2X7BA

Crystal structure of the n-terminal acetylase ard1 from sulfolobus solfataricus p2
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
156
structure length
156
Chain Sequence
DFTLRNARMDDIDQIIKINRLTLPENYPYYFFVEHLKEYGLAFFVAIVDNSVVGYIMPRIEWGFSNIKQLPSLVRKGHVVSIAVLEEYRRKGIATTLLEASMKSMKNDYNAEEIYLEVRVSNYPAIALYEKLNFKKVKVLKGYYADGEDAYLMARP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
molecule keywords N-ACETYLTRANSFERASE SSO0209
total genus 44
structure length 156
sequence length 156
ec nomenclature ec 2.3.1.255: N-terminal amino-acid N(alpha)-acetyltransferase NatA.
pdb deposition date 2010-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2x7bA00
2I00A 4JLYA 3C26A 2G3AA 5J8CA 1Q2YA 4XNHB 1XIXA 4CRYB 4PSXA 4ORFA 4JXRA 4KOVA 3F5BA 2Z11A 4B5PB 2B4DA 4H6UA 1Y9WA 3SXOA 4J3GA 5EBVA 3TO9A 3CXPA 1FY7A 3R9FA 2B4BA 3FIXA 4UBRA 5E96A 3P2FA 4ZBGA 4L8AA 2Z0ZA 1R57A 5JPHA 4AVAA 2K5TA 4U9YA 4PK2A 3TFYA 4NSQA 4M3SA 3TT2A 3LODA 1KUYA 2IL4A 3DSBA 2ZPAA 3EC4A 3EXNA 4MHDA 5H86A 1KUVA 1GHEA 3DNSA 1RXTA 2Q7BA 3R9GA 1BO4A 3EY5A 4BMHA 1YGHA 4YFJA 2FSRA 2FIWA 2R7HA 2PR1A 4R87A 3TO6A 4MBUA 3IWGA 1L0CA 3EFAA 1I12A 4U5YA 1NE9A 4HNXB 1Z9UA 5FVJA 4XPDC 4EVYA 5DWMA 5F47A 4B5PA 1WWZA 1YLEA 2FT0A 4UWJA 4YGOA 1I21A 1LRZA 2P0WA 3FBUA 1MJ9A 5GCNA 1QSNA 5ISVA 1UFHA 4KLWA 2EVNA 4KOSA 1PUAA 3D8PA 4H89A 3P2HA 3F8KA 5C82A 3R9EA 4KUBA 4XPLA 2PRBA 1MJBA 2D4PA 2ARHA 1CM0A 4QUSA 1YVOA 2JDCA 2ZW4A 1VHSA 1QSMA 2G3TA 2Q4YA 1Z4RA 1VKCA 5DWNA 2Q04A 2PR8A 4KVME 2AJ6A 4NXYA 3LD2A 4M85A 2VEZA 4PV6A 4KORA 4FD7A 3FNCA 1S7NA 4ONUA 4QVTA 3CXQA 4E2AA 2CY2A 3R1KA 4RS2A 4Y49B 4PK3A 1U6MA 4K30A 4YRHA 4R9MA 2WPXA 4RI1A 2X7BA 1J4JA 1YREA 1WK4A 1SQHA 2FXFA 4DNCA 2PQ8A 3SXNA 3H4QA 4MY3A 3BJ8A 2VI7A 3BJ7A 1IICA 1YVKA 2Q0YA 3TE4A 4JJXA 4R3KA 3FYNA 2AE6A 4IF5A 4KOYA 2ZW7A 3S6GA 3IGRA 2P6FA 1N71A 2I79A 3E0KA 3PGPA 2VZYA 5CNPA 3WR7A 5EC4A 3FRMA 3R95A 1MJAA 4UA3A 4XPDB 1Q2CA 3GY9A 4CAXA 2R98A 2B3UA 1TIQA 2J8RA 1S7FA 4JD6A 3TTHA 2OU2A 3JVNA 4KLVA 2B4DB 5IV0A 2FE7A 4LUAA 4I49A 4CAWA 1M1DA 4KOWA 4QB9A 2EUIA 3TO7A 1QSRA 4XPKA 2J8NA 1XE4A 4Y49C 4AG7A 2B5GB 4KUAA 1Y7RA 2F5IA 2CNSA 3W91A 2HV2A 5H84A 4II9A 4KOUA 3V8IA 1MK4A 4L89A 5HMNA 2JDDA 1Z4EA 2REFA 5F48A 3D2PA 2B5GA 1IIDA 3W6XA 1S7LA 3MGDA 1M4DA 2GE3A 2BUEA 4FD5A 3NE7A 4KVOE 1XMTA 3I3GA 2PSWA 1NMTA 2ATRA 3W6SA 4KOXA 5IB0A 2ZW5A 1RO5A 2VQYA 1P0HA 1P4NA 2A4NA 3GYAA 4MY0A 2B58A 2FS5A 4PSWA 3UY5A 4CRZB 2CNMA 3OWCA 1M4IA 4QBJA 2GANA 3K9UA 2O28A 1OZPA 1M4GA 3VWEA 4CS0B 1QSOA 1IB1E 3G8WA 1I1DA 4AVCA 2CNTA 4QC6A 3D2MA 4OLLA 3TCVA 4UWIA 2PDOA 4R57A 4MI4A 2J8MA 4AG9A 3PP9A 2C27A 2NMTA 2OB0A 2Y0MA 4MJ8A 4JXQA 4FD4A 2OH1A 2D4OA 3I9SA 3PZJA 3D3SA 4NCZA 1S60A 2PC1A 2P6EA 5F49A 4B5OA 4E0AA 3EO4A 2H5MA 2OZHA 4X5KA 4AVBA 4U9ZA 3N7ZA 4LX9A 1IYLA 2P6GA 2DXQA 2GIVA 5JQ4A 4H6ZA 3GKRA 4F0YA 3DR8A 3VWDA 2ZW6A 4KOTA 3ZJ0A 5J8FA 3G3SA 1ON0A 2JLMA 2Q4VA 5HH1A 1XEBA 2VZZA 3BLNA 2R8VA 4KVXA 2BL1A 1KUXA 1KZFA 1IYKA 4OAEA 2HUZA 4JWPA 1K4JA 4R3LA 1Y9KA 3SHPA 2Q44A 3DR6A 2WPWA 1YK3A 2Z10A 4FD6A 1Q2DA 5IX3A 4IUSA 2QMLA 1BOBA 2QECA 1NSLA 3ZZIA 1YX0A 2RC4A 5KTDA 4HNWB 3F0AA 3T90A 3S6HA 1PU9A 3QAHA 2KCWA 1B87A 1QSTA 3R96A 4NEXA 4XNHC 3FB3A 1XF8A 2OZUA 3KKWA 1CJWA 4GS4A 2FL4A 2FCKA 3CXSA 2G0BA 5KTCA 1S3ZA 3FXTA 2VXKA 1S7KA 3B8GA 2OZGA 4AB7A 2FIAA 2HQYA 4CAVA 3JUWA 2BEIA 5I0CA 5KTAA 4HNYB 4F6AA 5F46A 1V0CA 3T9YA 1S5KA 4KZTA 5C88A 2ZXVA 2JEVA 3S6KA 2REEA 2B3VA 3TOBA 2BSWA 3TOAA 2R1IA 3QB8A 4OADA 2QIRA 1M44A 4E8OA 1B6BA 1YR0A 4NF1A 3S6FA 2VBQA 3RYOA 3DDDA 4HKFA
chains in the Genus database with same CATH superfamily
1LCPA 4UF4A 2DF5A 2I00A 4JLYA 3C26A 2G3AA 4Q38A 5AG6A 5HVFA 4C2XA 4P10A 3L2NA 5J8CA 1F2OA 1Q2YA 3GLJA 5AG5A 4XNHB 1XIXA 2CF4A 4UFXA 5LYDA 4CRYB 4HKFA 3D4UA 4PSXA 4ORFA 1Z5RA 3KR5A 2PJCA 4JXRA 5DS0A 4C7HA 1XJOA 1YMEA 4KOVA 5A28A 3F5BA 2PJBA 1ZLIA 5JM6A 2Z11A 4A2ZA 1IY7A 4B5PB 2B4DA 4H6UA 1Y9WA 3IFEA 1JQGA 2F8HA 3SXOA 4J3GA 2EWBA 4ZY2A 5EBVA 3TO9A 3CXPA 4UEZA 1FY7A 1Y0YA 2B4BA 3R9FA 4FAIA 5THWA 3FIXA 4UBRA 3HLPA 5E96A 3P2FA 4ZBGA 4L8AA 4IHMA 2AFZA 3SJGA 2Z0ZA 3FEDA 3PEIA 5K8OA 1R57A 5JPHA 4NGPA 4AVAA 4CYNA 4P6YA 2K5TA 4U9YA 4OC1A 5LRKA 1TXRA 2F7VA 2QYVA 4JYWA 4PK2A 3TFYA 1F2PA 4NJRA 2PJ2A 4NFRA 2DEAA 4M3SA 4NSQA 3TT2A 3LODA 4FWUA 2Z3NA 3IWWA 4ZI6A 1KUYA 2IL4A 3DSBA 2ZPAA 3EC4A 3EXNA 4MHDA 3D7DA 4IAVA 1CPSA 1LANA 2XEJA 1KUVA 1GHEA 3DNSA 3ISXA 5H86A 1RXTA 2ZEPA 2Q7BA 2ZENA 1UWYA 3FJUA 2OOTA 1TKHA 3R9GA 1BO4A 3EY5A 4R76A 4BMHA 4F9VA 3SJXA 1CP7A 2J9AA 1YGHA 4YFJA 4OIWA 2FSRA 2FIWA 2O4HA 3BI1A 1A2ZA 2R7HA 3RAMA 2PR1A 1VHEA 4R87A 3TO6A 2GREA 1LAPA 2PJ7A 4MBUA 1F57A 5AGEA 5G1ZA 3IWGA 1L0CA 4C2YA 3EFAA 1I12A 4U5YA 2AFMA 2PCUA 3PBBA 1NE9A 4YWYA 4HNXB 4CGNA 3S9NA 2PJ8A 3PB8X 2IMOA 1Z9UA 2EK9A 2AFWA 3CDXA 4M6GA 4MCQA 5FVJA 4XPDC 4EVYA 1R43A 3H8GA 5DWMA 5F47A 4B5PA 1WWZA 4OC4A 1YLEA 4A31A 5AG4A 2FT0A 4UWJA 4YGOA 1I21A 1LRZA 2P0WA 3FBUA 1MJ9A 1TKJA 1QSNA 5GCNA 4Q36A 3RZAA 4O23A 1Z8TA 1UFHA 1JWQA 2GLJA 1HDQA 1QMUA 2DPTA 4KLWA 1AYEA 2EVNA 4P44A 4KOSA 4B14A 1PUAA 3D8PA 3DLJA 4H89A 5CBMA 3P2HA 4WJBA 1IOIA 3F8KA 4B13A 5C82A 3R9EA 4KUBA 5G20A 4XPLA 2PRBA 1MJBA 1ZLHA 2D4PA 4WWVA 3IU2A 2ARHA 1CM0A 4QUSA 4X2TA 2YNCC 3VATA 1YW6A 2ZEDA 1YVOA 2JDCA 2Q7SA 4TWEA 4CPAA 4CYPA 2ZW4A 4DUKA 1TF8A 2Q51A 4C68A 3NA6A 1VHSA 2FVGA 2PE3A 3CT9A 1QSMA 2G3TA 1TF9A 2Q4YA 1X10A 1Z4RA 2JBKA 3QNVA 1VKCA 5I4MA 2WSAA 5DWNA 4GXHA 3PBEA 2Q04A 1ARMA 3TC8A 2PR8A 2XEFA 1CP6A 2AJ6A 4KVME 3WC6A 4RUHA 4MHYA 1PYTB 4NXYA 1VIXA 3LD2A 4TNUA 4M85A 4X3RA 2VEZA 1LOKA 2AFUA 2RFHA 4PV6A 4KORA 3VH9A 4NGSA 4ZY0A 2PJ3A 3B3TA 3JRUA 3WC7A 4FD7A 5LYFA 2GFQA 3FMCA 3H8FA 1LFWA 3FNCA 1S7NA 4ONUA 4QVTA 3CXQA 4E2AA 2PVVA 1AUGA 3IJ3A 2CY2A 4NGMA 3R1KA 3N5FA 4RS2A 4Y49B 2ZEFA 2EBJA 2IQ6A 4PK3A 1X12A 1U6MA 4UEFA 2YNCA 4K30A 4YRHA 4R9MA 4LQ6A 4P4JA 2WPXA 4RI1A 1XFOA 3PFOA 1CBXA 2YGWA 2BCOA 2POKA 4MCRA 2X7BA 1IGBA 4A32A 1J4JA 3PB7X 4ZX8A 4F0XA 4CYOA 1YREA 1WK4A 1Z2LA 3I1UA 1IU8A 1SQHA 2FXFA 3B3CA 4DNCA 4LQGA 2PQ8A 3SXNA 1ELLP 3H4QA 4MY3A 3BJ8A 4UIAA 3NH5A 3PB6X 2VI7A 3BJ7A 3BHXA 3FH4A 1IICA 1YVKA 4AXVA 2Q0YA 3TE4A 4JJXA 4R3KA 3FYNA 2AE6A 3ISZA 4CGMA 4IF5A 4A94A 4P45A 3V7ZA 2G9DA 4CAFA 4MFJA 4ZY1A 3D68A 4KOYA 2ZW7A 1AMPA 4NGRA 2XEGA 4OC3A 4A38A 4MHZA 3S6GA 3IGRA 2P6FA 4FBEA 1N71A 2I79A 3E0KA 1Y0RA 2C6PA 3PGPA 1CX8A 4P4IA 2VZYA 4UFWA 1M4LA 5CNPA 2WYRA 2V77A 3WR7A 4ZGYB 4K3NA 5EC4A 3FRMA 5EMIA 3R95A 1HDUA 3GIUA 1MJAA 3KI9A 4UA3A 4NGNA 4XPDB 1Q2CA 3GY9A 3A9LA 4CAXA 2R98A 4EWTA 3TX8A 2B3UA 1TIQA 4OC2A 4OC0A 2AFOA 2QJ8A 1OBRA 5AG7A 1ZG7A 3S9LA 4B11A 1R3NA 4EFDA 2J8RA 1S7FA 4JD6A 3PRTA 3TTHA 2OU2A 3JVNA 4KLVA 3S9MA 2GLFA 2B4DB 5IV0A 2FE7A 5HXDA 4LUAA 2WZNA 3D7FA 2ABZA 3NH8A 4I49A 4B6ZA 4CAWA 4W9YA 4P4BA 1YW4A 1M1DA 4KOWA 4QB9A 1XRYA 2EUIA 4UCPA 4A33A 2CTBA 3TO7A 3RO0A 3V38A 7CPAA 1QSRA 4XPKA 2J8NA 2PIZA 1XE4A 4R6TA 4Y49C 4ZX9A 2B5GB 4KUAA 4AG7A 1Y7RA 3KR4A 2F5IA 5HVGA 2CNSA 8CPAA 1VGYA 2NSMA 2ZOFA 3LACA 4FUUA 5ELYA 3W91A 2HV2A 1BPNA 3FECA 5H84A 4KOUA 3V8IA 3GUXA 5JGFA 4II9A 4OMEA 4CGLA 2ZEMA 3DGVA 2WUUA 3D66A 2QVPA 1MK4A 1BAVA 1ZG8A 4L89A 2V8GA 5HMNA 5K8NA 2JDDA 3FX6A 3PB9X 4UEEA 2NYQA 5CPAA 1Z4EA 2REFA 2ANPA 2PVWA 5F48A 3D2PA 2B5GA 1IIDA 3KZWA 5G21A 3W6XA 3VARA 3FEEA 1S7LA 3MGDA 1IOFA 1M4DA 2GE3A 2BUEA 4FD5A 3NE7A 1BPMA 2Q4ZA 4KVOE 4A30A 1XMTA 3B35A 4NJQA 3I3GA 3B3WA 1FT7A 2PSWA 1NMTA 4PXBA 2ATRA 5LYLA 1NSAA 4CGOA 3W6SA 1EE3P 4KOXA 4CYQA 4OKOA 2C6GA 5IB0A 3CZXA 2ZW5A 1RO5A 4UFVA 2PJ4A 3MN8A 3LMSA 1TKFA 4OC5A 2ZEGA 3D7HA 1QQ9A 3IIBA 3KL9A 3K2KA 2VQYA 3T8WA 3H5ZA 1P0HA 4JZ0A 4MFZA 2PRQA 2VL1A 1LAMA 1P4NA 1ELMP 4KSAA 2A4NA 3GYAA 4MY0A 4B12A 2B58A 2FS5A 2V8DA 4PSWA 3UY5A 4CRZB 1Q7LA 2CNMA 5LRJA 1YQEA 5HVHA 3OWCA 1M4IA 4MFPA 4MXUA 4EMEA 4QBJA 2GANA 3RBUA 3K9UA 2O28A 1OZPA 1M4GA 3VWEA 2OR4A 2Z3PA 4CS0B 4RN7A 4PXDA 1QSOA 1IB1E 3KASA 2PJ1A 2EK8A 2PJ6A 3G8WA 2PJ0A 3WABA 3KHXA 1I1DA 2YNDA 1H8LA 4AVCA 3IO1A 2CNTA 4QC6A 4PPZA 3KHZA 3D2MA 2Q43A 4G1PA 3NE8A 4OLLA 3TCVA 4UWIA 2PDOA 3PB4X 4R57A 4MI4A 5LRGA 2J8MA 4AG9A 3PP9A 5D29A 4C7IA 2V8HA 2C27A 2NMTA 3BI0A 4R7MA 2OB0A 2Y0MA 5A27A 4JXQA 4MJ8A 3RNZA 4FD4A 2OH1A 2D4OA 3I9SA 3HUVA 4ZYQA 4MFLA 2JBJA 3FF3A 3PZJA 3D3SA 2ZEEA 2CIJA 6CPAA 3IU1A 5JH9A 4MFQA 4NCZA 3CPAA 4A39A 1KWMA 2YNEA 2V8VA 4P4EA 4HPSA 1S60A 2PC1A 3WC5A 4A95A 2ZEOA 3KQXA 4KS9A 4UCMA 2P6EA 4PXEA 1YSJA 5F49A 4B5OA 3LWUA 3QAYA 3JTKA 4E0AA 3EO4A 2H5MA 2OZHA 4X5KA 4AVBA 4MCPA 3B3SA 4U9ZA 4Q7AA 2PJ9A 3SI2A 3N7ZA 1XOVA 2Z3KA 3WT4A 4LX9A 1IYLA 5J1QA 3MRUA 2AFSA 1Z8LA 2P6GA 5D8NA 1GYTA 2DXQA 2O53A 2PJAA 2GIVA 2BOAA 3NH4A 4M6HA 5JQ4A 4H6ZA 3GKRA 3B7IA 4DYOA 2PJ5A 2XEIA 2Z3MA 3DR8A 3VWDA 4F0YA 2ZW6A 3SJEA 2JEWA 4KOTA 3ZJ0A 5J8FA 3G3SA 4P4FA 3BXMA 1ON0A 1BLLE 2JLMA 2DPSA 2Q4VA 5HH1A 1XEBA 2VZZA 3BLNA 4F8ZA 2R8VA 4KVXA 2I3CA 1CG2A 2BL1A 1XBUA 1KUXA 3B2YA 4BD9A 4DJLA 5K8MA 2ZEHA 1KZFA 1IYKA 2GU2A 2HUZA 4OAEA 4JWPA 4C2ZA 1K4JA 3SJFA 4R3LA 1Y9KA 1DE4C 5ISVA 1PCAA 4GM5A 3SHPA 3B3VA 4IK2A 4MCSA 4OIDA 1HEEA 1YLOA 3H8EA 4CAEA 2CTCA 2Q44A 3DR6A 2RB7A 2WPWA 1YK3A 2Z10A 4FD6A 3NFZA 5F09A 1Q2DA 1RTQA 5IX3A 5K8PA 2HB6A 3D67A 3IWEA 1ARLA 3K9TA 4IUSA 4PQAA 4KSFA 1FNOA 2QMLA 1BOBA 3GB0A 2PIYA 2QECA 1VHOA 2ZELA 2EO8A 1NSLA 3ZZIA 3CPXA 1YX0A 2RC4A 4MHPA 5KTDA 4HNWB 3FVLA 3F0AA 4Z65A 3T90A 4P4DA 3S6HA 1PU9A 3QAHA 4MRIA 2KCWA 3SI1A 1B87A 1QSTA 2Z3OA 3R96A 4NEXA 4XNHC 1Y7EA 3FB3A 1XF8A 2OZUA 3KKWA 4MFKA 4GS4A 2FL4A 3D7GA 3IEHA 2FCKA 5LYIA 3SI0A 3CXSA 2G0BA 4CGPA 5KTCA 2HC9A 1ZO0A 1S3ZA 3FXTA 4M6IA 4UIBA 4A37A 4MMOA 4MHNA 2VXKA 1S7KA 2IJZA 3KQZA 3B8GA 2OZGA 1ZG9A 2FIAA 2HQYA 1CPXA 4YU9A 4AB7A 4NGQA 2Z3LA 3JUWA 2BEIA 2AFXA 4ONWA 4CAVA 4KSIA 5I0CA 5KTAA 2BO9A 1XMBA 2ZOGA 4X8IA 2C6CA 2C1CA 4HNYB 4F6AA 5F46A 5IB9A 1V0CA 4R8FA 4BINA 3PFEA 3T9YA 1S5KA 4KZTA 5C88A 2ZXVA 2JEVA 3S6KA 2CXAA 4H2KA 2REEA 4OP4A 2ODFA 2B3VA 3TOBA 4UCNA 2BSWA 1DTDA 1Z8XA 3TOAA 2R1IA 3QB8A 4BBHA 3IC1A 4OADA 2QIRA 1M44A 4NGTA 4E8OA 4PXCA 5BWAB 1B6BA 1YR0A 1Z8WA 4NF1A 3S6FA 4B10A 5G22A 2VBQA 3KGQA 3RYOA 3DDDA 4F9UA 1CJWA
chains in the Genus database with same CATH topology
2I00A 4JLYA 3C26A 2G3AA 4Q38A 5AG6A 4C2XA 5J8CA 1Q2YA 5AG5A 4XNHB 1XIXA 4UFXA 4CRYB 4PSXA 4ORFA 4JXRA 4C7HA 4KOVA 5A28A 3F5BA 2Z11A 4A2ZA 4B5PB 2B4DA 4H6UA 1Y9WA 3SXOA 4J3GA 5EBVA 3TO9A 3CXPA 1FY7A 3R9FA 2B4BA 3FIXA 4UBRA 5E96A 3P2FA 4ZBGA 4L8AA 2Z0ZA 1R57A 5JPHA 4CYNA 4AVAA 2K5TA 4U9YA 4PK2A 3TFYA 4NSQA 4M3SA 3TT2A 3LODA 2Z3NA 1KUYA 2IL4A 3DSBA 2ZPAA 3EC4A 3EXNA 4MHDA 5H86A 1KUVA 1GHEA 3DNSA 1RXTA 2Q7BA 3R9GA 1BO4A 3EY5A 4BMHA 1YGHA 4YFJA 2FSRA 2FIWA 2R7HA 2PR1A 4R87A 3TO6A 4MBUA 5AGEA 5G1ZA 3IWGA 1L0CA 4C2YA 3EFAA 1I12A 4U5YA 1NE9A 4HNXB 4CGNA 1Z9UA 5FVJA 4XPDC 4EVYA 5DWMA 5F47A 4B5PA 1WWZA 5AG4A 1YLEA 4A31A 2FT0A 4UWJA 4YGOA 1I21A 1LRZA 2P0WA 3FBUA 1MJ9A 5GCNA 1QSNA 5ISVA 4Q36A 1UFHA 4KLWA 2DPTA 2EVNA 4KOSA 4B14A 1PUAA 3D8PA 4H89A 3P2HA 4B13A 3F8KA 5C82A 3R9EA 4KUBA 5G20A 4XPLA 2PRBA 1MJBA 2D4PA 3IU2A 2ARHA 1CM0A 4QUSA 2YNCC 1YVOA 2JDCA 4CYPA 2ZW4A 4C68A 1VHSA 1QSMA 2G3TA 2Q4YA 1Z4RA 1VKCA 2WSAA 5DWNA 2Q04A 2PR8A 4KVME 2AJ6A 4NXYA 3LD2A 4M85A 2VEZA 4PV6A 4KORA 4FD7A 3FNCA 1S7NA 4ONUA 4QVTA 3CXQA 4E2AA 2CY2A 3R1KA 4RS2A 4Y49B 4PK3A 1U6MA 2YNCA 4K30A 4YRHA 4R9MA 2WPXA 4RI1A 2YGWA 2X7BA 4A32A 1J4JA 4F0XA 4CYOA 1YREA 1WK4A 1SQHA 2FXFA 4DNCA 2PQ8A 3SXNA 3H4QA 4MY3A 3BJ8A 2VI7A 3BJ7A 1IICA 1YVKA 2Q0YA 3TE4A 4JJXA 4R3KA 3FYNA 2AE6A 4CGMA 4IF5A 4CAFA 4MFJA 4KOYA 2ZW7A 3S6GA 3IGRA 2P6FA 1N71A 2I79A 3E0KA 3PGPA 2VZYA 4UFWA 5CNPA 3WR7A 4ZGYB 5EC4A 3FRMA 3R95A 1MJAA 4UA3A 4XPDB 1Q2CA 3GY9A 3A9LA 4CAXA 2R98A 2B3UA 1TIQA 5AG7A 4B11A 2J8RA 1S7FA 4JD6A 3TTHA 2OU2A 3JVNA 4KLVA 2B4DB 5IV0A 2FE7A 4LUAA 4I49A 4CAWA 1M1DA 4KOWA 4QB9A 2EUIA 4UCPA 4A33A 3TO7A 1QSRA 4XPKA 2J8NA 1XE4A 4Y49C 4AG7A 2B5GB 4KUAA 1Y7RA 2F5IA 2CNSA 3W91A 2HV2A 5H84A 4II9A 4KOUA 3V8IA 4CGLA 2WUUA 1MK4A 4L89A 5HMNA 2JDDA 1Z4EA 2REFA 5F48A 3D2PA 2B5GA 1IIDA 5G21A 3W6XA 1S7LA 3MGDA 1M4DA 2GE3A 2BUEA 4FD5A 3NE7A 4KVOE 4A30A 1XMTA 3I3GA 2PSWA 1NMTA 2ATRA 4CGOA 3W6SA 4KOXA 4CYQA 5IB0A 2ZW5A 1RO5A 4UFVA 2VQYA 3H5ZA 1P0HA 4MFZA 4KSAA 1P4NA 2A4NA 3GYAA 4MY0A 4B12A 2B58A 2FS5A 4PSWA 3UY5A 4CRZB 2CNMA 3OWCA 1M4IA 4MFPA 4QBJA 2GANA 3K9UA 2O28A 1OZPA 1M4GA 3VWEA 2Z3PA 4CS0B 1QSOA 1IB1E 3G8WA 1I1DA 2YNDA 4AVCA 2CNTA 4QC6A 3D2MA 4OLLA 3TCVA 4UWIA 2PDOA 4R57A 4MI4A 2J8MA 4AG9A 3PP9A 4C7IA 2C27A 2NMTA 5A27A 2OB0A 2Y0MA 4JXQA 4MJ8A 4FD4A 2OH1A 2D4OA 3I9SA 4MFLA 3PZJA 3D3SA 3IU1A 4MFQA 4NCZA 2YNEA 1S60A 2PC1A 4A95A 4UCMA 4KS9A 2P6EA 5F49A 4B5OA 3JTKA 4E0AA 3EO4A 2H5MA 2OZHA 4X5KA 4AVBA 4U9ZA 3N7ZA 2Z3KA 4LX9A 1IYLA 2P6GA 2DXQA 2GIVA 5JQ4A 4H6ZA 3GKRA 2Z3MA 4F0YA 3DR8A 3VWDA 2ZW6A 4KOTA 3ZJ0A 5J8FA 3G3SA 1ON0A 2JLMA 2DPSA 2Q4VA 5HH1A 1XEBA 2VZZA 3BLNA 2R8VA 4KVXA 2BL1A 1KUXA 1KZFA 1IYKA 4OAEA 2HUZA 4JWPA 4C2ZA 1K4JA 4R3LA 1Y9KA 3SHPA 4CAEA 2Q44A 3DR6A 2WPWA 1YK3A 2Z10A 4FD6A 1Q2DA 5IX3A 3IWEA 4IUSA 4KSFA 2QMLA 1BOBA 2QECA 1NSLA 3ZZIA 1YX0A 2RC4A 5KTDA 4HNWB 3F0AA 3T90A 3S6HA 1PU9A 3QAHA 2KCWA 1B87A 1QSTA 2Z3OA 3R96A 4NEXA 4XNHC 3FB3A 1XF8A 2OZUA 3KKWA 1CJWA 4MFKA 4GS4A 2FL4A 2FCKA 3CXSA 2G0BA 4CGPA 5KTCA 1ZO0A 1S3ZA 3FXTA 2VXKA 1S7KA 3B8GA 2OZGA 4AB7A 2FIAA 2HQYA 2Z3LA 3JUWA 2BEIA 4CAVA 5I0CA 5KTAA 4HNYB 4F6AA 5F46A 1V0CA 3T9YA 1S5KA 4KZTA 5C88A 2ZXVA 2JEVA 3S6KA 2CXAA 2REEA 2B3VA 3TOBA 4UCNA 2BSWA 3TOAA 2R1IA 3QB8A 4BBHA 4OADA 2QIRA 1M44A 4E8OA 5BWAB 1B6BA 1YR0A 4NF1A 3S6FA 4B10A 5G22A 2VBQA 3RYOA 3DDDA 4HKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I00 A;  4JLY A;  3C26 A;  2G3A A;  5J8C A;  1Q2Y A;  4XNH B;  1XIX A;  4CRY B;  4PSX A;  4ORF A;  4JXR A;  4KOV A;  3F5B A;  2Z11 A;  4B5P B;  2B4D A;  4H6U A;  1Y9W A;  3SXO A;  4J3G A;  5EBV A;  3TO9 A;  3CXP A;  1FY7 A;  3R9F A;  2B4B A;  3FIX A;  4UBR A;  5E96 A;  3P2F A;  4ZBG A;  4L8A A;  2Z0Z A;  1R57 A;  5JPH A;  4AVA A;  2K5T A;  4U9Y A;  4PK2 A;  3TFY A;  4NSQ A;  4M3S A;  3TT2 A;  3LOD A;  1KUY A;  2IL4 A;  3DSB A;  2ZPA A;  3EC4 A;  3EXN A;  4MHD A;  5H86 A;  1KUV A;  1GHE A;  3DNS A;  1RXT A;  2Q7B A;  3R9G A;  1BO4 A;  3EY5 A;  4BMH A;  1YGH A;  4YFJ A;  2FSR A;  2FIW A;  2R7H A;  2PR1 A;  4R87 A;  3TO6 A;  4MBU A;  3IWG A;  1L0C A;  3EFA A;  1I12 A;  4U5Y A;  1NE9 A;  4HNX B;  1Z9U A;  5FVJ A;  4XPD C;  4EVY A;  5DWM A;  5F47 A;  4B5P A;  1WWZ A;  1YLE A;  2FT0 A;  4UWJ A;  4YGO A;  1I21 A;  1LRZ A;  2P0W A;  3FBU A;  1MJ9 A;  5GCN A;  1QSN A;  5ISV A;  1UFH A;  4KLW A;  2EVN A;  4KOS A;  1PUA A;  3D8P A;  4H89 A;  3P2H A;  3F8K A;  5C82 A;  3R9E A;  4KUB A;  4XPL A;  2PRB A;  1MJB A;  2D4P A;  2ARH A;  1CM0 A;  4QUS A;  1YVO A;  2JDC A;  2ZW4 A;  1VHS A;  1QSM A;  2G3T A;  2Q4Y A;  1Z4R A;  1VKC A;  5DWN A;  2Q04 A;  2PR8 A;  4KVM E;  2AJ6 A;  4NXY A;  3LD2 A;  4M85 A;  2VEZ A;  4PV6 A;  4KOR A;  4FD7 A;  3FNC A;  1S7N A;  4ONU A;  4QVT A;  3CXQ A;  4E2A A;  2CY2 A;  3R1K A;  4RS2 A;  4Y49 B;  4PK3 A;  1U6M A;  4K30 A;  4YRH A;  4R9M A;  2WPX A;  4RI1 A;  2X7B A;  1J4J A;  1YRE A;  1WK4 A;  1SQH A;  2FXF A;  4DNC A;  2PQ8 A;  3SXN A;  3H4Q A;  4MY3 A;  3BJ8 A;  2VI7 A;  3BJ7 A;  1IIC A;  1YVK A;  2Q0Y A;  3TE4 A;  4JJX A;  4R3K A;  3FYN A;  2AE6 A;  4IF5 A;  4KOY A;  2ZW7 A;  3S6G A;  3IGR A;  2P6F A;  1N71 A;  2I79 A;  3E0K A;  3PGP A;  2VZY A;  5CNP A;  3WR7 A;  5EC4 A;  3FRM A;  3R95 A;  1MJA A;  4UA3 A;  4XPD B;  1Q2C A;  3GY9 A;  4CAX A;  2R98 A;  2B3U A;  1TIQ A;  2J8R A;  1S7F A;  4JD6 A;  3TTH A;  2OU2 A;  3JVN A;  4KLV A;  2B4D B;  5IV0 A;  2FE7 A;  4LUA A;  4I49 A;  4CAW A;  1M1D A;  4KOW A;  4QB9 A;  2EUI A;  3TO7 A;  1QSR A;  4XPK A;  2J8N A;  1XE4 A;  4Y49 C;  4AG7 A;  2B5G B;  4KUA A;  1Y7R A;  2F5I A;  2CNS A;  3W91 A;  2HV2 A;  5H84 A;  4II9 A;  4KOU A;  3V8I A;  1MK4 A;  4L89 A;  5HMN A;  2JDD A;  1Z4E A;  2REF A;  5F48 A;  3D2P A;  2B5G A;  1IID A;  3W6X A;  1S7L A;  3MGD A;  1M4D A;  2GE3 A;  2BUE A;  4FD5 A;  3NE7 A;  4KVO E;  1XMT A;  3I3G A;  2PSW A;  1NMT A;  2ATR A;  3W6S A;  4KOX A;  5IB0 A;  2ZW5 A;  1RO5 A;  2VQY A;  1P0H A;  1P4N A;  2A4N A;  3GYA A;  4MY0 A;  2B58 A;  2FS5 A;  4PSW A;  3UY5 A;  4CRZ B;  2CNM A;  3OWC A;  1M4I A;  4QBJ A;  2GAN A;  3K9U A;  2O28 A;  1OZP A;  1M4G A;  3VWE A;  4CS0 B;  1QSO A;  1IB1 E;  3G8W A;  1I1D A;  4AVC A;  2CNT A;  4QC6 A;  3D2M A;  4OLL A;  3TCV A;  4UWI A;  2PDO A;  4R57 A;  4MI4 A;  2J8M A;  4AG9 A;  3PP9 A;  2C27 A;  2NMT A;  2OB0 A;  2Y0M A;  4MJ8 A;  4JXQ A;  4FD4 A;  2OH1 A;  2D4O A;  3I9S A;  3PZJ A;  3D3S A;  4NCZ A;  1S60 A;  2PC1 A;  2P6E A;  5F49 A;  4B5O A;  4E0A A;  3EO4 A;  2H5M A;  2OZH A;  4X5K A;  4AVB A;  4U9Z A;  3N7Z A;  4LX9 A;  1IYL A;  2P6G A;  2DXQ A;  2GIV A;  5JQ4 A;  4H6Z A;  3GKR A;  4F0Y A;  3DR8 A;  3VWD A;  2ZW6 A;  4KOT A;  3ZJ0 A;  5J8F A;  3G3S A;  1ON0 A;  2JLM A;  2Q4V A;  5HH1 A;  1XEB A;  2VZZ A;  3BLN A;  2R8V A;  4KVX A;  2BL1 A;  1KUX A;  1KZF A;  1IYK A;  4OAE A;  2HUZ A;  4JWP A;  1K4J A;  4R3L A;  1Y9K A;  3SHP A;  2Q44 A;  3DR6 A;  2WPW A;  1YK3 A;  2Z10 A;  4FD6 A;  1Q2D A;  5IX3 A;  4IUS A;  2QML A;  1BOB A;  2QEC A;  1NSL A;  3ZZI A;  1YX0 A;  2RC4 A;  5KTD A;  4HNW B;  3F0A A;  3T90 A;  3S6H A;  1PU9 A;  3QAH A;  2KCW A;  1B87 A;  1QST A;  3R96 A;  4NEX A;  4XNH C;  3FB3 A;  1XF8 A;  2OZU A;  3KKW A;  1CJW A;  4GS4 A;  2FL4 A;  2FCK A;  3CXS A;  2G0B A;  5KTC A;  1S3Z A;  3FXT A;  2VXK A;  1S7K A;  3B8G A;  2OZG A;  4AB7 A;  2FIA A;  2HQY A;  4CAV A;  3JUW A;  2BEI A;  5I0C A;  5KTA A;  4HNY B;  4F6A A;  5F46 A;  1V0C A;  3T9Y A;  1S5K A;  4KZT A;  5C88 A;  2ZXV A;  2JEV A;  3S6K A;  2REE A;  2B3V A;  3TOB A;  2BSW A;  3TOA A;  2R1I A;  3QB8 A;  4OAD A;  2QIR A;  1M44 A;  4E8O A;  1B6B A;  1YR0 A;  4NF1 A;  3S6F A;  2VBQ A;  3RYO A;  3DDD A;  4HKF A; 
#chains in the Genus database with same CATH topology
 1LCP A;  4UF4 A;  2DF5 A;  2I00 A;  4JLY A;  3C26 A;  2G3A A;  4Q38 A;  5AG6 A;  5HVF A;  4C2X A;  4P10 A;  3L2N A;  5J8C A;  1F2O A;  1Q2Y A;  3GLJ A;  5AG5 A;  4XNH B;  1XIX A;  2CF4 A;  4UFX A;  5LYD A;  4CRY B;  4HKF A;  3D4U A;  4PSX A;  4ORF A;  1Z5R A;  3KR5 A;  2PJC A;  4JXR A;  5DS0 A;  4C7H A;  1XJO A;  1YME A;  4KOV A;  5A28 A;  3F5B A;  2PJB A;  1ZLI A;  5JM6 A;  2Z11 A;  4A2Z A;  1IY7 A;  4B5P B;  2B4D A;  4H6U A;  1Y9W A;  3IFE A;  1JQG A;  2F8H A;  3SXO A;  4J3G A;  2EWB A;  4ZY2 A;  5EBV A;  3TO9 A;  3CXP A;  4UEZ A;  1FY7 A;  1Y0Y A;  2B4B A;  3R9F A;  4FAI A;  5THW A;  3FIX A;  4UBR A;  3HLP A;  5E96 A;  3P2F A;  4ZBG A;  4L8A A;  4IHM A;  2AFZ A;  3SJG A;  2Z0Z A;  3FED A;  3PEI A;  5K8O A;  1R57 A;  5JPH A;  4NGP A;  4AVA A;  4CYN A;  4P6Y A;  2K5T A;  4U9Y A;  4OC1 A;  5LRK A;  1TXR A;  2F7V A;  2QYV A;  4JYW A;  4PK2 A;  3TFY A;  1F2P A;  4NJR A;  2PJ2 A;  4NFR A;  2DEA A;  4M3S A;  4NSQ A;  3TT2 A;  3LOD A;  4FWU A;  2Z3N A;  3IWW A;  4ZI6 A;  1KUY A;  2IL4 A;  3DSB A;  2ZPA A;  3EC4 A;  3EXN A;  4MHD A;  3D7D A;  4IAV A;  1CPS A;  1LAN A;  2XEJ A;  1KUV A;  1GHE A;  3DNS A;  3ISX A;  5H86 A;  1RXT A;  2ZEP A;  2Q7B A;  2ZEN A;  1UWY A;  3FJU A;  2OOT A;  1TKH A;  3R9G A;  1BO4 A;  3EY5 A;  4R76 A;  4BMH A;  4F9V A;  3SJX A;  1CP7 A;  2J9A A;  1YGH A;  4YFJ A;  4OIW A;  2FSR A;  2FIW A;  2O4H A;  3BI1 A;  1A2Z A;  2R7H A;  3RAM A;  2PR1 A;  1VHE A;  4R87 A;  3TO6 A;  2GRE A;  1LAP A;  2PJ7 A;  4MBU A;  1F57 A;  5AGE A;  5G1Z A;  3IWG A;  1L0C A;  4C2Y A;  3EFA A;  1I12 A;  4U5Y A;  2AFM A;  2PCU A;  3PBB A;  1NE9 A;  4YWY A;  4HNX B;  4CGN A;  3S9N A;  2PJ8 A;  3PB8 X;  2IMO A;  1Z9U A;  2EK9 A;  2AFW A;  3CDX A;  4M6G A;  4MCQ A;  5FVJ A;  4XPD C;  4EVY A;  1R43 A;  3H8G A;  5DWM A;  5F47 A;  4B5P A;  1WWZ A;  4OC4 A;  1YLE A;  4A31 A;  5AG4 A;  2FT0 A;  4UWJ A;  4YGO A;  1I21 A;  1LRZ A;  2P0W A;  3FBU A;  1MJ9 A;  1TKJ A;  1QSN A;  5GCN A;  4Q36 A;  3RZA A;  4O23 A;  1Z8T A;  1UFH A;  1JWQ A;  2GLJ A;  1HDQ A;  1QMU A;  2DPT A;  4KLW A;  1AYE A;  2EVN A;  4P44 A;  4KOS A;  4B14 A;  1PUA A;  3D8P A;  3DLJ A;  4H89 A;  5CBM A;  3P2H A;  4WJB A;  1IOI A;  3F8K A;  4B13 A;  5C82 A;  3R9E A;  4KUB A;  5G20 A;  4XPL A;  2PRB A;  1MJB A;  1ZLH A;  2D4P A;  4WWV A;  3IU2 A;  2ARH A;  1CM0 A;  4QUS A;  4X2T A;  2YNC C;  3VAT A;  1YW6 A;  2ZED A;  1YVO A;  2JDC A;  2Q7S A;  4TWE A;  4CPA A;  4CYP A;  2ZW4 A;  4DUK A;  1TF8 A;  2Q51 A;  4C68 A;  3NA6 A;  1VHS A;  2FVG A;  2PE3 A;  3CT9 A;  1QSM A;  2G3T A;  1TF9 A;  2Q4Y A;  1X10 A;  1Z4R A;  2JBK A;  3QNV A;  1VKC A;  5I4M A;  2WSA A;  5DWN A;  4GXH A;  3PBE A;  2Q04 A;  1ARM A;  3TC8 A;  2PR8 A;  2XEF A;  1CP6 A;  2AJ6 A;  4KVM E;  3WC6 A;  4RUH A;  4MHY A;  1PYT B;  4NXY A;  1VIX A;  3LD2 A;  4TNU A;  4M85 A;  4X3R A;  2VEZ A;  1LOK A;  2AFU A;  2RFH A;  4PV6 A;  4KOR A;  3VH9 A;  4NGS A;  4ZY0 A;  2PJ3 A;  3B3T A;  3JRU A;  3WC7 A;  4FD7 A;  5LYF A;  2GFQ A;  3FMC A;  3H8F A;  1LFW A;  3FNC A;  1S7N A;  4ONU A;  4QVT A;  3CXQ A;  4E2A A;  2PVV A;  1AUG A;  3IJ3 A;  2CY2 A;  4NGM A;  3R1K A;  3N5F A;  4RS2 A;  4Y49 B;  2ZEF A;  2EBJ A;  2IQ6 A;  4PK3 A;  1X12 A;  1U6M A;  4UEF A;  2YNC A;  4K30 A;  4YRH A;  4R9M A;  4LQ6 A;  4P4J A;  2WPX A;  4RI1 A;  1XFO A;  3PFO A;  1CBX A;  2YGW A;  2BCO A;  2POK A;  4MCR A;  2X7B A;  1IGB A;  4A32 A;  1J4J A;  3PB7 X;  4ZX8 A;  4F0X A;  4CYO A;  1YRE A;  1WK4 A;  1Z2L A;  3I1U A;  1IU8 A;  1SQH A;  2FXF A;  3B3C A;  4DNC A;  4LQG A;  2PQ8 A;  3SXN A;  1ELL P;  3H4Q A;  4MY3 A;  3BJ8 A;  4UIA A;  3NH5 A;  3PB6 X;  2VI7 A;  3BJ7 A;  3BHX A;  3FH4 A;  1IIC A;  1YVK A;  4AXV A;  2Q0Y A;  3TE4 A;  4JJX A;  4R3K A;  3FYN A;  2AE6 A;  3ISZ A;  4CGM A;  4IF5 A;  4A94 A;  4P45 A;  3V7Z A;  2G9D A;  4CAF A;  4MFJ A;  4ZY1 A;  3D68 A;  4KOY A;  2ZW7 A;  1AMP A;  4NGR A;  2XEG A;  4OC3 A;  4A38 A;  4MHZ A;  3S6G A;  3IGR A;  2P6F A;  4FBE A;  1N71 A;  2I79 A;  3E0K A;  1Y0R A;  2C6P A;  3PGP A;  1CX8 A;  4P4I A;  2VZY A;  4UFW A;  1M4L A;  5CNP A;  2WYR A;  2V77 A;  3WR7 A;  4ZGY B;  4K3N A;  5EC4 A;  3FRM A;  5EMI A;  3R95 A;  1HDU A;  3GIU A;  1MJA A;  3KI9 A;  4UA3 A;  4NGN A;  4XPD B;  1Q2C A;  3GY9 A;  3A9L A;  4CAX A;  2R98 A;  4EWT A;  3TX8 A;  2B3U A;  1TIQ A;  4OC2 A;  4OC0 A;  2AFO A;  2QJ8 A;  1OBR A;  5AG7 A;  1ZG7 A;  3S9L A;  4B11 A;  1R3N A;  4EFD A;  2J8R A;  1S7F A;  4JD6 A;  3PRT A;  3TTH A;  2OU2 A;  3JVN A;  4KLV A;  3S9M A;  2GLF A;  2B4D B;  5IV0 A;  2FE7 A;  5HXD A;  4LUA A;  2WZN A;  3D7F A;  2ABZ A;  3NH8 A;  4I49 A;  4B6Z A;  4CAW A;  4W9Y A;  4P4B A;  1YW4 A;  1M1D A;  4KOW A;  4QB9 A;  1XRY A;  2EUI A;  4UCP A;  4A33 A;  2CTB A;  3TO7 A;  3RO0 A;  3V38 A;  7CPA A;  1QSR A;  4XPK A;  2J8N A;  2PIZ A;  1XE4 A;  4R6T A;  4Y49 C;  4ZX9 A;  2B5G B;  4KUA A;  4AG7 A;  1Y7R A;  3KR4 A;  2F5I A;  5HVG A;  2CNS A;  8CPA A;  1VGY A;  2NSM A;  2ZOF A;  3LAC A;  4FUU A;  5ELY A;  3W91 A;  2HV2 A;  1BPN A;  3FEC A;  5H84 A;  4KOU A;  3V8I A;  3GUX A;  5JGF A;  4II9 A;  4OME A;  4CGL A;  2ZEM A;  3DGV A;  2WUU A;  3D66 A;  2QVP A;  1MK4 A;  1BAV A;  1ZG8 A;  4L89 A;  2V8G A;  5HMN A;  5K8N A;  2JDD A;  3FX6 A;  3PB9 X;  4UEE A;  2NYQ A;  5CPA A;  1Z4E A;  2REF A;  2ANP A;  2PVW A;  5F48 A;  3D2P A;  2B5G A;  1IID A;  3KZW A;  5G21 A;  3W6X A;  3VAR A;  3FEE A;  1S7L A;  3MGD A;  1IOF A;  1M4D A;  2GE3 A;  2BUE A;  4FD5 A;  3NE7 A;  1BPM A;  2Q4Z A;  4KVO E;  4A30 A;  1XMT A;  3B35 A;  4NJQ A;  3I3G A;  3B3W A;  1FT7 A;  2PSW A;  1NMT A;  4PXB A;  2ATR A;  5LYL A;  1NSA A;  4CGO A;  3W6S A;  1EE3 P;  4KOX A;  4CYQ A;  4OKO A;  2C6G A;  5IB0 A;  3CZX A;  2ZW5 A;  1RO5 A;  4UFV A;  2PJ4 A;  3MN8 A;  3LMS A;  1TKF A;  4OC5 A;  2ZEG A;  3D7H A;  1QQ9 A;  3IIB A;  3KL9 A;  3K2K A;  2VQY A;  3T8W A;  3H5Z A;  1P0H A;  4JZ0 A;  4MFZ A;  2PRQ A;  2VL1 A;  1LAM A;  1P4N A;  1ELM P;  4KSA A;  2A4N A;  3GYA A;  4MY0 A;  4B12 A;  2B58 A;  2FS5 A;  2V8D A;  4PSW A;  3UY5 A;  4CRZ B;  1Q7L A;  2CNM A;  5LRJ A;  1YQE A;  5HVH A;  3OWC A;  1M4I A;  4MFP A;  4MXU A;  4EME A;  4QBJ A;  2GAN A;  3RBU A;  3K9U A;  2O28 A;  1OZP A;  1M4G A;  3VWE A;  2OR4 A;  2Z3P A;  4CS0 B;  4RN7 A;  4PXD A;  1QSO A;  1IB1 E;  3KAS A;  2PJ1 A;  2EK8 A;  2PJ6 A;  3G8W A;  2PJ0 A;  3WAB A;  3KHX A;  1I1D A;  2YND A;  1H8L A;  4AVC A;  3IO1 A;  2CNT A;  4QC6 A;  4PPZ A;  3KHZ A;  3D2M A;  2Q43 A;  4G1P A;  3NE8 A;  4OLL A;  3TCV A;  4UWI A;  2PDO A;  3PB4 X;  4R57 A;  4MI4 A;  5LRG A;  2J8M A;  4AG9 A;  3PP9 A;  5D29 A;  4C7I A;  2V8H A;  2C27 A;  2NMT A;  3BI0 A;  4R7M A;  2OB0 A;  2Y0M A;  5A27 A;  4JXQ A;  4MJ8 A;  3RNZ A;  4FD4 A;  2OH1 A;  2D4O A;  3I9S A;  3HUV A;  4ZYQ A;  4MFL A;  2JBJ A;  3FF3 A;  3PZJ A;  3D3S A;  2ZEE A;  2CIJ A;  6CPA A;  3IU1 A;  5JH9 A;  4MFQ A;  4NCZ A;  3CPA A;  4A39 A;  1KWM A;  2YNE A;  2V8V A;  4P4E A;  4HPS A;  1S60 A;  2PC1 A;  3WC5 A;  4A95 A;  2ZEO A;  3KQX A;  4KS9 A;  4UCM A;  2P6E A;  4PXE A;  1YSJ A;  5F49 A;  4B5O A;  3LWU A;  3QAY A;  3JTK A;  4E0A A;  3EO4 A;  2H5M A;  2OZH A;  4X5K A;  4AVB A;  4MCP A;  3B3S A;  4U9Z A;  4Q7A A;  2PJ9 A;  3SI2 A;  3N7Z A;  1XOV A;  2Z3K A;  3WT4 A;  4LX9 A;  1IYL A;  5J1Q A;  3MRU A;  2AFS A;  1Z8L A;  2P6G A;  5D8N A;  1GYT A;  2DXQ A;  2O53 A;  2PJA A;  2GIV A;  2BOA A;  3NH4 A;  4M6H A;  5JQ4 A;  4H6Z A;  3GKR A;  3B7I A;  4DYO A;  2PJ5 A;  2XEI A;  2Z3M A;  3DR8 A;  3VWD A;  4F0Y A;  2ZW6 A;  3SJE A;  2JEW A;  4KOT A;  3ZJ0 A;  5J8F A;  3G3S A;  4P4F A;  3BXM A;  1ON0 A;  1BLL E;  2JLM A;  2DPS A;  2Q4V A;  5HH1 A;  1XEB A;  2VZZ A;  3BLN A;  4F8Z A;  2R8V A;  4KVX A;  2I3C A;  1CG2 A;  2BL1 A;  1XBU A;  1KUX A;  3B2Y A;  4BD9 A;  4DJL A;  5K8M A;  2ZEH A;  1KZF A;  1IYK A;  2GU2 A;  2HUZ A;  4OAE A;  4JWP A;  4C2Z A;  1K4J A;  3SJF A;  4R3L A;  1Y9K A;  1DE4 C;  5ISV A;  1PCA A;  4GM5 A;  3SHP A;  3B3V A;  4IK2 A;  4MCS A;  4OID A;  1HEE A;  1YLO A;  3H8E A;  4CAE A;  2CTC A;  2Q44 A;  3DR6 A;  2RB7 A;  2WPW A;  1YK3 A;  2Z10 A;  4FD6 A;  3NFZ A;  5F09 A;  1Q2D A;  1RTQ A;  5IX3 A;  5K8P A;  2HB6 A;  3D67 A;  3IWE A;  1ARL A;  3K9T A;  4IUS A;  4PQA A;  4KSF A;  1FNO A;  2QML A;  1BOB A;  3GB0 A;  2PIY A;  2QEC A;  1VHO A;  2ZEL A;  2EO8 A;  1NSL A;  3ZZI A;  3CPX A;  1YX0 A;  2RC4 A;  4MHP A;  5KTD A;  4HNW B;  3FVL A;  3F0A A;  4Z65 A;  3T90 A;  4P4D A;  3S6H A;  1PU9 A;  3QAH A;  4MRI A;  2KCW A;  3SI1 A;  1B87 A;  1QST A;  2Z3O A;  3R96 A;  4NEX A;  4XNH C;  1Y7E A;  3FB3 A;  1XF8 A;  2OZU A;  3KKW A;  4MFK A;  4GS4 A;  2FL4 A;  3D7G A;  3IEH A;  2FCK A;  5LYI A;  3SI0 A;  3CXS A;  2G0B A;  4CGP A;  5KTC A;  2HC9 A;  1ZO0 A;  1S3Z A;  3FXT A;  4M6I A;  4UIB A;  4A37 A;  4MMO A;  4MHN A;  2VXK A;  1S7K A;  2IJZ A;  3KQZ A;  3B8G A;  2OZG A;  1ZG9 A;  2FIA A;  2HQY A;  1CPX A;  4YU9 A;  4AB7 A;  4NGQ A;  2Z3L A;  3JUW A;  2BEI A;  2AFX A;  4ONW A;  4CAV A;  4KSI A;  5I0C A;  5KTA A;  2BO9 A;  1XMB A;  2ZOG A;  4X8I A;  2C6C A;  2C1C A;  4HNY B;  4F6A A;  5F46 A;  5IB9 A;  1V0C A;  4R8F A;  4BIN A;  3PFE A;  3T9Y A;  1S5K A;  4KZT A;  5C88 A;  2ZXV A;  2JEV A;  3S6K A;  2CXA A;  4H2K A;  2REE A;  4OP4 A;  2ODF A;  2B3V A;  3TOB A;  4UCN A;  2BSW A;  1DTD A;  1Z8X A;  3TOA A;  2R1I A;  3QB8 A;  4BBH A;  3IC1 A;  4OAD A;  2QIR A;  1M44 A;  4NGT A;  4E8O A;  4PXC A;  5BWA B;  1B6B A;  1YR0 A;  1Z8W A;  4NF1 A;  3S6F A;  4B10 A;  5G22 A;  2VBQ A;  3KGQ A;  3RYO A;  3DDD A;  4F9U A;  1CJW A; 
#chains in the Genus database with same CATH homology
 2I00 A;  4JLY A;  3C26 A;  2G3A A;  4Q38 A;  5AG6 A;  4C2X A;  5J8C A;  1Q2Y A;  5AG5 A;  4XNH B;  1XIX A;  4UFX A;  4CRY B;  4PSX A;  4ORF A;  4JXR A;  4C7H A;  4KOV A;  5A28 A;  3F5B A;  2Z11 A;  4A2Z A;  4B5P B;  2B4D A;  4H6U A;  1Y9W A;  3SXO A;  4J3G A;  5EBV A;  3TO9 A;  3CXP A;  1FY7 A;  3R9F A;  2B4B A;  3FIX A;  4UBR A;  5E96 A;  3P2F A;  4ZBG A;  4L8A A;  2Z0Z A;  1R57 A;  5JPH A;  4CYN A;  4AVA A;  2K5T A;  4U9Y A;  4PK2 A;  3TFY A;  4NSQ A;  4M3S A;  3TT2 A;  3LOD A;  2Z3N A;  1KUY A;  2IL4 A;  3DSB A;  2ZPA A;  3EC4 A;  3EXN A;  4MHD A;  5H86 A;  1KUV A;  1GHE A;  3DNS A;  1RXT A;  2Q7B A;  3R9G A;  1BO4 A;  3EY5 A;  4BMH A;  1YGH A;  4YFJ A;  2FSR A;  2FIW A;  2R7H A;  2PR1 A;  4R87 A;  3TO6 A;  4MBU A;  5AGE A;  5G1Z A;  3IWG A;  1L0C A;  4C2Y A;  3EFA A;  1I12 A;  4U5Y A;  1NE9 A;  4HNX B;  4CGN A;  1Z9U A;  5FVJ A;  4XPD C;  4EVY A;  5DWM A;  5F47 A;  4B5P A;  1WWZ A;  5AG4 A;  1YLE A;  4A31 A;  2FT0 A;  4UWJ A;  4YGO A;  1I21 A;  1LRZ A;  2P0W A;  3FBU A;  1MJ9 A;  5GCN A;  1QSN A;  5ISV A;  4Q36 A;  1UFH A;  4KLW A;  2DPT A;  2EVN A;  4KOS A;  4B14 A;  1PUA A;  3D8P A;  4H89 A;  3P2H A;  4B13 A;  3F8K A;  5C82 A;  3R9E A;  4KUB A;  5G20 A;  4XPL A;  2PRB A;  1MJB A;  2D4P A;  3IU2 A;  2ARH A;  1CM0 A;  4QUS A;  2YNC C;  1YVO A;  2JDC A;  4CYP A;  2ZW4 A;  4C68 A;  1VHS A;  1QSM A;  2G3T A;  2Q4Y A;  1Z4R A;  1VKC A;  2WSA A;  5DWN A;  2Q04 A;  2PR8 A;  4KVM E;  2AJ6 A;  4NXY A;  3LD2 A;  4M85 A;  2VEZ A;  4PV6 A;  4KOR A;  4FD7 A;  3FNC A;  1S7N A;  4ONU A;  4QVT A;  3CXQ A;  4E2A A;  2CY2 A;  3R1K A;  4RS2 A;  4Y49 B;  4PK3 A;  1U6M A;  2YNC A;  4K30 A;  4YRH A;  4R9M A;  2WPX A;  4RI1 A;  2YGW A;  2X7B A;  4A32 A;  1J4J A;  4F0X A;  4CYO A;  1YRE A;  1WK4 A;  1SQH A;  2FXF A;  4DNC A;  2PQ8 A;  3SXN A;  3H4Q A;  4MY3 A;  3BJ8 A;  2VI7 A;  3BJ7 A;  1IIC A;  1YVK A;  2Q0Y A;  3TE4 A;  4JJX A;  4R3K A;  3FYN A;  2AE6 A;  4CGM A;  4IF5 A;  4CAF A;  4MFJ A;  4KOY A;  2ZW7 A;  3S6G A;  3IGR A;  2P6F A;  1N71 A;  2I79 A;  3E0K A;  3PGP A;  2VZY A;  4UFW A;  5CNP A;  3WR7 A;  4ZGY B;  5EC4 A;  3FRM A;  3R95 A;  1MJA A;  4UA3 A;  4XPD B;  1Q2C A;  3GY9 A;  3A9L A;  4CAX A;  2R98 A;  2B3U A;  1TIQ A;  5AG7 A;  4B11 A;  2J8R A;  1S7F A;  4JD6 A;  3TTH A;  2OU2 A;  3JVN A;  4KLV A;  2B4D B;  5IV0 A;  2FE7 A;  4LUA A;  4I49 A;  4CAW A;  1M1D A;  4KOW A;  4QB9 A;  2EUI A;  4UCP A;  4A33 A;  3TO7 A;  1QSR A;  4XPK A;  2J8N A;  1XE4 A;  4Y49 C;  4AG7 A;  2B5G B;  4KUA A;  1Y7R A;  2F5I A;  2CNS A;  3W91 A;  2HV2 A;  5H84 A;  4II9 A;  4KOU A;  3V8I A;  4CGL A;  2WUU A;  1MK4 A;  4L89 A;  5HMN A;  2JDD A;  1Z4E A;  2REF A;  5F48 A;  3D2P A;  2B5G A;  1IID A;  5G21 A;  3W6X A;  1S7L A;  3MGD A;  1M4D A;  2GE3 A;  2BUE A;  4FD5 A;  3NE7 A;  4KVO E;  4A30 A;  1XMT A;  3I3G A;  2PSW A;  1NMT A;  2ATR A;  4CGO A;  3W6S A;  4KOX A;  4CYQ A;  5IB0 A;  2ZW5 A;  1RO5 A;  4UFV A;  2VQY A;  3H5Z A;  1P0H A;  4MFZ A;  4KSA A;  1P4N A;  2A4N A;  3GYA A;  4MY0 A;  4B12 A;  2B58 A;  2FS5 A;  4PSW A;  3UY5 A;  4CRZ B;  2CNM A;  3OWC A;  1M4I A;  4MFP A;  4QBJ A;  2GAN A;  3K9U A;  2O28 A;  1OZP A;  1M4G A;  3VWE A;  2Z3P A;  4CS0 B;  1QSO A;  1IB1 E;  3G8W A;  1I1D A;  2YND A;  4AVC A;  2CNT A;  4QC6 A;  3D2M A;  4OLL A;  3TCV A;  4UWI A;  2PDO A;  4R57 A;  4MI4 A;  2J8M A;  4AG9 A;  3PP9 A;  4C7I A;  2C27 A;  2NMT A;  5A27 A;  2OB0 A;  2Y0M A;  4JXQ A;  4MJ8 A;  4FD4 A;  2OH1 A;  2D4O A;  3I9S A;  4MFL A;  3PZJ A;  3D3S A;  3IU1 A;  4MFQ A;  4NCZ A;  2YNE A;  1S60 A;  2PC1 A;  4A95 A;  4UCM A;  4KS9 A;  2P6E A;  5F49 A;  4B5O A;  3JTK A;  4E0A A;  3EO4 A;  2H5M A;  2OZH A;  4X5K A;  4AVB A;  4U9Z A;  3N7Z A;  2Z3K A;  4LX9 A;  1IYL A;  2P6G A;  2DXQ A;  2GIV A;  5JQ4 A;  4H6Z A;  3GKR A;  2Z3M A;  4F0Y A;  3DR8 A;  3VWD A;  2ZW6 A;  4KOT A;  3ZJ0 A;  5J8F A;  3G3S A;  1ON0 A;  2JLM A;  2DPS A;  2Q4V A;  5HH1 A;  1XEB A;  2VZZ A;  3BLN A;  2R8V A;  4KVX A;  2BL1 A;  1KUX A;  1KZF A;  1IYK A;  4OAE A;  2HUZ A;  4JWP A;  4C2Z A;  1K4J A;  4R3L A;  1Y9K A;  3SHP A;  4CAE A;  2Q44 A;  3DR6 A;  2WPW A;  1YK3 A;  2Z10 A;  4FD6 A;  1Q2D A;  5IX3 A;  3IWE A;  4IUS A;  4KSF A;  2QML A;  1BOB A;  2QEC A;  1NSL A;  3ZZI A;  1YX0 A;  2RC4 A;  5KTD A;  4HNW B;  3F0A A;  3T90 A;  3S6H A;  1PU9 A;  3QAH A;  2KCW A;  1B87 A;  1QST A;  2Z3O A;  3R96 A;  4NEX A;  4XNH C;  3FB3 A;  1XF8 A;  2OZU A;  3KKW A;  1CJW A;  4MFK A;  4GS4 A;  2FL4 A;  2FCK A;  3CXS A;  2G0B A;  4CGP A;  5KTC A;  1ZO0 A;  1S3Z A;  3FXT A;  2VXK A;  1S7K A;  3B8G A;  2OZG A;  4AB7 A;  2FIA A;  2HQY A;  2Z3L A;  3JUW A;  2BEI A;  4CAV A;  5I0C A;  5KTA A;  4HNY B;  4F6A A;  5F46 A;  1V0C A;  3T9Y A;  1S5K A;  4KZT A;  5C88 A;  2ZXV A;  2JEV A;  3S6K A;  2CXA A;  2REE A;  2B3V A;  3TOB A;  4UCN A;  2BSW A;  3TOA A;  2R1I A;  3QB8 A;  4BBH A;  4OAD A;  2QIR A;  1M44 A;  4E8O A;  5BWA B;  1B6B A;  1YR0 A;  4NF1 A;  3S6F A;  4B10 A;  5G22 A;  2VBQ A;  3RYO A;  3DDD A;  4HKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...