2X7BA

Crystal structure of the n-terminal acetylase ard1 from sulfolobus solfataricus p2
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
156
structure length
156
Chain Sequence
b'DFTLRNARMDDIDQIIKINRLTLPENYPYYFFVEHLKEYGLAFFVAIVDNSVVGYIMPRIEWGFSNIKQLPSLVRKGHVVSIAVLEEYRRKGIATTLLEASMKSMKNDYNAEEIYLEVRVSNYPAIALYEKLNFKKVKVLKGYYADGEDAYLMARP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACETYLTRANSFERASE SSO0209
publication title The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
total genus 44
structure length 156
sequence length 156
ec nomenclature ec 2.3.1.255: N-terminal amino-acid N(alpha)-acetyltransferase NatA.
pdb deposition date 2010-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2x7bA00
3EY5A 1WK4A 2EUIA 4H89A 3P2HA 1WWZA 2CNMA 3W6SA 1Q2DA 1LRZA 4HKFA 1MJAA 3QAHA 4XNHC 1FY7A 2ZXVA 3T90A 5J8FA 1S7LA 3I9SA 2ZW7A 3CXPA 2HV2A 4JJXA 2JDDA 1L0CA 2HUZA 5IV0A 1Q2CA 1XE4A 3TTHA 4JXRA 2PR1A 2OH1A 2J8NA 2VI7A 2ZW6A 4KUBA 3R9GA 1IB1E 1J4JA 2J8MA 3R1KA 3TE4A 5H84A 4NF1A 4KZTA 3V8IA 2Z11A 2K5TA 3FIXA 4EVYA 5KTDA 3T9YA 1YVOA 2Q04A 4MI4A 2REFA 4UWIA 2D4OA 1NE9A 4R57A 2R8VA 2FE7A 2VBQA 3FXTA 2OB0A 2QIRA 2OZHA 4XPDC 4ONUA 3TOAA 2I79A 4CS0B 4FD7A 4H6UA 1M4IA 3TOBA 4KOVA 2Z0ZA 2FXFA 4GS4A 4U9YA 4X5KA 3TT2A 2GIVA 2FL4A 1YVKA 2B58A 3S6HA 1MJ9A 1CM0A 2F5IA 2R1IA 3EFAA 4FD6A 2FIWA 4UBRA 4XPKA 4F6AA 1S5KA 1KUXA 4XPLA 4NCZA 2OZUA 1YK3A 2WPWA 1XEBA 2Y0MA 4MHDA 3TO7A 2GE3A 3GYAA 3F8KA 3UY5A 1VKCA 4NEXA 1YR0A 2ATRA 3EO4A 2VQYA 2B5GB 3ZZIA 3G3SA 4JXQA 4I49A 4AG9A 4QBJA 5HMNA 3PP9A 3H4QA 2VEZA 5FVJA 3FBUA 1Z4RA 1I12A 2P0WA 2IL4A 1KZFA 2AJ6A 2BL1A 2ARHA 4RI1A 3PZJA 1M44A 2REEA 2J8RA 5H86A 1XF8A 2DXQA 4IF5A 1S60A 3DR8A 4JWPA 1Y9WA 4KOUA 2ZPAA 4HNWB 4PV6A 4YFJA 5KTAA 3QB8A 3SXNA 4KORA 2QMLA 2JEVA 3R9EA 3DR6A 1KUVA 1M4GA 4AB7A 5C82A 4PK2A 2D4PA 3DNSA 1RXTA 4XNHB 4PSXA 4DNCA 4IUSA 1YREA 4UWJA 1PU9A 2HQYA 2WPXA 1V0CA 2Q44A 4FD4A 1Y9KA 1I21A 4QUSA 1MJBA 1N71A 1Z9UA 5E96A 2G3AA 3BLNA 4L89A 2Q0YA 3BJ7A 4KOSA 3JUWA 5IB0A 4E8OA 5IX3A 2X7BA 1S7NA 4QB9A 3W6XA 3R9FA 1GHEA 2PQ8A 2FCKA 4Y49C 5F47A 4E2AA 4HNYB 1Y7RA 2PRBA 2B4BA 4KUAA 2AE6A 4NSQA 4UA3A 3GY9A 3N7ZA 2QECA 1M4DA 4MJ8A 3F0AA 4XPDB 2G0BA 1YX0A 2EVNA 3NE7A 2KCWA 4AVCA 1U6MA 1QSOA 4OLLA 3S6KA 1S3ZA 4ZBGA 2Q4YA 3TCVA 3LD2A 3R95A 3FB3A 4R87A 3B8GA 3D2MA 3LODA 4F0YA 1NSLA 2R7HA 3FRMA 4KVXA 3DSBA 2Q7BA 3KKWA 3FYNA 3WR7A 3VWDA 1IIDA 4JLYA 3CXSA 2PSWA 1Q2YA 1SQHA 4QVTA 2BUEA 1PUAA 1CJWA 2P6GA 5JPHA 4CAXA 4KVOE 4B5PA 2Z10A 3D8PA 3VWEA 4LX9A 3JVNA 4U9ZA 1QSTA 3EXNA 5DWNA 2CNTA 1XIXA 1BO4A 4R9MA 4KLWA 2NMTA 5EBVA 2G3TA 5GCNA 4B5OA 4YGOA 3D3SA 1UFHA 4NXYA 3K9UA 2PR8A 4J3GA 5CNPA 3TFYA 2BEIA 3ZJ0A 3S6GA 2OZGA 4ORFA 4KOTA 3EC4A 4QC6A 5F49A 1P4NA 4KLVA 3R96A 3E0KA 5I0CA 5J8CA 5KTCA 4AVBA 3W91A 4LUAA 1Z4EA 2FIAA 1ON0A 4AG7A 3MGDA 2RC4A 3BJ8A 3I3GA 1IYKA 1KUYA 1P0HA 1YLEA 4B5PB 2ZW5A 1K4JA 1R57A 2R98A 4L8AA 3FNCA 1BOBA 4M3SA 4KVME 2B3UA 1QSRA 1QSNA 2GANA 3TO6A 2A4NA 2ZW4A 2B3VA 4KOWA 2FT0A 1IICA 4HNXB 4MY3A 3D2PA 2H5MA 2CNSA 5ISVA 2I00A 3RYOA 4R3KA 2B5GA 2FS5A 4R3LA 1S7FA 2O28A 4CAVA 2B4DA 2VXKA 4E0AA 4Y49B 3IWGA 1IYLA 5DWMA 1MK4A 3CXQA 3OWCA 3P2FA 1TIQA 2FSRA 3C26A 3S6FA 4BMHA 2JDCA 4PK3A 2PDOA 2PC1A 4CRYB 4OAEA 1I1DA 5C88A 5HH1A 2VZZA 1M1DA 3F5BA 1VHSA 2Q4VA 4MY0A 4U5YA 1B87A 1NMTA 1OZPA 2P6FA 4K30A 3SXOA 5EC4A 1QSMA 3SHPA 4PSWA 3TO9A 4MBUA 5F48A 3GKRA 3G8WA 2VZYA 4RS2A 4YRHA 4KOXA 2OU2A 4H6ZA 3PGPA 4CAWA 4M85A 2BSWA 4KOYA 1S7KA 4CRZB 5JQ4A 4II9A 2B4DB 2JLMA 1YGHA 2C27A 1RO5A 4FD5A 4OADA 1B6BA 3DDDA 2P6EA 4AVAA 2CY2A 1XMTA 4JD6A 5F46A 3IGRA
chains in the Genus database with same CATH superfamily
1UWYA 3EY5A 4EMEA 1WK4A 2EUIA 2DPSA 2HB6A 2IJZA 2ZEOA 4H89A 4CAFA 3P2HA 1WWZA 3D68A 2CNMA 3W6SA 4PXDA 2ZEDA 4A32A 4MXUA 4UIBA 1Q2DA 4IHMA 1LRZA 4HKFA 5J1QA 1MJAA 3QAHA 3H5ZA 4XNHC 4OP4A 1HEEA 1FY7A 3FX6A 2ZXVA 3T90A 5J8FA 1S7LA 2PRQA 2Q51A 2ODFA 4C7HA 3I9SA 3IWEA 4OC0A 4W9YA 2ZW7A 4UFVA 4PQAA 4KSAA 3CXPA 2C1CA 2HV2A 4AXVA 3S9NA 2OOTA 4JJXA 2JDDA 3FJUA 1L0CA 2HUZA 5IV0A 1Q2CA 1XE4A 3TTHA 5G22A 3PB7X 4JXRA 1F57A 2PR1A 2OH1A 4P4BA 2J8NA 2AFXA 2VI7A 2Z3NA 2ZW6A 4KUBA 1TF9A 1IB1E 5AG6A 4OC5A 3R9GA 4A33A 1J4JA 2J8MA 2JBKA 3R1KA 4C7IA 3TE4A 4JYWA 1ZG7A 3FEDA 5H84A 4NF1A 4KZTA 3VARA 2ABZA 3V8IA 2Z11A 2PJ0A 5K8NA 4CAEA 4K3NA 2K5TA 2J9AA 2ZOFA 4NGRA 3FIXA 4OMEA 4EVYA 1DTDA 2AFWA 5KTDA 4C2ZA 3T8WA 3T9YA 4CGPA 4F9UA 1ELMP 3WC5A 2NSMA 1YVOA 1YQEA 2Q04A 2REFA 4MI4A 2PCUA 3B3VA 2D4OA 1NE9A 4NJQA 4Q38A 4R57A 4UWIA 4OC1A 2R8VA 2FE7A 2VBQA 4UCMA 3FXTA 1TKFA 2OB0A 2QIRA 5G21A 2OZHA 4XPDC 4ONUA 4UIAA 4UEFA 2G9DA 3TOAA 2I79A 3HLPA 4NGQA 1KWMA 2GFQA 2O53A 4CS0B 4FD7A 3SJEA 2PVWA 4H6UA 1X12A 1M4IA 3CZXA 3TOBA 1ZG8A 4KOVA 3RAMA 2Z0ZA 1Z2LA 2FXFA 2YNCA 4GS4A 2EBJA 4U9YA 4X5KA 4CPAA 4BBHA 3TT2A 4LQ6A 2GIVA 2FL4A 1YVKA 1F2OA 2QVPA 2B58A 3S6HA 2ZEEA 1IY7A 1Z8TA 1XBUA 3BI1A 4ZX8A 2WZNA 5LYIA 1ZLHA 3IFEA 4KSIA 1MJ9A 1CM0A 2F5IA 2R1IA 3EFAA 2GLJA 4FD6A 4CGNA 2FIWA 2PJ9A 1ARLA 4UBRA 4XPKA 1YMEA 2DPTA 4F6AA 3B3WA 1S5KA 2PJBA 5K8OA 3L2NA 1KUXA 4X8IA 4XPLA 1LAPA 4M6HA 4NGTA 2CF4A 4NCZA 2OZUA 4UF4A 2V8GA 1YK3A 2WPWA 1TXRA 1XEBA 2Y0MA 3PBEA 4MHDA 3TO7A 3VATA 4P4IA 5D29A 5K8PA 2GE3A 3GYAA 3F8KA 2PJ5A 3UY5A 3FF3A 1Y0RA 1VKCA 4NEXA 1YR0A 5AGEA 3IC1A 1XMBA 2ATRA 2BO9A 3EO4A 2VQYA 4MHZA 4GM5A 4ZY0A 2I3CA 2GREA 2WUUA 2B5GB 4UEEA 3ZZIA 3G3SA 4JXQA 4Z65A 3D7HA 3PEIA 4I49A 1ZO0A 1BPMA 2WYRA 4AG9A 4QBJA 3PP9A 5HMNA 3A9LA 3H4QA 4CYNA 2VEZA 5FVJA 3FBUA 3JTKA 1Z4RA 1I12A 2P0WA 2Z3KA 3H8GA 1CBXA 2IL4A 1KZFA 2AJ6A 2BL1A 4X3RA 2V8HA 4MFJA 4Q7AA 2ARHA 3NFZA 3B2YA 4RI1A 3S9LA 3KI9A 1M44A 2REEA 3PZJA 2J8RA 1XJOA 5H86A 2V8DA 2WSAA 4MCSA 2PJ8A 1XF8A 2DXQA 1JWQA 3KQXA 2PJ7A 2YNEA 3KR5A 4FWUA 2YGWA 4BD9A 4C2YA 4IF5A 1S60A 4JZ0A 3DR8A 2QYVA 4IK2A 1Y9WA 4JWPA 5AG5A 5F09A 4KOUA 2ZPAA 4HNWB 4PV6A 4CGOA 4YFJA 5KTAA 3QB8A 3NA6A 2Q43A 3QAYA 6CPAA 3H8EA 3SXNA 4KORA 3DLJA 4DYOA 3B35A 4EWTA 3SI1A 2QMLA 2JEVA 3R9EA 3DR6A 1KUVA 2PJ1A 1BAVA 2AFUA 1M4GA 1R3NA 2ZEFA 4AB7A 5C82A 2CTCA 5JGFA 4MFKA 4PK2A 2D4PA 3DNSA 1RXTA 3CDXA 2DEAA 4ZY2A 4XNHB 4PSXA 4MMOA 4DNCA 4MCRA 4PPZA 1VHEA 4IUSA 1YREA 4UWJA 2AFSA 1PU9A 2HQYA 2IMOA 2WPXA 1BLLE 4R76A 1TKJA 5LRJA 3RZAA 3I1UA 1V0CA 2Q44A 1VGYA 4MFZA 2EK8A 2BCOA 4ZY1A 1Z8LA 4FD4A 3PB8X 4A94A 1Y9KA 2Z3MA 1I21A 4B11A 4QUSA 2ZEGA 1XOVA 3D7FA 1MJBA 4HPSA 1CP7A 1TKHA 4MFLA 1N71A 1Z9UA 3RNZA 4OIWA 5E96A 4A31A 3BHXA 4B13A 2G3AA 3WC7A 5IB9A 3KL9A 5JPHA 3BLNA 4L89A 2Q0YA 4UCNA 3BXMA 4OC4A 2PJ3A 3K9TA 3QNVA 3BJ7A 3KASA 4KOSA 2V77A 4PXEA 3JUWA 3NE8A 5IB0A 3IU2A 2OR4A 4TNUA 1M4LA 1VHOA 4E8OA 1YSJA 2Z3LA 5IX3A 2X7BA 1S7NA 1LAMA 4QB9A 3W6XA 3PBBA 3NH4A 4NGPA 3R9FA 2ZEHA 1GHEA 3KZWA 2PQ8A 2ZENA 3H8FA 2FCKA 1R43A 4Y49C 5F47A 4E2AA 2Z3OA 4HNYB 1Y7RA 3PB4X 1HDQA 2B4BA 2PRBA 3ISXA 5D8NA 4KUAA 1ARMA 2AE6A 1XFOA 4NSQA 3D67A 4PXCA 4CGMA 3N5FA 5HVHA 2QJ8A 1YW4A 4UA3A 1HDUA 3GY9A 2JEWA 2QECA 3N7ZA 3WC6A 2RB7A 1M4DA 4KS9A 4MJ8A 2PJ2A 3MN8A 3F0AA 4XPDB 2G0BA 4CGLA 1YX0A 4G1PA 4B12A 3PFEA 2EVNA 3NE7A 2KCWA 3D4UA 4AVCA 2IQ6A 1U6MA 2Q7SA 1QSOA 2XEFA 4OLLA 4FUUA 3S6KA 5LYLA 1S3ZA 4A30A 4ZBGA 1IU8A 2Q4YA 4P44A 3TCVA 4FAIA 2XEJA 2PJCA 1YLOA 3LD2A 4P4FA 3FB3A 3PRTA 4R87A 3R95A 4RN7A 3S9MA 3B8GA 3D2MA 4NJRA 2C6CA 2BOAA 3LODA 4F0YA 1ELLP 1LANA 1NSLA 4R6TA 2R7HA 3FRMA 4KVXA 1LOKA 3DSBA 5AG7A 3ISZA 1DE4C 3KKWA 2Q7BA 3FYNA 3WR7A 4OC3A 2C6PA 4WJBA 3VWDA 1IIDA 4JLYA 4UFXA 5CBMA 3CXSA 4NGNA 2PSWA 4ZGYB 1Q2YA 1SQHA 3MRUA 4LQGA 4QVTA 4BINA 2BUEA 1PUAA 3CT9A 1CJWA 2CXAA 4A37A 3PFOA 1LCPA 2P6GA 3KHZA 2XEGA 4CAXA 3B3CA 4KVOE 2Z10A 2HC9A 3FH4A 4OC2A 2CIJA 3D8PA 4R8FA 4B5PA 3VWEA 4LX9A 3JVNA 1YW6A 3IWWA 4U9ZA 2YNDA 1QSTA 5A28A 2ANPA 3EXNA 5DWNA 2ZEPA 3NH5A 3CPXA 3KQZA 3D7DA 1Q7LA 2PJ4A 3TX8A 4MFPA 1ZG9A 3LACA 2CNTA 1XIXA 4MHPA 1BO4A 4R9MA 4KLWA 2O4HA 2NMTA 5F46A 5JH9A 2EO8A 3JRUA 5EBVA 2G3TA 2JBJA 3RBUA 5GCNA 4B5OA 1CX8A 3K2KA 4M6IA 1GYTA 4YGOA 1A2ZA 5I4MA 2VL1A 5LRGA 3D3SA 7CPAA 3B7IA 1CG2A 4Q36A 2ZELA 3IU1A 4P4EA 1UFHA 3BI0A 4P6YA 2AFMA 4NXYA 4X2TA 4MRIA 1Y7EA 2XEIA 3K9UA 4ONWA 5CPAA 2PR8A 4J3GA 5CNPA 4A2ZA 3TFYA 3GB0A 2BEIA 3ZJ0A 3S6GA 2OZGA 1EE3P 4ORFA 4DUKA 4KOTA 3EC4A 4QC6A 5F49A 1P4NA 4GXHA 4KLVA 3R96A 3E0KA 1BPNA 2AFZA 2DF5A 5I0CA 5EMIA 5J8CA 5BWAB 1X10A 4UFWA 5JM6A 5KTCA 1AUGA 2RFHA 4A39A 4AVBA 3W91A 4LUAA 1Z4EA 2FIAA 1ON0A 4AG7A 4ZX9A 3MGDA 3SI0A 1FNOA 2RC4A 3BJ8A 3I3GA 1IYKA 1KUYA 1P0HA 4WWVA 3RO0A 1YLEA 3WT4A 1CPXA 1Z5RA 4B5PB 4H2KA 2ZW5A 1K4JA 3IO1A 4MCQA 4FBEA 1R57A 1Y0YA 4UEZA 2ZOGA 2R98A 3TC8A 3FNCA 4L8AA 4B6ZA 1QMUA 4R7MA 1BOBA 4M3SA 1IGBA 4KVME 4KSFA 2B3UA 1QSRA 1QSNA 2GANA 4CYQA 3TO6A 3FEEA 2A4NA 3SJXA 3VH9A 2ZW4A 1PCAA 2B3VA 3V38A 5DS0A 4KOWA 5LYFA 2FT0A 1ZLIA 5LRKA 1QQ9A 1IICA 4HNXB 4P4DA 4MY3A 3SI2A 3KHXA 4P10A 3D2PA 2PVVA 2H5MA 4ZI6A 2PJ6A 2CNSA 5ISVA 2I00A 3IJ3A 3RYOA 4MHNA 5ELYA 2GLFA 2F8HA 4R3KA 2B5GA 3B3SA 3DGVA 2FS5A 3FMCA 1LFWA 4P4JA 4R3LA 3V7ZA 1S7FA 2O28A 5THWA 4F9VA 4CAVA 3FVLA 3GUXA 2B4DA 2ZEMA 5HVFA 1PYTB 2VXKA 1H8LA 1FT7A 4E0AA 4UCPA 4Y49B 3IWGA 1IYLA 3LMSA 5A27A 4IAVA 3D7GA 3PB6X 3FECA 5DWMA 1RTQA 1Z8XA 4RUHA 1MK4A 1IOFA 3CXQA 3OWCA 4CYOA 3P2FA 1TIQA 5G20A 2FVGA 2FSRA 4OIDA 3C26A 3S6FA 4EFDA 4BMHA 2JDCA 4PK3A 5G1ZA 2PDOA 1IOIA 3HUVA 2GU2A 2PC1A 4CRYB 1F2PA 3GLJA 4YWYA 4OAEA 4A38A 4B10A 1I1DA 2NYQA 5C88A 1VIXA 2PIZA 5HH1A 3D66A 3GIUA 2VZZA 1M1DA 3F5BA 3KR4A 1VHSA 2Q4VA 2C6GA 4MY0A 4U5YA 1B87A 1NMTA 4DJLA 4YU9A 1OZPA 2P6FA 1TF8A 4B14A 4PXBA 4F8ZA 4ZYQA 4K30A 4MFQA 1JQGA 3PB9X 3SXOA 4CYPA 1AYEA 5EC4A 1QSMA 2PJAA 3SHPA 1XRYA 4PSWA 5LYDA 3CPAA 3WABA 5K8MA 2PE3A 3TO9A 4MBUA 4P45A 5F48A 1CPSA 2F7VA 3GKRA 3B3TA 3NH8A 3SJFA 4O23A 3SJGA 3G8WA 3LWUA 2VZYA 4RS2A 4YRHA 4KOXA 2OU2A 4H6ZA 3PGPA 4C68A 4CAWA 4A95A 4F0XA 2YNCC 1CP6A 2EWBA 4M85A 4NGMA 2BSWA 4KOYA 1S7KA 1AMPA 4TWEA 2Q4ZA 4C2XA 4OKOA 4CRZB 5JQ4A 4II9A 2B4DB 2POKA 1Z8WA 5AG4A 2JLMA 5HXDA 2Z3PA 1YGHA 4MHYA 4MCPA 2C27A 2V8VA 1RO5A 3IIBA 4FD5A 3IEHA 2EK9A 2CTBA 4NFRA 4OADA 4M6GA 8CPAA 2PIYA 1B6BA 3DDDA 1OBRA 2P6EA 4NGSA 4AVAA 2CY2A 1XMTA 1NSAA 5HVGA 4JD6A 2AFOA 3IGRA 3KGQA
chains in the Genus database with same CATH topology
3EY5A 1WK4A 2EUIA 2DPSA 4H89A 4CAFA 3P2HA 1WWZA 2CNMA 3W6SA 4A32A 1Q2DA 1LRZA 4HKFA 1MJAA 3QAHA 3H5ZA 4XNHC 1FY7A 2ZXVA 3T90A 5J8FA 1S7LA 4C7HA 3I9SA 3IWEA 2ZW7A 4UFVA 4KSAA 3CXPA 2HV2A 4JJXA 2JDDA 1L0CA 2HUZA 5IV0A 1Q2CA 1XE4A 3TTHA 5G22A 4JXRA 2PR1A 2OH1A 2J8NA 2VI7A 2Z3NA 2ZW6A 4KUBA 3R9GA 1IB1E 5AG6A 4A33A 1J4JA 2J8MA 3R1KA 4C7IA 3TE4A 5H84A 4NF1A 4KZTA 3V8IA 2Z11A 4CAEA 2K5TA 3FIXA 4EVYA 5KTDA 3T9YA 4CGPA 1YVOA 2Q04A 4MI4A 2REFA 4Q38A 5A27A 4UWIA 2D4OA 1NE9A 4R57A 2R8VA 2FE7A 2VBQA 4UCMA 3FXTA 2OB0A 2QIRA 5G21A 2OZHA 4XPDC 4ONUA 3TOAA 2I79A 4CS0B 4FD7A 4H6UA 1M4IA 3TOBA 4KOVA 2Z0ZA 2FXFA 2YNCA 4GS4A 4U9YA 4X5KA 4BBHA 3TT2A 2GIVA 2FL4A 1YVKA 2B58A 3S6HA 1MJ9A 1CM0A 2F5IA 2R1IA 3EFAA 4FD6A 4CGNA 2FIWA 4UBRA 4XPKA 2DPTA 4F6AA 1S5KA 1KUXA 4XPLA 4NCZA 2OZUA 1YK3A 2WPWA 1XEBA 2Y0MA 4MHDA 3TO7A 2GE3A 3GYAA 3F8KA 3UY5A 1VKCA 4NEXA 1YR0A 5AGEA 2ATRA 3EO4A 2VQYA 2WUUA 2B5GB 3ZZIA 3G3SA 4JXQA 4I49A 1ZO0A 4AG9A 4QBJA 5HMNA 3PP9A 3A9LA 3H4QA 4CYNA 2VEZA 5FVJA 3FBUA 3JTKA 1Z4RA 1I12A 2P0WA 2Z3KA 2IL4A 1KZFA 2AJ6A 2BL1A 4MFJA 2ARHA 4RI1A 3PZJA 1M44A 2REEA 2J8RA 5H86A 2WSAA 1XF8A 2DXQA 2YNEA 2YGWA 4C2YA 4IF5A 1S60A 3DR8A 4JWPA 1Y9WA 5AG5A 4KOUA 2ZPAA 4HNWB 4PV6A 4CGOA 4YFJA 5KTAA 3QB8A 3SXNA 4KORA 2QMLA 2JEVA 3R9EA 3DR6A 1KUVA 1M4GA 4AB7A 5C82A 4MFKA 4PK2A 2D4PA 3DNSA 1RXTA 4XNHB 4PSXA 4DNCA 4IUSA 1YREA 4UWJA 1PU9A 2HQYA 2WPXA 1V0CA 2Q44A 4MFZA 4FD4A 1Y9KA 2Z3MA 1I21A 4B11A 4QUSA 1MJBA 4MFLA 4A31A 1N71A 1Z9UA 4B13A 5E96A 2G3AA 3BLNA 4L89A 2Q0YA 4UCNA 3BJ7A 4KOSA 3JUWA 5IB0A 3IU2A 4E8OA 2Z3LA 5IX3A 2X7BA 1S7NA 4QB9A 3W6XA 3R9FA 1GHEA 2PQ8A 2FCKA 4Y49C 5F47A 4E2AA 2Z3OA 4HNYB 1Y7RA 2PRBA 2B4BA 4KUAA 2AE6A 4NSQA 4CGMA 4UA3A 3GY9A 3N7ZA 2QECA 1M4DA 4KS9A 4MJ8A 3F0AA 4XPDB 2G0BA 4CGLA 1YX0A 4B12A 2EVNA 3NE7A 2KCWA 4AVCA 1U6MA 1QSOA 4OLLA 3S6KA 1S3ZA 4A30A 4ZBGA 2Q4YA 3TCVA 3LD2A 3R95A 4C2ZA 3FB3A 4R87A 3B8GA 3D2MA 3LODA 4F0YA 1NSLA 2R7HA 3FRMA 4KVXA 3DSBA 5AG7A 2Q7BA 3KKWA 3FYNA 3WR7A 3VWDA 1IIDA 4JLYA 4UFXA 3CXSA 2PSWA 4ZGYB 1Q2YA 1SQHA 4QVTA 2BUEA 1PUAA 1CJWA 2CXAA 2P6GA 5JPHA 4CAXA 4KVOE 4B5PA 2Z10A 3D8PA 3VWEA 4LX9A 3JVNA 4U9ZA 2YNDA 1QSTA 5A28A 3EXNA 5DWNA 4MFPA 2CNTA 1XIXA 1BO4A 4R9MA 4KLWA 2NMTA 5EBVA 2G3TA 5GCNA 4B5OA 4YGOA 3D3SA 4Q36A 3IU1A 1UFHA 4NXYA 3K9UA 2PR8A 4J3GA 5CNPA 4A2ZA 3TFYA 2BEIA 3ZJ0A 3S6GA 2OZGA 4ORFA 4KOTA 3EC4A 4QC6A 5F49A 1P4NA 4KLVA 3R96A 3E0KA 5I0CA 5J8CA 5BWAB 4UFWA 5KTCA 4AVBA 3W91A 4LUAA 1Z4EA 2FIAA 1ON0A 4AG7A 3MGDA 2RC4A 3BJ8A 3I3GA 1IYKA 1KUYA 1P0HA 1YLEA 4B5PB 2ZW5A 1K4JA 1R57A 2R98A 3FNCA 4L8AA 1BOBA 4M3SA 4KVME 4KSFA 2B3UA 1QSRA 1QSNA 2GANA 4CYQA 3TO6A 2A4NA 2ZW4A 2B3VA 4KOWA 2FT0A 1IICA 4HNXB 4MY3A 3D2PA 2H5MA 2CNSA 5ISVA 2I00A 3RYOA 4R3KA 2B5GA 2FS5A 4R3LA 1S7FA 2O28A 4CAVA 2B4DA 2VXKA 4E0AA 4UCPA 4Y49B 3IWGA 1IYLA 5DWMA 1MK4A 3CXQA 3OWCA 4CYOA 3P2FA 1TIQA 5G20A 2FSRA 3C26A 3S6FA 4BMHA 2JDCA 4PK3A 5G1ZA 2PDOA 2PC1A 4CRYB 4B10A 4OAEA 1I1DA 5C88A 5HH1A 2VZZA 1M1DA 3F5BA 1VHSA 2Q4VA 4MY0A 4U5YA 1B87A 1NMTA 1OZPA 2P6FA 4B14A 4K30A 4MFQA 4CYPA 3SXOA 5EC4A 1QSMA 3SHPA 4PSWA 3TO9A 4MBUA 5F48A 3GKRA 3G8WA 2VZYA 4RS2A 4YRHA 4KOXA 2OU2A 4H6ZA 3PGPA 4C68A 4CAWA 4A95A 4F0XA 2YNCC 4M85A 2BSWA 4KOYA 1S7KA 4C2XA 4CRZB 5JQ4A 4II9A 2B4DB 5AG4A 2JLMA 2Z3PA 1YGHA 2C27A 1RO5A 4FD5A 4OADA 1B6BA 3DDDA 2P6EA 4AVAA 2CY2A 1XMTA 4JD6A 5F46A 3IGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EY5 A;  1WK4 A;  2EUI A;  4H89 A;  3P2H A;  1WWZ A;  2CNM A;  3W6S A;  1Q2D A;  1LRZ A;  4HKF A;  1MJA A;  3QAH A;  4XNH C;  1FY7 A;  2ZXV A;  3T90 A;  5J8F A;  1S7L A;  3I9S A;  2ZW7 A;  3CXP A;  2HV2 A;  4JJX A;  2JDD A;  1L0C A;  2HUZ A;  5IV0 A;  1Q2C A;  1XE4 A;  3TTH A;  4JXR A;  2PR1 A;  2OH1 A;  2J8N A;  2VI7 A;  2ZW6 A;  4KUB A;  3R9G A;  1IB1 E;  1J4J A;  2J8M A;  3R1K A;  3TE4 A;  5H84 A;  4NF1 A;  4KZT A;  3V8I A;  2Z11 A;  2K5T A;  3FIX A;  4EVY A;  5KTD A;  3T9Y A;  1YVO A;  2Q04 A;  4MI4 A;  2REF A;  4UWI A;  2D4O A;  1NE9 A;  4R57 A;  2R8V A;  2FE7 A;  2VBQ A;  3FXT A;  2OB0 A;  2QIR A;  2OZH A;  4XPD C;  4ONU A;  3TOA A;  2I79 A;  4CS0 B;  4FD7 A;  4H6U A;  1M4I A;  3TOB A;  4KOV A;  2Z0Z A;  2FXF A;  4GS4 A;  4U9Y A;  4X5K A;  3TT2 A;  2GIV A;  2FL4 A;  1YVK A;  2B58 A;  3S6H A;  1MJ9 A;  1CM0 A;  2F5I A;  2R1I A;  3EFA A;  4FD6 A;  2FIW A;  4UBR A;  4XPK A;  4F6A A;  1S5K A;  1KUX A;  4XPL A;  4NCZ A;  2OZU A;  1YK3 A;  2WPW A;  1XEB A;  2Y0M A;  4MHD A;  3TO7 A;  2GE3 A;  3GYA A;  3F8K A;  3UY5 A;  1VKC A;  4NEX A;  1YR0 A;  2ATR A;  3EO4 A;  2VQY A;  2B5G B;  3ZZI A;  3G3S A;  4JXQ A;  4I49 A;  4AG9 A;  4QBJ A;  5HMN A;  3PP9 A;  3H4Q A;  2VEZ A;  5FVJ A;  3FBU A;  1Z4R A;  1I12 A;  2P0W A;  2IL4 A;  1KZF A;  2AJ6 A;  2BL1 A;  2ARH A;  4RI1 A;  3PZJ A;  1M44 A;  2REE A;  2J8R A;  5H86 A;  1XF8 A;  2DXQ A;  4IF5 A;  1S60 A;  3DR8 A;  4JWP A;  1Y9W A;  4KOU A;  2ZPA A;  4HNW B;  4PV6 A;  4YFJ A;  5KTA A;  3QB8 A;  3SXN A;  4KOR A;  2QML A;  2JEV A;  3R9E A;  3DR6 A;  1KUV A;  1M4G A;  4AB7 A;  5C82 A;  4PK2 A;  2D4P A;  3DNS A;  1RXT A;  4XNH B;  4PSX A;  4DNC A;  4IUS A;  1YRE A;  4UWJ A;  1PU9 A;  2HQY A;  2WPX A;  1V0C A;  2Q44 A;  4FD4 A;  1Y9K A;  1I21 A;  4QUS A;  1MJB A;  1N71 A;  1Z9U A;  5E96 A;  2G3A A;  3BLN A;  4L89 A;  2Q0Y A;  3BJ7 A;  4KOS A;  3JUW A;  5IB0 A;  4E8O A;  5IX3 A;  2X7B A;  1S7N A;  4QB9 A;  3W6X A;  3R9F A;  1GHE A;  2PQ8 A;  2FCK A;  4Y49 C;  5F47 A;  4E2A A;  4HNY B;  1Y7R A;  2PRB A;  2B4B A;  4KUA A;  2AE6 A;  4NSQ A;  4UA3 A;  3GY9 A;  3N7Z A;  2QEC A;  1M4D A;  4MJ8 A;  3F0A A;  4XPD B;  2G0B A;  1YX0 A;  2EVN A;  3NE7 A;  2KCW A;  4AVC A;  1U6M A;  1QSO A;  4OLL A;  3S6K A;  1S3Z A;  4ZBG A;  2Q4Y A;  3TCV A;  3LD2 A;  3R95 A;  3FB3 A;  4R87 A;  3B8G A;  3D2M A;  3LOD A;  4F0Y A;  1NSL A;  2R7H A;  3FRM A;  4KVX A;  3DSB A;  2Q7B A;  3KKW A;  3FYN A;  3WR7 A;  3VWD A;  1IID A;  4JLY A;  3CXS A;  2PSW A;  1Q2Y A;  1SQH A;  4QVT A;  2BUE A;  1PUA A;  1CJW A;  2P6G A;  5JPH A;  4CAX A;  4KVO E;  4B5P A;  2Z10 A;  3D8P A;  3VWE A;  4LX9 A;  3JVN A;  4U9Z A;  1QST A;  3EXN A;  5DWN A;  2CNT A;  1XIX A;  1BO4 A;  4R9M A;  4KLW A;  2NMT A;  5EBV A;  2G3T A;  5GCN A;  4B5O A;  4YGO A;  3D3S A;  1UFH A;  4NXY A;  3K9U A;  2PR8 A;  4J3G A;  5CNP A;  3TFY A;  2BEI A;  3ZJ0 A;  3S6G A;  2OZG A;  4ORF A;  4KOT A;  3EC4 A;  4QC6 A;  5F49 A;  1P4N A;  4KLV A;  3R96 A;  3E0K A;  5I0C A;  5J8C A;  5KTC A;  4AVB A;  3W91 A;  4LUA A;  1Z4E A;  2FIA A;  1ON0 A;  4AG7 A;  3MGD A;  2RC4 A;  3BJ8 A;  3I3G A;  1IYK A;  1KUY A;  1P0H A;  1YLE A;  4B5P B;  2ZW5 A;  1K4J A;  1R57 A;  2R98 A;  4L8A A;  3FNC A;  1BOB A;  4M3S A;  4KVM E;  2B3U A;  1QSR A;  1QSN A;  2GAN A;  3TO6 A;  2A4N A;  2ZW4 A;  2B3V A;  4KOW A;  2FT0 A;  1IIC A;  4HNX B;  4MY3 A;  3D2P A;  2H5M A;  2CNS A;  5ISV A;  2I00 A;  3RYO A;  4R3K A;  2B5G A;  2FS5 A;  4R3L A;  1S7F A;  2O28 A;  4CAV A;  2B4D A;  2VXK A;  4E0A A;  4Y49 B;  3IWG A;  1IYL A;  5DWM A;  1MK4 A;  3CXQ A;  3OWC A;  3P2F A;  1TIQ A;  2FSR A;  3C26 A;  3S6F A;  4BMH A;  2JDC A;  4PK3 A;  2PDO A;  2PC1 A;  4CRY B;  4OAE A;  1I1D A;  5C88 A;  5HH1 A;  2VZZ A;  1M1D A;  3F5B A;  1VHS A;  2Q4V A;  4MY0 A;  4U5Y A;  1B87 A;  1NMT A;  1OZP A;  2P6F A;  4K30 A;  3SXO A;  5EC4 A;  1QSM A;  3SHP A;  4PSW A;  3TO9 A;  4MBU A;  5F48 A;  3GKR A;  3G8W A;  2VZY A;  4RS2 A;  4YRH A;  4KOX A;  2OU2 A;  4H6Z A;  3PGP A;  4CAW A;  4M85 A;  2BSW A;  4KOY A;  1S7K A;  4CRZ B;  5JQ4 A;  4II9 A;  2B4D B;  2JLM A;  1YGH A;  2C27 A;  1RO5 A;  4FD5 A;  4OAD A;  1B6B A;  3DDD A;  2P6E A;  4AVA A;  2CY2 A;  1XMT A;  4JD6 A;  5F46 A;  3IGR A; 
#chains in the Genus database with same CATH topology
 1UWY A;  3EY5 A;  4EME A;  1WK4 A;  2EUI A;  2DPS A;  2HB6 A;  2IJZ A;  2ZEO A;  4H89 A;  4CAF A;  3P2H A;  1WWZ A;  3D68 A;  2CNM A;  3W6S A;  4PXD A;  2ZED A;  4A32 A;  4MXU A;  4UIB A;  1Q2D A;  4IHM A;  1LRZ A;  4HKF A;  5J1Q A;  1MJA A;  3QAH A;  3H5Z A;  4XNH C;  4OP4 A;  1HEE A;  1FY7 A;  3FX6 A;  2ZXV A;  3T90 A;  5J8F A;  1S7L A;  2PRQ A;  2Q51 A;  2ODF A;  4C7H A;  3I9S A;  3IWE A;  4OC0 A;  4W9Y A;  2ZW7 A;  4UFV A;  4PQA A;  4KSA A;  3CXP A;  2C1C A;  2HV2 A;  4AXV A;  3S9N A;  2OOT A;  4JJX A;  2JDD A;  3FJU A;  1L0C A;  2HUZ A;  5IV0 A;  1Q2C A;  1XE4 A;  3TTH A;  5G22 A;  3PB7 X;  4JXR A;  1F57 A;  2PR1 A;  2OH1 A;  4P4B A;  2J8N A;  2AFX A;  2VI7 A;  2Z3N A;  2ZW6 A;  4KUB A;  1TF9 A;  1IB1 E;  5AG6 A;  4OC5 A;  3R9G A;  4A33 A;  1J4J A;  2J8M A;  2JBK A;  3R1K A;  4C7I A;  3TE4 A;  4JYW A;  1ZG7 A;  3FED A;  5H84 A;  4NF1 A;  4KZT A;  3VAR A;  2ABZ A;  3V8I A;  2Z11 A;  2PJ0 A;  5K8N A;  4CAE A;  4K3N A;  2K5T A;  2J9A A;  2ZOF A;  4NGR A;  3FIX A;  4OME A;  4EVY A;  1DTD A;  2AFW A;  5KTD A;  4C2Z A;  3T8W A;  3T9Y A;  4CGP A;  4F9U A;  1ELM P;  3WC5 A;  2NSM A;  1YVO A;  1YQE A;  2Q04 A;  2REF A;  4MI4 A;  2PCU A;  3B3V A;  2D4O A;  1NE9 A;  4NJQ A;  4Q38 A;  4R57 A;  4UWI A;  4OC1 A;  2R8V A;  2FE7 A;  2VBQ A;  4UCM A;  3FXT A;  1TKF A;  2OB0 A;  2QIR A;  5G21 A;  2OZH A;  4XPD C;  4ONU A;  4UIA A;  4UEF A;  2G9D A;  3TOA A;  2I79 A;  3HLP A;  4NGQ A;  1KWM A;  2GFQ A;  2O53 A;  4CS0 B;  4FD7 A;  3SJE A;  2PVW A;  4H6U A;  1X12 A;  1M4I A;  3CZX A;  3TOB A;  1ZG8 A;  4KOV A;  3RAM A;  2Z0Z A;  1Z2L A;  2FXF A;  2YNC A;  4GS4 A;  2EBJ A;  4U9Y A;  4X5K A;  4CPA A;  4BBH A;  3TT2 A;  4LQ6 A;  2GIV A;  2FL4 A;  1YVK A;  1F2O A;  2QVP A;  2B58 A;  3S6H A;  2ZEE A;  1IY7 A;  1Z8T A;  1XBU A;  3BI1 A;  4ZX8 A;  2WZN A;  5LYI A;  1ZLH A;  3IFE A;  4KSI A;  1MJ9 A;  1CM0 A;  2F5I A;  2R1I A;  3EFA A;  2GLJ A;  4FD6 A;  4CGN A;  2FIW A;  2PJ9 A;  1ARL A;  4UBR A;  4XPK A;  1YME A;  2DPT A;  4F6A A;  3B3W A;  1S5K A;  2PJB A;  5K8O A;  3L2N A;  1KUX A;  4X8I A;  4XPL A;  1LAP A;  4M6H A;  4NGT A;  2CF4 A;  4NCZ A;  2OZU A;  4UF4 A;  2V8G A;  1YK3 A;  2WPW A;  1TXR A;  1XEB A;  2Y0M A;  3PBE A;  4MHD A;  3TO7 A;  3VAT A;  4P4I A;  5D29 A;  5K8P A;  2GE3 A;  3GYA A;  3F8K A;  2PJ5 A;  3UY5 A;  3FF3 A;  1Y0R A;  1VKC A;  4NEX A;  1YR0 A;  5AGE A;  3IC1 A;  1XMB A;  2ATR A;  2BO9 A;  3EO4 A;  2VQY A;  4MHZ A;  4GM5 A;  4ZY0 A;  2I3C A;  2GRE A;  2WUU A;  2B5G B;  4UEE A;  3ZZI A;  3G3S A;  4JXQ A;  4Z65 A;  3D7H A;  3PEI A;  4I49 A;  1ZO0 A;  1BPM A;  2WYR A;  4AG9 A;  4QBJ A;  3PP9 A;  5HMN A;  3A9L A;  3H4Q A;  4CYN A;  2VEZ A;  5FVJ A;  3FBU A;  3JTK A;  1Z4R A;  1I12 A;  2P0W A;  2Z3K A;  3H8G A;  1CBX A;  2IL4 A;  1KZF A;  2AJ6 A;  2BL1 A;  4X3R A;  2V8H A;  4MFJ A;  4Q7A A;  2ARH A;  3NFZ A;  3B2Y A;  4RI1 A;  3S9L A;  3KI9 A;  1M44 A;  2REE A;  3PZJ A;  2J8R A;  1XJO A;  5H86 A;  2V8D A;  2WSA A;  4MCS A;  2PJ8 A;  1XF8 A;  2DXQ A;  1JWQ A;  3KQX A;  2PJ7 A;  2YNE A;  3KR5 A;  4FWU A;  2YGW A;  4BD9 A;  4C2Y A;  4IF5 A;  1S60 A;  4JZ0 A;  3DR8 A;  2QYV A;  4IK2 A;  1Y9W A;  4JWP A;  5AG5 A;  5F09 A;  4KOU A;  2ZPA A;  4HNW B;  4PV6 A;  4CGO A;  4YFJ A;  5KTA A;  3QB8 A;  3NA6 A;  2Q43 A;  3QAY A;  6CPA A;  3H8E A;  3SXN A;  4KOR A;  3DLJ A;  4DYO A;  3B35 A;  4EWT A;  3SI1 A;  2QML A;  2JEV A;  3R9E A;  3DR6 A;  1KUV A;  2PJ1 A;  1BAV A;  2AFU A;  1M4G A;  1R3N A;  2ZEF A;  4AB7 A;  5C82 A;  2CTC A;  5JGF A;  4MFK A;  4PK2 A;  2D4P A;  3DNS A;  1RXT A;  3CDX A;  2DEA A;  4ZY2 A;  4XNH B;  4PSX A;  4MMO A;  4DNC A;  4MCR A;  4PPZ A;  1VHE A;  4IUS A;  1YRE A;  4UWJ A;  2AFS A;  1PU9 A;  2HQY A;  2IMO A;  2WPX A;  1BLL E;  4R76 A;  1TKJ A;  5LRJ A;  3RZA A;  3I1U A;  1V0C A;  2Q44 A;  1VGY A;  4MFZ A;  2EK8 A;  2BCO A;  4ZY1 A;  1Z8L A;  4FD4 A;  3PB8 X;  4A94 A;  1Y9K A;  2Z3M A;  1I21 A;  4B11 A;  4QUS A;  2ZEG A;  1XOV A;  3D7F A;  1MJB A;  4HPS A;  1CP7 A;  1TKH A;  4MFL A;  1N71 A;  1Z9U A;  3RNZ A;  4OIW A;  5E96 A;  4A31 A;  3BHX A;  4B13 A;  2G3A A;  3WC7 A;  5IB9 A;  3KL9 A;  5JPH A;  3BLN A;  4L89 A;  2Q0Y A;  4UCN A;  3BXM A;  4OC4 A;  2PJ3 A;  3K9T A;  3QNV A;  3BJ7 A;  3KAS A;  4KOS A;  2V77 A;  4PXE A;  3JUW A;  3NE8 A;  5IB0 A;  3IU2 A;  2OR4 A;  4TNU A;  1M4L A;  1VHO A;  4E8O A;  1YSJ A;  2Z3L A;  5IX3 A;  2X7B A;  1S7N A;  1LAM A;  4QB9 A;  3W6X A;  3PBB A;  3NH4 A;  4NGP A;  3R9F A;  2ZEH A;  1GHE A;  3KZW A;  2PQ8 A;  2ZEN A;  3H8F A;  2FCK A;  1R43 A;  4Y49 C;  5F47 A;  4E2A A;  2Z3O A;  4HNY B;  1Y7R A;  3PB4 X;  1HDQ A;  2B4B A;  2PRB A;  3ISX A;  5D8N A;  4KUA A;  1ARM A;  2AE6 A;  1XFO A;  4NSQ A;  3D67 A;  4PXC A;  4CGM A;  3N5F A;  5HVH A;  2QJ8 A;  1YW4 A;  4UA3 A;  1HDU A;  3GY9 A;  2JEW A;  2QEC A;  3N7Z A;  3WC6 A;  2RB7 A;  1M4D A;  4KS9 A;  4MJ8 A;  2PJ2 A;  3MN8 A;  3F0A A;  4XPD B;  2G0B A;  4CGL A;  1YX0 A;  4G1P A;  4B12 A;  3PFE A;  2EVN A;  3NE7 A;  2KCW A;  3D4U A;  4AVC A;  2IQ6 A;  1U6M A;  2Q7S A;  1QSO A;  2XEF A;  4OLL A;  4FUU A;  3S6K A;  5LYL A;  1S3Z A;  4A30 A;  4ZBG A;  1IU8 A;  2Q4Y A;  4P44 A;  3TCV A;  4FAI A;  2XEJ A;  2PJC A;  1YLO A;  3LD2 A;  4P4F A;  3FB3 A;  3PRT A;  4R87 A;  3R95 A;  4RN7 A;  3S9M A;  3B8G A;  3D2M A;  4NJR A;  2C6C A;  2BOA A;  3LOD A;  4F0Y A;  1ELL P;  1LAN A;  1NSL A;  4R6T A;  2R7H A;  3FRM A;  4KVX A;  1LOK A;  3DSB A;  5AG7 A;  3ISZ A;  1DE4 C;  3KKW A;  2Q7B A;  3FYN A;  3WR7 A;  4OC3 A;  2C6P A;  4WJB A;  3VWD A;  1IID A;  4JLY A;  4UFX A;  5CBM A;  3CXS A;  4NGN A;  2PSW A;  4ZGY B;  1Q2Y A;  1SQH A;  3MRU A;  4LQG A;  4QVT A;  4BIN A;  2BUE A;  1PUA A;  3CT9 A;  1CJW A;  2CXA A;  4A37 A;  3PFO A;  1LCP A;  2P6G A;  3KHZ A;  2XEG A;  4CAX A;  3B3C A;  4KVO E;  2Z10 A;  2HC9 A;  3FH4 A;  4OC2 A;  2CIJ A;  3D8P A;  4R8F A;  4B5P A;  3VWE A;  4LX9 A;  3JVN A;  1YW6 A;  3IWW A;  4U9Z A;  2YND A;  1QST A;  5A28 A;  2ANP A;  3EXN A;  5DWN A;  2ZEP A;  3NH5 A;  3CPX A;  3KQZ A;  3D7D A;  1Q7L A;  2PJ4 A;  3TX8 A;  4MFP A;  1ZG9 A;  3LAC A;  2CNT A;  1XIX A;  4MHP A;  1BO4 A;  4R9M A;  4KLW A;  2O4H A;  2NMT A;  5F46 A;  5JH9 A;  2EO8 A;  3JRU A;  5EBV A;  2G3T A;  2JBJ A;  3RBU A;  5GCN A;  4B5O A;  1CX8 A;  3K2K A;  4M6I A;  1GYT A;  4YGO A;  1A2Z A;  5I4M A;  2VL1 A;  5LRG A;  3D3S A;  7CPA A;  3B7I A;  1CG2 A;  4Q36 A;  2ZEL A;  3IU1 A;  4P4E A;  1UFH A;  3BI0 A;  4P6Y A;  2AFM A;  4NXY A;  4X2T A;  4MRI A;  1Y7E A;  2XEI A;  3K9U A;  4ONW A;  5CPA A;  2PR8 A;  4J3G A;  5CNP A;  4A2Z A;  3TFY A;  3GB0 A;  2BEI A;  3ZJ0 A;  3S6G A;  2OZG A;  1EE3 P;  4ORF A;  4DUK A;  4KOT A;  3EC4 A;  4QC6 A;  5F49 A;  1P4N A;  4GXH A;  4KLV A;  3R96 A;  3E0K A;  1BPN A;  2AFZ A;  2DF5 A;  5I0C A;  5EMI A;  5J8C A;  5BWA B;  1X10 A;  4UFW A;  5JM6 A;  5KTC A;  1AUG A;  2RFH A;  4A39 A;  4AVB A;  3W91 A;  4LUA A;  1Z4E A;  2FIA A;  1ON0 A;  4AG7 A;  4ZX9 A;  3MGD A;  3SI0 A;  1FNO A;  2RC4 A;  3BJ8 A;  3I3G A;  1IYK A;  1KUY A;  1P0H A;  4WWV A;  3RO0 A;  1YLE A;  3WT4 A;  1CPX A;  1Z5R A;  4B5P B;  4H2K A;  2ZW5 A;  1K4J A;  3IO1 A;  4MCQ A;  4FBE A;  1R57 A;  1Y0Y A;  4UEZ A;  2ZOG A;  2R98 A;  3TC8 A;  3FNC A;  4L8A A;  4B6Z A;  1QMU A;  4R7M A;  1BOB A;  4M3S A;  1IGB A;  4KVM E;  4KSF A;  2B3U A;  1QSR A;  1QSN A;  2GAN A;  4CYQ A;  3TO6 A;  3FEE A;  2A4N A;  3SJX A;  3VH9 A;  2ZW4 A;  1PCA A;  2B3V A;  3V38 A;  5DS0 A;  4KOW A;  5LYF A;  2FT0 A;  1ZLI A;  5LRK A;  1QQ9 A;  1IIC A;  4HNX B;  4P4D A;  4MY3 A;  3SI2 A;  3KHX A;  4P10 A;  3D2P A;  2PVV A;  2H5M A;  4ZI6 A;  2PJ6 A;  2CNS A;  5ISV A;  2I00 A;  3IJ3 A;  3RYO A;  4MHN A;  5ELY A;  2GLF A;  2F8H A;  4R3K A;  2B5G A;  3B3S A;  3DGV A;  2FS5 A;  3FMC A;  1LFW A;  4P4J A;  4R3L A;  3V7Z A;  1S7F A;  2O28 A;  5THW A;  4F9V A;  4CAV A;  3FVL A;  3GUX A;  2B4D A;  2ZEM A;  5HVF A;  1PYT B;  2VXK A;  1H8L A;  1FT7 A;  4E0A A;  4UCP A;  4Y49 B;  3IWG A;  1IYL A;  3LMS A;  5A27 A;  4IAV A;  3D7G A;  3PB6 X;  3FEC A;  5DWM A;  1RTQ A;  1Z8X A;  4RUH A;  1MK4 A;  1IOF A;  3CXQ A;  3OWC A;  4CYO A;  3P2F A;  1TIQ A;  5G20 A;  2FVG A;  2FSR A;  4OID A;  3C26 A;  3S6F A;  4EFD A;  4BMH A;  2JDC A;  4PK3 A;  5G1Z A;  2PDO A;  1IOI A;  3HUV A;  2GU2 A;  2PC1 A;  4CRY B;  1F2P A;  3GLJ A;  4YWY A;  4OAE A;  4A38 A;  4B10 A;  1I1D A;  2NYQ A;  5C88 A;  1VIX A;  2PIZ A;  5HH1 A;  3D66 A;  3GIU A;  2VZZ A;  1M1D A;  3F5B A;  3KR4 A;  1VHS A;  2Q4V A;  2C6G A;  4MY0 A;  4U5Y A;  1B87 A;  1NMT A;  4DJL A;  4YU9 A;  1OZP A;  2P6F A;  1TF8 A;  4B14 A;  4PXB A;  4F8Z A;  4ZYQ A;  4K30 A;  4MFQ A;  1JQG A;  3PB9 X;  3SXO A;  4CYP A;  1AYE A;  5EC4 A;  1QSM A;  2PJA A;  3SHP A;  1XRY A;  4PSW A;  5LYD A;  3CPA A;  3WAB A;  5K8M A;  2PE3 A;  3TO9 A;  4MBU A;  4P45 A;  5F48 A;  1CPS A;  2F7V A;  3GKR A;  3B3T A;  3NH8 A;  3SJF A;  4O23 A;  3SJG A;  3G8W A;  3LWU A;  2VZY A;  4RS2 A;  4YRH A;  4KOX A;  2OU2 A;  4H6Z A;  3PGP A;  4C68 A;  4CAW A;  4A95 A;  4F0X A;  2YNC C;  1CP6 A;  2EWB A;  4M85 A;  4NGM A;  2BSW A;  4KOY A;  1S7K A;  1AMP A;  4TWE A;  2Q4Z A;  4C2X A;  4OKO A;  4CRZ B;  5JQ4 A;  4II9 A;  2B4D B;  2POK A;  1Z8W A;  5AG4 A;  2JLM A;  5HXD A;  2Z3P A;  1YGH A;  4MHY A;  4MCP A;  2C27 A;  2V8V A;  1RO5 A;  3IIB A;  4FD5 A;  3IEH A;  2EK9 A;  2CTB A;  4NFR A;  4OAD A;  4M6G A;  8CPA A;  2PIY A;  1B6B A;  3DDD A;  1OBR A;  2P6E A;  4NGS A;  4AVA A;  2CY2 A;  1XMT A;  1NSA A;  5HVG A;  4JD6 A;  2AFO A;  3IGR A;  3KGQ A; 
#chains in the Genus database with same CATH homology
 3EY5 A;  1WK4 A;  2EUI A;  2DPS A;  4H89 A;  4CAF A;  3P2H A;  1WWZ A;  2CNM A;  3W6S A;  4A32 A;  1Q2D A;  1LRZ A;  4HKF A;  1MJA A;  3QAH A;  3H5Z A;  4XNH C;  1FY7 A;  2ZXV A;  3T90 A;  5J8F A;  1S7L A;  4C7H A;  3I9S A;  3IWE A;  2ZW7 A;  4UFV A;  4KSA A;  3CXP A;  2HV2 A;  4JJX A;  2JDD A;  1L0C A;  2HUZ A;  5IV0 A;  1Q2C A;  1XE4 A;  3TTH A;  5G22 A;  4JXR A;  2PR1 A;  2OH1 A;  2J8N A;  2VI7 A;  2Z3N A;  2ZW6 A;  4KUB A;  3R9G A;  1IB1 E;  5AG6 A;  4A33 A;  1J4J A;  2J8M A;  3R1K A;  4C7I A;  3TE4 A;  5H84 A;  4NF1 A;  4KZT A;  3V8I A;  2Z11 A;  4CAE A;  2K5T A;  3FIX A;  4EVY A;  5KTD A;  3T9Y A;  4CGP A;  1YVO A;  2Q04 A;  4MI4 A;  2REF A;  4Q38 A;  5A27 A;  4UWI A;  2D4O A;  1NE9 A;  4R57 A;  2R8V A;  2FE7 A;  2VBQ A;  4UCM A;  3FXT A;  2OB0 A;  2QIR A;  5G21 A;  2OZH A;  4XPD C;  4ONU A;  3TOA A;  2I79 A;  4CS0 B;  4FD7 A;  4H6U A;  1M4I A;  3TOB A;  4KOV A;  2Z0Z A;  2FXF A;  2YNC A;  4GS4 A;  4U9Y A;  4X5K A;  4BBH A;  3TT2 A;  2GIV A;  2FL4 A;  1YVK A;  2B58 A;  3S6H A;  1MJ9 A;  1CM0 A;  2F5I A;  2R1I A;  3EFA A;  4FD6 A;  4CGN A;  2FIW A;  4UBR A;  4XPK A;  2DPT A;  4F6A A;  1S5K A;  1KUX A;  4XPL A;  4NCZ A;  2OZU A;  1YK3 A;  2WPW A;  1XEB A;  2Y0M A;  4MHD A;  3TO7 A;  2GE3 A;  3GYA A;  3F8K A;  3UY5 A;  1VKC A;  4NEX A;  1YR0 A;  5AGE A;  2ATR A;  3EO4 A;  2VQY A;  2WUU A;  2B5G B;  3ZZI A;  3G3S A;  4JXQ A;  4I49 A;  1ZO0 A;  4AG9 A;  4QBJ A;  5HMN A;  3PP9 A;  3A9L A;  3H4Q A;  4CYN A;  2VEZ A;  5FVJ A;  3FBU A;  3JTK A;  1Z4R A;  1I12 A;  2P0W A;  2Z3K A;  2IL4 A;  1KZF A;  2AJ6 A;  2BL1 A;  4MFJ A;  2ARH A;  4RI1 A;  3PZJ A;  1M44 A;  2REE A;  2J8R A;  5H86 A;  2WSA A;  1XF8 A;  2DXQ A;  2YNE A;  2YGW A;  4C2Y A;  4IF5 A;  1S60 A;  3DR8 A;  4JWP A;  1Y9W A;  5AG5 A;  4KOU A;  2ZPA A;  4HNW B;  4PV6 A;  4CGO A;  4YFJ A;  5KTA A;  3QB8 A;  3SXN A;  4KOR A;  2QML A;  2JEV A;  3R9E A;  3DR6 A;  1KUV A;  1M4G A;  4AB7 A;  5C82 A;  4MFK A;  4PK2 A;  2D4P A;  3DNS A;  1RXT A;  4XNH B;  4PSX A;  4DNC A;  4IUS A;  1YRE A;  4UWJ A;  1PU9 A;  2HQY A;  2WPX A;  1V0C A;  2Q44 A;  4MFZ A;  4FD4 A;  1Y9K A;  2Z3M A;  1I21 A;  4B11 A;  4QUS A;  1MJB A;  4MFL A;  4A31 A;  1N71 A;  1Z9U A;  4B13 A;  5E96 A;  2G3A A;  3BLN A;  4L89 A;  2Q0Y A;  4UCN A;  3BJ7 A;  4KOS A;  3JUW A;  5IB0 A;  3IU2 A;  4E8O A;  2Z3L A;  5IX3 A;  2X7B A;  1S7N A;  4QB9 A;  3W6X A;  3R9F A;  1GHE A;  2PQ8 A;  2FCK A;  4Y49 C;  5F47 A;  4E2A A;  2Z3O A;  4HNY B;  1Y7R A;  2PRB A;  2B4B A;  4KUA A;  2AE6 A;  4NSQ A;  4CGM A;  4UA3 A;  3GY9 A;  3N7Z A;  2QEC A;  1M4D A;  4KS9 A;  4MJ8 A;  3F0A A;  4XPD B;  2G0B A;  4CGL A;  1YX0 A;  4B12 A;  2EVN A;  3NE7 A;  2KCW A;  4AVC A;  1U6M A;  1QSO A;  4OLL A;  3S6K A;  1S3Z A;  4A30 A;  4ZBG A;  2Q4Y A;  3TCV A;  3LD2 A;  3R95 A;  4C2Z A;  3FB3 A;  4R87 A;  3B8G A;  3D2M A;  3LOD A;  4F0Y A;  1NSL A;  2R7H A;  3FRM A;  4KVX A;  3DSB A;  5AG7 A;  2Q7B A;  3KKW A;  3FYN A;  3WR7 A;  3VWD A;  1IID A;  4JLY A;  4UFX A;  3CXS A;  2PSW A;  4ZGY B;  1Q2Y A;  1SQH A;  4QVT A;  2BUE A;  1PUA A;  1CJW A;  2CXA A;  2P6G A;  5JPH A;  4CAX A;  4KVO E;  4B5P A;  2Z10 A;  3D8P A;  3VWE A;  4LX9 A;  3JVN A;  4U9Z A;  2YND A;  1QST A;  5A28 A;  3EXN A;  5DWN A;  4MFP A;  2CNT A;  1XIX A;  1BO4 A;  4R9M A;  4KLW A;  2NMT A;  5EBV A;  2G3T A;  5GCN A;  4B5O A;  4YGO A;  3D3S A;  4Q36 A;  3IU1 A;  1UFH A;  4NXY A;  3K9U A;  2PR8 A;  4J3G A;  5CNP A;  4A2Z A;  3TFY A;  2BEI A;  3ZJ0 A;  3S6G A;  2OZG A;  4ORF A;  4KOT A;  3EC4 A;  4QC6 A;  5F49 A;  1P4N A;  4KLV A;  3R96 A;  3E0K A;  5I0C A;  5J8C A;  5BWA B;  4UFW A;  5KTC A;  4AVB A;  3W91 A;  4LUA A;  1Z4E A;  2FIA A;  1ON0 A;  4AG7 A;  3MGD A;  2RC4 A;  3BJ8 A;  3I3G A;  1IYK A;  1KUY A;  1P0H A;  1YLE A;  4B5P B;  2ZW5 A;  1K4J A;  1R57 A;  2R98 A;  3FNC A;  4L8A A;  1BOB A;  4M3S A;  4KVM E;  4KSF A;  2B3U A;  1QSR A;  1QSN A;  2GAN A;  4CYQ A;  3TO6 A;  2A4N A;  2ZW4 A;  2B3V A;  4KOW A;  2FT0 A;  1IIC A;  4HNX B;  4MY3 A;  3D2P A;  2H5M A;  2CNS A;  5ISV A;  2I00 A;  3RYO A;  4R3K A;  2B5G A;  2FS5 A;  4R3L A;  1S7F A;  2O28 A;  4CAV A;  2B4D A;  2VXK A;  4E0A A;  4UCP A;  4Y49 B;  3IWG A;  1IYL A;  5DWM A;  1MK4 A;  3CXQ A;  3OWC A;  4CYO A;  3P2F A;  1TIQ A;  5G20 A;  2FSR A;  3C26 A;  3S6F A;  4BMH A;  2JDC A;  4PK3 A;  5G1Z A;  2PDO A;  2PC1 A;  4CRY B;  4B10 A;  4OAE A;  1I1D A;  5C88 A;  5HH1 A;  2VZZ A;  1M1D A;  3F5B A;  1VHS A;  2Q4V A;  4MY0 A;  4U5Y A;  1B87 A;  1NMT A;  1OZP A;  2P6F A;  4B14 A;  4K30 A;  4MFQ A;  4CYP A;  3SXO A;  5EC4 A;  1QSM A;  3SHP A;  4PSW A;  3TO9 A;  4MBU A;  5F48 A;  3GKR A;  3G8W A;  2VZY A;  4RS2 A;  4YRH A;  4KOX A;  2OU2 A;  4H6Z A;  3PGP A;  4C68 A;  4CAW A;  4A95 A;  4F0X A;  2YNC C;  4M85 A;  2BSW A;  4KOY A;  1S7K A;  4C2X A;  4CRZ B;  5JQ4 A;  4II9 A;  2B4D B;  5AG4 A;  2JLM A;  2Z3P A;  1YGH A;  2C27 A;  1RO5 A;  4FD5 A;  4OAD A;  1B6B A;  3DDD A;  2P6E A;  4AVA A;  2CY2 A;  1XMT A;  4JD6 A;  5F46 A;  3IGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...