A;  1HEE A;  4C68 A;  3TFY A;  3S6G A;  4AG7 A;  4CYQ A;  3MRU A;  4NGN A;  2RC4 A;  3WC6 A;  3LMS A;  1ARL A;  4R9M A;  2G9D A;  5JQ4 A;  2HC9 A;  1YME A;  1WK4 A;  2WPW A;  5JH9 A;  2NSM A;  1QQ9 A;  1ZG9 A;  1YLE A;  5JM6 A;  4B14 A;  1F57 A;  4DNC A;  4ZY1 A;  4NGT A;  4FD6 A;  4KUB A;  4CAF A;  3I1U A;  4CAW A;  4OAD A;  2BUE A;  5I4M A;  5J8C A;  2ABZ A;  4R7M A;  3FMC A;  1S3Z A;  4KSI A;  3NFZ A;  3TOB A;  4CRY B;  1S60 A;  4F8Z A;  4P4J A;  4CYP A;  1Z8T A;  4JJX A;  2GFQ A;  2R8V A;  4UBR A;  5AG6 A;  2Z11 A;  4CGP A;  3R96 A;  3RAM A;  4H6U A;  1F2O A;  2OZH A;  5KTA A;  2VEZ A;  1XMB A;  2REF A;  4UIB A;  4KOV A;  4ZBG A;  3PRT A;  3CZX A;  4A31 A;  3LOD A;  4OC5 A;  2GU2 A;  4Y49 B;  4ZX9 A;  4MHN A;  3P2F A;  2V8V A;  4OC1 A;  5H86 A;  1RXT A;  3SXN A;  3WC5 A;  1R3N A;  2YND A;  2D4P A;  4MCS A;  2O53 A;  1PUA A;  3IU2 A;  4CAV A;  1U6M A;  1RO5 A;  2FVG A;  4OAE A;  4IAV A;  4FBE A;  5AG5 A;  4PSW A;  3DDD A;  2QJ8 A;  2PVW A;  3PEI A;  4GS4 A;  4JZ0 A;  3EC4 A;  2QVP A;  2HV2 A;  1YK3 A;  5C88 A;  4XPD C;  4CAE A;  4A33 A;  3DSB A;  3SJE A;  1M4L A;  4DJL A;  4MJ8 A;  3R1K A;  5F48 A;  2F5I A;  3D7G A;  1XIX A;  3JVN A;  1R43 A;  2ZEP A;  4ZX8 A;  3IFE A;  1KUV A;  2WSA A;  2JDD A;  1IOI A;  1YVO A;  1IIC A;  2Q0Y A;  3SJX A;  4A37 A;  3B3S A;  3DLJ A;  3L2N A;  1DTD A;  3FF3 A;  4MHY A;  1SQH A;  4MXU A;  4UEZ A;  1IGB A;  3PZJ A;  3RYO A;  2Q7S A;  4BBH A;  2CF4 A;  1TKF A;  2Q04 A;  4A30 A;  3PB8 X;  1Z4R A;  4MFK A;  3B8G A;  2EWB A;  1X10 A;  3CXQ A;  3TO6 A;  2JLM A;  4Q38 A;  2EVN A;  4B5P B;  5HH1 A;  1HDU A;  1JWQ A;  2PJ8 A;  3F8K A;  4FWU A;  2IMO A;  3B7I A;  4B11 A;  2C6P A;  2VI7 A;  2FE7 A;  1YR0 A;  2QIR A;  1IYL A;  1X12 A;  2FCK A;  3NH4 A;  2P6E A;  2V8G A;  2D4O A;  3DNS A;  1Y9K A;  5HXD A;  3KQX A;  3GYA A;  4OC0 A;  1YW4 A;  3T90 A;  4X5K A;  2P0W A;  1QMU A;  1LOK A;  4U9Z A;  1Q2Y A;  3FNC A;  3ISZ A;  3PP9 A;  4F9V A;  4PXD A;  1BPM A;  1XMT A;  3DR8 A;  2VBQ A;  5EC4 A;  5EMI A;  3IIB A;  2ZW6 A;  1ARM A;  1Q2D A;  1WWZ A;  4NFR A;  4P45 A;  2WZN A;  1VIX A;  4MHP A;  2AFZ A;  3NA6 A;  1I21 A;  1CX8 A;  3V8I A;  3PFE A;  3BI0 A;  2PJ7 A;  4CRZ B;  4LQG A;  4CGN A;  3OWC A;  3FX6 A;  3D67 A;  4XNH C;  3W91 A;  1TKJ A;  5FVJ A;  4NF1 A;  4EWT A;  3D3S A;  2CNM A;  3H5Z A;  4OIW A;  1LFW A;  2IJZ A;  2NYQ A;  2PJ4 A;  3FBU A;  3B2Y A;  4QC6 A;  4RN7 A;  1IY7 A;  3LAC A;  3FRM A;  4OC2 A;  2R1I A;  2ZW5 A;  4R6T A;  1MJ9 A;  3GKR A;  1LAM A;  3FYN A;  2HUZ A;  1M44 A;  2B3U A;  3D2M A;  4OC3 A;  5E96 A;  4MMO A;  4P10 A;  5JGF A;  2EO8 A;  4PK3 A;  2ZW7 A;  1Z2L A;  5G20 A;  2H5M A;  4XPK A;  4B6Z A;  4JWP A;  1GHE A;  1YLO A;  2B4B A;  3QB8 A;  3T9Y A;  4C2Z A;  2XEI A;  5HVG A;  1YW6 A;  1Z8W A;  2PJ3 A;  2ZOG A;  4ZI6 A;  2JBJ A;  2ZEG A;  5LYF A;  2FL4 A;  4CPA A;  3KHZ A;  4GM5 A;  4OC4 A;  1ZG7 A;  2Y0M A;  1BOB A;  1Z8X A;  3E0K A;  1YVK A;  3IJ3 A;  1F2P A;  3CT9 A;  4P4F A;  4BD9 A;  2PC1 A;  2PSW A;  1M4I A;  1MJB A;  4RI1 A;  4C7H A;  2J8N A;  2VL1 A;  4KVM E;  4KOU A;  5D29 A;  4B5P A;  4M6G A;  3TCV A;  5AG4 A;  2GLJ A;  4MCR A;  3W6S A;  4E8O A;  4WJB A;  3MN8 A;  4IF5 A;  4NGR A;  3BJ7 A;  3SI2 A;  4B5O A;  1XRY A;  4EFD A;  1TXR A;  2ZOF A;  2ARH A;  4ORF A;  4P4D A;  3K9U A;  2C6G A;  2WUU A;  4X8I A;  4P4I A;  1UWY A;  2PJ9 A;  5G21 A;  1I1D A;  4H2K A;  4H89 A;  3HLP A;  4KOR A;  4M85 A;  3R9F A;  3PB7 X;  1PCA A;  3DGV A;  3WC7 A;  4AG9 A;  2ZXV A;  4KSF A;  3VWD A;  2Q51 A;  3NE7 A;  4MCP A;  4A95 A;  4FAI A;  4OID A;  3FEE A;  4HPS A;  1Z9U A;  4HKF A;  4Q7A A;  4UIA A;  2PRQ A;  5K8M A;  4TWE A;  4F6A A;  1ELL P;  4C7I A;  4UWI A;  3CPA A;  1NSA A;  1Y7R A;  2REE A;  3KR5 A;  1TIQ A;  1H8L A;  3TC8 A;  1LRZ A;  1Z5R A;  3BJ8 A;  5IX3 A;  3F5B A;  2XEG A;  2EK9 A;  3QAY A;  3WT4 A;  2CTB A;  4KS9 A;  5K8N A;  3QAH A;  3KZW A;  1IB1 E;  3PBE A;  2PJC A;  5J1Q A;  2NMT A;  2DPS A;  3RZA A;  4AB7 A;  1JQG A;  2ATR A;  4R3L A;  3D7H A;  3S6H A;  2Q44 A;  4MHZ A;  2C6C A;  4A2Z A;  3RO0 A;  3RNZ A;  2PCU A;  4JXQ A;  4PV6 A;  1Z4E A;  2O28 A;  5AG7 A;  4H6Z A;  1M1D A;  4AVB A;  2Z3K A;  4NCZ A;  1XJO A;  2CIJ A;  2DPT A;  2B5G A;  2PE3 A;  4QUS A;  2OZG A;  4NJR A;  1HDQ A;  1MK4 A;  1EE3 P;  3C26 A;  5G1Z A;  4RUH A;  3SI1 A;  2AFU A;  4CYN A;  2G0B A;  4NGS A;  3H8F A;  3D4U A;  4L89 A;  4PQA A;  4IUS A;  5I0C A;  4XPL A;  1VKC A;  3TT2 A;  4U9Y A;  1Y0Y A;  5G22 A;  3DR6 A;  1AUG A;  5EBV A;  1LAN A;  1Y7E A;  2C27 A;  2EUI A;  4MRI A;  1KUX A;  4YGO A;  2AE6 A;  4RS2 A;  2KCW A;  4A38 A;  1B87 A;  1CPX A;  1GYT A;  1Q7L A;  1L0C A;  2BOA A;  5LRJ A;  3TOA A;  1BLL E;  1MJA A;  1AMP A;  4MFQ A;  3ISX A;  2P6G A;  4P6Y A;  4E2A A;  2Z0Z A;  4X3R A;  3F0A A;  3BLN A;  4YU9 A;  4ONW A;  3FIX A;  2BSW A;  4JYW A;  3QNV A;  4P4E A;  1DE4 C;  4YRH A;  3R95 A;  4B12 A;  1ELM P;  4KOT A;  3PFO A;  2ZEO A;  3B3T A;  5D8N A;  4KLW A;  2AFO A;  3CXP A;  3NE8 A;  2A4N A;  3V38 A;  4NSQ A;  5F46 A;  1B6B A;  4OP4 A;  3PB4 X;  3B3V A;  3FVL A;  3B3C A;  4KOW A;  4IHM A;  2HQY A;  4L8A A;  3K2K A;  1PU9 A;  4LUA A;  4MCQ A;  2FS5 A;  4R87 A;  4LQ6 A;  2YNC C;  4W9Y A;  4CS0 B;  4B13 A;  1NE9 A;  2FXF A;  4BIN A;  3JTK A;  2PIY A;  1IOF A;  1RTQ A;  2Z3L A;  1M4D A;  4R57 A;  2K5T A;  7CPA A;  2C1C A;  4OLL A;  3FB3 A;  4UA3 A;  4X2T A;  5AGE A;  2YNE A;  4KLV A;  5KTD A;  1QSM A;  4MI4 A;  4E0A A;  5KTC A;  4UFW A;  2V8D A;  3H8G A;  1J4J A;  4XPD B;  3FED A;  4MHD A;  5HMN A;  1LCP A;  2V77 A;  2BL1 A;  3D7D A;  1CP6 A;  2PR1 A;  3T8W A;  4KOX A;  4NEX A;  4CGM A;  1CBX A;  3KKW A;  2B4D A;  1PYT B;  1Y9W A;  3LD2 A;  4M6I A;  4R3K A;  2AFM A;  4UFV A;  3D68 A;  5CNP A;  4A39 A;  4F9U A;  2B5G B;  4K3N A;  4M6H A;  2DEA A;  3IU1 A;  2CNS A;  4Y49 C;  4ZY2 A;  3S6K A;  3SJF A;  4UWJ A;  2B3V A;  2PIZ A;  2ODF A;  4NJQ A;  2PVV A;  4UEF A;  3K9T A;  4KVX A;  1FNO A;  1KWM A;  3NH8 A;  5DWN A;  3D2P A;  2FIW A;  3WAB A;  2GE3 A;  2F7V A;  2HB6 A;  2PDO A;  2WPX A;  4HNY B;  1P0H A;  2PJA A;  2AFW A;  5THW A;  3PBB A;  1Y0R A;  1N71 A;  3MGD A;  1UFH A;  4O23 A;  2ZEF A;  2BO9 A;  4JLY A;  1I12 A;  2BEI A;  4CGO A;  5ISV A;  3I3G A;  4R76 A;  3SJG A;  4OKO A;  4R8F A;  1A2Z A;  2ZEL A;  4J3G A;  4MFL A;  4IK2 A;  2OZU A;  5LYL A;  2OR4 A;  2OH1 A;  1KUY A;  5GCN A;  1XF8 A;  1ZO0 A;  3S9M A;  5CBM A;  3R9E A;  5LYI A;  3SHP A;  2WYR A;  4KOS A;  5HVH A;  1XBU A;  1M4G A;  2XEJ A;  5A27 A;  4C2X A;  4NGQ A;  5DWM A;  4ZGY B;  3KHX A;  3TX8 A;  2QYV A;  4UF4 A;  4FUU A;  4KUA A;  2VQY A;  1IYK A;  3S6F A;  3IWE A;  2PRB A;  4F0Y A;  3KAS A;  4NXY A;  4PXB A;  4CAX A;  5A28 A;  5LRK A;  3D7F A;  2EBJ A;  4MFP A;  2G3A A;  5ELY A;  4Q36 A;  4OME A;  4JD6 A;  2JEV A;  2GRE A;  2ZPA A;  4FD4 A;  1IID A;  4XNH B;  2R98 A;  4QVT A;  4CGL A;  5F09 A;  2PJ5 A;  3S9N A;  5JPH A;  1IU8 A;  4UFX A;  2RB7 A;  4A94 A;  3EXN A;  1XFO A;  2GIV A;  2ZEE A;  1AYE A;  2Q7B A;  4AXV A;  1P4N A;  2POK A;  8CPA A;  2B58 A;  1VGY A;  4QBJ A;  1ZG8 A;  5IB0 A;  3TE4 A;  2JBK A;  4LX9 A;  2Q4Y A;  3IWG A;  2I00 A;  2Z3M A;  4UEE A;  2Z3P A;  3D8P A;  5H84 A;  3TO7 A;  5K8P A;  6CPA A;  3ZJ0 A;  4GXH A;  2PJ2 A;  5J8F A;  2JDC A;  1FT7 A;  2DF5 A;  3EO4 A;  3TTH A;  3A9L A;  4F0X A;  4NGP A;  3NH5 A;  2IL4 A;  3B35 A;  3SXO A;  2B4D B;  1XEB A;  1S7N A;  4UCM A;  1TF9 A;  4G1P A;  1YRE A;  1ZLH A;  1S7L A;  4HNW B;  4PSX A;  1S7K A;  3EFA A;  2OB0 A;  2Z10 A;  1OBR A;  2JEW A;  2IQ6 A;  4KOY A;  2AFX A;  2Z3N A;  5DS0 A;  1CJW A;  2I3C A;  3D66 A;  4FD7 A;  1FY7 A;  1XOV A;  4MY3 A;  5F47 A;  3IEH A;  4DUK A;  4YFJ A;  2Z3O A;  1YQE A;  3WR7 A;  4KSA A;  1K4J A;  3KL9 A;  3VAT A;  2ZEH A;  3R9G A;  5IV0 A;  4M3S A;  3CDX A;  2V8H A;  3KR4 A;  4U5Y A;  2VZZ A;  2PJ1 A;  2ZED A;  1R57 A;  3IWW A;  5LYD A;  5F49 A;  3PB9 X;  4CYO A;  3CXS A;  1S7F A;  2FSR A;  1VHS A;  4DYO A;  4PXE A;  2EK8 A;  4KZT A;  1VHO A;  1BAV A;  2BCO A;  2J8R A;  2QML A;  1OZP A;  3BI1 A;  3GY9 A;  4NGM A;  4FD5 A;  1S5K A;  4TNU A;  2ANP A;  4MBU A;  4UCP A;  2CY2 A;  2YGW A;  3VH9 A;  2RFH A;  5IB9 A;  5LRG A;  1CP7 A;  5C82 A;  2CNT A;  2J9A A;  2Q43 A;  2VZY A;  3G8W A;  2CTC A;  3KI9 A;  1KZF A;  3FJU A;  2VXK A;  2YNC A;  4KVO E;  4MFJ A;  4AVA A;  2ZEM A;  3FH4 A;  4YWY A;  5K8O A;  2PJ0 A;  1QSN A;  3V7Z A;  1NMT A;  4ONU A;  2FIA A;  3HUV A;  3IGR A;  2XEF A;  1CG2 A;  4A32 A;  3G3S A;  1Z8L A;  2ZEN A;  3KQZ A;  3BXM A;  3FXT A;  1QST A;  4P44 A;  3TO9 A;  4B10 A;  4MFZ A; 
#chains in the Genus database with same CATH homology
 2X7B A;  4C2Y A;  2I79 A;  4UCN A;  2DXQ A;  4EVY A;  3I9S A;  4QB9 A;  1QSR A;  2AJ6 A;  4PK2 A;  2OU2 A;  1YGH A;  3VWE A;  2PQ8 A;  4II9 A;  2Q4V A;  3N7Z A;  1XE4 A;  4I49 A;  4K30 A;  3W6X A;  1YX0 A;  4AVC A;  3UY5 A;  4JXR A;  2PR8 A;  1CM0 A;  1ON0 A;  1QSO A;  2ZW4 A;  2P6F A;  3PGP A;  2CXA A;  2FT0 A;  5BWA B;  2QEC A;  1NSL A;  2G3T A;  1V0C A;  4BMH A;  3H4Q A;  1BO4 A;  2GAN A;  4MY0 A;  2J8M A;  3P2H A;  2R7H A;  3EY5 A;  3JUW A;  4HNX B;  1Q2C A;  4C68 A;  3TFY A;  3S6G A;  4AG7 A;  4CYQ A;  2RC4 A;  4R9M A;  5JQ4 A;  1WK4 A;  2WPW A;  1YLE A;  4B14 A;  4DNC A;  4FD6 A;  4KUB A;  4CAF A;  4CAW A;  4OAD A;  2BUE A;  5J8C A;  1S3Z A;  3TOB A;  4CRY B;  1S60 A;  4CYP A;  4JJX A;  2R8V A;  4UBR A;  5AG6 A;  2Z11 A;  4CGP A;  3R96 A;  4H6U A;  2OZH A;  5KTA A;  2VEZ A;  2REF A;  4KOV A;  4ZBG A;  4A31 A;  3LOD A;  5H86 A;  4Y49 B;  3SXN A;  3P2F A;  1RXT A;  2YND A;  2D4P A;  1PUA A;  3IU2 A;  4CAV A;  1U6M A;  1RO5 A;  4OAE A;  5AG5 A;  4PSW A;  3DDD A;  4GS4 A;  3EC4 A;  2HV2 A;  1YK3 A;  5C88 A;  4XPD C;  4CAE A;  4A33 A;  3DSB A;  4MJ8 A;  3R1K A;  5F48 A;  2F5I A;  1XIX A;  3JVN A;  1KUV A;  2WSA A;  2JDD A;  1YVO A;  1IIC A;  2Q0Y A;  1SQH A;  3PZJ A;  3RYO A;  4BBH A;  2Q04 A;  4A30 A;  1Z4R A;  4MFK A;  3B8G A;  3CXQ A;  3TO6 A;  2JLM A;  4Q38 A;  2EVN A;  4B5P B;  5HH1 A;  3F8K A;  4B11 A;  2VI7 A;  2FE7 A;  1YR0 A;  2QIR A;  1IYL A;  2FCK A;  2P6E A;  2D4O A;  3DNS A;  1Y9K A;  3GYA A;  4X5K A;  2P0W A;  4U9Z A;  1Q2Y A;  3FNC A;  3PP9 A;  1XMT A;  3DR8 A;  2VBQ A;  5EC4 A;  2ZW6 A;  1Q2D A;  1WWZ A;  1I21 A;  3V8I A;  4CRZ B;  4CGN A;  3OWC A;  4XNH C;  3W91 A;  5FVJ A;  4NF1 A;  3D3S A;  2CNM A;  3H5Z A;  3FBU A;  4QC6 A;  3FRM A;  2R1I A;  2ZW5 A;  1MJ9 A;  3GKR A;  3FYN A;  2HUZ A;  1M44 A;  2B3U A;  3D2M A;  5E96 A;  4PK3 A;  2ZW7 A;  5G20 A;  2H5M A;  4XPK A;  4JWP A;  1GHE A;  3QB8 A;  2B4B A;  3T9Y A;  4C2Z A;  2FL4 A;  2Y0M A;  1BOB A;  3E0K A;  1YVK A;  2PC1 A;  2PSW A;  1M4I A;  1MJB A;  4RI1 A;  4C7H A;  2J8N A;  4KVM E;  4KOU A;  4B5P A;  3TCV A;  5AG4 A;  4E8O A;  3W6S A;  4IF5 A;  4B5O A;  3BJ7 A;  2ARH A;  4ORF A;  3K9U A;  2WUU A;  5G21 A;  1I1D A;  4H89 A;  4KOR A;  4M85 A;  3R9F A;  4AG9 A;  2ZXV A;  4KSF A;  3VWD A;  3NE7 A;  4A95 A;  1Z9U A;  4HKF A;  4F6A A;  4C7I A;  4UWI A;  1Y7R A;  2REE A;  1TIQ A;  1LRZ A;  3BJ8 A;  5IX3 A;  3F5B A;  4KS9 A;  3QAH A;  1IB1 E;  2NMT A;  2DPS A;  4AB7 A;  2ATR A;  4R3L A;  3S6H A;  2Q44 A;  4A2Z A;  4JXQ A;  4PV6 A;  1Z4E A;  2O28 A;  5AG7 A;  4H6Z A;  1M1D A;  4AVB A;  2Z3K A;  4NCZ A;  4QUS A;  2DPT A;  3T90 A;  2B5G A;  5G1Z A;  3ZZI A;  2OZG A;  1MK4 A;  3C26 A;  4CYN A;  2G0B A;  4L89 A;  4IUS A;  5I0C A;  4XPL A;  1VKC A;  3TT2 A;  4U9Y A;  5G22 A;  3DR6 A;  5EBV A;  2C27 A;  4YGO A;  2EUI A;  1KUX A;  2AE6 A;  4RS2 A;  2KCW A;  1B87 A;  3TOA A;  1L0C A;  1MJA A;  4MFQ A;  2P6G A;  4E2A A;  2Z0Z A;  3F0A A;  3BLN A;  3FIX A;  2BSW A;  4YRH A;  3R95 A;  4B12 A;  4KOT A;  4KLW A;  3CXP A;  2A4N A;  4NSQ A;  5F46 A;  1B6B A;  4KOW A;  2HQY A;  4L8A A;  1PU9 A;  4LUA A;  2FS5 A;  4R87 A;  2YNC C;  4CS0 B;  4B13 A;  1NE9 A;  2FXF A;  3JTK A;  2Z3L A;  1M4D A;  4R57 A;  2K5T A;  4OLL A;  3FB3 A;  4UA3 A;  5AGE A;  2YNE A;  4KLV A;  5KTD A;  1QSM A;  4MI4 A;  4E0A A;  5KTC A;  4UFW A;  1J4J A;  4XPD B;  4MHD A;  5HMN A;  2BL1 A;  2PR1 A;  4KOX A;  4NEX A;  4CGM A;  3KKW A;  2B4D A;  1Y9W A;  3LD2 A;  4R3K A;  4UFV A;  5CNP A;  5IV0 A;  2B5G B;  3IU1 A;  3S6K A;  2CNS A;  4Y49 C;  4UWJ A;  2B3V A;  4KVX A;  5DWN A;  3D2P A;  2FIW A;  2GE3 A;  2PDO A;  2WPX A;  4HNY B;  1P0H A;  1N71 A;  3MGD A;  1UFH A;  4JLY A;  1I12 A;  2BEI A;  4CGO A;  5ISV A;  3I3G A;  4J3G A;  4MFL A;  2OZU A;  2OH1 A;  1KUY A;  5GCN A;  1XF8 A;  1ZO0 A;  3R9E A;  3SHP A;  4KOS A;  1M4G A;  5A27 A;  4C2X A;  5DWM A;  4ZGY B;  4KUA A;  2VQY A;  1IYK A;  3S6F A;  3IWE A;  2PRB A;  4F0Y A;  4NXY A;  4CAX A;  5A28 A;  4MFP A;  2G3A A;  4Q36 A;  4JD6 A;  2JEV A;  2ZPA A;  4FD4 A;  1IID A;  4XNH B;  2R98 A;  4QVT A;  4CGL A;  5JPH A;  4UFX A;  3EXN A;  2GIV A;  2Q7B A;  1P4N A;  2B58 A;  5IB0 A;  3TE4 A;  4LX9 A;  2Q4Y A;  3IWG A;  2I00 A;  2Z3M A;  2Z3P A;  3D8P A;  5H84 A;  3TO7 A;  3ZJ0 A;  5J8F A;  2JDC A;  3EO4 A;  3TTH A;  4F0X A;  3A9L A;  2IL4 A;  3SXO A;  2B4D B;  1XEB A;  1S7N A;  4UCM A;  1YRE A;  1S7L A;  4HNW B;  4PSX A;  1S7K A;  3EFA A;  2OB0 A;  2Z10 A;  4QBJ A;  4KOY A;  2Z3N A;  1CJW A;  4FD7 A;  4MY3 A;  5F47 A;  1FY7 A;  4YFJ A;  2Z3O A;  3WR7 A;  4KSA A;  1K4J A;  3R9G A;  4M3S A;  4U5Y A;  2VZZ A;  1R57 A;  5F49 A;  4CYO A;  3CXS A;  1S7F A;  2FSR A;  1VHS A;  4KZT A;  2J8R A;  2QML A;  1OZP A;  3GY9 A;  4FD5 A;  1S5K A;  4MBU A;  4UCP A;  2CY2 A;  2YGW A;  5C82 A;  2CNT A;  2VZY A;  3G8W A;  1KZF A;  2VXK A;  2YNC A;  4KVO E;  4MFJ A;  4AVA A;  1QSN A;  1NMT A;  4ONU A;  2FIA A;  3IGR A;  4A32 A;  3G3S A;  3FXT A;  1QST A;  3TO9 A;  4B10 A;  4MFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...