5JQ4A

Structure of a gnat acetyltransferase sacol1063 from staphylococcus aureus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
142
structure length
142
Chain Sequence
AMFSKVNNQKMLEDCFYIRKKVFVEEQGIPEESEIDEYESESIHLIGYDNGQPVATARIRPINETTVKIERVAVMKSHRGQGMGRMLMQAVESLAKDEGFYVATMNAQCHAIPFYESLNFKMRGNIFLEEGIEHIEMTKKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyltransferase SACOL1063
publication title Insight into the 3D structure and substrate specificity of previously uncharacterized GNAT superfamily acetyltransferases from pathogenic bacteria.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 34
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2016-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5jq4A00
2P0WA 4AG7A 3BJ8A 2JDDA 2CNMA 3F5BA 4QB9A 2Q7BA 1XEBA 3DR6A 3EO4A 1IB1E 3TCVA 4F0YA 1UFHA 4FD7A 1QSOA 4BMHA 3G3SA 2K5TA 4R3KA 2J8RA 3T90A 1XMTA 2EUIA 1XE4A 2B5GA 3GY9A 4U5YA 2QECA 1S7NA 3JVNA 3P2FA 2Q4VA 3S6GA 4PV6A 4KOTA 1S7FA 3FNCA 5HH1A 4EVYA 4X5KA 3FYNA 1N71A 1NE9A 1YK3A 3F0AA 3W6XA 4RI1A 1GHEA 2DXQA 1Y9WA 3TO6A 1KZFA 1S5KA 2J8NA 1Z9UA 3PGPA 2HUZA 1QSTA 2ZW7A 4MBUA 1Z4RA 1SQHA 4DNCA 1MJ9A 1WK4A 2OU2A 4PK2A 1MJAA 4XNHB 2ATRA 5F46A 2B4DA 2GANA 2VXKA 1Y7RA 1RO5A 2G0BA 2REEA 4JD6A 3D3SA 1CM0A 5EC4A 2PRBA 2VEZA 2ZW6A 1IYLA 1Q2YA 2Q4YA 4HNXB 5F47A 3F8KA 4QBJA 3TT2A 3TTHA 2D4PA 3DR8A 3TE4A 1TIQA 3NE7A 4CAWA 1YVOA 1FY7A 2PSWA 1WWZA 2EVNA 1P4NA 3SXOA 4QUSA 4HNYB 4KVME 4H6UA 4XNHC 3RYOA 3UY5A 4KOUA 1J4JA 5I0CA 2VZZA 5DWMA 1Y9KA 4AB7A 5KTCA 1I12A 2NMTA 2FE7A 2WPXA 4B5PA 2HV2A 2RC4A 2B58A 4JLYA 3SHPA 1YX0A 2R7HA 2PR8A 3V8IA 1M1DA 4UWJA 1QSMA 2F5IA 5J8FA 1QSNA 3BLNA 2OB0A 3S6KA 1YGHA 2GIVA 3EY5A 4J3GA 3CXQA 3GKRA 2I79A 4XPLA 4CAVA 1YLEA 2FT0A 2CY2A 4HKFA 3W6SA 4UWIA 2PR1A 2JLMA 2HQYA 4LUAA 2P6EA 4XPKA 3TO9A 2I00A 2ZW5A 1M4GA 3R9EA 4B5OA 5C82A 1Q2DA 2BUEA 1B6BA 2GE3A 4HNWB 2G3AA 1BOBA 5GCNA 2WPWA 4GS4A 2B3UA 3H4QA 2OZHA 1I1DA 4CRYB 2B3VA 4Y49B 4NCZA 3W91A 4AVAA 4H6ZA 4ONUA 4QC6A 1IYKA 2J8MA 1IIDA 4U9ZA 2REFA 4YGOA 3EC4A 2A4NA 1VHSA 4KOWA 3TOBA 2OZGA 4U9YA 1OZPA 2FIWA 3I3GA 2PDOA 3IGRA 4R9MA 4AVCA 3LD2A 3S6FA 4IF5A 4NEXA 2VZYA 1KUYA 2BSWA 1XF8A 4FD4A 4KVXA 1K4JA 3S6HA 3R95A 5C88A 4KZTA 3CXSA 5EBVA 2BEIA 3GYAA 4B5PB 4QVTA 2JEVA 5DWNA 2R8VA 5IV0A 1LRZA 2QIRA 2Z0ZA 2BL1A 4E8OA 5KTAA 2ZXVA 3I9SA 3LODA 3R9FA 4JXRA 4PSWA 2CNTA 5JPHA 2PC1A 2FIAA 5HMNA 2O28A 4L8AA 1NSLA 2IL4A 2OZUA 4PK3A 3WR7A 4JXQA 4KUBA 3MGDA 4F6AA 4KOSA 3R96A 2Y0MA 1V0CA 3FB3A 2R1IA 2Q44A 2QMLA 3EXNA 2ZPAA 2P6GA 1Z4EA 1XIXA 3DSBA 1PU9A 2B5GB 4MY0A 2JDCA 4UA3A 3VWEA 3G8WA 4YRHA 1KUVA 1M4DA 1YVKA 2PQ8A 3SXNA 4FD6A 2FXFA 4M85A 4KORA 3C26A 4KLWA 1RXTA 2H5MA 4MJ8A 1QSRA 3KKWA 5F48A 3N7ZA 4L89A 4KLVA 3B8GA 3TOAA 4NF1A 2Q0YA 3OWCA 5IX3A 2AJ6A 5E96A 4ORFA 1KUXA 4OAEA 1S3ZA 2R98A 4I49A 3QB8A 4UBRA 2D4OA 4II9A 5JQ4A 3P2HA 2B4DB 3D2PA 2ZW4A 3K9UA 2P6FA 4JJXA 2FCKA 4E2AA 4IUSA 3DNSA 3TO7A 1YR0A 1S7LA 2Z10A 4NSQA 3D8PA 3D2MA 5KTDA 3ZJ0A 2VQYA 1R57A 4R3LA 1VKCA 3BJ7A 3CXPA 1Q2CA 2KCWA 1YREA 1L0CA 4KUAA 2AE6A 3R1KA 2FS5A 5ISVA 4NXYA 5J8CA 2FL4A 3PP9A 4MY3A 3TFYA 2C27A 4Y49C 3T9YA 4OLLA 4H89A 4JWPA 3VWDA 4OADA 3IWGA 5H86A 4RS2A 4KOYA 2CNSA 2G3TA 2VBQA 3FBUA 3FIXA 3FRMA 5H84A 5CNPA 2VI7A 4CRZB 1BO4A 1I21A 3DDDA 5FVJA 1P0HA 4AVBA 2ARHA 1MJBA 4KVOE 2X7BA 4R87A 4E0AA 4YFJA 1IICA 2FSRA 4AG9A 1S7KA 1M4IA 4XPDB 1ON0A 4FD5A 3FXTA 4MI4A 1MK4A 1B87A 1CJWA 1PUAA 3JUWA 4LX9A 1NMTA 3EFAA 5F49A 4PSXA 4CS0B 3ZZIA 4KOXA 3PZJA 4M3SA 4ZBGA 3QAHA 3R9GA 4MHDA 4XPDC 5IB0A 4CAXA 2B4BA 2OH1A 2Q04A 2Z11A 1S60A 1U6MA 4KOVA 4R57A 4K30A 1M44A 3E0KA
chains in the Genus database with same CATH superfamily
4DYOA 2P0WA 2WYRA 4AG7A 3MRUA 5G20A 3WABA 3BJ8A 3KZWA 2JDDA 2CNMA 3F5BA 4QB9A 4TNUA 4IAVA 5AG4A 4A95A 2Q7BA 2YNEA 1XEBA 4ZGYB 1ARLA 2ZEEA 1UWYA 1X12A 1IB1E 3DR6A 3EO4A 4PXCA 2F7VA 5D8NA 2AFZA 3TCVA 4F0YA 1UFHA 3SI1A 4FD7A 1QSOA 3SJGA 2JBKA 2DPSA 4BMHA 1CP7A 2O53A 3B35A 4A32A 3G3SA 4UF4A 2K5TA 4R3KA 1LCPA 2J8RA 5HVGA 3B3CA 3T90A 2ANPA 2HB6A 1XMTA 2EUIA 1XE4A 2B5GA 3GY9A 3SJEA 4U5YA 2QECA 2EBJA 3MN8A 2JEWA 4X2TA 1OBRA 2AFMA 2OOTA 1S7NA 3JVNA 3P2FA 2Q4VA 1Z5RA 3IU2A 4MCPA 3NFZA 3S6GA 4C7HA 4PV6A 1ARMA 4PPZA 4KOTA 3D7HA 4UIAA 1S7FA 3FNCA 5HH1A 3IU1A 4EVYA 3BI0A 5J1QA 4X5KA 5EMIA 3FYNA 2PJ0A 1N71A 1NE9A 2BCOA 4M6IA 1YK3A 3I1UA 3F0AA 3W6XA 4RI1A 1GHEA 5LYLA 2DXQA 1Y9WA 3TO6A 1KZFA 1S5KA 2J8NA 3IFEA 1Z9UA 3PGPA 3PFOA 2HUZA 3KASA 2GU2A 4K3NA 1QSTA 4UIBA 4NGPA 2ZW7A 4MBUA 1Z4RA 1CPSA 2PJ7A 2ZEGA 1BPMA 1SQHA 4MFKA 4NGQA 4FUUA 3KR5A 3JTKA 5DS0A 4Z65A 1TKJA 4PQAA 2CIJA 2PJ2A 5D29A 4CGPA 4ZY2A 4DNCA 1XBUA 1MJ9A 3NE8A 1WK4A 2ODFA 2OU2A 3PBBA 4OC3A 4B6ZA 4PK2A 1RTQA 2WUUA 3A9LA 4C2XA 3FEDA 1MJAA 2YNCC 4OIWA 4XNHB 5AG5A 1ELMP 2ATRA 4IHMA 4UCMA 5F46A 2B4DA 5G21A 2GANA 2VXKA 4R76A 1Y7RA 1RO5A 2G0BA 2REEA 2PJ4A 3K2KA 3D3SA 1CM0A 4JD6A 5K8MA 1Y0YA 5EC4A 4NGMA 2PRBA 2AFOA 3RBUA 2VEZA 2ZW6A 4M6HA 1IYLA 1Q2YA 2Q4YA 2Z3MA 4HNXB 1IY7A 4WJBA 5F47A 4DJLA 2PRQA 3PB8X 3F8KA 4QBJA 3TT2A 3TTHA 2D4PA 5LRKA 3DR8A 2PCUA 3TE4A 1HDUA 4P45A 3V38A 4TWEA 4ZY1A 5AG6A 4JYWA 1TIQA 3NE7A 3L2NA 4B12A 1YVOA 4CAWA 1FY7A 4NGSA 2PSWA 1WWZA 3FEEA 2EVNA 1P4NA 3SXOA 3D68A 1GYTA 2PJ6A 4QUSA 4HNYB 4OKOA 1BAVA 4KVME 4MRIA 4H6UA 3WC5A 4XNHC 2WSAA 3RYOA 2EK8A 3UY5A 4KOUA 2NSMA 3CZXA 4GXHA 5JH9A 1J4JA 1ELLP 3CPXA 4MHPA 5ELYA 3PFEA 4OC1A 5I0CA 4X3RA 4MHYA 2VZZA 4AXVA 3D67A 3H5ZA 1Y9KA 5DWMA 4AB7A 5KTCA 1I12A 2NMTA 2FE7A 2Q4ZA 1YQEA 2V8HA 2WPXA 2AFUA 2Z3NA 3H8EA 4UCPA 4B5PA 2HV2A 2RC4A 3LMSA 4MHZA 4R6TA 3FECA 2B58A 4JLYA 3SHPA 1YX0A 1A2ZA 2R7HA 2PR8A 3V8IA 1M1DA 5IB9A 4UWJA 4ZI6A 6CPAA 5LRJA 1QSMA 2F5IA 5J8FA 4CYNA 1QSNA 3BLNA 1JQGA 2ZEOA 2OB0A 4KSIA 3S6KA 1CP6A 2AFWA 1YGHA 4P4DA 2GIVA 1ZLHA 3EY5A 4J3GA 3CDXA 3B3VA 3CXQA 3GKRA 3T8WA 2I79A 5LRGA 3H8GA 4XPLA 4B14A 4CAVA 3NH8A 1YLEA 2FT0A 2CY2A 2ZEFA 4HKFA 4CYPA 1TKFA 3W6SA 4UWIA 2PR1A 2DPTA 4O23A 5LYIA 2JLMA 2AFXA 2HQYA 2P6EA 4LUAA 4P4BA 2ZEPA 4XPKA 4UFXA 1PYTB 3TO9A 3QAYA 2I00A 2ZW5A 1M4GA 3WC6A 3R9EA 4B5OA 2RB7A 4G1PA 5C82A 1Q2DA 3SI0A 2BUEA 1B6BA 2IJZA 2ZEDA 4MFPA 2GE3A 4GM5A 4A33A 3GIUA 4YWYA 5A28A 3IEHA 4HNWB 2G3AA 3D7DA 1IOFA 1BOBA 5GCNA 2PJ3A 2WPWA 4GS4A 2B3UA 4OMEA 3PB4X 3H4QA 4LQGA 2OZHA 3PB7X 4PXBA 1I1DA 2GFQA 4OC2A 2GLFA 4CRYB 2B3VA 4A2ZA 1TXRA 1Z8TA 2C6CA 2BO9A 1LFWA 4Y49B 2PJCA 4FBEA 4NCZA 3W91A 5JM6A 3E0KA 4AVAA 4A39A 4M6GA 4H6ZA 4ONUA 4QC6A 4CAFA 2XEGA 5F09A 1Q7LA 4A31A 3FF3A 3RAMA 1JWQA 1IYKA 1F2PA 2J8MA 2BOAA 4P44A 1IIDA 2CTCA 4U9ZA 2J9AA 1F2OA 2PJBA 4X8IA 2REFA 4YGOA 3EC4A 2A4NA 1VHSA 4KOWA 3IJ3A 4FWUA 3TOBA 4Q7AA 2G9DA 2OZGA 4U9YA 4P4JA 2EO8A 1Z8LA 1OZPA 2FIWA 3LWUA 3I3GA 4ONWA 2PDOA 3IGRA 2PIYA 2Q43A 4MXUA 4R9MA 4NGTA 4F0XA 4AVCA 1R43A 3LD2A 3S9LA 3GB0A 3S6FA 4CGOA 3JRUA 4IF5A 4NEXA 4CGLA 2VZYA 1KUYA 2BSWA 1XF8A 1YW6A 3IIBA 4FD4A 3PBEA 4KVXA 3D66A 1K4JA 3B2YA 4OC4A 3FH4A 3S6HA 3R95A 4A30A 3BXMA 4KZTA 5C88A 2YNDA 3CXSA 5EBVA 2BEIA 3GYAA 4B5PB 4Q38A 4QVTA 2JEVA 1XJOA 2R8VA 5DWNA 5IV0A 3KI9A 2Z3KA 1LRZA 2QIRA 2Z0ZA 2BL1A 4OC0A 4E8OA 1Z2LA 2CXAA 3SI2A 4CAEA 1FT7A 1ZLIA 5KTAA 2QVPA 2ZXVA 3I9SA 3LODA 1AMPA 3R9FA 3PB9X 4JXRA 4PSWA 2CNTA 3B3TA 1H8LA 5JPHA 2PC1A 2FIAA 4DUKA 5HMNA 2XEIA 2O28A 4L8AA 1NSLA 2IL4A 2OZUA 4PK3A 4WWVA 3ISXA 5CPAA 3SJFA 3WR7A 4JXQA 3KQZA 4KUBA 3MGDA 5HVFA 4F6AA 4CYOA 4KOSA 4LQ6A 3R96A 2Y0MA 4A38A 1V0CA 3HUVA 3FB3A 4MCQA 2R1IA 5JGFA 2PJ5A 1Y7EA 4KS9A 3B3SA 4MFLA 1BPNA 4H2KA 2PIZA 5AGEA 4UFVA 2Q44A 3FVLA 2ZOFA 2QMLA 3SJXA 4UEZA 1AYEA 3EXNA 2I3CA 4C7IA 1CBXA 2P6GA 2ZPAA 1ZG8A 1Z4EA 1XIXA 2PVVA 4MMOA 3DSBA 3LACA 1PU9A 3D4UA 2B5GB 1BLLE 4MY0A 4R7MA 7CPAA 1IGBA 2JDCA 4CGMA 4UA3A 3WC7A 3VWEA 3KR4A 2GREA 5A27A 3G8WA 4YRHA 1KUVA 1M4DA 1YVKA 2PQ8A 3IWWA 3KHZA 3SXNA 3TC8A 1X10A 4B11A 4FD6A 2FXFA 2EWBA 1KWMA 3RZAA 4M85A 4KORA 3C26A 4KLWA 1RXTA 2NYQA 2OR4A 2CTBA 4P6YA 4B13A 2H5MA 4MJ8A 1QSRA 2V8GA 3KKWA 5F48A 4CYQA 3N7ZA 4L89A 4C2ZA 4KLVA 1CG2A 3B8GA 3TX8A 3TOAA 4W9YA 2Z3LA 4NF1A 2PJAA 2RFHA 2Q0YA 2HC9A 3OWCA 3KL9A 1XMBA 3KHXA 4MCSA 5IX3A 1XOVA 2AJ6A 4B10A 2PE3A 5E96A 4OP4A 3FJUA 4ORFA 1KUXA 4OAEA 1S3ZA 3ISZA 2R98A 4I49A 3QB8A 4UBRA 1YSJA 4NJQA 2D4OA 2DF5A 2VL1A 3S9MA 1IU8A 4II9A 1PCAA 5JQ4A 2QYVA 4MFQA 5HXDA 3P2HA 4MCRA 2B4DB 2PJ1A 3D2PA 1VIXA 3PB6X 4C2YA 2ZW4A 4NJRA 3K9UA 2P6FA 4JJXA 2FCKA 4EMEA 4E2AA 4F9VA 1TKHA 4IUSA 2ZELA 3DNSA 3TO7A 1YR0A 1QQ9A 2Z3PA 1XFOA 5K8PA 4JZ0A 1S7LA 2Z10A 1VHEA 1LANA 3VATA 4NSQA 1HEEA 2PVWA 3S9NA 3D8PA 3D2MA 5KTDA 1M4LA 4PXEA 5G22A 1Z8WA 3ZJ0A 4FAIA 2VQYA 1R57A 2IQ6A 2ZEMA 1F57A 4R3LA 2C6GA 3PRTA 1NSAA 4BINA 4F9UA 3IO1A 4YU9A 2ABZA 1VKCA 5LYDA 2C6PA 3BJ7A 1Q2CA 3CXPA 1LAMA 4CPAA 4UEFA 2KCWA 1YREA 4P4IA 1L0CA 4CGNA 3D7GA 4KSAA 4ZX9A 3KQXA 1YW4A 4KUAA 5AG7A 2AE6A 8CPAA 3R1KA 4OC5A 2FS5A 1VGYA 5BWAB 5ISVA 4P4FA 4NXYA 5J8CA 3BHXA 2FL4A 2PJ9A 4Q36A 2XEFA 3PP9A 1YMEA 4MY3A 1HDQA 3TFYA 2C27A 4Y49C 3T9YA 3K9TA 4OLLA 2POKA 1EE3P 4RUHA 3WT4A 4H89A 1ZG9A 1LAPA 3D7FA 1TF9A 4KSFA 3RNZA 2WZNA 4JWPA 2ZEHA 3VWDA 4OADA 3IWGA 5H86A 2XEJA 4RS2A 2V8DA 4ZX8A 2Q7SA 2V8VA 5K8NA 2IMOA 4KOYA 2EK9A 3GUXA 2CNSA 3NH4A 3N5FA 2FVGA 3DGVA 4MFZA 4BD9A 2G3TA 2YNCA 2VBQA 3FBUA 3FIXA 3FRMA 5H84A 1LOKA 5CNPA 3B7IA 5G1ZA 1Y0RA 1TF8A 4RN7A 2VI7A 3BI1A 4CRZB 1CPXA 2Q51A 1BO4A 4MHNA 4ZYQA 1I21A 1ZG7A 2O4HA 2JBJA 3DDDA 5FVJA 2ZENA 1P0HA 1ZO0A 4UFWA 4AVBA 2ARHA 1MJBA 3KGQA 4EFDA 2DEAA 4KVOE 5HVHA 4NGNA 3IWEA 3V7ZA 2X7BA 4R87A 4E0AA 4YFJA 5CBMA 1IICA 1QMUA 2FSRA 4AG9A 1S7KA 4A37A 4A94A 1YLOA 5LYFA 1M4IA 4P4EA 4UEEA 4XPDB 3VH9A 1ON0A 1VHOA 2Z3OA 2C1CA 4BBHA 5K8OA 4C68A 4FD5A 2GLJA 3FXTA 4MI4A 1MK4A 3RO0A 3NH5A 4HPSA 1B87A 2V77A 4R8FA 4F8ZA 1IOIA 2PJ8A 1R3NA 1CJWA 1PUAA 3CT9A 3H8FA 3JUWA 4LX9A 1AUGA 5THWA 2QJ8A 1XRYA 1Z8XA 1NMTA 2F8HA 2AFSA 4ZY0A 3FMCA 3DLJA 4P10A 3EFAA 5F49A 3CPAA 3VARA 4EWTA 3IC1A 4NFRA 4NGRA 2ZOGA 1FNOA 4PSXA 2CF4A 4OIDA 5I4MA 3B3WA 4PXDA 3ZZIA 4CS0B 1CX8A 4UCNA 3HLPA 4KOXA 3PZJA 4M3SA 4ZBGA 3QAHA 3FX6A 3QNVA 3R9GA 4MHDA 2YGWA 4XPDC 4MFJA 3NA6A 4IK2A 5IB0A 4CAXA 2B4BA 1DTDA 3GLJA 3PEIA 2OH1A 2Q04A 2Z11A 1S60A 1U6MA 4KOVA 4R57A 4K30A 1M44A 1DE4C
chains in the Genus database with same CATH topology
2P0WA 4AG7A 5G20A 3BJ8A 2JDDA 2CNMA 3F5BA 4QB9A 5AG4A 4A95A 2Q7BA 2YNEA 1XEBA 4ZGYB 3DR6A 3EO4A 1IB1E 3TCVA 4F0YA 1UFHA 4FD7A 1QSOA 4BMHA 2DPSA 4A32A 3G3SA 2K5TA 4R3KA 2J8RA 3T90A 1XMTA 2EUIA 1XE4A 2B5GA 3GY9A 4U5YA 2QECA 1S7NA 3JVNA 3P2FA 2Q4VA 3IU2A 3S6GA 4C7HA 4PV6A 4KOTA 1S7FA 3FNCA 5HH1A 3IU1A 4EVYA 4X5KA 3FYNA 1N71A 1NE9A 1YK3A 3F0AA 3W6XA 4RI1A 1GHEA 2DXQA 1Y9WA 3TO6A 1KZFA 1S5KA 2J8NA 1Z9UA 3PGPA 2HUZA 1QSTA 2ZW7A 4MBUA 1Z4RA 4MFKA 1SQHA 3JTKA 4CGPA 4DNCA 1MJ9A 1WK4A 2OU2A 4PK2A 2WUUA 3A9LA 4C2XA 1MJAA 2YNCC 4XNHB 5AG5A 2ATRA 4UCMA 5F46A 2B4DA 5G21A 2GANA 2VXKA 1Y7RA 1RO5A 2G0BA 2REEA 4JD6A 3D3SA 1CM0A 5EC4A 2PRBA 2VEZA 2ZW6A 1IYLA 1Q2YA 2Q4YA 2Z3MA 4HNXB 5F47A 3F8KA 4QBJA 3TT2A 3TTHA 2D4PA 3DR8A 3TE4A 5AG6A 1TIQA 3NE7A 4B12A 4CAWA 1YVOA 1FY7A 2PSWA 1WWZA 2EVNA 1P4NA 3SXOA 4QUSA 4HNYB 4KVME 4H6UA 4XNHC 2WSAA 3RYOA 3UY5A 4KOUA 1J4JA 5I0CA 2VZZA 3H5ZA 1Y9KA 5DWMA 4AB7A 5KTCA 1I12A 2NMTA 2FE7A 2Z3NA 2WPXA 4UCPA 4B5PA 2HV2A 2RC4A 2B58A 4JLYA 3SHPA 1YX0A 2R7HA 2PR8A 3V8IA 1M1DA 4UWJA 1QSMA 2F5IA 5J8FA 4CYNA 1QSNA 3BLNA 2OB0A 3S6KA 1YGHA 2GIVA 3EY5A 4J3GA 3CXQA 3GKRA 2I79A 4XPLA 4B14A 4CAVA 1YLEA 2FT0A 2CY2A 4HKFA 4CYPA 3W6SA 4UWIA 2PR1A 2DPTA 2JLMA 2HQYA 4LUAA 2P6EA 4XPKA 4UFXA 3TO9A 2I00A 2ZW5A 1M4GA 3R9EA 4B5OA 5C82A 1Q2DA 2BUEA 1B6BA 4MFPA 2GE3A 4A33A 5A28A 4HNWB 2G3AA 1BOBA 5GCNA 2WPWA 4GS4A 2B3UA 3H4QA 2OZHA 1I1DA 4CRYB 2B3VA 4A2ZA 4Y49B 4NCZA 3W91A 4AVAA 4CAFA 4H6ZA 4ONUA 4QC6A 4A31A 1IYKA 2J8MA 1IIDA 4U9ZA 2REFA 4YGOA 3EC4A 2A4NA 1VHSA 4KOWA 3TOBA 2OZGA 4U9YA 1OZPA 2FIWA 3I3GA 2PDOA 3IGRA 4R9MA 4F0XA 4AVCA 3LD2A 3S6FA 4CGOA 4IF5A 4NEXA 4CGLA 2VZYA 1KUYA 2BSWA 1XF8A 4FD4A 4KVXA 1K4JA 3S6HA 3R95A 4A30A 5C88A 4KZTA 2YNDA 3CXSA 5EBVA 2BEIA 3GYAA 4B5PB 4Q38A 4QVTA 2JEVA 5DWNA 2R8VA 5IV0A 2Z3KA 1LRZA 2QIRA 2Z0ZA 2BL1A 4E8OA 4CAEA 2CXAA 5KTAA 2ZXVA 3I9SA 3LODA 3R9FA 4JXRA 4PSWA 2CNTA 5JPHA 2PC1A 2FIAA 5HMNA 2O28A 4L8AA 1NSLA 2IL4A 2OZUA 4PK3A 3WR7A 4JXQA 4KUBA 3MGDA 4F6AA 4CYOA 4KOSA 3R96A 2Y0MA 1V0CA 3FB3A 2R1IA 4KS9A 4MFLA 5AGEA 4UFVA 2Q44A 2QMLA 3EXNA 4C7IA 2ZPAA 2P6GA 1Z4EA 1XIXA 3DSBA 1PU9A 2B5GB 4MY0A 2JDCA 4CGMA 4UA3A 3VWEA 5A27A 3G8WA 4YRHA 1KUVA 1M4DA 1YVKA 2PQ8A 3SXNA 4B11A 4FD6A 2FXFA 4M85A 4KORA 3C26A 4KLWA 1RXTA 4B13A 2H5MA 4MJ8A 1QSRA 3KKWA 5F48A 4CYQA 3N7ZA 4L89A 4C2ZA 4KLVA 3B8GA 3TOAA 2Z3LA 4NF1A 2Q0YA 3OWCA 5IX3A 2AJ6A 4B10A 5E96A 4ORFA 1KUXA 4OAEA 1S3ZA 2R98A 4I49A 3QB8A 4UBRA 2D4OA 4II9A 5JQ4A 4MFQA 3P2HA 2B4DB 4C2YA 3D2PA 2ZW4A 3K9UA 2P6FA 4JJXA 2FCKA 4E2AA 4IUSA 3DNSA 3TO7A 1YR0A 2Z3PA 1S7LA 2Z10A 4NSQA 3D8PA 3D2MA 5KTDA 5G22A 3ZJ0A 2VQYA 1R57A 4R3LA 1VKCA 3BJ7A 3CXPA 1Q2CA 2KCWA 1YREA 4CGNA 1L0CA 4KSAA 5AG7A 4KUAA 2AE6A 3R1KA 2FS5A 5BWAB 5ISVA 4NXYA 5J8CA 2FL4A 4Q36A 3PP9A 4MY3A 3TFYA 2C27A 4Y49C 3T9YA 4OLLA 4H89A 4KSFA 4JWPA 3VWDA 4OADA 3IWGA 5H86A 4RS2A 4KOYA 2CNSA 4MFZA 2G3TA 2YNCA 2VBQA 3FBUA 3FIXA 3FRMA 5H84A 5CNPA 5G1ZA 2VI7A 4CRZB 1BO4A 1I21A 3DDDA 5FVJA 1P0HA 1ZO0A 4UFWA 4AVBA 2ARHA 1MJBA 4KVOE 3IWEA 2X7BA 4R87A 4E0AA 4YFJA 1IICA 2FSRA 4AG9A 1S7KA 1M4IA 4XPDB 1ON0A 4BBHA 2Z3OA 4C68A 4FD5A 3FXTA 4MI4A 1MK4A 1B87A 1CJWA 1PUAA 3JUWA 4LX9A 1NMTA 3EFAA 5F49A 4PSXA 4CS0B 3ZZIA 4UCNA 4KOXA 3PZJA 4M3SA 4ZBGA 3QAHA 3R9GA 4MHDA 2YGWA 4XPDC 4MFJA 5IB0A 4CAXA 2B4BA 2OH1A 2Q04A 2Z11A 1S60A 1U6MA 4KOVA 4R57A 4K30A 1M44A 3E0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P0W A;  4AG7 A;  3BJ8 A;  2JDD A;  2CNM A;  3F5B A;  4QB9 A;  2Q7B A;  1XEB A;  3DR6 A;  3EO4 A;  1IB1 E;  3TCV A;  4F0Y A;  1UFH A;  4FD7 A;  1QSO A;  4BMH A;  3G3S A;  2K5T A;  4R3K A;  2J8R A;  3T90 A;  1XMT A;  2EUI A;  1XE4 A;  2B5G A;  3GY9 A;  4U5Y A;  2QEC A;  1S7N A;  3JVN A;  3P2F A;  2Q4V A;  3S6G A;  4PV6 A;  4KOT A;  1S7F A;  3FNC A;  5HH1 A;  4EVY A;  4X5K A;  3FYN A;  1N71 A;  1NE9 A;  1YK3 A;  3F0A A;  3W6X A;  4RI1 A;  1GHE A;  2DXQ A;  1Y9W A;  3TO6 A;  1KZF A;  1S5K A;  2J8N A;  1Z9U A;  3PGP A;  2HUZ A;  1QST A;  2ZW7 A;  4MBU A;  1Z4R A;  1SQH A;  4DNC A;  1MJ9 A;  1WK4 A;  2OU2 A;  4PK2 A;  1MJA A;  4XNH B;  2ATR A;  5F46 A;  2B4D A;  2GAN A;  2VXK A;  1Y7R A;  1RO5 A;  2G0B A;  2REE A;  4JD6 A;  3D3S A;  1CM0 A;  5EC4 A;  2PRB A;  2VEZ A;  2ZW6 A;  1IYL A;  1Q2Y A;  2Q4Y A;  4HNX B;  5F47 A;  3F8K A;  4QBJ A;  3TT2 A;  3TTH A;  2D4P A;  3DR8 A;  3TE4 A;  1TIQ A;  3NE7 A;  4CAW A;  1YVO A;  1FY7 A;  2PSW A;  1WWZ A;  2EVN A;  1P4N A;  3SXO A;  4QUS A;  4HNY B;  4KVM E;  4H6U A;  4XNH C;  3RYO A;  3UY5 A;  4KOU A;  1J4J A;  5I0C A;  2VZZ A;  5DWM A;  1Y9K A;  4AB7 A;  5KTC A;  1I12 A;  2NMT A;  2FE7 A;  2WPX A;  4B5P A;  2HV2 A;  2RC4 A;  2B58 A;  4JLY A;  3SHP A;  1YX0 A;  2R7H A;  2PR8 A;  3V8I A;  1M1D A;  4UWJ A;  1QSM A;  2F5I A;  5J8F A;  1QSN A;  3BLN A;  2OB0 A;  3S6K A;  1YGH A;  2GIV A;  3EY5 A;  4J3G A;  3CXQ A;  3GKR A;  2I79 A;  4XPL A;  4CAV A;  1YLE A;  2FT0 A;  2CY2 A;  4HKF A;  3W6S A;  4UWI A;  2PR1 A;  2JLM A;  2HQY A;  4LUA A;  2P6E A;  4XPK A;  3TO9 A;  2I00 A;  2ZW5 A;  1M4G A;  3R9E A;  4B5O A;  5C82 A;  1Q2D A;  2BUE A;  1B6B A;  2GE3 A;  4HNW B;  2G3A A;  1BOB A;  5GCN A;  2WPW A;  4GS4 A;  2B3U A;  3H4Q A;  2OZH A;  1I1D A;  4CRY B;  2B3V A;  4Y49 B;  4NCZ A;  3W91 A;  4AVA A;  4H6Z A;  4ONU A;  4QC6 A;  1IYK A;  2J8M A;  1IID A;  4U9Z A;  2REF A;  4YGO A;  3EC4 A;  2A4N A;  1VHS A;  4KOW A;  3TOB A;  2OZG A;  4U9Y A;  1OZP A;  2FIW A;  3I3G A;  2PDO A;  3IGR A;  4R9M A;  4AVC A;  3LD2 A;  3S6F A;  4IF5 A;  4NEX A;  2VZY A;  1KUY A;  2BSW A;  1XF8 A;  4FD4 A;  4KVX A;  1K4J A;  3S6H A;  3R95 A;  5C88 A;  4KZT A;  3CXS A;  5EBV A;  2BEI A;  3GYA A;  4B5P B;  4QVT A;  2JEV A;  5DWN A;  2R8V A;  5IV0 A;  1LRZ A;  2QIR A;  2Z0Z A;  2BL1 A;  4E8O A;  5KTA A;  2ZXV A;  3I9S A;  3LOD A;  3R9F A;  4JXR A;  4PSW A;  2CNT A;  5JPH A;  2PC1 A;  2FIA A;  5HMN A;  2O28 A;  4L8A A;  1NSL A;  2IL4 A;  2OZU A;  4PK3 A;  3WR7 A;  4JXQ A;  4KUB A;  3MGD A;  4F6A A;  4KOS A;  3R96 A;  2Y0M A;  1V0C A;  3FB3 A;  2R1I A;  2Q44 A;  2QML A;  3EXN A;  2ZPA A;  2P6G A;  1Z4E A;  1XIX A;  3DSB A;  1PU9 A;  2B5G B;  4MY0 A;  2JDC A;  4UA3 A;  3VWE A;  3G8W A;  4YRH A;  1KUV A;  1M4D A;  1YVK A;  2PQ8 A;  3SXN A;  4FD6 A;  2FXF A;  4M85 A;  4KOR A;  3C26 A;  4KLW A;  1RXT A;  2H5M A;  4MJ8 A;  1QSR A;  3KKW A;  5F48 A;  3N7Z A;  4L89 A;  4KLV A;  3B8G A;  3TOA A;  4NF1 A;  2Q0Y A;  3OWC A;  5IX3 A;  2AJ6 A;  5E96 A;  4ORF A;  1KUX A;  4OAE A;  1S3Z A;  2R98 A;  4I49 A;  3QB8 A;  4UBR A;  2D4O A;  4II9 A;  5JQ4 A;  3P2H A;  2B4D B;  3D2P A;  2ZW4 A;  3K9U A;  2P6F A;  4JJX A;  2FCK A;  4E2A A;  4IUS A;  3DNS A;  3TO7 A;  1YR0 A;  1S7L A;  2Z10 A;  4NSQ A;  3D8P A;  3D2M A;  5KTD A;  3ZJ0 A;  2VQY A;  1R57 A;  4R3L A;  1VKC A;  3BJ7 A;  3CXP A;  1Q2C A;  2KCW A;  1YRE A;  1L0C A;  4KUA A;  2AE6 A;  3R1K A;  2FS5 A;  5ISV A;  4NXY A;  5J8C A;  2FL4 A;  3PP9 A;  4MY3 A;  3TFY A;  2C27 A;  4Y49 C;  3T9Y A;  4OLL A;  4H89 A;  4JWP A;  3VWD A;  4OAD A;  3IWG A;  5H86 A;  4RS2 A;  4KOY A;  2CNS A;  2G3T A;  2VBQ A;  3FBU A;  3FIX A;  3FRM A;  5H84 A;  5CNP A;  2VI7 A;  4CRZ B;  1BO4 A;  1I21 A;  3DDD A;  5FVJ A;  1P0H A;  4AVB A;  2ARH A;  1MJB A;  4KVO E;  2X7B A;  4R87 A;  4E0A A;  4YFJ A;  1IIC A;  2FSR A;  4AG9 A;  1S7K A;  1M4I A;  4XPD B;  1ON0 A;  4FD5 A;  3FXT A;  4MI4 A;  1MK4 A;  1B87 A;  1CJW A;  1PUA A;  3JUW A;  4LX9 A;  1NMT A;  3EFA A;  5F49 A;  4PSX A;  4CS0 B;  3ZZI A;  4KOX A;  3PZJ A;  4M3S A;  4ZBG A;  3QAH A;  3R9G A;  4MHD A;  4XPD C;  5IB0 A;  4CAX A;  2B4B A;  2OH1 A;  2Q04 A;  2Z11 A;  1S60 A;  1U6M A;  4KOV A;  4R57 A;  4K30 A;  1M44 A;  3E0K A; 
#chains in the Genus database with same CATH topology
 4DYO A;  2P0W A;  2WYR A;  4AG7 A;  3MRU A;  5G20 A;  3WAB A;  3BJ8 A;  3KZW A;  2JDD A;  2CNM A;  3F5B A;  4QB9 A;  4TNU A;  4IAV A;  5AG4 A;  4A95 A;  2Q7B A;  2YNE A;  1XEB A;  4ZGY B;  1ARL A;  2ZEE A;  1UWY A;  1X12 A;  1IB1 E;  3DR6 A;  3EO4 A;  4PXC A;  2F7V A;  5D8N A;  2AFZ A;  3TCV A;  4F0Y A;  1UFH A;  3SI1 A;  4FD7 A;  1QSO A;  3SJG A;  2JBK A;  2DPS A;  4BMH A;  1CP7 A;  2O53 A;  3B35 A;  4A32 A;  3G3S A;  4UF4 A;  2K5T A;  4R3K A;  1LCP A;  2J8R A;  5HVG A;  3B3C A;  3T90 A;  2ANP A;  2HB6 A;  1XMT A;  2EUI A;  1XE4 A;  2B5G A;  3GY9 A;  3SJE A;  4U5Y A;  2QEC A;  2EBJ A;  3MN8 A;  2JEW A;  4X2T A;  1OBR A;  2AFM A;  2OOT A;  1S7N A;  3JVN A;  3P2F A;  2Q4V A;  1Z5R A;  3IU2 A;  4MCP A;  3NFZ A;  3S6G A;  4C7H A;  4PV6 A;  1ARM A;  4PPZ A;  4KOT A;  3D7H A;  4UIA A;  1S7F A;  3FNC A;  5HH1 A;  3IU1 A;  4EVY A;  3BI0 A;  5J1Q A;  4X5K A;  5EMI A;  3FYN A;  2PJ0 A;  1N71 A;  1NE9 A;  2BCO A;  4M6I A;  1YK3 A;  3I1U A;  3F0A A;  3W6X A;  4RI1 A;  1GHE A;  5LYL A;  2DXQ A;  1Y9W A;  3TO6 A;  1KZF A;  1S5K A;  2J8N A;  3IFE A;  1Z9U A;  3PGP A;  3PFO A;  2HUZ A;  3KAS A;  2GU2 A;  4K3N A;  1QST A;  4UIB A;  4NGP A;  2ZW7 A;  4MBU A;  1Z4R A;  1CPS A;  2PJ7 A;  2ZEG A;  1BPM A;  1SQH A;  4MFK A;  4NGQ A;  4FUU A;  3KR5 A;  3JTK A;  5DS0 A;  4Z65 A;  1TKJ A;  4PQA A;  2CIJ A;  2PJ2 A;  5D29 A;  4CGP A;  4ZY2 A;  4DNC A;  1XBU A;  1MJ9 A;  3NE8 A;  1WK4 A;  2ODF A;  2OU2 A;  3PBB A;  4OC3 A;  4B6Z A;  4PK2 A;  1RTQ A;  2WUU A;  3A9L A;  4C2X A;  3FED A;  1MJA A;  2YNC C;  4OIW A;  4XNH B;  5AG5 A;  1ELM P;  2ATR A;  4IHM A;  4UCM A;  5F46 A;  2B4D A;  5G21 A;  2GAN A;  2VXK A;  4R76 A;  1Y7R A;  1RO5 A;  2G0B A;  2REE A;  2PJ4 A;  3K2K A;  3D3S A;  1CM0 A;  4JD6 A;  5K8M A;  1Y0Y A;  5EC4 A;  4NGM A;  2PRB A;  2AFO A;  3RBU A;  2VEZ A;  2ZW6 A;  4M6H A;  1IYL A;  1Q2Y A;  2Q4Y A;  2Z3M A;  4HNX B;  1IY7 A;  4WJB A;  5F47 A;  4DJL A;  2PRQ A;  3PB8 X;  3F8K A;  4QBJ A;  3TT2 A;  3TTH A;  2D4P A;  5LRK A;  3DR8 A;  2PCU A;  3TE4 A;  1HDU A;  4P45 A;  3V38 A;  4TWE A;  4ZY1 A;  5AG6 A;  4JYW A;  1TIQ A;  3NE7 A;  3L2N A;  4B12 A;  1YVO A;  4CAW A;  1FY7 A;  4NGS A;  2PSW A;  1WWZ A;  3FEE A;  2EVN A;  1P4N A;  3SXO A;  3D68 A;  1GYT A;  2PJ6 A;  4QUS A;  4HNY B;  4OKO A;  1BAV A;  4KVM E;  4MRI A;  4H6U A;  3WC5 A;  4XNH C;  2WSA A;  3RYO A;  2EK8 A;  3UY5 A;  4KOU A;  2NSM A;  3CZX A;  4GXH A;  5JH9 A;  1J4J A;  1ELL P;  3CPX A;  4MHP A;  5ELY A;  3PFE A;  4OC1 A;  5I0C A;  4X3R A;  4MHY A;  2VZZ A;  4AXV A;  3D67 A;  3H5Z A;  1Y9K A;  5DWM A;  4AB7 A;  5KTC A;  1I12 A;  2NMT A;  2FE7 A;  2Q4Z A;  1YQE A;  2V8H A;  2WPX A;  2AFU A;  2Z3N A;  3H8E A;  4UCP A;  4B5P A;  2HV2 A;  2RC4 A;  3LMS A;  4MHZ A;  4R6T A;  3FEC A;  2B58 A;  4JLY A;  3SHP A;  1YX0 A;  1A2Z A;  2R7H A;  2PR8 A;  3V8I A;  1M1D A;  5IB9 A;  4UWJ A;  4ZI6 A;  6CPA A;  5LRJ A;  1QSM A;  2F5I A;  5J8F A;  4CYN A;  1QSN A;  3BLN A;  1JQG A;  2ZEO A;  2OB0 A;  4KSI A;  3S6K A;  1CP6 A;  2AFW A;  1YGH A;  4P4D A;  2GIV A;  1ZLH A;  3EY5 A;  4J3G A;  3CDX A;  3B3V A;  3CXQ A;  3GKR A;  3T8W A;  2I79 A;  5LRG A;  3H8G A;  4XPL A;  4B14 A;  4CAV A;  3NH8 A;  1YLE A;  2FT0 A;  2CY2 A;  2ZEF A;  4HKF A;  4CYP A;  1TKF A;  3W6S A;  4UWI A;  2PR1 A;  2DPT A;  4O23 A;  5LYI A;  2JLM A;  2AFX A;  2HQY A;  2P6E A;  4LUA A;  4P4B A;  2ZEP A;  4XPK A;  4UFX A;  1PYT B;  3TO9 A;  3QAY A;  2I00 A;  2ZW5 A;  1M4G A;  3WC6 A;  3R9E A;  4B5O A;  2RB7 A;  4G1P A;  5C82 A;  1Q2D A;  3SI0 A;  2BUE A;  1B6B A;  2IJZ A;  2ZED A;  4MFP A;  2GE3 A;  4GM5 A;  4A33 A;  3GIU A;  4YWY A;  5A28 A;  3IEH A;  4HNW B;  2G3A A;  3D7D A;  1IOF A;  1BOB A;  5GCN A;  2PJ3 A;  2WPW A;  4GS4 A;  2B3U A;  4OME A;  3PB4 X;  3H4Q A;  4LQG A;  2OZH A;  3PB7 X;  4PXB A;  1I1D A;  2GFQ A;  4OC2 A;  2GLF A;  4CRY B;  2B3V A;  4A2Z A;  1TXR A;  1Z8T A;  2C6C A;  2BO9 A;  1LFW A;  4Y49 B;  2PJC A;  4FBE A;  4NCZ A;  3W91 A;  5JM6 A;  3E0K A;  4AVA A;  4A39 A;  4M6G A;  4H6Z A;  4ONU A;  4QC6 A;  4CAF A;  2XEG A;  5F09 A;  1Q7L A;  4A31 A;  3FF3 A;  3RAM A;  1JWQ A;  1IYK A;  1F2P A;  2J8M A;  2BOA A;  4P44 A;  1IID A;  2CTC A;  4U9Z A;  2J9A A;  1F2O A;  2PJB A;  4X8I A;  2REF A;  4YGO A;  3EC4 A;  2A4N A;  1VHS A;  4KOW A;  3IJ3 A;  4FWU A;  3TOB A;  4Q7A A;  2G9D A;  2OZG A;  4U9Y A;  4P4J A;  2EO8 A;  1Z8L A;  1OZP A;  2FIW A;  3LWU A;  3I3G A;  4ONW A;  2PDO A;  3IGR A;  2PIY A;  2Q43 A;  4MXU A;  4R9M A;  4NGT A;  4F0X A;  4AVC A;  1R43 A;  3LD2 A;  3S9L A;  3GB0 A;  3S6F A;  4CGO A;  3JRU A;  4IF5 A;  4NEX A;  4CGL A;  2VZY A;  1KUY A;  2BSW A;  1XF8 A;  1YW6 A;  3IIB A;  4FD4 A;  3PBE A;  4KVX A;  3D66 A;  1K4J A;  3B2Y A;  4OC4 A;  3FH4 A;  3S6H A;  3R95 A;  4A30 A;  3BXM A;  4KZT A;  5C88 A;  2YND A;  3CXS A;  5EBV A;  2BEI A;  3GYA A;  4B5P B;  4Q38 A;  4QVT A;  2JEV A;  1XJO A;  2R8V A;  5DWN A;  5IV0 A;  3KI9 A;  2Z3K A;  1LRZ A;  2QIR A;  2Z0Z A;  2BL1 A;  4OC0 A;  4E8O A;  1Z2L A;  2CXA A;  3SI2 A;  4CAE A;  1FT7 A;  1ZLI A;  5KTA A;  2QVP A;  2ZXV A;  3I9S A;  3LOD A;  1AMP A;  3R9F A;  3PB9 X;  4JXR A;  4PSW A;  2CNT A;  3B3T A;  1H8L A;  5JPH A;  2PC1 A;  2FIA A;  4DUK A;  5HMN A;  2XEI A;  2O28 A;  4L8A A;  1NSL A;  2IL4 A;  2OZU A;  4PK3 A;  4WWV A;  3ISX A;  5CPA A;  3SJF A;  3WR7 A;  4JXQ A;  3KQZ A;  4KUB A;  3MGD A;  5HVF A;  4F6A A;  4CYO A;  4KOS A;  4LQ6 A;  3R96 A;  2Y0M A;  4A38 A;  1V0C A;  3HUV A;  3FB3 A;  4MCQ A;  2R1I A;  5JGF A;  2PJ5 A;  1Y7E A;  4KS9 A;  3B3S A;  4MFL A;  1BPN A;  4H2K A;  2PIZ A;  5AGE A;  4UFV A;  2Q44 A;  3FVL A;  2ZOF A;  2QML A;  3SJX A;  4UEZ A;  1AYE A;  3EXN A;  2I3C A;  4C7I A;  1CBX A;  2P6G A;  2ZPA A;  1ZG8 A;  1Z4E A;  1XIX A;  2PVV A;  4MMO A;  3DSB A;  3LAC A;  1PU9 A;  3D4U A;  2B5G B;  1BLL E;  4MY0 A;  4R7M A;  7CPA A;  1IGB A;  2JDC A;  4CGM A;  4UA3 A;  3WC7 A;  3VWE A;  3KR4 A;  2GRE A;  5A27 A;  3G8W A;  4YRH A;  1KUV A;  1M4D A;  1YVK A;  2PQ8 A;  3IWW A;  3KHZ A;  3SXN A;  3TC8 A;  1X10 A;  4B11 A;  4FD6 A;  2FXF A;  2EWB A;  1KWM A;  3RZA A;  4M85 A;  4KOR A;  3C26 A;  4KLW A;  1RXT A;  2NYQ A;  2OR4 A;  2CTB A;  4P6Y A;  4B13 A;  2H5M A;  4MJ8 A;  1QSR A;  2V8G A;  3KKW A;  5F48 A;  4CYQ A;  3N7Z A;  4L89 A;  4C2Z A;  4KLV A;  1CG2 A;  3B8G A;  3TX8 A;  3TOA A;  4W9Y A;  2Z3L A;  4NF1 A;  2PJA A;  2RFH A;  2Q0Y A;  2HC9 A;  3OWC A;  3KL9 A;  1XMB A;  3KHX A;  4MCS A;  5IX3 A;  1XOV A;  2AJ6 A;  4B10 A;  2PE3 A;  5E96 A;  4OP4 A;  3FJU A;  4ORF A;  1KUX A;  4OAE A;  1S3Z A;  3ISZ A;  2R98 A;  4I49 A;  3QB8 A;  4UBR A;  1YSJ A;  4NJQ A;  2D4O A;  2DF5 A;  2VL1 A;  3S9M A;  1IU8 A;  4II9 A;  1PCA A;  5JQ4 A;  2QYV A;  4MFQ A;  5HXD A;  3P2H A;  4MCR A;  2B4D B;  2PJ1 A;  3D2P A;  1VIX A;  3PB6 X;  4C2Y A;  2ZW4 A;  4NJR A;  3K9U A;  2P6F A;  4JJX A;  2FCK A;  4EME A;  4E2A A;  4F9V A;  1TKH A;  4IUS A;  2ZEL A;  3DNS A;  3TO7 A;  1YR0 A;  1QQ9 A;  2Z3P A;  1XFO A;  5K8P A;  4JZ0 A;  1S7L A;  2Z10 A;  1VHE A;  1LAN A;  3VAT A;  4NSQ A;  1HEE A;  2PVW A;  3S9N A;  3D8P A;  3D2M A;  5KTD A;  1M4L A;  4PXE A;  5G22 A;  1Z8W A;  3ZJ0 A;  4FAI A;  2VQY A;  1R57 A;  2IQ6 A;  2ZEM A;  1F57 A;  4R3L A;  2C6G A;  3PRT A;  1NSA A;  4BIN A;  4F9U A;  3IO1 A;  4YU9 A;  2ABZ A;  1VKC A;  5LYD A;  2C6P A;  3BJ7 A;  1Q2C A;  3CXP A;  1LAM A;  4CPA A;  4UEF A;  2KCW A;  1YRE A;  4P4I A;  1L0C A;  4CGN A;  3D7G A;  4KSA A;  4ZX9 A;  3KQX A;  1YW4 A;  4KUA A;  5AG7 A;  2AE6 A;  8CPA A;  3R1K A;  4OC5 A;  2FS5 A;  1VGY A;  5BWA B;  5ISV A;  4P4F A;  4NXY A;  5J8C A;  3BHX A;  2FL4 A;  2PJ9 A;  4Q36 A;  2XEF A;  3PP9 A;  1YME A;  4MY3 A;  1HDQ A;  3TFY A;  2C27 A;  4Y49 C;  3T9Y A;  3K9T A;  4OLL A;  2POK A;  1EE3 P;  4RUH A;  3WT4 A;  4H89 A;  1ZG9 A;  1LAP A;  3D7F A;  1TF9 A;  4KSF A;  3RNZ A;  2WZN A;  4JWP A;  2ZEH A;  3VWD A;  4OAD A;  3IWG A;  5H86 A;  2XEJ A;  4RS2 A;  2V8D A;  4ZX8 A;  2Q7S A;  2V8V A;  5K8N A;  2IMO A;  4KOY A;  2EK9 A;  3GUX A;  2CNS A;  3NH4 A;  3N5F A;  2FVG A;  3DGV A;  4MFZ A;  4BD9 A;  2G3T A;  2YNC A;  2VBQ A;  3FBU A;  3FIX A;  3FRM A;  5H84 A;  1LOK A;  5CNP A;  3B7I A;  5G1Z A;  1Y0R A;  1TF8 A;  4RN7 A;  2VI7 A;  3BI1 A;  4CRZ B;  1CPX A;  2Q51 A;  1BO4 A;  4MHN A;  4ZYQ A;  1I21 A;  1ZG7 A;  2O4H A;  2JBJ A;  3DDD A;  5FVJ A;  2ZEN A;  1P0H A;  1ZO0 A;  4UFW A;  4AVB A;  2ARH A;  1MJB A;  3KGQ A;  4EFD A;  2DEA A;  4KVO E;  5HVH A;  4NGN A;  3IWE A;  3V7Z A;  2X7B A;  4R87 A;  4E0A A;  4YFJ A;  5CBM A;  1IIC A;  1QMU A;  2FSR A;  4AG9 A;  1S7K A;  4A37 A;  4A94 A;  1YLO A;  5LYF A;  1M4I A;  4P4E A;  4UEE A;  4XPD B;  3VH9 A;  1ON0 A;  1VHO A;  2Z3O A;  2C1C A;  4BBH A;  5K8O A;  4C68 A;  4FD5 A;  2GLJ A;  3FXT A;  4MI4 A;  1MK4 A;  3RO0 A;  3NH5 A;  4HPS A;  1B87 A;  2V77 A;  4R8F A;  4F8Z A;  1IOI A;  2PJ8 A;  1R3N A;  1CJW A;  1PUA A;  3CT9 A;  3H8F A;  3JUW A;  4LX9 A;  1AUG A;  5THW A;  2QJ8 A;  1XRY A;  1Z8X A;  1NMT A;  2F8H A;  2AFS A;  4ZY0 A;  3FMC A;  3DLJ A;  4P10 A;  3EFA A;  5F49 A;  3CPA A;  3VAR A;  4EWT A;  3IC1 A;  4NFR A;  4NGR A;  2ZOG A;  1FNO A;  4PSX A;  2CF4 A;  4OID A;  5I4M A;  3B3W A;  4PXD A;  3ZZI A;  4CS0 B;  1CX8 A;  4UCN A;  3HLP A;  4KOX A;  3PZJ A;  4M3S A;  4ZBG A;  3QAH A;  3FX6 A;  3QNV A;  3R9G A;  4MHD A;  2YGW A;  4XPD C;  4MFJ A;  3NA6 A;  4IK2 A;  5IB0 A;  4CAX A;  2B4B A;  1DTD A;  3GLJ A;  3PEI A;  2OH1 A;  2Q04 A;  2Z11 A;  1S60 A;  1U6M A;  4KOV A;  4R57 A;  4K30 A;  1M44 A;  1DE4 C; 
#chains in the Genus database with same CATH homology
 2P0W A;  4AG7 A;  5G20 A;  3BJ8 A;  2JDD A;  2CNM A;  3F5B A;  4QB9 A;  5AG4 A;  4A95 A;  2Q7B A;  2YNE A;  1XEB A;  4ZGY B;  3DR6 A;  3EO4 A;  1IB1 E;  3TCV A;  4F0Y A;  1UFH A;  4FD7 A;  1QSO A;  4BMH A;  2DPS A;  4A32 A;  3G3S A;  2K5T A;  4R3K A;  2J8R A;  3T90 A;  1XMT A;  2EUI A;  1XE4 A;  2B5G A;  3GY9 A;  4U5Y A;  2QEC A;  1S7N A;  3JVN A;  3P2F A;  2Q4V A;  3IU2 A;  3S6G A;  4C7H A;  4PV6 A;  4KOT A;  1S7F A;  3FNC A;  5HH1 A;  3IU1 A;  4EVY A;  4X5K A;  3FYN A;  1N71 A;  1NE9 A;  1YK3 A;  3F0A A;  3W6X A;  4RI1 A;  1GHE A;  2DXQ A;  1Y9W A;  3TO6 A;  1KZF A;  1S5K A;  2J8N A;  1Z9U A;  3PGP A;  2HUZ A;  1QST A;  2ZW7 A;  4MBU A;  1Z4R A;  4MFK A;  1SQH A;  3JTK A;  4CGP A;  4DNC A;  1MJ9 A;  1WK4 A;  2OU2 A;  4PK2 A;  2WUU A;  3A9L A;  4C2X A;  1MJA A;  2YNC C;  4XNH B;  5AG5 A;  2ATR A;  4UCM A;  5F46 A;  2B4D A;  5G21 A;  2GAN A;  2VXK A;  1Y7R A;  1RO5 A;  2G0B A;  2REE A;  4JD6 A;  3D3S A;  1CM0 A;  5EC4 A;  2PRB A;  2VEZ A;  2ZW6 A;  1IYL A;  1Q2Y A;  2Q4Y A;  2Z3M A;  4HNX B;  5F47 A;  3F8K A;  4QBJ A;  3TT2 A;  3TTH A;  2D4P A;  3DR8 A;  3TE4 A;  5AG6 A;  1TIQ A;  3NE7 A;  4B12 A;  4CAW A;  1YVO A;  1FY7 A;  2PSW A;  1WWZ A;  2EVN A;  1P4N A;  3SXO A;  4QUS A;  4HNY B;  4KVM E;  4H6U A;  4XNH C;  2WSA A;  3RYO A;  3UY5 A;  4KOU A;  1J4J A;  5I0C A;  2VZZ A;  3H5Z A;  1Y9K A;  5DWM A;  4AB7 A;  5KTC A;  1I12 A;  2NMT A;  2FE7 A;  2Z3N A;  2WPX A;  4UCP A;  4B5P A;  2HV2 A;  2RC4 A;  2B58 A;  4JLY A;  3SHP A;  1YX0 A;  2R7H A;  2PR8 A;  3V8I A;  1M1D A;  4UWJ A;  1QSM A;  2F5I A;  5J8F A;  4CYN A;  1QSN A;  3BLN A;  2OB0 A;  3S6K A;  1YGH A;  2GIV A;  3EY5 A;  4J3G A;  3CXQ A;  3GKR A;  2I79 A;  4XPL A;  4B14 A;  4CAV A;  1YLE A;  2FT0 A;  2CY2 A;  4HKF A;  4CYP A;  3W6S A;  4UWI A;  2PR1 A;  2DPT A;  2JLM A;  2HQY A;  4LUA A;  2P6E A;  4XPK A;  4UFX A;  3TO9 A;  2I00 A;  2ZW5 A;  1M4G A;  3R9E A;  4B5O A;  5C82 A;  1Q2D A;  2BUE A;  1B6B A;  4MFP A;  2GE3 A;  4A33 A;  5A28 A;  4HNW B;  2G3A A;  1BOB A;  5GCN A;  2WPW A;  4GS4 A;  2B3U A;  3H4Q A;  2OZH A;  1I1D A;  4CRY B;  2B3V A;  4A2Z A;  4Y49 B;  4NCZ A;  3W91 A;  4AVA A;  4CAF A;  4H6Z A;  4ONU A;  4QC6 A;  4A31 A;  1IYK A;  2J8M A;  1IID A;  4U9Z A;  2REF A;  4YGO A;  3EC4 A;  2A4N A;  1VHS A;  4KOW A;  3TOB A;  2OZG A;  4U9Y A;  1OZP A;  2FIW A;  3I3G A;  2PDO A;  3IGR A;  4R9M A;  4F0X A;  4AVC A;  3LD2 A;  3S6F A;  4CGO A;  4IF5 A;  4NEX A;  4CGL A;  2VZY A;  1KUY A;  2BSW A;  1XF8 A;  4FD4 A;  4KVX A;  1K4J A;  3S6H A;  3R95 A;  4A30 A;  5C88 A;  4KZT A;  2YND A;  3CXS A;  5EBV A;  2BEI A;  3GYA A;  4B5P B;  4Q38 A;  4QVT A;  2JEV A;  5DWN A;  2R8V A;  5IV0 A;  2Z3K A;  1LRZ A;  2QIR A;  2Z0Z A;  2BL1 A;  4E8O A;  4CAE A;  2CXA A;  5KTA A;  2ZXV A;  3I9S A;  3LOD A;  3R9F A;  4JXR A;  4PSW A;  2CNT A;  5JPH A;  2PC1 A;  2FIA A;  5HMN A;  2O28 A;  4L8A A;  1NSL A;  2IL4 A;  2OZU A;  4PK3 A;  3WR7 A;  4JXQ A;  4KUB A;  3MGD A;  4F6A A;  4CYO A;  4KOS A;  3R96 A;  2Y0M A;  1V0C A;  3FB3 A;  2R1I A;  4KS9 A;  4MFL A;  5AGE A;  4UFV A;  2Q44 A;  2QML A;  3EXN A;  4C7I A;  2ZPA A;  2P6G A;  1Z4E A;  1XIX A;  3DSB A;  1PU9 A;  2B5G B;  4MY0 A;  2JDC A;  4CGM A;  4UA3 A;  3VWE A;  5A27 A;  3G8W A;  4YRH A;  1KUV A;  1M4D A;  1YVK A;  2PQ8 A;  3SXN A;  4B11 A;  4FD6 A;  2FXF A;  4M85 A;  4KOR A;  3C26 A;  4KLW A;  1RXT A;  4B13 A;  2H5M A;  4MJ8 A;  1QSR A;  3KKW A;  5F48 A;  4CYQ A;  3N7Z A;  4L89 A;  4C2Z A;  4KLV A;  3B8G A;  3TOA A;  2Z3L A;  4NF1 A;  2Q0Y A;  3OWC A;  5IX3 A;  2AJ6 A;  4B10 A;  5E96 A;  4ORF A;  1KUX A;  4OAE A;  1S3Z A;  2R98 A;  4I49 A;  3QB8 A;  4UBR A;  2D4O A;  4II9 A;  5JQ4 A;  4MFQ A;  3P2H A;  2B4D B;  4C2Y A;  3D2P A;  2ZW4 A;  3K9U A;  2P6F A;  4JJX A;  2FCK A;  4E2A A;  4IUS A;  3DNS A;  3TO7 A;  1YR0 A;  2Z3P A;  1S7L A;  2Z10 A;  4NSQ A;  3D8P A;  3D2M A;  5KTD A;  5G22 A;  3ZJ0 A;  2VQY A;  1R57 A;  4R3L A;  1VKC A;  3BJ7 A;  3CXP A;  1Q2C A;  2KCW A;  1YRE A;  4CGN A;  1L0C A;  4KSA A;  5AG7 A;  4KUA A;  2AE6 A;  3R1K A;  2FS5 A;  5BWA B;  5ISV A;  4NXY A;  5J8C A;  2FL4 A;  4Q36 A;  3PP9 A;  4MY3 A;  3TFY A;  2C27 A;  4Y49 C;  3T9Y A;  4OLL A;  4H89 A;  4KSF A;  4JWP A;  3VWD A;  4OAD A;  3IWG A;  5H86 A;  4RS2 A;  4KOY A;  2CNS A;  4MFZ A;  2G3T A;  2YNC A;  2VBQ A;  3FBU A;  3FIX A;  3FRM A;  5H84 A;  5CNP A;  5G1Z A;  2VI7 A;  4CRZ B;  1BO4 A;  1I21 A;  3DDD A;  5FVJ A;  1P0H A;  1ZO0 A;  4UFW A;  4AVB A;  2ARH A;  1MJB A;  4KVO E;  3IWE A;  2X7B A;  4R87 A;  4E0A A;  4YFJ A;  1IIC A;  2FSR A;  4AG9 A;  1S7K A;  1M4I A;  4XPD B;  1ON0 A;  4BBH A;  2Z3O A;  4C68 A;  4FD5 A;  3FXT A;  4MI4 A;  1MK4 A;  1B87 A;  1CJW A;  1PUA A;  3JUW A;  4LX9 A;  1NMT A;  3EFA A;  5F49 A;  4PSX A;  4CS0 B;  3ZZI A;  4UCN A;  4KOX A;  3PZJ A;  4M3S A;  4ZBG A;  3QAH A;  3R9G A;  4MHD A;  2YGW A;  4XPD C;  4MFJ A;  5IB0 A;  4CAX A;  2B4B A;  2OH1 A;  2Q04 A;  2Z11 A;  1S60 A;  1U6M A;  4KOV A;  4R57 A;  4K30 A;  1M44 A;  3E0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...