1YVOA

Hypothetical acetyltransferase from p.aeruginosa pa01
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
169
structure length
169
Chain Sequence
SIRDAGVADLPGILAIYNDAVGNTTAIWNETPVDLANRQAWFDTRARQGYPILVASDAAGEVLGYASYGDWRPFEGFRGTVEHSVYVRDDQRGKGLGVQLLQALIERARAQGLHVMVAAIESGNAASIGLHRRLGFEISGQMPQVGQKFGRWLDLTFMQLNLDPTRSAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Crystal structure of a hypothetical acetyltransferase from P.aeruginosa PA01
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 49
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature ec 2.3.-.-:
pdb deposition date 2005-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1yvoA00
1RXTA 3R9GA 2FSRA 4ORFA 4AG7A 1Q2DA 2JEVA 2Q7BA 1IYKA 5H86A 3N7ZA 3BLNA 1YR0A 2PQ8A 4AG9A 3NE7A 2REEA 2EUIA 3I9SA 1YLEA 2PR8A 1PUAA 2BUEA 1S3ZA 2D4PA 3CXPA 1CM0A 4KUBA 4LUAA 1IIDA 3S6HA 4MI4A 5IX3A 2P6EA 3D2MA 4EVYA 4JJXA 2J8MA 3SXNA 3EFAA 5IB0A 4E2AA 2FS5A 3DSBA 4FD4A 4JXRA 2WPWA 2ARHA 3LD2A 3UY5A 1S7FA 5DWNA 1N71A 3C26A 4AVBA 2Q4VA 4MBUA 3P2HA 4QC6A 1M4GA 1NMTA 3FBUA 4R87A 3OWCA 2CY2A 3EC4A 3PGPA 1Q2CA 1XIXA 2QMLA 2DXQA 1Y9KA 3D8PA 3V8IA 4L89A 4R57A 2AJ6A 1ON0A 1MJBA 3WR7A 2ZW7A 3T9YA 2B5GA 4QUSA 3W6XA 3EO4A 1IB1E 4CRYB 2EVNA 1Z4EA 1M1DA 5KTCA 1QSRA 3R96A 4H6ZA 4FD6A 3TO6A 2BL1A 3BJ8A 4GS4A 2G0BA 4XPDB 3R95A 3K9UA 1IICA 2OZUA 5F49A 4MY3A 2KCWA 3TO7A 2FT0A 3S6KA 2B4DA 1XE4A 1KUVA 1QSTA 1L0CA 5E96A 3CXQA 3TE4A 2PR1A 2ZPAA 5JQ4A 5IV0A 3FIXA 1V0CA 2G3TA 2VQYA 4PK3A 4IF5A 2PRBA 2WPXA 3QAHA 1SQHA 1BO4A 2ATRA 4NXYA 5EC4A 3G8WA 4B5OA 1K4JA 4KOWA 3MGDA 4M85A 5H84A 1S7LA 2Q4YA 3FYNA 2BEIA 2BSWA 3G3SA 5C82A 1M4DA 4U9YA 3S6GA 2JLMA 4OLLA 4PSXA 4HNXB 3W91A 4B5PA 4AVAA 2P0WA 1M44A 1KUYA 4UWIA 4E0AA 4F0YA 5FVJA 5EBVA 2REFA 5J8FA 4UA3A 3FXTA 2CNTA 3I3GA 1MK4A 1P0HA 1I21A 4J3GA 2PSWA 3RYOA 3H4QA 1YVKA 2ZW5A 2ZW6A 3DR6A 4KLVA 2P6GA 3VWDA 2FCKA 2OU2A 2Y0MA 3R9FA 4XNHB 1FY7A 3B8GA 2VBQA 2Q44A 4KZTA 4AVCA 3LODA 2ZXVA 2R8VA 4XPKA 4Y49C 2JDCA 3BJ7A 1Z9UA 4XPDC 1QSMA 4K30A 3PP9A 4UBRA 1GHEA 3TCVA 1Y7RA 5J8CA 1IYLA 2A4NA 1YGHA 4U9ZA 2PDOA 4CAVA 4JLYA 2QIRA 5I0CA 4CAXA 2CNSA 1VHSA 4QB9A 4H6UA 4Y49B 2FIAA 3SXOA 2B58A 1M4IA 2QECA 4DNCA 4MY0A 5KTDA 3D3SA 4U5YA 2Z0ZA 1QSNA 3TOBA 1P4NA 4YRHA 1OZPA 2I79A 2VEZA 4UWJA 4OAEA 1KZFA 4KOVA 5F46A 3GKRA 2Z10A 4RI1A 3TFYA 5HH1A 2AE6A 2Q04A 4FD5A 4KOYA 4ZBGA 1MJ9A 1WK4A 4MJ8A 4FD7A 3IGRA 1YREA 2ZW4A 2R7HA 3SHPA 3P2FA 4M3SA 3FNCA 4HNYB 3W6SA 2FIWA 2J8NA 2P6FA 3JVNA 4CRZB 2B3VA 4PK2A 2B4BA 1Y9WA 1YX0A 2G3AA 3ZZIA 2CNMA 2B3UA 1U6MA 2B5GB 4KORA 5F48A 3TTHA 4PV6A 4F6AA 2IL4A 2F5IA 3IWGA 2FE7A 4JD6A 2GIVA 3QB8A 1R57A 4LX9A 4R3LA 5KTAA 4MHDA 1LRZA 2D4OA 4XNHC 4QVTA 2OZHA 1BOBA 2C27A 2H5MA 4AB7A 5JPHA 2OB0A 2B4DB 1S60A 3TOAA 4KOSA 4PSWA 4XPLA 2Z11A 4HKFA 1XF8A 1S7KA 4ONUA 1XEBA 1NSLA 5C88A 3S6FA 1YVOA 4KVXA 4YFJA 4BMHA 1I12A 5CNPA 4KVME 3D2PA 4OADA 2R1IA 4NF1A 4KLWA 1KUXA 4CAWA 4H89A 4I49A 1RO5A 3F5BA 1XMTA 2HUZA 3TT2A 2OH1A 4JXQA 3DDDA 4B5PB 3FB3A 4X5KA 2X7BA 2PC1A 5F47A 2GE3A 3DR8A 3GY9A 5ISVA 5GCNA 3R1KA 2HQYA 1B87A 1VKCA 4L8AA 2FXFA 4NCZA 4IUSA 2R98A 3F0AA 1MJAA 1Z4RA 4II9A 3DNSA 4R3KA 2OZGA 4HNWB 5HMNA 3EXNA 3GYAA 1Q2YA 1S5KA 3R9EA 3JUWA 2J8RA 3EY5A 2K5TA 4KOTA 2VXKA 1B6BA 4R9MA 1I1DA 1PU9A 4KOUA 4CS0B 4KOXA 3F8KA 1WWZA 4JWPA 3PZJA 4QBJA 2VI7A 2GANA 2RC4A 4RS2A 3CXSA 1UFHA 2I00A 3VWEA 2VZYA 3KKWA 3TO9A 4YGOA 1NE9A 4NSQA 5DWMA 1J4JA 1YK3A 4NEXA 2NMTA 2O28A 1S7NA 3E0KA 3FRMA 1CJWA 1QSOA 4KUAA 4E8OA 4KVOE 1TIQA 2Q0YA 2HV2A 2VZZA 2JDDA 3ZJ0A 2FL4A 3T90A
chains in the Genus database with same CATH superfamily
1AYEA 2JBJA 1RXTA 4EFDA 3R9GA 2FSRA 4ORFA 4IK2A 4AG7A 4TWEA 4UIAA 1Q2DA 4MFQA 2JEVA 2Q7BA 4CYPA 1IYKA 5H86A 3N7ZA 5ELYA 3BLNA 1YR0A 1QQ9A 2PQ8A 1YQEA 4AG9A 3NE7A 1Z2LA 2EUIA 2REEA 3IIBA 2AFXA 3I9SA 1YLEA 3KHZA 5AG5A 2PR8A 1PUAA 2BUEA 1S3ZA 1Y7EA 2D4PA 3DLJA 4OIDA 2Q4ZA 5AG6A 4RN7A 5EMIA 3CXPA 1CM0A 4KUBA 4LUAA 4CAEA 4LQGA 1IIDA 4NGTA 3S6HA 4MI4A 5IX3A 3PB6X 2P6EA 1CP7A 4ONWA 2F7VA 3D2MA 4EVYA 4JJXA 2J8MA 3SXNA 3EFAA 5IB0A 4E2AA 2FS5A 3DSBA 4FD4A 4JXRA 4NGSA 5DS0A 2Z3MA 1XRYA 2WPWA 2ARHA 3BXMA 3LD2A 4PXEA 3UY5A 4P10A 1LOKA 1S7FA 3MRUA 4TNUA 5DWNA 1N71A 1KWMA 3IU1A 3TC8A 3C26A 4AVBA 3NE8A 4A94A 2Q4VA 3D68A 4MBUA 3P2HA 3IO1A 4QC6A 4NGRA 1M4GA 5LRKA 3D7FA 1NMTA 3FBUA 4R87A 5AG4A 3OWCA 2XEJA 3PEIA 4WWVA 2CY2A 3SI1A 1CP6A 4CGNA 2GLFA 3EC4A 3PGPA 5AG7A 4HPSA 1Q2CA 1XIXA 5ISVA 2QMLA 2DXQA 1Y9KA 3D8PA 1ELMP 3GLJA 2DPSA 4L89A 3V8IA 4OC0A 4UEZA 2J9AA 4M6IA 2HC9A 1ELLP 2QJ8A 4R57A 1XOVA 2GU2A 3GUXA 3SJXA 3KQXA 2AJ6A 4MRIA 1ON0A 4MFPA 5D29A 2ZOGA 3HUVA 1MJBA 5G1ZA 3WR7A 4P44A 4P4EA 5K8NA 2ZW7A 3IU2A 1HDUA 3T9YA 2B5GA 4QUSA 3W6XA 4ZGYB 2V8DA 4AXVA 4CYOA 2QYVA 2ZEMA 3EO4A 1IB1E 3IWWA 2EVNA 1Z4EA 1M1DA 3PB8X 2PVWA 4MHPA 4NGMA 5LYDA 4CRYB 5KTCA 4BD9A 1QSRA 2PJBA 4LQ6A 3R96A 4Q38A 4H6ZA 4A32A 4B10A 2Z3PA 3H5ZA 4P4JA 1DTDA 3RNZA 4WJBA 4FD6A 4IHMA 4Q36A 1YSJA 5CPAA 3TO6A 2BL1A 1QMUA 3BJ8A 2IMOA 2G0BA 4GS4A 2ABZA 4XPDB 1R3NA 3R95A 1AUGA 4B12A 3K9UA 1IICA 2OZUA 5F49A 2PRQA 1GYTA 2PCUA 4MY3A 2Z3KA 2KCWA 2YNCC 3TO7A 2FT0A 2AFOA 3S6KA 1LAPA 2B4DA 1XE4A 1KUVA 4B6ZA 4EWTA 3FEEA 3V7ZA 5LYIA 4CPAA 2WZNA 1QSTA 1L0CA 5E96A 5I4MA 3S9LA 4DUKA 3VH9A 3CXQA 3TE4A 2XEGA 1ZG8A 2PR1A 4R8FA 5THWA 3V38A 2ZPAA 2PIYA 5JQ4A 5IV0A 3FIXA 5BWAB 1IGBA 1V0CA 2C6GA 2G3TA 2VQYA 2POKA 2V77A 4ZY0A 1HEEA 4PK3A 2ODFA 4IF5A 2PRBA 4KSAA 2V8HA 4P4DA 3NH8A 3NFZA 2WPXA 3QAHA 4CGMA 2ZEPA 2BO9A 3S9NA 1SQHA 2AFWA 4UFVA 1BO4A 2ATRA 4PXDA 2IQ6A 3I1UA 3IWEA 4NXYA 4PXBA 5EC4A 3D7GA 3G8WA 4B5OA 2AFSA 1K4JA 2C6PA 1Z8XA 4KOWA 3BI1A 4MFKA 3MGDA 4OIWA 3IC1A 4P6YA 4PPZA 3L2NA 4M85A 3BHXA 1TF9A 4OC4A 5H84A 1S7LA 2Q4YA 3FYNA 4BINA 4R6TA 2BEIA 2BSWA 2NSMA 4A38A 3G3SA 5C82A 1M4DA 1A2ZA 1CPXA 1HDQA 4H2KA 4U9YA 3S6GA 2JLMA 4OLLA 4PSXA 3SJFA 4UFWA 2AFUA 3ISZA 3PBEA 4HNXB 3W91A 2PJCA 4AVAA 4B5PA 4M6HA 3B7IA 3H8EA 4G1PA 2P0WA 1LANA 1M44A 1KUYA 2PJ0A 4UWIA 4E0AA 4R7MA 4EMEA 4F0YA 5FVJA 5EBVA 3KHXA 3LMSA 2REFA 2I3CA 1YW4A 2IJZA 5J8FA 4UA3A 1Y0RA 2PJ5A 3FXTA 2CNTA 3I3GA 4F9UA 1MK4A 1P0HA 1FNOA 1I21A 3PB9X 4J3GA 2PSWA 3B3SA 3RYOA 3H4QA 2HB6A 1YVKA 1ZG9A 2JEWA 4NGNA 4P45A 2YGWA 4C7IA 2ZW5A 3S9MA 4RUHA 2JBKA 2BOAA 2ZW6A 3DR6A 4UIBA 4KLVA 3JRUA 2P6GA 1Z8LA 2FCKA 3VWDA 2VL1A 2OU2A 1BAVA 2Y0MA 3KZWA 3R9FA 4XNHB 4NGQA 2PJ2A 3CPAA 4C2XA 2EWBA 1FY7A 3B8GA 3D7DA 2VBQA 2Q44A 4UFXA 2PIZA 4KZTA 1VHOA 4B14A 4CYNA 2DEAA 4UEFA 1LFWA 4AVCA 5K8MA 2RB7A 3D67A 4MXUA 4DYOA 3LODA 4CGPA 2ZXVA 2OOTA 3WT4A 1ZG7A 2R8VA 2ZEFA 4XPKA 1RTQA 4Y49C 4A2ZA 2JDCA 4UCPA 2PJ1A 2XEFA 3GIUA 3BJ7A 1Z5RA 1Z9UA 4XPDC 4X2TA 1QSMA 2C1CA 2C6CA 4K30A 3PP9A 3T8WA 4UBRA 1GHEA 3TCVA 1Y7RA 1ARMA 2V8GA 1M4LA 4GXHA 5J8CA 1IYLA 2A4NA 5HVFA 1IOFA 1YGHA 2ZEGA 3WC5A 4U9ZA 2PDOA 4CAVA 1TXRA 4JLYA 2QIRA 2YNCA 5I0CA 4A39A 2PVVA 4CAXA 3JTKA 2CNSA 1CG2A 1VHSA 4QB9A 5F09A 4H6UA 4KSFA 1YW6A 2CF4A 3B2YA 5IB9A 4Y49B 4Q7AA 2FIAA 3SXOA 4M6GA 2Q51A 2ANPA 2B58A 5HXDA 1F57A 1YLOA 4UCMA 1M4IA 2QECA 2RFHA 5JH9A 4DNCA 5G21A 4MY0A 2O53A 5KTDA 3D3SA 4U5YA 1BLLE 1QSNA 2Z0ZA 3TOBA 4ZYQA 3KASA 4A31A 4JZ0A 1P4NA 4YRHA 1OZPA 2I79A 2VEZA 1AMPA 2EBJA 4IAVA 4OC3A 2CIJA 4UWJA 4OAEA 1KZFA 4KOVA 5F46A 3HLPA 3FEDA 3NH4A 4MFZA 3GKRA 2Z10A 4OC2A 4RI1A 4C2YA 3TFYA 5HH1A 2Q7SA 2PJ9A 2AE6A 2Q04A 4FD5A 2PE3A 4KOYA 4ZBGA 3CPXA 1MJ9A 5K8OA 5G20A 1WK4A 4F9VA 4MJ8A 4FD7A 4DJLA 4A33A 3IGRA 5JM6A 1YREA 2ZW4A 2ZEHA 2R7HA 3SHPA 3B3VA 4MCRA 3KGQA 2V8VA 3P2FA 1F2OA 4O23A 4YU9A 4A30A 4M3SA 3FNCA 4HNYB 3W6SA 1EE3P 2FIWA 2J8NA 2EK9A 2P6FA 3JVNA 3KQZA 1LAMA 3FMCA 4CRZB 2B3VA 3KR5A 4B13A 4NGPA 1Q7LA 2YNEA 5AGEA 4PK2A 4KSIA 2B4BA 1Y9WA 1YX0A 2G3AA 3ZZIA 7CPAA 2CNMA 4OC5A 2B3UA 1U6MA 8CPAA 3FH4A 2B5GB 4KORA 5F48A 3VATA 3TTHA 4ZX8A 2PJ3A 4PV6A 4F6AA 3B3TA 1ZLIA 3D7HA 4P4BA 2IL4A 3CDXA 1VHEA 4R76A 5LRGA 1IOIA 2F5IA 3IWGA 2FE7A 4JD6A 2GIVA 2Z3OA 3QB8A 4W9YA 1R57A 3KL9A 4NFRA 3MN8A 4LX9A 4FWUA 4R3LA 3LACA 5KTAA 3K9TA 2OR4A 2WYRA 2PJ8A 4MHDA 1LRZA 1NSAA 4K3NA 4MCPA 2D4OA 4XNHC 2AFZA 2OZHA 4QVTA 1BPMA 3FJUA 1BOBA 2C27A 2H5MA 4AB7A 5JPHA 4OMEA 2OB0A 2O4HA 4C7HA 1ZO0A 3PB7X 1VIXA 2B4DB 4ZX9A 3WABA 2CXAA 1S60A 2Q43A 3CT9A 4KOSA 4PSWA 4XPLA 1Z8TA 3SJGA 3TOAA 2Z11A 4CAFA 5HVHA 1Z8WA 3WC6A 2AFMA 2PJ4A 2ZEOA 1XFOA 4HKFA 2BCOA 4FUUA 1XF8A 1JQGA 4GM5A 5D8NA 1S7KA 3NH5A 4ONUA 2FVGA 1XEBA 1BPNA 1NSLA 4OC1A 5C88A 5HVGA 4YWYA 3RAMA 1CX8A 1DE4C 3S6FA 4F0XA 1YVOA 4FBEA 1ARLA 4KVXA 4YFJA 4MFLA 1Y0YA 3ISXA 4BMHA 3B3CA 1I12A 5CNPA 4ZY2A 4KVME 2CTCA 3D2PA 4OADA 2R1IA 2GFQA 1XMBA 3CZXA 4OP4A 3H8GA 4C2ZA 4NF1A 4KLWA 1KUXA 1IY7A 2PJ7A 4CAWA 4MCQA 4H89A 4I49A 3FVLA 1RO5A 3RO0A 4CGOA 5K8PA 3F5BA 1IU8A 4NJQA 3RBUA 1XMTA 2HUZA 4NJRA 3RZAA 3TT2A 2OH1A 4JXQA 4A95A 3DDDA 4B5PB 3FB3A 4X5KA 3TX8A 5A28A 2X7BA 2PC1A 2QVPA 3PB4X 1R43A 5F47A 3PBBA 4PQAA 2GE3A 3DR8A 3QNVA 3GY9A 1FT7A 4P4IA 4F8ZA 1CBXA 1X10A 2DF5A 2ZELA 3A9LA 4MFJA 4UF4A 4CGLA 2EK8A 5LYFA 5LRJA 2CTBA 1ZLHA 2Z3LA 3D4UA 4X8IA 4CYQA 1TF8A 3KI9A 5GCNA 3H8FA 3R1KA 2HQYA 1B87A 1VKCA 4L8AA 2FXFA 2GREA 4NCZA 3SI0A 4IUSA 2R98A 2PJAA 1MJAA 1TKJA 1Z4RA 2ZEDA 3DNSA 3F0AA 4JYWA 4ZY1A 4II9A 4C68A 4R3KA 1PYTB 2OZGA 4HNWB 4ZI6A 3BI0A 5HMNA 2EO8A 2ZENA 3EXNA 3GYAA 1LCPA 3K2KA 1Q2YA 1S5KA 4FAIA 1XJOA 2F8HA 3R9EA 3JUWA 4B11A 2J8RA 5A27A 3NA6A 5J1QA 3PFOA 3EY5A 3FX6A 4MHNA 2K5TA 4KOTA 3LWUA 4A37A 2G9DA 2VXKA 1H8LA 1B6BA 1UWYA 1X12A 3B35A 4R9MA 2ZOFA 2GLJA 1I1DA 1JWQA 1PU9A 4KOUA 2WSAA 4CS0B 4KOXA 4PXCA 4UEEA 1TKFA 3N5FA 3SI2A 1VGYA 3F8KA 3IFEA 4OKOA 3IEHA 1WWZA 2NYQA 6CPAA 4JWPA 3IJ3A 5JGFA 4MMOA 4MHYA 3WC7A 3PZJA 4Z65A 1TKHA 4QBJA 1OBRA 2DPTA 2VI7A 2GANA 2Z3NA 2RC4A 4MCSA 2PJ6A 4RS2A 3KR4A 3VARA 3CXSA 1UFHA 2I00A 2YNDA 3VWEA 2VZYA 3KKWA 3TO9A 4X3RA 4YGOA 1NE9A 4NSQA 5CBMA 3FECA 1J4JA 5DWMA 5G22A 1YK3A 2XEIA 4NEXA 2NMTA 4UCNA 2O28A 1S7NA 5LYLA 2WUUA 3E0KA 3PFEA 3FRMA 1CJWA 1QSOA 4KUAA 4MHZA 2ZEEA 4E8OA 4KVOE 1CPSA 1XBUA 1PCAA 3QAYA 1F2PA 1TIQA 2Q0YA 3PRTA 2HV2A 3FF3A 2VZZA 3GB0A 4KS9A 2JDDA 3D66A 1YMEA 4P4FA 3ZJ0A 3DGVA 2FL4A 4BBHA 3SJEA 3B3WA 3T90A
chains in the Genus database with same CATH topology
1RXTA 3R9GA 2FSRA 4ORFA 4AG7A 1Q2DA 4MFQA 2JEVA 2Q7BA 4CYPA 1IYKA 5H86A 3N7ZA 3BLNA 1YR0A 2PQ8A 4AG9A 3NE7A 2REEA 2EUIA 3I9SA 1YLEA 5AG5A 2PR8A 1PUAA 2BUEA 1S3ZA 2D4PA 5AG6A 4CAEA 3CXPA 1CM0A 4KUBA 4LUAA 1IIDA 3S6HA 4MI4A 5IX3A 2P6EA 3D2MA 4EVYA 4JJXA 2J8MA 3SXNA 3EFAA 5IB0A 4E2AA 2FS5A 3DSBA 4FD4A 4JXRA 2Z3MA 2WPWA 2ARHA 3LD2A 3UY5A 1S7FA 5DWNA 1N71A 3IU1A 3C26A 4AVBA 2Q4VA 4MBUA 3P2HA 4QC6A 1M4GA 1NMTA 3FBUA 4R87A 5AG4A 3OWCA 2CY2A 4CGNA 3EC4A 3PGPA 5AG7A 1Q2CA 1XIXA 2QMLA 2DXQA 1Y9KA 3D8PA 3V8IA 2DPSA 4L89A 4R57A 2AJ6A 1ON0A 4MFPA 5G1ZA 1MJBA 3WR7A 2ZW7A 3IU2A 3T9YA 2B5GA 4QUSA 3W6XA 4ZGYB 4CYOA 3EO4A 1IB1E 4CRYB 2EVNA 1Z4EA 1M1DA 5KTCA 1QSRA 3R96A 4Q38A 4H6ZA 4A32A 4B10A 2Z3PA 3H5ZA 4FD6A 4Q36A 3TO6A 2BL1A 3BJ8A 4GS4A 2G0BA 4XPDB 3R95A 4B12A 3K9UA 1IICA 2OZUA 5F49A 4MY3A 2Z3KA 2KCWA 2YNCC 3TO7A 2FT0A 3S6KA 2B4DA 1XE4A 1KUVA 1QSTA 1L0CA 5E96A 3CXQA 3TE4A 2PR1A 2ZPAA 5JQ4A 5IV0A 3FIXA 5BWAB 1V0CA 2G3TA 2VQYA 4PK3A 4IF5A 2PRBA 4KSAA 2WPXA 3QAHA 4CGMA 1SQHA 4UFVA 1BO4A 2ATRA 3IWEA 4NXYA 5EC4A 3G8WA 4B5OA 1K4JA 4KOWA 4MFKA 3MGDA 4M85A 5H84A 1S7LA 2Q4YA 3FYNA 2BEIA 2BSWA 3G3SA 5C82A 1M4DA 4U9YA 3S6GA 2JLMA 4OLLA 4PSXA 4UFWA 4HNXB 3W91A 4B5PA 4AVAA 2P0WA 1M44A 1KUYA 4UWIA 4E0AA 4F0YA 5FVJA 5EBVA 2REFA 5J8FA 4UA3A 3FXTA 2CNTA 3I3GA 1MK4A 1P0HA 1I21A 4J3GA 2PSWA 3RYOA 3H4QA 1YVKA 2YGWA 4C7IA 2ZW5A 2ZW6A 3DR6A 4KLVA 2P6GA 3VWDA 2FCKA 2OU2A 2Y0MA 3R9FA 4XNHB 4C2XA 1FY7A 3B8GA 2VBQA 2Q44A 4UFXA 4KZTA 4B14A 4CYNA 4AVCA 3LODA 4CGPA 2ZXVA 2R8VA 4XPKA 4Y49C 4A2ZA 2JDCA 4UCPA 3BJ7A 1Z9UA 4XPDC 1QSMA 4K30A 3PP9A 4UBRA 1GHEA 3TCVA 1Y7RA 5J8CA 1IYLA 2A4NA 1YGHA 4U9ZA 2PDOA 4CAVA 4JLYA 2QIRA 2YNCA 5I0CA 4CAXA 3JTKA 2CNSA 1VHSA 4QB9A 4H6UA 4KSFA 4Y49B 2FIAA 3SXOA 2B58A 4UCMA 1M4IA 2QECA 4DNCA 5G21A 4MY0A 5KTDA 3D3SA 4U5YA 2Z0ZA 1QSNA 3TOBA 4A31A 1P4NA 4YRHA 1OZPA 2I79A 2VEZA 4UWJA 4OAEA 1KZFA 4KOVA 5F46A 4MFZA 3GKRA 2Z10A 4RI1A 4C2YA 3TFYA 5HH1A 2AE6A 2Q04A 4FD5A 4KOYA 4ZBGA 1MJ9A 5G20A 1WK4A 4MJ8A 4FD7A 4A33A 3IGRA 1YREA 2ZW4A 2R7HA 3SHPA 3P2FA 4A30A 4M3SA 3FNCA 4HNYB 3W6SA 2FIWA 2J8NA 2P6FA 3JVNA 4CRZB 2B3VA 4B13A 2YNEA 5AGEA 4PK2A 2B4BA 1Y9WA 1YX0A 2G3AA 3ZZIA 2CNMA 2B3UA 1U6MA 2B5GB 4KORA 5F48A 3TTHA 4PV6A 4F6AA 2IL4A 2F5IA 3IWGA 2FE7A 4JD6A 2GIVA 2Z3OA 3QB8A 1R57A 4LX9A 4R3LA 5KTAA 4MHDA 1LRZA 2D4OA 4XNHC 4QVTA 2OZHA 1BOBA 2C27A 2H5MA 4AB7A 5JPHA 2OB0A 4C7HA 1ZO0A 2B4DB 2CXAA 1S60A 3TOAA 4KOSA 4PSWA 4XPLA 2Z11A 4CAFA 4HKFA 1XF8A 1S7KA 4ONUA 1XEBA 1NSLA 5C88A 3S6FA 4F0XA 1YVOA 4KVXA 4YFJA 4MFLA 4BMHA 1I12A 5CNPA 4KVME 3D2PA 4OADA 2R1IA 4C2ZA 4NF1A 4KLWA 1KUXA 4CAWA 4H89A 4I49A 1RO5A 4CGOA 3F5BA 1XMTA 2HUZA 3TT2A 4A95A 2OH1A 4JXQA 3DDDA 4B5PB 3FB3A 4X5KA 5A28A 2X7BA 2PC1A 5F47A 2GE3A 3DR8A 3GY9A 4MFJA 5ISVA 3A9LA 4CGLA 2Z3LA 4CYQA 5GCNA 3R1KA 2HQYA 1B87A 1VKCA 4L8AA 2FXFA 4NCZA 4IUSA 2R98A 3F0AA 1MJAA 1Z4RA 4II9A 3DNSA 4C68A 4R3KA 2OZGA 4HNWB 5HMNA 3EXNA 3GYAA 1Q2YA 1S5KA 3R9EA 3JUWA 4B11A 2J8RA 5A27A 3EY5A 2K5TA 4KOTA 2VXKA 1B6BA 4R9MA 1I1DA 1PU9A 4KOUA 2WSAA 4CS0B 4KOXA 3F8KA 1WWZA 4JWPA 3PZJA 4QBJA 2DPTA 2VI7A 2GANA 2Z3NA 2RC4A 4RS2A 3CXSA 1UFHA 2I00A 2YNDA 3VWEA 2VZYA 3KKWA 3TO9A 4YGOA 1NE9A 4NSQA 5DWMA 1J4JA 5G22A 1YK3A 4NEXA 2NMTA 4UCNA 2O28A 1S7NA 2WUUA 3E0KA 3FRMA 1CJWA 1QSOA 4KUAA 4E8OA 4KVOE 4KS9A 1TIQA 2Q0YA 2HV2A 2VZZA 2JDDA 3ZJ0A 2FL4A 4BBHA 3T90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RXT A;  3R9G A;  2FSR A;  4ORF A;  4AG7 A;  1Q2D A;  2JEV A;  2Q7B A;  1IYK A;  5H86 A;  3N7Z A;  3BLN A;  1YR0 A;  2PQ8 A;  4AG9 A;  3NE7 A;  2REE A;  2EUI A;  3I9S A;  1YLE A;  2PR8 A;  1PUA A;  2BUE A;  1S3Z A;  2D4P A;  3CXP A;  1CM0 A;  4KUB A;  4LUA A;  1IID A;  3S6H A;  4MI4 A;  5IX3 A;  2P6E A;  3D2M A;  4EVY A;  4JJX A;  2J8M A;  3SXN A;  3EFA A;  5IB0 A;  4E2A A;  2FS5 A;  3DSB A;  4FD4 A;  4JXR A;  2WPW A;  2ARH A;  3LD2 A;  3UY5 A;  1S7F A;  5DWN A;  1N71 A;  3C26 A;  4AVB A;  2Q4V A;  4MBU A;  3P2H A;  4QC6 A;  1M4G A;  1NMT A;  3FBU A;  4R87 A;  3OWC A;  2CY2 A;  3EC4 A;  3PGP A;  1Q2C A;  1XIX A;  2QML A;  2DXQ A;  1Y9K A;  3D8P A;  3V8I A;  4L89 A;  4R57 A;  2AJ6 A;  1ON0 A;  1MJB A;  3WR7 A;  2ZW7 A;  3T9Y A;  2B5G A;  4QUS A;  3W6X A;  3EO4 A;  1IB1 E;  4CRY B;  2EVN A;  1Z4E A;  1M1D A;  5KTC A;  1QSR A;  3R96 A;  4H6Z A;  4FD6 A;  3TO6 A;  2BL1 A;  3BJ8 A;  4GS4 A;  2G0B A;  4XPD B;  3R95 A;  3K9U A;  1IIC A;  2OZU A;  5F49 A;  4MY3 A;  2KCW A;  3TO7 A;  2FT0 A;  3S6K A;  2B4D A;  1XE4 A;  1KUV A;  1QST A;  1L0C A;  5E96 A;  3CXQ A;  3TE4 A;  2PR1 A;  2ZPA A;  5JQ4 A;  5IV0 A;  3FIX A;  1V0C A;  2G3T A;  2VQY A;  4PK3 A;  4IF5 A;  2PRB A;  2WPX A;  3QAH A;  1SQH A;  1BO4 A;  2ATR A;  4NXY A;  5EC4 A;  3G8W A;  4B5O A;  1K4J A;  4KOW A;  3MGD A;  4M85 A;  5H84 A;  1S7L A;  2Q4Y A;  3FYN A;  2BEI A;  2BSW A;  3G3S A;  5C82 A;  1M4D A;  4U9Y A;  3S6G A;  2JLM A;  4OLL A;  4PSX A;  4HNX B;  3W91 A;  4B5P A;  4AVA A;  2P0W A;  1M44 A;  1KUY A;  4UWI A;  4E0A A;  4F0Y A;  5FVJ A;  5EBV A;  2REF A;  5J8F A;  4UA3 A;  3FXT A;  2CNT A;  3I3G A;  1MK4 A;  1P0H A;  1I21 A;  4J3G A;  2PSW A;  3RYO A;  3H4Q A;  1YVK A;  2ZW5 A;  2ZW6 A;  3DR6 A;  4KLV A;  2P6G A;  3VWD A;  2FCK A;  2OU2 A;  2Y0M A;  3R9F A;  4XNH B;  1FY7 A;  3B8G A;  2VBQ A;  2Q44 A;  4KZT A;  4AVC A;  3LOD A;  2ZXV A;  2R8V A;  4XPK A;  4Y49 C;  2JDC A;  3BJ7 A;  1Z9U A;  4XPD C;  1QSM A;  4K30 A;  3PP9 A;  4UBR A;  1GHE A;  3TCV A;  1Y7R A;  5J8C A;  1IYL A;  2A4N A;  1YGH A;  4U9Z A;  2PDO A;  4CAV A;  4JLY A;  2QIR A;  5I0C A;  4CAX A;  2CNS A;  1VHS A;  4QB9 A;  4H6U A;  4Y49 B;  2FIA A;  3SXO A;  2B58 A;  1M4I A;  2QEC A;  4DNC A;  4MY0 A;  5KTD A;  3D3S A;  4U5Y A;  2Z0Z A;  1QSN A;  3TOB A;  1P4N A;  4YRH A;  1OZP A;  2I79 A;  2VEZ A;  4UWJ A;  4OAE A;  1KZF A;  4KOV A;  5F46 A;  3GKR A;  2Z10 A;  4RI1 A;  3TFY A;  5HH1 A;  2AE6 A;  2Q04 A;  4FD5 A;  4KOY A;  4ZBG A;  1MJ9 A;  1WK4 A;  4MJ8 A;  4FD7 A;  3IGR A;  1YRE A;  2ZW4 A;  2R7H A;  3SHP A;  3P2F A;  4M3S A;  3FNC A;  4HNY B;  3W6S A;  2FIW A;  2J8N A;  2P6F A;  3JVN A;  4CRZ B;  2B3V A;  4PK2 A;  2B4B A;  1Y9W A;  1YX0 A;  2G3A A;  3ZZI A;  2CNM A;  2B3U A;  1U6M A;  2B5G B;  4KOR A;  5F48 A;  3TTH A;  4PV6 A;  4F6A A;  2IL4 A;  2F5I A;  3IWG A;  2FE7 A;  4JD6 A;  2GIV A;  3QB8 A;  1R57 A;  4LX9 A;  4R3L A;  5KTA A;  4MHD A;  1LRZ A;  2D4O A;  4XNH C;  4QVT A;  2OZH A;  1BOB A;  2C27 A;  2H5M A;  4AB7 A;  5JPH A;  2OB0 A;  2B4D B;  1S60 A;  3TOA A;  4KOS A;  4PSW A;  4XPL A;  2Z11 A;  4HKF A;  1XF8 A;  1S7K A;  4ONU A;  1XEB A;  1NSL A;  5C88 A;  3S6F A;  1YVO A;  4KVX A;  4YFJ A;  4BMH A;  1I12 A;  5CNP A;  4KVM E;  3D2P A;  4OAD A;  2R1I A;  4NF1 A;  4KLW A;  1KUX A;  4CAW A;  4H89 A;  4I49 A;  1RO5 A;  3F5B A;  1XMT A;  2HUZ A;  3TT2 A;  2OH1 A;  4JXQ A;  3DDD A;  4B5P B;  3FB3 A;  4X5K A;  2X7B A;  2PC1 A;  5F47 A;  2GE3 A;  3DR8 A;  3GY9 A;  5ISV A;  5GCN A;  3R1K A;  2HQY A;  1B87 A;  1VKC A;  4L8A A;  2FXF A;  4NCZ A;  4IUS A;  2R98 A;  3F0A A;  1MJA A;  1Z4R A;  4II9 A;  3DNS A;  4R3K A;  2OZG A;  4HNW B;  5HMN A;  3EXN A;  3GYA A;  1Q2Y A;  1S5K A;  3R9E A;  3JUW A;  2J8R A;  3EY5 A;  2K5T A;  4KOT A;  2VXK A;  1B6B A;  4R9M A;  1I1D A;  1PU9 A;  4KOU A;  4CS0 B;  4KOX A;  3F8K A;  1WWZ A;  4JWP A;  3PZJ A;  4QBJ A;  2VI7 A;  2GAN A;  2RC4 A;  4RS2 A;  3CXS A;  1UFH A;  2I00 A;  3VWE A;  2VZY A;  3KKW A;  3TO9 A;  4YGO A;  1NE9 A;  4NSQ A;  5DWM A;  1J4J A;  1YK3 A;  4NEX A;  2NMT A;  2O28 A;  1S7N A;  3E0K A;  3FRM A;  1CJW A;  1QSO A;  4KUA A;  4E8O A;  4KVO E;  1TIQ A;  2Q0Y A;  2HV2 A;  2VZZ A;  2JDD A;  3ZJ0 A;  2FL4 A;  3T90 A; 
#chains in the Genus database with same CATH topology
 1AYE A;  2JBJ A;  1RXT A;  4EFD A;  3R9G A;  2FSR A;  4ORF A;  4IK2 A;  4AG7 A;  4TWE A;  4UIA A;  1Q2D A;  4MFQ A;  2JEV A;  2Q7B A;  4CYP A;  1IYK A;  5H86 A;  3N7Z A;  5ELY A;  3BLN A;  1YR0 A;  1QQ9 A;  2PQ8 A;  1YQE A;  4AG9 A;  3NE7 A;  1Z2L A;  2EUI A;  2REE A;  3IIB A;  2AFX A;  3I9S A;  1YLE A;  3KHZ A;  5AG5 A;  2PR8 A;  1PUA A;  2BUE A;  1S3Z A;  1Y7E A;  2D4P A;  3DLJ A;  4OID A;  2Q4Z A;  5AG6 A;  4RN7 A;  5EMI A;  3CXP A;  1CM0 A;  4KUB A;  4LUA A;  4CAE A;  4LQG A;  1IID A;  4NGT A;  3S6H A;  4MI4 A;  5IX3 A;  3PB6 X;  2P6E A;  1CP7 A;  4ONW A;  2F7V A;  3D2M A;  4EVY A;  4JJX A;  2J8M A;  3SXN A;  3EFA A;  5IB0 A;  4E2A A;  2FS5 A;  3DSB A;  4FD4 A;  4JXR A;  4NGS A;  5DS0 A;  2Z3M A;  1XRY A;  2WPW A;  2ARH A;  3BXM A;  3LD2 A;  4PXE A;  3UY5 A;  4P10 A;  1LOK A;  1S7F A;  3MRU A;  4TNU A;  5DWN A;  1N71 A;  1KWM A;  3IU1 A;  3TC8 A;  3C26 A;  4AVB A;  3NE8 A;  4A94 A;  2Q4V A;  3D68 A;  4MBU A;  3P2H A;  3IO1 A;  4QC6 A;  4NGR A;  1M4G A;  5LRK A;  3D7F A;  1NMT A;  3FBU A;  4R87 A;  5AG4 A;  3OWC A;  2XEJ A;  3PEI A;  4WWV A;  2CY2 A;  3SI1 A;  1CP6 A;  4CGN A;  2GLF A;  3EC4 A;  3PGP A;  5AG7 A;  4HPS A;  1Q2C A;  1XIX A;  5ISV A;  2QML A;  2DXQ A;  1Y9K A;  3D8P A;  1ELM P;  3GLJ A;  2DPS A;  4L89 A;  3V8I A;  4OC0 A;  4UEZ A;  2J9A A;  4M6I A;  2HC9 A;  1ELL P;  2QJ8 A;  4R57 A;  1XOV A;  2GU2 A;  3GUX A;  3SJX A;  3KQX A;  2AJ6 A;  4MRI A;  1ON0 A;  4MFP A;  5D29 A;  2ZOG A;  3HUV A;  1MJB A;  5G1Z A;  3WR7 A;  4P44 A;  4P4E A;  5K8N A;  2ZW7 A;  3IU2 A;  1HDU A;  3T9Y A;  2B5G A;  4QUS A;  3W6X A;  4ZGY B;  2V8D A;  4AXV A;  4CYO A;  2QYV A;  2ZEM A;  3EO4 A;  1IB1 E;  3IWW A;  2EVN A;  1Z4E A;  1M1D A;  3PB8 X;  2PVW A;  4MHP A;  4NGM A;  5LYD A;  4CRY B;  5KTC A;  4BD9 A;  1QSR A;  2PJB A;  4LQ6 A;  3R96 A;  4Q38 A;  4H6Z A;  4A32 A;  4B10 A;  2Z3P A;  3H5Z A;  4P4J A;  1DTD A;  3RNZ A;  4WJB A;  4FD6 A;  4IHM A;  4Q36 A;  1YSJ A;  5CPA A;  3TO6 A;  2BL1 A;  1QMU A;  3BJ8 A;  2IMO A;  2G0B A;  4GS4 A;  2ABZ A;  4XPD B;  1R3N A;  3R95 A;  1AUG A;  4B12 A;  3K9U A;  1IIC A;  2OZU A;  5F49 A;  2PRQ A;  1GYT A;  2PCU A;  4MY3 A;  2Z3K A;  2KCW A;  2YNC C;  3TO7 A;  2FT0 A;  2AFO A;  3S6K A;  1LAP A;  2B4D A;  1XE4 A;  1KUV A;  4B6Z A;  4EWT A;  3FEE A;  3V7Z A;  5LYI A;  4CPA A;  2WZN A;  1QST A;  1L0C A;  5E96 A;  5I4M A;  3S9L A;  4DUK A;  3VH9 A;  3CXQ A;  3TE4 A;  2XEG A;  1ZG8 A;  2PR1 A;  4R8F A;  5THW A;  3V38 A;  2ZPA A;  2PIY A;  5JQ4 A;  5IV0 A;  3FIX A;  5BWA B;  1IGB A;  1V0C A;  2C6G A;  2G3T A;  2VQY A;  2POK A;  2V77 A;  4ZY0 A;  1HEE A;  4PK3 A;  2ODF A;  4IF5 A;  2PRB A;  4KSA A;  2V8H A;  4P4D A;  3NH8 A;  3NFZ A;  2WPX A;  3QAH A;  4CGM A;  2ZEP A;  2BO9 A;  3S9N A;  1SQH A;  2AFW A;  4UFV A;  1BO4 A;  2ATR A;  4PXD A;  2IQ6 A;  3I1U A;  3IWE A;  4NXY A;  4PXB A;  5EC4 A;  3D7G A;  3G8W A;  4B5O A;  2AFS A;  1K4J A;  2C6P A;  1Z8X A;  4KOW A;  3BI1 A;  4MFK A;  3MGD A;  4OIW A;  3IC1 A;  4P6Y A;  4PPZ A;  3L2N A;  4M85 A;  3BHX A;  1TF9 A;  4OC4 A;  5H84 A;  1S7L A;  2Q4Y A;  3FYN A;  4BIN A;  4R6T A;  2BEI A;  2BSW A;  2NSM A;  4A38 A;  3G3S A;  5C82 A;  1M4D A;  1A2Z A;  1CPX A;  1HDQ A;  4H2K A;  4U9Y A;  3S6G A;  2JLM A;  4OLL A;  4PSX A;  3SJF A;  4UFW A;  2AFU A;  3ISZ A;  3PBE A;  4HNX B;  3W91 A;  2PJC A;  4AVA A;  4B5P A;  4M6H A;  3B7I A;  3H8E A;  4G1P A;  2P0W A;  1LAN A;  1M44 A;  1KUY A;  2PJ0 A;  4UWI A;  4E0A A;  4R7M A;  4EME A;  4F0Y A;  5FVJ A;  5EBV A;  3KHX A;  3LMS A;  2REF A;  2I3C A;  1YW4 A;  2IJZ A;  5J8F A;  4UA3 A;  1Y0R A;  2PJ5 A;  3FXT A;  2CNT A;  3I3G A;  4F9U A;  1MK4 A;  1P0H A;  1FNO A;  1I21 A;  3PB9 X;  4J3G A;  2PSW A;  3B3S A;  3RYO A;  3H4Q A;  2HB6 A;  1YVK A;  1ZG9 A;  2JEW A;  4NGN A;  4P45 A;  2YGW A;  4C7I A;  2ZW5 A;  3S9M A;  4RUH A;  2JBK A;  2BOA A;  2ZW6 A;  3DR6 A;  4UIB A;  4KLV A;  3JRU A;  2P6G A;  1Z8L A;  2FCK A;  3VWD A;  2VL1 A;  2OU2 A;  1BAV A;  2Y0M A;  3KZW A;  3R9F A;  4XNH B;  4NGQ A;  2PJ2 A;  3CPA A;  4C2X A;  2EWB A;  1FY7 A;  3B8G A;  3D7D A;  2VBQ A;  2Q44 A;  4UFX A;  2PIZ A;  4KZT A;  1VHO A;  4B14 A;  4CYN A;  2DEA A;  4UEF A;  1LFW A;  4AVC A;  5K8M A;  2RB7 A;  3D67 A;  4MXU A;  4DYO A;  3LOD A;  4CGP A;  2ZXV A;  2OOT A;  3WT4 A;  1ZG7 A;  2R8V A;  2ZEF A;  4XPK A;  1RTQ A;  4Y49 C;  4A2Z A;  2JDC A;  4UCP A;  2PJ1 A;  2XEF A;  3GIU A;  3BJ7 A;  1Z5R A;  1Z9U A;  4XPD C;  4X2T A;  1QSM A;  2C1C A;  2C6C A;  4K30 A;  3PP9 A;  3T8W A;  4UBR A;  1GHE A;  3TCV A;  1Y7R A;  1ARM A;  2V8G A;  1M4L A;  4GXH A;  5J8C A;  1IYL A;  2A4N A;  5HVF A;  1IOF A;  1YGH A;  2ZEG A;  3WC5 A;  4U9Z A;  2PDO A;  4CAV A;  1TXR A;  4JLY A;  2QIR A;  2YNC A;  5I0C A;  4A39 A;  2PVV A;  4CAX A;  3JTK A;  2CNS A;  1CG2 A;  1VHS A;  4QB9 A;  5F09 A;  4H6U A;  4KSF A;  1YW6 A;  2CF4 A;  3B2Y A;  5IB9 A;  4Y49 B;  4Q7A A;  2FIA A;  3SXO A;  4M6G A;  2Q51 A;  2ANP A;  2B58 A;  5HXD A;  1F57 A;  1YLO A;  4UCM A;  1M4I A;  2QEC A;  2RFH A;  5JH9 A;  4DNC A;  5G21 A;  4MY0 A;  2O53 A;  5KTD A;  3D3S A;  4U5Y A;  1BLL E;  1QSN A;  2Z0Z A;  3TOB A;  4ZYQ A;  3KAS A;  4A31 A;  4JZ0 A;  1P4N A;  4YRH A;  1OZP A;  2I79 A;  2VEZ A;  1AMP A;  2EBJ A;  4IAV A;  4OC3 A;  2CIJ A;  4UWJ A;  4OAE A;  1KZF A;  4KOV A;  5F46 A;  3HLP A;  3FED A;  3NH4 A;  4MFZ A;  3GKR A;  2Z10 A;  4OC2 A;  4RI1 A;  4C2Y A;  3TFY A;  5HH1 A;  2Q7S A;  2PJ9 A;  2AE6 A;  2Q04 A;  4FD5 A;  2PE3 A;  4KOY A;  4ZBG A;  3CPX A;  1MJ9 A;  5K8O A;  5G20 A;  1WK4 A;  4F9V A;  4MJ8 A;  4FD7 A;  4DJL A;  4A33 A;  3IGR A;  5JM6 A;  1YRE A;  2ZW4 A;  2ZEH A;  2R7H A;  3SHP A;  3B3V A;  4MCR A;  3KGQ A;  2V8V A;  3P2F A;  1F2O A;  4O23 A;  4YU9 A;  4A30 A;  4M3S A;  3FNC A;  4HNY B;  3W6S A;  1EE3 P;  2FIW A;  2J8N A;  2EK9 A;  2P6F A;  3JVN A;  3KQZ A;  1LAM A;  3FMC A;  4CRZ B;  2B3V A;  3KR5 A;  4B13 A;  4NGP A;  1Q7L A;  2YNE A;  5AGE A;  4PK2 A;  4KSI A;  2B4B A;  1Y9W A;  1YX0 A;  2G3A A;  3ZZI A;  7CPA A;  2CNM A;  4OC5 A;  2B3U A;  1U6M A;  8CPA A;  3FH4 A;  2B5G B;  4KOR A;  5F48 A;  3VAT A;  3TTH A;  4ZX8 A;  2PJ3 A;  4PV6 A;  4F6A A;  3B3T A;  1ZLI A;  3D7H A;  4P4B A;  2IL4 A;  3CDX A;  1VHE A;  4R76 A;  5LRG A;  1IOI A;  2F5I A;  3IWG A;  2FE7 A;  4JD6 A;  2GIV A;  2Z3O A;  3QB8 A;  4W9Y A;  1R57 A;  3KL9 A;  4NFR A;  3MN8 A;  4LX9 A;  4FWU A;  4R3L A;  3LAC A;  5KTA A;  3K9T A;  2OR4 A;  2WYR A;  2PJ8 A;  4MHD A;  1LRZ A;  1NSA A;  4K3N A;  4MCP A;  2D4O A;  4XNH C;  2AFZ A;  2OZH A;  4QVT A;  1BPM A;  3FJU A;  1BOB A;  2C27 A;  2H5M A;  4AB7 A;  5JPH A;  4OME A;  2OB0 A;  2O4H A;  4C7H A;  1ZO0 A;  3PB7 X;  1VIX A;  2B4D B;  4ZX9 A;  3WAB A;  2CXA A;  1S60 A;  2Q43 A;  3CT9 A;  4KOS A;  4PSW A;  4XPL A;  1Z8T A;  3SJG A;  3TOA A;  2Z11 A;  4CAF A;  5HVH A;  1Z8W A;  3WC6 A;  2AFM A;  2PJ4 A;  2ZEO A;  1XFO A;  4HKF A;  2BCO A;  4FUU A;  1XF8 A;  1JQG A;  4GM5 A;  5D8N A;  1S7K A;  3NH5 A;  4ONU A;  2FVG A;  1XEB A;  1BPN A;  1NSL A;  4OC1 A;  5C88 A;  5HVG A;  4YWY A;  3RAM A;  1CX8 A;  1DE4 C;  3S6F A;  4F0X A;  1YVO A;  4FBE A;  1ARL A;  4KVX A;  4YFJ A;  4MFL A;  1Y0Y A;  3ISX A;  4BMH A;  3B3C A;  1I12 A;  5CNP A;  4ZY2 A;  4KVM E;  2CTC A;  3D2P A;  4OAD A;  2R1I A;  2GFQ A;  1XMB A;  3CZX A;  4OP4 A;  3H8G A;  4C2Z A;  4NF1 A;  4KLW A;  1KUX A;  1IY7 A;  2PJ7 A;  4CAW A;  4MCQ A;  4H89 A;  4I49 A;  3FVL A;  1RO5 A;  3RO0 A;  4CGO A;  5K8P A;  3F5B A;  1IU8 A;  4NJQ A;  3RBU A;  1XMT A;  2HUZ A;  4NJR A;  3RZA A;  3TT2 A;  2OH1 A;  4JXQ A;  4A95 A;  3DDD A;  4B5P B;  3FB3 A;  4X5K A;  3TX8 A;  5A28 A;  2X7B A;  2PC1 A;  2QVP A;  3PB4 X;  1R43 A;  5F47 A;  3PBB A;  4PQA A;  2GE3 A;  3DR8 A;  3QNV A;  3GY9 A;  1FT7 A;  4P4I A;  4F8Z A;  1CBX A;  1X10 A;  2DF5 A;  2ZEL A;  3A9L A;  4MFJ A;  4UF4 A;  4CGL A;  2EK8 A;  5LYF A;  5LRJ A;  2CTB A;  1ZLH A;  2Z3L A;  3D4U A;  4X8I A;  4CYQ A;  1TF8 A;  3KI9 A;  5GCN A;  3H8F A;  3R1K A;  2HQY A;  1B87 A;  1VKC A;  4L8A A;  2FXF A;  2GRE A;  4NCZ A;  3SI0 A;  4IUS A;  2R98 A;  2PJA A;  1MJA A;  1TKJ A;  1Z4R A;  2ZED A;  3DNS A;  3F0A A;  4JYW A;  4ZY1 A;  4II9 A;  4C68 A;  4R3K A;  1PYT B;  2OZG A;  4HNW B;  4ZI6 A;  3BI0 A;  5HMN A;  2EO8 A;  2ZEN A;  3EXN A;  3GYA A;  1LCP A;  3K2K A;  1Q2Y A;  1S5K A;  4FAI A;  1XJO A;  2F8H A;  3R9E A;  3JUW A;  4B11 A;  2J8R A;  5A27 A;  3NA6 A;  5J1Q A;  3PFO A;  3EY5 A;  3FX6 A;  4MHN A;  2K5T A;  4KOT A;  3LWU A;  4A37 A;  2G9D A;  2VXK A;  1H8L A;  1B6B A;  1UWY A;  1X12 A;  3B35 A;  4R9M A;  2ZOF A;  2GLJ A;  1I1D A;  1JWQ A;  1PU9 A;  4KOU A;  2WSA A;  4CS0 B;  4KOX A;  4PXC A;  4UEE A;  1TKF A;  3N5F A;  3SI2 A;  1VGY A;  3F8K A;  3IFE A;  4OKO A;  3IEH A;  1WWZ A;  2NYQ A;  6CPA A;  4JWP A;  3IJ3 A;  5JGF A;  4MMO A;  4MHY A;  3WC7 A;  3PZJ A;  4Z65 A;  1TKH A;  4QBJ A;  1OBR A;  2DPT A;  2VI7 A;  2GAN A;  2Z3N A;  2RC4 A;  4MCS A;  2PJ6 A;  4RS2 A;  3KR4 A;  3VAR A;  3CXS A;  1UFH A;  2I00 A;  2YND A;  3VWE A;  2VZY A;  3KKW A;  3TO9 A;  4X3R A;  4YGO A;  1NE9 A;  4NSQ A;  5CBM A;  3FEC A;  1J4J A;  5DWM A;  5G22 A;  1YK3 A;  2XEI A;  4NEX A;  2NMT A;  4UCN A;  2O28 A;  1S7N A;  5LYL A;  2WUU A;  3E0K A;  3PFE A;  3FRM A;  1CJW A;  1QSO A;  4KUA A;  4MHZ A;  2ZEE A;  4E8O A;  4KVO E;  1CPS A;  1XBU A;  1PCA A;  3QAY A;  1F2P A;  1TIQ A;  2Q0Y A;  3PRT A;  2HV2 A;  3FF3 A;  2VZZ A;  3GB0 A;  4KS9 A;  2JDD A;  3D66 A;  1YME A;  4P4F A;  3ZJ0 A;  3DGV A;  2FL4 A;  4BBH A;  3SJE A;  3B3W A;  3T90 A; 
#chains in the Genus database with same CATH homology
 1RXT A;  3R9G A;  2FSR A;  4ORF A;  4AG7 A;  1Q2D A;  4MFQ A;  2JEV A;  2Q7B A;  4CYP A;  1IYK A;  5H86 A;  3N7Z A;  3BLN A;  1YR0 A;  2PQ8 A;  4AG9 A;  3NE7 A;  2REE A;  2EUI A;  3I9S A;  1YLE A;  5AG5 A;  2PR8 A;  1PUA A;  2BUE A;  1S3Z A;  2D4P A;  5AG6 A;  4CAE A;  3CXP A;  1CM0 A;  4KUB A;  4LUA A;  1IID A;  3S6H A;  4MI4 A;  5IX3 A;  2P6E A;  3D2M A;  4EVY A;  4JJX A;  2J8M A;  3SXN A;  3EFA A;  5IB0 A;  4E2A A;  2FS5 A;  3DSB A;  4FD4 A;  4JXR A;  2Z3M A;  2WPW A;  2ARH A;  3LD2 A;  3UY5 A;  1S7F A;  5DWN A;  1N71 A;  3IU1 A;  3C26 A;  4AVB A;  2Q4V A;  4MBU A;  3P2H A;  4QC6 A;  1M4G A;  1NMT A;  3FBU A;  4R87 A;  5AG4 A;  3OWC A;  2CY2 A;  4CGN A;  3EC4 A;  3PGP A;  5AG7 A;  1Q2C A;  1XIX A;  2QML A;  2DXQ A;  1Y9K A;  3D8P A;  3V8I A;  2DPS A;  4L89 A;  4R57 A;  2AJ6 A;  1ON0 A;  4MFP A;  5G1Z A;  1MJB A;  3WR7 A;  2ZW7 A;  3IU2 A;  3T9Y A;  2B5G A;  4QUS A;  3W6X A;  4ZGY B;  4CYO A;  3EO4 A;  1IB1 E;  4CRY B;  2EVN A;  1Z4E A;  1M1D A;  5KTC A;  1QSR A;  3R96 A;  4Q38 A;  4H6Z A;  4A32 A;  4B10 A;  2Z3P A;  3H5Z A;  4FD6 A;  4Q36 A;  3TO6 A;  2BL1 A;  3BJ8 A;  4GS4 A;  2G0B A;  4XPD B;  3R95 A;  4B12 A;  3K9U A;  1IIC A;  2OZU A;  5F49 A;  4MY3 A;  2Z3K A;  2KCW A;  2YNC C;  3TO7 A;  2FT0 A;  3S6K A;  2B4D A;  1XE4 A;  1KUV A;  1QST A;  1L0C A;  5E96 A;  3CXQ A;  3TE4 A;  2PR1 A;  2ZPA A;  5JQ4 A;  5IV0 A;  3FIX A;  5BWA B;  1V0C A;  2G3T A;  2VQY A;  4PK3 A;  4IF5 A;  2PRB A;  4KSA A;  2WPX A;  3QAH A;  4CGM A;  1SQH A;  4UFV A;  1BO4 A;  2ATR A;  3IWE A;  4NXY A;  5EC4 A;  3G8W A;  4B5O A;  1K4J A;  4KOW A;  4MFK A;  3MGD A;  4M85 A;  5H84 A;  1S7L A;  2Q4Y A;  3FYN A;  2BEI A;  2BSW A;  3G3S A;  5C82 A;  1M4D A;  4U9Y A;  3S6G A;  2JLM A;  4OLL A;  4PSX A;  4UFW A;  4HNX B;  3W91 A;  4B5P A;  4AVA A;  2P0W A;  1M44 A;  1KUY A;  4UWI A;  4E0A A;  4F0Y A;  5FVJ A;  5EBV A;  2REF A;  5J8F A;  4UA3 A;  3FXT A;  2CNT A;  3I3G A;  1MK4 A;  1P0H A;  1I21 A;  4J3G A;  2PSW A;  3RYO A;  3H4Q A;  1YVK A;  2YGW A;  4C7I A;  2ZW5 A;  2ZW6 A;  3DR6 A;  4KLV A;  2P6G A;  3VWD A;  2FCK A;  2OU2 A;  2Y0M A;  3R9F A;  4XNH B;  4C2X A;  1FY7 A;  3B8G A;  2VBQ A;  2Q44 A;  4UFX A;  4KZT A;  4B14 A;  4CYN A;  4AVC A;  3LOD A;  4CGP A;  2ZXV A;  2R8V A;  4XPK A;  4Y49 C;  4A2Z A;  2JDC A;  4UCP A;  3BJ7 A;  1Z9U A;  4XPD C;  1QSM A;  4K30 A;  3PP9 A;  4UBR A;  1GHE A;  3TCV A;  1Y7R A;  5J8C A;  1IYL A;  2A4N A;  1YGH A;  4U9Z A;  2PDO A;  4CAV A;  4JLY A;  2QIR A;  2YNC A;  5I0C A;  4CAX A;  3JTK A;  2CNS A;  1VHS A;  4QB9 A;  4H6U A;  4KSF A;  4Y49 B;  2FIA A;  3SXO A;  2B58 A;  4UCM A;  1M4I A;  2QEC A;  4DNC A;  5G21 A;  4MY0 A;  5KTD A;  3D3S A;  4U5Y A;  2Z0Z A;  1QSN A;  3TOB A;  4A31 A;  1P4N A;  4YRH A;  1OZP A;  2I79 A;  2VEZ A;  4UWJ A;  4OAE A;  1KZF A;  4KOV A;  5F46 A;  4MFZ A;  3GKR A;  2Z10 A;  4RI1 A;  4C2Y A;  3TFY A;  5HH1 A;  2AE6 A;  2Q04 A;  4FD5 A;  4KOY A;  4ZBG A;  1MJ9 A;  5G20 A;  1WK4 A;  4MJ8 A;  4FD7 A;  4A33 A;  3IGR A;  1YRE A;  2ZW4 A;  2R7H A;  3SHP A;  3P2F A;  4A30 A;  4M3S A;  3FNC A;  4HNY B;  3W6S A;  2FIW A;  2J8N A;  2P6F A;  3JVN A;  4CRZ B;  2B3V A;  4B13 A;  2YNE A;  5AGE A;  4PK2 A;  2B4B A;  1Y9W A;  1YX0 A;  2G3A A;  3ZZI A;  2CNM A;  2B3U A;  1U6M A;  2B5G B;  4KOR A;  5F48 A;  3TTH A;  4PV6 A;  4F6A A;  2IL4 A;  2F5I A;  3IWG A;  2FE7 A;  4JD6 A;  2GIV A;  2Z3O A;  3QB8 A;  1R57 A;  4LX9 A;  4R3L A;  5KTA A;  4MHD A;  1LRZ A;  2D4O A;  4XNH C;  4QVT A;  2OZH A;  1BOB A;  2C27 A;  2H5M A;  4AB7 A;  5JPH A;  2OB0 A;  4C7H A;  1ZO0 A;  2B4D B;  2CXA A;  1S60 A;  3TOA A;  4KOS A;  4PSW A;  4XPL A;  2Z11 A;  4CAF A;  4HKF A;  1XF8 A;  1S7K A;  4ONU A;  1XEB A;  1NSL A;  5C88 A;  3S6F A;  4F0X A;  1YVO A;  4KVX A;  4YFJ A;  4MFL A;  4BMH A;  1I12 A;  5CNP A;  4KVM E;  3D2P A;  4OAD A;  2R1I A;  4C2Z A;  4NF1 A;  4KLW A;  1KUX A;  4CAW A;  4H89 A;  4I49 A;  1RO5 A;  4CGO A;  3F5B A;  1XMT A;  2HUZ A;  3TT2 A;  4A95 A;  2OH1 A;  4JXQ A;  3DDD A;  4B5P B;  3FB3 A;  4X5K A;  5A28 A;  2X7B A;  2PC1 A;  5F47 A;  2GE3 A;  3DR8 A;  3GY9 A;  4MFJ A;  5ISV A;  3A9L A;  4CGL A;  2Z3L A;  4CYQ A;  5GCN A;  3R1K A;  2HQY A;  1B87 A;  1VKC A;  4L8A A;  2FXF A;  4NCZ A;  4IUS A;  2R98 A;  3F0A A;  1MJA A;  1Z4R A;  4II9 A;  3DNS A;  4C68 A;  4R3K A;  2OZG A;  4HNW B;  5HMN A;  3EXN A;  3GYA A;  1Q2Y A;  1S5K A;  3R9E A;  3JUW A;  4B11 A;  2J8R A;  5A27 A;  3EY5 A;  2K5T A;  4KOT A;  2VXK A;  1B6B A;  4R9M A;  1I1D A;  1PU9 A;  4KOU A;  2WSA A;  4CS0 B;  4KOX A;  3F8K A;  1WWZ A;  4JWP A;  3PZJ A;  4QBJ A;  2DPT A;  2VI7 A;  2GAN A;  2Z3N A;  2RC4 A;  4RS2 A;  3CXS A;  1UFH A;  2I00 A;  2YND A;  3VWE A;  2VZY A;  3KKW A;  3TO9 A;  4YGO A;  1NE9 A;  4NSQ A;  5DWM A;  1J4J A;  5G22 A;  1YK3 A;  4NEX A;  2NMT A;  4UCN A;  2O28 A;  1S7N A;  2WUU A;  3E0K A;  3FRM A;  1CJW A;  1QSO A;  4KUA A;  4E8O A;  4KVO E;  4KS9 A;  1TIQ A;  2Q0Y A;  2HV2 A;  2VZZ A;  2JDD A;  3ZJ0 A;  2FL4 A;  4BBH A;  3T90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...