1YVOA

Hypothetical acetyltransferase from p.aeruginosa pa01
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
169
structure length
169
Chain Sequence
SIRDAGVADLPGILAIYNDAVGNTTAIWNETPVDLANRQAWFDTRARQGYPILVASDAAGEVLGYASYGDWRPFEGFRGTVEHSVYVRDDQRGKGLGVQLLQALIERARAQGLHVMVAAIESGNAASIGLHRRLGFEISGQMPQVGQKFGRWLDLTFMQLNLDPTRSAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords conserved hypothetical protein
publication title Crystal structure of a hypothetical acetyltransferase from P.aeruginosa PA01
rcsb
source organism Pseudomonas aeruginosa
total genus 49
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature ec 2.3.-.-:
pdb deposition date 2005-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1yvoA00
3G8WA 1KUVA 2PQ8A 4YGOA 2ZPAA 4FD5A 3RYOA 2VQYA 3F5BA 2EUIA 1YLEA 1YK3A 2CY2A 1M4IA 4KVXA 2OZHA 3V8IA 1I21A 4YFJA 4KOTA 4NCZA 5DWNA 4B5OA 1IICA 2Y0MA 2FS5A 1IYKA 1U6MA 3BJ7A 2VEZA 3P2FA 1YVKA 4NXYA 4ZBGA 5F46A 5IB0A 2R8VA 2J8MA 2BSWA 3JVNA 3TO9A 4MHDA 2G3AA 3TE4A 2FT0A 1TIQA 2JDDA 2ARHA 4K30A 4OAEA 3TFYA 4AG9A 2Z10A 2HUZA 2OB0A 4BMHA 4I49A 4HNYB 2GE3A 2OH1A 3B8GA 2FIAA 3DR6A 2ZXVA 4B5PB 2VBQA 1RXTA 4HNWB 4KOWA 2C27A 3BJ8A 3GYAA 3T90A 2H5MA 4M3SA 1FY7A 4ONUA 4Y49C 4KVME 1L0CA 3TTHA 3T9YA 2DXQA 5IV0A 1MJAA 4U9ZA 5J8FA 4AG7A 4PSWA 1Y9WA 1BOBA 2R7HA 3C26A 2P6EA 2QIRA 4JXRA 1R57A 4LX9A 3BLNA 3GY9A 1J4JA 4FD4A 4IUSA 4H89A 4L89A 4MJ8A 4MY3A 1YX0A 4UA3A 3SXOA 3LODA 2EVNA 4R3LA 4UBRA 1XMTA 1I1DA 2I79A 2Q0YA 2ZW4A 2ZW6A 4JD6A 5E96A 1XEBA 4KOXA 1M44A 3EY5A 2G3TA 2B5GA 1KUXA 2GIVA 3FB3A 1QSTA 2GANA 4UWIA 5F49A 1M4DA 2B3UA 3SXNA 4KORA 1P4NA 5KTDA 5JPHA 4XPKA 4QB9A 1QSOA 2ZW7A 2VZYA 4YRHA 2VI7A 3DDDA 4Y49B 4CAXA 1Q2YA 1KZFA 3VWDA 1S7FA 2OZUA 4RI1A 2B58A 1VHSA 4PSXA 1Z9UA 3S6GA 5DWMA 2WPXA 4JXQA 3SHPA 5KTAA 4XPDC 3R9GA 4XPLA 1BO4A 1XE4A 4ORFA 2CNTA 3NE7A 3KKWA 1B87A 3TO6A 3DSBA 2BUEA 3D2PA 4PK2A 3FYNA 3H4QA 3GKRA 4R57A 3DR8A 4R9MA 3E0KA 3F8KA 4F6AA 1S3ZA 4HKFA 2B4DA 2HQYA 2VXKA 2BL1A 3PZJA 2WPWA 5F47A 1OZPA 2AE6A 2KCWA 1SQHA 5C88A 1PUAA 3ZJ0A 3JUWA 3R95A 1IB1E 4U9YA 2Q44A 1NMTA 4PV6A 2O28A 3I9SA 4JWPA 4IF5A 2B4BA 3EXNA 3R96A 1YVOA 3R1KA 3TT2A 1XIXA 3D2MA 4XPDB 4KLVA 2I00A 2REEA 5EC4A 2J8RA 3I3GA 2Q04A 1B6BA 5ISVA 3QB8A 1Z4RA 4CAVA 2FXFA 2PSWA 2F5IA 4JLYA 3CXQA 3K9UA 2Q7BA 4KVOE 4H6UA 1MJBA 1P0HA 2REFA 2CNSA 2Q4VA 4CAWA 3TOAA 4U5YA 4OADA 4FD7A 2PDOA 4KLWA 2VZZA 3PGPA 2K5TA 4AVBA 4QC6A 2FE7A 1S5KA 4X5KA 2R1IA 1IIDA 3IGRA 3OWCA 1UFHA 2QECA 3FBUA 4R87A 1S7NA 4XNHC 1CM0A 5HH1A 3R9EA 1Y9KA 2PC1A 4CRZB 3R9FA 2FL4A 1M4GA 4KOUA 4MI4A 5H84A 5F48A 1M1DA 3G3SA 1KUYA 1LRZA 2X7BA 5FVJA 4M85A 2PR1A 2B4DB 4L8AA 1N71A 3CXSA 3D3SA 5GCNA 4II9A 4RS2A 4KOSA 1PU9A 2RC4A 4KUAA 3DNSA 1MK4A 4NSQA 4GS4A 5H86A 3PP9A 2IL4A 2Z0ZA 2PRBA 4F0YA 4MY0A 3WR7A 2HV2A 1NSLA 3FXTA 1NE9A 2NMTA 1YREA 1Z4EA 2FCKA 3QAHA 4XNHB 2D4OA 4AVCA 1MJ9A 4JJXA 2PR8A 4AB7A 1S7LA 4E2AA 4E0AA 4QVTA 1Y7RA 1S60A 1YGHA 2OU2A 1Q2CA 3S6HA 1QSMA 3TO7A 2CNMA 4HNXB 4MBUA 2J8NA 4EVYA 2Q4YA 4KZTA 5HMNA 3FNCA 1RO5A 2B5GB 3EC4A 5KTCA 4KOYA 2JEVA 4AVAA 5J8CA 2FSRA 2G0BA 2JLMA 1VKCA 3CXPA 2B3VA 1QSNA 5IX3A 2P6GA 2ATRA 5CNPA 4CRYB 4FD6A 4DNCA 2Z11A 1S7KA 1GHEA 2OZGA 4CS0B 3FRMA 3W91A 3F0AA 2FIWA 5I0CA 3S6FA 5C82A 4J3GA 1WWZA 3TOBA 4KUBA 2P6FA 2JDCA 3EO4A 1ON0A 4KOVA 1I12A 1WK4A 4B5PA 3S6KA 1YR0A 2D4PA 1XF8A 1CJWA 2ZW5A 4OLLA 3W6SA 3EFAA 3D8PA 4NEXA 3LD2A 1V0CA 2BEIA 2P0WA 3UY5A 3W6XA 1Q2DA 4LUAA 4E8OA 3IWGA 2R98A 3N7ZA 2AJ6A 4R3KA 4QBJA 1K4JA 1QSRA 4NF1A 3ZZIA 3MGDA 5JQ4A 3VWEA 4PK3A 4QUSA 3TCVA 3FIXA 2QMLA 4H6ZA 2A4NA 3P2HA 1IYLA 5EBVA 4UWJA
chains in the Genus database with same CATH superfamily
3G8WA 1YW4A 3RNZA 3NH8A 1KUVA 4Q36A 5J1QA 1UWYA 2ODFA 2PQ8A 2ZEGA 2ZPAA 4FD5A 4YGOA 5IB9A 3KI9A 2PJAA 1CP7A 4K3NA 3RYOA 4A33A 2VQYA 4MFJA 3F5BA 3K9TA 4R7MA 5HVGA 2EUIA 1YLEA 2ABZA 1YK3A 1DE4C 2YNCA 2CY2A 3KR5A 1YSJA 3SI2A 1M4IA 2XEJA 1PCAA 4KVXA 4PXCA 3FEDA 1XJOA 2OZHA 3V38A 1I21A 3V8IA 1BAVA 4KOTA 4YFJA 4OC5A 4NCZA 5K8NA 5DWNA 4B5OA 1HDQA 2QJ8A 2ANPA 3NH5A 1IICA 4OC4A 3B3WA 2Y0MA 2FS5A 1IYKA 1U6MA 3LACA 3BJ7A 2ZEPA 3CDXA 2VEZA 3P2FA 5K8PA 2V8DA 1YVKA 3BHXA 4NXYA 4ZBGA 2ZEFA 5G21A 3WC5A 5F46A 5IB0A 2R8VA 3D68A 2J8MA 2BSWA 3JVNA 4C7IA 2DEAA 4ZY2A 5A28A 2QYVA 4NGPA 5BWAB 1XBUA 4UCMA 3TO9A 4MHDA 2OOTA 2G3AA 3TE4A 2FT0A 2O4HA 4PPZA 2NYQA 4YU9A 4A30A 1TIQA 2ZEHA 2JDDA 2PJ6A 4KSIA 1FNOA 1TKHA 4GM5A 2ARHA 2DPSA 3FJUA 3PB7X 4K30A 3SJEA 1VIXA 4BINA 4OAEA 3TFYA 4AG9A 2Q51A 2HUZA 2IMOA 2Z10A 2PJ4A 2OB0A 3ISZA 4BMHA 4OIDA 4A39A 4I49A 2AFXA 4HNYB 2JEWA 4UEEA 2GE3A 2OH1A 2C1CA 4WWVA 4YWYA 3S9MA 3B8GA 1FT7A 4O23A 1F57A 2PIZA 2CXAA 2FIAA 3RAMA 2EBJA 3N5FA 4UIBA 4CGNA 3DR6A 4UF4A 2GU2A 2ZXVA 4B5PB 2VBQA 1RXTA 3B7IA 4ZX9A 1R3NA 1YLOA 4HNWB 2PCUA 4KOWA 3B3CA 4PQAA 2C27A 3V7ZA 4A32A 3BJ8A 3GYAA 3T90A 2H5MA 4M3SA 3IEHA 5AG6A 1FY7A 4MMOA 3QAYA 4ONUA 4Y49C 4KVME 1L0CA 3TTHA 2DF5A 3FH4A 3T9YA 3ISXA 5LYFA 1LCPA 2DXQA 5IV0A 1MJAA 1YMEA 2ZEDA 3CPXA 3IU2A 1LAPA 3D7FA 4NFRA 4U9ZA 4PSWA 4UFWA 4AG7A 1Y9WA 1BOBA 1IOFA 2R7HA 3C26A 2P6EA 2QIRA 4JXRA 3DGVA 1R57A 4LX9A 3KHXA 3BI1A 3IFEA 3BLNA 3IWWA 5G1ZA 3GY9A 3IU1A 1J4JA 1TKFA 3JTKA 4FD4A 4P10A 4PXEA 1ZLIA 4IUSA 4H89A 4L89A 4TWEA 4OC2A 4MJ8A 4MY3A 4P44A 1CBXA 1XMBA 1YX0A 2PJBA 1DTDA 4UA3A 1F2OA 1OBRA 3SXOA 3NE8A 3LODA 2YNEA 4KSFA 5D29A 4B6ZA 2EVNA 3PB9X 4R3LA 4RUHA 4UBRA 1AUGA 2F7VA 5AG4A 1XMTA 1I1DA 2I79A 4CPAA 2Q0YA 2G9DA 4DUKA 4ONWA 2ZW4A 2ZW6A 4JD6A 5E96A 1XEBA 2Z3MA 4Z65A 4KOXA 3B35A 1M44A 4A31A 3EY5A 2G3TA 2B5GA 2BCOA 3PBEA 1KUXA 2GIVA 3FB3A 2WYRA 4A37A 2FVGA 2ZEOA 1QSTA 2GANA 5AG5A 4UWIA 5F49A 1M4DA 2B3UA 2PJ2A 3SXNA 1AYEA 1P4NA 4KORA 4MCRA 5KTDA 5JPHA 2CTCA 4F9UA 3FF3A 1CP6A 3D4UA 1LFWA 4UCPA 4XPKA 4QB9A 3KQXA 1QSOA 1TF9A 2ZW7A 2VZYA 4YRHA 2DPTA 2VI7A 3DDDA 4Y49B 4CAXA 1IU8A 3IC1A 4X2TA 1Q2YA 4EFDA 1KZFA 3VWDA 2POKA 3H8FA 1S7FA 2OZUA 3KHZA 4RI1A 4P4IA 1ELLP 4NGSA 4C2ZA 1TF8A 2B58A 1PYTB 2PVWA 1LANA 2XEIA 4ZYQA 1VHSA 4FWUA 3D7HA 4PSXA 1VGYA 3VATA 4B13A 5JH9A 1Z9UA 3S6GA 5DWMA 1GYTA 4NGMA 2WPXA 4JXQA 3SHPA 3GUXA 5KTAA 3NA6A 1CPXA 4XPDC 1Z2LA 4LQGA 2WUUA 4OIWA 5ELYA 2BOAA 3R9GA 2BO9A 4XPLA 1BO4A 4OMEA 4ZGYB 1XE4A 2VL1A 4ORFA 2CNTA 1JWQA 3NE7A 3KKWA 2V8VA 1B87A 1M4LA 4OC0A 3TO6A 3DSBA 4C2XA 4X8IA 2BUEA 4A94A 3D2PA 4CGMA 2AFWA 4PK2A 1ZG7A 3FYNA 3H4QA 3VARA 4CAFA 3GKRA 4NGRA 4R57A 3DR8A 4MFPA 5LYDA 3KZWA 4MHNA 3SJFA 2GFQA 2ZEMA 5A27A 4R9MA 3E0KA 2ZEEA 1YW6A 3PFEA 4JZ0A 2YNCC 4MFQA 3F8KA 1CX8A 4F6AA 1S3ZA 4HKFA 5HVHA 4A2ZA 2B4DA 2HQYA 2VXKA 2BL1A 3BXMA 1Y7EA 3PZJA 2AFMA 2WPWA 5F47A 1OZPA 3T8WA 2AE6A 2KCWA 1SQHA 3HUVA 4P45A 5C88A 1PUAA 2JBJA 2PJ5A 3ZJ0A 4W9YA 3JUWA 3FEEA 2Z3LA 3R95A 2IQ6A 4BD9A 5F09A 1IB1E 4M6GA 4U9YA 2Q44A 1NMTA 4C7HA 1IGBA 4PV6A 1CG2A 2GLFA 2O28A 3I9SA 3SI0A 4JWPA 4IF5A 1A2ZA 2B4BA 3PB8X 3EXNA 3R96A 1YVOA 5HXDA 4CGOA 1VHEA 3R1KA 3TT2A 4R6TA 5AGEA 1ARLA 1XIXA 3D2MA 4MFZA 3MRUA 4KS9A 4XPDB 2WSAA 1Y0YA 4KLVA 4UEZA 4PXDA 2I00A 8CPAA 1BPMA 2F8HA 2REEA 5EC4A 2J8RA 2PJ1A 2AFUA 2Q04A 3I3GA 3RZAA 4CYPA 1B6BA 2PJ9A 3D7DA 4F9VA 1IOIA 1ELMP 2V8HA 3DLJA 3QB8A 5ISVA 1Z4RA 4CAVA 2FXFA 3PBBA 4MCSA 5EMIA 3A9LA 2PSWA 3PB6X 4NJRA 2Z3NA 2F5IA 4JLYA 4FBEA 3CXQA 3FX6A 3K9UA 4MHPA 2RB7A 4NJQA 4X3RA 2Z3OA 3PFOA 3PRTA 2Q7BA 2PJ8A 4KVOE 4FUUA 4A95A 3H8EA 4H6UA 2Q7SA 1MJBA 1P0HA 2GREA 2REFA 2CNSA 2Q4VA 4OP4A 3LWUA 3TOAA 4CAWA 4U5YA 2HB6A 4M6IA 5CBMA 1Q7LA 4OADA 4FD7A 4A38A 3LMSA 1VHOA 2PDOA 4KLWA 4HPSA 4P4EA 2Q4ZA 4AXVA 2VZZA 5HVFA 3PGPA 4UEFA 1ZO0A 4CYQA 2K5TA 4AVBA 3BI0A 4QC6A 4Q7AA 2FE7A 1S5KA 1X10A 4X5KA 2R1IA 1IIDA 3IGRA 3OWCA 4MCPA 1UFHA 4LQ6A 1F2PA 2I3CA 4MHYA 2QECA 3FBUA 4R87A 4R8FA 1S7NA 2PJCA 2WZNA 4XNHC 3VH9A 3KR4A 5LRJA 4MRIA 1CM0A 4MFLA 1BLLE 5HH1A 3WC6A 5K8OA 4P4BA 3R9EA 3RO0A 2PJ7A 1Y9KA 2PC1A 3PEIA 4CRZB 3PB4X 2FL4A 3R9FA 1M4GA 1EE3P 4KOUA 1ZG8A 2Z3KA 4MI4A 2Z3PA 3KL9A 5H84A 3D67A 5F48A 1M1DA 3G3SA 1KUYA 3KGQA 4CAEA 1LRZA 2X7BA 5D8NA 1QQ9A 5FVJA 4M85A 2EK8A 2PR1A 2B4DB 3CPAA 1Y0RA 2AFZA 4L8AA 2PJ0A 4B10A 2JBKA 1N71A 2C6CA 4JYWA 1XOVA 5I4MA 1AMPA 3CXSA 3D3SA 4WJBA 5GCNA 4ZX8A 1RTQA 4II9A 2YNDA 4RS2A 4KOSA 1Z8WA 4UFVA 1PU9A 5LYLA 4NGTA 1ARMA 2AFOA 2RC4A 4NGQA 2CIJA 4UFXA 1KWMA 4P4FA 4UIAA 4B14A 1Z8TA 4KUAA 3RBUA 1LOKA 4OC1A 3DNSA 4R76A 1MK4A 3I1UA 4NSQA 4GS4A 3L2NA 5H86A 3PP9A 2IL4A 2Z0ZA 2PRBA 4BBHA 4F0YA 4MY0A 4CGLA 3WR7A 2HV2A 4Q38A 1NSLA 4H2KA 2CF4A 3FXTA 4ZY0A 3FECA 3SI1A 2ZELA 2HC9A 1XRYA 1NE9A 2NMTA 2Q43A 3D66A 3SJGA 1YREA 1Z4EA 4IK2A 4P4DA 2FCKA 1HEEA 3B2YA 3QAHA 4XNHB 4C68A 3GLJA 2D4OA 1JQGA 2O53A 4AVCA 3SJXA 1MJ9A 4JJXA 4CYOA 1H8LA 1TXRA 4EMEA 2PR8A 4AB7A 1S7LA 3WT4A 4E2AA 5THWA 5DS0A 4CYNA 2OR4A 4E0AA 4C2YA 4ZI6A 4QVTA 2XEGA 2ZOGA 1Y7RA 4RN7A 1ZLHA 5LYIA 1S60A 1YGHA 2PJ3A 2OU2A 3H5ZA 1YQEA 5LRKA 1Q2CA 3IJ3A 3S6HA 1QSMA 3CZXA 2ZOFA 2CNMA 3TO7A 5JM6A 4IHMA 1Z8XA 1IY7A 1NSAA 3FMCA 4HNXB 2CTBA 7CPAA 4MBUA 2J8NA 5J8FA 3B3TA 4EVYA 2Q4YA 4KZTA 5HMNA 3FNCA 1RO5A 2B5GB 3EC4A 4MHZA 1LAMA 3GB0A 4DYOA 4MXUA 4ZY1A 5KTCA 2PVVA 5JGFA 2AFSA 4KOYA 1Z5RA 2JEVA 1Z8LA 4AVAA 5CPAA 5J8CA 3GIUA 2FSRA 2G0BA 5LRGA 2JLMA 3D7GA 1VKCA 4B12A 3CXPA 2B3VA 3TX8A 1QSNA 5IX3A 3IIBA 1HDUA 2P6GA 2ATRA 2PE3A 5CNPA 3IO1A 4CRYB 4FD6A 3TC8A 3WABA 4G1PA 2EK9A 2J9AA 4DNCA 2Z11A 1S7KA 4EWTA 1GHEA 2OZGA 1X12A 3FRMA 3W91A 4CS0B 5G20A 3MN8A 1R43A 3F0AA 2EO8A 2FIWA 3WC7A 3B3VA 5I0CA 1XFOA 4NGNA 3S6FA 5C82A 3NH4A 4J3GA 3HLPA 1WWZA 2ZENA 3TOBA 4KUBA 4FAIA 2P6FA 2JDCA 3IWEA 4P6YA 4IAVA 3EO4A 1BPNA 1ON0A 3K2KA 1I12A 4KOVA 1WK4A 2V77A 4CGPA 4B5PA 3FVLA 4OKOA 3S6KA 1YR0A 2D4PA 1XF8A 1CJWA 2ZW5A 4OLLA 3W6SA 3EFAA 1CPSA 2XEFA 3D8PA 4F8ZA 4NEXA 1TKJA 2RFHA 6CPAA 3LD2A 1V0CA 2BEIA 3NFZA 5G22A 2C6GA 2P0WA 3UY5A 3W6XA 1Q2DA 4LUAA 4E8OA 3IWGA 4MCQA 2NSMA 2R98A 4P4JA 2GLJA 3N7ZA 2AJ6A 4R3KA 4B11A 4OC3A 2PIYA 4QBJA 2YGWA 1K4JA 1QSRA 4NF1A 3CT9A 3MGDA 3ZZIA 4DJLA 4KSAA 2QVPA 2C6PA 4UCNA 3VWEA 4PK3A 4F0XA 5JQ4A 1QMUA 3S9NA 4PXBA 3KASA 1ZG9A 2IJZA 5AG7A 4MFKA 4QUSA 3KQZA 2PRQA 2V8GA 4M6HA 3H8GA 3TCVA 3FIXA 2QMLA 3B3SA 5K8MA 2EWBA 4H6ZA 2A4NA 3S9LA 3P2HA 1IYLA 5EBVA 3JRUA 3QNVA 4UWJA 4TNUA 4GXHA
chains in the Genus database with same CATH topology
3G8WA 1KUVA 4Q36A 2PQ8A 4YGOA 2ZPAA 4FD5A 4A33A 3RYOA 2VQYA 4MFJA 3F5BA 2EUIA 1YLEA 1YK3A 2YNCA 2CY2A 1M4IA 4KVXA 2OZHA 3V8IA 1I21A 4YFJA 4KOTA 4NCZA 5DWNA 4B5OA 1IICA 2Y0MA 2FS5A 1IYKA 1U6MA 3BJ7A 2VEZA 3P2FA 1YVKA 4NXYA 4ZBGA 5G21A 5F46A 5IB0A 2R8VA 2J8MA 2BSWA 3JVNA 4C7IA 5A28A 5BWAB 4UCMA 3TO9A 4MHDA 2G3AA 3TE4A 2FT0A 4A30A 1TIQA 2JDDA 2ARHA 2DPSA 4K30A 4OAEA 3TFYA 4AG9A 2Z10A 2HUZA 2OB0A 4BMHA 4I49A 4HNYB 2GE3A 2OH1A 3B8GA 2CXAA 2FIAA 4CGNA 3DR6A 2ZXVA 4B5PB 2VBQA 1RXTA 4HNWB 4KOWA 2C27A 4A32A 3BJ8A 3GYAA 3T90A 2H5MA 4M3SA 5AG6A 1FY7A 4ONUA 4Y49C 4KVME 1L0CA 3TTHA 3T9YA 2DXQA 5IV0A 1MJAA 3IU2A 4U9ZA 4AG7A 5J8FA 4UFWA 4PSWA 1Y9WA 1BOBA 2R7HA 3C26A 4JXRA 2P6EA 2QIRA 1R57A 4LX9A 3BLNA 5G1ZA 3GY9A 3IU1A 1J4JA 3JTKA 4FD4A 4IUSA 4H89A 4L89A 4MJ8A 4MY3A 1YX0A 4UA3A 3SXOA 4ZGYB 3LODA 2YNEA 4KSFA 2EVNA 4R3LA 5AG4A 4UBRA 1XMTA 1I1DA 2I79A 2Q0YA 2ZW4A 2ZW6A 4JD6A 5E96A 1XEBA 2Z3MA 4KOXA 1M44A 4A31A 3EY5A 2G3TA 2B5GA 1KUXA 2GIVA 3FB3A 1QSTA 2GANA 5AG5A 4UWIA 5F49A 1M4DA 2B3UA 3SXNA 4KORA 1P4NA 5KTDA 5JPHA 4XPKA 4UCPA 4QB9A 1QSOA 2ZW7A 2VZYA 4YRHA 2DPTA 2VI7A 3DDDA 4Y49B 4CAXA 1Q2YA 1KZFA 3VWDA 1S7FA 2OZUA 4RI1A 4C2ZA 2B58A 1VHSA 4PSXA 4B13A 1Z9UA 3S6GA 5DWMA 2WPXA 4JXQA 3SHPA 5KTAA 4XPDC 2WUUA 3R9GA 4XPLA 1BO4A 1XE4A 4ORFA 2CNTA 3NE7A 3KKWA 1B87A 4C2XA 3TO6A 3DSBA 2BUEA 3D2PA 4CGMA 4PK2A 3FYNA 3H4QA 4CAFA 3GKRA 4R57A 3DR8A 4MFPA 5A27A 4R9MA 3E0KA 2YNCC 4MFQA 3F8KA 4F6AA 1S3ZA 4HKFA 4A2ZA 2B4DA 2HQYA 2VXKA 2BL1A 3PZJA 2WPWA 5F47A 1OZPA 2AE6A 2KCWA 1SQHA 5C88A 1PUAA 3ZJ0A 3JUWA 2Z3LA 3R95A 1IB1E 4U9YA 2Q44A 1NMTA 4C7HA 4PV6A 2O28A 3I9SA 4JWPA 4IF5A 2B4BA 3EXNA 3R96A 1YVOA 4CGOA 3R1KA 3TT2A 5AGEA 1XIXA 3D2MA 4MFZA 4KS9A 4XPDB 2WSAA 4KLVA 2I00A 2REEA 5EC4A 2J8RA 3I3GA 2Q04A 4CYPA 1B6BA 5ISVA 3QB8A 1Z4RA 4CAVA 2FXFA 3A9LA 2PSWA 2Z3NA 2F5IA 4JLYA 3CXQA 3K9UA 2Z3OA 2Q7BA 4KVOE 4A95A 4H6UA 1MJBA 1P0HA 2REFA 2CNSA 2Q4VA 4CAWA 3TOAA 4U5YA 4OADA 4FD7A 2PDOA 4KLWA 2VZZA 3PGPA 1ZO0A 4CYQA 2K5TA 4AVBA 4QC6A 2FE7A 1S5KA 4X5KA 2R1IA 1IIDA 3IGRA 3OWCA 1UFHA 2QECA 3FBUA 4R87A 1S7NA 4XNHC 1CM0A 4MFLA 5HH1A 3R9EA 1Y9KA 2PC1A 4CRZB 3R9FA 2FL4A 1M4GA 4KOUA 2Z3KA 4MI4A 2Z3PA 5H84A 5F48A 4CAEA 1M1DA 3G3SA 1KUYA 1LRZA 2X7BA 5FVJA 4M85A 2PR1A 2B4DB 4L8AA 4B10A 1N71A 3CXSA 3D3SA 5GCNA 4II9A 2YNDA 4RS2A 4KOSA 4UFVA 1PU9A 2RC4A 4UFXA 4B14A 4KUAA 3DNSA 1MK4A 4NSQA 4GS4A 5H86A 3PP9A 2IL4A 2Z0ZA 2PRBA 4BBHA 4F0YA 4MY0A 4CGLA 3WR7A 2HV2A 4Q38A 1NSLA 3FXTA 1NE9A 2NMTA 1YREA 1Z4EA 2FCKA 3QAHA 4XNHB 4C68A 2D4OA 4AVCA 4CYOA 1MJ9A 4JJXA 2PR8A 4AB7A 1S7LA 4E2AA 4CYNA 4E0AA 4C2YA 4QVTA 1Y7RA 1S60A 1YGHA 2OU2A 3H5ZA 1Q2CA 3S6HA 1QSMA 3TO7A 2CNMA 4HNXB 4MBUA 2J8NA 4EVYA 2Q4YA 4KZTA 5HMNA 3FNCA 1RO5A 2B5GB 3EC4A 5KTCA 4KOYA 2JEVA 4AVAA 5J8CA 2FSRA 2G0BA 2JLMA 1VKCA 4B12A 3CXPA 2B3VA 1QSNA 5IX3A 2P6GA 2ATRA 5CNPA 4CRYB 4FD6A 4DNCA 2Z11A 1S7KA 1GHEA 2OZGA 4CS0B 3FRMA 3W91A 5G20A 3F0AA 2FIWA 5I0CA 3S6FA 5C82A 4J3GA 1WWZA 3TOBA 4KUBA 2P6FA 2JDCA 3IWEA 3EO4A 1ON0A 4CGPA 4KOVA 1I12A 1WK4A 4B5PA 3S6KA 1YR0A 2D4PA 1XF8A 1CJWA 2ZW5A 4OLLA 3W6SA 3EFAA 3D8PA 4NEXA 3LD2A 1V0CA 2BEIA 5G22A 2P0WA 3UY5A 3W6XA 1Q2DA 4LUAA 4E8OA 3IWGA 2R98A 3N7ZA 2AJ6A 4R3KA 4B11A 4QBJA 2YGWA 1K4JA 1QSRA 4NF1A 3ZZIA 3MGDA 4KSAA 5JQ4A 4UCNA 3VWEA 4PK3A 4F0XA 5AG7A 4MFKA 4QUSA 3TCVA 3FIXA 2QMLA 4H6ZA 2A4NA 3P2HA 1IYLA 5EBVA 4UWJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G8W A;  1KUV A;  2PQ8 A;  4YGO A;  2ZPA A;  4FD5 A;  3RYO A;  2VQY A;  3F5B A;  2EUI A;  1YLE A;  1YK3 A;  2CY2 A;  1M4I A;  4KVX A;  2OZH A;  3V8I A;  1I21 A;  4YFJ A;  4KOT A;  4NCZ A;  5DWN A;  4B5O A;  1IIC A;  2Y0M A;  2FS5 A;  1IYK A;  1U6M A;  3BJ7 A;  2VEZ A;  3P2F A;  1YVK A;  4NXY A;  4ZBG A;  5F46 A;  5IB0 A;  2R8V A;  2J8M A;  2BSW A;  3JVN A;  3TO9 A;  4MHD A;  2G3A A;  3TE4 A;  2FT0 A;  1TIQ A;  2JDD A;  2ARH A;  4K30 A;  4OAE A;  3TFY A;  4AG9 A;  2Z10 A;  2HUZ A;  2OB0 A;  4BMH A;  4I49 A;  4HNY B;  2GE3 A;  2OH1 A;  3B8G A;  2FIA A;  3DR6 A;  2ZXV A;  4B5P B;  2VBQ A;  1RXT A;  4HNW B;  4KOW A;  2C27 A;  3BJ8 A;  3GYA A;  3T90 A;  2H5M A;  4M3S A;  1FY7 A;  4ONU A;  4Y49 C;  4KVM E;  1L0C A;  3TTH A;  3T9Y A;  2DXQ A;  5IV0 A;  1MJA A;  4U9Z A;  5J8F A;  4AG7 A;  4PSW A;  1Y9W A;  1BOB A;  2R7H A;  3C26 A;  2P6E A;  2QIR A;  4JXR A;  1R57 A;  4LX9 A;  3BLN A;  3GY9 A;  1J4J A;  4FD4 A;  4IUS A;  4H89 A;  4L89 A;  4MJ8 A;  4MY3 A;  1YX0 A;  4UA3 A;  3SXO A;  3LOD A;  2EVN A;  4R3L A;  4UBR A;  1XMT A;  1I1D A;  2I79 A;  2Q0Y A;  2ZW4 A;  2ZW6 A;  4JD6 A;  5E96 A;  1XEB A;  4KOX A;  1M44 A;  3EY5 A;  2G3T A;  2B5G A;  1KUX A;  2GIV A;  3FB3 A;  1QST A;  2GAN A;  4UWI A;  5F49 A;  1M4D A;  2B3U A;  3SXN A;  4KOR A;  1P4N A;  5KTD A;  5JPH A;  4XPK A;  4QB9 A;  1QSO A;  2ZW7 A;  2VZY A;  4YRH A;  2VI7 A;  3DDD A;  4Y49 B;  4CAX A;  1Q2Y A;  1KZF A;  3VWD A;  1S7F A;  2OZU A;  4RI1 A;  2B58 A;  1VHS A;  4PSX A;  1Z9U A;  3S6G A;  5DWM A;  2WPX A;  4JXQ A;  3SHP A;  5KTA A;  4XPD C;  3R9G A;  4XPL A;  1BO4 A;  1XE4 A;  4ORF A;  2CNT A;  3NE7 A;  3KKW A;  1B87 A;  3TO6 A;  3DSB A;  2BUE A;  3D2P A;  4PK2 A;  3FYN A;  3H4Q A;  3GKR A;  4R57 A;  3DR8 A;  4R9M A;  3E0K A;  3F8K A;  4F6A A;  1S3Z A;  4HKF A;  2B4D A;  2HQY A;  2VXK A;  2BL1 A;  3PZJ A;  2WPW A;  5F47 A;  1OZP A;  2AE6 A;  2KCW A;  1SQH A;  5C88 A;  1PUA A;  3ZJ0 A;  3JUW A;  3R95 A;  1IB1 E;  4U9Y A;  2Q44 A;  1NMT A;  4PV6 A;  2O28 A;  3I9S A;  4JWP A;  4IF5 A;  2B4B A;  3EXN A;  3R96 A;  1YVO A;  3R1K A;  3TT2 A;  1XIX A;  3D2M A;  4XPD B;  4KLV A;  2I00 A;  2REE A;  5EC4 A;  2J8R A;  3I3G A;  2Q04 A;  1B6B A;  5ISV A;  3QB8 A;  1Z4R A;  4CAV A;  2FXF A;  2PSW A;  2F5I A;  4JLY A;  3CXQ A;  3K9U A;  2Q7B A;  4KVO E;  4H6U A;  1MJB A;  1P0H A;  2REF A;  2CNS A;  2Q4V A;  4CAW A;  3TOA A;  4U5Y A;  4OAD A;  4FD7 A;  2PDO A;  4KLW A;  2VZZ A;  3PGP A;  2K5T A;  4AVB A;  4QC6 A;  2FE7 A;  1S5K A;  4X5K A;  2R1I A;  1IID A;  3IGR A;  3OWC A;  1UFH A;  2QEC A;  3FBU A;  4R87 A;  1S7N A;  4XNH C;  1CM0 A;  5HH1 A;  3R9E A;  1Y9K A;  2PC1 A;  4CRZ B;  3R9F A;  2FL4 A;  1M4G A;  4KOU A;  4MI4 A;  5H84 A;  5F48 A;  1M1D A;  3G3S A;  1KUY A;  1LRZ A;  2X7B A;  5FVJ A;  4M85 A;  2PR1 A;  2B4D B;  4L8A A;  1N71 A;  3CXS A;  3D3S A;  5GCN A;  4II9 A;  4RS2 A;  4KOS A;  1PU9 A;  2RC4 A;  4KUA A;  3DNS A;  1MK4 A;  4NSQ A;  4GS4 A;  5H86 A;  3PP9 A;  2IL4 A;  2Z0Z A;  2PRB A;  4F0Y A;  4MY0 A;  3WR7 A;  2HV2 A;  1NSL A;  3FXT A;  1NE9 A;  2NMT A;  1YRE A;  1Z4E A;  2FCK A;  3QAH A;  4XNH B;  2D4O A;  4AVC A;  1MJ9 A;  4JJX A;  2PR8 A;  4AB7 A;  1S7L A;  4E2A A;  4E0A A;  4QVT A;  1Y7R A;  1S60 A;  1YGH A;  2OU2 A;  1Q2C A;  3S6H A;  1QSM A;  3TO7 A;  2CNM A;  4HNX B;  4MBU A;  2J8N A;  4EVY A;  2Q4Y A;  4KZT A;  5HMN A;  3FNC A;  1RO5 A;  2B5G B;  3EC4 A;  5KTC A;  4KOY A;  2JEV A;  4AVA A;  5J8C A;  2FSR A;  2G0B A;  2JLM A;  1VKC A;  3CXP A;  2B3V A;  1QSN A;  5IX3 A;  2P6G A;  2ATR A;  5CNP A;  4CRY B;  4FD6 A;  4DNC A;  2Z11 A;  1S7K A;  1GHE A;  2OZG A;  4CS0 B;  3FRM A;  3W91 A;  3F0A A;  2FIW A;  5I0C A;  3S6F A;  5C82 A;  4J3G A;  1WWZ A;  3TOB A;  4KUB A;  2P6F A;  2JDC A;  3EO4 A;  1ON0 A;  4KOV A;  1I12 A;  1WK4 A;  4B5P A;  3S6K A;  1YR0 A;  2D4P A;  1XF8 A;  1CJW A;  2ZW5 A;  4OLL A;  3W6S A;  3EFA A;  3D8P A;  4NEX A;  3LD2 A;  1V0C A;  2BEI A;  2P0W A;  3UY5 A;  3W6X A;  1Q2D A;  4LUA A;  4E8O A;  3IWG A;  2R98 A;  3N7Z A;  2AJ6 A;  4R3K A;  4QBJ A;  1K4J A;  1QSR A;  4NF1 A;  3ZZI A;  3MGD A;  5JQ4 A;  3VWE A;  4PK3 A;  4QUS A;  3TCV A;  3FIX A;  2QML A;  4H6Z A;  2A4N A;  3P2H A;  1IYL A;  5EBV A;  4UWJ A; 
#chains in the Genus database with same CATH topology
 3G8W A;  1YW4 A;  3RNZ A;  3NH8 A;  1KUV A;  4Q36 A;  5J1Q A;  1UWY A;  2ODF A;  2PQ8 A;  2ZEG A;  2ZPA A;  4FD5 A;  4YGO A;  5IB9 A;  3KI9 A;  2PJA A;  1CP7 A;  4K3N A;  3RYO A;  4A33 A;  2VQY A;  4MFJ A;  3F5B A;  3K9T A;  4R7M A;  5HVG A;  2EUI A;  1YLE A;  2ABZ A;  1YK3 A;  1DE4 C;  2YNC A;  2CY2 A;  3KR5 A;  1YSJ A;  3SI2 A;  1M4I A;  2XEJ A;  1PCA A;  4KVX A;  4PXC A;  3FED A;  1XJO A;  2OZH A;  3V38 A;  1I21 A;  3V8I A;  1BAV A;  4KOT A;  4YFJ A;  4OC5 A;  4NCZ A;  5K8N A;  5DWN A;  4B5O A;  1HDQ A;  2QJ8 A;  2ANP A;  3NH5 A;  1IIC A;  4OC4 A;  3B3W A;  2Y0M A;  2FS5 A;  1IYK A;  1U6M A;  3LAC A;  3BJ7 A;  2ZEP A;  3CDX A;  2VEZ A;  3P2F A;  5K8P A;  2V8D A;  1YVK A;  3BHX A;  4NXY A;  4ZBG A;  2ZEF A;  5G21 A;  3WC5 A;  5F46 A;  5IB0 A;  2R8V A;  3D68 A;  2J8M A;  2BSW A;  3JVN A;  4C7I A;  2DEA A;  4ZY2 A;  5A28 A;  2QYV A;  4NGP A;  5BWA B;  1XBU A;  4UCM A;  3TO9 A;  4MHD A;  2OOT A;  2G3A A;  3TE4 A;  2FT0 A;  2O4H A;  4PPZ A;  2NYQ A;  4YU9 A;  4A30 A;  1TIQ A;  2ZEH A;  2JDD A;  2PJ6 A;  4KSI A;  1FNO A;  1TKH A;  4GM5 A;  2ARH A;  2DPS A;  3FJU A;  3PB7 X;  4K30 A;  3SJE A;  1VIX A;  4BIN A;  4OAE A;  3TFY A;  4AG9 A;  2Q51 A;  2HUZ A;  2IMO A;  2Z10 A;  2PJ4 A;  2OB0 A;  3ISZ A;  4BMH A;  4OID A;  4A39 A;  4I49 A;  2AFX A;  4HNY B;  2JEW A;  4UEE A;  2GE3 A;  2OH1 A;  2C1C A;  4WWV A;  4YWY A;  3S9M A;  3B8G A;  1FT7 A;  4O23 A;  1F57 A;  2PIZ A;  2CXA A;  2FIA A;  3RAM A;  2EBJ A;  3N5F A;  4UIB A;  4CGN A;  3DR6 A;  4UF4 A;  2GU2 A;  2ZXV A;  4B5P B;  2VBQ A;  1RXT A;  3B7I A;  4ZX9 A;  1R3N A;  1YLO A;  4HNW B;  2PCU A;  4KOW A;  3B3C A;  4PQA A;  2C27 A;  3V7Z A;  4A32 A;  3BJ8 A;  3GYA A;  3T90 A;  2H5M A;  4M3S A;  3IEH A;  5AG6 A;  1FY7 A;  4MMO A;  3QAY A;  4ONU A;  4Y49 C;  4KVM E;  1L0C A;  3TTH A;  2DF5 A;  3FH4 A;  3T9Y A;  3ISX A;  5LYF A;  1LCP A;  2DXQ A;  5IV0 A;  1MJA A;  1YME A;  2ZED A;  3CPX A;  3IU2 A;  1LAP A;  3D7F A;  4NFR A;  4U9Z A;  4PSW A;  4UFW A;  4AG7 A;  1Y9W A;  1BOB A;  1IOF A;  2R7H A;  3C26 A;  2P6E A;  2QIR A;  4JXR A;  3DGV A;  1R57 A;  4LX9 A;  3KHX A;  3BI1 A;  3IFE A;  3BLN A;  3IWW A;  5G1Z A;  3GY9 A;  3IU1 A;  1J4J A;  1TKF A;  3JTK A;  4FD4 A;  4P10 A;  4PXE A;  1ZLI A;  4IUS A;  4H89 A;  4L89 A;  4TWE A;  4OC2 A;  4MJ8 A;  4MY3 A;  4P44 A;  1CBX A;  1XMB A;  1YX0 A;  2PJB A;  1DTD A;  4UA3 A;  1F2O A;  1OBR A;  3SXO A;  3NE8 A;  3LOD A;  2YNE A;  4KSF A;  5D29 A;  4B6Z A;  2EVN A;  3PB9 X;  4R3L A;  4RUH A;  4UBR A;  1AUG A;  2F7V A;  5AG4 A;  1XMT A;  1I1D A;  2I79 A;  4CPA A;  2Q0Y A;  2G9D A;  4DUK A;  4ONW A;  2ZW4 A;  2ZW6 A;  4JD6 A;  5E96 A;  1XEB A;  2Z3M A;  4Z65 A;  4KOX A;  3B35 A;  1M44 A;  4A31 A;  3EY5 A;  2G3T A;  2B5G A;  2BCO A;  3PBE A;  1KUX A;  2GIV A;  3FB3 A;  2WYR A;  4A37 A;  2FVG A;  2ZEO A;  1QST A;  2GAN A;  5AG5 A;  4UWI A;  5F49 A;  1M4D A;  2B3U A;  2PJ2 A;  3SXN A;  1AYE A;  1P4N A;  4KOR A;  4MCR A;  5KTD A;  5JPH A;  2CTC A;  4F9U A;  3FF3 A;  1CP6 A;  3D4U A;  1LFW A;  4UCP A;  4XPK A;  4QB9 A;  3KQX A;  1QSO A;  1TF9 A;  2ZW7 A;  2VZY A;  4YRH A;  2DPT A;  2VI7 A;  3DDD A;  4Y49 B;  4CAX A;  1IU8 A;  3IC1 A;  4X2T A;  1Q2Y A;  4EFD A;  1KZF A;  3VWD A;  2POK A;  3H8F A;  1S7F A;  2OZU A;  3KHZ A;  4RI1 A;  4P4I A;  1ELL P;  4NGS A;  4C2Z A;  1TF8 A;  2B58 A;  1PYT B;  2PVW A;  1LAN A;  2XEI A;  4ZYQ A;  1VHS A;  4FWU A;  3D7H A;  4PSX A;  1VGY A;  3VAT A;  4B13 A;  5JH9 A;  1Z9U A;  3S6G A;  5DWM A;  1GYT A;  4NGM A;  2WPX A;  4JXQ A;  3SHP A;  3GUX A;  5KTA A;  3NA6 A;  1CPX A;  4XPD C;  1Z2L A;  4LQG A;  2WUU A;  4OIW A;  5ELY A;  2BOA A;  3R9G A;  2BO9 A;  4XPL A;  1BO4 A;  4OME A;  4ZGY B;  1XE4 A;  2VL1 A;  4ORF A;  2CNT A;  1JWQ A;  3NE7 A;  3KKW A;  2V8V A;  1B87 A;  1M4L A;  4OC0 A;  3TO6 A;  3DSB A;  4C2X A;  4X8I A;  2BUE A;  4A94 A;  3D2P A;  4CGM A;  2AFW A;  4PK2 A;  1ZG7 A;  3FYN A;  3H4Q A;  3VAR A;  4CAF A;  3GKR A;  4NGR A;  4R57 A;  3DR8 A;  4MFP A;  5LYD A;  3KZW A;  4MHN A;  3SJF A;  2GFQ A;  2ZEM A;  5A27 A;  4R9M A;  3E0K A;  2ZEE A;  1YW6 A;  3PFE A;  4JZ0 A;  2YNC C;  4MFQ A;  3F8K A;  1CX8 A;  4F6A A;  1S3Z A;  4HKF A;  5HVH A;  4A2Z A;  2B4D A;  2HQY A;  2VXK A;  2BL1 A;  3BXM A;  1Y7E A;  3PZJ A;  2AFM A;  2WPW A;  5F47 A;  1OZP A;  3T8W A;  2AE6 A;  2KCW A;  1SQH A;  3HUV A;  4P45 A;  5C88 A;  1PUA A;  2JBJ A;  2PJ5 A;  3ZJ0 A;  4W9Y A;  3JUW A;  3FEE A;  2Z3L A;  3R95 A;  2IQ6 A;  4BD9 A;  5F09 A;  1IB1 E;  4M6G A;  4U9Y A;  2Q44 A;  1NMT A;  4C7H A;  1IGB A;  4PV6 A;  1CG2 A;  2GLF A;  2O28 A;  3I9S A;  3SI0 A;  4JWP A;  4IF5 A;  1A2Z A;  2B4B A;  3PB8 X;  3EXN A;  3R96 A;  1YVO A;  5HXD A;  4CGO A;  1VHE A;  3R1K A;  3TT2 A;  4R6T A;  5AGE A;  1ARL A;  1XIX A;  3D2M A;  4MFZ A;  3MRU A;  4KS9 A;  4XPD B;  2WSA A;  1Y0Y A;  4KLV A;  4UEZ A;  4PXD A;  2I00 A;  8CPA A;  1BPM A;  2F8H A;  2REE A;  5EC4 A;  2J8R A;  2PJ1 A;  2AFU A;  2Q04 A;  3I3G A;  3RZA A;  4CYP A;  1B6B A;  2PJ9 A;  3D7D A;  4F9V A;  1IOI A;  1ELM P;  2V8H A;  3DLJ A;  3QB8 A;  5ISV A;  1Z4R A;  4CAV A;  2FXF A;  3PBB A;  4MCS A;  5EMI A;  3A9L A;  2PSW A;  3PB6 X;  4NJR A;  2Z3N A;  2F5I A;  4JLY A;  4FBE A;  3CXQ A;  3FX6 A;  3K9U A;  4MHP A;  2RB7 A;  4NJQ A;  4X3R A;  2Z3O A;  3PFO A;  3PRT A;  2Q7B A;  2PJ8 A;  4KVO E;  4FUU A;  4A95 A;  3H8E A;  4H6U A;  2Q7S A;  1MJB A;  1P0H A;  2GRE A;  2REF A;  2CNS A;  2Q4V A;  4OP4 A;  3LWU A;  3TOA A;  4CAW A;  4U5Y A;  2HB6 A;  4M6I A;  5CBM A;  1Q7L A;  4OAD A;  4FD7 A;  4A38 A;  3LMS A;  1VHO A;  2PDO A;  4KLW A;  4HPS A;  4P4E A;  2Q4Z A;  4AXV A;  2VZZ A;  5HVF A;  3PGP A;  4UEF A;  1ZO0 A;  4CYQ A;  2K5T A;  4AVB A;  3BI0 A;  4QC6 A;  4Q7A A;  2FE7 A;  1S5K A;  1X10 A;  4X5K A;  2R1I A;  1IID A;  3IGR A;  3OWC A;  4MCP A;  1UFH A;  4LQ6 A;  1F2P A;  2I3C A;  4MHY A;  2QEC A;  3FBU A;  4R87 A;  4R8F A;  1S7N A;  2PJC A;  2WZN A;  4XNH C;  3VH9 A;  3KR4 A;  5LRJ A;  4MRI A;  1CM0 A;  4MFL A;  1BLL E;  5HH1 A;  3WC6 A;  5K8O A;  4P4B A;  3R9E A;  3RO0 A;  2PJ7 A;  1Y9K A;  2PC1 A;  3PEI A;  4CRZ B;  3PB4 X;  2FL4 A;  3R9F A;  1M4G A;  1EE3 P;  4KOU A;  1ZG8 A;  2Z3K A;  4MI4 A;  2Z3P A;  3KL9 A;  5H84 A;  3D67 A;  5F48 A;  1M1D A;  3G3S A;  1KUY A;  3KGQ A;  4CAE A;  1LRZ A;  2X7B A;  5D8N A;  1QQ9 A;  5FVJ A;  4M85 A;  2EK8 A;  2PR1 A;  2B4D B;  3CPA A;  1Y0R A;  2AFZ A;  4L8A A;  2PJ0 A;  4B10 A;  2JBK A;  1N71 A;  2C6C A;  4JYW A;  1XOV A;  5I4M A;  1AMP A;  3CXS A;  3D3S A;  4WJB A;  5GCN A;  4ZX8 A;  1RTQ A;  4II9 A;  2YND A;  4RS2 A;  4KOS A;  1Z8W A;  4UFV A;  1PU9 A;  5LYL A;  4NGT A;  1ARM A;  2AFO A;  2RC4 A;  4NGQ A;  2CIJ A;  4UFX A;  1KWM A;  4P4F A;  4UIA A;  4B14 A;  1Z8T A;  4KUA A;  3RBU A;  1LOK A;  4OC1 A;  3DNS A;  4R76 A;  1MK4 A;  3I1U A;  4NSQ A;  4GS4 A;  3L2N A;  5H86 A;  3PP9 A;  2IL4 A;  2Z0Z A;  2PRB A;  4BBH A;  4F0Y A;  4MY0 A;  4CGL A;  3WR7 A;  2HV2 A;  4Q38 A;  1NSL A;  4H2K A;  2CF4 A;  3FXT A;  4ZY0 A;  3FEC A;  3SI1 A;  2ZEL A;  2HC9 A;  1XRY A;  1NE9 A;  2NMT A;  2Q43 A;  3D66 A;  3SJG A;  1YRE A;  1Z4E A;  4IK2 A;  4P4D A;  2FCK A;  1HEE A;  3B2Y A;  3QAH A;  4XNH B;  4C68 A;  3GLJ A;  2D4O A;  1JQG A;  2O53 A;  4AVC A;  3SJX A;  1MJ9 A;  4JJX A;  4CYO A;  1H8L A;  1TXR A;  4EME A;  2PR8 A;  4AB7 A;  1S7L A;  3WT4 A;  4E2A A;  5THW A;  5DS0 A;  4CYN A;  2OR4 A;  4E0A A;  4C2Y A;  4ZI6 A;  4QVT A;  2XEG A;  2ZOG A;  1Y7R A;  4RN7 A;  1ZLH A;  5LYI A;  1S60 A;  1YGH A;  2PJ3 A;  2OU2 A;  3H5Z A;  1YQE A;  5LRK A;  1Q2C A;  3IJ3 A;  3S6H A;  1QSM A;  3CZX A;  2ZOF A;  2CNM A;  3TO7 A;  5JM6 A;  4IHM A;  1Z8X A;  1IY7 A;  1NSA A;  3FMC A;  4HNX B;  2CTB A;  7CPA A;  4MBU A;  2J8N A;  5J8F A;  3B3T A;  4EVY A;  2Q4Y A;  4KZT A;  5HMN A;  3FNC A;  1RO5 A;  2B5G B;  3EC4 A;  4MHZ A;  1LAM A;  3GB0 A;  4DYO A;  4MXU A;  4ZY1 A;  5KTC A;  2PVV A;  5JGF A;  2AFS A;  4KOY A;  1Z5R A;  2JEV A;  1Z8L A;  4AVA A;  5CPA A;  5J8C A;  3GIU A;  2FSR A;  2G0B A;  5LRG A;  2JLM A;  3D7G A;  1VKC A;  4B12 A;  3CXP A;  2B3V A;  3TX8 A;  1QSN A;  5IX3 A;  3IIB A;  1HDU A;  2P6G A;  2ATR A;  2PE3 A;  5CNP A;  3IO1 A;  4CRY B;  4FD6 A;  3TC8 A;  3WAB A;  4G1P A;  2EK9 A;  2J9A A;  4DNC A;  2Z11 A;  1S7K A;  4EWT A;  1GHE A;  2OZG A;  1X12 A;  3FRM A;  3W91 A;  4CS0 B;  5G20 A;  3MN8 A;  1R43 A;  3F0A A;  2EO8 A;  2FIW A;  3WC7 A;  3B3V A;  5I0C A;  1XFO A;  4NGN A;  3S6F A;  5C82 A;  3NH4 A;  4J3G A;  3HLP A;  1WWZ A;  2ZEN A;  3TOB A;  4KUB A;  4FAI A;  2P6F A;  2JDC A;  3IWE A;  4P6Y A;  4IAV A;  3EO4 A;  1BPN A;  1ON0 A;  3K2K A;  1I12 A;  4KOV A;  1WK4 A;  2V77 A;  4CGP A;  4B5P A;  3FVL A;  4OKO A;  3S6K A;  1YR0 A;  2D4P A;  1XF8 A;  1CJW A;  2ZW5 A;  4OLL A;  3W6S A;  3EFA A;  1CPS A;  2XEF A;  3D8P A;  4F8Z A;  4NEX A;  1TKJ A;  2RFH A;  6CPA A;  3LD2 A;  1V0C A;  2BEI A;  3NFZ A;  5G22 A;  2C6G A;  2P0W A;  3UY5 A;  3W6X A;  1Q2D A;  4LUA A;  4E8O A;  3IWG A;  4MCQ A;  2NSM A;  2R98 A;  4P4J A;  2GLJ A;  3N7Z A;  2AJ6 A;  4R3K A;  4B11 A;  4OC3 A;  2PIY A;  4QBJ A;  2YGW A;  1K4J A;  1QSR A;  4NF1 A;  3CT9 A;  3MGD A;  3ZZI A;  4DJL A;  4KSA A;  2QVP A;  2C6P A;  4UCN A;  3VWE A;  4PK3 A;  4F0X A;  5JQ4 A;  1QMU A;  3S9N A;  4PXB A;  3KAS A;  1ZG9 A;  2IJZ A;  5AG7 A;  4MFK A;  4QUS A;  3KQZ A;  2PRQ A;  2V8G A;  4M6H A;  3H8G A;  3TCV A;  3FIX A;  2QML A;  3B3S A;  5K8M A;  2EWB A;  4H6Z A;  2A4N A;  3S9L A;  3P2H A;  1IYL A;  5EBV A;  3JRU A;  3QNV A;  4UWJ A;  4TNU A;  4GXH A; 
#chains in the Genus database with same CATH homology
 3G8W A;  1KUV A;  4Q36 A;  2PQ8 A;  4YGO A;  2ZPA A;  4FD5 A;  4A33 A;  3RYO A;  2VQY A;  4MFJ A;  3F5B A;  2EUI A;  1YLE A;  1YK3 A;  2YNC A;  2CY2 A;  1M4I A;  4KVX A;  2OZH A;  3V8I A;  1I21 A;  4YFJ A;  4KOT A;  4NCZ A;  5DWN A;  4B5O A;  1IIC A;  2Y0M A;  2FS5 A;  1IYK A;  1U6M A;  3BJ7 A;  2VEZ A;  3P2F A;  1YVK A;  4NXY A;  4ZBG A;  5G21 A;  5F46 A;  5IB0 A;  2R8V A;  2J8M A;  2BSW A;  3JVN A;  4C7I A;  5A28 A;  5BWA B;  4UCM A;  3TO9 A;  4MHD A;  2G3A A;  3TE4 A;  2FT0 A;  4A30 A;  1TIQ A;  2JDD A;  2ARH A;  2DPS A;  4K30 A;  4OAE A;  3TFY A;  4AG9 A;  2Z10 A;  2HUZ A;  2OB0 A;  4BMH A;  4I49 A;  4HNY B;  2GE3 A;  2OH1 A;  3B8G A;  2CXA A;  2FIA A;  4CGN A;  3DR6 A;  2ZXV A;  4B5P B;  2VBQ A;  1RXT A;  4HNW B;  4KOW A;  2C27 A;  4A32 A;  3BJ8 A;  3GYA A;  3T90 A;  2H5M A;  4M3S A;  5AG6 A;  1FY7 A;  4ONU A;  4Y49 C;  4KVM E;  1L0C A;  3TTH A;  3T9Y A;  2DXQ A;  5IV0 A;  1MJA A;  3IU2 A;  4U9Z A;  4AG7 A;  5J8F A;  4UFW A;  4PSW A;  1Y9W A;  1BOB A;  2R7H A;  3C26 A;  4JXR A;  2P6E A;  2QIR A;  1R57 A;  4LX9 A;  3BLN A;  5G1Z A;  3GY9 A;  3IU1 A;  1J4J A;  3JTK A;  4FD4 A;  4IUS A;  4H89 A;  4L89 A;  4MJ8 A;  4MY3 A;  1YX0 A;  4UA3 A;  3SXO A;  4ZGY B;  3LOD A;  2YNE A;  4KSF A;  2EVN A;  4R3L A;  5AG4 A;  4UBR A;  1XMT A;  1I1D A;  2I79 A;  2Q0Y A;  2ZW4 A;  2ZW6 A;  4JD6 A;  5E96 A;  1XEB A;  2Z3M A;  4KOX A;  1M44 A;  4A31 A;  3EY5 A;  2G3T A;  2B5G A;  1KUX A;  2GIV A;  3FB3 A;  1QST A;  2GAN A;  5AG5 A;  4UWI A;  5F49 A;  1M4D A;  2B3U A;  3SXN A;  4KOR A;  1P4N A;  5KTD A;  5JPH A;  4XPK A;  4UCP A;  4QB9 A;  1QSO A;  2ZW7 A;  2VZY A;  4YRH A;  2DPT A;  2VI7 A;  3DDD A;  4Y49 B;  4CAX A;  1Q2Y A;  1KZF A;  3VWD A;  1S7F A;  2OZU A;  4RI1 A;  4C2Z A;  2B58 A;  1VHS A;  4PSX A;  4B13 A;  1Z9U A;  3S6G A;  5DWM A;  2WPX A;  4JXQ A;  3SHP A;  5KTA A;  4XPD C;  2WUU A;  3R9G A;  4XPL A;  1BO4 A;  1XE4 A;  4ORF A;  2CNT A;  3NE7 A;  3KKW A;  1B87 A;  4C2X A;  3TO6 A;  3DSB A;  2BUE A;  3D2P A;  4CGM A;  4PK2 A;  3FYN A;  3H4Q A;  4CAF A;  3GKR A;  4R57 A;  3DR8 A;  4MFP A;  5A27 A;  4R9M A;  3E0K A;  2YNC C;  4MFQ A;  3F8K A;  4F6A A;  1S3Z A;  4HKF A;  4A2Z A;  2B4D A;  2HQY A;  2VXK A;  2BL1 A;  3PZJ A;  2WPW A;  5F47 A;  1OZP A;  2AE6 A;  2KCW A;  1SQH A;  5C88 A;  1PUA A;  3ZJ0 A;  3JUW A;  2Z3L A;  3R95 A;  1IB1 E;  4U9Y A;  2Q44 A;  1NMT A;  4C7H A;  4PV6 A;  2O28 A;  3I9S A;  4JWP A;  4IF5 A;  2B4B A;  3EXN A;  3R96 A;  1YVO A;  4CGO A;  3R1K A;  3TT2 A;  5AGE A;  1XIX A;  3D2M A;  4MFZ A;  4KS9 A;  4XPD B;  2WSA A;  4KLV A;  2I00 A;  2REE A;  5EC4 A;  2J8R A;  3I3G A;  2Q04 A;  4CYP A;  1B6B A;  5ISV A;  3QB8 A;  1Z4R A;  4CAV A;  2FXF A;  3A9L A;  2PSW A;  2Z3N A;  2F5I A;  4JLY A;  3CXQ A;  3K9U A;  2Z3O A;  2Q7B A;  4KVO E;  4A95 A;  4H6U A;  1MJB A;  1P0H A;  2REF A;  2CNS A;  2Q4V A;  4CAW A;  3TOA A;  4U5Y A;  4OAD A;  4FD7 A;  2PDO A;  4KLW A;  2VZZ A;  3PGP A;  1ZO0 A;  4CYQ A;  2K5T A;  4AVB A;  4QC6 A;  2FE7 A;  1S5K A;  4X5K A;  2R1I A;  1IID A;  3IGR A;  3OWC A;  1UFH A;  2QEC A;  3FBU A;  4R87 A;  1S7N A;  4XNH C;  1CM0 A;  4MFL A;  5HH1 A;  3R9E A;  1Y9K A;  2PC1 A;  4CRZ B;  3R9F A;  2FL4 A;  1M4G A;  4KOU A;  2Z3K A;  4MI4 A;  2Z3P A;  5H84 A;  5F48 A;  4CAE A;  1M1D A;  3G3S A;  1KUY A;  1LRZ A;  2X7B A;  5FVJ A;  4M85 A;  2PR1 A;  2B4D B;  4L8A A;  4B10 A;  1N71 A;  3CXS A;  3D3S A;  5GCN A;  4II9 A;  2YND A;  4RS2 A;  4KOS A;  4UFV A;  1PU9 A;  2RC4 A;  4UFX A;  4B14 A;  4KUA A;  3DNS A;  1MK4 A;  4NSQ A;  4GS4 A;  5H86 A;  3PP9 A;  2IL4 A;  2Z0Z A;  2PRB A;  4BBH A;  4F0Y A;  4MY0 A;  4CGL A;  3WR7 A;  2HV2 A;  4Q38 A;  1NSL A;  3FXT A;  1NE9 A;  2NMT A;  1YRE A;  1Z4E A;  2FCK A;  3QAH A;  4XNH B;  4C68 A;  2D4O A;  4AVC A;  4CYO A;  1MJ9 A;  4JJX A;  2PR8 A;  4AB7 A;  1S7L A;  4E2A A;  4CYN A;  4E0A A;  4C2Y A;  4QVT A;  1Y7R A;  1S60 A;  1YGH A;  2OU2 A;  3H5Z A;  1Q2C A;  3S6H A;  1QSM A;  3TO7 A;  2CNM A;  4HNX B;  4MBU A;  2J8N A;  4EVY A;  2Q4Y A;  4KZT A;  5HMN A;  3FNC A;  1RO5 A;  2B5G B;  3EC4 A;  5KTC A;  4KOY A;  2JEV A;  4AVA A;  5J8C A;  2FSR A;  2G0B A;  2JLM A;  1VKC A;  4B12 A;  3CXP A;  2B3V A;  1QSN A;  5IX3 A;  2P6G A;  2ATR A;  5CNP A;  4CRY B;  4FD6 A;  4DNC A;  2Z11 A;  1S7K A;  1GHE A;  2OZG A;  4CS0 B;  3FRM A;  3W91 A;  5G20 A;  3F0A A;  2FIW A;  5I0C A;  3S6F A;  5C82 A;  4J3G A;  1WWZ A;  3TOB A;  4KUB A;  2P6F A;  2JDC A;  3IWE A;  3EO4 A;  1ON0 A;  4CGP A;  4KOV A;  1I12 A;  1WK4 A;  4B5P A;  3S6K A;  1YR0 A;  2D4P A;  1XF8 A;  1CJW A;  2ZW5 A;  4OLL A;  3W6S A;  3EFA A;  3D8P A;  4NEX A;  3LD2 A;  1V0C A;  2BEI A;  5G22 A;  2P0W A;  3UY5 A;  3W6X A;  1Q2D A;  4LUA A;  4E8O A;  3IWG A;  2R98 A;  3N7Z A;  2AJ6 A;  4R3K A;  4B11 A;  4QBJ A;  2YGW A;  1K4J A;  1QSR A;  4NF1 A;  3ZZI A;  3MGD A;  4KSA A;  5JQ4 A;  4UCN A;  3VWE A;  4PK3 A;  4F0X A;  5AG7 A;  4MFK A;  4QUS A;  3TCV A;  3FIX A;  2QML A;  4H6Z A;  2A4N A;  3P2H A;  1IYL A;  5EBV A;  4UWJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...