2X7BA

Crystal structure of the n-terminal acetylase ard1 from sulfolobus solfataricus p2
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
156
structure length
156
Chain Sequence
DFTLRNARMDDIDQIIKINRLTLPENYPYYFFVEHLKEYGLAFFVAIVDNSVVGYIMPRIEWGFSNIKQLPSLVRKGHVVSIAVLEEYRRKGIATTLLEASMKSMKNDYNAEEIYLEVRVSNYPAIALYEKLNFKKVKVLKGYYADGEDAYLMARP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
molecule keywords N-ACETYLTRANSFERASE SSO0209
total genus 44
structure length 156
sequence length 156
ec nomenclature ec 2.3.1.255: N-terminal amino-acid N(alpha)-acetyltransferase NatA.
pdb deposition date 2010-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2x7bA00
4KOTA 1VKCA 1CM0A 2GE3A 1RXTA 4PK2A 1S3ZA 2B5GA 2PC1A 4U9YA 2OH1A 2FIWA 2O28A 2VI7A 1S7KA 2EVNA 2VXKA 2Z0ZA 2OZHA 3F5BA 4R57A 4OAEA 1U6MA 4KUBA 2J8RA 3E0KA 3BJ7A 4KLVA 3H4QA 1YGHA 4L8AA 1J4JA 3VWEA 1Z9UA 2R8VA 2B58A 4XNHC 3GYAA 4RS2A 2G0BA 2VEZA 1MK4A 2ZW5A 4H6UA 4KOWA 3SXOA 4NXYA 2FS5A 5F46A 1Y7RA 3BLNA 4OLLA 3FIXA 1WK4A 2OU2A 2VQYA 1KZFA 1VHSA 3EFAA 2HV2A 2OZGA 1YREA 2HQYA 3TFYA 4RI1A 3T9YA 3TE4A 4JD6A 2FCKA 4E8OA 4AG9A 4CAWA 4YFJA 3R9GA 4B5OA 2F5IA 4BMHA 3PGPA 4QC6A 4JLYA 1IYLA 4E0AA 5C88A 2P6FA 1UFHA 2VBQA 2Z10A 3LD2A 1WWZA 1QSOA 5F48A 1IYKA 2H5MA 1Q2YA 3CXSA 1YX0A 3TT2A 3P2FA 2RC4A 4QBJA 4R9MA 4I49A 1Q2CA 2AE6A 3S6HA 3PP9A 3R9FA 4CRYB 2J8NA 3OWCA 3TCVA 3W6XA 2REFA 4GS4A 4F0YA 4AVAA 4KVME 1P4NA 4UA3A 4H6ZA 4NF1A 3V8IA 1I21A 1KUVA 1S7LA 4AVCA 1QSMA 5GCNA 2JEVA 4ORFA 1CJWA 4QB9A 5EC4A 4UWJA 2ZPAA 5H86A 4KVOE 1TIQA 1RO5A 3DSBA 5ISVA 1B6BA 1LRZA 2NMTA 2KCWA 4CS0B 2FL4A 1V0CA 2Q4VA 1M4DA 3T90A 3TOAA 4E2AA 3TO6A 1KUXA 5HH1A 2AJ6A 5IX3A 5JPHA 5FVJA 3D8PA 2P0WA 5HMNA 3IWGA 4M3SA 4HNWB 3BJ8A 1GHEA 3R95A 4KZTA 4X5KA 2B3UA 2B5GB 4UBRA 3G3SA 5C82A 3NE7A 3TTHA 1S7FA 1P0HA 3IGRA 2P6GA 2ZXVA 3F8KA 3I3GA 3CXPA 4II9A 4HNYB 2FIAA 2Q04A 2PQ8A 3FYNA 3S6KA 1FY7A 1N71A 3D2MA 4PSWA 2PSWA 3FXTA 5KTDA 2PR8A 1Y9KA 4HNXB 3B8GA 2JDCA 2ARHA 1Z4RA 2G3AA 1IB1E 4R87A 2ZW4A 2B3VA 3PZJA 4JJXA 3UY5A 4Y49C 2BSWA 1YVKA 2CNTA 3TO9A 3EY5A 3WR7A 3MGDA 4DNCA 3JVNA 1XMTA 3KKWA 2IL4A 1I12A 4XNHB 1Y9WA 2BL1A 2OZUA 4JWPA 1Z4EA 4MY0A 2CY2A 4YRHA 4FD5A 4FD4A 4IF5A 2VZZA 5EBVA 1NMTA 4MBUA 1QSNA 4KVXA 1I1DA 1YK3A 3W91A 4JXRA 4CRZB 4B5PA 1S7NA 4K30A 4L89A 4B5PB 4LUAA 4AB7A 2REEA 3EO4A 4KLWA 1M44A 1MJAA 4U5YA 1MJ9A 2Z11A 3FB3A 4MHDA 4NSQA 5IB0A 1XEBA 1QSTA 4R3KA 4J3GA 4QUSA 1KUYA 1YR0A 2OB0A 3DNSA 2DXQA 2JDDA 2HUZA 4XPDC 4UWIA 1IICA 2QIRA 4PK3A 3C26A 5F49A 4AVBA 3GKRA 4QVTA 1XIXA 2X7BA 2B4DB 4KOXA 5JQ4A 2BUEA 4AG7A 5DWMA 4EVYA 5DWNA 1OZPA 1NSLA 4KOYA 2Q7BA 1PUAA 1MJBA 2BEIA 1ON0A 2B4BA 3QB8A 4PSXA 3GY9A 4KOUA 4KOSA 1YLEA 2GIVA 3FNCA 3QAHA 2I00A 2K5TA 1XF8A 2D4PA 1B87A 2QECA 3D2PA 5J8FA 2CNMA 2EUIA 1Q2DA 3ZJ0A 2ZW6A 3DR6A 2FXFA 2G3TA 2JLMA 2R7HA 4IUSA 4ONUA 3CXQA 2PDOA 2A4NA 3EXNA 3I9SA 3F0AA 4JXQA 1R57A 2FSRA 1SQHA 3W6SA 2R98A 1L0CA 1M4GA 4MI4A 2C27A 4HKFA 2PR1A 5CNPA 4F6AA 2Q0YA 2VZYA 4KUAA 3R96A 2QMLA 3P2HA 2I79A 5I0CA 5H84A 2CNSA 3EC4A 4U9ZA 4Y49B 3TO7A 3RYOA 1M1DA 1QSRA 2R1IA 4NCZA 2WPXA 4CAXA 1K4JA 1YVOA 1BO4A 4OADA 1IIDA 1S60A 2J8MA 2Y0MA 4H89A 4ZBGA 2Q44A 3D3SA 4M85A 2D4OA 2PRBA 3S6FA 4XPLA 5J8CA 3SHPA 4XPKA 3SXNA 1XE4A 3DDDA 4MY3A 2Q4YA 3LODA 3ZZIA 1BOBA 2GANA 2ATRA 3G8WA 5KTCA 3DR8A 4KOVA 3R9EA 5IV0A 1NE9A 5E96A 1S5KA 4R3LA 4LX9A 2FT0A 2ZW7A 4FD7A 4NEXA 3VWDA 3FBUA 2B4DA 3TOBA 4PV6A 2WPWA 3N7ZA 4MJ8A 4FD6A 4YGOA 5F47A 4XPDB 3JUWA 4KORA 3K9UA 4CAVA 3S6GA 2FE7A 3FRMA 1PU9A 5KTAA 1M4IA 2P6EA 3R1KA
chains in the Genus database with same CATH superfamily
4NGNA 2DF5A 4KOTA 1PCAA 1VKCA 1CM0A 5D29A 3D66A 3GUXA 2GE3A 1ARMA 3VH9A 1JQGA 1RXTA 3B3TA 4B6ZA 4PK2A 1S3ZA 2B5GA 1Z8WA 2PC1A 4U9YA 3S9LA 2OH1A 3IIBA 2O53A 1VHOA 1XRYA 2FIWA 2O28A 2PJ0A 2VI7A 3PB9X 2AFOA 1S7KA 2EVNA 2IJZA 2VXKA 1JWQA 3A9LA 3B3SA 2Z0ZA 4OP4A 2ZEPA 2OZHA 3F5BA 3RZAA 5AG4A 4R57A 2YNEA 4OAEA 2PJ7A 5HVGA 1U6MA 4KUBA 2J8RA 3E0KA 3BJ7A 3K2KA 4KLVA 4NGPA 3H4QA 1YGHA 4L8AA 4F0XA 1J4JA 4GXHA 3WT4A 4C2YA 3VWEA 4MHNA 1Z9UA 2R8VA 2B58A 4EWTA 4XNHC 3GYAA 2IMOA 4RS2A 3GB0A 4Q38A 2G0BA 1LOKA 2VEZA 3SJGA 1ZG8A 4R76A 5HVFA 1MK4A 2ZW5A 4H6UA 4KOWA 3SXOA 1OBRA 2AFZA 2PJ6A 2FVGA 4KSFA 1IU8A 4NXYA 1LCPA 2FS5A 4M6HA 4OC5A 1YQEA 4ZGYB 4DUKA 4MXUA 5F46A 2RB7A 3IWWA 1Y7RA 1YMEA 3SJXA 3BLNA 2ZEOA 4HPSA 4OLLA 4UIAA 3FIXA 1LAMA 2PCUA 3FECA 1WK4A 2OU2A 3BXMA 2VQYA 1KZFA 2IQ6A 1VHSA 3EFAA 3I1UA 2HV2A 3RNZA 2OZGA 4B14A 1YREA 4WWVA 2DEAA 2V8HA 2HQYA 3TFYA 2ZEDA 3JTKA 4RI1A 3T9YA 3TE4A 3PEIA 2C1CA 3KR5A 4CPAA 4JD6A 1H8LA 2FCKA 4E8OA 4AG9A 2YNCA 5AG5A 4CAWA 4YFJA 1TF9A 3R9GA 4B5OA 2F5IA 3PB7X 3V38A 4BMHA 3PGPA 4QC6A 3PB8X 3B35A 4JLYA 1DTDA 4P45A 1HDUA 1XOVA 4UIBA 1IYLA 4X8IA 4E0AA 1CPXA 5C88A 4CGOA 2P6FA 1UFHA 2VBQA 2Z10A 5G1ZA 3LD2A 1WWZA 4UFVA 1QSOA 5ELYA 1M4LA 5F48A 5K8MA 1IYKA 1Z8TA 5AGEA 2H5MA 4OC1A 3NA6A 4MFLA 1Q2YA 2ZEEA 1TKJA 3GIUA 4A2ZA 2EK8A 3CXSA 1TKFA 2GREA 1YX0A 5JM6A 3TT2A 3P2FA 5LYFA 2RC4A 4QBJA 3KI9A 1R43A 4IK2A 3VARA 2AFSA 4R9MA 4I49A 1Q2CA 4NGMA 4W9YA 3SI1A 2AE6A 2VL1A 3S6HA 1Y0YA 2Q7BA 3PP9A 3R9FA 4CRYB 2CF4A 2J8NA 1XBUA 1Y7EA 3OWCA 3TCVA 4UEZA 3W6XA 4NGQA 3IU1A 4MMOA 2REFA 3CZXA 4GS4A 4F0YA 4AVAA 4KVME 4A38A 1FNOA 5JH9A 1P4NA 4UA3A 4H6ZA 2EBJA 3V7ZA 4NF1A 1CG2A 2PE3A 4MCRA 3V8IA 1I21A 3D67A 3PBEA 3PFEA 1S7LA 2EO8A 1KUVA 1XMBA 4M6GA 4AVCA 1QSMA 4EFDA 4NGRA 5GCNA 2JEVA 4ORFA 3CPAA 4P4DA 4JZ0A 1CJWA 4QB9A 3H8EA 5EC4A 4F9UA 4Z65A 4P10A 3KL9A 4UWJA 2HB6A 2ZPAA 4NJQA 5H86A 1A2ZA 3B3CA 2WSAA 3FEEA 4PXCA 4OIWA 4OC3A 4BBHA 4NGSA 2Z3MA 4KVOE 1TKHA 1TIQA 3BI1A 4WJBA 1RO5A 3DSBA 3DLJA 4ZY1A 5ISVA 1B6BA 1LRZA 3K9TA 1ELLP 2NMTA 2KCWA 4O23A 4P4JA 4CS0B 3JRUA 4Q7AA 3CDXA 2FL4A 1V0CA 4A30A 2Q4VA 1M4DA 3MN8A 4PPZA 3T90A 3TOAA 4E2AA 3TO6A 1BPNA 1KUXA 2CIJA 4MCQA 3LWUA 5HH1A 4CAEA 2AJ6A 5IX3A 3S9NA 4RN7A 4ZY2A 5JPHA 4FWUA 5FVJA 5I4MA 2EK9A 3D8PA 2P0WA 2J9AA 5D8NA 3IWGA 4M3SA 5HMNA 4HNWB 3BJ8A 1KWMA 4ZYQA 1F57A 1GHEA 2XEFA 2Z3KA 1ZG9A 2XEGA 4UEEA 4DJLA 3R95A 4KZTA 3KASA 3PBBA 4UCNA 4C2ZA 2YNDA 6CPAA 3KGQA 3PB4X 4X5KA 3GLJA 2B3UA 3VATA 2B5GB 1Q7LA 1QMUA 3NFZA 1ELMP 4UBRA 1CBXA 3G3SA 4C68A 5C82A 1QQ9A 3PFOA 3NE7A 4OIDA 3TTHA 2ZENA 4MHZA 5LRJA 1X12A 1S7FA 4B12A 1P0HA 3IGRA 3CT9A 2P6GA 3D68A 3D7GA 2ZXVA 3F8KA 3I3GA 1CX8A 3CXPA 4ZX9A 3B2YA 2PVWA 4CGNA 2PJAA 4MCPA 4II9A 4TNUA 3D4UA 4HNYB 3FX6A 1VHEA 3KHXA 4UCMA 3N5FA 4ZY0A 4PQAA 2FIAA 2JBKA 2Q04A 2PQ8A 1AUGA 3FEDA 4KSAA 1XJOA 3FYNA 2ODFA 1LFWA 2ZOFA 3FVLA 3IWEA 3S6KA 3PB6X 4FAIA 3LACA 1CPSA 1FY7A 1N71A 1YW6A 2PJ4A 2O4HA 2PJ2A 3D2MA 2PSWA 3FXTA 4PSWA 3TC8A 5KTDA 4H2KA 7CPAA 2PR8A 4CGPA 2PJ1A 1Y9KA 4MHPA 1DE4C 5J1QA 4B10A 4FUUA 1BLLE 4HNXB 3B8GA 2YGWA 2GFQA 3BHXA 3D7HA 2JDCA 4P44A 4PXEA 2PJBA 4UF4A 3WC6A 2ARHA 2ZEMA 1Z4RA 2NYQA 2G3AA 1HEEA 1IB1E 4UEFA 2V8VA 3WC7A 4R87A 2ZW4A 2B3VA 2ZEFA 1ZLIA 3KQZA 3PZJA 4JJXA 4Y49C 3UY5A 2BSWA 4K3NA 3CPXA 4CYNA 1YVKA 5HVHA 2CNTA 3TO9A 3EY5A 4CYPA 2Q43A 3WR7A 5JGFA 1UWYA 3MGDA 4A37A 3KR4A 3D7FA 4DNCA 3JVNA 1XMTA 1F2OA 3KKWA 4BD9A 3H8FA 2IL4A 1I12A 4UFWA 3H8GA 4XNHB 1Y9WA 2WUUA 4UFXA 4BINA 3D7DA 4NFRA 2BL1A 2OZUA 4IHMA 4JWPA 1Z4EA 3KZWA 4MY0A 4MFQA 4LQGA 2CY2A 4C2XA 4YRHA 4A95A 4FD5A 1Y0RA 4FD4A 4IF5A 2VZZA 5LYIA 2AFXA 1HDQA 1NMTA 4MBUA 4MFJA 1TF8A 1QSNA 4KVXA 5EBVA 4P4BA 3B3VA 1I1DA 3RAMA 1X10A 1Z8XA 1YK3A 1VGYA 3B7IA 3W91A 2ZOGA 4JXRA 3H5ZA 5DS0A 1GYTA 3HLPA 4B5PA 4CRZB 1S7NA 4K30A 4L89A 1CP6A 4B5PB 4YU9A 4LUAA 2BCOA 3FJUA 4R7MA 3IFEA 1Z5RA 4OC2A 4X3RA 5AG7A 4AB7A 2REEA 3EO4A 3HUVA 4KLWA 1M44A 1MJAA 2PJ3A 2V8DA 5K8OA 3L2NA 4CYQA 1MJ9A 4U5YA 2Z11A 3FB3A 4MHDA 1F2PA 4GM5A 4NSQA 1YSJA 1ZLHA 4MFZA 2Z3OA 2RFHA 5IB0A 1XEBA 2QYVA 1ZG7A 4F9VA 1QSTA 4R3KA 5LRKA 4J3GA 4MFPA 3ISXA 4M6IA 2PJ5A 3PRTA 2C6CA 4QUSA 1KUYA 5IB9A 1YR0A 2OB0A 4G1PA 3DNSA 2DXQA 4A39A 2JDDA 2PJ9A 2HUZA 2PRQA 2V77A 4XPDC 4MRIA 1IICA 4UWIA 2QIRA 4PK3A 3C26A 4CGLA 5F49A 4AVBA 3GKRA 4QVTA 1XIXA 3SI2A 3IEHA 2X7BA 2PJ8A 2B4DB 4KOXA 5JQ4A 2BUEA 4AG7A 1BAVA 5DWMA 4EVYA 2BO9A 5DWNA 2C6GA 1OZPA 1NSLA 3TX8A 4KOYA 1XFOA 1CP7A 2I3CA 1MJBA 1PUAA 2BEIA 1ON0A 1VIXA 2B4BA 2POKA 3QB8A 4IAVA 4NGTA 4PSXA 5K8NA 4LQ6A 3GY9A 4KOUA 5G22A 3NH5A 4KOSA 1YLEA 2NSMA 3QAYA 2GIVA 3FNCA 4TWEA 5G21A 4PXBA 2Q7SA 3QAHA 2Z3NA 3IC1A 2I00A 2K5TA 3SJEA 2GU2A 2ZEHA 1XF8A 1YLOA 3MRUA 4CYOA 2D4PA 2OOTA 1B87A 2QECA 1ARLA 4A32A 3SI0A 3D2PA 4A94A 2YNCC 5J8FA 2CNMA 2EUIA 3BI0A 1EE3P 1Q2DA 4JYWA 4DYOA 3ZJ0A 4C7IA 2ZW6A 3NH8A 4B11A 2DPTA 3KHZA 4PXDA 2FXFA 3DR6A 3IJ3A 2F8HA 2G3TA 5THWA 2JLMA 2R7HA 1BPMA 4AXVA 4IUSA 4ONUA 3CXQA 1AYEA 3LMSA 2PDOA 2A4NA 3EXNA 4EMEA 3I9SA 3F0AA 4JXQA 5CPAA 2WZNA 3IO1A 2Z3LA 1R57A 2JEWA 2FSRA 1SQHA 2DPSA 2G9DA 3W6SA 4C7HA 2R98A 1L0CA 5EMIA 4B13A 2PJCA 5LYDA 1LAPA 1M4GA 4MI4A 2C27A 4HKFA 5A28A 1Z2LA 2PR1A 1PYTB 5CNPA 4F6AA 2Q0YA 2VZYA 4KUAA 3R96A 2QMLA 4MCSA 4NJRA 3P2HA 1YW4A 2I79A 4P4IA 5H84A 5I0CA 2AFUA 2CNSA 3EC4A 3ISZA 4U9ZA 4Y49B 4P6YA 4OC4A 3TO7A 2PIYA 3RYOA 4OC0A 1M1DA 3SJFA 3WC5A 1QSRA 2R1IA 2GLFA 4P4EA 4NCZA 2ZEGA 2WPXA 4RUHA 4CAXA 4FBEA 5CBMA 1K4JA 1YVOA 1BO4A 4OADA 4ZI6A 1IY7A 1IIDA 4OKOA 3FF3A 4YWYA 1S60A 1LANA 1TXRA 4UCPA 2BOAA 2J8MA 2Y0MA 1IOIA 4H89A 4KSIA 4ZBGA 3S9MA 2Q44A 3D3SA 4OMEA 4M85A 2OR4A 2D4OA 4X2TA 2PRBA 3B3WA 1Z8LA 8CPAA 5AG6A 1IOFA 3S6FA 4CAFA 4F8ZA 2CTBA 1AMPA 4XPLA 5J8CA 3SHPA 1RTQA 1IGBA 4A33A 2JBJA 4XPKA 3SXNA 5LYLA 5HXDA 2QVPA 2HC9A 1XE4A 3DDDA 4MY3A 2Q4YA 3LODA 3RO0A 3ZZIA 4CGMA 1BOBA 2GANA 4R8FA 2ABZA 2WYRA 2Q51A 2ATRA 3DGVA 4KS9A 2AFWA 2ZELA 2F7VA 3FH4A 4ZX8A 5A27A 3G8WA 5KTCA 4ONWA 3T8WA 2PIZA 2EWBA 3DR8A 4KOVA 2XEJA 3NE8A 5LRGA 3R9EA 4MHYA 3KQXA 2QJ8A 5IV0A 1NE9A 5E96A 2Z3PA 1S5KA 4R3LA 1FT7A 4LX9A 2FT0A 4MFKA 3WABA 2PVVA 2ZW7A 4FD7A 4NEXA 3VWDA 3FBUA 5K8PA 2V8GA 5G20A 2CTCA 2C6PA 1R3NA 4R6TA 3NH4A 3IU2A 2ANPA 2XEIA 2B4DA 3TOBA 4PV6A 5F09A 3RBUA 1NSAA 2WPWA 3FMCA 5BWAB 3N7ZA 3QNVA 4MJ8A 4FD6A 4YGOA 5F47A 4XPDB 3JUWA 4KORA 3K9UA 4P4FA 4CAVA 2CXAA 2AFMA 3S6GA 2GLJA 2FE7A 2Q4ZA 3FRMA 4A31A 1PU9A 5KTAA 1M4IA 2P6EA 3R1KA 4Q36A 1ZO0A
chains in the Genus database with same CATH topology
4KOTA 1VKCA 1CM0A 2GE3A 1RXTA 4PK2A 1S3ZA 2B5GA 2PC1A 4U9YA 2OH1A 2FIWA 2O28A 2VI7A 1S7KA 2EVNA 3A9LA 2VXKA 2Z0ZA 2OZHA 3F5BA 5AG4A 4R57A 2YNEA 4OAEA 1U6MA 4KUBA 2J8RA 3E0KA 3BJ7A 4F0XA 4KLVA 3H4QA 1YGHA 4L8AA 1J4JA 4C2YA 3VWEA 1Z9UA 2R8VA 2B58A 4XNHC 3GYAA 4RS2A 4Q38A 2G0BA 2VEZA 1MK4A 2ZW5A 4H6UA 4KOWA 3SXOA 4C2ZA 4NXYA 4KSFA 2FS5A 4ZGYB 5F46A 1Y7RA 3BLNA 4OLLA 3FIXA 1WK4A 2OU2A 2VQYA 1KZFA 1VHSA 3EFAA 2HV2A 2OZGA 4B14A 1YREA 2HQYA 3TFYA 3JTKA 4RI1A 3T9YA 3TE4A 4JD6A 2FCKA 4E8OA 4AG9A 2YNCA 5AG5A 4CAWA 4YFJA 3R9GA 4B5OA 2F5IA 4BMHA 3PGPA 4QC6A 4JLYA 1IYLA 4E0AA 5C88A 2P6FA 1UFHA 2VBQA 2Z10A 5G1ZA 3LD2A 1WWZA 4UFVA 1QSOA 5F48A 1IYKA 5AGEA 2H5MA 4MFLA 1Q2YA 4A2ZA 3CXSA 1YX0A 3TT2A 3P2FA 2RC4A 4QBJA 4R9MA 4I49A 1Q2CA 2AE6A 3S6HA 3PP9A 3R9FA 4CRYB 2J8NA 3OWCA 3TCVA 3W6XA 3IU1A 2REFA 4GS4A 4F0YA 4AVAA 4KVME 1P4NA 4UA3A 4H6ZA 4NF1A 3V8IA 1I21A 1KUVA 1S7LA 4AVCA 1QSMA 5GCNA 2JEVA 4ORFA 1CJWA 4QB9A 5EC4A 4UWJA 2ZPAA 5H86A 2WSAA 4BBHA 2Z3MA 4KVOE 1TIQA 1RO5A 3DSBA 5ISVA 1B6BA 1LRZA 2NMTA 2KCWA 4CS0B 2FL4A 1V0CA 4A30A 2Q4VA 1M4DA 3T90A 3TOAA 4E2AA 3TO6A 1KUXA 5HH1A 4CAEA 2AJ6A 5IX3A 5JPHA 5FVJA 3D8PA 2P0WA 5HMNA 3IWGA 4M3SA 4HNWB 3BJ8A 1GHEA 2Z3KA 3R95A 4KZTA 4UCNA 2YNDA 4X5KA 2B3UA 2B5GB 4UBRA 3G3SA 4C68A 5C82A 3NE7A 3TTHA 1S7FA 4B12A 1P0HA 3IGRA 2P6GA 2ZXVA 3F8KA 3I3GA 3CXPA 4CGNA 4II9A 4HNYB 4UCMA 2FIAA 2Q04A 2PQ8A 4KSAA 3FYNA 3IWEA 3S6KA 1FY7A 1N71A 3D2MA 4PSWA 2PSWA 3FXTA 5KTDA 2PR8A 4CGPA 1Y9KA 4B10A 4HNXB 3B8GA 2YGWA 2JDCA 2ARHA 1Z4RA 2G3AA 1IB1E 4R87A 2ZW4A 2B3VA 3PZJA 4JJXA 3UY5A 4Y49C 2BSWA 4CYNA 1YVKA 2CNTA 3TO9A 3EY5A 4CYPA 3WR7A 3MGDA 4DNCA 3JVNA 1XMTA 3KKWA 2IL4A 1I12A 4UFWA 4XNHB 1Y9WA 2WUUA 4UFXA 2BL1A 2OZUA 4JWPA 1Z4EA 4MY0A 4MFQA 2CY2A 4C2XA 4YRHA 4A95A 4FD5A 4FD4A 4IF5A 2VZZA 5EBVA 1NMTA 4MBUA 4MFJA 1QSNA 4KVXA 1I1DA 1YK3A 3W91A 4JXRA 3H5ZA 4CRZB 4B5PA 1S7NA 4K30A 4L89A 4B5PB 4LUAA 5AG7A 4AB7A 2REEA 3EO4A 4KLWA 1M44A 1MJAA 4CYQA 1MJ9A 4U5YA 2Z11A 3FB3A 4MHDA 4NSQA 4MFZA 2Z3OA 5IB0A 1XEBA 1QSTA 4R3KA 4J3GA 4MFPA 4QUSA 1KUYA 1YR0A 2OB0A 3DNSA 2DXQA 2JDDA 2HUZA 4XPDC 4UWIA 1IICA 2QIRA 4PK3A 3C26A 4CGLA 5F49A 4AVBA 3GKRA 4QVTA 1XIXA 2X7BA 2B4DB 4KOXA 5JQ4A 2BUEA 4AG7A 5DWMA 4EVYA 5DWNA 1OZPA 1NSLA 4KOYA 2Q7BA 1PUAA 1MJBA 2BEIA 4CGOA 1ON0A 2B4BA 3QB8A 4PSXA 3GY9A 4KOUA 5G22A 4KOSA 1YLEA 2GIVA 3FNCA 5G21A 3QAHA 2Z3NA 2I00A 2K5TA 1XF8A 4CYOA 2D4PA 1B87A 2QECA 4A32A 3D2PA 2YNCC 5J8FA 2CNMA 2EUIA 1Q2DA 3ZJ0A 4C7IA 2ZW6A 4B11A 2DPTA 3DR6A 2FXFA 2G3TA 2JLMA 2R7HA 4IUSA 4ONUA 3CXQA 2PDOA 2A4NA 3EXNA 3I9SA 3F0AA 4JXQA 2Z3LA 1R57A 2FSRA 1SQHA 2DPSA 4C7HA 3W6SA 2R98A 1L0CA 4B13A 1M4GA 4MI4A 2C27A 4HKFA 5A28A 2PR1A 5CNPA 4F6AA 2Q0YA 2VZYA 4KUAA 3R96A 2QMLA 3P2HA 2I79A 5I0CA 5H84A 2CNSA 3EC4A 4U9ZA 4Y49B 3TO7A 3RYOA 1M1DA 1QSRA 2R1IA 4NCZA 2WPXA 4CAXA 1K4JA 1YVOA 1BO4A 4OADA 1IIDA 1S60A 4UCPA 2J8MA 2Y0MA 4H89A 4ZBGA 2Q44A 3D3SA 4M85A 2D4OA 2PRBA 5AG6A 3S6FA 4CAFA 4XPLA 5J8CA 3SHPA 4A33A 4XPKA 3SXNA 1XE4A 3DDDA 4MY3A 2Q4YA 3LODA 3ZZIA 4CGMA 1BOBA 2GANA 2ATRA 4KS9A 5A27A 3G8WA 5KTCA 3DR8A 4KOVA 3R9EA 5IV0A 1NE9A 5E96A 2Z3PA 1S5KA 4R3LA 4LX9A 2FT0A 4MFKA 2ZW7A 4FD7A 4NEXA 3VWDA 3FBUA 5G20A 3IU2A 2B4DA 3TOBA 4PV6A 2WPWA 5BWAB 3N7ZA 4MJ8A 4FD6A 4YGOA 5F47A 4XPDB 3JUWA 4KORA 3K9UA 4CAVA 2CXAA 3S6GA 2FE7A 3FRMA 4A31A 1PU9A 5KTAA 1M4IA 2P6EA 3R1KA 4Q36A 1ZO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KOT A;  1VKC A;  1CM0 A;  2GE3 A;  1RXT A;  4PK2 A;  1S3Z A;  2B5G A;  2PC1 A;  4U9Y A;  2OH1 A;  2FIW A;  2O28 A;  2VI7 A;  1S7K A;  2EVN A;  2VXK A;  2Z0Z A;  2OZH A;  3F5B A;  4R57 A;  4OAE A;  1U6M A;  4KUB A;  2J8R A;  3E0K A;  3BJ7 A;  4KLV A;  3H4Q A;  1YGH A;  4L8A A;  1J4J A;  3VWE A;  1Z9U A;  2R8V A;  2B58 A;  4XNH C;  3GYA A;  4RS2 A;  2G0B A;  2VEZ A;  1MK4 A;  2ZW5 A;  4H6U A;  4KOW A;  3SXO A;  4NXY A;  2FS5 A;  5F46 A;  1Y7R A;  3BLN A;  4OLL A;  3FIX A;  1WK4 A;  2OU2 A;  2VQY A;  1KZF A;  1VHS A;  3EFA A;  2HV2 A;  2OZG A;  1YRE A;  2HQY A;  3TFY A;  4RI1 A;  3T9Y A;  3TE4 A;  4JD6 A;  2FCK A;  4E8O A;  4AG9 A;  4CAW A;  4YFJ A;  3R9G A;  4B5O A;  2F5I A;  4BMH A;  3PGP A;  4QC6 A;  4JLY A;  1IYL A;  4E0A A;  5C88 A;  2P6F A;  1UFH A;  2VBQ A;  2Z10 A;  3LD2 A;  1WWZ A;  1QSO A;  5F48 A;  1IYK A;  2H5M A;  1Q2Y A;  3CXS A;  1YX0 A;  3TT2 A;  3P2F A;  2RC4 A;  4QBJ A;  4R9M A;  4I49 A;  1Q2C A;  2AE6 A;  3S6H A;  3PP9 A;  3R9F A;  4CRY B;  2J8N A;  3OWC A;  3TCV A;  3W6X A;  2REF A;  4GS4 A;  4F0Y A;  4AVA A;  4KVM E;  1P4N A;  4UA3 A;  4H6Z A;  4NF1 A;  3V8I A;  1I21 A;  1KUV A;  1S7L A;  4AVC A;  1QSM A;  5GCN A;  2JEV A;  4ORF A;  1CJW A;  4QB9 A;  5EC4 A;  4UWJ A;  2ZPA A;  5H86 A;  4KVO E;  1TIQ A;  1RO5 A;  3DSB A;  5ISV A;  1B6B A;  1LRZ A;  2NMT A;  2KCW A;  4CS0 B;  2FL4 A;  1V0C A;  2Q4V A;  1M4D A;  3T90 A;  3TOA A;  4E2A A;  3TO6 A;  1KUX A;  5HH1 A;  2AJ6 A;  5IX3 A;  5JPH A;  5FVJ A;  3D8P A;  2P0W A;  5HMN A;  3IWG A;  4M3S A;  4HNW B;  3BJ8 A;  1GHE A;  3R95 A;  4KZT A;  4X5K A;  2B3U A;  2B5G B;  4UBR A;  3G3S A;  5C82 A;  3NE7 A;  3TTH A;  1S7F A;  1P0H A;  3IGR A;  2P6G A;  2ZXV A;  3F8K A;  3I3G A;  3CXP A;  4II9 A;  4HNY B;  2FIA A;  2Q04 A;  2PQ8 A;  3FYN A;  3S6K A;  1FY7 A;  1N71 A;  3D2M A;  4PSW A;  2PSW A;  3FXT A;  5KTD A;  2PR8 A;  1Y9K A;  4HNX B;  3B8G A;  2JDC A;  2ARH A;  1Z4R A;  2G3A A;  1IB1 E;  4R87 A;  2ZW4 A;  2B3V A;  3PZJ A;  4JJX A;  3UY5 A;  4Y49 C;  2BSW A;  1YVK A;  2CNT A;  3TO9 A;  3EY5 A;  3WR7 A;  3MGD A;  4DNC A;  3JVN A;  1XMT A;  3KKW A;  2IL4 A;  1I12 A;  4XNH B;  1Y9W A;  2BL1 A;  2OZU A;  4JWP A;  1Z4E A;  4MY0 A;  2CY2 A;  4YRH A;  4FD5 A;  4FD4 A;  4IF5 A;  2VZZ A;  5EBV A;  1NMT A;  4MBU A;  1QSN A;  4KVX A;  1I1D A;  1YK3 A;  3W91 A;  4JXR A;  4CRZ B;  4B5P A;  1S7N A;  4K30 A;  4L89 A;  4B5P B;  4LUA A;  4AB7 A;  2REE A;  3EO4 A;  4KLW A;  1M44 A;  1MJA A;  4U5Y A;  1MJ9 A;  2Z11 A;  3FB3 A;  4MHD A;  4NSQ A;  5IB0 A;  1XEB A;  1QST A;  4R3K A;  4J3G A;  4QUS A;  1KUY A;  1YR0 A;  2OB0 A;  3DNS A;  2DXQ A;  2JDD A;  2HUZ A;  4XPD C;  4UWI A;  1IIC A;  2QIR A;  4PK3 A;  3C26 A;  5F49 A;  4AVB A;  3GKR A;  4QVT A;  1XIX A;  2X7B A;  2B4D B;  4KOX A;  5JQ4 A;  2BUE A;  4AG7 A;  5DWM A;  4EVY A;  5DWN A;  1OZP A;  1NSL A;  4KOY A;  2Q7B A;  1PUA A;  1MJB A;  2BEI A;  1ON0 A;  2B4B A;  3QB8 A;  4PSX A;  3GY9 A;  4KOU A;  4KOS A;  1YLE A;  2GIV A;  3FNC A;  3QAH A;  2I00 A;  2K5T A;  1XF8 A;  2D4P A;  1B87 A;  2QEC A;  3D2P A;  5J8F A;  2CNM A;  2EUI A;  1Q2D A;  3ZJ0 A;  2ZW6 A;  3DR6 A;  2FXF A;  2G3T A;  2JLM A;  2R7H A;  4IUS A;  4ONU A;  3CXQ A;  2PDO A;  2A4N A;  3EXN A;  3I9S A;  3F0A A;  4JXQ A;  1R57 A;  2FSR A;  1SQH A;  3W6S A;  2R98 A;  1L0C A;  1M4G A;  4MI4 A;  2C27 A;  4HKF A;  2PR1 A;  5CNP A;  4F6A A;  2Q0Y A;  2VZY A;  4KUA A;  3R96 A;  2QML A;  3P2H A;  2I79 A;  5I0C A;  5H84 A;  2CNS A;  3EC4 A;  4U9Z A;  4Y49 B;  3TO7 A;  3RYO A;  1M1D A;  1QSR A;  2R1I A;  4NCZ A;  2WPX A;  4CAX A;  1K4J A;  1YVO A;  1BO4 A;  4OAD A;  1IID A;  1S60 A;  2J8M A;  2Y0M A;  4H89 A;  4ZBG A;  2Q44 A;  3D3S A;  4M85 A;  2D4O A;  2PRB A;  3S6F A;  4XPL A;  5J8C A;  3SHP A;  4XPK A;  3SXN A;  1XE4 A;  3DDD A;  4MY3 A;  2Q4Y A;  3LOD A;  3ZZI A;  1BOB A;  2GAN A;  2ATR A;  3G8W A;  5KTC A;  3DR8 A;  4KOV A;  3R9E A;  5IV0 A;  1NE9 A;  5E96 A;  1S5K A;  4R3L A;  4LX9 A;  2FT0 A;  2ZW7 A;  4FD7 A;  4NEX A;  3VWD A;  3FBU A;  2B4D A;  3TOB A;  4PV6 A;  2WPW A;  3N7Z A;  4MJ8 A;  4FD6 A;  4YGO A;  5F47 A;  4XPD B;  3JUW A;  4KOR A;  3K9U A;  4CAV A;  3S6G A;  2FE7 A;  3FRM A;  1PU9 A;  5KTA A;  1M4I A;  2P6E A;  3R1K A; 
#chains in the Genus database with same CATH topology
 4NGN A;  2DF5 A;  4KOT A;  1PCA A;  1VKC A;  1CM0 A;  5D29 A;  3D66 A;  3GUX A;  2GE3 A;  1ARM A;  3VH9 A;  1JQG A;  1RXT A;  3B3T A;  4B6Z A;  4PK2 A;  1S3Z A;  2B5G A;  1Z8W A;  2PC1 A;  4U9Y A;  3S9L A;  2OH1 A;  3IIB A;  2O53 A;  1VHO A;  1XRY A;  2FIW A;  2O28 A;  2PJ0 A;  2VI7 A;  3PB9 X;  2AFO A;  1S7K A;  2EVN A;  2IJZ A;  2VXK A;  1JWQ A;  3A9L A;  3B3S A;  2Z0Z A;  4OP4 A;  2ZEP A;  2OZH A;  3F5B A;  3RZA A;  5AG4 A;  4R57 A;  2YNE A;  4OAE A;  2PJ7 A;  5HVG A;  1U6M A;  4KUB A;  2J8R A;  3E0K A;  3BJ7 A;  3K2K A;  4KLV A;  4NGP A;  3H4Q A;  1YGH A;  4L8A A;  4F0X A;  1J4J A;  4GXH A;  3WT4 A;  4C2Y A;  3VWE A;  4MHN A;  1Z9U A;  2R8V A;  2B58 A;  4EWT A;  4XNH C;  3GYA A;  2IMO A;  4RS2 A;  3GB0 A;  4Q38 A;  2G0B A;  1LOK A;  2VEZ A;  3SJG A;  1ZG8 A;  4R76 A;  5HVF A;  1MK4 A;  2ZW5 A;  4H6U A;  4KOW A;  3SXO A;  1OBR A;  2AFZ A;  2PJ6 A;  2FVG A;  4KSF A;  1IU8 A;  4NXY A;  1LCP A;  2FS5 A;  4M6H A;  4OC5 A;  1YQE A;  4ZGY B;  4DUK A;  4MXU A;  5F46 A;  2RB7 A;  3IWW A;  1Y7R A;  1YME A;  3SJX A;  3BLN A;  2ZEO A;  4HPS A;  4OLL A;  4UIA A;  3FIX A;  1LAM A;  2PCU A;  3FEC A;  1WK4 A;  2OU2 A;  3BXM A;  2VQY A;  1KZF A;  2IQ6 A;  1VHS A;  3EFA A;  3I1U A;  2HV2 A;  3RNZ A;  2OZG A;  4B14 A;  1YRE A;  4WWV A;  2DEA A;  2V8H A;  2HQY A;  3TFY A;  2ZED A;  3JTK A;  4RI1 A;  3T9Y A;  3TE4 A;  3PEI A;  2C1C A;  3KR5 A;  4CPA A;  4JD6 A;  1H8L A;  2FCK A;  4E8O A;  4AG9 A;  2YNC A;  5AG5 A;  4CAW A;  4YFJ A;  1TF9 A;  3R9G A;  4B5O A;  2F5I A;  3PB7 X;  3V38 A;  4BMH A;  3PGP A;  4QC6 A;  3PB8 X;  3B35 A;  4JLY A;  1DTD A;  4P45 A;  1HDU A;  1XOV A;  4UIB A;  1IYL A;  4X8I A;  4E0A A;  1CPX A;  5C88 A;  4CGO A;  2P6F A;  1UFH A;  2VBQ A;  2Z10 A;  5G1Z A;  3LD2 A;  1WWZ A;  4UFV A;  1QSO A;  5ELY A;  1M4L A;  5F48 A;  5K8M A;  1IYK A;  1Z8T A;  5AGE A;  2H5M A;  4OC1 A;  3NA6 A;  4MFL A;  1Q2Y A;  2ZEE A;  1TKJ A;  3GIU A;  4A2Z A;  2EK8 A;  3CXS A;  1TKF A;  2GRE A;  1YX0 A;  5JM6 A;  3TT2 A;  3P2F A;  5LYF A;  2RC4 A;  4QBJ A;  3KI9 A;  1R43 A;  4IK2 A;  3VAR A;  2AFS A;  4R9M A;  4I49 A;  1Q2C A;  4NGM A;  4W9Y A;  3SI1 A;  2AE6 A;  2VL1 A;  3S6H A;  1Y0Y A;  2Q7B A;  3PP9 A;  3R9F A;  4CRY B;  2CF4 A;  2J8N A;  1XBU A;  1Y7E A;  3OWC A;  3TCV A;  4UEZ A;  3W6X A;  4NGQ A;  3IU1 A;  4MMO A;  2REF A;  3CZX A;  4GS4 A;  4F0Y A;  4AVA A;  4KVM E;  4A38 A;  1FNO A;  5JH9 A;  1P4N A;  4UA3 A;  4H6Z A;  2EBJ A;  3V7Z A;  4NF1 A;  1CG2 A;  2PE3 A;  4MCR A;  3V8I A;  1I21 A;  3D67 A;  3PBE A;  3PFE A;  1S7L A;  2EO8 A;  1KUV A;  1XMB A;  4M6G A;  4AVC A;  1QSM A;  4EFD A;  4NGR A;  5GCN A;  2JEV A;  4ORF A;  3CPA A;  4P4D A;  4JZ0 A;  1CJW A;  4QB9 A;  3H8E A;  5EC4 A;  4F9U A;  4Z65 A;  4P10 A;  3KL9 A;  4UWJ A;  2HB6 A;  2ZPA A;  4NJQ A;  5H86 A;  1A2Z A;  3B3C A;  2WSA A;  3FEE A;  4PXC A;  4OIW A;  4OC3 A;  4BBH A;  4NGS A;  2Z3M A;  4KVO E;  1TKH A;  1TIQ A;  3BI1 A;  4WJB A;  1RO5 A;  3DSB A;  3DLJ A;  4ZY1 A;  5ISV A;  1B6B A;  1LRZ A;  3K9T A;  1ELL P;  2NMT A;  2KCW A;  4O23 A;  4P4J A;  4CS0 B;  3JRU A;  4Q7A A;  3CDX A;  2FL4 A;  1V0C A;  4A30 A;  2Q4V A;  1M4D A;  3MN8 A;  4PPZ A;  3T90 A;  3TOA A;  4E2A A;  3TO6 A;  1BPN A;  1KUX A;  2CIJ A;  4MCQ A;  3LWU A;  5HH1 A;  4CAE A;  2AJ6 A;  5IX3 A;  3S9N A;  4RN7 A;  4ZY2 A;  5JPH A;  4FWU A;  5FVJ A;  5I4M A;  2EK9 A;  3D8P A;  2P0W A;  2J9A A;  5D8N A;  3IWG A;  4M3S A;  5HMN A;  4HNW B;  3BJ8 A;  1KWM A;  4ZYQ A;  1F57 A;  1GHE A;  2XEF A;  2Z3K A;  1ZG9 A;  2XEG A;  4UEE A;  4DJL A;  3R95 A;  4KZT A;  3KAS A;  3PBB A;  4UCN A;  4C2Z A;  2YND A;  6CPA A;  3KGQ A;  3PB4 X;  4X5K A;  3GLJ A;  2B3U A;  3VAT A;  2B5G B;  1Q7L A;  1QMU A;  3NFZ A;  1ELM P;  4UBR A;  1CBX A;  3G3S A;  4C68 A;  5C82 A;  1QQ9 A;  3PFO A;  3NE7 A;  4OID A;  3TTH A;  2ZEN A;  4MHZ A;  5LRJ A;  1X12 A;  1S7F A;  4B12 A;  1P0H A;  3IGR A;  3CT9 A;  2P6G A;  3D68 A;  3D7G A;  2ZXV A;  3F8K A;  3I3G A;  1CX8 A;  3CXP A;  4ZX9 A;  3B2Y A;  2PVW A;  4CGN A;  2PJA A;  4MCP A;  4II9 A;  4TNU A;  3D4U A;  4HNY B;  3FX6 A;  1VHE A;  3KHX A;  4UCM A;  3N5F A;  4ZY0 A;  4PQA A;  2FIA A;  2JBK A;  2Q04 A;  2PQ8 A;  1AUG A;  3FED A;  4KSA A;  1XJO A;  3FYN A;  2ODF A;  1LFW A;  2ZOF A;  3FVL A;  3IWE A;  3S6K A;  3PB6 X;  4FAI A;  3LAC A;  1CPS A;  1FY7 A;  1N71 A;  1YW6 A;  2PJ4 A;  2O4H A;  2PJ2 A;  3D2M A;  2PSW A;  3FXT A;  4PSW A;  3TC8 A;  5KTD A;  4H2K A;  7CPA A;  2PR8 A;  4CGP A;  2PJ1 A;  1Y9K A;  4MHP A;  1DE4 C;  5J1Q A;  4B10 A;  4FUU A;  1BLL E;  4HNX B;  3B8G A;  2YGW A;  2GFQ A;  3BHX A;  3D7H A;  2JDC A;  4P44 A;  4PXE A;  2PJB A;  4UF4 A;  3WC6 A;  2ARH A;  2ZEM A;  1Z4R A;  2NYQ A;  2G3A A;  1HEE A;  1IB1 E;  4UEF A;  2V8V A;  3WC7 A;  4R87 A;  2ZW4 A;  2B3V A;  2ZEF A;  1ZLI A;  3KQZ A;  3PZJ A;  4JJX A;  4Y49 C;  3UY5 A;  2BSW A;  4K3N A;  3CPX A;  4CYN A;  1YVK A;  5HVH A;  2CNT A;  3TO9 A;  3EY5 A;  4CYP A;  2Q43 A;  3WR7 A;  5JGF A;  1UWY A;  3MGD A;  4A37 A;  3KR4 A;  3D7F A;  4DNC A;  3JVN A;  1XMT A;  1F2O A;  3KKW A;  4BD9 A;  3H8F A;  2IL4 A;  1I12 A;  4UFW A;  3H8G A;  4XNH B;  1Y9W A;  2WUU A;  4UFX A;  4BIN A;  3D7D A;  4NFR A;  2BL1 A;  2OZU A;  4IHM A;  4JWP A;  1Z4E A;  3KZW A;  4MY0 A;  4MFQ A;  4LQG A;  2CY2 A;  4C2X A;  4YRH A;  4A95 A;  4FD5 A;  1Y0R A;  4FD4 A;  4IF5 A;  2VZZ A;  5LYI A;  2AFX A;  1HDQ A;  1NMT A;  4MBU A;  4MFJ A;  1TF8 A;  1QSN A;  4KVX A;  5EBV A;  4P4B A;  3B3V A;  1I1D A;  3RAM A;  1X10 A;  1Z8X A;  1YK3 A;  1VGY A;  3B7I A;  3W91 A;  2ZOG A;  4JXR A;  3H5Z A;  5DS0 A;  1GYT A;  3HLP A;  4B5P A;  4CRZ B;  1S7N A;  4K30 A;  4L89 A;  1CP6 A;  4B5P B;  4YU9 A;  4LUA A;  2BCO A;  3FJU A;  4R7M A;  3IFE A;  1Z5R A;  4OC2 A;  4X3R A;  5AG7 A;  4AB7 A;  2REE A;  3EO4 A;  3HUV A;  4KLW A;  1M44 A;  1MJA A;  2PJ3 A;  2V8D A;  5K8O A;  3L2N A;  4CYQ A;  1MJ9 A;  4U5Y A;  2Z11 A;  3FB3 A;  4MHD A;  1F2P A;  4GM5 A;  4NSQ A;  1YSJ A;  1ZLH A;  4MFZ A;  2Z3O A;  2RFH A;  5IB0 A;  1XEB A;  2QYV A;  1ZG7 A;  4F9V A;  1QST A;  4R3K A;  5LRK A;  4J3G A;  4MFP A;  3ISX A;  4M6I A;  2PJ5 A;  3PRT A;  2C6C A;  4QUS A;  1KUY A;  5IB9 A;  1YR0 A;  2OB0 A;  4G1P A;  3DNS A;  2DXQ A;  4A39 A;  2JDD A;  2PJ9 A;  2HUZ A;  2PRQ A;  2V77 A;  4XPD C;  4MRI A;  1IIC A;  4UWI A;  2QIR A;  4PK3 A;  3C26 A;  4CGL A;  5F49 A;  4AVB A;  3GKR A;  4QVT A;  1XIX A;  3SI2 A;  3IEH A;  2X7B A;  2PJ8 A;  2B4D B;  4KOX A;  5JQ4 A;  2BUE A;  4AG7 A;  1BAV A;  5DWM A;  4EVY A;  2BO9 A;  5DWN A;  2C6G A;  1OZP A;  1NSL A;  3TX8 A;  4KOY A;  1XFO A;  1CP7 A;  2I3C A;  1MJB A;  1PUA A;  2BEI A;  1ON0 A;  1VIX A;  2B4B A;  2POK A;  3QB8 A;  4IAV A;  4NGT A;  4PSX A;  5K8N A;  4LQ6 A;  3GY9 A;  4KOU A;  5G22 A;  3NH5 A;  4KOS A;  1YLE A;  2NSM A;  3QAY A;  2GIV A;  3FNC A;  4TWE A;  5G21 A;  4PXB A;  2Q7S A;  3QAH A;  2Z3N A;  3IC1 A;  2I00 A;  2K5T A;  3SJE A;  2GU2 A;  2ZEH A;  1XF8 A;  1YLO A;  3MRU A;  4CYO A;  2D4P A;  2OOT A;  1B87 A;  2QEC A;  1ARL A;  4A32 A;  3SI0 A;  3D2P A;  4A94 A;  2YNC C;  5J8F A;  2CNM A;  2EUI A;  3BI0 A;  1EE3 P;  1Q2D A;  4JYW A;  4DYO A;  3ZJ0 A;  4C7I A;  2ZW6 A;  3NH8 A;  4B11 A;  2DPT A;  3KHZ A;  4PXD A;  2FXF A;  3DR6 A;  3IJ3 A;  2F8H A;  2G3T A;  5THW A;  2JLM A;  2R7H A;  1BPM A;  4AXV A;  4IUS A;  4ONU A;  3CXQ A;  1AYE A;  3LMS A;  2PDO A;  2A4N A;  3EXN A;  4EME A;  3I9S A;  3F0A A;  4JXQ A;  5CPA A;  2WZN A;  3IO1 A;  2Z3L A;  1R57 A;  2JEW A;  2FSR A;  1SQH A;  2DPS A;  2G9D A;  3W6S A;  4C7H A;  2R98 A;  1L0C A;  5EMI A;  4B13 A;  2PJC A;  5LYD A;  1LAP A;  1M4G A;  4MI4 A;  2C27 A;  4HKF A;  5A28 A;  1Z2L A;  2PR1 A;  1PYT B;  5CNP A;  4F6A A;  2Q0Y A;  2VZY A;  4KUA A;  3R96 A;  2QML A;  4MCS A;  4NJR A;  3P2H A;  1YW4 A;  2I79 A;  4P4I A;  5H84 A;  5I0C A;  2AFU A;  2CNS A;  3EC4 A;  3ISZ A;  4U9Z A;  4Y49 B;  4P6Y A;  4OC4 A;  3TO7 A;  2PIY A;  3RYO A;  4OC0 A;  1M1D A;  3SJF A;  3WC5 A;  1QSR A;  2R1I A;  2GLF A;  4P4E A;  4NCZ A;  2ZEG A;  2WPX A;  4RUH A;  4CAX A;  4FBE A;  5CBM A;  1K4J A;  1YVO A;  1BO4 A;  4OAD A;  4ZI6 A;  1IY7 A;  1IID A;  4OKO A;  3FF3 A;  4YWY A;  1S60 A;  1LAN A;  1TXR A;  4UCP A;  2BOA A;  2J8M A;  2Y0M A;  1IOI A;  4H89 A;  4KSI A;  4ZBG A;  3S9M A;  2Q44 A;  3D3S A;  4OME A;  4M85 A;  2OR4 A;  2D4O A;  4X2T A;  2PRB A;  3B3W A;  1Z8L A;  8CPA A;  5AG6 A;  1IOF A;  3S6F A;  4CAF A;  4F8Z A;  2CTB A;  1AMP A;  4XPL A;  5J8C A;  3SHP A;  1RTQ A;  1IGB A;  4A33 A;  2JBJ A;  4XPK A;  3SXN A;  5LYL A;  5HXD A;  2QVP A;  2HC9 A;  1XE4 A;  3DDD A;  4MY3 A;  2Q4Y A;  3LOD A;  3RO0 A;  3ZZI A;  4CGM A;  1BOB A;  2GAN A;  4R8F A;  2ABZ A;  2WYR A;  2Q51 A;  2ATR A;  3DGV A;  4KS9 A;  2AFW A;  2ZEL A;  2F7V A;  3FH4 A;  4ZX8 A;  5A27 A;  3G8W A;  5KTC A;  4ONW A;  3T8W A;  2PIZ A;  2EWB A;  3DR8 A;  4KOV A;  2XEJ A;  3NE8 A;  5LRG A;  3R9E A;  4MHY A;  3KQX A;  2QJ8 A;  5IV0 A;  1NE9 A;  5E96 A;  2Z3P A;  1S5K A;  4R3L A;  1FT7 A;  4LX9 A;  2FT0 A;  4MFK A;  3WAB A;  2PVV A;  2ZW7 A;  4FD7 A;  4NEX A;  3VWD A;  3FBU A;  5K8P A;  2V8G A;  5G20 A;  2CTC A;  2C6P A;  1R3N A;  4R6T A;  3NH4 A;  3IU2 A;  2ANP A;  2XEI A;  2B4D A;  3TOB A;  4PV6 A;  5F09 A;  3RBU A;  1NSA A;  2WPW A;  3FMC A;  5BWA B;  3N7Z A;  3QNV A;  4MJ8 A;  4FD6 A;  4YGO A;  5F47 A;  4XPD B;  3JUW A;  4KOR A;  3K9U A;  4P4F A;  4CAV A;  2CXA A;  2AFM A;  3S6G A;  2GLJ A;  2FE7 A;  2Q4Z A;  3FRM A;  4A31 A;  1PU9 A;  5KTA A;  1M4I A;  2P6E A;  3R1K A;  4Q36 A;  1ZO0 A; 
#chains in the Genus database with same CATH homology
 4KOT A;  1VKC A;  1CM0 A;  2GE3 A;  1RXT A;  4PK2 A;  1S3Z A;  2B5G A;  2PC1 A;  4U9Y A;  2OH1 A;  2FIW A;  2O28 A;  2VI7 A;  1S7K A;  2EVN A;  3A9L A;  2VXK A;  2Z0Z A;  2OZH A;  3F5B A;  5AG4 A;  4R57 A;  2YNE A;  4OAE A;  1U6M A;  4KUB A;  2J8R A;  3E0K A;  3BJ7 A;  4F0X A;  4KLV A;  3H4Q A;  1YGH A;  4L8A A;  1J4J A;  4C2Y A;  3VWE A;  1Z9U A;  2R8V A;  2B58 A;  4XNH C;  3GYA A;  4RS2 A;  4Q38 A;  2G0B A;  2VEZ A;  1MK4 A;  2ZW5 A;  4H6U A;  4KOW A;  3SXO A;  4C2Z A;  4NXY A;  4KSF A;  2FS5 A;  4ZGY B;  5F46 A;  1Y7R A;  3BLN A;  4OLL A;  3FIX A;  1WK4 A;  2OU2 A;  2VQY A;  1KZF A;  1VHS A;  3EFA A;  2HV2 A;  2OZG A;  4B14 A;  1YRE A;  2HQY A;  3TFY A;  3JTK A;  4RI1 A;  3T9Y A;  3TE4 A;  4JD6 A;  2FCK A;  4E8O A;  4AG9 A;  2YNC A;  5AG5 A;  4CAW A;  4YFJ A;  3R9G A;  4B5O A;  2F5I A;  4BMH A;  3PGP A;  4QC6 A;  4JLY A;  1IYL A;  4E0A A;  5C88 A;  2P6F A;  1UFH A;  2VBQ A;  2Z10 A;  5G1Z A;  3LD2 A;  1WWZ A;  4UFV A;  1QSO A;  5F48 A;  1IYK A;  5AGE A;  2H5M A;  4MFL A;  1Q2Y A;  4A2Z A;  3CXS A;  1YX0 A;  3TT2 A;  3P2F A;  2RC4 A;  4QBJ A;  4R9M A;  4I49 A;  1Q2C A;  2AE6 A;  3S6H A;  3PP9 A;  3R9F A;  4CRY B;  2J8N A;  3OWC A;  3TCV A;  3W6X A;  3IU1 A;  2REF A;  4GS4 A;  4F0Y A;  4AVA A;  4KVM E;  1P4N A;  4UA3 A;  4H6Z A;  4NF1 A;  3V8I A;  1I21 A;  1KUV A;  1S7L A;  4AVC A;  1QSM A;  5GCN A;  2JEV A;  4ORF A;  1CJW A;  4QB9 A;  5EC4 A;  4UWJ A;  2ZPA A;  5H86 A;  2WSA A;  4BBH A;  2Z3M A;  4KVO E;  1TIQ A;  1RO5 A;  3DSB A;  5ISV A;  1B6B A;  1LRZ A;  2NMT A;  2KCW A;  4CS0 B;  2FL4 A;  1V0C A;  4A30 A;  2Q4V A;  1M4D A;  3T90 A;  3TOA A;  4E2A A;  3TO6 A;  1KUX A;  5HH1 A;  4CAE A;  2AJ6 A;  5IX3 A;  5JPH A;  5FVJ A;  3D8P A;  2P0W A;  5HMN A;  3IWG A;  4M3S A;  4HNW B;  3BJ8 A;  1GHE A;  2Z3K A;  3R95 A;  4KZT A;  4UCN A;  2YND A;  4X5K A;  2B3U A;  2B5G B;  4UBR A;  3G3S A;  4C68 A;  5C82 A;  3NE7 A;  3TTH A;  1S7F A;  4B12 A;  1P0H A;  3IGR A;  2P6G A;  2ZXV A;  3F8K A;  3I3G A;  3CXP A;  4CGN A;  4II9 A;  4HNY B;  4UCM A;  2FIA A;  2Q04 A;  2PQ8 A;  4KSA A;  3FYN A;  3IWE A;  3S6K A;  1FY7 A;  1N71 A;  3D2M A;  4PSW A;  2PSW A;  3FXT A;  5KTD A;  2PR8 A;  4CGP A;  1Y9K A;  4B10 A;  4HNX B;  3B8G A;  2YGW A;  2JDC A;  2ARH A;  1Z4R A;  2G3A A;  1IB1 E;  4R87 A;  2ZW4 A;  2B3V A;  3PZJ A;  4JJX A;  3UY5 A;  4Y49 C;  2BSW A;  4CYN A;  1YVK A;  2CNT A;  3TO9 A;  3EY5 A;  4CYP A;  3WR7 A;  3MGD A;  4DNC A;  3JVN A;  1XMT A;  3KKW A;  2IL4 A;  1I12 A;  4UFW A;  4XNH B;  1Y9W A;  2WUU A;  4UFX A;  2BL1 A;  2OZU A;  4JWP A;  1Z4E A;  4MY0 A;  4MFQ A;  2CY2 A;  4C2X A;  4YRH A;  4A95 A;  4FD5 A;  4FD4 A;  4IF5 A;  2VZZ A;  5EBV A;  1NMT A;  4MBU A;  4MFJ A;  1QSN A;  4KVX A;  1I1D A;  1YK3 A;  3W91 A;  4JXR A;  3H5Z A;  4CRZ B;  4B5P A;  1S7N A;  4K30 A;  4L89 A;  4B5P B;  4LUA A;  5AG7 A;  4AB7 A;  2REE A;  3EO4 A;  4KLW A;  1M44 A;  1MJA A;  4CYQ A;  1MJ9 A;  4U5Y A;  2Z11 A;  3FB3 A;  4MHD A;  4NSQ A;  4MFZ A;  2Z3O A;  5IB0 A;  1XEB A;  1QST A;  4R3K A;  4J3G A;  4MFP A;  4QUS A;  1KUY A;  1YR0 A;  2OB0 A;  3DNS A;  2DXQ A;  2JDD A;  2HUZ A;  4XPD C;  4UWI A;  1IIC A;  2QIR A;  4PK3 A;  3C26 A;  4CGL A;  5F49 A;  4AVB A;  3GKR A;  4QVT A;  1XIX A;  2X7B A;  2B4D B;  4KOX A;  5JQ4 A;  2BUE A;  4AG7 A;  5DWM A;  4EVY A;  5DWN A;  1OZP A;  1NSL A;  4KOY A;  2Q7B A;  1PUA A;  1MJB A;  2BEI A;  4CGO A;  1ON0 A;  2B4B A;  3QB8 A;  4PSX A;  3GY9 A;  4KOU A;  5G22 A;  4KOS A;  1YLE A;  2GIV A;  3FNC A;  5G21 A;  3QAH A;  2Z3N A;  2I00 A;  2K5T A;  1XF8 A;  4CYO A;  2D4P A;  1B87 A;  2QEC A;  4A32 A;  3D2P A;  2YNC C;  5J8F A;  2CNM A;  2EUI A;  1Q2D A;  3ZJ0 A;  4C7I A;  2ZW6 A;  4B11 A;  2DPT A;  3DR6 A;  2FXF A;  2G3T A;  2JLM A;  2R7H A;  4IUS A;  4ONU A;  3CXQ A;  2PDO A;  2A4N A;  3EXN A;  3I9S A;  3F0A A;  4JXQ A;  2Z3L A;  1R57 A;  2FSR A;  1SQH A;  2DPS A;  4C7H A;  3W6S A;  2R98 A;  1L0C A;  4B13 A;  1M4G A;  4MI4 A;  2C27 A;  4HKF A;  5A28 A;  2PR1 A;  5CNP A;  4F6A A;  2Q0Y A;  2VZY A;  4KUA A;  3R96 A;  2QML A;  3P2H A;  2I79 A;  5I0C A;  5H84 A;  2CNS A;  3EC4 A;  4U9Z A;  4Y49 B;  3TO7 A;  3RYO A;  1M1D A;  1QSR A;  2R1I A;  4NCZ A;  2WPX A;  4CAX A;  1K4J A;  1YVO A;  1BO4 A;  4OAD A;  1IID A;  1S60 A;  4UCP A;  2J8M A;  2Y0M A;  4H89 A;  4ZBG A;  2Q44 A;  3D3S A;  4M85 A;  2D4O A;  2PRB A;  5AG6 A;  3S6F A;  4CAF A;  4XPL A;  5J8C A;  3SHP A;  4A33 A;  4XPK A;  3SXN A;  1XE4 A;  3DDD A;  4MY3 A;  2Q4Y A;  3LOD A;  3ZZI A;  4CGM A;  1BOB A;  2GAN A;  2ATR A;  4KS9 A;  5A27 A;  3G8W A;  5KTC A;  3DR8 A;  4KOV A;  3R9E A;  5IV0 A;  1NE9 A;  5E96 A;  2Z3P A;  1S5K A;  4R3L A;  4LX9 A;  2FT0 A;  4MFK A;  2ZW7 A;  4FD7 A;  4NEX A;  3VWD A;  3FBU A;  5G20 A;  3IU2 A;  2B4D A;  3TOB A;  4PV6 A;  2WPW A;  5BWA B;  3N7Z A;  4MJ8 A;  4FD6 A;  4YGO A;  5F47 A;  4XPD B;  3JUW A;  4KOR A;  3K9U A;  4CAV A;  2CXA A;  3S6G A;  2FE7 A;  3FRM A;  4A31 A;  1PU9 A;  5KTA A;  1M4I A;  2P6E A;  3R1K A;  4Q36 A;  1ZO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...