2AFOA

Crystal structure of human glutaminyl cyclase at ph 8.0
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
329
structure length
321
Chain Sequence
ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutaminyl-peptide cyclotransferase
publication title Crystal structures of human glutaminyl cyclase, an enzyme responsible for protein N-terminal pyroglutamate formation
pubmed doi rcsb
source organism Homo sapiens
total genus 106
structure length 321
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2005-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2afoA00
1ZG7A 3FH4A 3DLJA 4OC4A 2Q4ZA 3KHZA 1NSAA 2NYQA 3B2YA 2EK8A 2ZEDA 2ZEHA 3WT4A 1CP6A 1R43A 4A94A 3BI0A 1CBXA 1H8LA 1XJOA 3D66A 4KSIA 1ZLHA 4ZI6A 3PEIA 4P4EA 3IO1A 4P4JA 2OR4A 4EWTA 2PVVA 1CX8A 7CPAA 4OIWA 2C1CA 1KWMA 2ZEMA 6CPAA 2ZOFA 3MN8A 1YMEA 3FMCA 4NFRA 1TKJA 2F7VA 1YLOA 4OC1A 5JGFA 4FWUA 4UIBA 2WYRA 1TKHA 2FVGA 1CP7A 2IQ6A 1BPNA 3ISZA 2PJ4A 3QNVA 3MRUA 2ZENA 1ELMP 3BXMA 3CPXA 4WWVA 2CTBA 3PBBA 5J1QA 2IJZA 4TNUA 2CTCA 2AFWA 4R7MA 4P4BA 4TWEA 3LMSA 4MHYA 3PFEA 2PJ0A 4JZ0A 4UEEA 1ARMA 3LWUA 3HLPA 5LRJA 1XMBA 3KGQA 4JYWA 1CG2A 3T8WA 3K2KA 1AMPA 3BI1A 2QJ8A 3ISXA 3L2NA 3B3WA 4RUHA 2PJ5A 5K8PA 4F9UA 2V8HA 4MCPA 5D8NA 1LANA 3CT9A 2AFMA 2WZNA 5IB9A 1ZLIA 4PXEA 3TX8A 4MMOA 4CPAA 4PXBA 4P4FA 2QYVA 4DYOA 3VARA 4OC3A 2PVWA 2C6PA 3IJ3A 4P44A 2DEAA 4X8IA 3B3VA 3KQXA 3CPAA 3D4UA 4DJLA 4G1PA 1LOKA 4W9YA 2Q43A 1BAVA 1ZG8A 4NGRA 1VGYA 2C6GA 1DTDA 3V38A 1IY7A 3WC5A 4PPZA 2GREA 4EMEA 4OKOA 3KI9A 3KL9A 2O53A 3IC1A 4OMEA 2PIYA 2XEGA 4LQGA 3PB4X 1TF9A 4NGPA 3B3TA 4MCSA 1HEEA 3PFOA 2PJ7A 1AYEA 5DS0A 2I3CA 1XBUA 4P10A 4UF4A 4Z65A 1XFOA 1LAPA 4ONWA 4P4IA 5JH9A 3CDXA 2BCOA 2PJ8A 2QVPA 1CPXA 4YWYA 2PIZA 3D7GA 5JM6A 4MRIA 3D7DA 4R6TA 3KZWA 4A39A 1Z5RA 4YU9A 2EWBA 5HVFA 5I4MA 2EK9A 2PE3A 2CIJA 5K8MA 4GM5A 4AXVA 2O4HA 4O23A 3S9LA 4UEFA 3B7IA 4B6ZA 4FBEA 1ARLA 3V7ZA 1Z2LA 1HDUA 3FX6A 3H8GA 3KHXA 3KR4A 1Q7LA 4ZX9A 2BO9A 2F8HA 4R8FA 3PB8X 3SJXA 3S9MA 1PYTB 1CPSA 4IHMA 1QQ9A 3B35A 3KR5A 2PRQA 4IAVA 2AFSA 4MHNA 5HVGA 2NSMA 2Q51A 2GLJA 2PJ2A 3B3SA 3VATA 1DE4C 3IEHA 3S9NA 1F2OA 3NH5A 4NJQA 3SJFA 3RAMA 2V8VA 3I1UA 2JBJA 2V8GA 1Y0RA 4ZX8A 4FUUA 5THWA 2JBKA 3GLJA 1BPMA 2RFHA 1HDQA 2PJ1A 1LAMA 3NH4A 4NGTA 5LYLA 3FEDA 4ZY0A 1LFWA 3JRUA 5HXDA 3DGVA 3RBUA 4MHPA 1YW4A 3D68A 2V8DA 8CPAA 5LYIA 1IGBA 4H2KA 3TC8A 2CF4A 2ZEFA 3K9TA 3WC6A 2RB7A 2ZEEA 4MHZA 3D67A 1EE3P 2XEIA 1Y0YA 4OP4A 2POKA 4UEZA 3SJEA 2PCUA 3WC7A 5LRGA 1F2PA 1GYTA 2XEFA 3SI2A 4Q7AA 4NGQA 2ZOGA 3RZAA 3FJUA 4NGNA 3D7HA 4P45A 1Z8LA 2AFUA 3N5FA 5LYFA 2PJAA 5ELYA 3D7FA 1LCPA 2PJ3A 2BOAA 3BHXA 2G9DA 2GU2A 4PQAA 3FVLA 1F57A 1TXRA 4F8ZA 2PJCA 4MXUA 4DUKA 2PJ9A 4OC5A 2AFZA 3SI1A 2IMOA 4WJBA 3FEEA 1FNOA 4R76A 1VHOA 3SI0A 4NJRA 4P4DA 3PB9X 4MCQA 3KASA 5LYDA 1ELLP 2VL1A 3VH9A 1RTQA 1YW6A 1FT7A 3NFZA 4X2TA 2C6CA 1OBRA 4EFDA 2OOTA 4BD9A 2HB6A 3FF3A 2ANPA 3FECA 1UWYA 3B3CA 5CPAA 5LRKA 1YSJA 2ABZA 4UIAA 2V77A 5K8OA 1TKFA 4ZY2A 4A37A 3PB7X 1Y7EA 3NH8A 5CBMA 1PCAA 2PJBA 3IIBA 3PRTA 3PB6X 3NA6A 4OC0A 2GLFA 2ZEPA 2AFOA 1M4LA 3KQZA 3IFEA 4IK2A 4NGSA 2J9AA 4NGMA 2ZELA 4OIDA 1XRYA 1JQGA 4MCRA 2XEJA 1VIXA 2AFXA 3HUVA 4P6YA 1R3NA 2HC9A 4ZYQA 1TF8A 3IWWA 2ZEOA 4OC2A 3H8FA 4PXDA 5D29A 4FAIA 5K8NA 5F09A 1QMUA 4K3NA 2JEWA 1BLLE 3GUXA 4A38A 3H8EA 3GB0A 2PJ6A 1ZG9A 3SJGA 3WABA 4F9VA 1VHEA 4PXCA 4X3RA 4ZY1A 3PBEA 5HVHA 2ZEGA
chains in the Genus database with same CATH superfamily
1ZG7A 2Z3LA 4KOUA 3TO6A 4KORA 3FH4A 4FD6A 5A27A 2Z3NA 5EC4A 2P6EA 3FBUA 1Y9KA 1S7FA 3DLJA 1XEBA 3PZJA 4OC4A 2Q4ZA 3KHZA 1NSAA 4AVBA 1SQHA 2NYQA 2EK8A 2ZEDA 2ZEHA 3B2YA 5G20A 3BJ7A 1U6MA 3WT4A 2FS5A 3TCVA 1CP6A 1R43A 4A94A 4CGOA 3BI0A 2B58A 1CBXA 1H8LA 3EC4A 1XJOA 5H86A 3D66A 4KSIA 3I9SA 4KOXA 1ZLHA 3W91A 4ZI6A 1JWQA 3PEIA 4P4EA 3IO1A 4ONUA 4P4JA 4GS4A 2OR4A 4EWTA 2PVVA 1CX8A 3IWEA 4UCNA 7CPAA 4OIWA 2C1CA 1KWMA 2ZEMA 5E96A 3NE8A 5KTCA 1KUYA 2ATRA 6CPAA 1IU8A 2ZOFA 2REEA 3MN8A 1QSOA 1YMEA 3FMCA 5AGEA 1VKCA 1XMTA 4NFRA 2JDDA 1TKJA 2C27A 3VWDA 2F7VA 1YLOA 1S7KA 4OC1A 2D4OA 1XIXA 2JEVA 5JGFA 2X7BA 4FWUA 4UIBA 2WYRA 1TKHA 2FVGA 4Q36A 1MJ9A 2NMTA 4CGLA 1CP7A 2IQ6A 1BPNA 3ISZA 3TT2A 2REFA 2PJ4A 3NE7A 4GXHA 2QIRA 3QNVA 3MRUA 3R1KA 2K5TA 1ELMP 2Z0ZA 2ZENA 2HUZA 4H6UA 1YLEA 2JDCA 3BXMA 3PGPA 2CY2A 3CPXA 4DNCA 4WWVA 2CTBA 2PQ8A 3PBBA 5F46A 3FXTA 2IJZA 5J1QA 4M6IA 4B13A 5J8FA 4TNUA 2CTCA 4HNXB 1P4NA 2CNTA 3SXNA 3IGRA 2AFWA 4R7MA 2Q4VA 4P4BA 4QBJA 4TWEA 4MY0A 3LMSA 4B11A 5KTAA 3CXPA 1M44A 4MHYA 2VZYA 4YGOA 3PFEA 2PJ0A 4JZ0A 2JLMA 4UEEA 1ARMA 3LWUA 4LQ6A 3HLPA 5LRJA 1XMBA 1Z8TA 4BINA 3KGQA 4JYWA 1CG2A 3T8WA 1PU9A 3K2KA 1AMPA 2BL1A 3BI1A 2QJ8A 3ISXA 1NE9A 1KUVA 1Q2DA 1V0CA 1WK4A 2J8NA 3L2NA 3B3WA 4RUHA 2PJ5A 5K8PA 4CYNA 4BMHA 2ZW5A 4RI1A 4F9UA 2V8HA 4KLWA 4MCPA 1LANA 5D8NA 3CT9A 1X12A 2R1IA 2DPTA 4XNHB 2AFMA 4B5OA 2WZNA 3DR8A 4KVME 1YGHA 1S5KA 4K30A 5IB9A 1ZLIA 4PXEA 3TO7A 3TX8A 4MMOA 5F49A 4CPAA 4PXBA 1I21A 2BEIA 2WPXA 4ORFA 4IUSA 1R57A 2WPWA 4P4FA 2DF5A 2QYVA 4DYOA 3VARA 4OC3A 2PVWA 2C6PA 3IJ3A 1NSLA 4U9ZA 1Z4EA 2A4NA 2O28A 4P44A 2DEAA 1NMTA 4KOWA 4LUAA 5I0CA 3DR6A 3QB8A 4YFJA 2OB0A 2OZHA 2CXAA 4X8IA 3N7ZA 3B3VA 3KQXA 4R87A 2HQYA 3CPAA 3D4UA 4DJLA 4G1PA 4X5KA 1LOKA 1KZFA 4W9YA 2Q43A 1BAVA 1ZG8A 4FD5A 2F5IA 4NGRA 4MFJA 1M4GA 1VGYA 1YR0A 2C6GA 2R7HA 1DTDA 3B8GA 4EVYA 3V38A 1IY7A 4ZBGA 3WC5A 4PPZA 2GREA 2RC4A 3S6KA 4EMEA 2EO8A 4PK2A 4IF5A 4OKOA 4B14A 3KI9A 3KL9A 2O53A 3IC1A 3OWCA 4OMEA 5DWMA 2PIYA 2XEGA 4JD6A 4M6HA 4LQGA 4AVAA 3PB4X 4OAEA 4XPDB 3JUWA 2FT0A 1TF9A 2FCKA 4NGPA 4NCZA 1OZPA 3B3TA 4MCSA 1HEEA 4A2ZA 4UFWA 4NSQA 3UY5A 5IX3A 3PFOA 1YVOA 2PJ7A 1AYEA 3EO4A 2I3CA 5DS0A 4CGMA 2YNEA 1XBUA 2Q4YA 3IWGA 4C7HA 4P10A 4CYOA 1BO4A 1IOFA 4C2XA 4UF4A 4Z65A 4UA3A 1XFOA 1LAPA 4ONWA 4P4IA 3V8IA 5JH9A 3CDXA 4MHDA 2B4BA 2Q0YA 2BCOA 3EY5A 3MGDA 3SXOA 4Y49B 2PJ8A 2YNCC 4F6AA 2QVPA 2Y0MA 4CAVA 2PSWA 1CPXA 4YWYA 2PIZA 3D7GA 3H4QA 2ZW4A 5JM6A 4MRIA 3TOBA 2H5MA 3FRMA 3D7DA 2Q7BA 4B10A 4PK3A 4YRHA 1TIQA 4R6TA 3KZWA 4A39A 1B6BA 1Z5RA 1B87A 4KUBA 4YU9A 2EWBA 3SHPA 2AJ6A 4B5PB 5HVFA 1YREA 5I4MA 2EK9A 2PE3A 4CRYB 2CIJA 5K8MA 5AG7A 2CNMA 4GM5A 1J4JA 4QUSA 5CNPA 4AXVA 4JWPA 2O4HA 4O23A 3S9LA 3F8KA 4UEFA 3B7IA 2CNSA 5F47A 4B6ZA 5IV0A 2ZXVA 4CAWA 3IU2A 2DXQA 3F5BA 5BWAB 1IYKA 1QSRA 2B4DA 4FBEA 2G3TA 2B4DB 1ARLA 3A9LA 4R3LA 3V7ZA 4II9A 2IL4A 1Z2LA 1HDUA 5JQ4A 1LRZA 4OLLA 4MFQA 3FX6A 3H8GA 3KHXA 3KR4A 1Q7LA 4XPLA 4ZX9A 3T90A 3TO9A 2BO9A 2PDOA 2B5GA 4HPSA 4E0AA 3IU1A 2F8HA 4R8FA 2B5GB 3GIUA 3PB8X 5AG5A 1IIDA 3DSBA 3SJXA 3S9MA 1PYTB 4KS9A 1RXTA 4CGNA 3GKRA 4U5YA 3R9FA 2P0WA 1CPSA 1Y9WA 4IHMA 1QQ9A 1MK4A 2I79A 5F48A 3B35A 5JPHA 3KR5A 2PRQA 4JJXA 4CRZB 3JTKA 4RS2A 3K9UA 4IAVA 2DPSA 2AFSA 4MHNA 5HVGA 2NSMA 2Q51A 2WUUA 4UCMA 2Q04A 4A33A 2GLJA 2PJ2A 4A32A 3KKWA 5AG6A 1M1DA 3B3SA 3GYAA 1DE4C 3VATA 4CAXA 4L8AA 3IEHA 4ZGYB 3S9NA 4CYQA 4M85A 1F2OA 3NH5A 4NJQA 4H89A 1L0CA 3SJFA 4F0YA 4KVOE 3RAMA 2V8VA 3I1UA 2JBJA 2V8GA 4PSWA 1Y0RA 4Q38A 4C2YA 5G21A 4ZX8A 4FUUA 4L89A 5THWA 2JBKA 1VHSA 3GLJA 3D8PA 1BPMA 1CM0A 1K4JA 1M4IA 2RFHA 1MJAA 1P0HA 4HNYB 1HDQA 2PJ1A 1LAMA 4C7IA 3NH4A 4NGTA 5LYLA 3FEDA 4ZY0A 1MJBA 2BUEA 2J8RA 1LFWA 3JRUA 5G22A 3CXSA 3VWEA 1S60A 4R57A 4A31A 5HXDA 1S3ZA 3TFYA 2P6FA 3DGVA 1CJWA 3RBUA 4MHPA 3S6FA 3F0AA 5A28A 3G8WA 4CGPA 3LD2A 2FXFA 1YW4A 3FNCA 4J3GA 3D68A 4MFZA 1ZO0A 2V8DA 4C2ZA 8CPAA 3G3SA 2OZUA 5LYIA 1IGBA 4H2KA 3TC8A 2QMLA 2CF4A 4NEXA 4FD4A 4A38A 2ZEFA 3K9TA 3WC6A 2RB7A 1IOIA 2ZEEA 2Z11A 2EUIA 4MHZA 3D67A 1EE3P 5J8CA 1YVKA 3DDDA 2XEIA 3D3SA 1Y0YA 4OP4A 2POKA 2ZPAA 2R8VA 2ZW6A 2VZZA 2PC1A 4UEZA 2Z3MA 4CAEA 3JVNA 4JXQA 3SJEA 2PCUA 4KOTA 1Q2CA 2Q44A 3D2PA 3WC7A 3RYOA 5LRGA 5C82A 1F2PA 1GYTA 4AG7A 5C88A 5ISVA 2XEFA 3SI2A 2FIAA 1Q2YA 3R96A 4E2AA 4Q7AA 1Z9UA 1RO5A 4NGQA 2ZOGA 2FSRA 3RZAA 3FJUA 4M3SA 3QAHA 4NXYA 3D7HA 4NGNA 4P45A 4AB7A 1KUXA 2ODFA 4UWIA 1Z8LA 2AFUA 3S6HA 3N5FA 1PUAA 2OU2A 5LYFA 1I1DA 1X10A 2PRBA 3R95A 4M6GA 2PR1A 4KSFA 4RN7A 2I00A 2PJAA 3GY9A 2EBJA 4KZTA 3DNSA 2VI7A 5FVJA 5ELYA 4QB9A 3D7FA 5GCNA 1LCPA 2PJ3A 2BOAA 3FB3A 3LACA 4NF1A 3BHXA 4JXRA 3RO0A 4XPKA 4B5PA 4KOYA 4MFKA 4MJ8A 2B3VA 2G9DA 2GU2A 4KVXA 4PQAA 1FY7A 1IICA 3FVLA 1UFHA 1F57A 1TXRA 4F8ZA 2PJCA 2EVNA 2ZW7A 4MXUA 3P2HA 1QSNA 4DUKA 2OH1A 2PJ9A 4OC5A 2AFZA 3SI1A 2YNDA 1GHEA 4XNHC 2IMOA 4WJBA 2GANA 2R98A 1FNOA 3FEEA 4R76A 5AG4A 2BSWA 1VHOA 1Z8WA 3SI0A 1A2ZA 4LX9A 4NJRA 2Z10A 4AVCA 4P4DA 3PB9X 1YX0A 2OZGA 3EXNA 4MCQA 3KASA 5LYDA 4UWJA 4CS0B 1ELLP 3D2MA 2B3UA 2FIWA 3FYNA 2VL1A 4HNWB 4PV6A 3VH9A 2GE3A 3I3GA 1RTQA 3EFAA 2AE6A 2YNCA 1YW6A 1FT7A 3NFZA 4X2TA 5EMIA 2G3AA 3C26A 2C6CA 4KOSA 1OBRA 2Z3PA 3ZJ0A 1YK3A 4EFDA 2OOTA 1AUGA 1YQEA 1XE4A 1Z4RA 2HB6A 3FF3A 4BD9A 4KUAA 2ANPA 3FECA 1UWYA 3CXQA 4UBRA 1Y7RA 1QSMA 3B3CA 4I49A 3R9EA 1N71A 3PP9A 4KSAA 2J8MA 4OADA 4KOVA 5CPAA 5LRKA 3RNZA 2Z3OA 3W6SA 1YSJA 2ABZA 4UIAA 2V77A 5K8OA 1TKFA 4ZY2A 1IYLA 4HKFA 4C68A 2KCWA 4PSXA 2Q7SA 2G0BA 4A30A 2VQYA 4A37A 3PB7X 1Y7EA 3NH8A 3TTHA 1PCAA 2PJBA 5CBMA 3IIBA 3FIXA 3PRTA 3PB6X 4XPDC 3CZXA 1IB1E 2P6GA 4MFLA 3S6GA 3NA6A 4OC0A 2GLFA 2ZEPA 3T9YA 3ZZIA 2AFOA 1M4LA 4H6ZA 2VXKA 3LODA 4JLYA 4QVTA 2FE7A 3KQZA 3IFEA 1XF8A 4IK2A 2ARHA 4NGSA 1I12A 2J9AA 4UFVA 4CAFA 4NGMA 5EBVA 5HMNA 3E0KA 4U9YA 2ZELA 3P2FA 4BBHA 4OIDA 1XRYA 3BJ8A 1JQGA 4MCRA 4R9MA 5G1ZA 2XEJA 5H84A 1VIXA 3QAYA 4KLVA 4AG9A 2AFXA 4MI4A 2WSAA 3BLNA 3HUVA 4P6YA 1M4DA 4R3KA 3TOAA 1R3NA 2HC9A 3WR7A 4Y49C 3W6XA 1TF8A 3IWWA 4B12A 4ZYQA 1BOBA 2VEZA 2ZEOA 4OC2A 3H8FA 4PXDA 3TE4A 2FL4A 4UFXA 5D29A 4CYPA 4FAIA 5K8NA 4MY3A 5F09A 5HH1A 1QMUA 1WWZA 4A95A 4K3NA 4E8OA 4MFPA 4UCPA 2HV2A 1BLLE 2JEWA 2YGWA 2QECA 3GUXA 3GB0A 2PJ6A 1ZG9A 1S7LA 1S7NA 3H8EA 3R9GA 3SJGA 4QC6A 3WABA 2GFQA 4F9VA 1QSTA 1VHEA 4PXCA 4X3RA 2Z3KA 1XOVA 1Z8XA 4ZY1A 1ON0A 3PBEA 2GIVA 3H5ZA 2D4PA 5DWNA 5IB0A 5HVHA 4FD7A 2PR8A 4F0XA 5KTDA 4MBUA 2VBQA 2ZEGA
chains in the Genus database with same CATH topology
1ZG7A 3FH4A 3DLJA 4OC4A 2Q4ZA 3KHZA 1NSAA 2NYQA 3B2YA 2EK8A 2ZEDA 2ZEHA 3WT4A 1CP6A 1R43A 4A94A 3BI0A 1CBXA 1H8LA 1XJOA 3D66A 4KSIA 1ZLHA 4ZI6A 3PEIA 4P4EA 3IO1A 4P4JA 2OR4A 4EWTA 2PVVA 1CX8A 7CPAA 4OIWA 2C1CA 1KWMA 2ZEMA 6CPAA 2ZOFA 3MN8A 1YMEA 3FMCA 4NFRA 1TKJA 2F7VA 1YLOA 4OC1A 5JGFA 4FWUA 4UIBA 2WYRA 1TKHA 2FVGA 1CP7A 2IQ6A 1BPNA 3ISZA 2PJ4A 3QNVA 3MRUA 2ZENA 1ELMP 3BXMA 3CPXA 4WWVA 2CTBA 3PBBA 5J1QA 2IJZA 4TNUA 2CTCA 2AFWA 4R7MA 4P4BA 4TWEA 3LMSA 4MHYA 3PFEA 2PJ0A 4JZ0A 4UEEA 1ARMA 3LWUA 3HLPA 5LRJA 1XMBA 3KGQA 4JYWA 1CG2A 3T8WA 3K2KA 1AMPA 3BI1A 2QJ8A 3ISXA 3L2NA 3B3WA 4RUHA 2PJ5A 5K8PA 4F9UA 2V8HA 4MCPA 5D8NA 1LANA 3CT9A 2AFMA 2WZNA 5IB9A 1ZLIA 4PXEA 3TX8A 4MMOA 4CPAA 4PXBA 4P4FA 2QYVA 4DYOA 3VARA 4OC3A 2PVWA 2C6PA 3IJ3A 4P44A 2DEAA 4X8IA 3B3VA 3KQXA 3CPAA 3D4UA 4DJLA 4G1PA 1LOKA 4W9YA 2Q43A 1BAVA 1ZG8A 4NGRA 1VGYA 2C6GA 1DTDA 3V38A 1IY7A 3WC5A 4PPZA 2GREA 4EMEA 4OKOA 3KI9A 3KL9A 2O53A 3IC1A 4OMEA 2PIYA 2XEGA 4LQGA 3PB4X 1TF9A 4NGPA 3B3TA 4MCSA 1HEEA 3PFOA 2PJ7A 1AYEA 5DS0A 2I3CA 1XBUA 4P10A 4UF4A 4Z65A 1XFOA 1LAPA 4ONWA 4P4IA 5JH9A 3CDXA 2BCOA 2PJ8A 2QVPA 1CPXA 4YWYA 2PIZA 3D7GA 5JM6A 4MRIA 3D7DA 4R6TA 3KZWA 4A39A 1Z5RA 4YU9A 2EWBA 5HVFA 5I4MA 2EK9A 2PE3A 2CIJA 5K8MA 4GM5A 4AXVA 2O4HA 4O23A 3S9LA 4UEFA 3B7IA 4B6ZA 4FBEA 1ARLA 3V7ZA 1Z2LA 1HDUA 3FX6A 3H8GA 3KHXA 3KR4A 1Q7LA 4ZX9A 2BO9A 2F8HA 4R8FA 3PB8X 3SJXA 3S9MA 1PYTB 1CPSA 4IHMA 1QQ9A 3B35A 3KR5A 2PRQA 4IAVA 2AFSA 4MHNA 5HVGA 2NSMA 2Q51A 2GLJA 2PJ2A 3B3SA 3VATA 1DE4C 3IEHA 3S9NA 1F2OA 3NH5A 4NJQA 3SJFA 3RAMA 2V8VA 3I1UA 2JBJA 2V8GA 1Y0RA 4ZX8A 4FUUA 5THWA 2JBKA 3GLJA 1BPMA 2RFHA 1HDQA 2PJ1A 1LAMA 3NH4A 4NGTA 5LYLA 3FEDA 4ZY0A 1LFWA 3JRUA 5HXDA 3DGVA 3RBUA 4MHPA 1YW4A 3D68A 2V8DA 8CPAA 5LYIA 1IGBA 4H2KA 3TC8A 2CF4A 2ZEFA 3K9TA 3WC6A 2RB7A 2ZEEA 4MHZA 3D67A 1EE3P 2XEIA 1Y0YA 4OP4A 2POKA 4UEZA 3SJEA 2PCUA 3WC7A 5LRGA 1F2PA 1GYTA 2XEFA 3SI2A 4Q7AA 4NGQA 2ZOGA 3RZAA 3FJUA 4NGNA 3D7HA 4P45A 1Z8LA 2AFUA 3N5FA 5LYFA 2PJAA 5ELYA 3D7FA 1LCPA 2PJ3A 2BOAA 3BHXA 2G9DA 2GU2A 4PQAA 3FVLA 1F57A 1TXRA 4F8ZA 2PJCA 4MXUA 4DUKA 2PJ9A 4OC5A 2AFZA 3SI1A 2IMOA 4WJBA 3FEEA 1FNOA 4R76A 1VHOA 3SI0A 4NJRA 4P4DA 3PB9X 4MCQA 3KASA 5LYDA 1ELLP 2VL1A 3VH9A 1RTQA 1YW6A 1FT7A 3NFZA 4X2TA 2C6CA 1OBRA 4EFDA 2OOTA 4BD9A 2HB6A 3FF3A 2ANPA 3FECA 1UWYA 3B3CA 5CPAA 5LRKA 1YSJA 2ABZA 4UIAA 2V77A 5K8OA 1TKFA 4ZY2A 4A37A 3PB7X 1Y7EA 3NH8A 5CBMA 1PCAA 2PJBA 3IIBA 3PRTA 3PB6X 3NA6A 4OC0A 2GLFA 2ZEPA 2AFOA 1M4LA 3KQZA 3IFEA 4IK2A 4NGSA 2J9AA 4NGMA 2ZELA 4OIDA 1XRYA 1JQGA 4MCRA 2XEJA 1VIXA 2AFXA 3HUVA 4P6YA 1R3NA 2HC9A 4ZYQA 1TF8A 3IWWA 2ZEOA 4OC2A 3H8FA 4PXDA 5D29A 4FAIA 5K8NA 5F09A 1QMUA 4K3NA 2JEWA 1BLLE 3GUXA 4A38A 3H8EA 3GB0A 2PJ6A 1ZG9A 3SJGA 3WABA 4F9VA 1VHEA 4PXCA 4X3RA 4ZY1A 3PBEA 5HVHA 2ZEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZG7 A;  3FH4 A;  3DLJ A;  4OC4 A;  2Q4Z A;  3KHZ A;  1NSA A;  2NYQ A;  3B2Y A;  2EK8 A;  2ZED A;  2ZEH A;  3WT4 A;  1CP6 A;  1R43 A;  4A94 A;  3BI0 A;  1CBX A;  1H8L A;  1XJO A;  3D66 A;  4KSI A;  1ZLH A;  4ZI6 A;  3PEI A;  4P4E A;  3IO1 A;  4P4J A;  2OR4 A;  4EWT A;  2PVV A;  1CX8 A;  7CPA A;  4OIW A;  2C1C A;  1KWM A;  2ZEM A;  6CPA A;  2ZOF A;  3MN8 A;  1YME A;  3FMC A;  4NFR A;  1TKJ A;  2F7V A;  1YLO A;  4OC1 A;  5JGF A;  4FWU A;  4UIB A;  2WYR A;  1TKH A;  2FVG A;  1CP7 A;  2IQ6 A;  1BPN A;  3ISZ A;  2PJ4 A;  3QNV A;  3MRU A;  2ZEN A;  1ELM P;  3BXM A;  3CPX A;  4WWV A;  2CTB A;  3PBB A;  5J1Q A;  2IJZ A;  4TNU A;  2CTC A;  2AFW A;  4R7M A;  4P4B A;  4TWE A;  3LMS A;  4MHY A;  3PFE A;  2PJ0 A;  4JZ0 A;  4UEE A;  1ARM A;  3LWU A;  3HLP A;  5LRJ A;  1XMB A;  3KGQ A;  4JYW A;  1CG2 A;  3T8W A;  3K2K A;  1AMP A;  3BI1 A;  2QJ8 A;  3ISX A;  3L2N A;  3B3W A;  4RUH A;  2PJ5 A;  5K8P A;  4F9U A;  2V8H A;  4MCP A;  5D8N A;  1LAN A;  3CT9 A;  2AFM A;  2WZN A;  5IB9 A;  1ZLI A;  4PXE A;  3TX8 A;  4MMO A;  4CPA A;  4PXB A;  4P4F A;  2QYV A;  4DYO A;  3VAR A;  4OC3 A;  2PVW A;  2C6P A;  3IJ3 A;  4P44 A;  2DEA A;  4X8I A;  3B3V A;  3KQX A;  3CPA A;  3D4U A;  4DJL A;  4G1P A;  1LOK A;  4W9Y A;  2Q43 A;  1BAV A;  1ZG8 A;  4NGR A;  1VGY A;  2C6G A;  1DTD A;  3V38 A;  1IY7 A;  3WC5 A;  4PPZ A;  2GRE A;  4EME A;  4OKO A;  3KI9 A;  3KL9 A;  2O53 A;  3IC1 A;  4OME A;  2PIY A;  2XEG A;  4LQG A;  3PB4 X;  1TF9 A;  4NGP A;  3B3T A;  4MCS A;  1HEE A;  3PFO A;  2PJ7 A;  1AYE A;  5DS0 A;  2I3C A;  1XBU A;  4P10 A;  4UF4 A;  4Z65 A;  1XFO A;  1LAP A;  4ONW A;  4P4I A;  5JH9 A;  3CDX A;  2BCO A;  2PJ8 A;  2QVP A;  1CPX A;  4YWY A;  2PIZ A;  3D7G A;  5JM6 A;  4MRI A;  3D7D A;  4R6T A;  3KZW A;  4A39 A;  1Z5R A;  4YU9 A;  2EWB A;  5HVF A;  5I4M A;  2EK9 A;  2PE3 A;  2CIJ A;  5K8M A;  4GM5 A;  4AXV A;  2O4H A;  4O23 A;  3S9L A;  4UEF A;  3B7I A;  4B6Z A;  4FBE A;  1ARL A;  3V7Z A;  1Z2L A;  1HDU A;  3FX6 A;  3H8G A;  3KHX A;  3KR4 A;  1Q7L A;  4ZX9 A;  2BO9 A;  2F8H A;  4R8F A;  3PB8 X;  3SJX A;  3S9M A;  1PYT B;  1CPS A;  4IHM A;  1QQ9 A;  3B35 A;  3KR5 A;  2PRQ A;  4IAV A;  2AFS A;  4MHN A;  5HVG A;  2NSM A;  2Q51 A;  2GLJ A;  2PJ2 A;  3B3S A;  3VAT A;  1DE4 C;  3IEH A;  3S9N A;  1F2O A;  3NH5 A;  4NJQ A;  3SJF A;  3RAM A;  2V8V A;  3I1U A;  2JBJ A;  2V8G A;  1Y0R A;  4ZX8 A;  4FUU A;  5THW A;  2JBK A;  3GLJ A;  1BPM A;  2RFH A;  1HDQ A;  2PJ1 A;  1LAM A;  3NH4 A;  4NGT A;  5LYL A;  3FED A;  4ZY0 A;  1LFW A;  3JRU A;  5HXD A;  3DGV A;  3RBU A;  4MHP A;  1YW4 A;  3D68 A;  2V8D A;  8CPA A;  5LYI A;  1IGB A;  4H2K A;  3TC8 A;  2CF4 A;  2ZEF A;  3K9T A;  3WC6 A;  2RB7 A;  2ZEE A;  4MHZ A;  3D67 A;  1EE3 P;  2XEI A;  1Y0Y A;  4OP4 A;  2POK A;  4UEZ A;  3SJE A;  2PCU A;  3WC7 A;  5LRG A;  1F2P A;  1GYT A;  2XEF A;  3SI2 A;  4Q7A A;  4NGQ A;  2ZOG A;  3RZA A;  3FJU A;  4NGN A;  3D7H A;  4P45 A;  1Z8L A;  2AFU A;  3N5F A;  5LYF A;  2PJA A;  5ELY A;  3D7F A;  1LCP A;  2PJ3 A;  2BOA A;  3BHX A;  2G9D A;  2GU2 A;  4PQA A;  3FVL A;  1F57 A;  1TXR A;  4F8Z A;  2PJC A;  4MXU A;  4DUK A;  2PJ9 A;  4OC5 A;  2AFZ A;  3SI1 A;  2IMO A;  4WJB A;  3FEE A;  1FNO A;  4R76 A;  1VHO A;  3SI0 A;  4NJR A;  4P4D A;  3PB9 X;  4MCQ A;  3KAS A;  5LYD A;  1ELL P;  2VL1 A;  3VH9 A;  1RTQ A;  1YW6 A;  1FT7 A;  3NFZ A;  4X2T A;  2C6C A;  1OBR A;  4EFD A;  2OOT A;  4BD9 A;  2HB6 A;  3FF3 A;  2ANP A;  3FEC A;  1UWY A;  3B3C A;  5CPA A;  5LRK A;  1YSJ A;  2ABZ A;  4UIA A;  2V77 A;  5K8O A;  1TKF A;  4ZY2 A;  4A37 A;  3PB7 X;  1Y7E A;  3NH8 A;  5CBM A;  1PCA A;  2PJB A;  3IIB A;  3PRT A;  3PB6 X;  3NA6 A;  4OC0 A;  2GLF A;  2ZEP A;  2AFO A;  1M4L A;  3KQZ A;  3IFE A;  4IK2 A;  4NGS A;  2J9A A;  4NGM A;  2ZEL A;  4OID A;  1XRY A;  1JQG A;  4MCR A;  2XEJ A;  1VIX A;  2AFX A;  3HUV A;  4P6Y A;  1R3N A;  2HC9 A;  4ZYQ A;  1TF8 A;  3IWW A;  2ZEO A;  4OC2 A;  3H8F A;  4PXD A;  5D29 A;  4FAI A;  5K8N A;  5F09 A;  1QMU A;  4K3N A;  2JEW A;  1BLL E;  3GUX A;  4A38 A;  3H8E A;  3GB0 A;  2PJ6 A;  1ZG9 A;  3SJG A;  3WAB A;  4F9V A;  1VHE A;  4PXC A;  4X3R A;  4ZY1 A;  3PBE A;  5HVH A;  2ZEG A; 
#chains in the Genus database with same CATH topology
 1ZG7 A;  2Z3L A;  4KOU A;  3TO6 A;  4KOR A;  3FH4 A;  4FD6 A;  5A27 A;  2Z3N A;  5EC4 A;  2P6E A;  3FBU A;  1Y9K A;  1S7F A;  3DLJ A;  1XEB A;  3PZJ A;  4OC4 A;  2Q4Z A;  3KHZ A;  1NSA A;  4AVB A;  1SQH A;  2NYQ A;  2EK8 A;  2ZED A;  2ZEH A;  3B2Y A;  5G20 A;  3BJ7 A;  1U6M A;  3WT4 A;  2FS5 A;  3TCV A;  1CP6 A;  1R43 A;  4A94 A;  4CGO A;  3BI0 A;  2B58 A;  1CBX A;  1H8L A;  3EC4 A;  1XJO A;  5H86 A;  3D66 A;  4KSI A;  3I9S A;  4KOX A;  1ZLH A;  3W91 A;  4ZI6 A;  1JWQ A;  3PEI A;  4P4E A;  3IO1 A;  4ONU A;  4P4J A;  4GS4 A;  2OR4 A;  4EWT A;  2PVV A;  1CX8 A;  3IWE A;  4UCN A;  7CPA A;  4OIW A;  2C1C A;  1KWM A;  2ZEM A;  5E96 A;  3NE8 A;  5KTC A;  1KUY A;  2ATR A;  6CPA A;  1IU8 A;  2ZOF A;  2REE A;  3MN8 A;  1QSO A;  1YME A;  3FMC A;  5AGE A;  1VKC A;  1XMT A;  4NFR A;  2JDD A;  1TKJ A;  2C27 A;  3VWD A;  2F7V A;  1YLO A;  1S7K A;  4OC1 A;  2D4O A;  1XIX A;  2JEV A;  5JGF A;  2X7B A;  4FWU A;  4UIB A;  2WYR A;  1TKH A;  2FVG A;  4Q36 A;  1MJ9 A;  2NMT A;  4CGL A;  1CP7 A;  2IQ6 A;  1BPN A;  3ISZ A;  3TT2 A;  2REF A;  2PJ4 A;  3NE7 A;  4GXH A;  2QIR A;  3QNV A;  3MRU A;  3R1K A;  2K5T A;  1ELM P;  2Z0Z A;  2ZEN A;  2HUZ A;  4H6U A;  1YLE A;  2JDC A;  3BXM A;  3PGP A;  2CY2 A;  3CPX A;  4DNC A;  4WWV A;  2CTB A;  2PQ8 A;  3PBB A;  5F46 A;  3FXT A;  2IJZ A;  5J1Q A;  4M6I A;  4B13 A;  5J8F A;  4TNU A;  2CTC A;  4HNX B;  1P4N A;  2CNT A;  3SXN A;  3IGR A;  2AFW A;  4R7M A;  2Q4V A;  4P4B A;  4QBJ A;  4TWE A;  4MY0 A;  3LMS A;  4B11 A;  5KTA A;  3CXP A;  1M44 A;  4MHY A;  2VZY A;  4YGO A;  3PFE A;  2PJ0 A;  4JZ0 A;  2JLM A;  4UEE A;  1ARM A;  3LWU A;  4LQ6 A;  3HLP A;  5LRJ A;  1XMB A;  1Z8T A;  4BIN A;  3KGQ A;  4JYW A;  1CG2 A;  3T8W A;  1PU9 A;  3K2K A;  1AMP A;  2BL1 A;  3BI1 A;  2QJ8 A;  3ISX A;  1NE9 A;  1KUV A;  1Q2D A;  1V0C A;  1WK4 A;  2J8N A;  3L2N A;  3B3W A;  4RUH A;  2PJ5 A;  5K8P A;  4CYN A;  4BMH A;  2ZW5 A;  4RI1 A;  4F9U A;  2V8H A;  4KLW A;  4MCP A;  1LAN A;  5D8N A;  3CT9 A;  1X12 A;  2R1I A;  2DPT A;  4XNH B;  2AFM A;  4B5O A;  2WZN A;  3DR8 A;  4KVM E;  1YGH A;  1S5K A;  4K30 A;  5IB9 A;  1ZLI A;  4PXE A;  3TO7 A;  3TX8 A;  4MMO A;  5F49 A;  4CPA A;  4PXB A;  1I21 A;  2BEI A;  2WPX A;  4ORF A;  4IUS A;  1R57 A;  2WPW A;  4P4F A;  2DF5 A;  2QYV A;  4DYO A;  3VAR A;  4OC3 A;  2PVW A;  2C6P A;  3IJ3 A;  1NSL A;  4U9Z A;  1Z4E A;  2A4N A;  2O28 A;  4P44 A;  2DEA A;  1NMT A;  4KOW A;  4LUA A;  5I0C A;  3DR6 A;  3QB8 A;  4YFJ A;  2OB0 A;  2OZH A;  2CXA A;  4X8I A;  3N7Z A;  3B3V A;  3KQX A;  4R87 A;  2HQY A;  3CPA A;  3D4U A;  4DJL A;  4G1P A;  4X5K A;  1LOK A;  1KZF A;  4W9Y A;  2Q43 A;  1BAV A;  1ZG8 A;  4FD5 A;  2F5I A;  4NGR A;  4MFJ A;  1M4G A;  1VGY A;  1YR0 A;  2C6G A;  2R7H A;  1DTD A;  3B8G A;  4EVY A;  3V38 A;  1IY7 A;  4ZBG A;  3WC5 A;  4PPZ A;  2GRE A;  2RC4 A;  3S6K A;  4EME A;  2EO8 A;  4PK2 A;  4IF5 A;  4OKO A;  4B14 A;  3KI9 A;  3KL9 A;  2O53 A;  3IC1 A;  3OWC A;  4OME A;  5DWM A;  2PIY A;  2XEG A;  4JD6 A;  4M6H A;  4LQG A;  4AVA A;  3PB4 X;  4OAE A;  4XPD B;  3JUW A;  2FT0 A;  1TF9 A;  2FCK A;  4NGP A;  4NCZ A;  1OZP A;  3B3T A;  4MCS A;  1HEE A;  4A2Z A;  4UFW A;  4NSQ A;  3UY5 A;  5IX3 A;  3PFO A;  1YVO A;  2PJ7 A;  1AYE A;  3EO4 A;  2I3C A;  5DS0 A;  4CGM A;  2YNE A;  1XBU A;  2Q4Y A;  3IWG A;  4C7H A;  4P10 A;  4CYO A;  1BO4 A;  1IOF A;  4C2X A;  4UF4 A;  4Z65 A;  4UA3 A;  1XFO A;  1LAP A;  4ONW A;  4P4I A;  3V8I A;  5JH9 A;  3CDX A;  4MHD A;  2B4B A;  2Q0Y A;  2BCO A;  3EY5 A;  3MGD A;  3SXO A;  4Y49 B;  2PJ8 A;  2YNC C;  4F6A A;  2QVP A;  2Y0M A;  4CAV A;  2PSW A;  1CPX A;  4YWY A;  2PIZ A;  3D7G A;  3H4Q A;  2ZW4 A;  5JM6 A;  4MRI A;  3TOB A;  2H5M A;  3FRM A;  3D7D A;  2Q7B A;  4B10 A;  4PK3 A;  4YRH A;  1TIQ A;  4R6T A;  3KZW A;  4A39 A;  1B6B A;  1Z5R A;  1B87 A;  4KUB A;  4YU9 A;  2EWB A;  3SHP A;  2AJ6 A;  4B5P B;  5HVF A;  1YRE A;  5I4M A;  2EK9 A;  2PE3 A;  4CRY B;  2CIJ A;  5K8M A;  5AG7 A;  2CNM A;  4GM5 A;  1J4J A;  4QUS A;  5CNP A;  4AXV A;  4JWP A;  2O4H A;  4O23 A;  3S9L A;  3F8K A;  4UEF A;  3B7I A;  2CNS A;  5F47 A;  4B6Z A;  5IV0 A;  2ZXV A;  4CAW A;  3IU2 A;  2DXQ A;  3F5B A;  5BWA B;  1IYK A;  1QSR A;  2B4D A;  4FBE A;  2G3T A;  2B4D B;  1ARL A;  3A9L A;  4R3L A;  3V7Z A;  4II9 A;  2IL4 A;  1Z2L A;  1HDU A;  5JQ4 A;  1LRZ A;  4OLL A;  4MFQ A;  3FX6 A;  3H8G A;  3KHX A;  3KR4 A;  1Q7L A;  4XPL A;  4ZX9 A;  3T90 A;  3TO9 A;  2BO9 A;  2PDO A;  2B5G A;  4HPS A;  4E0A A;  3IU1 A;  2F8H A;  4R8F A;  2B5G B;  3GIU A;  3PB8 X;  5AG5 A;  1IID A;  3DSB A;  3SJX A;  3S9M A;  1PYT B;  4KS9 A;  1RXT A;  4CGN A;  3GKR A;  4U5Y A;  3R9F A;  2P0W A;  1CPS A;  1Y9W A;  4IHM A;  1QQ9 A;  1MK4 A;  2I79 A;  5F48 A;  3B35 A;  5JPH A;  3KR5 A;  2PRQ A;  4JJX A;  4CRZ B;  3JTK A;  4RS2 A;  3K9U A;  4IAV A;  2DPS A;  2AFS A;  4MHN A;  5HVG A;  2NSM A;  2Q51 A;  2WUU A;  4UCM A;  2Q04 A;  4A33 A;  2GLJ A;  2PJ2 A;  4A32 A;  3KKW A;  5AG6 A;  1M1D A;  3B3S A;  3GYA A;  1DE4 C;  3VAT A;  4CAX A;  4L8A A;  3IEH A;  4ZGY B;  3S9N A;  4CYQ A;  4M85 A;  1F2O A;  3NH5 A;  4NJQ A;  4H89 A;  1L0C A;  3SJF A;  4F0Y A;  4KVO E;  3RAM A;  2V8V A;  3I1U A;  2JBJ A;  2V8G A;  4PSW A;  1Y0R A;  4Q38 A;  4C2Y A;  5G21 A;  4ZX8 A;  4FUU A;  4L89 A;  5THW A;  2JBK A;  1VHS A;  3GLJ A;  3D8P A;  1BPM A;  1CM0 A;  1K4J A;  1M4I A;  2RFH A;  1MJA A;  1P0H A;  4HNY B;  1HDQ A;  2PJ1 A;  1LAM A;  4C7I A;  3NH4 A;  4NGT A;  5LYL A;  3FED A;  4ZY0 A;  1MJB A;  2BUE A;  2J8R A;  1LFW A;  3JRU A;  5G22 A;  3CXS A;  3VWE A;  1S60 A;  4R57 A;  4A31 A;  5HXD A;  1S3Z A;  3TFY A;  2P6F A;  3DGV A;  1CJW A;  3RBU A;  4MHP A;  3S6F A;  3F0A A;  5A28 A;  3G8W A;  4CGP A;  3LD2 A;  2FXF A;  1YW4 A;  3FNC A;  4J3G A;  3D68 A;  4MFZ A;  1ZO0 A;  2V8D A;  4C2Z A;  8CPA A;  3G3S A;  2OZU A;  5LYI A;  1IGB A;  4H2K A;  3TC8 A;  2QML A;  2CF4 A;  4NEX A;  4FD4 A;  4A38 A;  2ZEF A;  3K9T A;  3WC6 A;  2RB7 A;  1IOI A;  2ZEE A;  2Z11 A;  2EUI A;  4MHZ A;  3D67 A;  1EE3 P;  5J8C A;  1YVK A;  3DDD A;  2XEI A;  3D3S A;  1Y0Y A;  4OP4 A;  2POK A;  2ZPA A;  2R8V A;  2ZW6 A;  2VZZ A;  2PC1 A;  4UEZ A;  2Z3M A;  4CAE A;  3JVN A;  4JXQ A;  3SJE A;  2PCU A;  4KOT A;  1Q2C A;  2Q44 A;  3D2P A;  3WC7 A;  3RYO A;  5LRG A;  5C82 A;  1F2P A;  1GYT A;  4AG7 A;  5C88 A;  5ISV A;  2XEF A;  3SI2 A;  2FIA A;  1Q2Y A;  3R96 A;  4E2A A;  4Q7A A;  1Z9U A;  1RO5 A;  4NGQ A;  2ZOG A;  2FSR A;  3RZA A;  3FJU A;  4M3S A;  3QAH A;  4NXY A;  3D7H A;  4NGN A;  4P45 A;  4AB7 A;  1KUX A;  2ODF A;  4UWI A;  1Z8L A;  2AFU A;  3S6H A;  3N5F A;  1PUA A;  2OU2 A;  5LYF A;  1I1D A;  1X10 A;  2PRB A;  3R95 A;  4M6G A;  2PR1 A;  4KSF A;  4RN7 A;  2I00 A;  2PJA A;  3GY9 A;  2EBJ A;  4KZT A;  3DNS A;  2VI7 A;  5FVJ A;  5ELY A;  4QB9 A;  3D7F A;  5GCN A;  1LCP A;  2PJ3 A;  2BOA A;  3FB3 A;  3LAC A;  4NF1 A;  3BHX A;  4JXR A;  3RO0 A;  4XPK A;  4B5P A;  4KOY A;  4MFK A;  4MJ8 A;  2B3V A;  2G9D A;  2GU2 A;  4KVX A;  4PQA A;  1FY7 A;  1IIC A;  3FVL A;  1UFH A;  1F57 A;  1TXR A;  4F8Z A;  2PJC A;  2EVN A;  2ZW7 A;  4MXU A;  3P2H A;  1QSN A;  4DUK A;  2OH1 A;  2PJ9 A;  4OC5 A;  2AFZ A;  3SI1 A;  2YND A;  1GHE A;  4XNH C;  2IMO A;  4WJB A;  2GAN A;  2R98 A;  1FNO A;  3FEE A;  4R76 A;  5AG4 A;  2BSW A;  1VHO A;  1Z8W A;  3SI0 A;  1A2Z A;  4LX9 A;  4NJR A;  2Z10 A;  4AVC A;  4P4D A;  3PB9 X;  1YX0 A;  2OZG A;  3EXN A;  4MCQ A;  3KAS A;  5LYD A;  4UWJ A;  4CS0 B;  1ELL P;  3D2M A;  2B3U A;  2FIW A;  3FYN A;  2VL1 A;  4HNW B;  4PV6 A;  3VH9 A;  2GE3 A;  3I3G A;  1RTQ A;  3EFA A;  2AE6 A;  2YNC A;  1YW6 A;  1FT7 A;  3NFZ A;  4X2T A;  5EMI A;  2G3A A;  3C26 A;  2C6C A;  4KOS A;  1OBR A;  2Z3P A;  3ZJ0 A;  1YK3 A;  4EFD A;  2OOT A;  1AUG A;  1YQE A;  1XE4 A;  1Z4R A;  2HB6 A;  3FF3 A;  4BD9 A;  4KUA A;  2ANP A;  3FEC A;  1UWY A;  3CXQ A;  4UBR A;  1Y7R A;  1QSM A;  3B3C A;  4I49 A;  3R9E A;  1N71 A;  3PP9 A;  4KSA A;  2J8M A;  4OAD A;  4KOV A;  5CPA A;  5LRK A;  3RNZ A;  2Z3O A;  3W6S A;  1YSJ A;  2ABZ A;  4UIA A;  2V77 A;  5K8O A;  1TKF A;  4ZY2 A;  1IYL A;  4HKF A;  4C68 A;  2KCW A;  4PSX A;  2Q7S A;  2G0B A;  4A30 A;  2VQY A;  4A37 A;  3PB7 X;  1Y7E A;  3NH8 A;  3TTH A;  1PCA A;  2PJB A;  5CBM A;  3IIB A;  3FIX A;  3PRT A;  3PB6 X;  4XPD C;  3CZX A;  1IB1 E;  2P6G A;  4MFL A;  3S6G A;  3NA6 A;  4OC0 A;  2GLF A;  2ZEP A;  3T9Y A;  3ZZI A;  2AFO A;  1M4L A;  4H6Z A;  2VXK A;  3LOD A;  4JLY A;  4QVT A;  2FE7 A;  3KQZ A;  3IFE A;  1XF8 A;  4IK2 A;  2ARH A;  4NGS A;  1I12 A;  2J9A A;  4UFV A;  4CAF A;  4NGM A;  5EBV A;  5HMN A;  3E0K A;  4U9Y A;  2ZEL A;  3P2F A;  4BBH A;  4OID A;  1XRY A;  3BJ8 A;  1JQG A;  4MCR A;  4R9M A;  5G1Z A;  2XEJ A;  5H84 A;  1VIX A;  3QAY A;  4KLV A;  4AG9 A;  2AFX A;  4MI4 A;  2WSA A;  3BLN A;  3HUV A;  4P6Y A;  1M4D A;  4R3K A;  3TOA A;  1R3N A;  2HC9 A;  3WR7 A;  4Y49 C;  3W6X A;  1TF8 A;  3IWW A;  4B12 A;  4ZYQ A;  1BOB A;  2VEZ A;  2ZEO A;  4OC2 A;  3H8F A;  4PXD A;  3TE4 A;  2FL4 A;  4UFX A;  5D29 A;  4CYP A;  4FAI A;  5K8N A;  4MY3 A;  5F09 A;  5HH1 A;  1QMU A;  1WWZ A;  4A95 A;  4K3N A;  4E8O A;  4MFP A;  4UCP A;  2HV2 A;  1BLL E;  2JEW A;  2YGW A;  2QEC A;  3GUX A;  3GB0 A;  2PJ6 A;  1ZG9 A;  1S7L A;  1S7N A;  3H8E A;  3R9G A;  3SJG A;  4QC6 A;  3WAB A;  2GFQ A;  4F9V A;  1QST A;  1VHE A;  4PXC A;  4X3R A;  2Z3K A;  1XOV A;  1Z8X A;  4ZY1 A;  1ON0 A;  3PBE A;  2GIV A;  3H5Z A;  2D4P A;  5DWN A;  5IB0 A;  5HVH A;  4FD7 A;  2PR8 A;  4F0X A;  5KTD A;  4MBU A;  2VBQ A;  2ZEG A; 
#chains in the Genus database with same CATH homology
 1ZG7 A;  3FH4 A;  3DLJ A;  4OC4 A;  2Q4Z A;  3KHZ A;  1NSA A;  2NYQ A;  3B2Y A;  2EK8 A;  2ZED A;  2ZEH A;  3WT4 A;  1CP6 A;  1R43 A;  4A94 A;  3BI0 A;  1CBX A;  1H8L A;  1XJO A;  3D66 A;  4KSI A;  1ZLH A;  4ZI6 A;  3PEI A;  4P4E A;  3IO1 A;  4P4J A;  2OR4 A;  4EWT A;  2PVV A;  1CX8 A;  7CPA A;  4OIW A;  2C1C A;  1KWM A;  2ZEM A;  6CPA A;  2ZOF A;  3MN8 A;  1YME A;  3FMC A;  4NFR A;  1TKJ A;  2F7V A;  1YLO A;  4OC1 A;  5JGF A;  4FWU A;  4UIB A;  2WYR A;  1TKH A;  2FVG A;  1CP7 A;  2IQ6 A;  1BPN A;  3ISZ A;  2PJ4 A;  3QNV A;  3MRU A;  2ZEN A;  1ELM P;  3BXM A;  3CPX A;  4WWV A;  2CTB A;  3PBB A;  5J1Q A;  2IJZ A;  4TNU A;  2CTC A;  2AFW A;  4R7M A;  4P4B A;  4TWE A;  3LMS A;  4MHY A;  3PFE A;  2PJ0 A;  4JZ0 A;  4UEE A;  1ARM A;  3LWU A;  3HLP A;  5LRJ A;  1XMB A;  3KGQ A;  4JYW A;  1CG2 A;  3T8W A;  3K2K A;  1AMP A;  3BI1 A;  2QJ8 A;  3ISX A;  3L2N A;  3B3W A;  4RUH A;  2PJ5 A;  5K8P A;  4F9U A;  2V8H A;  4MCP A;  5D8N A;  1LAN A;  3CT9 A;  2AFM A;  2WZN A;  5IB9 A;  1ZLI A;  4PXE A;  3TX8 A;  4MMO A;  4CPA A;  4PXB A;  4P4F A;  2QYV A;  4DYO A;  3VAR A;  4OC3 A;  2PVW A;  2C6P A;  3IJ3 A;  4P44 A;  2DEA A;  4X8I A;  3B3V A;  3KQX A;  3CPA A;  3D4U A;  4DJL A;  4G1P A;  1LOK A;  4W9Y A;  2Q43 A;  1BAV A;  1ZG8 A;  4NGR A;  1VGY A;  2C6G A;  1DTD A;  3V38 A;  1IY7 A;  3WC5 A;  4PPZ A;  2GRE A;  4EME A;  4OKO A;  3KI9 A;  3KL9 A;  2O53 A;  3IC1 A;  4OME A;  2PIY A;  2XEG A;  4LQG A;  3PB4 X;  1TF9 A;  4NGP A;  3B3T A;  4MCS A;  1HEE A;  3PFO A;  2PJ7 A;  1AYE A;  5DS0 A;  2I3C A;  1XBU A;  4P10 A;  4UF4 A;  4Z65 A;  1XFO A;  1LAP A;  4ONW A;  4P4I A;  5JH9 A;  3CDX A;  2BCO A;  2PJ8 A;  2QVP A;  1CPX A;  4YWY A;  2PIZ A;  3D7G A;  5JM6 A;  4MRI A;  3D7D A;  4R6T A;  3KZW A;  4A39 A;  1Z5R A;  4YU9 A;  2EWB A;  5HVF A;  5I4M A;  2EK9 A;  2PE3 A;  2CIJ A;  5K8M A;  4GM5 A;  4AXV A;  2O4H A;  4O23 A;  3S9L A;  4UEF A;  3B7I A;  4B6Z A;  4FBE A;  1ARL A;  3V7Z A;  1Z2L A;  1HDU A;  3FX6 A;  3H8G A;  3KHX A;  3KR4 A;  1Q7L A;  4ZX9 A;  2BO9 A;  2F8H A;  4R8F A;  3PB8 X;  3SJX A;  3S9M A;  1PYT B;  1CPS A;  4IHM A;  1QQ9 A;  3B35 A;  3KR5 A;  2PRQ A;  4IAV A;  2AFS A;  4MHN A;  5HVG A;  2NSM A;  2Q51 A;  2GLJ A;  2PJ2 A;  3B3S A;  3VAT A;  1DE4 C;  3IEH A;  3S9N A;  1F2O A;  3NH5 A;  4NJQ A;  3SJF A;  3RAM A;  2V8V A;  3I1U A;  2JBJ A;  2V8G A;  1Y0R A;  4ZX8 A;  4FUU A;  5THW A;  2JBK A;  3GLJ A;  1BPM A;  2RFH A;  1HDQ A;  2PJ1 A;  1LAM A;  3NH4 A;  4NGT A;  5LYL A;  3FED A;  4ZY0 A;  1LFW A;  3JRU A;  5HXD A;  3DGV A;  3RBU A;  4MHP A;  1YW4 A;  3D68 A;  2V8D A;  8CPA A;  5LYI A;  1IGB A;  4H2K A;  3TC8 A;  2CF4 A;  2ZEF A;  3K9T A;  3WC6 A;  2RB7 A;  2ZEE A;  4MHZ A;  3D67 A;  1EE3 P;  2XEI A;  1Y0Y A;  4OP4 A;  2POK A;  4UEZ A;  3SJE A;  2PCU A;  3WC7 A;  5LRG A;  1F2P A;  1GYT A;  2XEF A;  3SI2 A;  4Q7A A;  4NGQ A;  2ZOG A;  3RZA A;  3FJU A;  4NGN A;  3D7H A;  4P45 A;  1Z8L A;  2AFU A;  3N5F A;  5LYF A;  2PJA A;  5ELY A;  3D7F A;  1LCP A;  2PJ3 A;  2BOA A;  3BHX A;  2G9D A;  2GU2 A;  4PQA A;  3FVL A;  1F57 A;  1TXR A;  4F8Z A;  2PJC A;  4MXU A;  4DUK A;  2PJ9 A;  4OC5 A;  2AFZ A;  3SI1 A;  2IMO A;  4WJB A;  3FEE A;  1FNO A;  4R76 A;  1VHO A;  3SI0 A;  4NJR A;  4P4D A;  3PB9 X;  4MCQ A;  3KAS A;  5LYD A;  1ELL P;  2VL1 A;  3VH9 A;  1RTQ A;  1YW6 A;  1FT7 A;  3NFZ A;  4X2T A;  2C6C A;  1OBR A;  4EFD A;  2OOT A;  4BD9 A;  2HB6 A;  3FF3 A;  2ANP A;  3FEC A;  1UWY A;  3B3C A;  5CPA A;  5LRK A;  1YSJ A;  2ABZ A;  4UIA A;  2V77 A;  5K8O A;  1TKF A;  4ZY2 A;  4A37 A;  3PB7 X;  1Y7E A;  3NH8 A;  5CBM A;  1PCA A;  2PJB A;  3IIB A;  3PRT A;  3PB6 X;  3NA6 A;  4OC0 A;  2GLF A;  2ZEP A;  2AFO A;  1M4L A;  3KQZ A;  3IFE A;  4IK2 A;  4NGS A;  2J9A A;  4NGM A;  2ZEL A;  4OID A;  1XRY A;  1JQG A;  4MCR A;  2XEJ A;  1VIX A;  2AFX A;  3HUV A;  4P6Y A;  1R3N A;  2HC9 A;  4ZYQ A;  1TF8 A;  3IWW A;  2ZEO A;  4OC2 A;  3H8F A;  4PXD A;  5D29 A;  4FAI A;  5K8N A;  5F09 A;  1QMU A;  4K3N A;  2JEW A;  1BLL E;  3GUX A;  4A38 A;  3H8E A;  3GB0 A;  2PJ6 A;  1ZG9 A;  3SJG A;  3WAB A;  4F9V A;  1VHE A;  4PXC A;  4X3R A;  4ZY1 A;  3PBE A;  5HVH A;  2ZEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...