4A30A

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a pyrazole sulphonamide ligand
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Discovery of a novel class of orally active trypanocidal N-myristoyltransferase inhibitors.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 124
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4a30A00
4A95A 4C7IA 2YNDA 2YNCC 3JTKA 5G1ZA 4A33A 4A31A 4CGMA 5AG4A 2YNCA 4CGNA 2WUUA 4BBHA 4CAFA 4CGLA 4CYPA 3IU1A 4C68A 4A2ZA 2YNEA 5AG5A 4A30A 4B10A 4C7HA 4C2ZA 4UCNA 4CYNA 4B11A 4UCPA 4B14A 4C2YA 3IWEA 4A32A 4B12A 4C2XA 4CGPA 3H5ZA 5G20A 5AG6A 4CYQA 4UFXA 5G22A 5A27A 5A28A 4UCMA 5G21A 4UFVA 4CGOA 4CAEA 4UFWA 2WSAA 4CYOA 3IU2A 4B13A 5AG7A 5AGEA
chains in the Genus database with same CATH superfamily
4A95A 4OKOA 4NGNA 2ZEDA 3FVLA 3HLPA 4CAVA 4MHPA 1Z5RA 3KI9A 2WUUA 5F09A 3F0AA 4KS9A 1CPSA 1AYEA 1NMTA 4GM5A 4R3KA 5C82A 4JD6A 4P4BA 2ZEEA 1BOBA 5F48A 1XBUA 4ZY1A 4EWTA 4MRIA 1JQGA 2FT0A 4KLWA 3VATA 1YLEA 4AVAA 3P2HA 4FWUA 1PYTB 2EUIA 1YGHA 2Z3NA 4QUSA 4R6TA 2F7VA 3S9NA 4CAEA 4B5OA 4YFJA 1BAVA 4G1PA 1RTQA 1YX0A 4PQAA 4QBJA 4HNWB 1MJBA 4OAEA 5LYLA 2RB7A 3R9EA 4CRYB 5AG4A 1R3NA 3DR8A 2CNSA 3FJUA 4CAFA 3G3SA 4JJXA 3S6GA 3PB9X 4F9UA 5IX3A 2EBJA 1UFHA 3D2MA 2ZEHA 1CP6A 4P4EA 2NMTA 1LCPA 1TKHA 3CPXA 3DGVA 3DSBA 1ELLP 1ARMA 3H8GA 4M85A 3PGPA 5FVJA 4Z65A 4NGQA 1VHOA 3RO0A 3FEDA 2J8RA 4TWEA 4FD4A 1WWZA 2JEVA 1FNOA 2GLFA 2HV2A 4XPKA 2REFA 2Z10A 4JXQA 3PRTA 5LRKA 1F2PA 1P4NA 2QIRA 2BO9A 4OLLA 3PFOA 3NA6A 4H89A 4MHYA 5K8PA 2EVNA 2JDDA 2Z3KA 4LQ6A 1Y7EA 4NJQA 4ONUA 3T9YA 5CBMA 1CM0A 3S6KA 4KOSA 4U9ZA 2G0BA 1N71A 1S5KA 1Q2DA 3TT2A 1M4IA 1YLOA 1GHEA 2Q4VA 3D68A 3L2NA 4CYNA 1XF8A 3IFEA 2PJ6A 4IAVA 2I00A 4UCPA 4B11A 1ON0A 3IGRA 3CT9A 3D3SA 2I79A 3H5ZA 3F5BA 4L89A 5CNPA 3G8WA 4O23A 5A27A 3NE7A 3NFZA 5HVGA 4IF5A 2D4OA 2XEJA 4UWJA 5F49A 3TOBA 5C88A 1S7FA 2IMOA 2ZW6A 2ZEGA 3PB6X 2ZEFA 4NGTA 4B5PA 3PBBA 3V38A 3SI1A 4B12A 2Q0YA 3CPAA 4U5YA 1SQHA 2PE3A 4Y49B 4YRHA 2VL1A 3B3SA 3JTKA 4EFDA 2PJCA 2F5IA 3QNVA 4KSFA 3H4QA 2HB6A 4MHNA 3K9TA 3WABA 4F6AA 4GS4A 1XMTA 2J8NA 4A30A 2A4NA 2YNEA 2PJAA 3CXPA 4H6ZA 3IEHA 4YGOA 5EMIA 1CP7A 2ZPAA 4UCNA 2PJ0A 3GYAA 3E0KA 2IL4A 3IJ3A 2HUZA 1S60A 4MFLA 4ZY0A 7CPAA 3RAMA 3R9GA 3IWWA 3TE4A 3IWGA 4UCMA 5K8NA 1BO4A 5H84A 4HNXB 2G3TA 3ISZA 1ELMP 1Z2LA 3FX6A 4JYWA 3S9LA 2G9DA 4UIAA 1BLLE 2DPTA 1IYLA 3BI0A 2P0WA 1ARLA 2YNDA 4OIDA 3KL9A 1B87A 2V77A 2P6FA 2QVPA 3KHXA 2ATRA 4R87A 4RS2A 4TNUA 4H2KA 4MCRA 4HPSA 1NSLA 3GLJA 4ZX9A 2FCKA 4OP4A 2IQ6A 2I3CA 4FUUA 4KOUA 2AJ6A 4KORA 4R8FA 4HKFA 1TKJA 2OH1A 1YREA 4K3NA 4R57A 3T8WA 4FD5A 3LD2A 5G22A 1IOIA 1I21A 2C6PA 4NXYA 4Y49C 2PJ3A 3H8FA 4KOVA 1QSRA 3FYNA 4LQGA 4UFVA 4NGSA 2ZW7A 1XMBA 4WWVA 5LRJA 4CS0B 1Y9WA 2OZGA 3LWUA 4NFRA 4MBUA 4NGRA 1KUXA 1X10A 4E0AA 2DF5A 3ZJ0A 4JXRA 2R7HA 2XEIA 3PFEA 4AVBA 2CTBA 4F0YA 3D7GA 1KZFA 1S7NA 1TXRA 3S6FA 4ZGYB 3EY5A 4MCSA 2ZEOA 3LACA 3WC5A 5GCNA 1H8LA 2P6GA 4CYPA 5LYIA 4OC1A 2FIAA 4DYOA 2V8HA 1NE9A 4PPZA 3TO9A 4RUHA 3PZJA 5HXDA 2PJ7A 3OWCA 1CX8A 3IC1A 4FBEA 4MMOA 2B58A 5DWMA 5BWAB 4R3LA 3KR5A 5AG6A 2Q7BA 3KHZA 1UWYA 1Z4RA 2AFZA 4AG7A 4PK3A 4PV6A 2B3UA 2OR4A 2Q04A 1VIXA 4IHMA 2RFHA 4BMHA 2P6EA 1L0CA 2V8VA 3GIUA 4KUAA 4BINA 4X8IA 3RBUA 4A94A 2G3AA 2BOAA 2Q44A 4ORFA 3DDDA 2FIWA 3BI1A 2VI7A 3IU1A 2OZHA 1EE3P 1XJOA 3SI2A 4RN7A 3SXNA 2JBJA 1YQEA 3MRUA 2Q7SA 2Z3LA 4MY0A 4X5KA 4ZY2A 4OC4A 2GANA 2K5TA 4JWPA 3TOAA 3W6SA 2Z11A 4E2AA 2J8MA 4ONWA 5G20A 3KR4A 4Q38A 5H86A 2CTCA 5THWA 2OOTA 3FB3A 5A28A 2GREA 4QVTA 3KQXA 2J9AA 2QMLA 1I12A 1Q2YA 4P10A 1VHSA 1IY7A 2B5GA 4AG9A 3SHPA 5AG7A 5J1QA 1B6BA 4UEZA 5IV0A 1YK3A 2OZUA 3QAYA 2VEZA 4OC2A 4K30A 2FXFA 3CZXA 2HC9A 2PR1A 5EC4A 3RYOA 4B5PB 4A39A 3TO6A 1CJWA 5DWNA 3PB4X 3GY9A 4A2ZA 2Z3PA 4R76A 4KVME 4C2ZA 3D7HA 2EK9A 5K8OA 5KTAA 1I1DA 1YMEA 3N5FA 2PQ8A 3D7DA 1NSAA 4QB9A 3S9MA 3V8IA 1KUVA 4IUSA 2ZXVA 3FECA 1YVOA 4MFPA 4CYOA 4UFWA 2WSAA 1ZLHA 4MJ8A 1R57A 3D66A 3D8PA 3H8EA 1YW4A 1CBXA 2BL1A 2BSWA 2C27A 4AVCA 1M4DA 5AGEA 4C7IA 4L8AA 4CGMA 2YNCA 4CGNA 1R43A 5D29A 5KTDA 2PJ1A 1M4GA 4YU9A 3MGDA 1KUYA 5AG5A 2FS5A 5J8FA 5JH9A 3DR6A 4A37A 1OZPA 4NF1A 3MN8A 4MHZA 4YWYA 4KUBA 5LYDA 3IWEA 2FE7A 1F2OA 2B4DA 4NGPA 1BPMA 4DUKA 1WK4A 3ISXA 4CYQA 5HVHA 2ZEPA 2AE6A 4NEXA 3D7FA 1S3ZA 3EC4A 3LMSA 4MFJA 3QB8A 1XOVA 1MK4A 1YR0A 1GYTA 2JEWA 5HVFA 2VZYA 1QSMA 3EFAA 4FD6A 5I4MA 4DNCA 2ABZA 2R1IA 4AB7A 1IICA 2ZW4A 2AFUA 4XPLA 1K4JA 1Z8WA 2FVGA 2NSMA 4CGLA 2GE3A 4I49A 4R9MA 2REEA 3QAHA 4C68A 1XFOA 1LAPA 2QECA 4KLVA 4P4FA 4BD9A 1YVKA 3KZWA 2C1CA 2PCUA 3B3VA 4P4DA 4CAWA 1RO5A 4LX9A 4CAXA 3CDXA 2NYQA 3NE8A 4P4IA 2PR8A 3JRUA 5I0CA 2PJ2A 2DEAA 5ELYA 4KOYA 4B6ZA 5KTCA 4MCQA 2R98A 2CIJA 4H6UA 1ZG8A 3BLNA 1OBRA 2Q4ZA 3SJXA 1BPNA 3BJ7A 4B13A 3B3TA 4UEEA 2QJ8A 4MFKA 2ANPA 2Z0ZA 1Z9UA 3SJEA 2O4HA 4P44A 4F9VA 4PSWA 4A31A 5JM6A 1QSNA 1Z8TA 3FEEA 3K9UA 1ZG7A 2XEGA 4MHDA 5E96A 2EWBA 4FAIA 3B3WA 1PUAA 1Z8XA 2VBQA 1Q7LA 1DE4C 3FIXA 2PIZA 1LAMA 6CPAA 2B3VA 4MXUA 4XNHB 4MFZA 2PRQA 3PP9A 1XIXA 3UY5A 5HH1A 4OC3A 2Q43A 2VZZA 1TF9A 5D8NA 2ZEMA 4ZX8A 2PRBA 2AFXA 2BEIA 2GFQA 2ZENA 2JLMA 4Q36A 4OC0A 3RZAA 1F57A 3SI0A 5HMNA 5J8CA 2PDOA 1CG2A 4NJRA 3R95A 1M4LA 4KVOE 2WYRA 3KKWA 2B5GB 4KSIA 4NSQA 4X2TA 4GXHA 5JQ4A 5CPAA 2ZOFA 4ZBGA 1LRZA 4F8ZA 1M1DA 1PU9A 1LOKA 4HNYB 4UEFA 3NH5A 2PJ5A 2WZNA 4MI4A 2HQYA 4C2YA 1Q2CA 3D4UA 4ZI6A 1Y7RA 4UFXA 3TX8A 4CRZB 3EO4A 2EO8A 1AUGA 2OU2A 2PJ8A 4PXCA 4OIWA 1TIQA 2FSRA 3FXTA 3PB8X 4OADA 4PK2A 2O53A 2PIYA 3A9LA 3FMCA 5F47A 4LUAA 3B8GA 2XEFA 2CNMA 1ZO0A 1YSJA 3IIBA 3ZZIA 1MJAA 1VHEA 2OB0A 2Y0MA 1S7LA 3F8KA 4FD7A 2VQYA 4XNHC 2GIVA 2CNTA 2AFWA 3I1UA 1VGYA 2V8GA 2X7BA 1IGBA 4PXEA 4XPDB 3W91A 4ZYQA 5K8MA 1IU8A 1HDQA 1IIDA 2ZW5A 3BJ8A 1LANA 3CXQA 3HUVA 3PBEA 3SJFA 3I9SA 2B4BA 3GKRA 3KQZA 2DXQA 4C2XA 2ODFA 1J4JA 5DS0A 3TTHA 1PCAA 3RNZA 4DJLA 3D67A 5JGFA 2C6GA 3VWDA 4CGOA 3N7ZA 1XEBA 1XE4A 1Y0RA 2B4DB 2GU2A 2POKA 4F0XA 3R9FA 1IYKA 4KOXA 4IK2A 4UF4A 3GUXA 4UIBA 3B35A 1P0HA 3WC6A 5F46A 4UWIA 4KVXA 1Z4EA 4A33A 4A38A 3B3CA 1QSOA 2PJBA 3NH4A 4JLYA 3WC7A 3DLJA 4P45A 1QSTA 4PXDA 2QYVA 2O28A 1HEEA 1YW6A 1AMPA 4KOTA 1ZG9A 4QC6A 5IB9A 2RC4A 1JWQA 2ZELA 3PEIA 1QQ9A 3T90A 1IB1E 2DPSA 2Q51A 1V0CA 3FBUA 2AFMA 4OC5A 3SJGA 4JZ0A 1RXTA 2YGWA 1TF8A 2D4PA 3NH8A 4II9A 1M44A 1VKCA 3C26A 3TCVA 2PVWA 1DTDA 2AFOA 1A2ZA 2KCWA 3IO1A 3BHXA 3IU2A 5LYFA 3D2PA 4PXBA 4WJBA 4UBRA 3WR7A 4M6IA 3CXSA 4XPDC 3DNSA 1FT7A 3PB7X 2YNCC 1Y9KA 4M6HA 1FY7A 2CF4A 5G1ZA 2Z3MA 3VARA 3VH9A 4UA3A 4M3SA 3EXNA 4BBHA 1Z8LA 1XRYA 1Y0YA 4AXVA 2VXKA 4W9YA 3S6HA 1X12A 3B7IA 4C7HA 2Z3OA 4CPAA 1HDUA 4KSAA 3R96A 4P4JA 2PJ4A 2JDCA 2CXAA 4B14A 2IJZA 2F8HA 4A32A 4CGPA 4EMEA 5ISVA 2Q4YA 1TKFA 4MCPA 4M6GA 5EBVA 3P2FA 3LODA 8CPAA 2CY2A 5LRGA 4MY3A 2WPXA 3FH4A 1ZLIA 4MFQA 1MJ9A 3JVNA 3I3GA 4PSXA 2PJ9A 2V8DA 4P6YA 2GLJA 4E8OA 2BCOA 3BXMA 3KGQA 4X3RA 3GB0A 4R7MA 2FL4A 5JPHA 3TO7A 2EK8A 1CPXA 2BUEA 3W6XA 3FNCA 3R1KA 2PC1A 3VWEA 4EVYA 1S7KA 2ARHA 2ZOGA 4J3GA 2H5MA 4B10A 3WT4A 2JBKA 3FRMA 4KZTA 1LFWA 3TFYA 3SXOA 2C6CA 5IB0A 3B2YA 2R8VA 4NGMA 3K2KA 4KOWA 3V7ZA 1IOFA 3KASA 5G21A 4RI1A 2PVVA 1QMUA 3JUWA 1KWMA 4NCZA 2AFSA 2PSWA 1U6MA 4OMEA 3TC8A 2WPWA 4Q7AA 4U9YA 3FF3A
chains in the Genus database with same CATH topology
4A95A 4CAVA 2WUUA 3F0AA 4KS9A 1NMTA 5C82A 4R3KA 4JD6A 1BOBA 5F48A 2FT0A 4KLWA 1YLEA 4AVAA 3P2HA 2EUIA 1YGHA 2Z3NA 4QUSA 4CAEA 4B5OA 4YFJA 1YX0A 4QBJA 4HNWB 1MJBA 4OAEA 3R9EA 4CRYB 5AG4A 3DR8A 2CNSA 4CAFA 3G3SA 4JJXA 3S6GA 5IX3A 1UFHA 3D2MA 2NMTA 3DSBA 4M85A 3PGPA 5FVJA 2J8RA 4FD4A 1WWZA 2JEVA 2HV2A 4XPKA 2REFA 2Z10A 4JXQA 1P4NA 2QIRA 4OLLA 4H89A 2EVNA 2JDDA 2Z3KA 4ONUA 3T9YA 1CM0A 3S6KA 4KOSA 4U9ZA 2G0BA 1N71A 1S5KA 1Q2DA 3TT2A 1M4IA 1GHEA 2Q4VA 4CYNA 1XF8A 4B11A 2I00A 4UCPA 1ON0A 3IGRA 3D3SA 2I79A 3H5ZA 3F5BA 4L89A 5CNPA 3G8WA 5A27A 3NE7A 4IF5A 2D4OA 4UWJA 5F49A 3TOBA 5C88A 1S7FA 2ZW6A 4B5PA 2Q0YA 4U5YA 1SQHA 4Y49B 4YRHA 3JTKA 2F5IA 4KSFA 3H4QA 4F6AA 4GS4A 1XMTA 2J8NA 4A30A 2A4NA 2YNEA 3CXPA 4H6ZA 4YGOA 2ZPAA 4UCNA 3GYAA 3E0KA 2IL4A 2HUZA 1S60A 4MFLA 3R9GA 3TE4A 3IWGA 4UCMA 1BO4A 5H84A 4HNXB 2G3TA 2DPTA 1IYLA 2P0WA 2YNDA 1B87A 2P6FA 4R87A 2ATRA 4RS2A 1NSLA 2FCKA 4KOUA 4KORA 2AJ6A 4HKFA 2OH1A 1YREA 4R57A 4FD5A 3LD2A 5G22A 1I21A 4NXYA 4Y49C 4KOVA 1QSRA 3FYNA 4UFVA 2ZW7A 4CS0B 1Y9WA 2OZGA 4MBUA 1KUXA 4E0AA 4JXRA 2R7HA 4AVBA 4F0YA 1KZFA 1S7NA 3S6FA 4ZGYB 3EY5A 5GCNA 4CYPA 2P6GA 2FIAA 1NE9A 3TO9A 3PZJA 3OWCA 2B58A 5DWMA 4R3LA 5AG6A 2Q7BA 1Z4RA 4AG7A 4PK3A 4PV6A 2B3UA 2Q04A 4BMHA 2P6EA 1L0CA 4KUAA 2G3AA 2Q44A 4ORFA 3DDDA 2FIWA 3IU1A 2VI7A 2OZHA 3SXNA 2Z3LA 4MY0A 4X5KA 3W6SA 5BWAB 2GANA 2K5TA 4JWPA 3TOAA 4E2AA 2Z11A 2J8MA 5G20A 4Q38A 5H86A 3FB3A 5A28A 4QVTA 2QMLA 1I12A 1Q2YA 1VHSA 2B5GA 4AG9A 3SHPA 5AG7A 1B6BA 5IV0A 1YK3A 2OZUA 2VEZA 4K30A 2FXFA 2PR1A 3RYOA 5EC4A 4B5PB 3TO6A 1CJWA 5DWNA 3GY9A 4A2ZA 2Z3PA 4KVME 4C2ZA 5KTAA 1I1DA 2PQ8A 4QB9A 3V8IA 1KUVA 4IUSA 2ZXVA 1YVOA 4MFPA 4CYOA 4UFWA 2WSAA 4MJ8A 1R57A 3D8PA 2BL1A 2BSWA 2C27A 4AVCA 1M4DA 5AGEA 4C7IA 4L8AA 4CGMA 2YNCA 4CGNA 5KTDA 1M4GA 3MGDA 1KUYA 5AG5A 2FS5A 5J8FA 3DR6A 1OZPA 4NF1A 4KUBA 3IWEA 2FE7A 2B4DA 1WK4A 4CYQA 2AE6A 4NEXA 1S3ZA 3EC4A 4MFJA 3QB8A 1MK4A 1YR0A 2VZYA 1QSMA 3EFAA 4FD6A 4DNCA 2R1IA 4AB7A 1IICA 2ZW4A 4XPLA 1K4JA 4CGLA 2GE3A 4I49A 4R9MA 2REEA 3QAHA 4C68A 2QECA 4KLVA 1YVKA 4CAWA 1RO5A 4LX9A 4CAXA 2PR8A 5I0CA 4KOYA 5KTCA 2R98A 4H6UA 3BLNA 3BJ7A 4B13A 4MFKA 2Z0ZA 1Z9UA 4PSWA 4A31A 1QSNA 3K9UA 4MHDA 5E96A 1PUAA 2VBQA 3FIXA 2B3VA 4XNHB 3ZJ0A 4MFZA 4B12A 3PP9A 1XIXA 3UY5A 5HH1A 2VZZA 2PRBA 2BEIA 2JLMA 4Q36A 5HMNA 5J8CA 2PDOA 3R95A 4KVOE 3KKWA 2B5GB 4NSQA 5JQ4A 4ZBGA 1LRZA 1M1DA 1PU9A 4HNYB 4MI4A 2HQYA 4C2YA 1Q2CA 1Y7RA 4UFXA 4CRZB 3EO4A 2OU2A 1TIQA 2FSRA 3FXTA 4OADA 4PK2A 3A9LA 5F47A 4LUAA 3B8GA 2CNMA 1ZO0A 3ZZIA 1MJAA 2OB0A 2Y0MA 3F8KA 1S7LA 4FD7A 2VQYA 4XNHC 2GIVA 2CNTA 4XPDB 3W91A 2X7BA 1IIDA 2ZW5A 3BJ8A 3CXQA 3I9SA 2B4BA 3GKRA 4C2XA 2DXQA 1J4JA 3TTHA 3VWDA 4CGOA 3N7ZA 1XEBA 1XE4A 2B4DB 4F0XA 3R9FA 1IYKA 4KOXA 1P0HA 5F46A 4UWIA 4KVXA 1Z4EA 4A33A 1QSOA 4JLYA 1QSTA 2O28A 4KOTA 4QC6A 2RC4A 3T90A 1IB1E 2DPSA 3FBUA 1V0CA 1RXTA 2YGWA 2D4PA 4II9A 1M44A 1VKCA 3C26A 3TCVA 2KCWA 3IU2A 3D2PA 3WR7A 4UBRA 3CXSA 4XPDC 3DNSA 2YNCC 1Y9KA 1FY7A 5G1ZA 2Z3MA 4UA3A 4M3SA 3EXNA 4BBHA 2VXKA 3S6HA 4C7HA 2Z3OA 4KSAA 3R96A 2JDCA 2CXAA 4B14A 4A32A 5ISVA 4CGPA 2Q4YA 5EBVA 3P2FA 3LODA 2CY2A 4MY3A 2WPXA 4MFQA 1MJ9A 3JVNA 3I3GA 4PSXA 4E8OA 2FL4A 5JPHA 3TO7A 2BUEA 3W6XA 3FNCA 3R1KA 2PC1A 3VWEA 4EVYA 1S7KA 2ARHA 4J3GA 2H5MA 4B10A 3FRMA 4KZTA 3TFYA 3SXOA 5IB0A 2R8VA 4KOWA 5G21A 4RI1A 3JUWA 4NCZA 2PSWA 1U6MA 2WPWA 4U9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A95 A;  4C7I A;  2YND A;  2YNC C;  3JTK A;  5G1Z A;  4A33 A;  4A31 A;  4CGM A;  5AG4 A;  2YNC A;  4CGN A;  2WUU A;  4BBH A;  4CAF A;  4CGL A;  4CYP A;  3IU1 A;  4C68 A;  4A2Z A;  2YNE A;  5AG5 A;  4A30 A;  4B10 A;  4C7H A;  4C2Z A;  4UCN A;  4CYN A;  4B11 A;  4UCP A;  4B14 A;  4C2Y A;  3IWE A;  4A32 A;  4B12 A;  4C2X A;  4CGP A;  3H5Z A;  5G20 A;  5AG6 A;  4CYQ A;  4UFX A;  5G22 A;  5A27 A;  5A28 A;  4UCM A;  5G21 A;  4UFV A;  4CGO A;  4CAE A;  4UFW A;  2WSA A;  4CYO A;  3IU2 A;  4B13 A;  5AG7 A;  5AGE A; 
#chains in the Genus database with same CATH topology
 4A95 A;  4OKO A;  4NGN A;  2ZED A;  3FVL A;  3HLP A;  4CAV A;  4MHP A;  1Z5R A;  3KI9 A;  2WUU A;  5F09 A;  3F0A A;  4KS9 A;  1CPS A;  1AYE A;  1NMT A;  4GM5 A;  4R3K A;  5C82 A;  4JD6 A;  4P4B A;  2ZEE A;  1BOB A;  5F48 A;  1XBU A;  4ZY1 A;  4EWT A;  4MRI A;  1JQG A;  2FT0 A;  4KLW A;  3VAT A;  1YLE A;  4AVA A;  3P2H A;  4FWU A;  1PYT B;  2EUI A;  1YGH A;  2Z3N A;  4QUS A;  4R6T A;  2F7V A;  3S9N A;  4CAE A;  4B5O A;  4YFJ A;  1BAV A;  4G1P A;  1RTQ A;  1YX0 A;  4PQA A;  4QBJ A;  4HNW B;  1MJB A;  4OAE A;  5LYL A;  2RB7 A;  3R9E A;  4CRY B;  5AG4 A;  1R3N A;  3DR8 A;  2CNS A;  3FJU A;  4CAF A;  3G3S A;  4JJX A;  3S6G A;  3PB9 X;  4F9U A;  5IX3 A;  2EBJ A;  1UFH A;  3D2M A;  2ZEH A;  1CP6 A;  4P4E A;  2NMT A;  1LCP A;  1TKH A;  3CPX A;  3DGV A;  3DSB A;  1ELL P;  1ARM A;  3H8G A;  4M85 A;  3PGP A;  5FVJ A;  4Z65 A;  4NGQ A;  1VHO A;  3RO0 A;  3FED A;  2J8R A;  4TWE A;  4FD4 A;  1WWZ A;  2JEV A;  1FNO A;  2GLF A;  2HV2 A;  4XPK A;  2REF A;  2Z10 A;  4JXQ A;  3PRT A;  5LRK A;  1F2P A;  1P4N A;  2QIR A;  2BO9 A;  4OLL A;  3PFO A;  3NA6 A;  4H89 A;  4MHY A;  5K8P A;  2EVN A;  2JDD A;  2Z3K A;  4LQ6 A;  1Y7E A;  4NJQ A;  4ONU A;  3T9Y A;  5CBM A;  1CM0 A;  3S6K A;  4KOS A;  4U9Z A;  2G0B A;  1N71 A;  1S5K A;  1Q2D A;  3TT2 A;  1M4I A;  1YLO A;  1GHE A;  2Q4V A;  3D68 A;  3L2N A;  4CYN A;  1XF8 A;  3IFE A;  2PJ6 A;  4IAV A;  2I00 A;  4UCP A;  4B11 A;  1ON0 A;  3IGR A;  3CT9 A;  3D3S A;  2I79 A;  3H5Z A;  3F5B A;  4L89 A;  5CNP A;  3G8W A;  4O23 A;  5A27 A;  3NE7 A;  3NFZ A;  5HVG A;  4IF5 A;  2D4O A;  2XEJ A;  4UWJ A;  5F49 A;  3TOB A;  5C88 A;  1S7F A;  2IMO A;  2ZW6 A;  2ZEG A;  3PB6 X;  2ZEF A;  4NGT A;  4B5P A;  3PBB A;  3V38 A;  3SI1 A;  4B12 A;  2Q0Y A;  3CPA A;  4U5Y A;  1SQH A;  2PE3 A;  4Y49 B;  4YRH A;  2VL1 A;  3B3S A;  3JTK A;  4EFD A;  2PJC A;  2F5I A;  3QNV A;  4KSF A;  3H4Q A;  2HB6 A;  4MHN A;  3K9T A;  3WAB A;  4F6A A;  4GS4 A;  1XMT A;  2J8N A;  4A30 A;  2A4N A;  2YNE A;  2PJA A;  3CXP A;  4H6Z A;  3IEH A;  4YGO A;  5EMI A;  1CP7 A;  2ZPA A;  4UCN A;  2PJ0 A;  3GYA A;  3E0K A;  2IL4 A;  3IJ3 A;  2HUZ A;  1S60 A;  4MFL A;  4ZY0 A;  7CPA A;  3RAM A;  3R9G A;  3IWW A;  3TE4 A;  3IWG A;  4UCM A;  5K8N A;  1BO4 A;  5H84 A;  4HNX B;  2G3T A;  3ISZ A;  1ELM P;  1Z2L A;  3FX6 A;  4JYW A;  3S9L A;  2G9D A;  4UIA A;  1BLL E;  2DPT A;  1IYL A;  3BI0 A;  2P0W A;  1ARL A;  2YND A;  4OID A;  3KL9 A;  1B87 A;  2V77 A;  2P6F A;  2QVP A;  3KHX A;  2ATR A;  4R87 A;  4RS2 A;  4TNU A;  4H2K A;  4MCR A;  4HPS A;  1NSL A;  3GLJ A;  4ZX9 A;  2FCK A;  4OP4 A;  2IQ6 A;  2I3C A;  4FUU A;  4KOU A;  2AJ6 A;  4KOR A;  4R8F A;  4HKF A;  1TKJ A;  2OH1 A;  1YRE A;  4K3N A;  4R57 A;  3T8W A;  4FD5 A;  3LD2 A;  5G22 A;  1IOI A;  1I21 A;  2C6P A;  4NXY A;  4Y49 C;  2PJ3 A;  3H8F A;  4KOV A;  1QSR A;  3FYN A;  4LQG A;  4UFV A;  4NGS A;  2ZW7 A;  1XMB A;  4WWV A;  5LRJ A;  4CS0 B;  1Y9W A;  2OZG A;  3LWU A;  4NFR A;  4MBU A;  4NGR A;  1KUX A;  1X10 A;  4E0A A;  2DF5 A;  3ZJ0 A;  4JXR A;  2R7H A;  2XEI A;  3PFE A;  4AVB A;  2CTB A;  4F0Y A;  3D7G A;  1KZF A;  1S7N A;  1TXR A;  3S6F A;  4ZGY B;  3EY5 A;  4MCS A;  2ZEO A;  3LAC A;  3WC5 A;  5GCN A;  1H8L A;  2P6G A;  4CYP A;  5LYI A;  4OC1 A;  2FIA A;  4DYO A;  2V8H A;  1NE9 A;  4PPZ A;  3TO9 A;  4RUH A;  3PZJ A;  5HXD A;  2PJ7 A;  3OWC A;  1CX8 A;  3IC1 A;  4FBE A;  4MMO A;  2B58 A;  5DWM A;  5BWA B;  4R3L A;  3KR5 A;  5AG6 A;  2Q7B A;  3KHZ A;  1UWY A;  1Z4R A;  2AFZ A;  4AG7 A;  4PK3 A;  4PV6 A;  2B3U A;  2OR4 A;  2Q04 A;  1VIX A;  4IHM A;  2RFH A;  4BMH A;  2P6E A;  1L0C A;  2V8V A;  3GIU A;  4KUA A;  4BIN A;  4X8I A;  3RBU A;  4A94 A;  2G3A A;  2BOA A;  2Q44 A;  4ORF A;  3DDD A;  2FIW A;  3BI1 A;  2VI7 A;  3IU1 A;  2OZH A;  1EE3 P;  1XJO A;  3SI2 A;  4RN7 A;  3SXN A;  2JBJ A;  1YQE A;  3MRU A;  2Q7S A;  2Z3L A;  4MY0 A;  4X5K A;  4ZY2 A;  4OC4 A;  2GAN A;  2K5T A;  4JWP A;  3TOA A;  3W6S A;  2Z11 A;  4E2A A;  2J8M A;  4ONW A;  5G20 A;  3KR4 A;  4Q38 A;  5H86 A;  2CTC A;  5THW A;  2OOT A;  3FB3 A;  5A28 A;  2GRE A;  4QVT A;  3KQX A;  2J9A A;  2QML A;  1I12 A;  1Q2Y A;  4P10 A;  1VHS A;  1IY7 A;  2B5G A;  4AG9 A;  3SHP A;  5AG7 A;  5J1Q A;  1B6B A;  4UEZ A;  5IV0 A;  1YK3 A;  2OZU A;  3QAY A;  2VEZ A;  4OC2 A;  4K30 A;  2FXF A;  3CZX A;  2HC9 A;  2PR1 A;  5EC4 A;  3RYO A;  4B5P B;  4A39 A;  3TO6 A;  1CJW A;  5DWN A;  3PB4 X;  3GY9 A;  4A2Z A;  2Z3P A;  4R76 A;  4KVM E;  4C2Z A;  3D7H A;  2EK9 A;  5K8O A;  5KTA A;  1I1D A;  1YME A;  3N5F A;  2PQ8 A;  3D7D A;  1NSA A;  4QB9 A;  3S9M A;  3V8I A;  1KUV A;  4IUS A;  2ZXV A;  3FEC A;  1YVO A;  4MFP A;  4CYO A;  4UFW A;  2WSA A;  1ZLH A;  4MJ8 A;  1R57 A;  3D66 A;  3D8P A;  3H8E A;  1YW4 A;  1CBX A;  2BL1 A;  2BSW A;  2C27 A;  4AVC A;  1M4D A;  5AGE A;  4C7I A;  4L8A A;  4CGM A;  2YNC A;  4CGN A;  1R43 A;  5D29 A;  5KTD A;  2PJ1 A;  1M4G A;  4YU9 A;  3MGD A;  1KUY A;  5AG5 A;  2FS5 A;  5J8F A;  5JH9 A;  3DR6 A;  4A37 A;  1OZP A;  4NF1 A;  3MN8 A;  4MHZ A;  4YWY A;  4KUB A;  5LYD A;  3IWE A;  2FE7 A;  1F2O A;  2B4D A;  4NGP A;  1BPM A;  4DUK A;  1WK4 A;  3ISX A;  4CYQ A;  5HVH A;  2ZEP A;  2AE6 A;  4NEX A;  3D7F A;  1S3Z A;  3EC4 A;  3LMS A;  4MFJ A;  3QB8 A;  1XOV A;  1MK4 A;  1YR0 A;  1GYT A;  2JEW A;  5HVF A;  2VZY A;  1QSM A;  3EFA A;  4FD6 A;  5I4M A;  4DNC A;  2ABZ A;  2R1I A;  4AB7 A;  1IIC A;  2ZW4 A;  2AFU A;  4XPL A;  1K4J A;  1Z8W A;  2FVG A;  2NSM A;  4CGL A;  2GE3 A;  4I49 A;  4R9M A;  2REE A;  3QAH A;  4C68 A;  1XFO A;  1LAP A;  2QEC A;  4KLV A;  4P4F A;  4BD9 A;  1YVK A;  3KZW A;  2C1C A;  2PCU A;  3B3V A;  4P4D A;  4CAW A;  1RO5 A;  4LX9 A;  4CAX A;  3CDX A;  2NYQ A;  3NE8 A;  4P4I A;  2PR8 A;  3JRU A;  5I0C A;  2PJ2 A;  2DEA A;  5ELY A;  4KOY A;  4B6Z A;  5KTC A;  4MCQ A;  2R98 A;  2CIJ A;  4H6U A;  1ZG8 A;  3BLN A;  1OBR A;  2Q4Z A;  3SJX A;  1BPN A;  3BJ7 A;  4B13 A;  3B3T A;  4UEE A;  2QJ8 A;  4MFK A;  2ANP A;  2Z0Z A;  1Z9U A;  3SJE A;  2O4H A;  4P44 A;  4F9V A;  4PSW A;  4A31 A;  5JM6 A;  1QSN A;  1Z8T A;  3FEE A;  3K9U A;  1ZG7 A;  2XEG A;  4MHD A;  5E96 A;  2EWB A;  4FAI A;  3B3W A;  1PUA A;  1Z8X A;  2VBQ A;  1Q7L A;  1DE4 C;  3FIX A;  2PIZ A;  1LAM A;  6CPA A;  2B3V A;  4MXU A;  4XNH B;  4MFZ A;  2PRQ A;  3PP9 A;  1XIX A;  3UY5 A;  5HH1 A;  4OC3 A;  2Q43 A;  2VZZ A;  1TF9 A;  5D8N A;  2ZEM A;  4ZX8 A;  2PRB A;  2AFX A;  2BEI A;  2GFQ A;  2ZEN A;  2JLM A;  4Q36 A;  4OC0 A;  3RZA A;  1F57 A;  3SI0 A;  5HMN A;  5J8C A;  2PDO A;  1CG2 A;  4NJR A;  3R95 A;  1M4L A;  4KVO E;  2WYR A;  3KKW A;  2B5G B;  4KSI A;  4NSQ A;  4X2T A;  4GXH A;  5JQ4 A;  5CPA A;  2ZOF A;  4ZBG A;  1LRZ A;  4F8Z A;  1M1D A;  1PU9 A;  1LOK A;  4HNY B;  4UEF A;  3NH5 A;  2PJ5 A;  2WZN A;  4MI4 A;  2HQY A;  4C2Y A;  1Q2C A;  3D4U A;  4ZI6 A;  1Y7R A;  4UFX A;  3TX8 A;  4CRZ B;  3EO4 A;  2EO8 A;  1AUG A;  2OU2 A;  2PJ8 A;  4PXC A;  4OIW A;  1TIQ A;  2FSR A;  3FXT A;  3PB8 X;  4OAD A;  4PK2 A;  2O53 A;  2PIY A;  3A9L A;  3FMC A;  5F47 A;  4LUA A;  3B8G A;  2XEF A;  2CNM A;  1ZO0 A;  1YSJ A;  3IIB A;  3ZZI A;  1MJA A;  1VHE A;  2OB0 A;  2Y0M A;  1S7L A;  3F8K A;  4FD7 A;  2VQY A;  4XNH C;  2GIV A;  2CNT A;  2AFW A;  3I1U A;  1VGY A;  2V8G A;  2X7B A;  1IGB A;  4PXE A;  4XPD B;  3W91 A;  4ZYQ A;  5K8M A;  1IU8 A;  1HDQ A;  1IID A;  2ZW5 A;  3BJ8 A;  1LAN A;  3CXQ A;  3HUV A;  3PBE A;  3SJF A;  3I9S A;  2B4B A;  3GKR A;  3KQZ A;  2DXQ A;  4C2X A;  2ODF A;  1J4J A;  5DS0 A;  3TTH A;  1PCA A;  3RNZ A;  4DJL A;  3D67 A;  5JGF A;  2C6G A;  3VWD A;  4CGO A;  3N7Z A;  1XEB A;  1XE4 A;  1Y0R A;  2B4D B;  2GU2 A;  2POK A;  4F0X A;  3R9F A;  1IYK A;  4KOX A;  4IK2 A;  4UF4 A;  3GUX A;  4UIB A;  3B35 A;  1P0H A;  3WC6 A;  5F46 A;  4UWI A;  4KVX A;  1Z4E A;  4A33 A;  4A38 A;  3B3C A;  1QSO A;  2PJB A;  3NH4 A;  4JLY A;  3WC7 A;  3DLJ A;  4P45 A;  1QST A;  4PXD A;  2QYV A;  2O28 A;  1HEE A;  1YW6 A;  1AMP A;  4KOT A;  1ZG9 A;  4QC6 A;  5IB9 A;  2RC4 A;  1JWQ A;  2ZEL A;  3PEI A;  1QQ9 A;  3T90 A;  1IB1 E;  2DPS A;  2Q51 A;  1V0C A;  3FBU A;  2AFM A;  4OC5 A;  3SJG A;  4JZ0 A;  1RXT A;  2YGW A;  1TF8 A;  2D4P A;  3NH8 A;  4II9 A;  1M44 A;  1VKC A;  3C26 A;  3TCV A;  2PVW A;  1DTD A;  2AFO A;  1A2Z A;  2KCW A;  3IO1 A;  3BHX A;  3IU2 A;  5LYF A;  3D2P A;  4PXB A;  4WJB A;  4UBR A;  3WR7 A;  4M6I A;  3CXS A;  4XPD C;  3DNS A;  1FT7 A;  3PB7 X;  2YNC C;  1Y9K A;  4M6H A;  1FY7 A;  2CF4 A;  5G1Z A;  2Z3M A;  3VAR A;  3VH9 A;  4UA3 A;  4M3S A;  3EXN A;  4BBH A;  1Z8L A;  1XRY A;  1Y0Y A;  4AXV A;  2VXK A;  4W9Y A;  3S6H A;  1X12 A;  3B7I A;  4C7H A;  2Z3O A;  4CPA A;  1HDU A;  4KSA A;  3R96 A;  4P4J A;  2PJ4 A;  2JDC A;  2CXA A;  4B14 A;  2IJZ A;  2F8H A;  4A32 A;  4CGP A;  4EME A;  5ISV A;  2Q4Y A;  1TKF A;  4MCP A;  4M6G A;  5EBV A;  3P2F A;  3LOD A;  8CPA A;  2CY2 A;  5LRG A;  4MY3 A;  2WPX A;  3FH4 A;  1ZLI A;  4MFQ A;  1MJ9 A;  3JVN A;  3I3G A;  4PSX A;  2PJ9 A;  2V8D A;  4P6Y A;  2GLJ A;  4E8O A;  2BCO A;  3BXM A;  3KGQ A;  4X3R A;  3GB0 A;  4R7M A;  2FL4 A;  5JPH A;  3TO7 A;  2EK8 A;  1CPX A;  2BUE A;  3W6X A;  3FNC A;  3R1K A;  2PC1 A;  3VWE A;  4EVY A;  1S7K A;  2ARH A;  2ZOG A;  4J3G A;  2H5M A;  4B10 A;  3WT4 A;  2JBK A;  3FRM A;  4KZT A;  1LFW A;  3TFY A;  3SXO A;  2C6C A;  5IB0 A;  3B2Y A;  2R8V A;  4NGM A;  3K2K A;  4KOW A;  3V7Z A;  1IOF A;  3KAS A;  5G21 A;  4RI1 A;  2PVV A;  1QMU A;  3JUW A;  1KWM A;  4NCZ A;  2AFS A;  2PSW A;  1U6M A;  4OME A;  3TC8 A;  2WPW A;  4Q7A A;  4U9Y A;  3FF3 A; 
#chains in the Genus database with same CATH homology
 4A95 A;  4CAV A;  2WUU A;  3F0A A;  4KS9 A;  1NMT A;  5C82 A;  4R3K A;  4JD6 A;  1BOB A;  5F48 A;  2FT0 A;  4KLW A;  1YLE A;  4AVA A;  3P2H A;  2EUI A;  1YGH A;  2Z3N A;  4QUS A;  4CAE A;  4B5O A;  4YFJ A;  1YX0 A;  4QBJ A;  4HNW B;  1MJB A;  4OAE A;  3R9E A;  4CRY B;  5AG4 A;  3DR8 A;  2CNS A;  4CAF A;  3G3S A;  4JJX A;  3S6G A;  5IX3 A;  1UFH A;  3D2M A;  2NMT A;  3DSB A;  4M85 A;  3PGP A;  5FVJ A;  2J8R A;  4FD4 A;  1WWZ A;  2JEV A;  2HV2 A;  4XPK A;  2REF A;  2Z10 A;  4JXQ A;  1P4N A;  2QIR A;  4OLL A;  4H89 A;  2EVN A;  2JDD A;  2Z3K A;  4ONU A;  3T9Y A;  1CM0 A;  3S6K A;  4KOS A;  4U9Z A;  2G0B A;  1N71 A;  1S5K A;  1Q2D A;  3TT2 A;  1M4I A;  1GHE A;  2Q4V A;  4CYN A;  1XF8 A;  4B11 A;  2I00 A;  4UCP A;  1ON0 A;  3IGR A;  3D3S A;  2I79 A;  3H5Z A;  3F5B A;  4L89 A;  5CNP A;  3G8W A;  5A27 A;  3NE7 A;  4IF5 A;  2D4O A;  4UWJ A;  5F49 A;  3TOB A;  5C88 A;  1S7F A;  2ZW6 A;  4B5P A;  2Q0Y A;  4U5Y A;  1SQH A;  4Y49 B;  4YRH A;  3JTK A;  2F5I A;  4KSF A;  3H4Q A;  4F6A A;  4GS4 A;  1XMT A;  2J8N A;  4A30 A;  2A4N A;  2YNE A;  3CXP A;  4H6Z A;  4YGO A;  2ZPA A;  4UCN A;  3GYA A;  3E0K A;  2IL4 A;  2HUZ A;  1S60 A;  4MFL A;  3R9G A;  3TE4 A;  3IWG A;  4UCM A;  1BO4 A;  5H84 A;  4HNX B;  2G3T A;  2DPT A;  1IYL A;  2P0W A;  2YND A;  1B87 A;  2P6F A;  4R87 A;  2ATR A;  4RS2 A;  1NSL A;  2FCK A;  4KOU A;  4KOR A;  2AJ6 A;  4HKF A;  2OH1 A;  1YRE A;  4R57 A;  4FD5 A;  3LD2 A;  5G22 A;  1I21 A;  4NXY A;  4Y49 C;  4KOV A;  1QSR A;  3FYN A;  4UFV A;  2ZW7 A;  4CS0 B;  1Y9W A;  2OZG A;  4MBU A;  1KUX A;  4E0A A;  4JXR A;  2R7H A;  4AVB A;  4F0Y A;  1KZF A;  1S7N A;  3S6F A;  4ZGY B;  3EY5 A;  5GCN A;  4CYP A;  2P6G A;  2FIA A;  1NE9 A;  3TO9 A;  3PZJ A;  3OWC A;  2B58 A;  5DWM A;  4R3L A;  5AG6 A;  2Q7B A;  1Z4R A;  4AG7 A;  4PK3 A;  4PV6 A;  2B3U A;  2Q04 A;  4BMH A;  2P6E A;  1L0C A;  4KUA A;  2G3A A;  2Q44 A;  4ORF A;  3DDD A;  2FIW A;  3IU1 A;  2VI7 A;  2OZH A;  3SXN A;  2Z3L A;  4MY0 A;  4X5K A;  3W6S A;  5BWA B;  2GAN A;  2K5T A;  4JWP A;  3TOA A;  4E2A A;  2Z11 A;  2J8M A;  5G20 A;  4Q38 A;  5H86 A;  3FB3 A;  5A28 A;  4QVT A;  2QML A;  1I12 A;  1Q2Y A;  1VHS A;  2B5G A;  4AG9 A;  3SHP A;  5AG7 A;  1B6B A;  5IV0 A;  1YK3 A;  2OZU A;  2VEZ A;  4K30 A;  2FXF A;  2PR1 A;  3RYO A;  5EC4 A;  4B5P B;  3TO6 A;  1CJW A;  5DWN A;  3GY9 A;  4A2Z A;  2Z3P A;  4KVM E;  4C2Z A;  5KTA A;  1I1D A;  2PQ8 A;  4QB9 A;  3V8I A;  1KUV A;  4IUS A;  2ZXV A;  1YVO A;  4MFP A;  4CYO A;  4UFW A;  2WSA A;  4MJ8 A;  1R57 A;  3D8P A;  2BL1 A;  2BSW A;  2C27 A;  4AVC A;  1M4D A;  5AGE A;  4C7I A;  4L8A A;  4CGM A;  2YNC A;  4CGN A;  5KTD A;  1M4G A;  3MGD A;  1KUY A;  5AG5 A;  2FS5 A;  5J8F A;  3DR6 A;  1OZP A;  4NF1 A;  4KUB A;  3IWE A;  2FE7 A;  2B4D A;  1WK4 A;  4CYQ A;  2AE6 A;  4NEX A;  1S3Z A;  3EC4 A;  4MFJ A;  3QB8 A;  1MK4 A;  1YR0 A;  2VZY A;  1QSM A;  3EFA A;  4FD6 A;  4DNC A;  2R1I A;  4AB7 A;  1IIC A;  2ZW4 A;  4XPL A;  1K4J A;  4CGL A;  2GE3 A;  4I49 A;  4R9M A;  2REE A;  3QAH A;  4C68 A;  2QEC A;  4KLV A;  1YVK A;  4CAW A;  1RO5 A;  4LX9 A;  4CAX A;  2PR8 A;  5I0C A;  4KOY A;  5KTC A;  2R98 A;  4H6U A;  3BLN A;  3BJ7 A;  4B13 A;  4MFK A;  2Z0Z A;  1Z9U A;  4PSW A;  4A31 A;  1QSN A;  3K9U A;  4MHD A;  5E96 A;  1PUA A;  2VBQ A;  3FIX A;  2B3V A;  4XNH B;  3ZJ0 A;  4MFZ A;  4B12 A;  3PP9 A;  1XIX A;  3UY5 A;  5HH1 A;  2VZZ A;  2PRB A;  2BEI A;  2JLM A;  4Q36 A;  5HMN A;  5J8C A;  2PDO A;  3R95 A;  4KVO E;  3KKW A;  2B5G B;  4NSQ A;  5JQ4 A;  4ZBG A;  1LRZ A;  1M1D A;  1PU9 A;  4HNY B;  4MI4 A;  2HQY A;  4C2Y A;  1Q2C A;  1Y7R A;  4UFX A;  4CRZ B;  3EO4 A;  2OU2 A;  1TIQ A;  2FSR A;  3FXT A;  4OAD A;  4PK2 A;  3A9L A;  5F47 A;  4LUA A;  3B8G A;  2CNM A;  1ZO0 A;  3ZZI A;  1MJA A;  2OB0 A;  2Y0M A;  3F8K A;  1S7L A;  4FD7 A;  2VQY A;  4XNH C;  2GIV A;  2CNT A;  4XPD B;  3W91 A;  2X7B A;  1IID A;  2ZW5 A;  3BJ8 A;  3CXQ A;  3I9S A;  2B4B A;  3GKR A;  4C2X A;  2DXQ A;  1J4J A;  3TTH A;  3VWD A;  4CGO A;  3N7Z A;  1XEB A;  1XE4 A;  2B4D B;  4F0X A;  3R9F A;  1IYK A;  4KOX A;  1P0H A;  5F46 A;  4UWI A;  4KVX A;  1Z4E A;  4A33 A;  1QSO A;  4JLY A;  1QST A;  2O28 A;  4KOT A;  4QC6 A;  2RC4 A;  3T90 A;  1IB1 E;  2DPS A;  3FBU A;  1V0C A;  1RXT A;  2YGW A;  2D4P A;  4II9 A;  1M44 A;  1VKC A;  3C26 A;  3TCV A;  2KCW A;  3IU2 A;  3D2P A;  3WR7 A;  4UBR A;  3CXS A;  4XPD C;  3DNS A;  2YNC C;  1Y9K A;  1FY7 A;  5G1Z A;  2Z3M A;  4UA3 A;  4M3S A;  3EXN A;  4BBH A;  2VXK A;  3S6H A;  4C7H A;  2Z3O A;  4KSA A;  3R96 A;  2JDC A;  2CXA A;  4B14 A;  4A32 A;  5ISV A;  4CGP A;  2Q4Y A;  5EBV A;  3P2F A;  3LOD A;  2CY2 A;  4MY3 A;  2WPX A;  4MFQ A;  1MJ9 A;  3JVN A;  3I3G A;  4PSX A;  4E8O A;  2FL4 A;  5JPH A;  3TO7 A;  2BUE A;  3W6X A;  3FNC A;  3R1K A;  2PC1 A;  3VWE A;  4EVY A;  1S7K A;  2ARH A;  4J3G A;  2H5M A;  4B10 A;  3FRM A;  4KZT A;  3TFY A;  3SXO A;  5IB0 A;  2R8V A;  4KOW A;  5G21 A;  4RI1 A;  3JUW A;  4NCZ A;  2PSW A;  1U6M A;  2WPW A;  4U9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...