1YVOA

Hypothetical acetyltransferase from p.aeruginosa pa01
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
169
structure length
169
Chain Sequence
b'SIRDAGVADLPGILAIYNDAVGNTTAIWNETPVDLANRQAWFDTRARQGYPILVASDAAGEVLGYASYGDWRPFEGFRGTVEHSVYVRDDQRGKGLGVQLLQALIERARAQGLHVMVAAIESGNAASIGLHRRLGFEISGQMPQVGQKFGRWLDLTFMQLNLDPTRSAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Crystal structure of a hypothetical acetyltransferase from P.aeruginosa PA01
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 49
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature ec 2.3.-.-:
pdb deposition date 2005-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1yvoA00
2FIWA 3TOAA 4L8AA 4Y49C 2P6FA 2PRBA 4CAXA 2Y0MA 1M44A 3TFYA 2VZZA 2VEZA 2J8NA 4CRYB 2R98A 4UA3A 5H86A 4JLYA 2OZGA 3E0KA 4IF5A 1OZPA 1IYLA 4R57A 1KUYA 2R8VA 2OB0A 5KTCA 3D2MA 2EUIA 3DDDA 2HUZA 4U9YA 1Y9KA 3R1KA 2KCWA 2OH1A 1Q2DA 3FXTA 3N7ZA 1NSLA 2B58A 2JDDA 2B4DA 1WWZA 2O28A 3QAHA 3TO7A 3PP9A 3FNCA 1S7KA 2ZW5A 3R9FA 1S60A 4JXRA 2Q7BA 1ON0A 3QB8A 4XNHB 2I00A 2JLMA 4Y49B 3ZZIA 3R95A 2B3UA 4UWJA 2B5GA 4PSWA 1U6MA 2ZW4A 4E8OA 2G3TA 4L89A 5IB0A 2FCKA 2HQYA 4MJ8A 2JEVA 2Q04A 1WK4A 4HNWB 3EXNA 4MBUA 1S7FA 1Q2CA 2G0BA 2JDCA 1YVOA 4KOUA 3W6XA 2BSWA 4U5YA 1R57A 1XEBA 1J4JA 1UFHA 1KUVA 4H89A 1NMTA 3KKWA 1S7NA 4CAWA 3F0AA 1K4JA 3D3SA 5F46A 2GIVA 2PDOA 2ARHA 3S6HA 5I0CA 1S7LA 4BMHA 4YFJA 2GE3A 3WR7A 2Q0YA 2WPWA 2FIAA 3V8IA 5DWNA 1YREA 2VQYA 1YX0A 3W91A 1S5KA 3TTHA 4OADA 1NE9A 2QIRA 4X5KA 3GKRA 4QUSA 1SQHA 4KLWA 1XMTA 3P2FA 1RXTA 4AG7A 4JJXA 2PQ8A 2PSWA 4AVAA 3FBUA 2WPXA 3SXOA 2VI7A 4KLVA 2ZW6A 4ZBGA 4R9MA 1MK4A 2I79A 3BLNA 2QECA 4KOYA 3EY5A 5DWMA 3S6FA 1S3ZA 4KVME 3R96A 3BJ8A 3EO4A 3F5BA 3GY9A 1Q2YA 2B4DB 1IYKA 3TCVA 3EC4A 1M4GA 2J8RA 4AVCA 1MJBA 5C88A 4U9ZA 4F6AA 3EFAA 2X7BA 2P6EA 1LRZA 4NCZA 1VHSA 5JPHA 3VWDA 5C82A 1FY7A 1Y7RA 2Q4VA 1L0CA 5FVJA 2B5GB 2B3VA 4UWIA 1XF8A 4XPLA 4MY3A 4B5PA 3MGDA 4I49A 2K5TA 4MHDA 3NE7A 4KOTA 3SHPA 2QMLA 4HKFA 2D4OA 3S6KA 1YVKA 3F8KA 2ZW7A 3UY5A 4M3SA 4DNCA 1YLEA 5KTAA 3DNSA 4KOSA 1QSTA 4NEXA 1PU9A 3JVNA 3C26A 4ONUA 2A4NA 4PK3A 2IL4A 4KVOE 4IUSA 2REFA 3CXSA 3TOBA 4KOXA 4LX9A 4EVYA 1QSOA 4QC6A 4JXQA 4CS0B 4AB7A 1YR0A 1P4NA 4JWPA 3D8PA 2ATRA 5E96A 1QSRA 3JUWA 4YRHA 3IGRA 4AVBA 3G8WA 1CJWA 1P0HA 2PC1A 1M4IA 2FT0A 2FSRA 4KOVA 5J8FA 5JQ4A 2NMTA 1GHEA 5HMNA 5F49A 3TO9A 2FS5A 4AG9A 2VXKA 1RO5A 3LODA 2F5IA 2VBQA 3FIXA 3IWGA 1I1DA 2Z11A 1QSNA 4RS2A 3R9GA 3H4QA 3PGPA 1PUAA 1IB1E 3P2HA 4E2AA 3T90A 1I21A 1Y9WA 5KTDA 4OAEA 1VKCA 2ZPAA 4KOWA 1Z4EA 1XE4A 3FYNA 4HNXB 2DXQA 3TE4A 4MI4A 4UBRA 3CXQA 4FD6A 5EC4A 1V0CA 2CNMA 3DR8A 5F47A 2BEIA 4KZTA 5IX3A 2REEA 4QB9A 4MY0A 2P6GA 1B87A 4CRZB 5EBVA 4B5PB 3I3GA 4R87A 4NSQA 2FL4A 2GANA 1CM0A 4JD6A 3TT2A 4FD7A 4R3LA 2AJ6A 2D4PA 1M1DA 4HNYB 2J8MA 1KZFA 2R1IA 3DR6A 1YGHA 4NXYA 3DSBA 2R7HA 4PK2A 5GCNA 2P0WA 4KUAA 1MJAA 1QSMA 3K9UA 1IIDA 4QVTA 4K30A 4XPKA 3TO6A 4F0YA 2CNTA 5CNPA 3B8GA 2ZXVA 4PSXA 2B4BA 1BOBA 3OWCA 4H6UA 2CNSA 3RYOA 2Q4YA 1I12A 4RI1A 1KUXA 2OZHA 3PZJA 3CXPA 4XPDC 1M4DA 2PR1A 4FD5A 3R9EA 2Z0ZA 4QBJA 4KORA 3I9SA 4CAVA 2OU2A 3VWEA 1BO4A 5J8CA 3W6SA 3T9YA 3ZJ0A 4FD4A 3SXNA 1TIQA 2VZYA 2BL1A 2FXFA 1YK3A 3BJ7A 2CY2A 3LD2A 4GS4A 4PV6A 3S6GA 1IICA 2G3AA 4M85A 1MJ9A 4OLLA 4YGOA 3FRMA 5IV0A 3FB3A 2H5MA 2Z10A 2C27A 2FE7A 4E0AA 4B5OA 4ORFA 5HH1A 5F48A 5H84A 5ISVA 2HV2A 4LUAA 4KUBA 2EVNA 2RC4A 2BUEA 4H6ZA 2PR8A 4J3GA 2OZUA 4R3KA 1N71A 1B6BA 4KVXA 4XPDB 3GYAA 3G3SA 4II9A 4NF1A 3D2PA 2Q44A 1Z4RA 2AE6A 1Z9UA 4XNHC 1XIXA
chains in the Genus database with same CATH superfamily
1XRYA 2FIWA 3TOAA 2QJ8A 5G20A 4L8AA 1BAVA 2P6FA 2PRBA 3ISXA 3L2NA 4Y49C 4CAXA 5LYFA 2Y0MA 5LYLA 1M44A 4CAFA 3TFYA 2VZZA 2AFMA 4MFQA 2VEZA 3TX8A 2J8NA 4A31A 4CRYB 2R98A 2POKA 2IQ6A 4UA3A 5H86A 1BPNA 1XFOA 4PXDA 1HDUA 5A27A 2PE3A 4OIDA 4JLYA 2OZGA 2O4HA 2ABZA 3E0KA 4A2ZA 2ZENA 4DYOA 2PJ2A 1OZPA 1IYLA 4IF5A 4UEZA 3KHXA 4R57A 4OC2A 1KUYA 4P4EA 2ZOGA 2R8VA 4A38A 2OB0A 4A33A 5KTCA 3D2MA 2EUIA 2F7VA 1IGBA 3GB0A 2QVPA 4C2XA 4C2YA 3DDDA 2HUZA 4ZX8A 2XEJA 4UCMA 4U9YA 2WZNA 2QYVA 1Y0RA 1Y9KA 1XBUA 3CPXA 3R1KA 5THWA 2KCWA 2ODFA 4NJRA 3SI0A 2OH1A 1Q2DA 2V8GA 3FEEA 3LWUA 4CGOA 4G1PA 4YU9A 4MFPA 1VHOA 1ZG9A 3FXTA 3N7ZA 1QMUA 4KS9A 4B12A 1NSLA 2B58A 2JDDA 3NH8A 2B4DA 1WWZA 2O28A 3QAHA 3TO7A 3PP9A 3D7DA 3FNCA 3QNVA 5AG4A 1Z8LA 1S7KA 2ZW5A 3R9FA 3D67A 2Z3OA 6CPAA 1AUGA 1S60A 4JXRA 4P6YA 1ON0A 4NGNA 2Q7BA 3QB8A 1Z8XA 4XNHB 4KSAA 1LCPA 2I00A 2AFSA 2JLMA 3B3WA 4Y49B 4ZGYB 4AXVA 3ZZIA 3R95A 2B3UA 4FUUA 4UWJA 4MMOA 4WWVA 3IU1A 2B5GA 4IAVA 4PSWA 1U6MA 1BLLE 2ZW4A 2G3TA 2AFOA 4L89A 2FCKA 4E8OA 5IB0A 2BOAA 2HQYA 2GREA 2HC9A 1JQGA 4M6HA 4DJLA 4TNUA 4MJ8A 2Q43A 2WUUA 2AFXA 1AYEA 2JEVA 5AG5A 2ZEGA 2CXAA 2Q04A 3BI0A 5CPAA 1WK4A 4HNWB 2GLFA 3EXNA 3PB7X 2ZEDA 3DLJA 1QQ9A 4MBUA 1S7FA 2EO8A 2Q4ZA 4ZY0A 1Q2CA 2G0BA 5JM6A 2JDCA 1YVOA 3KHZA 4KOUA 3W6XA 2BSWA 2DF5A 3HUVA 2BO9A 2AFUA 2PJ7A 4U5YA 1R57A 2GFQA 4NGPA 1XEBA 1J4JA 2CF4A 5K8NA 1UFHA 2PRQA 1IOFA 2AFZA 1KUVA 4DUKA 4H89A 4F9UA 1NMTA 1R43A 1ZLIA 3KKWA 3SJXA 4MHNA 4NGTA 1S7NA 2EK9A 1PYTB 1HEEA 5AG7A 4CAWA 3F0AA 4PPZA 4C68A 3SJFA 1K4JA 4MHPA 1CPSA 5A28A 3D3SA 5F46A 3IWWA 2EK8A 2PJ1A 3SI1A 2GIVA 2PDOA 4GXHA 3RO0A 3RNZA 2ARHA 4FWUA 3S6HA 5I0CA 1CP7A 4JZ0A 1ZG8A 1S7LA 4NGSA 5AG6A 3R96A 4UIAA 3IIBA 4BMHA 4MCPA 2PJ9A 2GE3A 4YFJA 4X3RA 2Q0YA 2WPWA 3WR7A 4PXEA 4Z65A 2FIAA 1LANA 4UCNA 3V8IA 5DWNA 1YREA 3MN8A 2VQYA 1ELLP 1XMBA 1YX0A 4B11A 5LYIA 3W91A 1S5KA 3TTHA 3PB4X 1NE9A 4OADA 2QIRA 3IJ3A 5I4MA 1YLOA 4X5KA 3GKRA 3NFZA 4QUSA 1SQHA 1TKJA 1VGYA 4M6GA 4P4BA 4KLWA 3S9NA 1LAPA 4P4FA 1XMTA 3P2FA 4UF4A 5JH9A 1RXTA 4MXUA 4AG7A 3FMCA 1LAMA 4JJXA 1CBXA 3VH9A 4NGMA 4ZY1A 2PQ8A 4TWEA 2PSWA 5D29A 2ANPA 4AVAA 3FBUA 2WPXA 4OMEA 3SXOA 2VI7A 4KLVA 2ZW6A 4ZBGA 4R9MA 1MK4A 2I79A 3BLNA 4MRIA 2QECA 4KOYA 4A37A 3EY5A 1PCAA 5LYDA 5DWMA 3S6FA 2CIJA 1S3ZA 4EMEA 4KVME 4PQAA 4P44A 1YQEA 1Z5RA 2C6CA 3BJ8A 3B3VA 2FVGA 3EO4A 1ZO0A 3B3CA 3FX6A 4NFRA 3F5BA 3GY9A 1FT7A 1Q2YA 2B4DB 2WYRA 1IYKA 5D8NA 1IU8A 1UWYA 3PB9X 3TCVA 1YSJA 3EC4A 3B2YA 1M4GA 2J8RA 4AVCA 1MJBA 1Y0YA 5C88A 2YNCA 4U9ZA 4F6AA 2AFWA 1F57A 1RTQA 2X7BA 3EFAA 3WC5A 1ARMA 2V8DA 2P6EA 2PJ6A 1LRZA 3D66A 4NCZA 1VHSA 5JPHA 4MFJA 3VWDA 4OC3A 5C82A 1FY7A 1Y7RA 1TXRA 1Z8WA 2Q4VA 2ZEMA 1L0CA 5FVJA 2B5GB 2B3VA 4X2TA 4UWIA 1XF8A 4OKOA 4MY3A 4XPLA 4B5PA 2PJ0A 3D4UA 3KR4A 2PVWA 3MGDA 3KASA 4I49A 2XEFA 3K9TA 2K5TA 4MHDA 3NE7A 4KOTA 4CGLA 3SHPA 1CX8A 1X12A 2QMLA 2D4OA 2IMOA 1YVKA 1DE4C 2F8HA 3NH4A 4HKFA 3S6KA 5JGFA 4R8FA 5ELYA 3F8KA 2ZW7A 3UY5A 4M3SA 4DNCA 2VL1A 1YLEA 1CP6A 2Z3LA 5KTAA 3IC1A 1AMPA 3DNSA 4KOSA 1QSTA 4CPAA 4NEXA 1PU9A 3JVNA 3C26A 5LRJA 3LACA 3ISZA 4ONUA 2A4NA 4PK3A 2IL4A 4KVOE 3B35A 2REFA 4IUSA 1Z8TA 8CPAA 3CXSA 4LQGA 3TOBA 4RUHA 2C6GA 2O53A 4KOXA 4LX9A 3H5ZA 4EVYA 3RAMA 1QSOA 3PEIA 1Y7EA 3KQZA 4QC6A 4W9YA 3RBUA 2IJZA 3FEDA 4BD9A 4X8IA 2ZEOA 4JXQA 3KQXA 2PJ4A 2PIZA 4CS0B 2ZEHA 4FBEA 5F09A 4AB7A 1YR0A 5HVFA 1P4NA 1F2OA 4JWPA 2ZEPA 3D8PA 2ATRA 5E96A 2YNCC 3H8GA 4P10A 4P4DA 1QSRA 3JUWA 1VIXA 4B6ZA 3NA6A 2ZEFA 4YRHA 3IGRA 4AVBA 2EWBA 3G8WA 1CJWA 1P0HA 2DPTA 2PC1A 3V38A 4K3NA 3H8EA 5CBMA 1M4IA 1R3NA 1YMEA 1X10A 2EBJA 5LRGA 2FT0A 2Q51A 2RB7A 5DS0A 2FSRA 4KOVA 5J8FA 3WC6A 2PVVA 5JQ4A 2Q7SA 2NMTA 3KI9A 1GHEA 5HMNA 4P45A 1ELMP 4NGRA 3PB8X 5F49A 5G1ZA 3GIUA 3K2KA 3TO9A 2FS5A 4AG9A 2VXKA 4ZX9A 1RO5A 1ZLHA 2G9DA 4MFLA 4CAEA 3LODA 2F5IA 2VBQA 4NGQA 3FIXA 2Z3NA 3IWGA 1XOVA 1I1DA 5HVGA 3PB6X 2V77A 1M4LA 2Z11A 4UFWA 1QSNA 4RS2A 3R9GA 4RN7A 3H4QA 5K8MA 3KZWA 5G22A 3PGPA 4ZY2A 1LOKA 4C7IA 5BWAB 2NSMA 1PUAA 5IB9A 1IB1E 3P2HA 4OC5A 4E2AA 3S9MA 1OBRA 3T90A 4NJQA 1TKHA 1I21A 1YW6A 4KSIA 4MCRA 3MRUA 2NYQA 1Y9WA 4IK2A 5KTDA 4OAEA 4BINA 1CPXA 1H8LA 1VKCA 2ZPAA 3GUXA 4H2KA 5K8OA 4KOWA 1Z4EA 3WC7A 1TF9A 1XE4A 3FYNA 3JTKA 2GLJA 2DXQA 3CT9A 3PBBA 4HNXB 3TE4A 2OR4A 4MI4A 2I3CA 3A9LA 4UBRA 3CXQA 4B10A 4F8ZA 4FD6A 1GYTA 2Z3PA 1V0CA 5EC4A 2CNMA 3DR8A 3B7IA 2BEIA 5F47A 4KZTA 4R6TA 1IOIA 2JBJA 1TKFA 3FH4A 5IX3A 4IHMA 5K8PA 2REEA 4QB9A 4MY0A 4A94A 2P6GA 1B87A 4CRZB 4CYPA 4PXCA 4ONWA 5EBVA 4B5PB 3FECA 3I3GA 2XEIA 1HDQA 4P4JA 4R87A 4CYQA 2C6PA 3B3TA 4OC0A 4NSQA 4UEEA 3IEHA 4C7HA 2FL4A 3FJUA 2GANA 3S9LA 3CPAA 1CM0A 1NSAA 2V8HA 4R7MA 4GM5A 1Q7LA 2C1CA 2PJBA 2Z3MA 4A39A 4A30A 4F0XA 3PFOA 4JD6A 4A32A 4Q38A 3TT2A 1Z2LA 3VARA 3CZXA 4F9VA 3IU2A 1IY7A 2JEWA 4FD7A 4LQ6A 2PCUA 2AJ6A 2D4PA 4R3LA 1M1DA 4HNYB 4UEFA 3SI2A 2J8MA 2RFHA 1KZFA 2R1IA 3DR6A 4HPSA 1YGHA 4NXYA 5J1QA 3HLPA 2WSAA 3DSBA 1LFWA 2R7HA 4PK2A 4MHZA 2YNEA 5GCNA 2P0WA 1DTDA 4KUAA 4UFVA 2BCOA 1CG2A 2PJ3A 1MJAA 1QSMA 2CTBA 3KGQA 1XJOA 3K9UA 1IIDA 2YGWA 4QVTA 4Q7AA 4K30A 4XPKA 3BI1A 3TO6A 4F0YA 2CNTA 5CNPA 3B8GA 3QAYA 4R76A 2ZXVA 2XEGA 4PSXA 2B4BA 1BOBA 3OWCA 3IWEA 2CNSA 4H6UA 4O23A 3RYOA 4B13A 2HB6A 2JBKA 2Q4YA 4MFKA 3LMSA 1I12A 3GLJA 3KL9A 4CGMA 1VHEA 1F2PA 2V8VA 4RI1A 3SJEA 1KUXA 4ZI6A 2OZHA 1TF8A 3PZJA 3CDXA 4CGPA 1JWQA 1FNOA 3CXPA 2PJ5A 4KSFA 4PXBA 4XPDC 4EWTA 1M4DA 2GU2A 2PR1A 4FD5A 2Z0ZA 3R9EA 4YWYA 7CPAA 4OIWA 4KORA 4QBJA 4UFXA 4CYOA 3I9SA 4CAVA 4EFDA 2OU2A 2ZELA 2DPSA 3VWEA 1BO4A 5J8CA 3TC8A 3W6SA 4CYNA 4OC4A 4FAIA 4ZYQA 4MHYA 5AGEA 3IFEA 3B3SA 3DGVA 3T9YA 3ZJ0A 4A95A 3SJGA 3T8WA 3WT4A 5HVHA 4FD4A 3NH5A 3SXNA 1TIQA 2VZYA 2BL1A 4MCQA 3NE8A 1EE3P 2FXFA 1YK3A 4M6IA 3BJ7A 3H8FA 2CY2A 3IO1A 2ZEEA 3LD2A 4GS4A 1IICA 1ZG7A 4OP4A 4PV6A 3S6GA 2G3AA 4M85A 1MJ9A 4OLLA 4MFZA 4YGOA 3FRMA 4MCSA 5IV0A 3FB3A 2H5MA 3N5FA 1KWMA 4C2ZA 2Z10A 5HXDA 2PIYA 2C27A 3KR5A 4CGNA 3FVLA 3VATA 2FE7A 2PJ8A 2Z3KA 4E0AA 3D7FA 4B5OA 4ORFA 4OC1A 5HH1A 5F48A 4Q36A 5H84A 5ISVA 4BBHA 3FF3A 2ZOFA 3D7HA 3V7ZA 2CTCA 2HV2A 4LUAA 2PJCA 4KUBA 2EVNA 3D7GA 3PRTA 2RC4A 1YW4A 2DEAA 3BHXA 2BUEA 3BXMA 4JYWA 5G21A 3RZAA 4H6ZA 2J9AA 3JRUA 1BPMA 2PR8A 4J3GA 2OZUA 4R3KA 1N71A 2OOTA 3I1UA 1B6BA 4P4IA 4UIBA 5LRKA 4KVXA 4XPDB 3GYAA 1A2ZA 3G3SA 4II9A 4NF1A 4B14A 3WABA 3D2PA 2PJAA 2Q44A 1Z4RA 3D68A 2AE6A 3PBEA 3PFEA 4UCPA 1Z9UA 4WJBA 5EMIA 2YNDA 4XNHC 1ARLA 1XIXA
chains in the Genus database with same CATH topology
2FIWA 3TOAA 5G20A 4L8AA 4Y49C 2P6FA 2PRBA 4CAXA 2Y0MA 1M44A 4CAFA 3TFYA 2VZZA 4MFQA 2VEZA 2J8NA 4A31A 4CRYB 2R98A 4UA3A 5H86A 5A27A 4JLYA 2OZGA 3E0KA 4A2ZA 4IF5A 1OZPA 1IYLA 4R57A 1KUYA 2R8VA 2OB0A 4A33A 5KTCA 3D2MA 2EUIA 4C2XA 4C2YA 3DDDA 2HUZA 4UCMA 4U9YA 1Y9KA 3R1KA 2KCWA 2OH1A 1Q2DA 4CGOA 4MFPA 3FXTA 3N7ZA 4KS9A 4B12A 1NSLA 2B58A 2JDDA 2B4DA 1WWZA 2O28A 3QAHA 3TO7A 3PP9A 5AG4A 3FNCA 1S7KA 2ZW5A 3R9FA 2Z3OA 1S60A 4JXRA 2Q7BA 1ON0A 3QB8A 4XNHB 4KSAA 2I00A 2JLMA 4Y49B 3ZZIA 3R95A 2B3UA 4UWJA 3IU1A 2B5GA 4PSWA 1U6MA 2ZW4A 4E8OA 2G3TA 4L89A 5IB0A 2FCKA 2HQYA 4MJ8A 2WUUA 2JEVA 5AG5A 2CXAA 2Q04A 1WK4A 4HNWB 3EXNA 4MBUA 1S7FA 1Q2CA 2G0BA 2JDCA 1YVOA 4KOUA 3W6XA 2BSWA 4U5YA 1R57A 1XEBA 1J4JA 1UFHA 1KUVA 4H89A 1NMTA 3KKWA 1S7NA 5AG7A 4CAWA 3F0AA 4C68A 1K4JA 5A28A 3D3SA 5F46A 2GIVA 2PDOA 2ARHA 3S6HA 5I0CA 1S7LA 5AG6A 4BMHA 4YFJA 2GE3A 3WR7A 2Q0YA 2WPWA 2FIAA 4UCNA 3V8IA 5DWNA 1YREA 2VQYA 1YX0A 4B11A 3W91A 1S5KA 3TTHA 4OADA 1NE9A 2QIRA 4X5KA 3GKRA 4QUSA 1SQHA 4KLWA 1XMTA 3P2FA 1RXTA 4AG7A 4JJXA 2PQ8A 2PSWA 4AVAA 3FBUA 2WPXA 3SXOA 2VI7A 4KLVA 2ZW6A 4ZBGA 4R9MA 1MK4A 2I79A 3BLNA 2QECA 4KOYA 3EY5A 5DWMA 3S6FA 1S3ZA 4KVME 3R96A 3BJ8A 3EO4A 1ZO0A 3F5BA 3GY9A 1Q2YA 2B4DB 1IYKA 3TCVA 3EC4A 1M4GA 2J8RA 4AVCA 1MJBA 5C88A 2YNCA 4U9ZA 4F6AA 3EFAA 2X7BA 2P6EA 1LRZA 4NCZA 1VHSA 5JPHA 4MFJA 3VWDA 5C82A 1FY7A 1Y7RA 2Q4VA 1L0CA 5FVJA 2B5GB 2B3VA 4UWIA 1XF8A 4XPLA 4MY3A 4B5PA 3MGDA 4I49A 2K5TA 4MHDA 3NE7A 4KOTA 4CGLA 3SHPA 2QMLA 4HKFA 2D4OA 3S6KA 1YVKA 3F8KA 2ZW7A 3UY5A 4M3SA 4DNCA 1YLEA 2Z3LA 5KTAA 3DNSA 4KOSA 1QSTA 4NEXA 1PU9A 3JVNA 3C26A 4ONUA 2A4NA 4PK3A 2IL4A 4KVOE 4IUSA 2REFA 3CXSA 3TOBA 4KOXA 4LX9A 3H5ZA 4EVYA 1QSOA 4QC6A 4JXQA 4CS0B 4AB7A 1YR0A 1P4NA 4JWPA 3D8PA 2ATRA 5E96A 2YNCC 1QSRA 3JUWA 4YRHA 3IGRA 4AVBA 3G8WA 1CJWA 1P0HA 2DPTA 2PC1A 1M4IA 2FT0A 2FSRA 4KOVA 5J8FA 5JQ4A 2NMTA 1GHEA 5HMNA 5F49A 5G1ZA 3TO9A 2FS5A 4AG9A 2VXKA 1RO5A 4MFLA 4CAEA 3LODA 2F5IA 2VBQA 3FIXA 2Z3NA 3IWGA 1I1DA 2Z11A 4UFWA 1QSNA 4RS2A 3R9GA 3H4QA 5G22A 3PGPA 4C7IA 5BWAB 1PUAA 1IB1E 3P2HA 4E2AA 3T90A 1I21A 1Y9WA 5KTDA 4OAEA 1VKCA 2ZPAA 4KOWA 1Z4EA 1XE4A 3FYNA 3JTKA 4HNXB 2DXQA 3TE4A 4MI4A 3A9LA 4UBRA 3CXQA 4B10A 4FD6A 5EC4A 2Z3PA 1V0CA 2CNMA 3DR8A 5F47A 2BEIA 4KZTA 5IX3A 2REEA 4QB9A 4MY0A 2P6GA 1B87A 4CRZB 4CYPA 5EBVA 4B5PB 3I3GA 4R87A 4CYQA 4NSQA 4C7HA 2FL4A 2GANA 1CM0A 2Z3MA 4A30A 4F0XA 4JD6A 4A32A 4Q38A 3TT2A 3IU2A 4FD7A 4R3LA 2AJ6A 2D4PA 1M1DA 4HNYB 2J8MA 1KZFA 2R1IA 3DR6A 1YGHA 4NXYA 2WSAA 3DSBA 2R7HA 4PK2A 2YNEA 5GCNA 2P0WA 4KUAA 4UFVA 1MJAA 1QSMA 3K9UA 1IIDA 2YGWA 4QVTA 4K30A 4XPKA 3TO6A 4F0YA 2CNTA 5CNPA 3B8GA 2ZXVA 4PSXA 2B4BA 1BOBA 3OWCA 3IWEA 2CNSA 4H6UA 4B13A 3RYOA 2Q4YA 4MFKA 1I12A 4CGMA 4RI1A 1KUXA 2OZHA 3PZJA 4CGPA 3CXPA 4KSFA 4XPDC 1M4DA 2PR1A 4FD5A 3R9EA 2Z0ZA 4QBJA 4KORA 4UFXA 4CYOA 3I9SA 4CAVA 2OU2A 2DPSA 3VWEA 1BO4A 5J8CA 3W6SA 4CYNA 5AGEA 3T9YA 3ZJ0A 4A95A 4FD4A 3SXNA 1TIQA 2VZYA 2BL1A 2FXFA 1YK3A 4ZGYB 3BJ7A 2CY2A 3LD2A 4GS4A 4PV6A 3S6GA 1IICA 2G3AA 4M85A 1MJ9A 4OLLA 4MFZA 4YGOA 3FRMA 5IV0A 3FB3A 2H5MA 4C2ZA 2Z10A 2C27A 4CGNA 2FE7A 2Z3KA 4E0AA 4B5OA 4ORFA 5HH1A 5F48A 4Q36A 5H84A 5ISVA 4BBHA 2HV2A 4LUAA 4KUBA 2EVNA 2RC4A 5G21A 2BUEA 4H6ZA 2PR8A 4J3GA 2OZUA 4R3KA 1N71A 1B6BA 4KVXA 4XPDB 3GYAA 3G3SA 4II9A 4NF1A 4B14A 3D2PA 2Q44A 1Z4RA 4UCPA 2AE6A 1Z9UA 2YNDA 4XNHC 1XIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FIW A;  3TOA A;  4L8A A;  4Y49 C;  2P6F A;  2PRB A;  4CAX A;  2Y0M A;  1M44 A;  3TFY A;  2VZZ A;  2VEZ A;  2J8N A;  4CRY B;  2R98 A;  4UA3 A;  5H86 A;  4JLY A;  2OZG A;  3E0K A;  4IF5 A;  1OZP A;  1IYL A;  4R57 A;  1KUY A;  2R8V A;  2OB0 A;  5KTC A;  3D2M A;  2EUI A;  3DDD A;  2HUZ A;  4U9Y A;  1Y9K A;  3R1K A;  2KCW A;  2OH1 A;  1Q2D A;  3FXT A;  3N7Z A;  1NSL A;  2B58 A;  2JDD A;  2B4D A;  1WWZ A;  2O28 A;  3QAH A;  3TO7 A;  3PP9 A;  3FNC A;  1S7K A;  2ZW5 A;  3R9F A;  1S60 A;  4JXR A;  2Q7B A;  1ON0 A;  3QB8 A;  4XNH B;  2I00 A;  2JLM A;  4Y49 B;  3ZZI A;  3R95 A;  2B3U A;  4UWJ A;  2B5G A;  4PSW A;  1U6M A;  2ZW4 A;  4E8O A;  2G3T A;  4L89 A;  5IB0 A;  2FCK A;  2HQY A;  4MJ8 A;  2JEV A;  2Q04 A;  1WK4 A;  4HNW B;  3EXN A;  4MBU A;  1S7F A;  1Q2C A;  2G0B A;  2JDC A;  1YVO A;  4KOU A;  3W6X A;  2BSW A;  4U5Y A;  1R57 A;  1XEB A;  1J4J A;  1UFH A;  1KUV A;  4H89 A;  1NMT A;  3KKW A;  1S7N A;  4CAW A;  3F0A A;  1K4J A;  3D3S A;  5F46 A;  2GIV A;  2PDO A;  2ARH A;  3S6H A;  5I0C A;  1S7L A;  4BMH A;  4YFJ A;  2GE3 A;  3WR7 A;  2Q0Y A;  2WPW A;  2FIA A;  3V8I A;  5DWN A;  1YRE A;  2VQY A;  1YX0 A;  3W91 A;  1S5K A;  3TTH A;  4OAD A;  1NE9 A;  2QIR A;  4X5K A;  3GKR A;  4QUS A;  1SQH A;  4KLW A;  1XMT A;  3P2F A;  1RXT A;  4AG7 A;  4JJX A;  2PQ8 A;  2PSW A;  4AVA A;  3FBU A;  2WPX A;  3SXO A;  2VI7 A;  4KLV A;  2ZW6 A;  4ZBG A;  4R9M A;  1MK4 A;  2I79 A;  3BLN A;  2QEC A;  4KOY A;  3EY5 A;  5DWM A;  3S6F A;  1S3Z A;  4KVM E;  3R96 A;  3BJ8 A;  3EO4 A;  3F5B A;  3GY9 A;  1Q2Y A;  2B4D B;  1IYK A;  3TCV A;  3EC4 A;  1M4G A;  2J8R A;  4AVC A;  1MJB A;  5C88 A;  4U9Z A;  4F6A A;  3EFA A;  2X7B A;  2P6E A;  1LRZ A;  4NCZ A;  1VHS A;  5JPH A;  3VWD A;  5C82 A;  1FY7 A;  1Y7R A;  2Q4V A;  1L0C A;  5FVJ A;  2B5G B;  2B3V A;  4UWI A;  1XF8 A;  4XPL A;  4MY3 A;  4B5P A;  3MGD A;  4I49 A;  2K5T A;  4MHD A;  3NE7 A;  4KOT A;  3SHP A;  2QML A;  4HKF A;  2D4O A;  3S6K A;  1YVK A;  3F8K A;  2ZW7 A;  3UY5 A;  4M3S A;  4DNC A;  1YLE A;  5KTA A;  3DNS A;  4KOS A;  1QST A;  4NEX A;  1PU9 A;  3JVN A;  3C26 A;  4ONU A;  2A4N A;  4PK3 A;  2IL4 A;  4KVO E;  4IUS A;  2REF A;  3CXS A;  3TOB A;  4KOX A;  4LX9 A;  4EVY A;  1QSO A;  4QC6 A;  4JXQ A;  4CS0 B;  4AB7 A;  1YR0 A;  1P4N A;  4JWP A;  3D8P A;  2ATR A;  5E96 A;  1QSR A;  3JUW A;  4YRH A;  3IGR A;  4AVB A;  3G8W A;  1CJW A;  1P0H A;  2PC1 A;  1M4I A;  2FT0 A;  2FSR A;  4KOV A;  5J8F A;  5JQ4 A;  2NMT A;  1GHE A;  5HMN A;  5F49 A;  3TO9 A;  2FS5 A;  4AG9 A;  2VXK A;  1RO5 A;  3LOD A;  2F5I A;  2VBQ A;  3FIX A;  3IWG A;  1I1D A;  2Z11 A;  1QSN A;  4RS2 A;  3R9G A;  3H4Q A;  3PGP A;  1PUA A;  1IB1 E;  3P2H A;  4E2A A;  3T90 A;  1I21 A;  1Y9W A;  5KTD A;  4OAE A;  1VKC A;  2ZPA A;  4KOW A;  1Z4E A;  1XE4 A;  3FYN A;  4HNX B;  2DXQ A;  3TE4 A;  4MI4 A;  4UBR A;  3CXQ A;  4FD6 A;  5EC4 A;  1V0C A;  2CNM A;  3DR8 A;  5F47 A;  2BEI A;  4KZT A;  5IX3 A;  2REE A;  4QB9 A;  4MY0 A;  2P6G A;  1B87 A;  4CRZ B;  5EBV A;  4B5P B;  3I3G A;  4R87 A;  4NSQ A;  2FL4 A;  2GAN A;  1CM0 A;  4JD6 A;  3TT2 A;  4FD7 A;  4R3L A;  2AJ6 A;  2D4P A;  1M1D A;  4HNY B;  2J8M A;  1KZF A;  2R1I A;  3DR6 A;  1YGH A;  4NXY A;  3DSB A;  2R7H A;  4PK2 A;  5GCN A;  2P0W A;  4KUA A;  1MJA A;  1QSM A;  3K9U A;  1IID A;  4QVT A;  4K30 A;  4XPK A;  3TO6 A;  4F0Y A;  2CNT A;  5CNP A;  3B8G A;  2ZXV A;  4PSX A;  2B4B A;  1BOB A;  3OWC A;  4H6U A;  2CNS A;  3RYO A;  2Q4Y A;  1I12 A;  4RI1 A;  1KUX A;  2OZH A;  3PZJ A;  3CXP A;  4XPD C;  1M4D A;  2PR1 A;  4FD5 A;  3R9E A;  2Z0Z A;  4QBJ A;  4KOR A;  3I9S A;  4CAV A;  2OU2 A;  3VWE A;  1BO4 A;  5J8C A;  3W6S A;  3T9Y A;  3ZJ0 A;  4FD4 A;  3SXN A;  1TIQ A;  2VZY A;  2BL1 A;  2FXF A;  1YK3 A;  3BJ7 A;  2CY2 A;  3LD2 A;  4GS4 A;  4PV6 A;  3S6G A;  1IIC A;  2G3A A;  4M85 A;  1MJ9 A;  4OLL A;  4YGO A;  3FRM A;  5IV0 A;  3FB3 A;  2H5M A;  2Z10 A;  2C27 A;  2FE7 A;  4E0A A;  4B5O A;  4ORF A;  5HH1 A;  5F48 A;  5H84 A;  5ISV A;  2HV2 A;  4LUA A;  4KUB A;  2EVN A;  2RC4 A;  2BUE A;  4H6Z A;  2PR8 A;  4J3G A;  2OZU A;  4R3K A;  1N71 A;  1B6B A;  4KVX A;  4XPD B;  3GYA A;  3G3S A;  4II9 A;  4NF1 A;  3D2P A;  2Q44 A;  1Z4R A;  2AE6 A;  1Z9U A;  4XNH C;  1XIX A; 
#chains in the Genus database with same CATH topology
 1XRY A;  2FIW A;  3TOA A;  2QJ8 A;  5G20 A;  4L8A A;  1BAV A;  2P6F A;  2PRB A;  3ISX A;  3L2N A;  4Y49 C;  4CAX A;  5LYF A;  2Y0M A;  5LYL A;  1M44 A;  4CAF A;  3TFY A;  2VZZ A;  2AFM A;  4MFQ A;  2VEZ A;  3TX8 A;  2J8N A;  4A31 A;  4CRY B;  2R98 A;  2POK A;  2IQ6 A;  4UA3 A;  5H86 A;  1BPN A;  1XFO A;  4PXD A;  1HDU A;  5A27 A;  2PE3 A;  4OID A;  4JLY A;  2OZG A;  2O4H A;  2ABZ A;  3E0K A;  4A2Z A;  2ZEN A;  4DYO A;  2PJ2 A;  1OZP A;  1IYL A;  4IF5 A;  4UEZ A;  3KHX A;  4R57 A;  4OC2 A;  1KUY A;  4P4E A;  2ZOG A;  2R8V A;  4A38 A;  2OB0 A;  4A33 A;  5KTC A;  3D2M A;  2EUI A;  2F7V A;  1IGB A;  3GB0 A;  2QVP A;  4C2X A;  4C2Y A;  3DDD A;  2HUZ A;  4ZX8 A;  2XEJ A;  4UCM A;  4U9Y A;  2WZN A;  2QYV A;  1Y0R A;  1Y9K A;  1XBU A;  3CPX A;  3R1K A;  5THW A;  2KCW A;  2ODF A;  4NJR A;  3SI0 A;  2OH1 A;  1Q2D A;  2V8G A;  3FEE A;  3LWU A;  4CGO A;  4G1P A;  4YU9 A;  4MFP A;  1VHO A;  1ZG9 A;  3FXT A;  3N7Z A;  1QMU A;  4KS9 A;  4B12 A;  1NSL A;  2B58 A;  2JDD A;  3NH8 A;  2B4D A;  1WWZ A;  2O28 A;  3QAH A;  3TO7 A;  3PP9 A;  3D7D A;  3FNC A;  3QNV A;  5AG4 A;  1Z8L A;  1S7K A;  2ZW5 A;  3R9F A;  3D67 A;  2Z3O A;  6CPA A;  1AUG A;  1S60 A;  4JXR A;  4P6Y A;  1ON0 A;  4NGN A;  2Q7B A;  3QB8 A;  1Z8X A;  4XNH B;  4KSA A;  1LCP A;  2I00 A;  2AFS A;  2JLM A;  3B3W A;  4Y49 B;  4ZGY B;  4AXV A;  3ZZI A;  3R95 A;  2B3U A;  4FUU A;  4UWJ A;  4MMO A;  4WWV A;  3IU1 A;  2B5G A;  4IAV A;  4PSW A;  1U6M A;  1BLL E;  2ZW4 A;  2G3T A;  2AFO A;  4L89 A;  2FCK A;  4E8O A;  5IB0 A;  2BOA A;  2HQY A;  2GRE A;  2HC9 A;  1JQG A;  4M6H A;  4DJL A;  4TNU A;  4MJ8 A;  2Q43 A;  2WUU A;  2AFX A;  1AYE A;  2JEV A;  5AG5 A;  2ZEG A;  2CXA A;  2Q04 A;  3BI0 A;  5CPA A;  1WK4 A;  4HNW B;  2GLF A;  3EXN A;  3PB7 X;  2ZED A;  3DLJ A;  1QQ9 A;  4MBU A;  1S7F A;  2EO8 A;  2Q4Z A;  4ZY0 A;  1Q2C A;  2G0B A;  5JM6 A;  2JDC A;  1YVO A;  3KHZ A;  4KOU A;  3W6X A;  2BSW A;  2DF5 A;  3HUV A;  2BO9 A;  2AFU A;  2PJ7 A;  4U5Y A;  1R57 A;  2GFQ A;  4NGP A;  1XEB A;  1J4J A;  2CF4 A;  5K8N A;  1UFH A;  2PRQ A;  1IOF A;  2AFZ A;  1KUV A;  4DUK A;  4H89 A;  4F9U A;  1NMT A;  1R43 A;  1ZLI A;  3KKW A;  3SJX A;  4MHN A;  4NGT A;  1S7N A;  2EK9 A;  1PYT B;  1HEE A;  5AG7 A;  4CAW A;  3F0A A;  4PPZ A;  4C68 A;  3SJF A;  1K4J A;  4MHP A;  1CPS A;  5A28 A;  3D3S A;  5F46 A;  3IWW A;  2EK8 A;  2PJ1 A;  3SI1 A;  2GIV A;  2PDO A;  4GXH A;  3RO0 A;  3RNZ A;  2ARH A;  4FWU A;  3S6H A;  5I0C A;  1CP7 A;  4JZ0 A;  1ZG8 A;  1S7L A;  4NGS A;  5AG6 A;  3R96 A;  4UIA A;  3IIB A;  4BMH A;  4MCP A;  2PJ9 A;  2GE3 A;  4YFJ A;  4X3R A;  2Q0Y A;  2WPW A;  3WR7 A;  4PXE A;  4Z65 A;  2FIA A;  1LAN A;  4UCN A;  3V8I A;  5DWN A;  1YRE A;  3MN8 A;  2VQY A;  1ELL P;  1XMB A;  1YX0 A;  4B11 A;  5LYI A;  3W91 A;  1S5K A;  3TTH A;  3PB4 X;  1NE9 A;  4OAD A;  2QIR A;  3IJ3 A;  5I4M A;  1YLO A;  4X5K A;  3GKR A;  3NFZ A;  4QUS A;  1SQH A;  1TKJ A;  1VGY A;  4M6G A;  4P4B A;  4KLW A;  3S9N A;  1LAP A;  4P4F A;  1XMT A;  3P2F A;  4UF4 A;  5JH9 A;  1RXT A;  4MXU A;  4AG7 A;  3FMC A;  1LAM A;  4JJX A;  1CBX A;  3VH9 A;  4NGM A;  4ZY1 A;  2PQ8 A;  4TWE A;  2PSW A;  5D29 A;  2ANP A;  4AVA A;  3FBU A;  2WPX A;  4OME A;  3SXO A;  2VI7 A;  4KLV A;  2ZW6 A;  4ZBG A;  4R9M A;  1MK4 A;  2I79 A;  3BLN A;  4MRI A;  2QEC A;  4KOY A;  4A37 A;  3EY5 A;  1PCA A;  5LYD A;  5DWM A;  3S6F A;  2CIJ A;  1S3Z A;  4EME A;  4KVM E;  4PQA A;  4P44 A;  1YQE A;  1Z5R A;  2C6C A;  3BJ8 A;  3B3V A;  2FVG A;  3EO4 A;  1ZO0 A;  3B3C A;  3FX6 A;  4NFR A;  3F5B A;  3GY9 A;  1FT7 A;  1Q2Y A;  2B4D B;  2WYR A;  1IYK A;  5D8N A;  1IU8 A;  1UWY A;  3PB9 X;  3TCV A;  1YSJ A;  3EC4 A;  3B2Y A;  1M4G A;  2J8R A;  4AVC A;  1MJB A;  1Y0Y A;  5C88 A;  2YNC A;  4U9Z A;  4F6A A;  2AFW A;  1F57 A;  1RTQ A;  2X7B A;  3EFA A;  3WC5 A;  1ARM A;  2V8D A;  2P6E A;  2PJ6 A;  1LRZ A;  3D66 A;  4NCZ A;  1VHS A;  5JPH A;  4MFJ A;  3VWD A;  4OC3 A;  5C82 A;  1FY7 A;  1Y7R A;  1TXR A;  1Z8W A;  2Q4V A;  2ZEM A;  1L0C A;  5FVJ A;  2B5G B;  2B3V A;  4X2T A;  4UWI A;  1XF8 A;  4OKO A;  4MY3 A;  4XPL A;  4B5P A;  2PJ0 A;  3D4U A;  3KR4 A;  2PVW A;  3MGD A;  3KAS A;  4I49 A;  2XEF A;  3K9T A;  2K5T A;  4MHD A;  3NE7 A;  4KOT A;  4CGL A;  3SHP A;  1CX8 A;  1X12 A;  2QML A;  2D4O A;  2IMO A;  1YVK A;  1DE4 C;  2F8H A;  3NH4 A;  4HKF A;  3S6K A;  5JGF A;  4R8F A;  5ELY A;  3F8K A;  2ZW7 A;  3UY5 A;  4M3S A;  4DNC A;  2VL1 A;  1YLE A;  1CP6 A;  2Z3L A;  5KTA A;  3IC1 A;  1AMP A;  3DNS A;  4KOS A;  1QST A;  4CPA A;  4NEX A;  1PU9 A;  3JVN A;  3C26 A;  5LRJ A;  3LAC A;  3ISZ A;  4ONU A;  2A4N A;  4PK3 A;  2IL4 A;  4KVO E;  3B35 A;  2REF A;  4IUS A;  1Z8T A;  8CPA A;  3CXS A;  4LQG A;  3TOB A;  4RUH A;  2C6G A;  2O53 A;  4KOX A;  4LX9 A;  3H5Z A;  4EVY A;  3RAM A;  1QSO A;  3PEI A;  1Y7E A;  3KQZ A;  4QC6 A;  4W9Y A;  3RBU A;  2IJZ A;  3FED A;  4BD9 A;  4X8I A;  2ZEO A;  4JXQ A;  3KQX A;  2PJ4 A;  2PIZ A;  4CS0 B;  2ZEH A;  4FBE A;  5F09 A;  4AB7 A;  1YR0 A;  5HVF A;  1P4N A;  1F2O A;  4JWP A;  2ZEP A;  3D8P A;  2ATR A;  5E96 A;  2YNC C;  3H8G A;  4P10 A;  4P4D A;  1QSR A;  3JUW A;  1VIX A;  4B6Z A;  3NA6 A;  2ZEF A;  4YRH A;  3IGR A;  4AVB A;  2EWB A;  3G8W A;  1CJW A;  1P0H A;  2DPT A;  2PC1 A;  3V38 A;  4K3N A;  3H8E A;  5CBM A;  1M4I A;  1R3N A;  1YME A;  1X10 A;  2EBJ A;  5LRG A;  2FT0 A;  2Q51 A;  2RB7 A;  5DS0 A;  2FSR A;  4KOV A;  5J8F A;  3WC6 A;  2PVV A;  5JQ4 A;  2Q7S A;  2NMT A;  3KI9 A;  1GHE A;  5HMN A;  4P45 A;  1ELM P;  4NGR A;  3PB8 X;  5F49 A;  5G1Z A;  3GIU A;  3K2K A;  3TO9 A;  2FS5 A;  4AG9 A;  2VXK A;  4ZX9 A;  1RO5 A;  1ZLH A;  2G9D A;  4MFL A;  4CAE A;  3LOD A;  2F5I A;  2VBQ A;  4NGQ A;  3FIX A;  2Z3N A;  3IWG A;  1XOV A;  1I1D A;  5HVG A;  3PB6 X;  2V77 A;  1M4L A;  2Z11 A;  4UFW A;  1QSN A;  4RS2 A;  3R9G A;  4RN7 A;  3H4Q A;  5K8M A;  3KZW A;  5G22 A;  3PGP A;  4ZY2 A;  1LOK A;  4C7I A;  5BWA B;  2NSM A;  1PUA A;  5IB9 A;  1IB1 E;  3P2H A;  4OC5 A;  4E2A A;  3S9M A;  1OBR A;  3T90 A;  4NJQ A;  1TKH A;  1I21 A;  1YW6 A;  4KSI A;  4MCR A;  3MRU A;  2NYQ A;  1Y9W A;  4IK2 A;  5KTD A;  4OAE A;  4BIN A;  1CPX A;  1H8L A;  1VKC A;  2ZPA A;  3GUX A;  4H2K A;  5K8O A;  4KOW A;  1Z4E A;  3WC7 A;  1TF9 A;  1XE4 A;  3FYN A;  3JTK A;  2GLJ A;  2DXQ A;  3CT9 A;  3PBB A;  4HNX B;  3TE4 A;  2OR4 A;  4MI4 A;  2I3C A;  3A9L A;  4UBR A;  3CXQ A;  4B10 A;  4F8Z A;  4FD6 A;  1GYT A;  2Z3P A;  1V0C A;  5EC4 A;  2CNM A;  3DR8 A;  3B7I A;  2BEI A;  5F47 A;  4KZT A;  4R6T A;  1IOI A;  2JBJ A;  1TKF A;  3FH4 A;  5IX3 A;  4IHM A;  5K8P A;  2REE A;  4QB9 A;  4MY0 A;  4A94 A;  2P6G A;  1B87 A;  4CRZ B;  4CYP A;  4PXC A;  4ONW A;  5EBV A;  4B5P B;  3FEC A;  3I3G A;  2XEI A;  1HDQ A;  4P4J A;  4R87 A;  4CYQ A;  2C6P A;  3B3T A;  4OC0 A;  4NSQ A;  4UEE A;  3IEH A;  4C7H A;  2FL4 A;  3FJU A;  2GAN A;  3S9L A;  3CPA A;  1CM0 A;  1NSA A;  2V8H A;  4R7M A;  4GM5 A;  1Q7L A;  2C1C A;  2PJB A;  2Z3M A;  4A39 A;  4A30 A;  4F0X A;  3PFO A;  4JD6 A;  4A32 A;  4Q38 A;  3TT2 A;  1Z2L A;  3VAR A;  3CZX A;  4F9V A;  3IU2 A;  1IY7 A;  2JEW A;  4FD7 A;  4LQ6 A;  2PCU A;  2AJ6 A;  2D4P A;  4R3L A;  1M1D A;  4HNY B;  4UEF A;  3SI2 A;  2J8M A;  2RFH A;  1KZF A;  2R1I A;  3DR6 A;  4HPS A;  1YGH A;  4NXY A;  5J1Q A;  3HLP A;  2WSA A;  3DSB A;  1LFW A;  2R7H A;  4PK2 A;  4MHZ A;  2YNE A;  5GCN A;  2P0W A;  1DTD A;  4KUA A;  4UFV A;  2BCO A;  1CG2 A;  2PJ3 A;  1MJA A;  1QSM A;  2CTB A;  3KGQ A;  1XJO A;  3K9U A;  1IID A;  2YGW A;  4QVT A;  4Q7A A;  4K30 A;  4XPK A;  3BI1 A;  3TO6 A;  4F0Y A;  2CNT A;  5CNP A;  3B8G A;  3QAY A;  4R76 A;  2ZXV A;  2XEG A;  4PSX A;  2B4B A;  1BOB A;  3OWC A;  3IWE A;  2CNS A;  4H6U A;  4O23 A;  3RYO A;  4B13 A;  2HB6 A;  2JBK A;  2Q4Y A;  4MFK A;  3LMS A;  1I12 A;  3GLJ A;  3KL9 A;  4CGM A;  1VHE A;  1F2P A;  2V8V A;  4RI1 A;  3SJE A;  1KUX A;  4ZI6 A;  2OZH A;  1TF8 A;  3PZJ A;  3CDX A;  4CGP A;  1JWQ A;  1FNO A;  3CXP A;  2PJ5 A;  4KSF A;  4PXB A;  4XPD C;  4EWT A;  1M4D A;  2GU2 A;  2PR1 A;  4FD5 A;  2Z0Z A;  3R9E A;  4YWY A;  7CPA A;  4OIW A;  4KOR A;  4QBJ A;  4UFX A;  4CYO A;  3I9S A;  4CAV A;  4EFD A;  2OU2 A;  2ZEL A;  2DPS A;  3VWE A;  1BO4 A;  5J8C A;  3TC8 A;  3W6S A;  4CYN A;  4OC4 A;  4FAI A;  4ZYQ A;  4MHY A;  5AGE A;  3IFE A;  3B3S A;  3DGV A;  3T9Y A;  3ZJ0 A;  4A95 A;  3SJG A;  3T8W A;  3WT4 A;  5HVH A;  4FD4 A;  3NH5 A;  3SXN A;  1TIQ A;  2VZY A;  2BL1 A;  4MCQ A;  3NE8 A;  1EE3 P;  2FXF A;  1YK3 A;  4M6I A;  3BJ7 A;  3H8F A;  2CY2 A;  3IO1 A;  2ZEE A;  3LD2 A;  4GS4 A;  1IIC A;  1ZG7 A;  4OP4 A;  4PV6 A;  3S6G A;  2G3A A;  4M85 A;  1MJ9 A;  4OLL A;  4MFZ A;  4YGO A;  3FRM A;  4MCS A;  5IV0 A;  3FB3 A;  2H5M A;  3N5F A;  1KWM A;  4C2Z A;  2Z10 A;  5HXD A;  2PIY A;  2C27 A;  3KR5 A;  4CGN A;  3FVL A;  3VAT A;  2FE7 A;  2PJ8 A;  2Z3K A;  4E0A A;  3D7F A;  4B5O A;  4ORF A;  4OC1 A;  5HH1 A;  5F48 A;  4Q36 A;  5H84 A;  5ISV A;  4BBH A;  3FF3 A;  2ZOF A;  3D7H A;  3V7Z A;  2CTC A;  2HV2 A;  4LUA A;  2PJC A;  4KUB A;  2EVN A;  3D7G A;  3PRT A;  2RC4 A;  1YW4 A;  2DEA A;  3BHX A;  2BUE A;  3BXM A;  4JYW A;  5G21 A;  3RZA A;  4H6Z A;  2J9A A;  3JRU A;  1BPM A;  2PR8 A;  4J3G A;  2OZU A;  4R3K A;  1N71 A;  2OOT A;  3I1U A;  1B6B A;  4P4I A;  4UIB A;  5LRK A;  4KVX A;  4XPD B;  3GYA A;  1A2Z A;  3G3S A;  4II9 A;  4NF1 A;  4B14 A;  3WAB A;  3D2P A;  2PJA A;  2Q44 A;  1Z4R A;  3D68 A;  2AE6 A;  3PBE A;  3PFE A;  4UCP A;  1Z9U A;  4WJB A;  5EMI A;  2YND A;  4XNH C;  1ARL A;  1XIX A; 
#chains in the Genus database with same CATH homology
 2FIW A;  3TOA A;  5G20 A;  4L8A A;  4Y49 C;  2P6F A;  2PRB A;  4CAX A;  2Y0M A;  1M44 A;  4CAF A;  3TFY A;  2VZZ A;  4MFQ A;  2VEZ A;  2J8N A;  4A31 A;  4CRY B;  2R98 A;  4UA3 A;  5H86 A;  5A27 A;  4JLY A;  2OZG A;  3E0K A;  4A2Z A;  4IF5 A;  1OZP A;  1IYL A;  4R57 A;  1KUY A;  2R8V A;  2OB0 A;  4A33 A;  5KTC A;  3D2M A;  2EUI A;  4C2X A;  4C2Y A;  3DDD A;  2HUZ A;  4UCM A;  4U9Y A;  1Y9K A;  3R1K A;  2KCW A;  2OH1 A;  1Q2D A;  4CGO A;  4MFP A;  3FXT A;  3N7Z A;  4KS9 A;  4B12 A;  1NSL A;  2B58 A;  2JDD A;  2B4D A;  1WWZ A;  2O28 A;  3QAH A;  3TO7 A;  3PP9 A;  5AG4 A;  3FNC A;  1S7K A;  2ZW5 A;  3R9F A;  2Z3O A;  1S60 A;  4JXR A;  2Q7B A;  1ON0 A;  3QB8 A;  4XNH B;  4KSA A;  2I00 A;  2JLM A;  4Y49 B;  3ZZI A;  3R95 A;  2B3U A;  4UWJ A;  3IU1 A;  2B5G A;  4PSW A;  1U6M A;  2ZW4 A;  4E8O A;  2G3T A;  4L89 A;  5IB0 A;  2FCK A;  2HQY A;  4MJ8 A;  2WUU A;  2JEV A;  5AG5 A;  2CXA A;  2Q04 A;  1WK4 A;  4HNW B;  3EXN A;  4MBU A;  1S7F A;  1Q2C A;  2G0B A;  2JDC A;  1YVO A;  4KOU A;  3W6X A;  2BSW A;  4U5Y A;  1R57 A;  1XEB A;  1J4J A;  1UFH A;  1KUV A;  4H89 A;  1NMT A;  3KKW A;  1S7N A;  5AG7 A;  4CAW A;  3F0A A;  4C68 A;  1K4J A;  5A28 A;  3D3S A;  5F46 A;  2GIV A;  2PDO A;  2ARH A;  3S6H A;  5I0C A;  1S7L A;  5AG6 A;  4BMH A;  4YFJ A;  2GE3 A;  3WR7 A;  2Q0Y A;  2WPW A;  2FIA A;  4UCN A;  3V8I A;  5DWN A;  1YRE A;  2VQY A;  1YX0 A;  4B11 A;  3W91 A;  1S5K A;  3TTH A;  4OAD A;  1NE9 A;  2QIR A;  4X5K A;  3GKR A;  4QUS A;  1SQH A;  4KLW A;  1XMT A;  3P2F A;  1RXT A;  4AG7 A;  4JJX A;  2PQ8 A;  2PSW A;  4AVA A;  3FBU A;  2WPX A;  3SXO A;  2VI7 A;  4KLV A;  2ZW6 A;  4ZBG A;  4R9M A;  1MK4 A;  2I79 A;  3BLN A;  2QEC A;  4KOY A;  3EY5 A;  5DWM A;  3S6F A;  1S3Z A;  4KVM E;  3R96 A;  3BJ8 A;  3EO4 A;  1ZO0 A;  3F5B A;  3GY9 A;  1Q2Y A;  2B4D B;  1IYK A;  3TCV A;  3EC4 A;  1M4G A;  2J8R A;  4AVC A;  1MJB A;  5C88 A;  2YNC A;  4U9Z A;  4F6A A;  3EFA A;  2X7B A;  2P6E A;  1LRZ A;  4NCZ A;  1VHS A;  5JPH A;  4MFJ A;  3VWD A;  5C82 A;  1FY7 A;  1Y7R A;  2Q4V A;  1L0C A;  5FVJ A;  2B5G B;  2B3V A;  4UWI A;  1XF8 A;  4XPL A;  4MY3 A;  4B5P A;  3MGD A;  4I49 A;  2K5T A;  4MHD A;  3NE7 A;  4KOT A;  4CGL A;  3SHP A;  2QML A;  4HKF A;  2D4O A;  3S6K A;  1YVK A;  3F8K A;  2ZW7 A;  3UY5 A;  4M3S A;  4DNC A;  1YLE A;  2Z3L A;  5KTA A;  3DNS A;  4KOS A;  1QST A;  4NEX A;  1PU9 A;  3JVN A;  3C26 A;  4ONU A;  2A4N A;  4PK3 A;  2IL4 A;  4KVO E;  4IUS A;  2REF A;  3CXS A;  3TOB A;  4KOX A;  4LX9 A;  3H5Z A;  4EVY A;  1QSO A;  4QC6 A;  4JXQ A;  4CS0 B;  4AB7 A;  1YR0 A;  1P4N A;  4JWP A;  3D8P A;  2ATR A;  5E96 A;  2YNC C;  1QSR A;  3JUW A;  4YRH A;  3IGR A;  4AVB A;  3G8W A;  1CJW A;  1P0H A;  2DPT A;  2PC1 A;  1M4I A;  2FT0 A;  2FSR A;  4KOV A;  5J8F A;  5JQ4 A;  2NMT A;  1GHE A;  5HMN A;  5F49 A;  5G1Z A;  3TO9 A;  2FS5 A;  4AG9 A;  2VXK A;  1RO5 A;  4MFL A;  4CAE A;  3LOD A;  2F5I A;  2VBQ A;  3FIX A;  2Z3N A;  3IWG A;  1I1D A;  2Z11 A;  4UFW A;  1QSN A;  4RS2 A;  3R9G A;  3H4Q A;  5G22 A;  3PGP A;  4C7I A;  5BWA B;  1PUA A;  1IB1 E;  3P2H A;  4E2A A;  3T90 A;  1I21 A;  1Y9W A;  5KTD A;  4OAE A;  1VKC A;  2ZPA A;  4KOW A;  1Z4E A;  1XE4 A;  3FYN A;  3JTK A;  4HNX B;  2DXQ A;  3TE4 A;  4MI4 A;  3A9L A;  4UBR A;  3CXQ A;  4B10 A;  4FD6 A;  5EC4 A;  2Z3P A;  1V0C A;  2CNM A;  3DR8 A;  5F47 A;  2BEI A;  4KZT A;  5IX3 A;  2REE A;  4QB9 A;  4MY0 A;  2P6G A;  1B87 A;  4CRZ B;  4CYP A;  5EBV A;  4B5P B;  3I3G A;  4R87 A;  4CYQ A;  4NSQ A;  4C7H A;  2FL4 A;  2GAN A;  1CM0 A;  2Z3M A;  4A30 A;  4F0X A;  4JD6 A;  4A32 A;  4Q38 A;  3TT2 A;  3IU2 A;  4FD7 A;  4R3L A;  2AJ6 A;  2D4P A;  1M1D A;  4HNY B;  2J8M A;  1KZF A;  2R1I A;  3DR6 A;  1YGH A;  4NXY A;  2WSA A;  3DSB A;  2R7H A;  4PK2 A;  2YNE A;  5GCN A;  2P0W A;  4KUA A;  4UFV A;  1MJA A;  1QSM A;  3K9U A;  1IID A;  2YGW A;  4QVT A;  4K30 A;  4XPK A;  3TO6 A;  4F0Y A;  2CNT A;  5CNP A;  3B8G A;  2ZXV A;  4PSX A;  2B4B A;  1BOB A;  3OWC A;  3IWE A;  2CNS A;  4H6U A;  4B13 A;  3RYO A;  2Q4Y A;  4MFK A;  1I12 A;  4CGM A;  4RI1 A;  1KUX A;  2OZH A;  3PZJ A;  4CGP A;  3CXP A;  4KSF A;  4XPD C;  1M4D A;  2PR1 A;  4FD5 A;  3R9E A;  2Z0Z A;  4QBJ A;  4KOR A;  4UFX A;  4CYO A;  3I9S A;  4CAV A;  2OU2 A;  2DPS A;  3VWE A;  1BO4 A;  5J8C A;  3W6S A;  4CYN A;  5AGE A;  3T9Y A;  3ZJ0 A;  4A95 A;  4FD4 A;  3SXN A;  1TIQ A;  2VZY A;  2BL1 A;  2FXF A;  1YK3 A;  4ZGY B;  3BJ7 A;  2CY2 A;  3LD2 A;  4GS4 A;  4PV6 A;  3S6G A;  1IIC A;  2G3A A;  4M85 A;  1MJ9 A;  4OLL A;  4MFZ A;  4YGO A;  3FRM A;  5IV0 A;  3FB3 A;  2H5M A;  4C2Z A;  2Z10 A;  2C27 A;  4CGN A;  2FE7 A;  2Z3K A;  4E0A A;  4B5O A;  4ORF A;  5HH1 A;  5F48 A;  4Q36 A;  5H84 A;  5ISV A;  4BBH A;  2HV2 A;  4LUA A;  4KUB A;  2EVN A;  2RC4 A;  5G21 A;  2BUE A;  4H6Z A;  2PR8 A;  4J3G A;  2OZU A;  4R3K A;  1N71 A;  1B6B A;  4KVX A;  4XPD B;  3GYA A;  3G3S A;  4II9 A;  4NF1 A;  4B14 A;  3D2P A;  2Q44 A;  1Z4R A;  4UCP A;  2AE6 A;  1Z9U A;  2YND A;  4XNH C;  1XIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...