2X7BA

Crystal structure of the n-terminal acetylase ard1 from sulfolobus solfataricus p2
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
156
structure length
156
Chain Sequence
DFTLRNARMDDIDQIIKINRLTLPENYPYYFFVEHLKEYGLAFFVAIVDNSVVGYIMPRIEWGFSNIKQLPSLVRKGHVVSIAVLEEYRRKGIATTLLEASMKSMKNDYNAEEIYLEVRVSNYPAIALYEKLNFKKVKVLKGYYADGEDAYLMARP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N-ACETYLTRANSFERASE SSO0209
publication title The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 44
structure length 156
sequence length 156
ec nomenclature ec 2.3.1.255: N-terminal amino-acid N(alpha)-acetyltransferase NatA.
pdb deposition date 2010-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2x7bA00
3DR8A 4Y49B 5F48A 4M3SA 3TT2A 2Q44A 4B5PB 2P6GA 1M1DA 4XPDC 2PR1A 3P2FA 4RS2A 4MBUA 4FD7A 2B3VA 4KOWA 1Q2YA 2JDCA 3TOAA 3GY9A 1KUYA 1NSLA 2OB0A 2CNTA 3TCVA 4MY3A 4R3LA 1NMTA 4MI4A 5F46A 2D4PA 4KOYA 5F47A 5F49A 1WWZA 2O28A 2H5MA 1M4GA 1Z9UA 2B4DA 4QVTA 1R57A 3R9GA 1PU9A 1S7KA 2WPXA 2Q7BA 3G8WA 1M4DA 4LX9A 2B5GB 3CXQA 3I9SA 2ZW6A 4KZTA 4HNWB 3D2MA 5EBVA 1GHEA 3WR7A 2REEA 2VZZA 3FBUA 1BOBA 1YR0A 3D3SA 1S5KA 1V0CA 1YVKA 1Y7RA 1K4JA 3DNSA 1CJWA 2VI7A 2J8NA 4PSWA 3EO4A 2J8RA 4JXRA 2JLMA 2VBQA 2OZHA 3DR6A 4II9A 4YFJA 1YGHA 4HNYB 3UY5A 1OZPA 1B87A 4NCZA 1TIQA 3TO7A 1SQHA 3CXSA 4XNHC 4ZBGA 1UFHA 3BJ8A 2Q4YA 3TFYA 1RO5A 2ARHA 3TO6A 4FD6A 3W6XA 1MJBA 4JXQA 4CAWA 2P0WA 3GYAA 4F0YA 1Y9WA 2QMLA 4MHDA 2QIRA 4MJ8A 1PUAA 2I00A 2A4NA 2JEVA 2OZUA 3B8GA 4KOTA 4YRHA 5IX3A 5ISVA 3IGRA 4K30A 3LD2A 4RI1A 2ZXVA 4BMHA 3FRMA 4CS0B 4XPKA 4H89A 4AG9A 3VWDA 2D4OA 3TO9A 3KKWA 4GS4A 2R1IA 1Y9KA 4NEXA 3CXPA 2B4DB 4CAVA 5KTCA 4PK3A 2Q0YA 1S60A 2RC4A 2HQYA 4L8AA 4PV6A 4Y49C 1Q2DA 3JVNA 2GE3A 3EFAA 4JD6A 2R98A 1I21A 2VEZA 2Q04A 2ZW5A 5IV0A 2Z11A 3P2HA 2OU2A 5IB0A 4M85A 4NXYA 1MJAA 2R7HA 1IICA 1B6BA 4MY0A 4AVAA 5EC4A 2B58A 2FIAA 2PQ8A 4KUBA 4JJXA 5JQ4A 2C27A 4UWJA 1RXTA 4AB7A 3R96A 3BLNA 4NSQA 3C26A 2PRBA 2EVNA 2B4BA 2QECA 4R57A 1KZFA 4KOVA 3FYNA 4KLVA 1J4JA 2BL1A 1XMTA 1BO4A 3NE7A 2CNMA 4JLYA 1XEBA 2FIWA 4CRYB 4KORA 2FL4A 4IF5A 4KLWA 1S7NA 1YREA 4U5YA 4R87A 3G3SA 3F5BA 3VWEA 2CY2A 1CM0A 1QSOA 2P6EA 2VXKA 4AVBA 5GCNA 2Y0MA 4PK2A 3MGDA 1I1DA 2REFA 2ZW7A 3FXTA 2Z10A 4I49A 4U9YA 2AE6A 4FD4A 3SXOA 3R95A 1LRZA 2DXQA 4B5OA 5JPHA 1L0CA 3I3GA 1S7LA 1N71A 3IWGA 5H86A 1XE4A 4KVXA 2G0BA 4XPLA 3W6SA 5HH1A 2G3AA 4OLLA 4EVYA 2GANA 1Z4EA 3DDDA 3GKRA 2KCWA 3SXNA 2IL4A 2FXFA 1Z4RA 1XIXA 4KOUA 4HNXB 3BJ7A 2X7BA 5KTAA 4XPDB 3PP9A 2AJ6A 2ZPAA 4YGOA 3S6GA 2WPWA 3E0KA 3K9UA 3F8KA 4FD5A 2Q4VA 3D2PA 4ORFA 4OADA 4UWIA 1M44A 1KUXA 2Z0ZA 3S6HA 2BEIA 2PR8A 5KTDA 2ATRA 4E0AA 3T90A 1YK3A 2K5TA 3FIXA 3SHPA 3T9YA 1XF8A 3DSBA 4UBRA 5I0CA 1KUVA 3ZJ0A 3N7ZA 4QBJA 2PDOA 1VHSA 4E8OA 4AG7A 3LODA 3TE4A 3RYOA 1FY7A 3OWCA 1S7FA 2R8VA 4R3KA 1YX0A 1IYLA 3H4QA 2ZW4A 1YVOA 4L89A 4NF1A 3ZZIA 4B5PA 1IIDA 2P6FA 4R9MA 4U9ZA 2FSRA 2VZYA 4CAXA 1P0HA 4H6UA 2PC1A 4QUSA 4F6AA 1QSNA 4KVME 2OH1A 5C82A 5J8CA 4QB9A 5DWMA 5H84A 2HUZA 2FS5A 3F0AA 4CRZB 2NMTA 4KOXA 1NE9A 3JUWA 4KOSA 3TTHA 4ONUA 2GIVA 1IYKA 3R1KA 4KVOE 1QSMA 3QB8A 3TOBA 4UA3A 4PSXA 4JWPA 3S6FA 4KUAA 4OAEA 1U6MA 1WK4A 2I79A 1IB1E 5HMNA 4AVCA 2FE7A 2JDDA 1QSTA 1QSRA 4XNHB 4J3GA 2B5GA 2BUEA 2FT0A 4DNCA 4H6ZA 1ON0A 1Q2CA 3W91A 2B3UA 2J8MA 4QC6A 1S3ZA 2EUIA 2HV2A 1I12A 3R9EA 3FB3A 3PGPA 5C88A 5J8FA 5DWNA 1MJ9A 3D8PA 2G3TA 1YLEA 3EY5A 1VKCA 4IUSA 3EXNA 4E2AA 1P4NA 4X5KA 1MK4A 2OZGA 5FVJA 4HKFA 3QAHA 5CNPA 3V8IA 2PSWA 2BSWA 2VQYA 3R9FA 5E96A 2CNSA 3PZJA 1M4IA 4LUAA 2F5IA 3EC4A 3S6KA 2FCKA 3FNCA
chains in the Genus database with same CATH superfamily
3DR8A 4Y49B 5F48A 3NFZA 4M3SA 4A32A 1HDUA 3TT2A 2Q44A 4B5PB 2P6GA 4YU9A 1M1DA 2Z3KA 4XPDC 3K9TA 2PR1A 4DYOA 3P2FA 2G9DA 4UFXA 3QNVA 1OBRA 1ZG9A 3S9MA 2EO8A 4RS2A 4MBUA 5K8PA 4FD7A 3KHZA 3MRUA 1ZO0A 2WUUA 4ZX8A 5K8OA 1UWYA 2B3VA 4KOWA 4C7HA 1Q2YA 2C6GA 2FVGA 4A94A 2JDCA 3TOAA 1H8LA 3GY9A 1KUYA 1NSLA 2OB0A 5D8NA 2CNTA 4GXHA 3KQZA 3TCVA 2AFOA 4KSFA 4X8IA 3VH9A 3RZAA 4DJLA 4MY3A 3B7IA 4R3LA 1ZG8A 4B6ZA 2QJ8A 4NGNA 1NMTA 4MI4A 5F46A 2D4PA 4KOYA 5F47A 4CGPA 2PJAA 5F49A 2XEIA 1WWZA 2O28A 2H5MA 4CYNA 4DUKA 1M4GA 1Z9UA 2PJCA 3JTKA 2B4DA 5DS0A 4QVTA 1R57A 3KASA 2YNCC 3R9GA 1PU9A 1QQ9A 5HVGA 1S7KA 2WPXA 5HVFA 2Q7BA 4A37A 1TF9A 3BHXA 3G8WA 1M4DA 1XJOA 2F8HA 5AGEA 3TX8A 1YLOA 1Q7LA 3PBEA 4LX9A 5ELYA 1AMPA 2B5GB 3CXQA 2PRQA 3I9SA 2DF5A 2ZW6A 4KZTA 2PJBA 3FH4A 3WT4A 1PCAA 4HNWB 3PRTA 3D2MA 3IFEA 3PB6X 5EBVA 1GHEA 3WR7A 4UFWA 4UCPA 2REEA 3CDXA 2VZZA 1HDQA 2NSMA 3FBUA 3GLJA 1BOBA 1YR0A 3D3SA 1S5KA 1V0CA 5HVHA 1YVKA 5THWA 3VATA 3FEEA 2PJ6A 1Y7RA 2DPTA 1CP6A 1K4JA 2J9AA 3DNSA 2Z3LA 1CJWA 2VI7A 2J8NA 1Z8LA 4PSWA 3PFOA 4Q7AA 3EO4A 2J8RA 4G1PA 1RTQA 4JXRA 3SJXA 2JLMA 5LRGA 1VIXA 3GB0A 2VBQA 2OZHA 3DR6A 3LWUA 4MFLA 4II9A 4ZYQA 4C2ZA 4YFJA 1YGHA 2ZEFA 5K8NA 2EK9A 4HNYB 4LQGA 5IB9A 3KL9A 3UY5A 1OZPA 4CYQA 1ARLA 1B87A 1Y0YA 2CF4A 4O23A 4B14A 4NCZA 1TIQA 2HC9A 3TO7A 1SQHA 4F9UA 4JZ0A 3CXSA 4XNHC 1XMBA 2YGWA 4ZBGA 1UFHA 3B2YA 5K8MA 3BJ8A 2Q4YA 3TFYA 1RO5A 2ARHA 3TO6A 4A39A 4FD6A 4HPSA 3W6XA 2POKA 4UFVA 1Z8WA 3KGQA 1MJBA 4JXQA 4CAWA 1JWQA 2P0WA 3GYAA 4NGQA 4F0YA 1Y9WA 2QMLA 5G21A 3WC5A 5JM6A 2YNDA 4MFQA 4MHDA 4FAIA 2QIRA 5AG4A 1A2ZA 4MJ8A 4NGSA 2BO9A 1PUAA 1TF8A 2PIYA 4TNUA 2I00A 2A4NA 2JEVA 3CPXA 2OZUA 3B8GA 4KOTA 4YRHA 4PXDA 4B12A 5IX3A 3FEDA 1ZLIA 5ISVA 3IGRA 4PXEA 5CPAA 4K30A 3IU1A 3LD2A 4K3NA 2ZXVA 4RI1A 4BMHA 3NH8A 2WSAA 3LMSA 4UIBA 3FRMA 4CS0B 2ZELA 4P10A 2Z3PA 1CPXA 4C7IA 4ZY1A 3IEHA 2IMOA 4XPKA 4H89A 2PVVA 4MFJA 1CP7A 4KS9A 4AG9A 3KI9A 2WZNA 3VWDA 3D68A 5LYFA 2D4OA 3TO9A 3KKWA 3GUXA 4FWUA 4A31A 4P4EA 2CTBA 1IOFA 3LACA 2IQ6A 2ZEHA 4GS4A 2R1IA 2PIZA 1Y9KA 4NEXA 1VGYA 1Z5RA 4Z65A 4P4IA 3CXPA 2B4DB 4MCPA 2RFHA 3RAMA 2AFMA 2GREA 4H2KA 4CAVA 4P6YA 4RUHA 1X10A 2Q7SA 4PK3A 4Q38A 5KTCA 2Q0YA 3SJEA 1NSAA 3V7ZA 1S60A 1CPSA 2RC4A 4AXVA 4MRIA 2HQYA 4L8AA 4PV6A 4Y49C 2Q43A 4B10A 4MMOA 3DGVA 1Q2DA 2ABZA 3JVNA 3IWEA 3FVLA 1FT7A 2GE3A 2JBKA 3EFAA 4JD6A 2PJ4A 2R98A 1I21A 2VEZA 3H8GA 3D7FA 3SI2A 2Q04A 3WC7A 4UEEA 2ZW5A 4PPZA 5IV0A 2CTCA 3IU2A 2Z11A 4F0XA 3P2HA 2OU2A 5IB0A 4NFRA 4PXBA 3BI0A 4M85A 8CPAA 4TWEA 4NXYA 2EK8A 1MJAA 2R7HA 2AFZA 1IICA 2HB6A 4M6IA 2C6CA 1B6BA 2OR4A 4ZY2A 2EBJA 2XEFA 3PBBA 5F09A 4F8ZA 5LYLA 4MY0A 2CIJA 4AVAA 2ODFA 2Z3NA 3S9NA 4OC3A 3PFEA 2B58A 2FIAA 2PQ8A 2ZEOA 1YMEA 4KUBA 4UEZA 5EC4A 3KQXA 4JJXA 5JQ4A 4BINA 2JEWA 2YNEA 3SI0A 4NGPA 4CPAA 2C27A 1DTDA 5AG5A 4UWJA 3WC6A 4NJQA 1RXTA 4MCQA 3BI1A 1ZG7A 4AB7A 2AFSA 4NGTA 3R96A 4A33A 5A27A 3BLNA 4NSQA 5J1QA 3C26A 3HUVA 4MFPA 2PRBA 4ZGYB 4EMEA 2EVNA 2B4BA 3KR5A 2V8VA 4B13A 2PVWA 1TKHA 2YNCA 2PJ7A 2QECA 4P4BA 4R57A 1KZFA 1Z2LA 4KOVA 4CAFA 5D29A 4PQAA 1Y0RA 3FYNA 1J4JA 4KLVA 3T8WA 4CGOA 1Z8TA 2BL1A 1XMTA 1BO4A 2GLFA 3NE7A 3PB4X 2CNMA 4JLYA 1XEBA 3D7GA 2FIWA 4R8FA 5LYDA 2GLJA 3V38A 1YW6A 1LAPA 3NA6A 4CRYB 2CXAA 1R3NA 2FL4A 3B3CA 1ELMP 1S7NA 1YREA 3N5FA 4IF5A 4KLWA 4KORA 4R87A 4U5YA 5CBMA 3G3SA 4P4DA 3F5BA 3VWEA 2CY2A 3TC8A 4BBHA 3B35A 4OC2A 2EWBA 3SJFA 5AG7A 3VARA 1CM0A 2AFWA 3PEIA 1QSOA 2P6EA 4OMEA 2VXKA 1LFWA 2ANPA 4AVBA 5GCNA 2GU2A 2Y0MA 4PK2A 3MGDA 3KHXA 2Z3OA 1BAVA 1CG2A 4C68A 1I1DA 3GIUA 1XOVA 1CBXA 2REFA 2V8DA 2ZW7A 3FXTA 2Z10A 4I49A 4U9YA 2AE6A 4UCMA 2AFXA 4FD4A 3SXOA 3R95A 3S9LA 1LRZA 2DXQA 1IOIA 4B5OA 5JPHA 1L0CA 2PJ5A 3I3GA 1KWMA 2ZEMA 1S7LA 4CGMA 1EE3P 3H8FA 1N71A 3IWGA 4F9VA 2Q51A 1XE4A 5H86A 2OOTA 4R7MA 4R76A 4KVXA 2PCUA 1BLLE 2G0BA 3H8EA 4UCNA 4XPLA 3B3VA 3W6SA 4EWTA 2IJZA 5HH1A 2G3AA 4C2XA 2ZEEA 3FMCA 2XEGA 3FF3A 4OLLA 2GANA 2QVPA 4OC4A 1Z4EA 3D67A 3DDDA 4MHPA 4MXUA 4EVYA 3IO1A 3GKRA 2KCWA 3NH5A 3SXNA 2IL4A 2FXFA 1Z4RA 4ZI6A 1XIXA 3QAYA 2JBJA 4KOUA 4HNXB 4CGNA 5G20A 3BJ7A 4ZY0A 6CPAA 4PXCA 1GYTA 2X7BA 5KTAA 4XPDB 1F2OA 3IJ3A 4EFDA 4YWYA 3RO0A 1VHOA 4Q36A 3PP9A 5HXDA 5JH9A 4MFZA 1IGBA 2AJ6A 4CYOA 4IHMA 3BXMA 2PJ9A 3D4UA 2C1CA 2ZPAA 4YGOA 3NE8A 3S6GA 3SJGA 2WPWA 3E0KA 3K9UA 3F8KA 1YQEA 4FD5A 2Q4VA 1X12A 3RBUA 4OKOA 1Z8XA 3D2PA 4ONWA 3IWWA 4ORFA 4OADA 4UWIA 1ELLP 1M44A 1KUXA 2Z0ZA 3S6HA 1BPMA 3JRUA 2BEIA 2PR8A 5KTDA 3PB7X 4KSIA 2ATRA 4MHNA 2PJ8A 4P44A 4NGRA 4E0AA 5G1ZA 2BCOA 3T90A 1YK3A 4ZX9A 5AG6A 2K5TA 4KSAA 4NGMA 3FIXA 3SHPA 3IIBA 2ZEDA 3T9YA 5A28A 4BD9A 1XF8A 3DSBA 4UBRA 5EMIA 7CPAA 2GFQA 5I0CA 2QYVA 1KUVA 3ZJ0A 5JGFA 3N7ZA 4WJBA 4QBJA 2Q4ZA 2PDOA 1TKJA 1VHSA 4MCRA 4E8OA 4WWVA 4AG7A 4MHYA 3CPAA 1LCPA 1XFOA 3LODA 3TE4A 3RYOA 4CAEA 1FY7A 3ISXA 3OWCA 2BOAA 1S7FA 2R8VA 4C2YA 4CGLA 4R3KA 2ZENA 2WYRA 4A30A 4OIDA 1YX0A 1IYLA 1FNOA 2PJ0A 3H4QA 2ZW4A 1YVOA 4L89A 4LQ6A 3H5ZA 4MCSA 4NF1A 3ZZIA 4B5PA 3SI1A 1IIDA 2P6FA 1XRYA 2V8GA 1DE4C 4R9MA 4U9ZA 4A38A 2FSRA 1F2PA 4UEFA 2VZYA 1TXRA 4CAXA 5I4MA 1HEEA 1QMUA 1P0HA 4H6UA 4JYWA 2PC1A 1LOKA 2XEJA 4QUSA 4F6AA 1QSNA 1VHEA 3RNZA 4NJRA 4KVME 3FECA 1JQGA 2OH1A 4GM5A 4MFKA 1F57A 5C82A 4QB9A 5J8CA 3KR4A 5DWMA 5H84A 2O4HA 2DEAA 2HUZA 4OP4A 2DPSA 2FS5A 3F0AA 4IAVA 4R6TA 4CRZB 2NMTA 2PJ1A 1NE9A 4KOXA 4P4JA 3JUWA 4KOSA 3TTHA 3I1UA 1AUGA 3FX6A 2GIVA 4ONUA 1Y7EA 5LRKA 1IYKA 2ZEGA 3K2KA 3R1KA 1PYTB 4KVOE 1QSMA 3QB8A 3TOBA 1M4LA 3IC1A 3MN8A 4UA3A 1CX8A 4CYPA 4PSXA 2PE3A 4JWPA 2V77A 2ZOGA 4B11A 3A9LA 3S6FA 4KUAA 4OAEA 1U6MA 1WK4A 2RB7A 1YSJA 4FUUA 2I79A 3D66A 4OC5A 1IB1E 4X2TA 3WABA 4AVCA 5HMNA 2FE7A 2JDDA 4RN7A 1QSTA 1QSRA 4XNHB 3D7DA 3DLJA 4J3GA 4M6HA 1BPNA 2B5GA 4P4FA 2BUEA 2FT0A 2AFUA 4DNCA 4H6ZA 2NYQA 1ON0A 1XBUA 1LANA 1Q2CA 3B3TA 3W91A 2I3CA 2B3UA 3NH4A 2J8MA 4QC6A 4OC0A 4UIAA 4A95A 1S3ZA 3PB8X 4W9YA 1IY7A 2EUIA 2V8HA 5BWAB 2PJ3A 4M6GA 1LAMA 2HV2A 1IU8A 1I12A 2VL1A 4MHZA 3R9EA 4FBEA 3FB3A 4IK2A 3CT9A 2O53A 3KZWA 3PGPA 4OC1A 5C88A 5DWNA 5J8FA 1MJ9A 2C6PA 1ZLHA 3D8PA 4P45A 1ARMA 5LYIA 4A2ZA 3ISZA 2G3TA 1YLEA 3EY5A 3L2NA 1VKCA 3D7HA 3EXNA 3PB9X 4IUSA 4E2AA 1P4NA 1YW4A 4X5KA 1MK4A 2PJ2A 5LRJA 3B3WA 2F7VA 2OZGA 3FJUA 5FVJA 3CZXA 4X3RA 1AYEA 4HKFA 3QAHA 5CNPA 3V8IA 4UF4A 2PSWA 2BSWA 2VQYA 5G22A 3R9FA 5E96A 2ZOFA 2CNSA 4OIWA 3PZJA 2ZEPA 3HLPA 1M4IA 4LUAA 3B3SA 2F5IA 1TKFA 2Z3MA 3EC4A 3S6KA 1R43A 2FCKA 3FNCA
chains in the Genus database with same CATH topology
3DR8A 4Y49B 5F48A 4M3SA 4A32A 3TT2A 2Q44A 4B5PB 2P6GA 1M1DA 2Z3KA 4XPDC 2PR1A 3P2FA 4UFXA 4RS2A 4MBUA 4FD7A 1ZO0A 2WUUA 2B3VA 4KOWA 4C7HA 1Q2YA 2JDCA 3TOAA 3GY9A 1KUYA 1NSLA 2OB0A 2CNTA 3TCVA 4KSFA 4MY3A 4R3LA 1NMTA 4MI4A 5F46A 2D4PA 4KOYA 5F47A 4CGPA 5F49A 1WWZA 2O28A 2H5MA 1M4GA 1Z9UA 3JTKA 2B4DA 4QVTA 1R57A 3R9GA 2YNCC 1PU9A 1S7KA 2WPXA 2Q7BA 3G8WA 5AGEA 1M4DA 4LX9A 2B5GB 3CXQA 3I9SA 2ZW6A 4KZTA 4HNWB 3D2MA 5EBVA 1GHEA 3WR7A 4UFWA 4UCPA 2REEA 2VZZA 3FBUA 1BOBA 1YR0A 3D3SA 1S5KA 1V0CA 1YVKA 1Y7RA 2DPTA 1K4JA 3DNSA 2Z3LA 1CJWA 2VI7A 2J8NA 4PSWA 3EO4A 2J8RA 4JXRA 2JLMA 2VBQA 2OZHA 3DR6A 4II9A 4MFLA 4C2ZA 4YFJA 1YGHA 4HNYB 3UY5A 1OZPA 4CYQA 1B87A 4B14A 4NCZA 1TIQA 3TO7A 1SQHA 3CXSA 4XNHC 2YGWA 4ZBGA 1UFHA 3BJ8A 2Q4YA 3TFYA 1RO5A 2ARHA 3TO6A 4FD6A 3W6XA 4UFVA 1MJBA 4JXQA 4CAWA 2P0WA 3GYAA 4F0YA 1Y9WA 2QMLA 5G21A 2YNDA 4MFQA 4MHDA 2QIRA 5AG4A 4MJ8A 1PUAA 2I00A 2A4NA 2JEVA 2OZUA 3B8GA 4KOTA 4YRHA 4B12A 5IX3A 5ISVA 3IGRA 4K30A 3IU1A 3LD2A 4RI1A 2ZXVA 4BMHA 2WSAA 3FRMA 4CS0B 2Z3PA 4C7IA 4XPKA 4H89A 4MFJA 4KS9A 4AG9A 3VWDA 2D4OA 3TO9A 3KKWA 4A31A 4GS4A 2R1IA 1Y9KA 4NEXA 3CXPA 2B4DB 4CAVA 5KTCA 4PK3A 4Q38A 2Q0YA 1S60A 2RC4A 2HQYA 4L8AA 4PV6A 4Y49C 4B10A 1Q2DA 3JVNA 3IWEA 2GE3A 3EFAA 4JD6A 2R98A 1I21A 2VEZA 2Q04A 2ZW5A 5IV0A 3IU2A 2Z11A 4F0XA 3P2HA 2OU2A 5IB0A 4M85A 4NXYA 1MJAA 2R7HA 1IICA 1B6BA 4MY0A 4AVAA 2Z3NA 5EC4A 2B58A 2FIAA 2PQ8A 4KUBA 4JJXA 5JQ4A 2YNEA 2C27A 5AG5A 4UWJA 1RXTA 4AB7A 4A33A 3R96A 5A27A 3BLNA 4NSQA 3C26A 4MFPA 2PRBA 4ZGYB 2EVNA 2B4BA 4B13A 2YNCA 2QECA 4R57A 1KZFA 4KOVA 4CAFA 4CYNA 3FYNA 1J4JA 4KLVA 2BL1A 1XMTA 1BO4A 3NE7A 2CNMA 4JLYA 1XEBA 2FIWA 4CRYB 2CXAA 4KORA 2FL4A 4IF5A 4KLWA 1S7NA 1YREA 4U5YA 4R87A 3G3SA 3F5BA 3VWEA 2CY2A 4BBHA 5AG7A 1CM0A 1QSOA 2P6EA 2VXKA 4AVBA 5GCNA 2Y0MA 4PK2A 3MGDA 2Z3OA 4C68A 1I1DA 4CGOA 2REFA 2ZW7A 3FXTA 2Z10A 4I49A 4U9YA 2AE6A 4UCMA 4FD4A 3SXOA 3R95A 1LRZA 2DXQA 4B5OA 5JPHA 1L0CA 3I3GA 1S7LA 4CGMA 1N71A 3IWGA 5H86A 1XE4A 4KVXA 2G0BA 4UCNA 4XPLA 3W6SA 5HH1A 2G3AA 4C2XA 4OLLA 4EVYA 2GANA 1Z4EA 3DDDA 3GKRA 2KCWA 3SXNA 2IL4A 2FXFA 1Z4RA 1XIXA 4KOUA 4HNXB 4CGNA 5G20A 3BJ7A 2X7BA 5KTAA 4XPDB 4Q36A 3PP9A 4MFZA 2AJ6A 4CYOA 2ZPAA 4YGOA 3S6GA 2WPWA 3E0KA 3K9UA 3F8KA 4FD5A 2Q4VA 3D2PA 4ORFA 4OADA 4UWIA 1M44A 1KUXA 2Z0ZA 3S6HA 2BEIA 2PR8A 5KTDA 2ATRA 4E0AA 5G1ZA 3T90A 1YK3A 5AG6A 2K5TA 4KSAA 3FIXA 3SHPA 3T9YA 5A28A 1XF8A 3DSBA 4UBRA 5I0CA 1KUVA 3ZJ0A 3N7ZA 4QBJA 2PDOA 1VHSA 4E8OA 4AG7A 3LODA 3TE4A 3RYOA 4CAEA 1FY7A 3OWCA 1S7FA 2R8VA 4C2YA 4CGLA 4R3KA 4A30A 1YX0A 1IYLA 3H4QA 2ZW4A 1YVOA 4L89A 3H5ZA 4NF1A 3ZZIA 4B5PA 1IIDA 2P6FA 4R9MA 4U9ZA 2FSRA 2VZYA 4CAXA 1P0HA 4H6UA 2PC1A 4QUSA 4F6AA 1QSNA 4KVME 2OH1A 4MFKA 5C82A 5J8CA 4QB9A 5DWMA 5H84A 2HUZA 2DPSA 2FS5A 3F0AA 4CRZB 2NMTA 4KOXA 1NE9A 3JUWA 4KOSA 3TTHA 4ONUA 2GIVA 1IYKA 3R1KA 4KVOE 1QSMA 3QB8A 3TOBA 4UA3A 4CYPA 4PSXA 4JWPA 4B11A 3A9LA 3S6FA 4KUAA 4OAEA 1U6MA 1WK4A 2I79A 1IB1E 5HMNA 4AVCA 2FE7A 2JDDA 1QSTA 1QSRA 4XNHB 4J3GA 2B5GA 2BUEA 2FT0A 4DNCA 4H6ZA 1ON0A 1Q2CA 3W91A 2B3UA 2J8MA 4QC6A 4A95A 1S3ZA 2EUIA 5BWAB 2HV2A 1I12A 3R9EA 3FB3A 3PGPA 5C88A 5J8FA 5DWNA 1MJ9A 3D8PA 4A2ZA 2G3TA 1YLEA 3EY5A 1VKCA 4IUSA 3EXNA 4E2AA 1P4NA 4X5KA 1MK4A 2OZGA 5FVJA 4HKFA 3QAHA 5CNPA 3V8IA 5G22A 2PSWA 2BSWA 2VQYA 3R9FA 5E96A 2CNSA 3PZJA 1M4IA 4LUAA 2F5IA 2Z3MA 3EC4A 3S6KA 2FCKA 3FNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DR8 A;  4Y49 B;  5F48 A;  4M3S A;  3TT2 A;  2Q44 A;  4B5P B;  2P6G A;  1M1D A;  4XPD C;  2PR1 A;  3P2F A;  4RS2 A;  4MBU A;  4FD7 A;  2B3V A;  4KOW A;  1Q2Y A;  2JDC A;  3TOA A;  3GY9 A;  1KUY A;  1NSL A;  2OB0 A;  2CNT A;  3TCV A;  4MY3 A;  4R3L A;  1NMT A;  4MI4 A;  5F46 A;  2D4P A;  4KOY A;  5F47 A;  5F49 A;  1WWZ A;  2O28 A;  2H5M A;  1M4G A;  1Z9U A;  2B4D A;  4QVT A;  1R57 A;  3R9G A;  1PU9 A;  1S7K A;  2WPX A;  2Q7B A;  3G8W A;  1M4D A;  4LX9 A;  2B5G B;  3CXQ A;  3I9S A;  2ZW6 A;  4KZT A;  4HNW B;  3D2M A;  5EBV A;  1GHE A;  3WR7 A;  2REE A;  2VZZ A;  3FBU A;  1BOB A;  1YR0 A;  3D3S A;  1S5K A;  1V0C A;  1YVK A;  1Y7R A;  1K4J A;  3DNS A;  1CJW A;  2VI7 A;  2J8N A;  4PSW A;  3EO4 A;  2J8R A;  4JXR A;  2JLM A;  2VBQ A;  2OZH A;  3DR6 A;  4II9 A;  4YFJ A;  1YGH A;  4HNY B;  3UY5 A;  1OZP A;  1B87 A;  4NCZ A;  1TIQ A;  3TO7 A;  1SQH A;  3CXS A;  4XNH C;  4ZBG A;  1UFH A;  3BJ8 A;  2Q4Y A;  3TFY A;  1RO5 A;  2ARH A;  3TO6 A;  4FD6 A;  3W6X A;  1MJB A;  4JXQ A;  4CAW A;  2P0W A;  3GYA A;  4F0Y A;  1Y9W A;  2QML A;  4MHD A;  2QIR A;  4MJ8 A;  1PUA A;  2I00 A;  2A4N A;  2JEV A;  2OZU A;  3B8G A;  4KOT A;  4YRH A;  5IX3 A;  5ISV A;  3IGR A;  4K30 A;  3LD2 A;  4RI1 A;  2ZXV A;  4BMH A;  3FRM A;  4CS0 B;  4XPK A;  4H89 A;  4AG9 A;  3VWD A;  2D4O A;  3TO9 A;  3KKW A;  4GS4 A;  2R1I A;  1Y9K A;  4NEX A;  3CXP A;  2B4D B;  4CAV A;  5KTC A;  4PK3 A;  2Q0Y A;  1S60 A;  2RC4 A;  2HQY A;  4L8A A;  4PV6 A;  4Y49 C;  1Q2D A;  3JVN A;  2GE3 A;  3EFA A;  4JD6 A;  2R98 A;  1I21 A;  2VEZ A;  2Q04 A;  2ZW5 A;  5IV0 A;  2Z11 A;  3P2H A;  2OU2 A;  5IB0 A;  4M85 A;  4NXY A;  1MJA A;  2R7H A;  1IIC A;  1B6B A;  4MY0 A;  4AVA A;  5EC4 A;  2B58 A;  2FIA A;  2PQ8 A;  4KUB A;  4JJX A;  5JQ4 A;  2C27 A;  4UWJ A;  1RXT A;  4AB7 A;  3R96 A;  3BLN A;  4NSQ A;  3C26 A;  2PRB A;  2EVN A;  2B4B A;  2QEC A;  4R57 A;  1KZF A;  4KOV A;  3FYN A;  4KLV A;  1J4J A;  2BL1 A;  1XMT A;  1BO4 A;  3NE7 A;  2CNM A;  4JLY A;  1XEB A;  2FIW A;  4CRY B;  4KOR A;  2FL4 A;  4IF5 A;  4KLW A;  1S7N A;  1YRE A;  4U5Y A;  4R87 A;  3G3S A;  3F5B A;  3VWE A;  2CY2 A;  1CM0 A;  1QSO A;  2P6E A;  2VXK A;  4AVB A;  5GCN A;  2Y0M A;  4PK2 A;  3MGD A;  1I1D A;  2REF A;  2ZW7 A;  3FXT A;  2Z10 A;  4I49 A;  4U9Y A;  2AE6 A;  4FD4 A;  3SXO A;  3R95 A;  1LRZ A;  2DXQ A;  4B5O A;  5JPH A;  1L0C A;  3I3G A;  1S7L A;  1N71 A;  3IWG A;  5H86 A;  1XE4 A;  4KVX A;  2G0B A;  4XPL A;  3W6S A;  5HH1 A;  2G3A A;  4OLL A;  4EVY A;  2GAN A;  1Z4E A;  3DDD A;  3GKR A;  2KCW A;  3SXN A;  2IL4 A;  2FXF A;  1Z4R A;  1XIX A;  4KOU A;  4HNX B;  3BJ7 A;  2X7B A;  5KTA A;  4XPD B;  3PP9 A;  2AJ6 A;  2ZPA A;  4YGO A;  3S6G A;  2WPW A;  3E0K A;  3K9U A;  3F8K A;  4FD5 A;  2Q4V A;  3D2P A;  4ORF A;  4OAD A;  4UWI A;  1M44 A;  1KUX A;  2Z0Z A;  3S6H A;  2BEI A;  2PR8 A;  5KTD A;  2ATR A;  4E0A A;  3T90 A;  1YK3 A;  2K5T A;  3FIX A;  3SHP A;  3T9Y A;  1XF8 A;  3DSB A;  4UBR A;  5I0C A;  1KUV A;  3ZJ0 A;  3N7Z A;  4QBJ A;  2PDO A;  1VHS A;  4E8O A;  4AG7 A;  3LOD A;  3TE4 A;  3RYO A;  1FY7 A;  3OWC A;  1S7F A;  2R8V A;  4R3K A;  1YX0 A;  1IYL A;  3H4Q A;  2ZW4 A;  1YVO A;  4L89 A;  4NF1 A;  3ZZI A;  4B5P A;  1IID A;  2P6F A;  4R9M A;  4U9Z A;  2FSR A;  2VZY A;  4CAX A;  1P0H A;  4H6U A;  2PC1 A;  4QUS A;  4F6A A;  1QSN A;  4KVM E;  2OH1 A;  5C82 A;  5J8C A;  4QB9 A;  5DWM A;  5H84 A;  2HUZ A;  2FS5 A;  3F0A A;  4CRZ B;  2NMT A;  4KOX A;  1NE9 A;  3JUW A;  4KOS A;  3TTH A;  4ONU A;  2GIV A;  1IYK A;  3R1K A;  4KVO E;  1QSM A;  3QB8 A;  3TOB A;  4UA3 A;  4PSX A;  4JWP A;  3S6F A;  4KUA A;  4OAE A;  1U6M A;  1WK4 A;  2I79 A;  1IB1 E;  5HMN A;  4AVC A;  2FE7 A;  2JDD A;  1QST A;  1QSR A;  4XNH B;  4J3G A;  2B5G A;  2BUE A;  2FT0 A;  4DNC A;  4H6Z A;  1ON0 A;  1Q2C A;  3W91 A;  2B3U A;  2J8M A;  4QC6 A;  1S3Z A;  2EUI A;  2HV2 A;  1I12 A;  3R9E A;  3FB3 A;  3PGP A;  5C88 A;  5J8F A;  5DWN A;  1MJ9 A;  3D8P A;  2G3T A;  1YLE A;  3EY5 A;  1VKC A;  4IUS A;  3EXN A;  4E2A A;  1P4N A;  4X5K A;  1MK4 A;  2OZG A;  5FVJ A;  4HKF A;  3QAH A;  5CNP A;  3V8I A;  2PSW A;  2BSW A;  2VQY A;  3R9F A;  5E96 A;  2CNS A;  3PZJ A;  1M4I A;  4LUA A;  2F5I A;  3EC4 A;  3S6K A;  2FCK A;  3FNC A; 
#chains in the Genus database with same CATH topology
 3DR8 A;  4Y49 B;  5F48 A;  3NFZ A;  4M3S A;  4A32 A;  1HDU A;  3TT2 A;  2Q44 A;  4B5P B;  2P6G A;  4YU9 A;  1M1D A;  2Z3K A;  4XPD C;  3K9T A;  2PR1 A;  4DYO A;  3P2F A;  2G9D A;  4UFX A;  3QNV A;  1OBR A;  1ZG9 A;  3S9M A;  2EO8 A;  4RS2 A;  4MBU A;  5K8P A;  4FD7 A;  3KHZ A;  3MRU A;  1ZO0 A;  2WUU A;  4ZX8 A;  5K8O A;  1UWY A;  2B3V A;  4KOW A;  4C7H A;  1Q2Y A;  2C6G A;  2FVG A;  4A94 A;  2JDC A;  3TOA A;  1H8L A;  3GY9 A;  1KUY A;  1NSL A;  2OB0 A;  5D8N A;  2CNT A;  4GXH A;  3KQZ A;  3TCV A;  2AFO A;  4KSF A;  4X8I A;  3VH9 A;  3RZA A;  4DJL A;  4MY3 A;  3B7I A;  4R3L A;  1ZG8 A;  4B6Z A;  2QJ8 A;  4NGN A;  1NMT A;  4MI4 A;  5F46 A;  2D4P A;  4KOY A;  5F47 A;  4CGP A;  2PJA A;  5F49 A;  2XEI A;  1WWZ A;  2O28 A;  2H5M A;  4CYN A;  4DUK A;  1M4G A;  1Z9U A;  2PJC A;  3JTK A;  2B4D A;  5DS0 A;  4QVT A;  1R57 A;  3KAS A;  2YNC C;  3R9G A;  1PU9 A;  1QQ9 A;  5HVG A;  1S7K A;  2WPX A;  5HVF A;  2Q7B A;  4A37 A;  1TF9 A;  3BHX A;  3G8W A;  1M4D A;  1XJO A;  2F8H A;  5AGE A;  3TX8 A;  1YLO A;  1Q7L A;  3PBE A;  4LX9 A;  5ELY A;  1AMP A;  2B5G B;  3CXQ A;  2PRQ A;  3I9S A;  2DF5 A;  2ZW6 A;  4KZT A;  2PJB A;  3FH4 A;  3WT4 A;  1PCA A;  4HNW B;  3PRT A;  3D2M A;  3IFE A;  3PB6 X;  5EBV A;  1GHE A;  3WR7 A;  4UFW A;  4UCP A;  2REE A;  3CDX A;  2VZZ A;  1HDQ A;  2NSM A;  3FBU A;  3GLJ A;  1BOB A;  1YR0 A;  3D3S A;  1S5K A;  1V0C A;  5HVH A;  1YVK A;  5THW A;  3VAT A;  3FEE A;  2PJ6 A;  1Y7R A;  2DPT A;  1CP6 A;  1K4J A;  2J9A A;  3DNS A;  2Z3L A;  1CJW A;  2VI7 A;  2J8N A;  1Z8L A;  4PSW A;  3PFO A;  4Q7A A;  3EO4 A;  2J8R A;  4G1P A;  1RTQ A;  4JXR A;  3SJX A;  2JLM A;  5LRG A;  1VIX A;  3GB0 A;  2VBQ A;  2OZH A;  3DR6 A;  3LWU A;  4MFL A;  4II9 A;  4ZYQ A;  4C2Z A;  4YFJ A;  1YGH A;  2ZEF A;  5K8N A;  2EK9 A;  4HNY B;  4LQG A;  5IB9 A;  3KL9 A;  3UY5 A;  1OZP A;  4CYQ A;  1ARL A;  1B87 A;  1Y0Y A;  2CF4 A;  4O23 A;  4B14 A;  4NCZ A;  1TIQ A;  2HC9 A;  3TO7 A;  1SQH A;  4F9U A;  4JZ0 A;  3CXS A;  4XNH C;  1XMB A;  2YGW A;  4ZBG A;  1UFH A;  3B2Y A;  5K8M A;  3BJ8 A;  2Q4Y A;  3TFY A;  1RO5 A;  2ARH A;  3TO6 A;  4A39 A;  4FD6 A;  4HPS A;  3W6X A;  2POK A;  4UFV A;  1Z8W A;  3KGQ A;  1MJB A;  4JXQ A;  4CAW A;  1JWQ A;  2P0W A;  3GYA A;  4NGQ A;  4F0Y A;  1Y9W A;  2QML A;  5G21 A;  3WC5 A;  5JM6 A;  2YND A;  4MFQ A;  4MHD A;  4FAI A;  2QIR A;  5AG4 A;  1A2Z A;  4MJ8 A;  4NGS A;  2BO9 A;  1PUA A;  1TF8 A;  2PIY A;  4TNU A;  2I00 A;  2A4N A;  2JEV A;  3CPX A;  2OZU A;  3B8G A;  4KOT A;  4YRH A;  4PXD A;  4B12 A;  5IX3 A;  3FED A;  1ZLI A;  5ISV A;  3IGR A;  4PXE A;  5CPA A;  4K30 A;  3IU1 A;  3LD2 A;  4K3N A;  2ZXV A;  4RI1 A;  4BMH A;  3NH8 A;  2WSA A;  3LMS A;  4UIB A;  3FRM A;  4CS0 B;  2ZEL A;  4P10 A;  2Z3P A;  1CPX A;  4C7I A;  4ZY1 A;  3IEH A;  2IMO A;  4XPK A;  4H89 A;  2PVV A;  4MFJ A;  1CP7 A;  4KS9 A;  4AG9 A;  3KI9 A;  2WZN A;  3VWD A;  3D68 A;  5LYF A;  2D4O A;  3TO9 A;  3KKW A;  3GUX A;  4FWU A;  4A31 A;  4P4E A;  2CTB A;  1IOF A;  3LAC A;  2IQ6 A;  2ZEH A;  4GS4 A;  2R1I A;  2PIZ A;  1Y9K A;  4NEX A;  1VGY A;  1Z5R A;  4Z65 A;  4P4I A;  3CXP A;  2B4D B;  4MCP A;  2RFH A;  3RAM A;  2AFM A;  2GRE A;  4H2K A;  4CAV A;  4P6Y A;  4RUH A;  1X10 A;  2Q7S A;  4PK3 A;  4Q38 A;  5KTC A;  2Q0Y A;  3SJE A;  1NSA A;  3V7Z A;  1S60 A;  1CPS A;  2RC4 A;  4AXV A;  4MRI A;  2HQY A;  4L8A A;  4PV6 A;  4Y49 C;  2Q43 A;  4B10 A;  4MMO A;  3DGV A;  1Q2D A;  2ABZ A;  3JVN A;  3IWE A;  3FVL A;  1FT7 A;  2GE3 A;  2JBK A;  3EFA A;  4JD6 A;  2PJ4 A;  2R98 A;  1I21 A;  2VEZ A;  3H8G A;  3D7F A;  3SI2 A;  2Q04 A;  3WC7 A;  4UEE A;  2ZW5 A;  4PPZ A;  5IV0 A;  2CTC A;  3IU2 A;  2Z11 A;  4F0X A;  3P2H A;  2OU2 A;  5IB0 A;  4NFR A;  4PXB A;  3BI0 A;  4M85 A;  8CPA A;  4TWE A;  4NXY A;  2EK8 A;  1MJA A;  2R7H A;  2AFZ A;  1IIC A;  2HB6 A;  4M6I A;  2C6C A;  1B6B A;  2OR4 A;  4ZY2 A;  2EBJ A;  2XEF A;  3PBB A;  5F09 A;  4F8Z A;  5LYL A;  4MY0 A;  2CIJ A;  4AVA A;  2ODF A;  2Z3N A;  3S9N A;  4OC3 A;  3PFE A;  2B58 A;  2FIA A;  2PQ8 A;  2ZEO A;  1YME A;  4KUB A;  4UEZ A;  5EC4 A;  3KQX A;  4JJX A;  5JQ4 A;  4BIN A;  2JEW A;  2YNE A;  3SI0 A;  4NGP A;  4CPA A;  2C27 A;  1DTD A;  5AG5 A;  4UWJ A;  3WC6 A;  4NJQ A;  1RXT A;  4MCQ A;  3BI1 A;  1ZG7 A;  4AB7 A;  2AFS A;  4NGT A;  3R96 A;  4A33 A;  5A27 A;  3BLN A;  4NSQ A;  5J1Q A;  3C26 A;  3HUV A;  4MFP A;  2PRB A;  4ZGY B;  4EME A;  2EVN A;  2B4B A;  3KR5 A;  2V8V A;  4B13 A;  2PVW A;  1TKH A;  2YNC A;  2PJ7 A;  2QEC A;  4P4B A;  4R57 A;  1KZF A;  1Z2L A;  4KOV A;  4CAF A;  5D29 A;  4PQA A;  1Y0R A;  3FYN A;  1J4J A;  4KLV A;  3T8W A;  4CGO A;  1Z8T A;  2BL1 A;  1XMT A;  1BO4 A;  2GLF A;  3NE7 A;  3PB4 X;  2CNM A;  4JLY A;  1XEB A;  3D7G A;  2FIW A;  4R8F A;  5LYD A;  2GLJ A;  3V38 A;  1YW6 A;  1LAP A;  3NA6 A;  4CRY B;  2CXA A;  1R3N A;  2FL4 A;  3B3C A;  1ELM P;  1S7N A;  1YRE A;  3N5F A;  4IF5 A;  4KLW A;  4KOR A;  4R87 A;  4U5Y A;  5CBM A;  3G3S A;  4P4D A;  3F5B A;  3VWE A;  2CY2 A;  3TC8 A;  4BBH A;  3B35 A;  4OC2 A;  2EWB A;  3SJF A;  5AG7 A;  3VAR A;  1CM0 A;  2AFW A;  3PEI A;  1QSO A;  2P6E A;  4OME A;  2VXK A;  1LFW A;  2ANP A;  4AVB A;  5GCN A;  2GU2 A;  2Y0M A;  4PK2 A;  3MGD A;  3KHX A;  2Z3O A;  1BAV A;  1CG2 A;  4C68 A;  1I1D A;  3GIU A;  1XOV A;  1CBX A;  2REF A;  2V8D A;  2ZW7 A;  3FXT A;  2Z10 A;  4I49 A;  4U9Y A;  2AE6 A;  4UCM A;  2AFX A;  4FD4 A;  3SXO A;  3R95 A;  3S9L A;  1LRZ A;  2DXQ A;  1IOI A;  4B5O A;  5JPH A;  1L0C A;  2PJ5 A;  3I3G A;  1KWM A;  2ZEM A;  1S7L A;  4CGM A;  1EE3 P;  3H8F A;  1N71 A;  3IWG A;  4F9V A;  2Q51 A;  1XE4 A;  5H86 A;  2OOT A;  4R7M A;  4R76 A;  4KVX A;  2PCU A;  1BLL E;  2G0B A;  3H8E A;  4UCN A;  4XPL A;  3B3V A;  3W6S A;  4EWT A;  2IJZ A;  5HH1 A;  2G3A A;  4C2X A;  2ZEE A;  3FMC A;  2XEG A;  3FF3 A;  4OLL A;  2GAN A;  2QVP A;  4OC4 A;  1Z4E A;  3D67 A;  3DDD A;  4MHP A;  4MXU A;  4EVY A;  3IO1 A;  3GKR A;  2KCW A;  3NH5 A;  3SXN A;  2IL4 A;  2FXF A;  1Z4R A;  4ZI6 A;  1XIX A;  3QAY A;  2JBJ A;  4KOU A;  4HNX B;  4CGN A;  5G20 A;  3BJ7 A;  4ZY0 A;  6CPA A;  4PXC A;  1GYT A;  2X7B A;  5KTA A;  4XPD B;  1F2O A;  3IJ3 A;  4EFD A;  4YWY A;  3RO0 A;  1VHO A;  4Q36 A;  3PP9 A;  5HXD A;  5JH9 A;  4MFZ A;  1IGB A;  2AJ6 A;  4CYO A;  4IHM A;  3BXM A;  2PJ9 A;  3D4U A;  2C1C A;  2ZPA A;  4YGO A;  3NE8 A;  3S6G A;  3SJG A;  2WPW A;  3E0K A;  3K9U A;  3F8K A;  1YQE A;  4FD5 A;  2Q4V A;  1X12 A;  3RBU A;  4OKO A;  1Z8X A;  3D2P A;  4ONW A;  3IWW A;  4ORF A;  4OAD A;  4UWI A;  1ELL P;  1M44 A;  1KUX A;  2Z0Z A;  3S6H A;  1BPM A;  3JRU A;  2BEI A;  2PR8 A;  5KTD A;  3PB7 X;  4KSI A;  2ATR A;  4MHN A;  2PJ8 A;  4P44 A;  4NGR A;  4E0A A;  5G1Z A;  2BCO A;  3T90 A;  1YK3 A;  4ZX9 A;  5AG6 A;  2K5T A;  4KSA A;  4NGM A;  3FIX A;  3SHP A;  3IIB A;  2ZED A;  3T9Y A;  5A28 A;  4BD9 A;  1XF8 A;  3DSB A;  4UBR A;  5EMI A;  7CPA A;  2GFQ A;  5I0C A;  2QYV A;  1KUV A;  3ZJ0 A;  5JGF A;  3N7Z A;  4WJB A;  4QBJ A;  2Q4Z A;  2PDO A;  1TKJ A;  1VHS A;  4MCR A;  4E8O A;  4WWV A;  4AG7 A;  4MHY A;  3CPA A;  1LCP A;  1XFO A;  3LOD A;  3TE4 A;  3RYO A;  4CAE A;  1FY7 A;  3ISX A;  3OWC A;  2BOA A;  1S7F A;  2R8V A;  4C2Y A;  4CGL A;  4R3K A;  2ZEN A;  2WYR A;  4A30 A;  4OID A;  1YX0 A;  1IYL A;  1FNO A;  2PJ0 A;  3H4Q A;  2ZW4 A;  1YVO A;  4L89 A;  4LQ6 A;  3H5Z A;  4MCS A;  4NF1 A;  3ZZI A;  4B5P A;  3SI1 A;  1IID A;  2P6F A;  1XRY A;  2V8G A;  1DE4 C;  4R9M A;  4U9Z A;  4A38 A;  2FSR A;  1F2P A;  4UEF A;  2VZY A;  1TXR A;  4CAX A;  5I4M A;  1HEE A;  1QMU A;  1P0H A;  4H6U A;  4JYW A;  2PC1 A;  1LOK A;  2XEJ A;  4QUS A;  4F6A A;  1QSN A;  1VHE A;  3RNZ A;  4NJR A;  4KVM E;  3FEC A;  1JQG A;  2OH1 A;  4GM5 A;  4MFK A;  1F57 A;  5C82 A;  4QB9 A;  5J8C A;  3KR4 A;  5DWM A;  5H84 A;  2O4H A;  2DEA A;  2HUZ A;  4OP4 A;  2DPS A;  2FS5 A;  3F0A A;  4IAV A;  4R6T A;  4CRZ B;  2NMT A;  2PJ1 A;  1NE9 A;  4KOX A;  4P4J A;  3JUW A;  4KOS A;  3TTH A;  3I1U A;  1AUG A;  3FX6 A;  2GIV A;  4ONU A;  1Y7E A;  5LRK A;  1IYK A;  2ZEG A;  3K2K A;  3R1K A;  1PYT B;  4KVO E;  1QSM A;  3QB8 A;  3TOB A;  1M4L A;  3IC1 A;  3MN8 A;  4UA3 A;  1CX8 A;  4CYP A;  4PSX A;  2PE3 A;  4JWP A;  2V77 A;  2ZOG A;  4B11 A;  3A9L A;  3S6F A;  4KUA A;  4OAE A;  1U6M A;  1WK4 A;  2RB7 A;  1YSJ A;  4FUU A;  2I79 A;  3D66 A;  4OC5 A;  1IB1 E;  4X2T A;  3WAB A;  4AVC A;  5HMN A;  2FE7 A;  2JDD A;  4RN7 A;  1QST A;  1QSR A;  4XNH B;  3D7D A;  3DLJ A;  4J3G A;  4M6H A;  1BPN A;  2B5G A;  4P4F A;  2BUE A;  2FT0 A;  2AFU A;  4DNC A;  4H6Z A;  2NYQ A;  1ON0 A;  1XBU A;  1LAN A;  1Q2C A;  3B3T A;  3W91 A;  2I3C A;  2B3U A;  3NH4 A;  2J8M A;  4QC6 A;  4OC0 A;  4UIA A;  4A95 A;  1S3Z A;  3PB8 X;  4W9Y A;  1IY7 A;  2EUI A;  2V8H A;  5BWA B;  2PJ3 A;  4M6G A;  1LAM A;  2HV2 A;  1IU8 A;  1I12 A;  2VL1 A;  4MHZ A;  3R9E A;  4FBE A;  3FB3 A;  4IK2 A;  3CT9 A;  2O53 A;  3KZW A;  3PGP A;  4OC1 A;  5C88 A;  5DWN A;  5J8F A;  1MJ9 A;  2C6P A;  1ZLH A;  3D8P A;  4P45 A;  1ARM A;  5LYI A;  4A2Z A;  3ISZ A;  2G3T A;  1YLE A;  3EY5 A;  3L2N A;  1VKC A;  3D7H A;  3EXN A;  3PB9 X;  4IUS A;  4E2A A;  1P4N A;  1YW4 A;  4X5K A;  1MK4 A;  2PJ2 A;  5LRJ A;  3B3W A;  2F7V A;  2OZG A;  3FJU A;  5FVJ A;  3CZX A;  4X3R A;  1AYE A;  4HKF A;  3QAH A;  5CNP A;  3V8I A;  4UF4 A;  2PSW A;  2BSW A;  2VQY A;  5G22 A;  3R9F A;  5E96 A;  2ZOF A;  2CNS A;  4OIW A;  3PZJ A;  2ZEP A;  3HLP A;  1M4I A;  4LUA A;  3B3S A;  2F5I A;  1TKF A;  2Z3M A;  3EC4 A;  3S6K A;  1R43 A;  2FCK A;  3FNC A; 
#chains in the Genus database with same CATH homology
 3DR8 A;  4Y49 B;  5F48 A;  4M3S A;  4A32 A;  3TT2 A;  2Q44 A;  4B5P B;  2P6G A;  1M1D A;  2Z3K A;  4XPD C;  2PR1 A;  3P2F A;  4UFX A;  4RS2 A;  4MBU A;  4FD7 A;  1ZO0 A;  2WUU A;  2B3V A;  4KOW A;  4C7H A;  1Q2Y A;  2JDC A;  3TOA A;  3GY9 A;  1KUY A;  1NSL A;  2OB0 A;  2CNT A;  3TCV A;  4KSF A;  4MY3 A;  4R3L A;  1NMT A;  4MI4 A;  5F46 A;  2D4P A;  4KOY A;  5F47 A;  4CGP A;  5F49 A;  1WWZ A;  2O28 A;  2H5M A;  1M4G A;  1Z9U A;  3JTK A;  2B4D A;  4QVT A;  1R57 A;  3R9G A;  2YNC C;  1PU9 A;  1S7K A;  2WPX A;  2Q7B A;  3G8W A;  5AGE A;  1M4D A;  4LX9 A;  2B5G B;  3CXQ A;  3I9S A;  2ZW6 A;  4KZT A;  4HNW B;  3D2M A;  5EBV A;  1GHE A;  3WR7 A;  4UFW A;  4UCP A;  2REE A;  2VZZ A;  3FBU A;  1BOB A;  1YR0 A;  3D3S A;  1S5K A;  1V0C A;  1YVK A;  1Y7R A;  2DPT A;  1K4J A;  3DNS A;  2Z3L A;  1CJW A;  2VI7 A;  2J8N A;  4PSW A;  3EO4 A;  2J8R A;  4JXR A;  2JLM A;  2VBQ A;  2OZH A;  3DR6 A;  4II9 A;  4MFL A;  4C2Z A;  4YFJ A;  1YGH A;  4HNY B;  3UY5 A;  1OZP A;  4CYQ A;  1B87 A;  4B14 A;  4NCZ A;  1TIQ A;  3TO7 A;  1SQH A;  3CXS A;  4XNH C;  2YGW A;  4ZBG A;  1UFH A;  3BJ8 A;  2Q4Y A;  3TFY A;  1RO5 A;  2ARH A;  3TO6 A;  4FD6 A;  3W6X A;  4UFV A;  1MJB A;  4JXQ A;  4CAW A;  2P0W A;  3GYA A;  4F0Y A;  1Y9W A;  2QML A;  5G21 A;  2YND A;  4MFQ A;  4MHD A;  2QIR A;  5AG4 A;  4MJ8 A;  1PUA A;  2I00 A;  2A4N A;  2JEV A;  2OZU A;  3B8G A;  4KOT A;  4YRH A;  4B12 A;  5IX3 A;  5ISV A;  3IGR A;  4K30 A;  3IU1 A;  3LD2 A;  4RI1 A;  2ZXV A;  4BMH A;  2WSA A;  3FRM A;  4CS0 B;  2Z3P A;  4C7I A;  4XPK A;  4H89 A;  4MFJ A;  4KS9 A;  4AG9 A;  3VWD A;  2D4O A;  3TO9 A;  3KKW A;  4A31 A;  4GS4 A;  2R1I A;  1Y9K A;  4NEX A;  3CXP A;  2B4D B;  4CAV A;  5KTC A;  4PK3 A;  4Q38 A;  2Q0Y A;  1S60 A;  2RC4 A;  2HQY A;  4L8A A;  4PV6 A;  4Y49 C;  4B10 A;  1Q2D A;  3JVN A;  3IWE A;  2GE3 A;  3EFA A;  4JD6 A;  2R98 A;  1I21 A;  2VEZ A;  2Q04 A;  2ZW5 A;  5IV0 A;  3IU2 A;  2Z11 A;  4F0X A;  3P2H A;  2OU2 A;  5IB0 A;  4M85 A;  4NXY A;  1MJA A;  2R7H A;  1IIC A;  1B6B A;  4MY0 A;  4AVA A;  2Z3N A;  5EC4 A;  2B58 A;  2FIA A;  2PQ8 A;  4KUB A;  4JJX A;  5JQ4 A;  2YNE A;  2C27 A;  5AG5 A;  4UWJ A;  1RXT A;  4AB7 A;  4A33 A;  3R96 A;  5A27 A;  3BLN A;  4NSQ A;  3C26 A;  4MFP A;  2PRB A;  4ZGY B;  2EVN A;  2B4B A;  4B13 A;  2YNC A;  2QEC A;  4R57 A;  1KZF A;  4KOV A;  4CAF A;  4CYN A;  3FYN A;  1J4J A;  4KLV A;  2BL1 A;  1XMT A;  1BO4 A;  3NE7 A;  2CNM A;  4JLY A;  1XEB A;  2FIW A;  4CRY B;  2CXA A;  4KOR A;  2FL4 A;  4IF5 A;  4KLW A;  1S7N A;  1YRE A;  4U5Y A;  4R87 A;  3G3S A;  3F5B A;  3VWE A;  2CY2 A;  4BBH A;  5AG7 A;  1CM0 A;  1QSO A;  2P6E A;  2VXK A;  4AVB A;  5GCN A;  2Y0M A;  4PK2 A;  3MGD A;  2Z3O A;  4C68 A;  1I1D A;  4CGO A;  2REF A;  2ZW7 A;  3FXT A;  2Z10 A;  4I49 A;  4U9Y A;  2AE6 A;  4UCM A;  4FD4 A;  3SXO A;  3R95 A;  1LRZ A;  2DXQ A;  4B5O A;  5JPH A;  1L0C A;  3I3G A;  1S7L A;  4CGM A;  1N71 A;  3IWG A;  5H86 A;  1XE4 A;  4KVX A;  2G0B A;  4UCN A;  4XPL A;  3W6S A;  5HH1 A;  2G3A A;  4C2X A;  4OLL A;  4EVY A;  2GAN A;  1Z4E A;  3DDD A;  3GKR A;  2KCW A;  3SXN A;  2IL4 A;  2FXF A;  1Z4R A;  1XIX A;  4KOU A;  4HNX B;  4CGN A;  5G20 A;  3BJ7 A;  2X7B A;  5KTA A;  4XPD B;  4Q36 A;  3PP9 A;  4MFZ A;  2AJ6 A;  4CYO A;  2ZPA A;  4YGO A;  3S6G A;  2WPW A;  3E0K A;  3K9U A;  3F8K A;  4FD5 A;  2Q4V A;  3D2P A;  4ORF A;  4OAD A;  4UWI A;  1M44 A;  1KUX A;  2Z0Z A;  3S6H A;  2BEI A;  2PR8 A;  5KTD A;  2ATR A;  4E0A A;  5G1Z A;  3T90 A;  1YK3 A;  5AG6 A;  2K5T A;  4KSA A;  3FIX A;  3SHP A;  3T9Y A;  5A28 A;  1XF8 A;  3DSB A;  4UBR A;  5I0C A;  1KUV A;  3ZJ0 A;  3N7Z A;  4QBJ A;  2PDO A;  1VHS A;  4E8O A;  4AG7 A;  3LOD A;  3TE4 A;  3RYO A;  4CAE A;  1FY7 A;  3OWC A;  1S7F A;  2R8V A;  4C2Y A;  4CGL A;  4R3K A;  4A30 A;  1YX0 A;  1IYL A;  3H4Q A;  2ZW4 A;  1YVO A;  4L89 A;  3H5Z A;  4NF1 A;  3ZZI A;  4B5P A;  1IID A;  2P6F A;  4R9M A;  4U9Z A;  2FSR A;  2VZY A;  4CAX A;  1P0H A;  4H6U A;  2PC1 A;  4QUS A;  4F6A A;  1QSN A;  4KVM E;  2OH1 A;  4MFK A;  5C82 A;  5J8C A;  4QB9 A;  5DWM A;  5H84 A;  2HUZ A;  2DPS A;  2FS5 A;  3F0A A;  4CRZ B;  2NMT A;  4KOX A;  1NE9 A;  3JUW A;  4KOS A;  3TTH A;  4ONU A;  2GIV A;  1IYK A;  3R1K A;  4KVO E;  1QSM A;  3QB8 A;  3TOB A;  4UA3 A;  4CYP A;  4PSX A;  4JWP A;  4B11 A;  3A9L A;  3S6F A;  4KUA A;  4OAE A;  1U6M A;  1WK4 A;  2I79 A;  1IB1 E;  5HMN A;  4AVC A;  2FE7 A;  2JDD A;  1QST A;  1QSR A;  4XNH B;  4J3G A;  2B5G A;  2BUE A;  2FT0 A;  4DNC A;  4H6Z A;  1ON0 A;  1Q2C A;  3W91 A;  2B3U A;  2J8M A;  4QC6 A;  4A95 A;  1S3Z A;  2EUI A;  5BWA B;  2HV2 A;  1I12 A;  3R9E A;  3FB3 A;  3PGP A;  5C88 A;  5J8F A;  5DWN A;  1MJ9 A;  3D8P A;  4A2Z A;  2G3T A;  1YLE A;  3EY5 A;  1VKC A;  4IUS A;  3EXN A;  4E2A A;  1P4N A;  4X5K A;  1MK4 A;  2OZG A;  5FVJ A;  4HKF A;  3QAH A;  5CNP A;  3V8I A;  5G22 A;  2PSW A;  2BSW A;  2VQY A;  3R9F A;  5E96 A;  2CNS A;  3PZJ A;  1M4I A;  4LUA A;  2F5I A;  2Z3M A;  3EC4 A;  3S6K A;  2FCK A;  3FNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...