2X7BA

Crystal structure of the n-terminal acetylase ard1 from sulfolobus solfataricus p2
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
156
structure length
156
Chain Sequence
DFTLRNARMDDIDQIIKINRLTLPENYPYYFFVEHLKEYGLAFFVAIVDNSVVGYIMPRIEWGFSNIKQLPSLVRKGHVVSIAVLEEYRRKGIATTLLEASMKSMKNDYNAEEIYLEVRVSNYPAIALYEKLNFKKVKVLKGYYADGEDAYLMARP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACETYLTRANSFERASE SSO0209
publication title The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
total genus 44
structure length 156
sequence length 156
ec nomenclature ec 2.3.1.255: N-terminal amino-acid N(alpha)-acetyltransferase NatA.
pdb deposition date 2010-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2x7bA00
2PC1A 2R7HA 4FD5A 1IICA 2QECA 3TE4A 3FNCA 5DWMA 2ZXVA 1BOBA 2Z11A 4XPKA 4PSXA 2QIRA 3DR8A 3PP9A 4PSWA 5CNPA 2FIWA 1Y9KA 4RS2A 4R9MA 5C88A 1YVOA 4KOWA 1M4DA 3FYNA 1XF8A 3LD2A 1N71A 4YGOA 3S6GA 1Z4EA 3RYOA 2G3TA 3ZZIA 4FD7A 4ZBGA 3EFAA 4UWIA 4CS0B 2ARHA 5H84A 2B3UA 4KUAA 4MJ8A 3BLNA 3W6XA 2J8RA 1CM0A 2KCWA 4B5PA 3GY9A 3TOBA 2CNSA 4MY0A 4JWPA 1NSLA 3W6SA 2I79A 4II9A 1IIDA 4JD6A 1P4NA 3IWGA 2FE7A 2VBQA 1NE9A 2G3AA 4XNHC 1WK4A 3CXPA 4CAWA 5DWNA 2FT0A 4HNYB 1YX0A 4Y49C 1S7FA 4NXYA 3I3GA 2PR1A 4JXQA 3R96A 1MJBA 2B5GB 2H5MA 2R98A 3DSBA 3BJ7A 2CNTA 2B4BA 2VEZA 2WPXA 2ATRA 1XE4A 4IF5A 3SXOA 5FVJA 4NCZA 1SQHA 1OZPA 1Y9WA 3TCVA 3FIXA 2VI7A 2ZPAA 4JLYA 2PQ8A 4RI1A 1UFHA 2Q04A 4HNXB 2ZW4A 2GE3A 1M4GA 1QSRA 2F5IA 1IB1E 2REFA 2GANA 2G0BA 2FL4A 4NF1A 4XPDC 3G3SA 5KTAA 4EVYA 4H89A 4R57A 2FSRA 1YVKA 3VWEA 3LODA 1I12A 4KVOE 4LUAA 1KUYA 4CRYB 4GS4A 3V8IA 4CRZB 2K5TA 4PV6A 3R9EA 3PGPA 4PK3A 4MY3A 1XIXA 2A4NA 2PRBA 2GIVA 3P2HA 4ORFA 5GCNA 2B4DA 2B58A 1MJAA 1VKCA 1BO4A 1S7KA 1QSNA 2B5GA 3TFYA 3R95A 5IV0A 5F48A 1QSTA 3QAHA 5F49A 5EC4A 4R3LA 2EUIA 5HH1A 2EVNA 5E96A 2WPWA 1B87A 2Q4VA 4UWJA 3UY5A 4AB7A 1YR0A 1RXTA 4XPLA 3TO7A 4U5YA 3GYAA 1KZFA 4FD4A 2FXFA 3F8KA 3D8PA 4MI4A 4E0AA 3JVNA 1Y7RA 3SXNA 2D4OA 1B6BA 4MBUA 1IYLA 2IL4A 2B4DB 4YRHA 4E2AA 4KLVA 1RO5A 1Q2CA 5F47A 2Q7BA 2JDCA 4QBJA 3OWCA 1LRZA 4KOXA 3DNSA 2AE6A 3EO4A 4UA3A 3WR7A 1PU9A 1Z9UA 4CAXA 2REEA 3CXQA 4KLWA 2FS5A 2Q0YA 3DDDA 3ZJ0A 2Q44A 5JPHA 2ZW7A 4M85A 1Z4RA 4NSQA 3KKWA 2ZW5A 3TT2A 4X5KA 2HV2A 1S7LA 3EC4A 4F6AA 2B3VA 2OH1A 3FXTA 1M1DA 4IUSA 3BJ8A 1TIQA 3D3SA 3T9YA 4Y49B 4AVBA 2BEIA 1J4JA 3W91A 3P2FA 3TOAA 2Y0MA 4M3SA 1PUAA 2FIAA 4KOTA 3TTHA 4AG7A 4K30A 3I9SA 4KZTA 2AJ6A 4AVAA 4QB9A 1WWZA 1NMTA 3PZJA 3F5BA 3F0AA 3FBUA 2OU2A 5I0CA 2HQYA 4JXRA 4JJXA 3S6KA 4H6ZA 3T90A 3GKRA 1I1DA 3C26A 1S7NA 1IYKA 3S6FA 2PR8A 3MGDA 3R9FA 2PSWA 3B8GA 4U9YA 5JQ4A 2BSWA 4B5OA 1XEBA 2P6FA 4CAVA 4ONUA 2JDDA 2X7BA 4XPDB 4U9ZA 3TO6A 3D2MA 2VXKA 4I49A 4KUBA 4KOYA 5F46A 4YFJA 2VQYA 1VHSA 1V0CA 3D2PA 3DR6A 3CXSA 1M4IA 1K4JA 4KOUA 2I00A 2P6GA 2Z0ZA 4KVME 3S6HA 1S5KA 4MHDA 4QC6A 2D4PA 5IX3A 5J8CA 2OZUA 4R87A 1P0HA 4H6UA 3IGRA 2ZW6A 1S3ZA 4OAEA 3FB3A 3R9GA 2Z10A 2P0WA 2R8VA 1CJWA 1MK4A 1Q2DA 2J8NA 2OZGA 1KUXA 3K9UA 2BUEA 3R1KA 2BL1A 2OZHA 3TO9A 2P6EA 4PK2A 4F0YA 4HKFA 2O28A 4AVCA 5IB0A 3JUWA 4BMHA 2DXQA 3G8WA 5J8FA 2JEVA 5H86A 5ISVA 5HMNA 1Q2YA 3VWDA 4R3KA 2CY2A 4L89A 4KOVA 4NEXA 4QVTA 4UBRA 4OADA 4LX9A 1FY7A 1QSOA 4XNHB 2R1IA 3E0KA 1YK3A 2HUZA 2PDOA 2JLMA 3NE7A 4KVXA 1YGHA 1L0CA 1S60A 4HNWB 2QMLA 3QB8A 1YLEA 4B5PB 4E8OA 2VZYA 1XMTA 1YREA 3FRMA 2NMTA 2FCKA 2J8MA 1GHEA 3EY5A 3H4QA 1QSMA 1R57A 3N7ZA 1MJ9A 2RC4A 4QUSA 4AG9A 2OB0A 2VZZA 4FD6A 5KTDA 4DNCA 4KOSA 5C82A 3EXNA 1ON0A 1I21A 2CNMA 1KUVA 4OLLA 4J3GA 2C27A 4KORA 1U6MA 1M44A 5KTCA 5EBVA 4L8AA 3SHPA 2Q4YA
chains in the Genus database with same CATH superfamily
2V8HA 2PC1A 2R7HA 4UEEA 4FD5A 1TKJA 1IICA 2QECA 4Q38A 3TE4A 3DGVA 2AFZA 3FNCA 5DWMA 2ZXVA 1BOBA 3NH8A 5G21A 1Z8LA 2Z11A 5JM6A 4XPKA 4PSXA 2QIRA 3DR8A 4OIWA 3TX8A 3PP9A 1VHEA 3D66A 1CPXA 3IJ3A 3NFZA 4P4FA 4PSWA 1TF8A 5CNPA 4F8ZA 2FIWA 1Y9KA 4RS2A 4ZY0A 4PXEA 4R9MA 4H2KA 4A30A 5C88A 2PJ4A 1YVOA 4KOWA 1ZG7A 1M4DA 3FYNA 3FMCA 3PB4X 1XF8A 3LD2A 4FAIA 1N71A 4CGLA 2ZELA 3WC7A 4M6GA 4P10A 2DF5A 4YGOA 3S6GA 1Z4EA 4A94A 4C2XA 3RYOA 1GYTA 2G3TA 3S9LA 2YNCA 1LOKA 3ZZIA 4CGOA 2EWBA 2GREA 4FD7A 1IU8A 3EFAA 4UWIA 4ZBGA 3CPXA 2ARHA 4CS0B 5H84A 2B3UA 5LYDA 4KUAA 4MJ8A 4MXUA 4CYNA 3BLNA 3W6XA 4UEFA 2AFWA 4ZGYB 2J8RA 3D67A 1CM0A 3V7ZA 2KCWA 4A39A 4B5PA 1AYEA 3GY9A 3TOBA 3FF3A 4A33A 2CNSA 4MY0A 4JWPA 1NSLA 4FBEA 1M4LA 3W6SA 5ELYA 2I79A 4II9A 1IIDA 4NJRA 3PB9X 1LANA 4A37A 5LYIA 4JD6A 4CAEA 1P4NA 3IWGA 2AFUA 2FE7A 2VBQA 4P4IA 1NE9A 2G3AA 4XNHC 1WK4A 2QYVA 3CXPA 4CAWA 4ZY1A 5DWNA 4DJLA 1JWQA 2Z3LA 3PBEA 2FT0A 2V77A 4HNYB 5K8MA 1AMPA 1Z8WA 2JBKA 3IU2A 1YX0A 4Y49C 1S7FA 1LCPA 5HVGA 2PE3A 3LWUA 4NXYA 4Q36A 3I3GA 2PR1A 4JXQA 3R96A 5K8NA 2PIYA 1MJBA 4IK2A 2C6CA 3LACA 2B5GB 4C2YA 2Z3MA 2H5MA 2R98A 3DSBA 4NGPA 3NA6A 2PJ7A 3BJ7A 2O4HA 2CNTA 2B4BA 5D8NA 5AGEA 2VEZA 1X10A 2ATRA 2WPXA 3SJEA 4HPSA 1BAVA 3BHXA 4ZX9A 4LQ6A 2PVWA 1YMEA 1XE4A 4M6HA 4LQGA 4IF5A 1XOVA 3SXOA 5FVJA 4NCZA 1SQHA 2PJAA 1OZPA 1PCAA 1Y9WA 4YU9A 1CX8A 2PJ2A 4C2ZA 3NE8A 5G22A 3FIXA 3TCVA 5LYFA 2VI7A 4UIBA 5A28A 2ZPAA 4JLYA 2PQ8A 4RI1A 4R7MA 1ARMA 1UFHA 4W9YA 1CP6A 2Q04A 3RZAA 4HNXB 4UF4A 1HDQA 1X12A 2ZW4A 1ZG8A 2GE3A 4PXBA 2ZEOA 2PJBA 2GFQA 4UFXA 1M4GA 1QSRA 2F5IA 2RFHA 5AG7A 2AFOA 1IB1E 2ZENA 1LAPA 2REFA 5CPAA 2GANA 2Q7SA 3KZWA 3PFEA 4ONWA 2G0BA 5HVFA 2FL4A 4NF1A 4OIDA 4XPDC 1ZLIA 4P4EA 3NH4A 3G3SA 3I1UA 5KTAA 2JEWA 2NSMA 4EVYA 4MHNA 2PJ0A 2GU2A 4H89A 2XEIA 4P6YA 4R57A 3PFOA 2FSRA 1TXRA 1YVKA 4CYQA 4OC4A 3VWEA 3LODA 1CP7A 2Z3KA 5K8PA 1I12A 4KVOE 1BLLE 1TKFA 1KUYA 3FVLA 2HC9A 4GS4A 4LUAA 4CRYB 2PJ5A 4DYOA 3V8IA 4CRZB 3JRUA 2K5TA 3H8GA 4PV6A 3R9EA 1IGBA 3PGPA 4PK3A 4AXVA 2ZEPA 4F9VA 3S9NA 1ZG9A 4B12A 3IWWA 4OMEA 4MY3A 1XIXA 1EE3P 3HUVA 2RB7A 2XEGA 2A4NA 2PRBA 4CGMA 2GIVA 3P2HA 4ORFA 5GCNA 4MCSA 4UIAA 3SJFA 1BPMA 1TF9A 1Q7LA 1XJOA 2BO9A 2B4DA 2B58A 2DEAA 3KQXA 1MJAA 1VKCA 1BO4A 5HVHA 1S7KA 1FT7A 2QJ8A 1QSNA 2B5GA 3TFYA 3R95A 2OOTA 4PQAA 1VGYA 2YNDA 4K3NA 5F48A 2Q4ZA 1QSTA 4JYWA 6CPAA 5IV0A 3QAHA 5F49A 5EC4A 4OC5A 4R3LA 1RTQA 3D7FA 4R6TA 2EUIA 3KR5A 5HH1A 2EVNA 5E96A 2JBJA 2WPWA 2AFMA 1B87A 2EBJA 3KR4A 2Q4VA 4UWJA 3PB8X 4CYOA 3UY5A 7CPAA 1ARLA 2PVVA 4AB7A 2Z3PA 1YR0A 1RXTA 2DPSA 2C1CA 1ELMP 3B3WA 4P4JA 4PXDA 4XPLA 4EMEA 3TO7A 4IAVA 4NGNA 4U5YA 3GYAA 2VL1A 2ZEDA 1KZFA 4X2TA 4FD4A 4MFZA 2FXFA 5JH9A 4CYPA 4P4BA 3F8KA 4Q7AA 1XRYA 1DE4C 2PJ8A 3D8PA 1F57A 4MI4A 4BINA 3GUXA 3JVNA 3PEIA 4E0AA 1Y7RA 3SXNA 3WABA 3FEEA 2D4OA 1QMUA 8CPAA 2YNCC 1A2ZA 1B6BA 2Q43A 2V8GA 2F7VA 2GLJA 3D7DA 4MBUA 1IYLA 2IL4A 3SJGA 2WUUA 2B4DB 4YRHA 4E2AA 1UWYA 3RNZA 4EWTA 4KLVA 1RO5A 4NGSA 3B7IA 4BBHA 1Q2CA 5F47A 2Q7BA 3SJXA 1CG2A 2JDCA 4QBJA 1Y7EA 1Z2LA 3OWCA 5K8OA 1LRZA 4MCRA 4KOXA 3DNSA 2AE6A 3EO4A 4UA3A 4ZX8A 2OR4A 3WR7A 1PU9A 1Z9UA 1JQGA 4CAXA 4R76A 2REEA 3FX6A 2NYQA 3V38A 3GB0A 1IY7A 3LMSA 3CDXA 3CXQA 2FS5A 3GLJA 3PB6X 4KLWA 4X8IA 2Q0YA 1Y0RA 1HDUA 2PJCA 1AUGA 3DDDA 5J1QA 3PB7X 3ZJ0A 2Q44A 3K2KA 2ZW7A 5JPHA 4NGMA 3FJUA 4M85A 1Z4RA 2F8HA 3KKWA 2ZW5A 4NFRA 2C6GA 4NSQA 1HEEA 3TT2A 4X5KA 5D29A 5LYLA 2HV2A 1S7LA 3EC4A 1LFWA 1QQ9A 4F6AA 2CXAA 1H8LA 3L2NA 2B3VA 3H8FA 2OH1A 3FXTA 1M1DA 4IUSA 3BJ8A 1TIQA 2POKA 4P44A 3D3SA 2ODFA 3SI1A 1ELLP 3FH4A 3D68A 3T9YA 5IB9A 2GLFA 4Y49B 4AVBA 2BEIA 1J4JA 1VHOA 1TKHA 3W91A 1YW4A 2ZEHA 1F2PA 3P2FA 2CTCA 3TOAA 2Y0MA 3MN8A 4M3SA 4DUKA 1PUAA 2AFXA 2FIAA 2AFSA 4KOTA 3TTHA 2CIJA 3KL9A 4AG7A 4K30A 3B3CA 3I9SA 4KZTA 4GXHA 1CBXA 2AJ6A 2WZNA 4TNUA 4F0XA 4AVAA 4QB9A 1WWZA 1XBUA 5LRKA 2YNEA 1NMTA 3SI0A 2ABZA 3PZJA 3F5BA 1YQEA 4MFPA 4OP4A 3F0AA 4OC1A 3FBUA 5AG4A 2ANPA 4KSFA 2Q51A 3BI0A 5JGFA 2OU2A 5I0CA 2HQYA 4JXRA 4JJXA 4MHZA 3S6KA 4B6ZA 3WT4A 4H6ZA 3T90A 3GKRA 1ZO0A 1I1DA 2ZEGA 3C26A 4MMOA 4MHPA 1S7NA 1IYKA 2CF4A 4FUUA 3S6FA 2PR8A 4JZ0A 3MGDA 3A9LA 3WC6A 3R9FA 2PSWA 4A31A 3B8GA 4U9YA 2EO8A 3T8WA 3QAYA 5JQ4A 1Y0YA 2BSWA 4PPZA 4CGNA 4B5OA 1XEBA 2P6FA 2WSAA 4ONUA 4B14A 4CAVA 2ZEFA 2I3CA 2JDDA 1Z8XA 2X7BA 5G20A 4RN7A 2FVGA 1Z5RA 4XPDB 2IMOA 2WYRA 2Z3NA 4U9ZA 3TO6A 4ZI6A 4ZYQA 2CTBA 3D2MA 3NH5A 1VIXA 3VATA 2VXKA 2ZOGA 4A32A 4KSAA 2V8VA 4I49A 4KUBA 4KOYA 5F46A 2XEJA 4B11A 4YFJA 2VQYA 3CT9A 1VHSA 4G1PA 1V0CA 3D2PA 3DR6A 3CXSA 1M4IA 3VARA 4A2ZA 2BOAA 1K4JA 4KOUA 2I00A 5LRJA 2P6GA 2ZEEA 4KS9A 4CGPA 2Z0ZA 3IIBA 4KVME 2Z3OA 3S6HA 1S5KA 4MHDA 4QC6A 2D4PA 4OKOA 4WJBA 5IX3A 5DS0A 5J8CA 2OZUA 2EK8A 4R87A 2ZOFA 1P0HA 4H6UA 3IGRA 4UFVA 2ZW6A 4ZY2A 4UEZA 1S3ZA 4MFKA 4OAEA 3FB3A 4MFQA 3TC8A 5THWA 4MRIA 3R9GA 2ZEMA 3IEHA 3RBUA 3IC1A 2Z10A 3IU1A 2P0WA 4UCNA 4NGTA 2R8VA 1CJWA 1R3NA 1XMBA 3DLJA 1MK4A 1Q2DA 2J8NA 3ISXA 5F09A 2OZGA 1KUXA 2PCUA 3K9UA 4MHYA 2PIZA 4C7IA 3BI1A 4B13A 3KHZA 3KI9A 2BUEA 1NSAA 1OBRA 3KHXA 2BL1A 3R1KA 1Z8TA 1XFOA 5G1ZA 2OZHA 3TO9A 3KGQA 2P6EA 4PK2A 1YSJA 5EMIA 3B3TA 5AG6A 4RUHA 3CZXA 4F0YA 5CBMA 4HKFA 2O28A 4UCPA 4AVCA 5IB0A 3IO1A 1CPSA 3PRTA 3KASA 2J9AA 3JUWA 2O53A 4BMHA 2DXQA 1ZLHA 3G8WA 5J8FA 2JEVA 3B3SA 1FNOA 5H86A 5ISVA 2HB6A 2PRQA 3FECA 5HMNA 2XEFA 4NGRA 3ISZA 4MFLA 1Q2YA 3VWDA 3B2YA 4EFDA 4R3KA 2CY2A 3D7HA 1KWMA 4L89A 4KOVA 4X3RA 3FEDA 4YWYA 4CPAA 4NEXA 4QVTA 3GIUA 4UBRA 4OADA 4GM5A 4R8FA 4LX9A 4A38A 3B35A 1FY7A 1QSOA 1YLOA 3JTKA 4MCQA 3QNVA 2R1IA 3E0KA 4XNHB 3RO0A 4B10A 1YK3A 2HUZA 2PDOA 4TWEA 2C6PA 2PJ6A 2DPTA 2JLMA 3D4UA 3NE7A 2QVPA 5AG5A 4OC3A 1LAMA 2PJ3A 3HLPA 4KVXA 1YGHA 3SI2A 3IFEA 4O23A 1L0CA 1IOIA 1S60A 4HNWB 4KSIA 2QMLA 4FWUA 1R43A 4A95A 3QB8A 1YLEA 3N5FA 4B5PB 2VZYA 1XMTA 4E8OA 1YREA 4MCPA 4Z65A 3FRMA 4NJQA 2IJZA 2NMTA 2FCKA 2J8MA 1GHEA 3EY5A 1F2OA 2G9DA 3H4QA 3BXMA 4OC0A 4P4DA 1QSMA 4P45A 1R57A 3N7ZA 4C68A 1MJ9A 2PJ1A 2RC4A 2PJ9A 3K9TA 4QUSA 4AG9A 1YW6A 2OB0A 2VZZA 4NGQA 4FD6A 5LRGA 1DTDA 5KTDA 4DNCA 3B3VA 4MFJA 4KOSA 5C82A 3EXNA 4UCMA 3WC5A 1IOFA 1ON0A 2IQ6A 3D7GA 3PBBA 1I21A 1PYTB 4M6IA 4WWVA 2CNMA 3H8EA 4C7HA 1KUVA 5HXDA 5A27A 3IWEA 4OLLA 3H5ZA 2C27A 4J3GA 2EK9A 2YGWA 3RAMA 5I4MA 3CPAA 4CAFA 4IHMA 4UFWA 3MRUA 4F9UA 4KORA 3S9MA 4BD9A 1U6MA 2BCOA 1BPNA 4PXCA 1M44A 5KTCA 5BWAB 5EBVA 3KQZA 4L8AA 3VH9A 3SHPA 2Q4YA 2V8DA 4OC2A
chains in the Genus database with same CATH topology
2PC1A 2R7HA 4FD5A 1IICA 2QECA 4Q38A 3TE4A 3FNCA 5DWMA 2ZXVA 1BOBA 5G21A 2Z11A 4XPKA 4PSXA 2QIRA 3DR8A 3PP9A 4PSWA 5CNPA 2FIWA 1Y9KA 4RS2A 4R9MA 4A30A 5C88A 1YVOA 4KOWA 1M4DA 3FYNA 1XF8A 3LD2A 1N71A 4CGLA 4YGOA 3S6GA 1Z4EA 4C2XA 3RYOA 2G3TA 2YNCA 3ZZIA 4CGOA 4FD7A 4ZBGA 3EFAA 4UWIA 4CS0B 2ARHA 5H84A 2B3UA 4KUAA 4MJ8A 4CYNA 3BLNA 3W6XA 4ZGYB 2J8RA 1CM0A 2KCWA 4B5PA 3GY9A 3TOBA 4A33A 2CNSA 4MY0A 4JWPA 1NSLA 3W6SA 2I79A 4II9A 1IIDA 4JD6A 4CAEA 1P4NA 3IWGA 2FE7A 2VBQA 1NE9A 2G3AA 4XNHC 1WK4A 3CXPA 4CAWA 5DWNA 2Z3LA 2FT0A 4HNYB 3IU2A 1YX0A 4Y49C 1S7FA 4NXYA 4Q36A 3I3GA 2PR1A 4JXQA 3R96A 1MJBA 2B5GB 4C2YA 2Z3MA 2H5MA 2R98A 3DSBA 3BJ7A 2CNTA 2B4BA 5AGEA 2VEZA 2WPXA 2ATRA 1XE4A 4IF5A 3SXOA 5FVJA 4NCZA 1SQHA 1OZPA 1Y9WA 4C2ZA 5G22A 3FIXA 3TCVA 2VI7A 5A28A 2ZPAA 4JLYA 2PQ8A 4RI1A 1UFHA 2Q04A 4HNXB 2ZW4A 2GE3A 4UFXA 1M4GA 1QSRA 2F5IA 5AG7A 1IB1E 2REFA 2GANA 2G0BA 2FL4A 4NF1A 4XPDC 3G3SA 5KTAA 4EVYA 4H89A 4R57A 2FSRA 1YVKA 4CYQA 3VWEA 3LODA 2Z3KA 1I12A 4KVOE 4LUAA 1KUYA 4CRYB 4GS4A 3V8IA 4CRZB 2K5TA 4PV6A 3R9EA 3PGPA 4PK3A 4B12A 4MY3A 1XIXA 2A4NA 2PRBA 4CGMA 2GIVA 3P2HA 4ORFA 5GCNA 2B4DA 2B58A 1MJAA 1VKCA 1BO4A 1S7KA 1QSNA 2B5GA 3TFYA 3R95A 5IV0A 2YNDA 5F48A 1QSTA 3QAHA 5F49A 5EC4A 4R3LA 2EUIA 5HH1A 2EVNA 5E96A 2WPWA 1B87A 2Q4VA 4UWJA 4CYOA 3UY5A 4AB7A 2Z3PA 1YR0A 1RXTA 2DPSA 4XPLA 3TO7A 4U5YA 3GYAA 1KZFA 4FD4A 4MFZA 2FXFA 4CYPA 3F8KA 3D8PA 4MI4A 4E0AA 3JVNA 1Y7RA 3SXNA 2D4OA 2YNCC 1B6BA 4MBUA 1IYLA 2IL4A 2WUUA 2B4DB 4YRHA 4E2AA 4KLVA 1RO5A 4BBHA 1Q2CA 5F47A 2Q7BA 2JDCA 4QBJA 3OWCA 1LRZA 4KOXA 3DNSA 2AE6A 3EO4A 4UA3A 3WR7A 1PU9A 1Z9UA 4CAXA 2REEA 3CXQA 4KLWA 2FS5A 2Q0YA 3DDDA 3ZJ0A 2Q44A 5JPHA 2ZW7A 4M85A 1Z4RA 4NSQA 3KKWA 2ZW5A 3TT2A 4X5KA 2HV2A 1S7LA 3EC4A 4F6AA 2CXAA 2B3VA 2OH1A 3FXTA 1M1DA 4IUSA 3BJ8A 1TIQA 3D3SA 3T9YA 4Y49B 4AVBA 2BEIA 1J4JA 3W91A 3P2FA 3TOAA 2Y0MA 4M3SA 1PUAA 2FIAA 4KOTA 3TTHA 4AG7A 4K30A 3I9SA 4KZTA 2AJ6A 4F0XA 4AVAA 4QB9A 1WWZA 2YNEA 1NMTA 3PZJA 3F5BA 4MFPA 3F0AA 3FBUA 5AG4A 4KSFA 2OU2A 5I0CA 2HQYA 4JXRA 4JJXA 3S6KA 4H6ZA 3T90A 3GKRA 1ZO0A 1I1DA 3C26A 1S7NA 1IYKA 3S6FA 2PR8A 4A31A 3MGDA 3A9LA 3R9FA 2PSWA 3B8GA 4U9YA 5JQ4A 2BSWA 4CGNA 4B5OA 1XEBA 2P6FA 2WSAA 4ONUA 4B14A 4CAVA 2JDDA 2X7BA 5G20A 4XPDB 2Z3NA 4U9ZA 3TO6A 3D2MA 2VXKA 4A32A 4KSAA 4I49A 4KUBA 4KOYA 5F46A 4B11A 4YFJA 2VQYA 1VHSA 1V0CA 3D2PA 3DR6A 3CXSA 1M4IA 4A2ZA 1K4JA 4KOUA 2I00A 2P6GA 4KS9A 4CGPA 2Z0ZA 4KVME 2Z3OA 3S6HA 1S5KA 4MHDA 4QC6A 2D4PA 5IX3A 5J8CA 2OZUA 4R87A 1P0HA 4H6UA 3IGRA 4UFVA 2ZW6A 1S3ZA 4MFKA 4OAEA 3FB3A 4MFQA 3R9GA 2Z10A 3IU1A 2P0WA 4UCNA 2R8VA 1CJWA 1MK4A 1Q2DA 2J8NA 2OZGA 1KUXA 3K9UA 4C7IA 4B13A 2BUEA 3R1KA 2BL1A 5G1ZA 2OZHA 3TO9A 2P6EA 4PK2A 5AG6A 4F0YA 4HKFA 2O28A 4UCPA 4AVCA 5IB0A 3JUWA 4BMHA 2DXQA 3G8WA 5J8FA 2JEVA 5H86A 5ISVA 5HMNA 4MFLA 1Q2YA 3VWDA 4R3KA 2CY2A 4L89A 4KOVA 4NEXA 4QVTA 4UBRA 4OADA 4LX9A 3JTKA 1FY7A 1QSOA 4XNHB 2R1IA 3E0KA 4B10A 1YK3A 2HUZA 2PDOA 2DPTA 2JLMA 3NE7A 5AG5A 4KVXA 1YGHA 1L0CA 1S60A 4HNWB 4A95A 2QMLA 3QB8A 1YLEA 4B5PB 4E8OA 2VZYA 1XMTA 1YREA 3FRMA 2NMTA 2FCKA 2J8MA 1GHEA 3EY5A 3H4QA 1QSMA 1R57A 3N7ZA 4C68A 1MJ9A 2RC4A 4QUSA 4AG9A 2OB0A 2VZZA 4FD6A 5KTDA 4DNCA 4MFJA 4KOSA 5C82A 3EXNA 4UCMA 1ON0A 1I21A 4C7HA 2CNMA 1KUVA 5A27A 3IWEA 4OLLA 4J3GA 3H5ZA 2C27A 2YGWA 4CAFA 4UFWA 4KORA 1U6MA 1M44A 5KTCA 5BWAB 5EBVA 4L8AA 3SHPA 2Q4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PC1 A;  2R7H A;  4FD5 A;  1IIC A;  2QEC A;  3TE4 A;  3FNC A;  5DWM A;  2ZXV A;  1BOB A;  2Z11 A;  4XPK A;  4PSX A;  2QIR A;  3DR8 A;  3PP9 A;  4PSW A;  5CNP A;  2FIW A;  1Y9K A;  4RS2 A;  4R9M A;  5C88 A;  1YVO A;  4KOW A;  1M4D A;  3FYN A;  1XF8 A;  3LD2 A;  1N71 A;  4YGO A;  3S6G A;  1Z4E A;  3RYO A;  2G3T A;  3ZZI A;  4FD7 A;  4ZBG A;  3EFA A;  4UWI A;  4CS0 B;  2ARH A;  5H84 A;  2B3U A;  4KUA A;  4MJ8 A;  3BLN A;  3W6X A;  2J8R A;  1CM0 A;  2KCW A;  4B5P A;  3GY9 A;  3TOB A;  2CNS A;  4MY0 A;  4JWP A;  1NSL A;  3W6S A;  2I79 A;  4II9 A;  1IID A;  4JD6 A;  1P4N A;  3IWG A;  2FE7 A;  2VBQ A;  1NE9 A;  2G3A A;  4XNH C;  1WK4 A;  3CXP A;  4CAW A;  5DWN A;  2FT0 A;  4HNY B;  1YX0 A;  4Y49 C;  1S7F A;  4NXY A;  3I3G A;  2PR1 A;  4JXQ A;  3R96 A;  1MJB A;  2B5G B;  2H5M A;  2R98 A;  3DSB A;  3BJ7 A;  2CNT A;  2B4B A;  2VEZ A;  2WPX A;  2ATR A;  1XE4 A;  4IF5 A;  3SXO A;  5FVJ A;  4NCZ A;  1SQH A;  1OZP A;  1Y9W A;  3TCV A;  3FIX A;  2VI7 A;  2ZPA A;  4JLY A;  2PQ8 A;  4RI1 A;  1UFH A;  2Q04 A;  4HNX B;  2ZW4 A;  2GE3 A;  1M4G A;  1QSR A;  2F5I A;  1IB1 E;  2REF A;  2GAN A;  2G0B A;  2FL4 A;  4NF1 A;  4XPD C;  3G3S A;  5KTA A;  4EVY A;  4H89 A;  4R57 A;  2FSR A;  1YVK A;  3VWE A;  3LOD A;  1I12 A;  4KVO E;  4LUA A;  1KUY A;  4CRY B;  4GS4 A;  3V8I A;  4CRZ B;  2K5T A;  4PV6 A;  3R9E A;  3PGP A;  4PK3 A;  4MY3 A;  1XIX A;  2A4N A;  2PRB A;  2GIV A;  3P2H A;  4ORF A;  5GCN A;  2B4D A;  2B58 A;  1MJA A;  1VKC A;  1BO4 A;  1S7K A;  1QSN A;  2B5G A;  3TFY A;  3R95 A;  5IV0 A;  5F48 A;  1QST A;  3QAH A;  5F49 A;  5EC4 A;  4R3L A;  2EUI A;  5HH1 A;  2EVN A;  5E96 A;  2WPW A;  1B87 A;  2Q4V A;  4UWJ A;  3UY5 A;  4AB7 A;  1YR0 A;  1RXT A;  4XPL A;  3TO7 A;  4U5Y A;  3GYA A;  1KZF A;  4FD4 A;  2FXF A;  3F8K A;  3D8P A;  4MI4 A;  4E0A A;  3JVN A;  1Y7R A;  3SXN A;  2D4O A;  1B6B A;  4MBU A;  1IYL A;  2IL4 A;  2B4D B;  4YRH A;  4E2A A;  4KLV A;  1RO5 A;  1Q2C A;  5F47 A;  2Q7B A;  2JDC A;  4QBJ A;  3OWC A;  1LRZ A;  4KOX A;  3DNS A;  2AE6 A;  3EO4 A;  4UA3 A;  3WR7 A;  1PU9 A;  1Z9U A;  4CAX A;  2REE A;  3CXQ A;  4KLW A;  2FS5 A;  2Q0Y A;  3DDD A;  3ZJ0 A;  2Q44 A;  5JPH A;  2ZW7 A;  4M85 A;  1Z4R A;  4NSQ A;  3KKW A;  2ZW5 A;  3TT2 A;  4X5K A;  2HV2 A;  1S7L A;  3EC4 A;  4F6A A;  2B3V A;  2OH1 A;  3FXT A;  1M1D A;  4IUS A;  3BJ8 A;  1TIQ A;  3D3S A;  3T9Y A;  4Y49 B;  4AVB A;  2BEI A;  1J4J A;  3W91 A;  3P2F A;  3TOA A;  2Y0M A;  4M3S A;  1PUA A;  2FIA A;  4KOT A;  3TTH A;  4AG7 A;  4K30 A;  3I9S A;  4KZT A;  2AJ6 A;  4AVA A;  4QB9 A;  1WWZ A;  1NMT A;  3PZJ A;  3F5B A;  3F0A A;  3FBU A;  2OU2 A;  5I0C A;  2HQY A;  4JXR A;  4JJX A;  3S6K A;  4H6Z A;  3T90 A;  3GKR A;  1I1D A;  3C26 A;  1S7N A;  1IYK A;  3S6F A;  2PR8 A;  3MGD A;  3R9F A;  2PSW A;  3B8G A;  4U9Y A;  5JQ4 A;  2BSW A;  4B5O A;  1XEB A;  2P6F A;  4CAV A;  4ONU A;  2JDD A;  2X7B A;  4XPD B;  4U9Z A;  3TO6 A;  3D2M A;  2VXK A;  4I49 A;  4KUB A;  4KOY A;  5F46 A;  4YFJ A;  2VQY A;  1VHS A;  1V0C A;  3D2P A;  3DR6 A;  3CXS A;  1M4I A;  1K4J A;  4KOU A;  2I00 A;  2P6G A;  2Z0Z A;  4KVM E;  3S6H A;  1S5K A;  4MHD A;  4QC6 A;  2D4P A;  5IX3 A;  5J8C A;  2OZU A;  4R87 A;  1P0H A;  4H6U A;  3IGR A;  2ZW6 A;  1S3Z A;  4OAE A;  3FB3 A;  3R9G A;  2Z10 A;  2P0W A;  2R8V A;  1CJW A;  1MK4 A;  1Q2D A;  2J8N A;  2OZG A;  1KUX A;  3K9U A;  2BUE A;  3R1K A;  2BL1 A;  2OZH A;  3TO9 A;  2P6E A;  4PK2 A;  4F0Y A;  4HKF A;  2O28 A;  4AVC A;  5IB0 A;  3JUW A;  4BMH A;  2DXQ A;  3G8W A;  5J8F A;  2JEV A;  5H86 A;  5ISV A;  5HMN A;  1Q2Y A;  3VWD A;  4R3K A;  2CY2 A;  4L89 A;  4KOV A;  4NEX A;  4QVT A;  4UBR A;  4OAD A;  4LX9 A;  1FY7 A;  1QSO A;  4XNH B;  2R1I A;  3E0K A;  1YK3 A;  2HUZ A;  2PDO A;  2JLM A;  3NE7 A;  4KVX A;  1YGH A;  1L0C A;  1S60 A;  4HNW B;  2QML A;  3QB8 A;  1YLE A;  4B5P B;  4E8O A;  2VZY A;  1XMT A;  1YRE A;  3FRM A;  2NMT A;  2FCK A;  2J8M A;  1GHE A;  3EY5 A;  3H4Q A;  1QSM A;  1R57 A;  3N7Z A;  1MJ9 A;  2RC4 A;  4QUS A;  4AG9 A;  2OB0 A;  2VZZ A;  4FD6 A;  5KTD A;  4DNC A;  4KOS A;  5C82 A;  3EXN A;  1ON0 A;  1I21 A;  2CNM A;  1KUV A;  4OLL A;  4J3G A;  2C27 A;  4KOR A;  1U6M A;  1M44 A;  5KTC A;  5EBV A;  4L8A A;  3SHP A;  2Q4Y A; 
#chains in the Genus database with same CATH topology
 2V8H A;  2PC1 A;  2R7H A;  4UEE A;  4FD5 A;  1TKJ A;  1IIC A;  2QEC A;  4Q38 A;  3TE4 A;  3DGV A;  2AFZ A;  3FNC A;  5DWM A;  2ZXV A;  1BOB A;  3NH8 A;  5G21 A;  1Z8L A;  2Z11 A;  5JM6 A;  4XPK A;  4PSX A;  2QIR A;  3DR8 A;  4OIW A;  3TX8 A;  3PP9 A;  1VHE A;  3D66 A;  1CPX A;  3IJ3 A;  3NFZ A;  4P4F A;  4PSW A;  1TF8 A;  5CNP A;  4F8Z A;  2FIW A;  1Y9K A;  4RS2 A;  4ZY0 A;  4PXE A;  4R9M A;  4H2K A;  4A30 A;  5C88 A;  2PJ4 A;  1YVO A;  4KOW A;  1ZG7 A;  1M4D A;  3FYN A;  3FMC A;  3PB4 X;  1XF8 A;  3LD2 A;  4FAI A;  1N71 A;  4CGL A;  2ZEL A;  3WC7 A;  4M6G A;  4P10 A;  2DF5 A;  4YGO A;  3S6G A;  1Z4E A;  4A94 A;  4C2X A;  3RYO A;  1GYT A;  2G3T A;  3S9L A;  2YNC A;  1LOK A;  3ZZI A;  4CGO A;  2EWB A;  2GRE A;  4FD7 A;  1IU8 A;  3EFA A;  4UWI A;  4ZBG A;  3CPX A;  2ARH A;  4CS0 B;  5H84 A;  2B3U A;  5LYD A;  4KUA A;  4MJ8 A;  4MXU A;  4CYN A;  3BLN A;  3W6X A;  4UEF A;  2AFW A;  4ZGY B;  2J8R A;  3D67 A;  1CM0 A;  3V7Z A;  2KCW A;  4A39 A;  4B5P A;  1AYE A;  3GY9 A;  3TOB A;  3FF3 A;  4A33 A;  2CNS A;  4MY0 A;  4JWP A;  1NSL A;  4FBE A;  1M4L A;  3W6S A;  5ELY A;  2I79 A;  4II9 A;  1IID A;  4NJR A;  3PB9 X;  1LAN A;  4A37 A;  5LYI A;  4JD6 A;  4CAE A;  1P4N A;  3IWG A;  2AFU A;  2FE7 A;  2VBQ A;  4P4I A;  1NE9 A;  2G3A A;  4XNH C;  1WK4 A;  2QYV A;  3CXP A;  4CAW A;  4ZY1 A;  5DWN A;  4DJL A;  1JWQ A;  2Z3L A;  3PBE A;  2FT0 A;  2V77 A;  4HNY B;  5K8M A;  1AMP A;  1Z8W A;  2JBK A;  3IU2 A;  1YX0 A;  4Y49 C;  1S7F A;  1LCP A;  5HVG A;  2PE3 A;  3LWU A;  4NXY A;  4Q36 A;  3I3G A;  2PR1 A;  4JXQ A;  3R96 A;  5K8N A;  2PIY A;  1MJB A;  4IK2 A;  2C6C A;  3LAC A;  2B5G B;  4C2Y A;  2Z3M A;  2H5M A;  2R98 A;  3DSB A;  4NGP A;  3NA6 A;  2PJ7 A;  3BJ7 A;  2O4H A;  2CNT A;  2B4B A;  5D8N A;  5AGE A;  2VEZ A;  1X10 A;  2ATR A;  2WPX A;  3SJE A;  4HPS A;  1BAV A;  3BHX A;  4ZX9 A;  4LQ6 A;  2PVW A;  1YME A;  1XE4 A;  4M6H A;  4LQG A;  4IF5 A;  1XOV A;  3SXO A;  5FVJ A;  4NCZ A;  1SQH A;  2PJA A;  1OZP A;  1PCA A;  1Y9W A;  4YU9 A;  1CX8 A;  2PJ2 A;  4C2Z A;  3NE8 A;  5G22 A;  3FIX A;  3TCV A;  5LYF A;  2VI7 A;  4UIB A;  5A28 A;  2ZPA A;  4JLY A;  2PQ8 A;  4RI1 A;  4R7M A;  1ARM A;  1UFH A;  4W9Y A;  1CP6 A;  2Q04 A;  3RZA A;  4HNX B;  4UF4 A;  1HDQ A;  1X12 A;  2ZW4 A;  1ZG8 A;  2GE3 A;  4PXB A;  2ZEO A;  2PJB A;  2GFQ A;  4UFX A;  1M4G A;  1QSR A;  2F5I A;  2RFH A;  5AG7 A;  2AFO A;  1IB1 E;  2ZEN A;  1LAP A;  2REF A;  5CPA A;  2GAN A;  2Q7S A;  3KZW A;  3PFE A;  4ONW A;  2G0B A;  5HVF A;  2FL4 A;  4NF1 A;  4OID A;  4XPD C;  1ZLI A;  4P4E A;  3NH4 A;  3G3S A;  3I1U A;  5KTA A;  2JEW A;  2NSM A;  4EVY A;  4MHN A;  2PJ0 A;  2GU2 A;  4H89 A;  2XEI A;  4P6Y A;  4R57 A;  3PFO A;  2FSR A;  1TXR A;  1YVK A;  4CYQ A;  4OC4 A;  3VWE A;  3LOD A;  1CP7 A;  2Z3K A;  5K8P A;  1I12 A;  4KVO E;  1BLL E;  1TKF A;  1KUY A;  3FVL A;  2HC9 A;  4GS4 A;  4LUA A;  4CRY B;  2PJ5 A;  4DYO A;  3V8I A;  4CRZ B;  3JRU A;  2K5T A;  3H8G A;  4PV6 A;  3R9E A;  1IGB A;  3PGP A;  4PK3 A;  4AXV A;  2ZEP A;  4F9V A;  3S9N A;  1ZG9 A;  4B12 A;  3IWW A;  4OME A;  4MY3 A;  1XIX A;  1EE3 P;  3HUV A;  2RB7 A;  2XEG A;  2A4N A;  2PRB A;  4CGM A;  2GIV A;  3P2H A;  4ORF A;  5GCN A;  4MCS A;  4UIA A;  3SJF A;  1BPM A;  1TF9 A;  1Q7L A;  1XJO A;  2BO9 A;  2B4D A;  2B58 A;  2DEA A;  3KQX A;  1MJA A;  1VKC A;  1BO4 A;  5HVH A;  1S7K A;  1FT7 A;  2QJ8 A;  1QSN A;  2B5G A;  3TFY A;  3R95 A;  2OOT A;  4PQA A;  1VGY A;  2YND A;  4K3N A;  5F48 A;  2Q4Z A;  1QST A;  4JYW A;  6CPA A;  5IV0 A;  3QAH A;  5F49 A;  5EC4 A;  4OC5 A;  4R3L A;  1RTQ A;  3D7F A;  4R6T A;  2EUI A;  3KR5 A;  5HH1 A;  2EVN A;  5E96 A;  2JBJ A;  2WPW A;  2AFM A;  1B87 A;  2EBJ A;  3KR4 A;  2Q4V A;  4UWJ A;  3PB8 X;  4CYO A;  3UY5 A;  7CPA A;  1ARL A;  2PVV A;  4AB7 A;  2Z3P A;  1YR0 A;  1RXT A;  2DPS A;  2C1C A;  1ELM P;  3B3W A;  4P4J A;  4PXD A;  4XPL A;  4EME A;  3TO7 A;  4IAV A;  4NGN A;  4U5Y A;  3GYA A;  2VL1 A;  2ZED A;  1KZF A;  4X2T A;  4FD4 A;  4MFZ A;  2FXF A;  5JH9 A;  4CYP A;  4P4B A;  3F8K A;  4Q7A A;  1XRY A;  1DE4 C;  2PJ8 A;  3D8P A;  1F57 A;  4MI4 A;  4BIN A;  3GUX A;  3JVN A;  3PEI A;  4E0A A;  1Y7R A;  3SXN A;  3WAB A;  3FEE A;  2D4O A;  1QMU A;  8CPA A;  2YNC C;  1A2Z A;  1B6B A;  2Q43 A;  2V8G A;  2F7V A;  2GLJ A;  3D7D A;  4MBU A;  1IYL A;  2IL4 A;  3SJG A;  2WUU A;  2B4D B;  4YRH A;  4E2A A;  1UWY A;  3RNZ A;  4EWT A;  4KLV A;  1RO5 A;  4NGS A;  3B7I A;  4BBH A;  1Q2C A;  5F47 A;  2Q7B A;  3SJX A;  1CG2 A;  2JDC A;  4QBJ A;  1Y7E A;  1Z2L A;  3OWC A;  5K8O A;  1LRZ A;  4MCR A;  4KOX A;  3DNS A;  2AE6 A;  3EO4 A;  4UA3 A;  4ZX8 A;  2OR4 A;  3WR7 A;  1PU9 A;  1Z9U A;  1JQG A;  4CAX A;  4R76 A;  2REE A;  3FX6 A;  2NYQ A;  3V38 A;  3GB0 A;  1IY7 A;  3LMS A;  3CDX A;  3CXQ A;  2FS5 A;  3GLJ A;  3PB6 X;  4KLW A;  4X8I A;  2Q0Y A;  1Y0R A;  1HDU A;  2PJC A;  1AUG A;  3DDD A;  5J1Q A;  3PB7 X;  3ZJ0 A;  2Q44 A;  3K2K A;  2ZW7 A;  5JPH A;  4NGM A;  3FJU A;  4M85 A;  1Z4R A;  2F8H A;  3KKW A;  2ZW5 A;  4NFR A;  2C6G A;  4NSQ A;  1HEE A;  3TT2 A;  4X5K A;  5D29 A;  5LYL A;  2HV2 A;  1S7L A;  3EC4 A;  1LFW A;  1QQ9 A;  4F6A A;  2CXA A;  1H8L A;  3L2N A;  2B3V A;  3H8F A;  2OH1 A;  3FXT A;  1M1D A;  4IUS A;  3BJ8 A;  1TIQ A;  2POK A;  4P44 A;  3D3S A;  2ODF A;  3SI1 A;  1ELL P;  3FH4 A;  3D68 A;  3T9Y A;  5IB9 A;  2GLF A;  4Y49 B;  4AVB A;  2BEI A;  1J4J A;  1VHO A;  1TKH A;  3W91 A;  1YW4 A;  2ZEH A;  1F2P A;  3P2F A;  2CTC A;  3TOA A;  2Y0M A;  3MN8 A;  4M3S A;  4DUK A;  1PUA A;  2AFX A;  2FIA A;  2AFS A;  4KOT A;  3TTH A;  2CIJ A;  3KL9 A;  4AG7 A;  4K30 A;  3B3C A;  3I9S A;  4KZT A;  4GXH A;  1CBX A;  2AJ6 A;  2WZN A;  4TNU A;  4F0X A;  4AVA A;  4QB9 A;  1WWZ A;  1XBU A;  5LRK A;  2YNE A;  1NMT A;  3SI0 A;  2ABZ A;  3PZJ A;  3F5B A;  1YQE A;  4MFP A;  4OP4 A;  3F0A A;  4OC1 A;  3FBU A;  5AG4 A;  2ANP A;  4KSF A;  2Q51 A;  3BI0 A;  5JGF A;  2OU2 A;  5I0C A;  2HQY A;  4JXR A;  4JJX A;  4MHZ A;  3S6K A;  4B6Z A;  3WT4 A;  4H6Z A;  3T90 A;  3GKR A;  1ZO0 A;  1I1D A;  2ZEG A;  3C26 A;  4MMO A;  4MHP A;  1S7N A;  1IYK A;  2CF4 A;  4FUU A;  3S6F A;  2PR8 A;  4JZ0 A;  3MGD A;  3A9L A;  3WC6 A;  3R9F A;  2PSW A;  4A31 A;  3B8G A;  4U9Y A;  2EO8 A;  3T8W A;  3QAY A;  5JQ4 A;  1Y0Y A;  2BSW A;  4PPZ A;  4CGN A;  4B5O A;  1XEB A;  2P6F A;  2WSA A;  4ONU A;  4B14 A;  4CAV A;  2ZEF A;  2I3C A;  2JDD A;  1Z8X A;  2X7B A;  5G20 A;  4RN7 A;  2FVG A;  1Z5R A;  4XPD B;  2IMO A;  2WYR A;  2Z3N A;  4U9Z A;  3TO6 A;  4ZI6 A;  4ZYQ A;  2CTB A;  3D2M A;  3NH5 A;  1VIX A;  3VAT A;  2VXK A;  2ZOG A;  4A32 A;  4KSA A;  2V8V A;  4I49 A;  4KUB A;  4KOY A;  5F46 A;  2XEJ A;  4B11 A;  4YFJ A;  2VQY A;  3CT9 A;  1VHS A;  4G1P A;  1V0C A;  3D2P A;  3DR6 A;  3CXS A;  1M4I A;  3VAR A;  4A2Z A;  2BOA A;  1K4J A;  4KOU A;  2I00 A;  5LRJ A;  2P6G A;  2ZEE A;  4KS9 A;  4CGP A;  2Z0Z A;  3IIB A;  4KVM E;  2Z3O A;  3S6H A;  1S5K A;  4MHD A;  4QC6 A;  2D4P A;  4OKO A;  4WJB A;  5IX3 A;  5DS0 A;  5J8C A;  2OZU A;  2EK8 A;  4R87 A;  2ZOF A;  1P0H A;  4H6U A;  3IGR A;  4UFV A;  2ZW6 A;  4ZY2 A;  4UEZ A;  1S3Z A;  4MFK A;  4OAE A;  3FB3 A;  4MFQ A;  3TC8 A;  5THW A;  4MRI A;  3R9G A;  2ZEM A;  3IEH A;  3RBU A;  3IC1 A;  2Z10 A;  3IU1 A;  2P0W A;  4UCN A;  4NGT A;  2R8V A;  1CJW A;  1R3N A;  1XMB A;  3DLJ A;  1MK4 A;  1Q2D A;  2J8N A;  3ISX A;  5F09 A;  2OZG A;  1KUX A;  2PCU A;  3K9U A;  4MHY A;  2PIZ A;  4C7I A;  3BI1 A;  4B13 A;  3KHZ A;  3KI9 A;  2BUE A;  1NSA A;  1OBR A;  3KHX A;  2BL1 A;  3R1K A;  1Z8T A;  1XFO A;  5G1Z A;  2OZH A;  3TO9 A;  3KGQ A;  2P6E A;  4PK2 A;  1YSJ A;  5EMI A;  3B3T A;  5AG6 A;  4RUH A;  3CZX A;  4F0Y A;  5CBM A;  4HKF A;  2O28 A;  4UCP A;  4AVC A;  5IB0 A;  3IO1 A;  1CPS A;  3PRT A;  3KAS A;  2J9A A;  3JUW A;  2O53 A;  4BMH A;  2DXQ A;  1ZLH A;  3G8W A;  5J8F A;  2JEV A;  3B3S A;  1FNO A;  5H86 A;  5ISV A;  2HB6 A;  2PRQ A;  3FEC A;  5HMN A;  2XEF A;  4NGR A;  3ISZ A;  4MFL A;  1Q2Y A;  3VWD A;  3B2Y A;  4EFD A;  4R3K A;  2CY2 A;  3D7H A;  1KWM A;  4L89 A;  4KOV A;  4X3R A;  3FED A;  4YWY A;  4CPA A;  4NEX A;  4QVT A;  3GIU A;  4UBR A;  4OAD A;  4GM5 A;  4R8F A;  4LX9 A;  4A38 A;  3B35 A;  1FY7 A;  1QSO A;  1YLO A;  3JTK A;  4MCQ A;  3QNV A;  2R1I A;  3E0K A;  4XNH B;  3RO0 A;  4B10 A;  1YK3 A;  2HUZ A;  2PDO A;  4TWE A;  2C6P A;  2PJ6 A;  2DPT A;  2JLM A;  3D4U A;  3NE7 A;  2QVP A;  5AG5 A;  4OC3 A;  1LAM A;  2PJ3 A;  3HLP A;  4KVX A;  1YGH A;  3SI2 A;  3IFE A;  4O23 A;  1L0C A;  1IOI A;  1S60 A;  4HNW B;  4KSI A;  2QML A;  4FWU A;  1R43 A;  4A95 A;  3QB8 A;  1YLE A;  3N5F A;  4B5P B;  2VZY A;  1XMT A;  4E8O A;  1YRE A;  4MCP A;  4Z65 A;  3FRM A;  4NJQ A;  2IJZ A;  2NMT A;  2FCK A;  2J8M A;  1GHE A;  3EY5 A;  1F2O A;  2G9D A;  3H4Q A;  3BXM A;  4OC0 A;  4P4D A;  1QSM A;  4P45 A;  1R57 A;  3N7Z A;  4C68 A;  1MJ9 A;  2PJ1 A;  2RC4 A;  2PJ9 A;  3K9T A;  4QUS A;  4AG9 A;  1YW6 A;  2OB0 A;  2VZZ A;  4NGQ A;  4FD6 A;  5LRG A;  1DTD A;  5KTD A;  4DNC A;  3B3V A;  4MFJ A;  4KOS A;  5C82 A;  3EXN A;  4UCM A;  3WC5 A;  1IOF A;  1ON0 A;  2IQ6 A;  3D7G A;  3PBB A;  1I21 A;  1PYT B;  4M6I A;  4WWV A;  2CNM A;  3H8E A;  4C7H A;  1KUV A;  5HXD A;  5A27 A;  3IWE A;  4OLL A;  3H5Z A;  2C27 A;  4J3G A;  2EK9 A;  2YGW A;  3RAM A;  5I4M A;  3CPA A;  4CAF A;  4IHM A;  4UFW A;  3MRU A;  4F9U A;  4KOR A;  3S9M A;  4BD9 A;  1U6M A;  2BCO A;  1BPN A;  4PXC A;  1M44 A;  5KTC A;  5BWA B;  5EBV A;  3KQZ A;  4L8A A;  3VH9 A;  3SHP A;  2Q4Y A;  2V8D A;  4OC2 A; 
#chains in the Genus database with same CATH homology
 2PC1 A;  2R7H A;  4FD5 A;  1IIC A;  2QEC A;  4Q38 A;  3TE4 A;  3FNC A;  5DWM A;  2ZXV A;  1BOB A;  5G21 A;  2Z11 A;  4XPK A;  4PSX A;  2QIR A;  3DR8 A;  3PP9 A;  4PSW A;  5CNP A;  2FIW A;  1Y9K A;  4RS2 A;  4R9M A;  4A30 A;  5C88 A;  1YVO A;  4KOW A;  1M4D A;  3FYN A;  1XF8 A;  3LD2 A;  1N71 A;  4CGL A;  4YGO A;  3S6G A;  1Z4E A;  4C2X A;  3RYO A;  2G3T A;  2YNC A;  3ZZI A;  4CGO A;  4FD7 A;  4ZBG A;  3EFA A;  4UWI A;  4CS0 B;  2ARH A;  5H84 A;  2B3U A;  4KUA A;  4MJ8 A;  4CYN A;  3BLN A;  3W6X A;  4ZGY B;  2J8R A;  1CM0 A;  2KCW A;  4B5P A;  3GY9 A;  3TOB A;  4A33 A;  2CNS A;  4MY0 A;  4JWP A;  1NSL A;  3W6S A;  2I79 A;  4II9 A;  1IID A;  4JD6 A;  4CAE A;  1P4N A;  3IWG A;  2FE7 A;  2VBQ A;  1NE9 A;  2G3A A;  4XNH C;  1WK4 A;  3CXP A;  4CAW A;  5DWN A;  2Z3L A;  2FT0 A;  4HNY B;  3IU2 A;  1YX0 A;  4Y49 C;  1S7F A;  4NXY A;  4Q36 A;  3I3G A;  2PR1 A;  4JXQ A;  3R96 A;  1MJB A;  2B5G B;  4C2Y A;  2Z3M A;  2H5M A;  2R98 A;  3DSB A;  3BJ7 A;  2CNT A;  2B4B A;  5AGE A;  2VEZ A;  2WPX A;  2ATR A;  1XE4 A;  4IF5 A;  3SXO A;  5FVJ A;  4NCZ A;  1SQH A;  1OZP A;  1Y9W A;  4C2Z A;  5G22 A;  3FIX A;  3TCV A;  2VI7 A;  5A28 A;  2ZPA A;  4JLY A;  2PQ8 A;  4RI1 A;  1UFH A;  2Q04 A;  4HNX B;  2ZW4 A;  2GE3 A;  4UFX A;  1M4G A;  1QSR A;  2F5I A;  5AG7 A;  1IB1 E;  2REF A;  2GAN A;  2G0B A;  2FL4 A;  4NF1 A;  4XPD C;  3G3S A;  5KTA A;  4EVY A;  4H89 A;  4R57 A;  2FSR A;  1YVK A;  4CYQ A;  3VWE A;  3LOD A;  2Z3K A;  1I12 A;  4KVO E;  4LUA A;  1KUY A;  4CRY B;  4GS4 A;  3V8I A;  4CRZ B;  2K5T A;  4PV6 A;  3R9E A;  3PGP A;  4PK3 A;  4B12 A;  4MY3 A;  1XIX A;  2A4N A;  2PRB A;  4CGM A;  2GIV A;  3P2H A;  4ORF A;  5GCN A;  2B4D A;  2B58 A;  1MJA A;  1VKC A;  1BO4 A;  1S7K A;  1QSN A;  2B5G A;  3TFY A;  3R95 A;  5IV0 A;  2YND A;  5F48 A;  1QST A;  3QAH A;  5F49 A;  5EC4 A;  4R3L A;  2EUI A;  5HH1 A;  2EVN A;  5E96 A;  2WPW A;  1B87 A;  2Q4V A;  4UWJ A;  4CYO A;  3UY5 A;  4AB7 A;  2Z3P A;  1YR0 A;  1RXT A;  2DPS A;  4XPL A;  3TO7 A;  4U5Y A;  3GYA A;  1KZF A;  4FD4 A;  4MFZ A;  2FXF A;  4CYP A;  3F8K A;  3D8P A;  4MI4 A;  4E0A A;  3JVN A;  1Y7R A;  3SXN A;  2D4O A;  2YNC C;  1B6B A;  4MBU A;  1IYL A;  2IL4 A;  2WUU A;  2B4D B;  4YRH A;  4E2A A;  4KLV A;  1RO5 A;  4BBH A;  1Q2C A;  5F47 A;  2Q7B A;  2JDC A;  4QBJ A;  3OWC A;  1LRZ A;  4KOX A;  3DNS A;  2AE6 A;  3EO4 A;  4UA3 A;  3WR7 A;  1PU9 A;  1Z9U A;  4CAX A;  2REE A;  3CXQ A;  4KLW A;  2FS5 A;  2Q0Y A;  3DDD A;  3ZJ0 A;  2Q44 A;  5JPH A;  2ZW7 A;  4M85 A;  1Z4R A;  4NSQ A;  3KKW A;  2ZW5 A;  3TT2 A;  4X5K A;  2HV2 A;  1S7L A;  3EC4 A;  4F6A A;  2CXA A;  2B3V A;  2OH1 A;  3FXT A;  1M1D A;  4IUS A;  3BJ8 A;  1TIQ A;  3D3S A;  3T9Y A;  4Y49 B;  4AVB A;  2BEI A;  1J4J A;  3W91 A;  3P2F A;  3TOA A;  2Y0M A;  4M3S A;  1PUA A;  2FIA A;  4KOT A;  3TTH A;  4AG7 A;  4K30 A;  3I9S A;  4KZT A;  2AJ6 A;  4F0X A;  4AVA A;  4QB9 A;  1WWZ A;  2YNE A;  1NMT A;  3PZJ A;  3F5B A;  4MFP A;  3F0A A;  3FBU A;  5AG4 A;  4KSF A;  2OU2 A;  5I0C A;  2HQY A;  4JXR A;  4JJX A;  3S6K A;  4H6Z A;  3T90 A;  3GKR A;  1ZO0 A;  1I1D A;  3C26 A;  1S7N A;  1IYK A;  3S6F A;  2PR8 A;  4A31 A;  3MGD A;  3A9L A;  3R9F A;  2PSW A;  3B8G A;  4U9Y A;  5JQ4 A;  2BSW A;  4CGN A;  4B5O A;  1XEB A;  2P6F A;  2WSA A;  4ONU A;  4B14 A;  4CAV A;  2JDD A;  2X7B A;  5G20 A;  4XPD B;  2Z3N A;  4U9Z A;  3TO6 A;  3D2M A;  2VXK A;  4A32 A;  4KSA A;  4I49 A;  4KUB A;  4KOY A;  5F46 A;  4B11 A;  4YFJ A;  2VQY A;  1VHS A;  1V0C A;  3D2P A;  3DR6 A;  3CXS A;  1M4I A;  4A2Z A;  1K4J A;  4KOU A;  2I00 A;  2P6G A;  4KS9 A;  4CGP A;  2Z0Z A;  4KVM E;  2Z3O A;  3S6H A;  1S5K A;  4MHD A;  4QC6 A;  2D4P A;  5IX3 A;  5J8C A;  2OZU A;  4R87 A;  1P0H A;  4H6U A;  3IGR A;  4UFV A;  2ZW6 A;  1S3Z A;  4MFK A;  4OAE A;  3FB3 A;  4MFQ A;  3R9G A;  2Z10 A;  3IU1 A;  2P0W A;  4UCN A;  2R8V A;  1CJW A;  1MK4 A;  1Q2D A;  2J8N A;  2OZG A;  1KUX A;  3K9U A;  4C7I A;  4B13 A;  2BUE A;  3R1K A;  2BL1 A;  5G1Z A;  2OZH A;  3TO9 A;  2P6E A;  4PK2 A;  5AG6 A;  4F0Y A;  4HKF A;  2O28 A;  4UCP A;  4AVC A;  5IB0 A;  3JUW A;  4BMH A;  2DXQ A;  3G8W A;  5J8F A;  2JEV A;  5H86 A;  5ISV A;  5HMN A;  4MFL A;  1Q2Y A;  3VWD A;  4R3K A;  2CY2 A;  4L89 A;  4KOV A;  4NEX A;  4QVT A;  4UBR A;  4OAD A;  4LX9 A;  3JTK A;  1FY7 A;  1QSO A;  4XNH B;  2R1I A;  3E0K A;  4B10 A;  1YK3 A;  2HUZ A;  2PDO A;  2DPT A;  2JLM A;  3NE7 A;  5AG5 A;  4KVX A;  1YGH A;  1L0C A;  1S60 A;  4HNW B;  4A95 A;  2QML A;  3QB8 A;  1YLE A;  4B5P B;  4E8O A;  2VZY A;  1XMT A;  1YRE A;  3FRM A;  2NMT A;  2FCK A;  2J8M A;  1GHE A;  3EY5 A;  3H4Q A;  1QSM A;  1R57 A;  3N7Z A;  4C68 A;  1MJ9 A;  2RC4 A;  4QUS A;  4AG9 A;  2OB0 A;  2VZZ A;  4FD6 A;  5KTD A;  4DNC A;  4MFJ A;  4KOS A;  5C82 A;  3EXN A;  4UCM A;  1ON0 A;  1I21 A;  4C7H A;  2CNM A;  1KUV A;  5A27 A;  3IWE A;  4OLL A;  4J3G A;  3H5Z A;  2C27 A;  2YGW A;  4CAF A;  4UFW A;  4KOR A;  1U6M A;  1M44 A;  5KTC A;  5BWA B;  5EBV A;  4L8A A;  3SHP A;  2Q4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...