4BD9A

Structure of the complex between smci and human carboxypeptidase a4
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
304
structure length
304
Chain Sequence
NFNYGAYHSLEAIYHEMDNIAADFPDLARRVKIGHSFENRPMYVLKFSTGKGVRRPAVWLNAGIHSREWISQATAIWTARKIVSDYQRDPAITSILEKMDIFLLPVANPDGYVYTQTQNRLWRKTRSRNPGSSCIGADPNRNWNASFAGKGASDNPCSEVYHGPHANSEVEVKSVVDFIQKHGNFKGFIDLHSYSQLLMYPYGYSVKKAPDAEELDKVARLAAKALASVSGTEYQVGPTCTTVYPASGSSIDWAYDNGIKFAFTFELRDTGTYGFLLPANQIIPTAEETWLGLKTIMEHVRDNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CARBOXYPEPTIDASE A4
publication title A Noncanonical Mechanism of Carboxypeptidase Inhibition Revealed by the Crystal Structure of the Tri-Kunitz Smci in Complex with Human Cpa4.
pubmed doi rcsb
source organism Homo sapiens
total genus 104
structure length 304
sequence length 304
ec nomenclature ec 3.4.17.-:
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4bd9A00
3H8FA 1BAVA 1XMBA 2JEWA 2PIYA 4PPZA 2ZEOA 4X3RA 5J1QA 2BCOA 4MRIA 3B3TA 3T8WA 4X8IA 5JM6A 4EWTA 3L2NA 2PJAA 4ONWA 4PQAA 2PJ3A 2WYRA 4FUUA 2QVPA 1Y0YA 4JZ0A 4DUKA 1GYTA 3PB9X 1RTQA 3WT4A 1ZLIA 2OR4A 2BOAA 1TKJA 4MCQA 4OC5A 2C6CA 4IAVA 4UIAA 5K8PA 4TNUA 1XFOA 5IB9A 3D4UA 3K2KA 2C1CA 3SJEA 4O23A 1HDUA 2XEJA 4P4JA 3WC6A 4F9VA 1TKHA 4PXBA 3H8EA 4R8FA 5HVHA 3I1UA 3BXMA 3IWWA 4A94A 2PJCA 3BHXA 1JQGA 4F9UA 2IJZA 4ZX9A 3IC1A 2DEAA 2EWBA 1HEEA 2V8VA 2Q51A 2O53A 3KR5A 4UEFA 1BPNA 3D7GA 4W9YA 2IQ6A 2GREA 5CPAA 3SI1A 3FEEA 1CPSA 4PXDA 1IGBA 2V8DA 1IY7A 3B2YA 4ZY1A 4NGSA 2V8HA 3RAMA 2V8GA 2ZOGA 5LRGA 4TWEA 1VHEA 2CIJA 3LMSA 2RB7A 3D66A 2PRQA 3FEDA 3MN8A 2ZOFA 2G9DA 3PB8X 5D8NA 3SJXA 4PXEA 3V7ZA 4G1PA 3FH4A 3PBBA 4FBEA 4OC4A 4ZYQA 4OC3A 5JGFA 3MRUA 1QQ9A 3PRTA 4WJBA 3B3VA 2NYQA 2PJ2A 4NFRA 3WABA 3S9MA 2AFSA 4EMEA 1KWMA 5LYIA 1DE4C 5K8OA 2CF4A 1ELLP 2EK8A 4PXCA 4P4IA 3FX6A 4MCRA 3NFZA 3SI0A 4MMOA 2AFOA 4NGMA 4DYOA 1M4LA 2JBKA 4H2KA 2PIZA 8CPAA 1YW4A 3FMCA 2GU2A 2ZEEA 3S9NA 4OP4A 3SJFA 4MHZA 2ANPA 4P6YA 4A38A 5LYLA 4YU9A 3KQXA 6CPAA 2VL1A 1TXRA 1OBRA 3B3CA 1CP6A 4DJLA 4R76A 2GLJA 4R6TA 4R7MA 1ZLHA 4K3NA 2O4HA 2PJ1A 2J9AA 5CBMA 3BI1A 2PCUA 3NH5A 5D29A 2ZEHA 2ZEDA 3K9TA 3KR4A 1R3NA 2HB6A 4ZX8A 3IJ3A 3PFOA 3D7FA 2PJ8A 2ABZA 4P4FA 4ZY2A 1TF9A 1FNOA 3D7DA 2Q4ZA 4NGNA 5ELYA 2CTCA 5THWA 3D7HA 3H8GA 3D68A 3B35A 2ZELA 2OOTA 1F57A 5HVFA 2AFZA 1Q7LA 3WC7A 4FAIA 1ZG9A 3FF3A 4MHPA 2QJ8A 3CPXA 1Z8LA 3GUXA 3FVLA 4JYWA 4B6ZA 2XEIA 2ZEGA 3CDXA 3TC8A 1Y0RA 3IEHA 3VATA 2I3CA 1R43A 5I4MA 3CT9A 4NJRA 4BD9A 4NGPA 4A37A 3SI2A 1YW6A 3NA6A 3PEIA 4MHNA 7CPAA 1XBUA 2AFMA 1HDQA 3IIBA 1CX8A 4UEEA 4NGTA 5HXDA 4KSIA 1FT7A 3S9LA 1TKFA 3RBUA 4Z65A 3KQZA 1TF8A 2AFUA 1CP7A 2F7VA 1ZG7A 1BPMA 2ZENA 2GLFA 3B3WA 5LRKA 3HUVA 1DTDA 3DGVA 2QYVA 3NH8A 1AMPA 1Y7EA 3GB0A 3QNVA 4CPAA 5LYDA 1LANA 1VIXA 1ELMP 4UEZA 4OC0A 1NSAA 4OMEA 3KZWA 3JRUA 4OKOA 3NH4A 1Z5RA 1ARMA 2PVVA 4FWUA 4P4DA 2PJ4A 2PE3A 1LAPA 3N5FA 5K8MA 1YLOA 4F8ZA 3PB7X 1ARLA 3KL9A 3IFEA 2C6PA 3IO1A 4ZI6A 3HLPA 3KHZA 4P10A 4P44A 1PCAA 1LFWA 3WC5A 4OIDA 4EFDA 3TX8A 2PJ9A 3V38A 1F2OA 1VGYA 3SJGA 2PVWA 2ZEFA 4GM5A 2AFXA 4OC1A 2IMOA 1CBXA 3BI0A 1XJOA 4ZY0A 4AXVA 1ZG8A 3KASA 1YMEA 4OC2A 4Q7AA 1LOKA 2Q43A 3ISXA 4LQGA 1UWYA 5HVGA 4MHYA 1VHOA 3DLJA 5LRJA 2C6GA 2PJ6A 3PB6X 5LYFA 2WZNA 2XEFA 4UF4A 1XRYA 3VH9A 5JH9A 1LAMA 2NSMA 2XEGA 3CPAA 1PYTB 5DS0A 1EE3P 1LCPA 4P4EA 1BLLE 4MCSA 2BO9A 3PBEA 4MCPA 4UIBA 4IK2A 4MXUA 4A39A 3KHXA 4NGQA 2POKA 2FVGA 3B3SA 3ISZA 3FECA 5F09A 4RUHA 2PJ7A 3KI9A 3PB4X 2CTBA 2PJ5A 1H8LA 1F2PA 2PJBA 3FJUA 4NJQA 1QMUA 2EK9A 1CG2A 2HC9A 2V77A 4X2TA 2ZEMA 4OIWA 1AYEA 4P4BA 4IHMA 3KGQA 1YSJA 3D67A 3GLJA 3VARA 3B7IA 3PFEA 4WWVA 3LWUA 1Z2LA 4NGRA 1CPXA 2RFHA 4P45A 2ZEPA 3RZAA 4YWYA 2F8HA 2JBJA 2AFWA 5K8NA 2PJ0A
chains in the Genus database with same CATH superfamily
3H8FA 1BAVA 3QAHA 1XMBA 2JEWA 3C26A 2PIYA 4PK3A 2B5GB 4PPZA 1S60A 3PP9A 2DF5A 2ZEOA 4X3RA 5J1QA 5EMIA 2BCOA 1MJAA 4MRIA 2IL4A 3B3TA 3T8WA 3CXSA 2ZW7A 3E0KA 4X8IA 4YRHA 5JM6A 4KOVA 5EBVA 4EWTA 2WPXA 3I3GA 3L2NA 3DR6A 1IOFA 2PJAA 2OU2A 4KOYA 4QC6A 4KSAA 4ONWA 4KUBA 4R87A 4X5KA 4PQAA 2PJ3A 2WUUA 2WYRA 4L8AA 3MGDA 2QVPA 4FUUA 4H6UA 3S6HA 1Y0YA 4JZ0A 4M6HA 4HNWB 1GYTA 4DUKA 3PB9X 1RTQA 5A28A 1NE9A 1IICA 1ZLIA 3WT4A 3RYOA 2OR4A 2BOAA 4YFJA 1TKJA 4C7IA 4CAXA 4CYQA 4MCQA 4OC5A 2C6CA 4IAVA 4UIAA 5K8PA 4TNUA 1XFOA 2GE3A 5HMNA 5IB9A 2VZZA 2Y0MA 3D4UA 3S6KA 3K2KA 4RN7A 5I0CA 2C1CA 3SJEA 2B5GA 4O23A 1HDUA 2XEJA 4JD6A 5AG7A 4B12A 1Z9UA 1QSTA 3S6GA 4MFJA 3T9YA 4P4JA 3WC6A 3OWCA 4LX9A 4UBRA 4F9VA 3IU1A 1TKHA 4PXBA 4LUAA 3H8EA 1S7LA 2VI7A 4R8FA 5HVHA 3I1UA 2Z0ZA 3BXMA 3IWWA 4A94A 2PJCA 3BHXA 1JQGA 4F9UA 1CJWA 2IJZA 2Z3LA 3F0AA 2DEAA 2EWBA 2FXFA 3IC1A 4UFWA 4ZX9A 1HEEA 2V8VA 2Q51A 2O53A 2YNEA 3KR5A 4CGOA 2DXQA 4UEFA 4JWPA 4I49A 2AJ6A 1BPNA 2CNMA 3DR8A 4B5PB 5BWAB 2Z11A 3D7GA 4W9YA 3SHPA 2IQ6A 3UY5A 1SQHA 2GREA 5CPAA 1TIQA 3SI1A 1IU8A 3TE4A 2JDDA 3FEEA 1IYLA 1CPSA 3TCVA 4PXDA 4CRYB 1IGBA 3FIXA 2V8DA 1IY7A 2Q4YA 3B2YA 4NGSA 4ZY1A 2V8HA 2J8NA 1Y7RA 3RAMA 3BJ8A 2V8GA 2ZOGA 5LRGA 1B6BA 4F0YA 4TWEA 1VHEA 3IGRA 4JXQA 3H5ZA 3G3SA 4AG7A 2CIJA 3LMSA 3LODA 2FIAA 2RB7A 3D66A 2PRQA 3FEDA 5AG6A 3MN8A 2ZOFA 4KLVA 2G9DA 3PB8X 4JLYA 4MFZA 5F47A 1NMTA 2H5MA 4UFVA 5D8NA 1X10A 2R98A 4PXEA 3SJXA 3V7ZA 4G1PA 4B13A 2YNCA 3RNZA 4AB7A 3FH4A 1KUVA 1YR0A 3VWDA 3PBBA 4B5PA 2G0BA 4HNYB 2F5IA 2EO8A 3JVNA 1FY7A 4XNHB 5F49A 4FBEA 4OC4A 3IWEA 4OC3A 2P6GA 4KVOE 4QB9A 1ZO0A 1QQ9A 3MRUA 3PRTA 4ZYQA 5JGFA 3TT2A 4WJBA 1YREA 4BMHA 4E0AA 3PGPA 5F48A 4U9ZA 3B3VA 3R9FA 7CPAA 2NYQA 2PJ2A 4NFRA 3WABA 4UCMA 3S9MA 3P2FA 2AFSA 4EMEA 1IOIA 3R95A 4UWJA 2R1IA 1KWMA 2YGWA 4R3KA 3KKWA 4XPDC 5LYIA 1DE4C 5K8OA 2B3UA 4U9YA 2CF4A 3GY9A 4CGMA 5C88A 4CYOA 4UFXA 4JXRA 3NE7A 1ELLP 2EK8A 4OLLA 4PXCA 4P4IA 3TO6A 1YK3A 3FX6A 4MCRA 4B10A 3NFZA 5EC4A 3SI0A 2J8RA 5AGEA 2PRBA 4MMOA 4DNCA 2AFOA 4NGMA 4DYOA 1QSNA 1M4LA 4UCPA 2JBKA 4H2KA 2PIZA 8CPAA 1XOVA 1YW4A 1VKCA 4Y49C 3FMCA 2D4PA 3N7ZA 2P6EA 2GU2A 1B87A 2ZEEA 3S9NA 1VHSA 2BUEA 3W91A 4OP4A 3SJFA 4MHZA 3TO9A 1RXTA 5H84A 2ANPA 4P6YA 4NCZA 3S6FA 3FXTA 4MY3A 3NE8A 4A38A 5LYLA 4YU9A 3KQXA 1BO4A 2WPWA 3K9UA 3R1KA 5IB0A 1YGHA 6CPAA 2VL1A 1TXRA 1OBRA 1XE4A 1CP6A 3B3CA 4AVAA 4DJLA 2PDOA 3TOBA 4R76A 2GLJA 4R6TA 5G22A 1Z8XA 4R7MA 4XNHC 1ZLHA 4RI1A 4K3NA 2O4HA 4A33A 3CXPA 2PJ1A 4KOUA 3F8KA 2HUZA 3QAYA 3FBUA 4E8OA 2J9AA 2REEA 2O28A 5G21A 5HH1A 5CBMA 3BI1A 2B4BA 3DSBA 4HNXB 1ON0A 2EBJA 2PCUA 3NH5A 5D29A 2ZEHA 2ZEDA 3K9TA 3KR4A 3DNSA 2BSWA 2B58A 3D8PA 4QVTA 1R3NA 2Z10A 2DPTA 2C27A 4KOXA 2FSRA 2PR8A 3F5BA 1QSOA 2HB6A 4ZX8A 4LQ6A 2PSWA 3IJ3A 4GS4A 3PFOA 3BLNA 3D7FA 4PV6A 2PJ8A 2ABZA 4C2YA 4P4FA 1KZFA 4ZY2A 1TF9A 2EUIA 4C2ZA 1FNOA 3CXQA 2OZGA 3D7DA 1PU9A 4PSXA 1I1DA 2J8MA 2Q4ZA 2Z3OA 4NGNA 4BBHA 1R57A 5ELYA 4A2ZA 1YVOA 2Q7BA 4CGLA 2CTCA 5THWA 1V0CA 4K30A 4YGOA 3D7HA 3H8GA 5J8CA 1XMTA 4M3SA 3D68A 2VBQA 3B35A 4BINA 2ZELA 5J8FA 5FVJA 2OOTA 2K5TA 2HQYA 2R7HA 3G8WA 1F57A 5HVFA 2AFZA 2VQYA 3FYNA 3GYAA 1Q7LA 3B8GA 1YQEA 2HV2A 4Q36A 3WC7A 3RO0A 4IF5A 4FAIA 3CZXA 2RC4A 1ZG9A 5DWNA 4NSQA 3FF3A 4MFKA 1MK4A 3D2MA 1LRZA 4MHPA 1S7KA 5KTAA 2QJ8A 3CPXA 1Z8LA 3GUXA 2I00A 2R8VA 3FVLA 2BEIA 2GIVA 4JYWA 2XEIA 4B6ZA 2ZEGA 3CDXA 5CNPA 4A95A 3TC8A 2Q0YA 4HKFA 1Z8TA 1Y0RA 3IEHA 1Z4RA 4NXYA 3VATA 4CS0B 2I3CA 1R43A 3D3SA 5IV0A 5I4MA 3CT9A 4NJRA 4BD9A 5ISVA 4UWIA 2Z3PA 4NGPA 4A37A 3SI2A 3VWEA 1YW6A 3NA6A 4KOTA 2ZW5A 4KVME 5G20A 2QECA 2WSAA 3PEIA 1IIDA 1L0CA 4M6IA 4MHNA 4KSFA 2FS5A 4UA3A 1XBUA 4MBUA 2ZW4A 1M4IA 1HDQA 2AFMA 1CX8A 2OZUA 3IIBA 3IU2A 2VZYA 4UEEA 4KVXA 4NGTA 4FD4A 5HXDA 4KSIA 3BJ7A 4PK2A 1FT7A 1UFHA 2AE6A 3S9LA 4B5OA 4CGPA 3W6SA 2G3AA 4MHDA 3TO7A 2FCKA 1TKFA 2FE7A 3RBUA 4Z65A 3KQZA 4MFPA 1TF8A 3TTHA 4CYPA 2ZPAA 2PQ8A 2AFUA 1CP7A 4J3GA 2F7VA 1ZG7A 1BPMA 4CAWA 2YNCC 2Z3MA 2ZENA 2GLFA 3B3WA 3R9GA 5LRKA 5AG4A 3HUVA 1DTDA 3DGVA 2GFQA 1AUGA 2QYVA 3NH8A 1AMPA 3EFAA 4KUAA 1JWQA 1Y7EA 4QBJA 3GB0A 3QNVA 4FD5A 4CPAA 2YNDA 5LYDA 3JTKA 1LANA 4L89A 3SXOA 1VIXA 1ELMP 5C82A 4UEZA 3A9LA 4KOSA 3P2HA 4OC0A 1NSAA 1S3ZA 4IUSA 1P4NA 4MFLA 3KZWA 4OMEA 1Q2DA 4C68A 1OZPA 4ORFA 5E96A 3JRUA 2PC1A 4OKOA 3NH4A 1Z5RA 1ARMA 2PVVA 4H6ZA 4FWUA 1X12A 4P4DA 4XPKA 1MJ9A 2PJ4A 2P0WA 3R96A 2FL4A 2PE3A 4MJ8A 1LAPA 2B4DB 3N5FA 4B11A 5K8MA 1Z8WA 1YLOA 4AVCA 1M44A 2I79A 4F8ZA 2Z3NA 3FRMA 4MFQA 3PB7X 4CGNA 1ARLA 2EVNA 3KL9A 4ONUA 4QUSA 2CXAA 3T90A 4CYNA 2ATRA 1Z4EA 2QMLA 3IFEA 2C6PA 3IO1A 3SXNA 1PUAA 1MJBA 3EC4A 2OZHA 4U5YA 4ZI6A 3DDDA 2VXKA 2FT0A 3HLPA 3KHZA 3V8IA 2ZW6A 4P10A 4P44A 1Y9WA 3H4QA 4FD7A 4M6GA 4CRZB 1PCAA 1LFWA 2ARHA 3WC5A 4R9MA 4OIDA 4EFDA 2PR1A 3JUWA 4CAFA 1WWZA 3QB8A 1RO5A 2PJ9A 3TX8A 3V38A 1XF8A 1F2OA 2B4DA 1VGYA 2PVWA 3FB3A 3SJGA 5KTDA 2G3TA 1XIXA 2ZEFA 4R57A 4C2XA 1J4JA 4GM5A 2AFXA 1YX0A 2IMOA 2ZXVA 4OC1A 4CAEA 4AVBA 1YVKA 1CBXA 4KS9A 3BI0A 2QIRA 5IX3A 1XJOA 4MY0A 4ZY0A 5G1ZA 4AXVA 1S7FA 1NSLA 2REFA 1A2ZA 1I21A 1ZG8A 3KASA 4B14A 4A31A 4ZGYB 1IB1E 1Q2YA 4OAEA 5A27A 1XEBA 1YMEA 3WR7A 3FNCA 2CY2A 3IWGA 4OC2A 3ZZIA 4GXHA 2Q44A 4C7HA 4Q7AA 1LOKA 2Q43A 3ISXA 1P0HA 3EY5A 4LQGA 1UWYA 2DPSA 5HVGA 5GCNA 2JLMA 4MHYA 2OH1A 4AG9A 1VHOA 3DLJA 3R9EA 5LRJA 2C6GA 2PJ6A 3PB6X 2Z3KA 5LYFA 2WZNA 4KORA 2XEFA 4UF4A 4MI4A 1XRYA 3GIUA 1M4GA 4XPDB 1Q2CA 3VH9A 5JH9A 5KTCA 1LAMA 2NSMA 2XEGA 3CPAA 1PYTB 1QSMA 2CNTA 5DS0A 1EE3P 1LCPA 4P4EA 1BLLE 2VEZA 4MCSA 2BO9A 4E2AA 3PBEA 4MCPA 4UIBA 1M1DA 3TFYA 4R3LA 5AG5A 1KUXA 1CM0A 2BL1A 4FD6A 4IK2A 5DWMA 3LACA 3W6XA 4MXUA 4CAVA 1S7NA 4A39A 4Y49B 4F6AA 2ODFA 1M4DA 3KHXA 4NGQA 2POKA 2FVGA 4H89A 3B3SA 4PSWA 4XPLA 2JDCA 2KCWA 3ISZA 3FECA 5F09A 2OB0A 3TOAA 3I9SA 1Y9KA 1K4JA 2PJ7A 4RUHA 3KI9A 4NEXA 1IYKA 4KOWA 3PB4X 1WK4A 3PZJA 2CTBA 4M85A 1QSRA 2PJ5A 2A4NA 5F46A 1H8LA 1F2PA 2PJBA 3FJUA 3LD2A 4NJQA 4OADA 1QMUA 2EK9A 1CG2A 2HC9A 4KZTA 2V77A 4JJXA 4X2TA 4EVYA 2ZEMA 4F0XA 4OIWA 3GKRA 2B3VA 1AYEA 2D4OA 4IHMA 4P4BA 1GHEA 3KGQA 1YSJA 1S5KA 2JEVA 3D67A 3GLJA 2GANA 1N71A 3ZJ0A 4ZBGA 4A32A 2X7BA 2Q7SA 2FIWA 2P6FA 2Q4VA 3VARA 5JQ4A 3B7IA 3PFEA 4UCNA 4RS2A 4WWVA 1BOBA 3LWUA 5JPHA 2Q04A 1Z2LA 4HPSA 4NGRA 5H86A 4II9A 4KLWA 1CPXA 4Q38A 2RFHA 2CNSA 2NMTA 4NF1A 4P45A 1KUYA 1YLEA 2ZEPA 3RZAA 4YWYA 3EXNA 3D2PA 3EO4A 4A30A 2F8HA 1U6MA 2JBJA 2AFWA 5K8NA 2PJ0A 1I12A
chains in the Genus database with same CATH topology
3H8FA 1BAVA 1XMBA 2JEWA 2PIYA 4PPZA 2ZEOA 4X3RA 5J1QA 2BCOA 4MRIA 3B3TA 3T8WA 4X8IA 5JM6A 4EWTA 3L2NA 2PJAA 4ONWA 4PQAA 2PJ3A 2WYRA 4FUUA 2QVPA 1Y0YA 4JZ0A 4DUKA 1GYTA 3PB9X 1RTQA 3WT4A 1ZLIA 2OR4A 2BOAA 1TKJA 4MCQA 4OC5A 2C6CA 4IAVA 4UIAA 5K8PA 4TNUA 1XFOA 5IB9A 3D4UA 3K2KA 2C1CA 3SJEA 4O23A 1HDUA 2XEJA 4P4JA 3WC6A 4F9VA 1TKHA 4PXBA 3H8EA 4R8FA 5HVHA 3I1UA 3BXMA 3IWWA 4A94A 2PJCA 3BHXA 1JQGA 4F9UA 2IJZA 4ZX9A 3IC1A 2DEAA 2EWBA 1HEEA 2V8VA 2Q51A 2O53A 3KR5A 4UEFA 1BPNA 3D7GA 4W9YA 2IQ6A 2GREA 5CPAA 3SI1A 3FEEA 1CPSA 4PXDA 1IGBA 2V8DA 1IY7A 3B2YA 4ZY1A 4NGSA 2V8HA 3RAMA 2V8GA 2ZOGA 5LRGA 4TWEA 1VHEA 2CIJA 3LMSA 2RB7A 3D66A 2PRQA 3FEDA 3MN8A 2ZOFA 2G9DA 3PB8X 5D8NA 3SJXA 4PXEA 3V7ZA 4G1PA 3FH4A 3PBBA 4FBEA 4OC4A 4ZYQA 4OC3A 5JGFA 3MRUA 1QQ9A 3PRTA 4WJBA 3B3VA 2NYQA 2PJ2A 4NFRA 3WABA 3S9MA 2AFSA 4EMEA 1KWMA 5LYIA 1DE4C 5K8OA 2CF4A 1ELLP 2EK8A 4PXCA 4P4IA 3FX6A 4MCRA 3NFZA 3SI0A 4MMOA 2AFOA 4NGMA 4DYOA 1M4LA 2JBKA 4H2KA 2PIZA 8CPAA 1YW4A 3FMCA 2GU2A 2ZEEA 3S9NA 4OP4A 3SJFA 4MHZA 2ANPA 4P6YA 4A38A 5LYLA 4YU9A 3KQXA 6CPAA 2VL1A 1TXRA 1OBRA 3B3CA 1CP6A 4DJLA 4R76A 2GLJA 4R6TA 4R7MA 1ZLHA 4K3NA 2O4HA 2PJ1A 2J9AA 5CBMA 3BI1A 2PCUA 3NH5A 5D29A 2ZEHA 2ZEDA 3K9TA 3KR4A 1R3NA 2HB6A 4ZX8A 3IJ3A 3PFOA 3D7FA 2PJ8A 2ABZA 4P4FA 4ZY2A 1TF9A 1FNOA 3D7DA 2Q4ZA 4NGNA 5ELYA 2CTCA 5THWA 3D7HA 3H8GA 3D68A 3B35A 2ZELA 2OOTA 1F57A 5HVFA 2AFZA 1Q7LA 3WC7A 4FAIA 1ZG9A 3FF3A 4MHPA 2QJ8A 3CPXA 1Z8LA 3GUXA 3FVLA 4JYWA 4B6ZA 2XEIA 2ZEGA 3CDXA 3TC8A 1Y0RA 3IEHA 3VATA 2I3CA 1R43A 5I4MA 3CT9A 4NJRA 4BD9A 4NGPA 4A37A 3SI2A 1YW6A 3NA6A 3PEIA 4MHNA 7CPAA 1XBUA 2AFMA 1HDQA 3IIBA 1CX8A 4UEEA 4NGTA 5HXDA 4KSIA 1FT7A 3S9LA 1TKFA 3RBUA 4Z65A 3KQZA 1TF8A 2AFUA 1CP7A 2F7VA 1ZG7A 1BPMA 2ZENA 2GLFA 3B3WA 5LRKA 3HUVA 1DTDA 3DGVA 2QYVA 3NH8A 1AMPA 1Y7EA 3GB0A 3QNVA 4CPAA 5LYDA 1LANA 1VIXA 1ELMP 4UEZA 4OC0A 1NSAA 4OMEA 3KZWA 3JRUA 4OKOA 3NH4A 1Z5RA 1ARMA 2PVVA 4FWUA 4P4DA 2PJ4A 2PE3A 1LAPA 3N5FA 5K8MA 1YLOA 4F8ZA 3PB7X 1ARLA 3KL9A 3IFEA 2C6PA 3IO1A 4ZI6A 3HLPA 3KHZA 4P10A 4P44A 1PCAA 1LFWA 3WC5A 4OIDA 4EFDA 3TX8A 2PJ9A 3V38A 1F2OA 1VGYA 3SJGA 2PVWA 2ZEFA 4GM5A 2AFXA 4OC1A 2IMOA 1CBXA 3BI0A 1XJOA 4ZY0A 4AXVA 1ZG8A 3KASA 1YMEA 4OC2A 4Q7AA 1LOKA 2Q43A 3ISXA 4LQGA 1UWYA 5HVGA 4MHYA 1VHOA 3DLJA 5LRJA 2C6GA 2PJ6A 3PB6X 5LYFA 2WZNA 2XEFA 4UF4A 1XRYA 3VH9A 5JH9A 1LAMA 2NSMA 2XEGA 3CPAA 1PYTB 5DS0A 1EE3P 1LCPA 4P4EA 1BLLE 4MCSA 2BO9A 3PBEA 4MCPA 4UIBA 4IK2A 4MXUA 4A39A 3KHXA 4NGQA 2POKA 2FVGA 3B3SA 3ISZA 3FECA 5F09A 4RUHA 2PJ7A 3KI9A 3PB4X 2CTBA 2PJ5A 1H8LA 1F2PA 2PJBA 3FJUA 4NJQA 1QMUA 2EK9A 1CG2A 2HC9A 2V77A 4X2TA 2ZEMA 4OIWA 1AYEA 4P4BA 4IHMA 3KGQA 1YSJA 3D67A 3GLJA 3VARA 3B7IA 3PFEA 4WWVA 3LWUA 1Z2LA 4NGRA 1CPXA 2RFHA 4P45A 2ZEPA 3RZAA 4YWYA 2F8HA 2JBJA 2AFWA 5K8NA 2PJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H8F A;  1BAV A;  1XMB A;  2JEW A;  2PIY A;  4PPZ A;  2ZEO A;  4X3R A;  5J1Q A;  2BCO A;  4MRI A;  3B3T A;  3T8W A;  4X8I A;  5JM6 A;  4EWT A;  3L2N A;  2PJA A;  4ONW A;  4PQA A;  2PJ3 A;  2WYR A;  4FUU A;  2QVP A;  1Y0Y A;  4JZ0 A;  4DUK A;  1GYT A;  3PB9 X;  1RTQ A;  3WT4 A;  1ZLI A;  2OR4 A;  2BOA A;  1TKJ A;  4MCQ A;  4OC5 A;  2C6C A;  4IAV A;  4UIA A;  5K8P A;  4TNU A;  1XFO A;  5IB9 A;  3D4U A;  3K2K A;  2C1C A;  3SJE A;  4O23 A;  1HDU A;  2XEJ A;  4P4J A;  3WC6 A;  4F9V A;  1TKH A;  4PXB A;  3H8E A;  4R8F A;  5HVH A;  3I1U A;  3BXM A;  3IWW A;  4A94 A;  2PJC A;  3BHX A;  1JQG A;  4F9U A;  2IJZ A;  4ZX9 A;  3IC1 A;  2DEA A;  2EWB A;  1HEE A;  2V8V A;  2Q51 A;  2O53 A;  3KR5 A;  4UEF A;  1BPN A;  3D7G A;  4W9Y A;  2IQ6 A;  2GRE A;  5CPA A;  3SI1 A;  3FEE A;  1CPS A;  4PXD A;  1IGB A;  2V8D A;  1IY7 A;  3B2Y A;  4ZY1 A;  4NGS A;  2V8H A;  3RAM A;  2V8G A;  2ZOG A;  5LRG A;  4TWE A;  1VHE A;  2CIJ A;  3LMS A;  2RB7 A;  3D66 A;  2PRQ A;  3FED A;  3MN8 A;  2ZOF A;  2G9D A;  3PB8 X;  5D8N A;  3SJX A;  4PXE A;  3V7Z A;  4G1P A;  3FH4 A;  3PBB A;  4FBE A;  4OC4 A;  4ZYQ A;  4OC3 A;  5JGF A;  3MRU A;  1QQ9 A;  3PRT A;  4WJB A;  3B3V A;  2NYQ A;  2PJ2 A;  4NFR A;  3WAB A;  3S9M A;  2AFS A;  4EME A;  1KWM A;  5LYI A;  1DE4 C;  5K8O A;  2CF4 A;  1ELL P;  2EK8 A;  4PXC A;  4P4I A;  3FX6 A;  4MCR A;  3NFZ A;  3SI0 A;  4MMO A;  2AFO A;  4NGM A;  4DYO A;  1M4L A;  2JBK A;  4H2K A;  2PIZ A;  8CPA A;  1YW4 A;  3FMC A;  2GU2 A;  2ZEE A;  3S9N A;  4OP4 A;  3SJF A;  4MHZ A;  2ANP A;  4P6Y A;  4A38 A;  5LYL A;  4YU9 A;  3KQX A;  6CPA A;  2VL1 A;  1TXR A;  1OBR A;  3B3C A;  1CP6 A;  4DJL A;  4R76 A;  2GLJ A;  4R6T A;  4R7M A;  1ZLH A;  4K3N A;  2O4H A;  2PJ1 A;  2J9A A;  5CBM A;  3BI1 A;  2PCU A;  3NH5 A;  5D29 A;  2ZEH A;  2ZED A;  3K9T A;  3KR4 A;  1R3N A;  2HB6 A;  4ZX8 A;  3IJ3 A;  3PFO A;  3D7F A;  2PJ8 A;  2ABZ A;  4P4F A;  4ZY2 A;  1TF9 A;  1FNO A;  3D7D A;  2Q4Z A;  4NGN A;  5ELY A;  2CTC A;  5THW A;  3D7H A;  3H8G A;  3D68 A;  3B35 A;  2ZEL A;  2OOT A;  1F57 A;  5HVF A;  2AFZ A;  1Q7L A;  3WC7 A;  4FAI A;  1ZG9 A;  3FF3 A;  4MHP A;  2QJ8 A;  3CPX A;  1Z8L A;  3GUX A;  3FVL A;  4JYW A;  4B6Z A;  2XEI A;  2ZEG A;  3CDX A;  3TC8 A;  1Y0R A;  3IEH A;  3VAT A;  2I3C A;  1R43 A;  5I4M A;  3CT9 A;  4NJR A;  4BD9 A;  4NGP A;  4A37 A;  3SI2 A;  1YW6 A;  3NA6 A;  3PEI A;  4MHN A;  7CPA A;  1XBU A;  2AFM A;  1HDQ A;  3IIB A;  1CX8 A;  4UEE A;  4NGT A;  5HXD A;  4KSI A;  1FT7 A;  3S9L A;  1TKF A;  3RBU A;  4Z65 A;  3KQZ A;  1TF8 A;  2AFU A;  1CP7 A;  2F7V A;  1ZG7 A;  1BPM A;  2ZEN A;  2GLF A;  3B3W A;  5LRK A;  3HUV A;  1DTD A;  3DGV A;  2QYV A;  3NH8 A;  1AMP A;  1Y7E A;  3GB0 A;  3QNV A;  4CPA A;  5LYD A;  1LAN A;  1VIX A;  1ELM P;  4UEZ A;  4OC0 A;  1NSA A;  4OME A;  3KZW A;  3JRU A;  4OKO A;  3NH4 A;  1Z5R A;  1ARM A;  2PVV A;  4FWU A;  4P4D A;  2PJ4 A;  2PE3 A;  1LAP A;  3N5F A;  5K8M A;  1YLO A;  4F8Z A;  3PB7 X;  1ARL A;  3KL9 A;  3IFE A;  2C6P A;  3IO1 A;  4ZI6 A;  3HLP A;  3KHZ A;  4P10 A;  4P44 A;  1PCA A;  1LFW A;  3WC5 A;  4OID A;  4EFD A;  3TX8 A;  2PJ9 A;  3V38 A;  1F2O A;  1VGY A;  3SJG A;  2PVW A;  2ZEF A;  4GM5 A;  2AFX A;  4OC1 A;  2IMO A;  1CBX A;  3BI0 A;  1XJO A;  4ZY0 A;  4AXV A;  1ZG8 A;  3KAS A;  1YME A;  4OC2 A;  4Q7A A;  1LOK A;  2Q43 A;  3ISX A;  4LQG A;  1UWY A;  5HVG A;  4MHY A;  1VHO A;  3DLJ A;  5LRJ A;  2C6G A;  2PJ6 A;  3PB6 X;  5LYF A;  2WZN A;  2XEF A;  4UF4 A;  1XRY A;  3VH9 A;  5JH9 A;  1LAM A;  2NSM A;  2XEG A;  3CPA A;  1PYT B;  5DS0 A;  1EE3 P;  1LCP A;  4P4E A;  1BLL E;  4MCS A;  2BO9 A;  3PBE A;  4MCP A;  4UIB A;  4IK2 A;  4MXU A;  4A39 A;  3KHX A;  4NGQ A;  2POK A;  2FVG A;  3B3S A;  3ISZ A;  3FEC A;  5F09 A;  4RUH A;  2PJ7 A;  3KI9 A;  3PB4 X;  2CTB A;  2PJ5 A;  1H8L A;  1F2P A;  2PJB A;  3FJU A;  4NJQ A;  1QMU A;  2EK9 A;  1CG2 A;  2HC9 A;  2V77 A;  4X2T A;  2ZEM A;  4OIW A;  1AYE A;  4P4B A;  4IHM A;  3KGQ A;  1YSJ A;  3D67 A;  3GLJ A;  3VAR A;  3B7I A;  3PFE A;  4WWV A;  3LWU A;  1Z2L A;  4NGR A;  1CPX A;  2RFH A;  4P45 A;  2ZEP A;  3RZA A;  4YWY A;  2F8H A;  2JBJ A;  2AFW A;  5K8N A;  2PJ0 A; 
#chains in the Genus database with same CATH topology
 3H8F A;  1BAV A;  3QAH A;  1XMB A;  2JEW A;  3C26 A;  2PIY A;  4PK3 A;  2B5G B;  4PPZ A;  1S60 A;  3PP9 A;  2DF5 A;  2ZEO A;  4X3R A;  5J1Q A;  5EMI A;  2BCO A;  1MJA A;  4MRI A;  2IL4 A;  3B3T A;  3T8W A;  3CXS A;  2ZW7 A;  3E0K A;  4X8I A;  4YRH A;  5JM6 A;  4KOV A;  5EBV A;  4EWT A;  2WPX A;  3I3G A;  3L2N A;  3DR6 A;  1IOF A;  2PJA A;  2OU2 A;  4KOY A;  4QC6 A;  4KSA A;  4ONW A;  4KUB A;  4R87 A;  4X5K A;  4PQA A;  2PJ3 A;  2WUU A;  2WYR A;  4L8A A;  3MGD A;  2QVP A;  4FUU A;  4H6U A;  3S6H A;  1Y0Y A;  4JZ0 A;  4M6H A;  4HNW B;  1GYT A;  4DUK A;  3PB9 X;  1RTQ A;  5A28 A;  1NE9 A;  1IIC A;  1ZLI A;  3WT4 A;  3RYO A;  2OR4 A;  2BOA A;  4YFJ A;  1TKJ A;  4C7I A;  4CAX A;  4CYQ A;  4MCQ A;  4OC5 A;  2C6C A;  4IAV A;  4UIA A;  5K8P A;  4TNU A;  1XFO A;  2GE3 A;  5HMN A;  5IB9 A;  2VZZ A;  2Y0M A;  3D4U A;  3S6K A;  3K2K A;  4RN7 A;  5I0C A;  2C1C A;  3SJE A;  2B5G A;  4O23 A;  1HDU A;  2XEJ A;  4JD6 A;  5AG7 A;  4B12 A;  1Z9U A;  1QST A;  3S6G A;  4MFJ A;  3T9Y A;  4P4J A;  3WC6 A;  3OWC A;  4LX9 A;  4UBR A;  4F9V A;  3IU1 A;  1TKH A;  4PXB A;  4LUA A;  3H8E A;  1S7L A;  2VI7 A;  4R8F A;  5HVH A;  3I1U A;  2Z0Z A;  3BXM A;  3IWW A;  4A94 A;  2PJC A;  3BHX A;  1JQG A;  4F9U A;  1CJW A;  2IJZ A;  2Z3L A;  3F0A A;  2DEA A;  2EWB A;  2FXF A;  3IC1 A;  4UFW A;  4ZX9 A;  1HEE A;  2V8V A;  2Q51 A;  2O53 A;  2YNE A;  3KR5 A;  4CGO A;  2DXQ A;  4UEF A;  4JWP A;  4I49 A;  2AJ6 A;  1BPN A;  2CNM A;  3DR8 A;  4B5P B;  5BWA B;  2Z11 A;  3D7G A;  4W9Y A;  3SHP A;  2IQ6 A;  3UY5 A;  1SQH A;  2GRE A;  5CPA A;  1TIQ A;  3SI1 A;  1IU8 A;  3TE4 A;  2JDD A;  3FEE A;  1IYL A;  1CPS A;  3TCV A;  4PXD A;  4CRY B;  1IGB A;  3FIX A;  2V8D A;  1IY7 A;  2Q4Y A;  3B2Y A;  4NGS A;  4ZY1 A;  2V8H A;  2J8N A;  1Y7R A;  3RAM A;  3BJ8 A;  2V8G A;  2ZOG A;  5LRG A;  1B6B A;  4F0Y A;  4TWE A;  1VHE A;  3IGR A;  4JXQ A;  3H5Z A;  3G3S A;  4AG7 A;  2CIJ A;  3LMS A;  3LOD A;  2FIA A;  2RB7 A;  3D66 A;  2PRQ A;  3FED A;  5AG6 A;  3MN8 A;  2ZOF A;  4KLV A;  2G9D A;  3PB8 X;  4JLY A;  4MFZ A;  5F47 A;  1NMT A;  2H5M A;  4UFV A;  5D8N A;  1X10 A;  2R98 A;  4PXE A;  3SJX A;  3V7Z A;  4G1P A;  4B13 A;  2YNC A;  3RNZ A;  4AB7 A;  3FH4 A;  1KUV A;  1YR0 A;  3VWD A;  3PBB A;  4B5P A;  2G0B A;  4HNY B;  2F5I A;  2EO8 A;  3JVN A;  1FY7 A;  4XNH B;  5F49 A;  4FBE A;  4OC4 A;  3IWE A;  4OC3 A;  2P6G A;  4KVO E;  4QB9 A;  1ZO0 A;  1QQ9 A;  3MRU A;  3PRT A;  4ZYQ A;  5JGF A;  3TT2 A;  4WJB A;  1YRE A;  4BMH A;  4E0A A;  3PGP A;  5F48 A;  4U9Z A;  3B3V A;  3R9F A;  7CPA A;  2NYQ A;  2PJ2 A;  4NFR A;  3WAB A;  4UCM A;  3S9M A;  3P2F A;  2AFS A;  4EME A;  1IOI A;  3R95 A;  4UWJ A;  2R1I A;  1KWM A;  2YGW A;  4R3K A;  3KKW A;  4XPD C;  5LYI A;  1DE4 C;  5K8O A;  2B3U A;  4U9Y A;  2CF4 A;  3GY9 A;  4CGM A;  5C88 A;  4CYO A;  4UFX A;  4JXR A;  3NE7 A;  1ELL P;  2EK8 A;  4OLL A;  4PXC A;  4P4I A;  3TO6 A;  1YK3 A;  3FX6 A;  4MCR A;  4B10 A;  3NFZ A;  5EC4 A;  3SI0 A;  2J8R A;  5AGE A;  2PRB A;  4MMO A;  4DNC A;  2AFO A;  4NGM A;  4DYO A;  1QSN A;  1M4L A;  4UCP A;  2JBK A;  4H2K A;  2PIZ A;  8CPA A;  1XOV A;  1YW4 A;  1VKC A;  4Y49 C;  3FMC A;  2D4P A;  3N7Z A;  2P6E A;  2GU2 A;  1B87 A;  2ZEE A;  3S9N A;  1VHS A;  2BUE A;  3W91 A;  4OP4 A;  3SJF A;  4MHZ A;  3TO9 A;  1RXT A;  5H84 A;  2ANP A;  4P6Y A;  4NCZ A;  3S6F A;  3FXT A;  4MY3 A;  3NE8 A;  4A38 A;  5LYL A;  4YU9 A;  3KQX A;  1BO4 A;  2WPW A;  3K9U A;  3R1K A;  5IB0 A;  1YGH A;  6CPA A;  2VL1 A;  1TXR A;  1OBR A;  1XE4 A;  1CP6 A;  3B3C A;  4AVA A;  4DJL A;  2PDO A;  3TOB A;  4R76 A;  2GLJ A;  4R6T A;  5G22 A;  1Z8X A;  4R7M A;  4XNH C;  1ZLH A;  4RI1 A;  4K3N A;  2O4H A;  4A33 A;  3CXP A;  2PJ1 A;  4KOU A;  3F8K A;  2HUZ A;  3QAY A;  3FBU A;  4E8O A;  2J9A A;  2REE A;  2O28 A;  5G21 A;  5HH1 A;  5CBM A;  3BI1 A;  2B4B A;  3DSB A;  4HNX B;  1ON0 A;  2EBJ A;  2PCU A;  3NH5 A;  5D29 A;  2ZEH A;  2ZED A;  3K9T A;  3KR4 A;  3DNS A;  2BSW A;  2B58 A;  3D8P A;  4QVT A;  1R3N A;  2Z10 A;  2DPT A;  2C27 A;  4KOX A;  2FSR A;  2PR8 A;  3F5B A;  1QSO A;  2HB6 A;  4ZX8 A;  4LQ6 A;  2PSW A;  3IJ3 A;  4GS4 A;  3PFO A;  3BLN A;  3D7F A;  4PV6 A;  2PJ8 A;  2ABZ A;  4C2Y A;  4P4F A;  1KZF A;  4ZY2 A;  1TF9 A;  2EUI A;  4C2Z A;  1FNO A;  3CXQ A;  2OZG A;  3D7D A;  1PU9 A;  4PSX A;  1I1D A;  2J8M A;  2Q4Z A;  2Z3O A;  4NGN A;  4BBH A;  1R57 A;  5ELY A;  4A2Z A;  1YVO A;  2Q7B A;  4CGL A;  2CTC A;  5THW A;  1V0C A;  4K30 A;  4YGO A;  3D7H A;  3H8G A;  5J8C A;  1XMT A;  4M3S A;  3D68 A;  2VBQ A;  3B35 A;  4BIN A;  2ZEL A;  5J8F A;  5FVJ A;  2OOT A;  2K5T A;  2HQY A;  2R7H A;  3G8W A;  1F57 A;  5HVF A;  2AFZ A;  2VQY A;  3FYN A;  3GYA A;  1Q7L A;  3B8G A;  1YQE A;  2HV2 A;  4Q36 A;  3WC7 A;  3RO0 A;  4IF5 A;  4FAI A;  3CZX A;  2RC4 A;  1ZG9 A;  5DWN A;  4NSQ A;  3FF3 A;  4MFK A;  1MK4 A;  3D2M A;  1LRZ A;  4MHP A;  1S7K A;  5KTA A;  2QJ8 A;  3CPX A;  1Z8L A;  3GUX A;  2I00 A;  2R8V A;  3FVL A;  2BEI A;  2GIV A;  4JYW A;  2XEI A;  4B6Z A;  2ZEG A;  3CDX A;  5CNP A;  4A95 A;  3TC8 A;  2Q0Y A;  4HKF A;  1Z8T A;  1Y0R A;  3IEH A;  1Z4R A;  4NXY A;  3VAT A;  4CS0 B;  2I3C A;  1R43 A;  3D3S A;  5IV0 A;  5I4M A;  3CT9 A;  4NJR A;  4BD9 A;  5ISV A;  4UWI A;  2Z3P A;  4NGP A;  4A37 A;  3SI2 A;  3VWE A;  1YW6 A;  3NA6 A;  4KOT A;  2ZW5 A;  4KVM E;  5G20 A;  2QEC A;  2WSA A;  3PEI A;  1IID A;  1L0C A;  4M6I A;  4MHN A;  4KSF A;  2FS5 A;  4UA3 A;  1XBU A;  4MBU A;  2ZW4 A;  1M4I A;  1HDQ A;  2AFM A;  1CX8 A;  2OZU A;  3IIB A;  3IU2 A;  2VZY A;  4UEE A;  4KVX A;  4NGT A;  4FD4 A;  5HXD A;  4KSI A;  3BJ7 A;  4PK2 A;  1FT7 A;  1UFH A;  2AE6 A;  3S9L A;  4B5O A;  4CGP A;  3W6S A;  2G3A A;  4MHD A;  3TO7 A;  2FCK A;  1TKF A;  2FE7 A;  3RBU A;  4Z65 A;  3KQZ A;  4MFP A;  1TF8 A;  3TTH A;  4CYP A;  2ZPA A;  2PQ8 A;  2AFU A;  1CP7 A;  4J3G A;  2F7V A;  1ZG7 A;  1BPM A;  4CAW A;  2YNC C;  2Z3M A;  2ZEN A;  2GLF A;  3B3W A;  3R9G A;  5LRK A;  5AG4 A;  3HUV A;  1DTD A;  3DGV A;  2GFQ A;  1AUG A;  2QYV A;  3NH8 A;  1AMP A;  3EFA A;  4KUA A;  1JWQ A;  1Y7E A;  4QBJ A;  3GB0 A;  3QNV A;  4FD5 A;  4CPA A;  2YND A;  5LYD A;  3JTK A;  1LAN A;  4L89 A;  3SXO A;  1VIX A;  1ELM P;  5C82 A;  4UEZ A;  3A9L A;  4KOS A;  3P2H A;  4OC0 A;  1NSA A;  1S3Z A;  4IUS A;  1P4N A;  4MFL A;  3KZW A;  4OME A;  1Q2D A;  4C68 A;  1OZP A;  4ORF A;  5E96 A;  3JRU A;  2PC1 A;  4OKO A;  3NH4 A;  1Z5R A;  1ARM A;  2PVV A;  4H6Z A;  4FWU A;  1X12 A;  4P4D A;  4XPK A;  1MJ9 A;  2PJ4 A;  2P0W A;  3R96 A;  2FL4 A;  2PE3 A;  4MJ8 A;  1LAP A;  2B4D B;  3N5F A;  4B11 A;  5K8M A;  1Z8W A;  1YLO A;  4AVC A;  1M44 A;  2I79 A;  4F8Z A;  2Z3N A;  3FRM A;  4MFQ A;  3PB7 X;  4CGN A;  1ARL A;  2EVN A;  3KL9 A;  4ONU A;  4QUS A;  2CXA A;  3T90 A;  4CYN A;  2ATR A;  1Z4E A;  2QML A;  3IFE A;  2C6P A;  3IO1 A;  3SXN A;  1PUA A;  1MJB A;  3EC4 A;  2OZH A;  4U5Y A;  4ZI6 A;  3DDD A;  2VXK A;  2FT0 A;  3HLP A;  3KHZ A;  3V8I A;  2ZW6 A;  4P10 A;  4P44 A;  1Y9W A;  3H4Q A;  4FD7 A;  4M6G A;  4CRZ B;  1PCA A;  1LFW A;  2ARH A;  3WC5 A;  4R9M A;  4OID A;  4EFD A;  2PR1 A;  3JUW A;  4CAF A;  1WWZ A;  3QB8 A;  1RO5 A;  2PJ9 A;  3TX8 A;  3V38 A;  1XF8 A;  1F2O A;  2B4D A;  1VGY A;  2PVW A;  3FB3 A;  3SJG A;  5KTD A;  2G3T A;  1XIX A;  2ZEF A;  4R57 A;  4C2X A;  1J4J A;  4GM5 A;  2AFX A;  1YX0 A;  2IMO A;  2ZXV A;  4OC1 A;  4CAE A;  4AVB A;  1YVK A;  1CBX A;  4KS9 A;  3BI0 A;  2QIR A;  5IX3 A;  1XJO A;  4MY0 A;  4ZY0 A;  5G1Z A;  4AXV A;  1S7F A;  1NSL A;  2REF A;  1A2Z A;  1I21 A;  1ZG8 A;  3KAS A;  4B14 A;  4A31 A;  4ZGY B;  1IB1 E;  1Q2Y A;  4OAE A;  5A27 A;  1XEB A;  1YME A;  3WR7 A;  3FNC A;  2CY2 A;  3IWG A;  4OC2 A;  3ZZI A;  4GXH A;  2Q44 A;  4C7H A;  4Q7A A;  1LOK A;  2Q43 A;  3ISX A;  1P0H A;  3EY5 A;  4LQG A;  1UWY A;  2DPS A;  5HVG A;  5GCN A;  2JLM A;  4MHY A;  2OH1 A;  4AG9 A;  1VHO A;  3DLJ A;  3R9E A;  5LRJ A;  2C6G A;  2PJ6 A;  3PB6 X;  2Z3K A;  5LYF A;  2WZN A;  4KOR A;  2XEF A;  4UF4 A;  4MI4 A;  1XRY A;  3GIU A;  1M4G A;  4XPD B;  1Q2C A;  3VH9 A;  5JH9 A;  5KTC A;  1LAM A;  2NSM A;  2XEG A;  3CPA A;  1PYT B;  1QSM A;  2CNT A;  5DS0 A;  1EE3 P;  1LCP A;  4P4E A;  1BLL E;  2VEZ A;  4MCS A;  2BO9 A;  4E2A A;  3PBE A;  4MCP A;  4UIB A;  1M1D A;  3TFY A;  4R3L A;  5AG5 A;  1KUX A;  1CM0 A;  2BL1 A;  4FD6 A;  4IK2 A;  5DWM A;  3LAC A;  3W6X A;  4MXU A;  4CAV A;  1S7N A;  4A39 A;  4Y49 B;  4F6A A;  2ODF A;  1M4D A;  3KHX A;  4NGQ A;  2POK A;  2FVG A;  4H89 A;  3B3S A;  4PSW A;  4XPL A;  2JDC A;  2KCW A;  3ISZ A;  3FEC A;  5F09 A;  2OB0 A;  3TOA A;  3I9S A;  1Y9K A;  1K4J A;  2PJ7 A;  4RUH A;  3KI9 A;  4NEX A;  1IYK A;  4KOW A;  3PB4 X;  1WK4 A;  3PZJ A;  2CTB A;  4M85 A;  1QSR A;  2PJ5 A;  2A4N A;  5F46 A;  1H8L A;  1F2P A;  2PJB A;  3FJU A;  3LD2 A;  4NJQ A;  4OAD A;  1QMU A;  2EK9 A;  1CG2 A;  2HC9 A;  4KZT A;  2V77 A;  4JJX A;  4X2T A;  4EVY A;  2ZEM A;  4F0X A;  4OIW A;  3GKR A;  2B3V A;  1AYE A;  2D4O A;  4IHM A;  4P4B A;  1GHE A;  3KGQ A;  1YSJ A;  1S5K A;  2JEV A;  3D67 A;  3GLJ A;  2GAN A;  1N71 A;  3ZJ0 A;  4ZBG A;  4A32 A;  2X7B A;  2Q7S A;  2FIW A;  2P6F A;  2Q4V A;  3VAR A;  5JQ4 A;  3B7I A;  3PFE A;  4UCN A;  4RS2 A;  4WWV A;  1BOB A;  3LWU A;  5JPH A;  2Q04 A;  1Z2L A;  4HPS A;  4NGR A;  5H86 A;  4II9 A;  4KLW A;  1CPX A;  4Q38 A;  2RFH A;  2CNS A;  2NMT A;  4NF1 A;  4P45 A;  1KUY A;  1YLE A;  2ZEP A;  3RZA A;  4YWY A;  3EXN A;  3D2P A;  3EO4 A;  4A30 A;  2F8H A;  1U6M A;  2JBJ A;  2AFW A;  5K8N A;  2PJ0 A;  1I12 A; 
#chains in the Genus database with same CATH homology
 3H8F A;  1BAV A;  1XMB A;  2JEW A;  2PIY A;  4PPZ A;  2ZEO A;  4X3R A;  5J1Q A;  2BCO A;  4MRI A;  3B3T A;  3T8W A;  4X8I A;  5JM6 A;  4EWT A;  3L2N A;  2PJA A;  4ONW A;  4PQA A;  2PJ3 A;  2WYR A;  4FUU A;  2QVP A;  1Y0Y A;  4JZ0 A;  4DUK A;  1GYT A;  3PB9 X;  1RTQ A;  3WT4 A;  1ZLI A;  2OR4 A;  2BOA A;  1TKJ A;  4MCQ A;  4OC5 A;  2C6C A;  4IAV A;  4UIA A;  5K8P A;  4TNU A;  1XFO A;  5IB9 A;  3D4U A;  3K2K A;  2C1C A;  3SJE A;  4O23 A;  1HDU A;  2XEJ A;  4P4J A;  3WC6 A;  4F9V A;  1TKH A;  4PXB A;  3H8E A;  4R8F A;  5HVH A;  3I1U A;  3BXM A;  3IWW A;  4A94 A;  2PJC A;  3BHX A;  1JQG A;  4F9U A;  2IJZ A;  4ZX9 A;  3IC1 A;  2DEA A;  2EWB A;  1HEE A;  2V8V A;  2Q51 A;  2O53 A;  3KR5 A;  4UEF A;  1BPN A;  3D7G A;  4W9Y A;  2IQ6 A;  2GRE A;  5CPA A;  3SI1 A;  3FEE A;  1CPS A;  4PXD A;  1IGB A;  2V8D A;  1IY7 A;  3B2Y A;  4ZY1 A;  4NGS A;  2V8H A;  3RAM A;  2V8G A;  2ZOG A;  5LRG A;  4TWE A;  1VHE A;  2CIJ A;  3LMS A;  2RB7 A;  3D66 A;  2PRQ A;  3FED A;  3MN8 A;  2ZOF A;  2G9D A;  3PB8 X;  5D8N A;  3SJX A;  4PXE A;  3V7Z A;  4G1P A;  3FH4 A;  3PBB A;  4FBE A;  4OC4 A;  4ZYQ A;  4OC3 A;  5JGF A;  3MRU A;  1QQ9 A;  3PRT A;  4WJB A;  3B3V A;  2NYQ A;  2PJ2 A;  4NFR A;  3WAB A;  3S9M A;  2AFS A;  4EME A;  1KWM A;  5LYI A;  1DE4 C;  5K8O A;  2CF4 A;  1ELL P;  2EK8 A;  4PXC A;  4P4I A;  3FX6 A;  4MCR A;  3NFZ A;  3SI0 A;  4MMO A;  2AFO A;  4NGM A;  4DYO A;  1M4L A;  2JBK A;  4H2K A;  2PIZ A;  8CPA A;  1YW4 A;  3FMC A;  2GU2 A;  2ZEE A;  3S9N A;  4OP4 A;  3SJF A;  4MHZ A;  2ANP A;  4P6Y A;  4A38 A;  5LYL A;  4YU9 A;  3KQX A;  6CPA A;  2VL1 A;  1TXR A;  1OBR A;  3B3C A;  1CP6 A;  4DJL A;  4R76 A;  2GLJ A;  4R6T A;  4R7M A;  1ZLH A;  4K3N A;  2O4H A;  2PJ1 A;  2J9A A;  5CBM A;  3BI1 A;  2PCU A;  3NH5 A;  5D29 A;  2ZEH A;  2ZED A;  3K9T A;  3KR4 A;  1R3N A;  2HB6 A;  4ZX8 A;  3IJ3 A;  3PFO A;  3D7F A;  2PJ8 A;  2ABZ A;  4P4F A;  4ZY2 A;  1TF9 A;  1FNO A;  3D7D A;  2Q4Z A;  4NGN A;  5ELY A;  2CTC A;  5THW A;  3D7H A;  3H8G A;  3D68 A;  3B35 A;  2ZEL A;  2OOT A;  1F57 A;  5HVF A;  2AFZ A;  1Q7L A;  3WC7 A;  4FAI A;  1ZG9 A;  3FF3 A;  4MHP A;  2QJ8 A;  3CPX A;  1Z8L A;  3GUX A;  3FVL A;  4JYW A;  4B6Z A;  2XEI A;  2ZEG A;  3CDX A;  3TC8 A;  1Y0R A;  3IEH A;  3VAT A;  2I3C A;  1R43 A;  5I4M A;  3CT9 A;  4NJR A;  4BD9 A;  4NGP A;  4A37 A;  3SI2 A;  1YW6 A;  3NA6 A;  3PEI A;  4MHN A;  7CPA A;  1XBU A;  2AFM A;  1HDQ A;  3IIB A;  1CX8 A;  4UEE A;  4NGT A;  5HXD A;  4KSI A;  1FT7 A;  3S9L A;  1TKF A;  3RBU A;  4Z65 A;  3KQZ A;  1TF8 A;  2AFU A;  1CP7 A;  2F7V A;  1ZG7 A;  1BPM A;  2ZEN A;  2GLF A;  3B3W A;  5LRK A;  3HUV A;  1DTD A;  3DGV A;  2QYV A;  3NH8 A;  1AMP A;  1Y7E A;  3GB0 A;  3QNV A;  4CPA A;  5LYD A;  1LAN A;  1VIX A;  1ELM P;  4UEZ A;  4OC0 A;  1NSA A;  4OME A;  3KZW A;  3JRU A;  4OKO A;  3NH4 A;  1Z5R A;  1ARM A;  2PVV A;  4FWU A;  4P4D A;  2PJ4 A;  2PE3 A;  1LAP A;  3N5F A;  5K8M A;  1YLO A;  4F8Z A;  3PB7 X;  1ARL A;  3KL9 A;  3IFE A;  2C6P A;  3IO1 A;  4ZI6 A;  3HLP A;  3KHZ A;  4P10 A;  4P44 A;  1PCA A;  1LFW A;  3WC5 A;  4OID A;  4EFD A;  3TX8 A;  2PJ9 A;  3V38 A;  1F2O A;  1VGY A;  3SJG A;  2PVW A;  2ZEF A;  4GM5 A;  2AFX A;  4OC1 A;  2IMO A;  1CBX A;  3BI0 A;  1XJO A;  4ZY0 A;  4AXV A;  1ZG8 A;  3KAS A;  1YME A;  4OC2 A;  4Q7A A;  1LOK A;  2Q43 A;  3ISX A;  4LQG A;  1UWY A;  5HVG A;  4MHY A;  1VHO A;  3DLJ A;  5LRJ A;  2C6G A;  2PJ6 A;  3PB6 X;  5LYF A;  2WZN A;  2XEF A;  4UF4 A;  1XRY A;  3VH9 A;  5JH9 A;  1LAM A;  2NSM A;  2XEG A;  3CPA A;  1PYT B;  5DS0 A;  1EE3 P;  1LCP A;  4P4E A;  1BLL E;  4MCS A;  2BO9 A;  3PBE A;  4MCP A;  4UIB A;  4IK2 A;  4MXU A;  4A39 A;  3KHX A;  4NGQ A;  2POK A;  2FVG A;  3B3S A;  3ISZ A;  3FEC A;  5F09 A;  4RUH A;  2PJ7 A;  3KI9 A;  3PB4 X;  2CTB A;  2PJ5 A;  1H8L A;  1F2P A;  2PJB A;  3FJU A;  4NJQ A;  1QMU A;  2EK9 A;  1CG2 A;  2HC9 A;  2V77 A;  4X2T A;  2ZEM A;  4OIW A;  1AYE A;  4P4B A;  4IHM A;  3KGQ A;  1YSJ A;  3D67 A;  3GLJ A;  3VAR A;  3B7I A;  3PFE A;  4WWV A;  3LWU A;  1Z2L A;  4NGR A;  1CPX A;  2RFH A;  4P45 A;  2ZEP A;  3RZA A;  4YWY A;  2F8H A;  2JBJ A;  2AFW A;  5K8N A;  2PJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...