1QSRA

Crystal structure of tetrahymena gcn5 with bound acetyl-coenzyme a
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
162
structure length
162
Chain Sequence
LDFDILTNDGTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMVILKNKQKVIGGICFRQYKPQRFAEVAFLAVTANEQVRGYGTRLMNKFKDHMQKQNIEYLLTYADNFAIGYFKKQGFTKEHRMPQEKWKGYIKDYDGGTLMECYIHPYVDYGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords TGCN5 HISTONE ACETYL TRANSFERASE
publication title Structure of Tetrahymena GCN5 bound to coenzyme A and a histone H3 peptide.
pubmed doi rcsb
source organism Tetrahymena thermophila
total genus 47
structure length 162
sequence length 162
ec nomenclature ec 2.3.1.-:
pdb deposition date 1999-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1qsrA00
1QSRA 2Q44A 3IWGA 2BUEA 2B58A 3TOAA 2PR8A 3C26A 2OB0A 3E0KA 5I0CA 1P4NA 5C88A 3DDDA 5FVJA 3R96A 3D2MA 1QSMA 2JDDA 3FB3A 1IYKA 3W91A 4Y49C 3VWEA 4AG7A 5KTDA 4XNHB 3T9YA 3TO9A 4IF5A 2J8MA 3F0AA 3FBUA 3LD2A 3ZZIA 3S6HA 2ZW7A 1Q2CA 5IB0A 4R87A 2DXQA 4U9YA 4PV6A 2FCKA 3DSBA 2B5GB 2QECA 4B5PA 2OZUA 4CRZB 4MHDA 4AB7A 3DR6A 2JLMA 5F46A 2OZGA 1IB1E 4KLWA 2G3TA 4CAVA 1M1DA 2HV2A 1S7NA 4KOVA 1Q2DA 1YREA 2FS5A 2Q04A 2VBQA 3I3GA 3OWCA 2EVNA 3GYAA 4OAEA 4YGOA 2HQYA 2OH1A 3TOBA 2P6EA 4QB9A 3S6FA 4LUAA 1QSOA 4KOWA 4JXQA 4NEXA 4XNHC 2B3VA 2FXFA 4UWJA 3VWDA 2CY2A 1IIDA 1FY7A 2ZW4A 2IL4A 2EUIA 1V0CA 4CAWA 4EVYA 4MY0A 3PGPA 4X5KA 4OADA 2PR1A 3EC4A 2QIRA 3R9EA 4NCZA 1WK4A 2HUZA 5GCNA 3JVNA 2BEIA 1MJBA 2GIVA 3LODA 3MGDA 4XPDB 4B5PB 2Q4VA 1S3ZA 3TCVA 4E2AA 2PQ8A 1VHSA 4LX9A 4PSWA 2BL1A 1I1DA 3K9UA 4R3KA 1L0CA 3NE7A 1CM0A 4F6AA 5C82A 4HKFA 1N71A 5F48A 3W6XA 1QSNA 4QVTA 3V8IA 5IX3A 2ATRA 1KUVA 3F8KA 4ZBGA 2R98A 2B3UA 4YRHA 1XMTA 1J4JA 2KCWA 4KVXA 2Z11A 3S6KA 1S5KA 4K30A 1IICA 4M3SA 1Z9UA 2CNTA 4II9A 1M4DA 4XPLA 1MJAA 2ZXVA 4AG9A 3TO6A 4MJ8A 2PRBA 3TE4A 4H6ZA 2R8VA 3CXPA 4HNWB 2D4OA 2GANA 2GE3A 5HH1A 4U5YA 3DR8A 1OZPA 1RXTA 4YFJA 4NXYA 5J8FA 1MK4A 4I49A 3BJ8A 3TFYA 3R1KA 2ARHA 4RI1A 4PSXA 4OLLA 4FD4A 1YVKA 2VQYA 5EC4A 1U6MA 1YR0A 1B87A 2I00A 3QAHA 1UFHA 3BJ7A 1BO4A 2H5MA 3IGRA 4MY3A 2D4PA 5JPHA 3GKRA 3WR7A 3PP9A 4MBUA 4NF1A 1S7FA 2FSRA 4R57A 2OZHA 3D2PA 3FYNA 4FD7A 4PK3A 3EO4A 3B8GA 3W6SA 4KZTA 3JUWA 2OU2A 4KOUA 1R57A 5JQ4A 1NE9A 3SXOA 1Y9KA 2PC1A 2JDCA 2G0BA 5HMNA 2ZW5A 3SXNA 4M85A 1GHEA 2CNSA 2VI7A 2P6GA 1P0HA 1XE4A 2X7BA 1Q2YA 3D3SA 1M44A 4E8OA 1KUYA 2FL4A 2JEVA 4FD5A 2RC4A 5F47A 2FIWA 3G3SA 4GS4A 2WPWA 4FD6A 4KVME 4KUBA 4Y49B 1B6BA 3UY5A 1KZFA 3P2HA 4QBJA 2PSWA 4JLYA 3I9SA 2FT0A 3RYOA 5CNPA 3EY5A 3SHPA 3T90A 4L89A 4F0YA 1XF8A 5H84A 1VKCA 1M4IA 3TO7A 2K5TA 4R9MA 2C27A 4H89A 2G3AA 4H6UA 4IUSA 4J3GA 5J8CA 1NMTA 5E96A 2F5IA 1QSTA 5IV0A 4KVOE 2Z10A 2P0WA 3PZJA 4KOSA 3H4QA 3DNSA 1YLEA 5DWMA 4L8AA 4KUAA 4KLVA 3FIXA 2QMLA 3FNCA 2J8NA 1K4JA 1S7KA 2B4DA 2WPXA 5EBVA 4KOYA 3GY9A 1PU9A 3EFAA 3QB8A 1XEBA 4CS0B 2PDOA 2Y0MA 4JJXA 1YK3A 4AVAA 2Z0ZA 1Z4RA 2REFA 2Q4YA 4XPDC 4QC6A 3FRMA 4KOTA 3FXTA 3EXNA 1XIXA 3BLNA 1CJWA 2REEA 1Y9WA 2I79A 1ON0A 4NSQA 4JWPA 3P2FA 4JXRA 4XPKA 3TT2A 5DWNA 4AVCA 4HNYB 5KTCA 2AJ6A 1WWZA 4KOXA 1S60A 1MJ9A 3R95A 2Q0YA 1LRZA 3CXSA 3G8WA 4UBRA 4AVBA 5H86A 1I21A 1SQHA 3TTHA 4B5OA 1YGHA 2FIAA 1PUAA 4KORA 4R3LA 2P6FA 1Z4EA 5ISVA 2B4DB 2AE6A 1BOBA 3N7ZA 2O28A 1YX0A 2VEZA 2Q7BA 4CRYB 1I12A 4ONUA 2BSWA 1YVOA 1M4GA 2VZZA 4CAXA 2J8RA 4BMHA 2ZPAA 1IYLA 4JD6A 3F5BA 1S7LA 1KUXA 2NMTA 4HNXB 2CNMA 2VXKA 2VZYA 4DNCA 2B4BA 4E0AA 3CXQA 3KKWA 3D8PA 3R9FA 5F49A 2R7HA 4QUSA 1TIQA 4UWIA 4U9ZA 2A4NA 3ZJ0A 1NSLA 4PK2A 2ZW6A 4ORFA 2B5GA 4RS2A 4UA3A 4MI4A 5KTAA 2FE7A 3R9GA 3S6GA 1Y7RA 1RO5A 2R1IA
chains in the Genus database with same CATH superfamily
1QSRA 3KR5A 2Q44A 4PXCA 4ZYQA 3IWGA 1YW4A 1Y0RA 3PB9X 2BUEA 2B58A 3TOAA 4KSFA 3WC5A 5THWA 2HB6A 2PR8A 3C26A 3NFZA 4CGNA 4O23A 3NH4A 2OB0A 1OBRA 4X3RA 2NYQA 2Z3OA 3E0KA 5HVGA 4ONWA 5I0CA 3JTKA 1P4NA 5C88A 3PB6X 3DDDA 3K2KA 5FVJA 2AFXA 4EFDA 3R96A 2FVGA 3SJXA 2DPTA 3D2MA 1QSMA 2JDDA 3FB3A 4WWVA 4A32A 1IYKA 3W91A 2Q4ZA 4Y49C 3VWEA 4A38A 4AG7A 5KTDA 1VHOA 1TKJA 4R76A 3S9MA 4P4FA 4XNHB 3T9YA 3TO9A 4IF5A 2J8MA 3F0AA 4UEFA 4C2YA 3FMCA 2BCOA 3FBUA 1TF9A 1CP6A 3LD2A 4OC1A 3ZZIA 4K3NA 4JZ0A 3S6HA 4IK2A 4CYOA 3CPXA 1BPNA 4NGTA 3JRUA 4UFVA 2ZW7A 1Q2CA 5IB0A 4MCRA 2CXAA 4R87A 2DXQA 4U9YA 2DPSA 4PV6A 2FCKA 3DSBA 2Z3NA 4OMEA 4CAFA 1AUGA 2B5GB 2QECA 4B5PA 3RNZA 4ZGYB 5HVHA 2OZUA 3QAYA 1ZLIA 4CRZB 4CAEA 3IU2A 4MHDA 5DS0A 4AB7A 4UCMA 4LQ6A 4C7HA 4A39A 4MMOA 1HEEA 3DR6A 3L2NA 1LCPA 2YNDA 2JLMA 5F46A 2OZGA 1IB1E 1VIXA 1JQGA 4KLWA 2G3TA 3KQXA 4CAVA 4H2KA 5JGFA 1M1DA 4MFJA 2HV2A 3NA6A 1IOFA 2ZEHA 1LFWA 4UIAA 2V8HA 1S7NA 2DEAA 1ZG7A 2XEGA 4GXHA 1Q2DA 4KOVA 1YREA 2AFMA 3VH9A 2FS5A 4X2TA 1IGBA 2Q04A 4JYWA 2PJ3A 4OP4A 2VBQA 3I3GA 3OWCA 1VHEA 2EVNA 2EWBA 3GYAA 4OAEA 4YGOA 3GIUA 2HQYA 4UCNA 2OH1A 3TOBA 2P6EA 2WZNA 4QB9A 4KSIA 2PVWA 1F57A 3S6FA 4TWEA 4LUAA 4F9UA 1QSOA 3CZXA 4DYOA 4AXVA 5LYLA 4OIWA 1HDUA 4KOWA 4JXQA 1LOKA 4NEXA 4TNUA 4XNHC 3N5FA 3NE8A 2QYVA 2B3VA 2FXFA 1BPMA 4LQGA 4UWJA 3VWDA 2QJ8A 2CY2A 1BLLE 4P44A 1IIDA 1FY7A 1IU8A 2ZW4A 5I4MA 2CF4A 2IL4A 2EUIA 1BAVA 4HPSA 1V0CA 2V8DA 4CAWA 1CX8A 4EVYA 4MY0A 3PGPA 4X5KA 4YWYA 4BD9A 4OADA 4R8FA 2PR1A 3EC4A 2IQ6A 2QIRA 2EK9A 3R9EA 4NCZA 1AYEA 1WK4A 4P4IA 5IB9A 3KHXA 2HUZA 4G1PA 5GCNA 3JVNA 2JEWA 2ZENA 4DUKA 2BEIA 1MJBA 2GIVA 3LODA 3MGDA 5G1ZA 4XPDB 4B12A 4B5PB 2C6PA 1LANA 1YMEA 2Q4VA 1S3ZA 1Z8XA 3TCVA 4E2AA 2PQ8A 1R3NA 1VHSA 5D8NA 4DJLA 4CGLA 1X10A 4OIDA 1YSJA 3B3VA 2GLJA 4LX9A 4PSWA 5AG4A 1YW6A 2BL1A 3DGVA 5K8NA 1UWYA 2PJ7A 1I1DA 3RBUA 3K9UA 3B3TA 3ISXA 1L0CA 3NE7A 1CM0A 4R3KA 3H5ZA 4C7IA 1CG2A 4F6AA 5C82A 3H8FA 4HKFA 5AG7A 1N71A 5F48A 4FBEA 4UCPA 1QSNA 4OC4A 4QVTA 3V8IA 4U5YA 3D67A 3W6XA 3IIBA 2ATRA 6CPAA 5IX3A 1KUVA 3F8KA 3NH5A 4ZBGA 2R98A 1XBUA 2B3UA 4YRHA 1XMTA 4GM5A 1J4JA 2KCWA 3FVLA 5D29A 4C2ZA 4KVXA 3IO1A 3V7ZA 2Z11A 3LACA 3KR4A 2C6GA 3S6KA 4MCQA 1S5KA 3PB4X 4K30A 2AFOA 1IICA 2I3CA 4M3SA 2PJCA 1Z9UA 2RFHA 2CNTA 1HDQA 2PJ8A 2Q43A 3PB7X 4MCPA 4II9A 1M4DA 2Q51A 4XPLA 4P4JA 3KI9A 4NGNA 3KZWA 3GLJA 1MJAA 2ZXVA 3H8EA 2ZEDA 4AG9A 4RUHA 3TO6A 1RTQA 4MJ8A 2PRBA 3TE4A 3WC7A 2Q7SA 4H6ZA 2R8VA 2O53A 3CXPA 2PJBA 4HNWB 2D4OA 2GANA 4UFWA 2GE3A 1XFOA 3WT4A 3D7GA 5HH1A 1R43A 3B3CA 1OZPA 1Y0YA 1RXTA 2PJAA 2PJ6A 3DR8A 4NGSA 4NXYA 3TC8A 4YFJA 3T8WA 1JWQA 1TXRA 2Z3MA 3B7IA 3FEEA 5J8FA 1MK4A 2F8HA 3BJ8A 4I49A 1A2ZA 3TFYA 2ZEFA 3R1KA 3GUXA 2ARHA 4RI1A 4PSXA 4MCSA 4OLLA 1NSAA 2PRQA 3KL9A 3H8GA 4IHMA 5G20A 4FD4A 1YVKA 2VQYA 5EC4A 4A30A 1YQEA 4R7MA 1M4LA 3KQZA 1U6MA 1YR0A 3B3SA 5AGEA 1B87A 2I00A 3QAHA 1UFHA 3BJ7A 1BO4A 2H5MA 3IGRA 3QNVA 3D68A 4MY3A 5LRJA 2D4PA 5JPHA 3GKRA 1ZLHA 2C1CA 4Q36A 2Z3PA 3WR7A 3PP9A 4MBUA 2PJ4A 4NF1A 1S7FA 3KGQA 2DF5A 3PEIA 2FSRA 1ARLA 4R57A 2Z3LA 3D7DA 2OZHA 3D2PA 2PJ0A 1FT7A 3IEHA 4A95A 3FYNA 5LRKA 4FD7A 3KASA 4PK3A 4YU9A 3EO4A 3B8GA 4FAIA 4MFLA 4MHYA 2BO9A 2HC9A 3W6SA 5J1QA 4KZTA 2V8GA 3BI0A 1LAMA 4EWTA 4Q7AA 4OC3A 8CPAA 3CT9A 3RZAA 4FUUA 1XJOA 2OU2A 2ZEOA 1R57A 3JUWA 2GU2A 4KOUA 5EMIA 2C6CA 3WABA 7CPAA 5JQ4A 1NE9A 2F7VA 3SXOA 1Y9KA 4B6ZA 2PC1A 2YNCC 2JDCA 2G0BA 5HMNA 4ZY2A 2ZW5A 4BINA 4MFPA 3SXNA 4M85A 1GHEA 2CNSA 2VI7A 4MHPA 1IOIA 2P6GA 4M6IA 3IC1A 3RAMA 3BXMA 1P0HA 1XE4A 5K8MA 4M6GA 2X7BA 1Q2YA 2XEJA 3D3SA 4CYQA 1M44A 2JBKA 5HXDA 4E8OA 1KUYA 4MRIA 4A37A 4IAVA 4CGOA 1QMUA 4PXBA 2FL4A 2JEVA 4UIBA 4FD5A 2RC4A 5F47A 2FIWA 4F8ZA 5F09A 3FEDA 3G3SA 4GS4A 5HVFA 1Q7LA 1TF8A 2WPWA 4FD6A 4KVME 4KUBA 4MFZA 4P4EA 1B6BA 2PCUA 4Y49B 3UY5A 1KZFA 2ZEGA 3P2HA 4QBJA 2PSWA 4ZX8A 4JLYA 3VATA 3I9SA 2PE3A 5G22A 3I1UA 2FT0A 3RYOA 5K8OA 5CNPA 4UFXA 1EE3P 1CBXA 3EY5A 3SHPA 3MN8A 3T90A 4L89A 4F0YA 2PJ9A 1TKHA 1XF8A 5H84A 1VKCA 4OC0A 1M4IA 1ZO0A 2GFQA 3TO7A 4OKOA 2BOAA 2K5TA 2C27A 4H89A 2G3AA 4H6UA 4IUSA 4J3GA 4R9MA 5J8CA 3KHZA 1CPXA 1NMTA 2GREA 3FECA 5E96A 2F5IA 1QSTA 5IV0A 3CPAA 4KVOE 4ZX9A 2ABZA 2Z10A 2P0WA 2XEIA 3PZJA 4KOSA 4B13A 2AFZA 4R6TA 3H4QA 3D7FA 1DTDA 3DNSA 2QVPA 3WC6A 1XOVA 1YLEA 4KS9A 3MRUA 2ZOGA 4L8AA 3GB0A 4KUAA 4KLVA 4OC5A 4MXUA 5DWMA 3LMSA 1ELLP 5JM6A 2NSMA 3FIXA 4WJBA 4A31A 3S9NA 1PCAA 2QMLA 3FNCA 2J8NA 1Z5RA 4UEZA 4B14A 1K4JA 1S7KA 2B4DA 5CPAA 4F9VA 4Z65A 2AFUA 4PXEA 5G21A 2WPXA 5EBVA 4KOYA 3GY9A 1TKFA 1PU9A 3D7HA 1ARMA 3HLPA 3A9LA 3EFAA 4PXDA 3QB8A 1XEBA 2CTBA 3FH4A 4CS0B 1GYTA 2PDOA 3SI0A 5AG5A 2ODFA 2Y0MA 1YK3A 4JJXA 5LRGA 4CYPA 3PBBA 4AVAA 2Z0ZA 1Z4RA 2REFA 4CYNA 3FX6A 2Q4YA 4BBHA 4EMEA 4XPDC 4QC6A 3FRMA 2AFWA 2PIYA 4KOTA 1F2OA 3B2YA 3SJEA 3FXTA 2EK8A 3EXNA 1QQ9A 1XIXA 3BLNA 1CJWA 2EO8A 2REEA 1Y9WA 2I79A 1XMBA 2PVVA 3D66A 1ON0A 3DLJA 2G9DA 2V8VA 2IMOA 4NSQA 4JWPA 3P2FA 4JXRA 4NJRA 4PPZA 4XPKA 3TT2A 1Z8TA 5DWNA 2WSAA 4AVCA 3FF3A 3IFEA 2EBJA 4HNYB 5A27A 2Z3KA 2VL1A 5KTCA 4UF4A 2AJ6A 1WWZA 4KOXA 1S60A 3IWEA 3IWWA 3PB8X 4MFQA 4NGQA 5ELYA 4CGPA 1MJ9A 2ZELA 3RO0A 3ISZA 4B10A 4FWUA 5JH9A 3R95A 3CDXA 2Q0YA 2ZEPA 1LRZA 3CXSA 3G8WA 2O4HA 3LWUA 4UBRA 3TX8A 4ZI6A 4AVBA 5H86A 2RB7A 1I21A 4X8IA 1X12A 1PYTB 1SQHA 1Z2LA 3SI1A 4CGMA 3VARA 3TTHA 5K8PA 4A94A 1FNOA 1KWMA 3K9TA 4C68A 2V77A 4P10A 1YGHA 2PJ1A 4B5OA 2FIAA 1PUAA 4KORA 3SJGA 4R3LA 4ZY0A 1ZG8A 2P6FA 2IJZA 1Z4EA 4M6HA 1F2PA 1ZG9A 5ISVA 4P45A 2B4DB 4Q38A 4MFKA 1CPSA 2AE6A 1BOBA 3N7ZA 1YLOA 2O28A 2YNEA 3PBEA 4OC2A 2WUUA 4W9YA 2OOTA 4MHNA 4A33A 1YX0A 4P4BA 4PQAA 3BI1A 2VEZA 2ZEEA 2Q7BA 4RN7A 4CRYB 5BWAB 1I12A 3B35A 2BSWA 3NH8A 4ONUA 5LYFA 1YVOA 1M4GA 3FJUA 2JBJA 1AMPA 4ZY1A 2VZZA 2PJ5A 2J8RA 5AG6A 4B11A 3B3WA 4BMHA 4CAXA 2ZPAA 2CIJA 3V38A 1IYLA 5A28A 4JD6A 3F5BA 1S7LA 2AFSA 4C2XA 1KUXA 2J9AA 2POKA 4P6YA 5LYIA 2NMTA 4HNXB 2CNMA 1VGYA 3D4UA 2VXKA 2VZYA 4NGRA 2YNCA 4CPAA 1Z8LA 3PRTA 3SI2A 4DNCA 2B4BA 4MHZA 1CP7A 4A2ZA 3BHXA 1H8LA 4E0AA 4NGMA 2ZOFA 3CXQA 3D8PA 3KKWA 1Y7EA 3SJFA 3S9LA 1XRYA 3R9FA 5F49A 2R7HA 2GLFA 4QUSA 1TIQA 3IJ3A 4UWIA 3PFOA 4U9ZA 2A4NA 3HUVA 5LYDA 3ZJ0A 2CTCA 2YGWA 4KSAA 4P4DA 1NSLA 1DE4C 1ELMP 2PJ2A 2XEFA 1IY7A 3IU1A 4PK2A 2ZW6A 4ORFA 2B5GA 4RS2A 4UA3A 4F0XA 2WYRA 4MI4A 5KTAA 1LAPA 2ANPA 5CBMA 2FE7A 4NJQA 4UEEA 3R9GA 3S6GA 4NGPA 2ZEMA 2PIZA 4NFRA 1Y7RA 1Z8WA 1RO5A 2OR4A 3PFEA 2R1IA
chains in the Genus database with same CATH topology
1QSRA 2Q44A 3IWGA 2BUEA 2B58A 3TOAA 4KSFA 2PR8A 3C26A 4CGNA 2OB0A 2Z3OA 3E0KA 5I0CA 3JTKA 1P4NA 5C88A 3DDDA 5FVJA 3R96A 2DPTA 3D2MA 1QSMA 2JDDA 3FB3A 4A32A 1IYKA 3W91A 4Y49C 3VWEA 4AG7A 5KTDA 4XNHB 3T9YA 3TO9A 4IF5A 2J8MA 3F0AA 4C2YA 3FBUA 3LD2A 3ZZIA 3S6HA 4CYOA 4UFVA 2ZW7A 1Q2CA 5IB0A 2CXAA 4R87A 2DXQA 4U9YA 2DPSA 4PV6A 2FCKA 3DSBA 2Z3NA 4CAFA 2B5GB 2QECA 4B5PA 4ZGYB 2OZUA 4CRZB 4CAEA 3IU2A 4MHDA 4AB7A 4UCMA 4C7HA 3DR6A 2YNDA 2JLMA 5F46A 2OZGA 1IB1E 4KLWA 2G3TA 4CAVA 1M1DA 4MFJA 2HV2A 1S7NA 4KOVA 1Q2DA 1YREA 2FS5A 2Q04A 2VBQA 3I3GA 3OWCA 2EVNA 3GYAA 4OAEA 4YGOA 2HQYA 4UCNA 2OH1A 3TOBA 2P6EA 4QB9A 3S6FA 4LUAA 1QSOA 4KOWA 4JXQA 4NEXA 4XNHC 2B3VA 2FXFA 4UWJA 3VWDA 2CY2A 1IIDA 1FY7A 2ZW4A 2IL4A 2EUIA 1V0CA 4CAWA 4EVYA 4MY0A 3PGPA 4X5KA 4OADA 2PR1A 3EC4A 2QIRA 3R9EA 4NCZA 1WK4A 2HUZA 5GCNA 3JVNA 2BEIA 1MJBA 2GIVA 3LODA 3MGDA 5G1ZA 4XPDB 4B12A 4B5PB 2Q4VA 1S3ZA 3TCVA 4E2AA 2PQ8A 1VHSA 4CGLA 4LX9A 4PSWA 5AG4A 2BL1A 1I1DA 3K9UA 4R3KA 1L0CA 3NE7A 1CM0A 3H5ZA 4C7IA 4F6AA 5C82A 4HKFA 5AG7A 1N71A 5F48A 4UCPA 1QSNA 4QVTA 3V8IA 3W6XA 5IX3A 2ATRA 1KUVA 3F8KA 4ZBGA 2R98A 2B3UA 4YRHA 1XMTA 1J4JA 2KCWA 4C2ZA 4KVXA 2Z11A 3S6KA 1S5KA 4K30A 1IICA 4M3SA 1Z9UA 2CNTA 4II9A 1M4DA 4XPLA 1MJAA 2ZXVA 4AG9A 3TO6A 4MJ8A 2PRBA 3TE4A 4H6ZA 2R8VA 3CXPA 4HNWB 2D4OA 2GANA 4UFWA 2GE3A 5HH1A 4U5YA 3DR8A 1OZPA 1RXTA 4YFJA 4NXYA 2Z3MA 5J8FA 1MK4A 4I49A 3BJ8A 3TFYA 3R1KA 2ARHA 4RI1A 4PSXA 4OLLA 5G20A 4FD4A 1YVKA 2VQYA 5EC4A 4A30A 1U6MA 1YR0A 5AGEA 1B87A 2I00A 3QAHA 1UFHA 3BJ7A 1BO4A 2H5MA 3IGRA 4MY3A 2D4PA 5JPHA 3GKRA 4Q36A 2Z3PA 3WR7A 3PP9A 4MBUA 4NF1A 1S7FA 2FSRA 4R57A 2Z3LA 2OZHA 3D2PA 4A95A 3FYNA 4FD7A 4PK3A 3EO4A 3B8GA 4MFLA 3W6SA 4KZTA 3JUWA 2OU2A 4KOUA 1R57A 5JQ4A 1NE9A 3SXOA 1Y9KA 2PC1A 2YNCC 2JDCA 2G0BA 5HMNA 2ZW5A 4MFPA 3SXNA 4M85A 1GHEA 2CNSA 2VI7A 2P6GA 1P0HA 1XE4A 2X7BA 1Q2YA 3D3SA 4CYQA 1M44A 4E8OA 1KUYA 4CGOA 2FL4A 2JEVA 4FD5A 2RC4A 5F47A 2FIWA 3G3SA 4GS4A 2WPWA 4FD6A 4KVME 4KUBA 4MFZA 4Y49B 1B6BA 3UY5A 1KZFA 3P2HA 4QBJA 2PSWA 4JLYA 3I9SA 5G22A 2FT0A 3RYOA 5CNPA 4UFXA 3EY5A 3SHPA 3T90A 4L89A 4F0YA 1XF8A 5H84A 1VKCA 1M4IA 1ZO0A 3TO7A 2K5TA 4R9MA 2C27A 4H89A 2G3AA 4H6UA 4IUSA 4J3GA 5J8CA 1NMTA 5E96A 2F5IA 1QSTA 5IV0A 4KVOE 2Z10A 2P0WA 4B13A 3PZJA 4KOSA 3H4QA 3DNSA 4KS9A 1YLEA 5DWMA 4L8AA 4KUAA 4KLVA 3FIXA 4A31A 2QMLA 3FNCA 2J8NA 4B14A 1K4JA 1S7KA 2B4DA 5G21A 2WPXA 5EBVA 4KOYA 3GY9A 1PU9A 3A9LA 3EFAA 3QB8A 1XEBA 4CS0B 2PDOA 5AG5A 2Y0MA 4JJXA 1YK3A 4CYPA 4AVAA 2Z0ZA 1Z4RA 2REFA 4CYNA 2Q4YA 4BBHA 4XPDC 4QC6A 3FRMA 4KOTA 3FXTA 3EXNA 1XIXA 3BLNA 1CJWA 2REEA 1Y9WA 2I79A 1ON0A 4NSQA 4JWPA 3P2FA 4JXRA 4XPKA 3TT2A 5DWNA 2WSAA 4AVCA 4HNYB 5A27A 2Z3KA 5KTCA 2AJ6A 1WWZA 4KOXA 1S60A 3IWEA 4MFQA 4CGPA 1MJ9A 4B10A 3R95A 2Q0YA 1LRZA 3CXSA 3G8WA 4UBRA 4AVBA 5H86A 1I21A 1SQHA 4CGMA 3TTHA 4C68A 4B5OA 1YGHA 2FIAA 1PUAA 4KORA 4R3LA 2P6FA 1Z4EA 5ISVA 2B4DB 4Q38A 4MFKA 2AE6A 1BOBA 3N7ZA 2O28A 2YNEA 4A33A 2WUUA 1YX0A 2VEZA 2Q7BA 4CRYB 5BWAB 1I12A 4ONUA 2BSWA 1YVOA 1M4GA 2VZZA 4CAXA 2J8RA 5AG6A 4B11A 4BMHA 2ZPAA 1IYLA 5A28A 4JD6A 3F5BA 1S7LA 4C2XA 1KUXA 2NMTA 4HNXB 2CNMA 2VXKA 2VZYA 2YNCA 4DNCA 2B4BA 4A2ZA 4E0AA 3CXQA 3KKWA 3D8PA 3R9FA 5F49A 2R7HA 4QUSA 1TIQA 4UWIA 4U9ZA 2A4NA 3ZJ0A 2YGWA 4KSAA 1NSLA 4PK2A 3IU1A 2ZW6A 4ORFA 2B5GA 4RS2A 4UA3A 4F0XA 4MI4A 5KTAA 2FE7A 3R9GA 3S6GA 1Y7RA 1RO5A 2R1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QSR A;  2Q44 A;  3IWG A;  2BUE A;  2B58 A;  3TOA A;  2PR8 A;  3C26 A;  2OB0 A;  3E0K A;  5I0C A;  1P4N A;  5C88 A;  3DDD A;  5FVJ A;  3R96 A;  3D2M A;  1QSM A;  2JDD A;  3FB3 A;  1IYK A;  3W91 A;  4Y49 C;  3VWE A;  4AG7 A;  5KTD A;  4XNH B;  3T9Y A;  3TO9 A;  4IF5 A;  2J8M A;  3F0A A;  3FBU A;  3LD2 A;  3ZZI A;  3S6H A;  2ZW7 A;  1Q2C A;  5IB0 A;  4R87 A;  2DXQ A;  4U9Y A;  4PV6 A;  2FCK A;  3DSB A;  2B5G B;  2QEC A;  4B5P A;  2OZU A;  4CRZ B;  4MHD A;  4AB7 A;  3DR6 A;  2JLM A;  5F46 A;  2OZG A;  1IB1 E;  4KLW A;  2G3T A;  4CAV A;  1M1D A;  2HV2 A;  1S7N A;  4KOV A;  1Q2D A;  1YRE A;  2FS5 A;  2Q04 A;  2VBQ A;  3I3G A;  3OWC A;  2EVN A;  3GYA A;  4OAE A;  4YGO A;  2HQY A;  2OH1 A;  3TOB A;  2P6E A;  4QB9 A;  3S6F A;  4LUA A;  1QSO A;  4KOW A;  4JXQ A;  4NEX A;  4XNH C;  2B3V A;  2FXF A;  4UWJ A;  3VWD A;  2CY2 A;  1IID A;  1FY7 A;  2ZW4 A;  2IL4 A;  2EUI A;  1V0C A;  4CAW A;  4EVY A;  4MY0 A;  3PGP A;  4X5K A;  4OAD A;  2PR1 A;  3EC4 A;  2QIR A;  3R9E A;  4NCZ A;  1WK4 A;  2HUZ A;  5GCN A;  3JVN A;  2BEI A;  1MJB A;  2GIV A;  3LOD A;  3MGD A;  4XPD B;  4B5P B;  2Q4V A;  1S3Z A;  3TCV A;  4E2A A;  2PQ8 A;  1VHS A;  4LX9 A;  4PSW A;  2BL1 A;  1I1D A;  3K9U A;  4R3K A;  1L0C A;  3NE7 A;  1CM0 A;  4F6A A;  5C82 A;  4HKF A;  1N71 A;  5F48 A;  3W6X A;  1QSN A;  4QVT A;  3V8I A;  5IX3 A;  2ATR A;  1KUV A;  3F8K A;  4ZBG A;  2R98 A;  2B3U A;  4YRH A;  1XMT A;  1J4J A;  2KCW A;  4KVX A;  2Z11 A;  3S6K A;  1S5K A;  4K30 A;  1IIC A;  4M3S A;  1Z9U A;  2CNT A;  4II9 A;  1M4D A;  4XPL A;  1MJA A;  2ZXV A;  4AG9 A;  3TO6 A;  4MJ8 A;  2PRB A;  3TE4 A;  4H6Z A;  2R8V A;  3CXP A;  4HNW B;  2D4O A;  2GAN A;  2GE3 A;  5HH1 A;  4U5Y A;  3DR8 A;  1OZP A;  1RXT A;  4YFJ A;  4NXY A;  5J8F A;  1MK4 A;  4I49 A;  3BJ8 A;  3TFY A;  3R1K A;  2ARH A;  4RI1 A;  4PSX A;  4OLL A;  4FD4 A;  1YVK A;  2VQY A;  5EC4 A;  1U6M A;  1YR0 A;  1B87 A;  2I00 A;  3QAH A;  1UFH A;  3BJ7 A;  1BO4 A;  2H5M A;  3IGR A;  4MY3 A;  2D4P A;  5JPH A;  3GKR A;  3WR7 A;  3PP9 A;  4MBU A;  4NF1 A;  1S7F A;  2FSR A;  4R57 A;  2OZH A;  3D2P A;  3FYN A;  4FD7 A;  4PK3 A;  3EO4 A;  3B8G A;  3W6S A;  4KZT A;  3JUW A;  2OU2 A;  4KOU A;  1R57 A;  5JQ4 A;  1NE9 A;  3SXO A;  1Y9K A;  2PC1 A;  2JDC A;  2G0B A;  5HMN A;  2ZW5 A;  3SXN A;  4M85 A;  1GHE A;  2CNS A;  2VI7 A;  2P6G A;  1P0H A;  1XE4 A;  2X7B A;  1Q2Y A;  3D3S A;  1M44 A;  4E8O A;  1KUY A;  2FL4 A;  2JEV A;  4FD5 A;  2RC4 A;  5F47 A;  2FIW A;  3G3S A;  4GS4 A;  2WPW A;  4FD6 A;  4KVM E;  4KUB A;  4Y49 B;  1B6B A;  3UY5 A;  1KZF A;  3P2H A;  4QBJ A;  2PSW A;  4JLY A;  3I9S A;  2FT0 A;  3RYO A;  5CNP A;  3EY5 A;  3SHP A;  3T90 A;  4L89 A;  4F0Y A;  1XF8 A;  5H84 A;  1VKC A;  1M4I A;  3TO7 A;  2K5T A;  4R9M A;  2C27 A;  4H89 A;  2G3A A;  4H6U A;  4IUS A;  4J3G A;  5J8C A;  1NMT A;  5E96 A;  2F5I A;  1QST A;  5IV0 A;  4KVO E;  2Z10 A;  2P0W A;  3PZJ A;  4KOS A;  3H4Q A;  3DNS A;  1YLE A;  5DWM A;  4L8A A;  4KUA A;  4KLV A;  3FIX A;  2QML A;  3FNC A;  2J8N A;  1K4J A;  1S7K A;  2B4D A;  2WPX A;  5EBV A;  4KOY A;  3GY9 A;  1PU9 A;  3EFA A;  3QB8 A;  1XEB A;  4CS0 B;  2PDO A;  2Y0M A;  4JJX A;  1YK3 A;  4AVA A;  2Z0Z A;  1Z4R A;  2REF A;  2Q4Y A;  4XPD C;  4QC6 A;  3FRM A;  4KOT A;  3FXT A;  3EXN A;  1XIX A;  3BLN A;  1CJW A;  2REE A;  1Y9W A;  2I79 A;  1ON0 A;  4NSQ A;  4JWP A;  3P2F A;  4JXR A;  4XPK A;  3TT2 A;  5DWN A;  4AVC A;  4HNY B;  5KTC A;  2AJ6 A;  1WWZ A;  4KOX A;  1S60 A;  1MJ9 A;  3R95 A;  2Q0Y A;  1LRZ A;  3CXS A;  3G8W A;  4UBR A;  4AVB A;  5H86 A;  1I21 A;  1SQH A;  3TTH A;  4B5O A;  1YGH A;  2FIA A;  1PUA A;  4KOR A;  4R3L A;  2P6F A;  1Z4E A;  5ISV A;  2B4D B;  2AE6 A;  1BOB A;  3N7Z A;  2O28 A;  1YX0 A;  2VEZ A;  2Q7B A;  4CRY B;  1I12 A;  4ONU A;  2BSW A;  1YVO A;  1M4G A;  2VZZ A;  4CAX A;  2J8R A;  4BMH A;  2ZPA A;  1IYL A;  4JD6 A;  3F5B A;  1S7L A;  1KUX A;  2NMT A;  4HNX B;  2CNM A;  2VXK A;  2VZY A;  4DNC A;  2B4B A;  4E0A A;  3CXQ A;  3KKW A;  3D8P A;  3R9F A;  5F49 A;  2R7H A;  4QUS A;  1TIQ A;  4UWI A;  4U9Z A;  2A4N A;  3ZJ0 A;  1NSL A;  4PK2 A;  2ZW6 A;  4ORF A;  2B5G A;  4RS2 A;  4UA3 A;  4MI4 A;  5KTA A;  2FE7 A;  3R9G A;  3S6G A;  1Y7R A;  1RO5 A;  2R1I A; 
#chains in the Genus database with same CATH topology
 1QSR A;  3KR5 A;  2Q44 A;  4PXC A;  4ZYQ A;  3IWG A;  1YW4 A;  1Y0R A;  3PB9 X;  2BUE A;  2B58 A;  3TOA A;  4KSF A;  3WC5 A;  5THW A;  2HB6 A;  2PR8 A;  3C26 A;  3NFZ A;  4CGN A;  4O23 A;  3NH4 A;  2OB0 A;  1OBR A;  4X3R A;  2NYQ A;  2Z3O A;  3E0K A;  5HVG A;  4ONW A;  5I0C A;  3JTK A;  1P4N A;  5C88 A;  3PB6 X;  3DDD A;  3K2K A;  5FVJ A;  2AFX A;  4EFD A;  3R96 A;  2FVG A;  3SJX A;  2DPT A;  3D2M A;  1QSM A;  2JDD A;  3FB3 A;  4WWV A;  4A32 A;  1IYK A;  3W91 A;  2Q4Z A;  4Y49 C;  3VWE A;  4A38 A;  4AG7 A;  5KTD A;  1VHO A;  1TKJ A;  4R76 A;  3S9M A;  4P4F A;  4XNH B;  3T9Y A;  3TO9 A;  4IF5 A;  2J8M A;  3F0A A;  4UEF A;  4C2Y A;  3FMC A;  2BCO A;  3FBU A;  1TF9 A;  1CP6 A;  3LD2 A;  4OC1 A;  3ZZI A;  4K3N A;  4JZ0 A;  3S6H A;  4IK2 A;  4CYO A;  3CPX A;  1BPN A;  4NGT A;  3JRU A;  4UFV A;  2ZW7 A;  1Q2C A;  5IB0 A;  4MCR A;  2CXA A;  4R87 A;  2DXQ A;  4U9Y A;  2DPS A;  4PV6 A;  2FCK A;  3DSB A;  2Z3N A;  4OME A;  4CAF A;  1AUG A;  2B5G B;  2QEC A;  4B5P A;  3RNZ A;  4ZGY B;  5HVH A;  2OZU A;  3QAY A;  1ZLI A;  4CRZ B;  4CAE A;  3IU2 A;  4MHD A;  5DS0 A;  4AB7 A;  4UCM A;  4LQ6 A;  4C7H A;  4A39 A;  4MMO A;  1HEE A;  3DR6 A;  3L2N A;  1LCP A;  2YND A;  2JLM A;  5F46 A;  2OZG A;  1IB1 E;  1VIX A;  1JQG A;  4KLW A;  2G3T A;  3KQX A;  4CAV A;  4H2K A;  5JGF A;  1M1D A;  4MFJ A;  2HV2 A;  3NA6 A;  1IOF A;  2ZEH A;  1LFW A;  4UIA A;  2V8H A;  1S7N A;  2DEA A;  1ZG7 A;  2XEG A;  4GXH A;  1Q2D A;  4KOV A;  1YRE A;  2AFM A;  3VH9 A;  2FS5 A;  4X2T A;  1IGB A;  2Q04 A;  4JYW A;  2PJ3 A;  4OP4 A;  2VBQ A;  3I3G A;  3OWC A;  1VHE A;  2EVN A;  2EWB A;  3GYA A;  4OAE A;  4YGO A;  3GIU A;  2HQY A;  4UCN A;  2OH1 A;  3TOB A;  2P6E A;  2WZN A;  4QB9 A;  4KSI A;  2PVW A;  1F57 A;  3S6F A;  4TWE A;  4LUA A;  4F9U A;  1QSO A;  3CZX A;  4DYO A;  4AXV A;  5LYL A;  4OIW A;  1HDU A;  4KOW A;  4JXQ A;  1LOK A;  4NEX A;  4TNU A;  4XNH C;  3N5F A;  3NE8 A;  2QYV A;  2B3V A;  2FXF A;  1BPM A;  4LQG A;  4UWJ A;  3VWD A;  2QJ8 A;  2CY2 A;  1BLL E;  4P44 A;  1IID A;  1FY7 A;  1IU8 A;  2ZW4 A;  5I4M A;  2CF4 A;  2IL4 A;  2EUI A;  1BAV A;  4HPS A;  1V0C A;  2V8D A;  4CAW A;  1CX8 A;  4EVY A;  4MY0 A;  3PGP A;  4X5K A;  4YWY A;  4BD9 A;  4OAD A;  4R8F A;  2PR1 A;  3EC4 A;  2IQ6 A;  2QIR A;  2EK9 A;  3R9E A;  4NCZ A;  1AYE A;  1WK4 A;  4P4I A;  5IB9 A;  3KHX A;  2HUZ A;  4G1P A;  5GCN A;  3JVN A;  2JEW A;  2ZEN A;  4DUK A;  2BEI A;  1MJB A;  2GIV A;  3LOD A;  3MGD A;  5G1Z A;  4XPD B;  4B12 A;  4B5P B;  2C6P A;  1LAN A;  1YME A;  2Q4V A;  1S3Z A;  1Z8X A;  3TCV A;  4E2A A;  2PQ8 A;  1R3N A;  1VHS A;  5D8N A;  4DJL A;  4CGL A;  1X10 A;  4OID A;  1YSJ A;  3B3V A;  2GLJ A;  4LX9 A;  4PSW A;  5AG4 A;  1YW6 A;  2BL1 A;  3DGV A;  5K8N A;  1UWY A;  2PJ7 A;  1I1D A;  3RBU A;  3K9U A;  3B3T A;  3ISX A;  1L0C A;  3NE7 A;  1CM0 A;  4R3K A;  3H5Z A;  4C7I A;  1CG2 A;  4F6A A;  5C82 A;  3H8F A;  4HKF A;  5AG7 A;  1N71 A;  5F48 A;  4FBE A;  4UCP A;  1QSN A;  4OC4 A;  4QVT A;  3V8I A;  4U5Y A;  3D67 A;  3W6X A;  3IIB A;  2ATR A;  6CPA A;  5IX3 A;  1KUV A;  3F8K A;  3NH5 A;  4ZBG A;  2R98 A;  1XBU A;  2B3U A;  4YRH A;  1XMT A;  4GM5 A;  1J4J A;  2KCW A;  3FVL A;  5D29 A;  4C2Z A;  4KVX A;  3IO1 A;  3V7Z A;  2Z11 A;  3LAC A;  3KR4 A;  2C6G A;  3S6K A;  4MCQ A;  1S5K A;  3PB4 X;  4K30 A;  2AFO A;  1IIC A;  2I3C A;  4M3S A;  2PJC A;  1Z9U A;  2RFH A;  2CNT A;  1HDQ A;  2PJ8 A;  2Q43 A;  3PB7 X;  4MCP A;  4II9 A;  1M4D A;  2Q51 A;  4XPL A;  4P4J A;  3KI9 A;  4NGN A;  3KZW A;  3GLJ A;  1MJA A;  2ZXV A;  3H8E A;  2ZED A;  4AG9 A;  4RUH A;  3TO6 A;  1RTQ A;  4MJ8 A;  2PRB A;  3TE4 A;  3WC7 A;  2Q7S A;  4H6Z A;  2R8V A;  2O53 A;  3CXP A;  2PJB A;  4HNW B;  2D4O A;  2GAN A;  4UFW A;  2GE3 A;  1XFO A;  3WT4 A;  3D7G A;  5HH1 A;  1R43 A;  3B3C A;  1OZP A;  1Y0Y A;  1RXT A;  2PJA A;  2PJ6 A;  3DR8 A;  4NGS A;  4NXY A;  3TC8 A;  4YFJ A;  3T8W A;  1JWQ A;  1TXR A;  2Z3M A;  3B7I A;  3FEE A;  5J8F A;  1MK4 A;  2F8H A;  3BJ8 A;  4I49 A;  1A2Z A;  3TFY A;  2ZEF A;  3R1K A;  3GUX A;  2ARH A;  4RI1 A;  4PSX A;  4MCS A;  4OLL A;  1NSA A;  2PRQ A;  3KL9 A;  3H8G A;  4IHM A;  5G20 A;  4FD4 A;  1YVK A;  2VQY A;  5EC4 A;  4A30 A;  1YQE A;  4R7M A;  1M4L A;  3KQZ A;  1U6M A;  1YR0 A;  3B3S A;  5AGE A;  1B87 A;  2I00 A;  3QAH A;  1UFH A;  3BJ7 A;  1BO4 A;  2H5M A;  3IGR A;  3QNV A;  3D68 A;  4MY3 A;  5LRJ A;  2D4P A;  5JPH A;  3GKR A;  1ZLH A;  2C1C A;  4Q36 A;  2Z3P A;  3WR7 A;  3PP9 A;  4MBU A;  2PJ4 A;  4NF1 A;  1S7F A;  3KGQ A;  2DF5 A;  3PEI A;  2FSR A;  1ARL A;  4R57 A;  2Z3L A;  3D7D A;  2OZH A;  3D2P A;  2PJ0 A;  1FT7 A;  3IEH A;  4A95 A;  3FYN A;  5LRK A;  4FD7 A;  3KAS A;  4PK3 A;  4YU9 A;  3EO4 A;  3B8G A;  4FAI A;  4MFL A;  4MHY A;  2BO9 A;  2HC9 A;  3W6S A;  5J1Q A;  4KZT A;  2V8G A;  3BI0 A;  1LAM A;  4EWT A;  4Q7A A;  4OC3 A;  8CPA A;  3CT9 A;  3RZA A;  4FUU A;  1XJO A;  2OU2 A;  2ZEO A;  1R57 A;  3JUW A;  2GU2 A;  4KOU A;  5EMI A;  2C6C A;  3WAB A;  7CPA A;  5JQ4 A;  1NE9 A;  2F7V A;  3SXO A;  1Y9K A;  4B6Z A;  2PC1 A;  2YNC C;  2JDC A;  2G0B A;  5HMN A;  4ZY2 A;  2ZW5 A;  4BIN A;  4MFP A;  3SXN A;  4M85 A;  1GHE A;  2CNS A;  2VI7 A;  4MHP A;  1IOI A;  2P6G A;  4M6I A;  3IC1 A;  3RAM A;  3BXM A;  1P0H A;  1XE4 A;  5K8M A;  4M6G A;  2X7B A;  1Q2Y A;  2XEJ A;  3D3S A;  4CYQ A;  1M44 A;  2JBK A;  5HXD A;  4E8O A;  1KUY A;  4MRI A;  4A37 A;  4IAV A;  4CGO A;  1QMU A;  4PXB A;  2FL4 A;  2JEV A;  4UIB A;  4FD5 A;  2RC4 A;  5F47 A;  2FIW A;  4F8Z A;  5F09 A;  3FED A;  3G3S A;  4GS4 A;  5HVF A;  1Q7L A;  1TF8 A;  2WPW A;  4FD6 A;  4KVM E;  4KUB A;  4MFZ A;  4P4E A;  1B6B A;  2PCU A;  4Y49 B;  3UY5 A;  1KZF A;  2ZEG A;  3P2H A;  4QBJ A;  2PSW A;  4ZX8 A;  4JLY A;  3VAT A;  3I9S A;  2PE3 A;  5G22 A;  3I1U A;  2FT0 A;  3RYO A;  5K8O A;  5CNP A;  4UFX A;  1EE3 P;  1CBX A;  3EY5 A;  3SHP A;  3MN8 A;  3T90 A;  4L89 A;  4F0Y A;  2PJ9 A;  1TKH A;  1XF8 A;  5H84 A;  1VKC A;  4OC0 A;  1M4I A;  1ZO0 A;  2GFQ A;  3TO7 A;  4OKO A;  2BOA A;  2K5T A;  2C27 A;  4H89 A;  2G3A A;  4H6U A;  4IUS A;  4J3G A;  4R9M A;  5J8C A;  3KHZ A;  1CPX A;  1NMT A;  2GRE A;  3FEC A;  5E96 A;  2F5I A;  1QST A;  5IV0 A;  3CPA A;  4KVO E;  4ZX9 A;  2ABZ A;  2Z10 A;  2P0W A;  2XEI A;  3PZJ A;  4KOS A;  4B13 A;  2AFZ A;  4R6T A;  3H4Q A;  3D7F A;  1DTD A;  3DNS A;  2QVP A;  3WC6 A;  1XOV A;  1YLE A;  4KS9 A;  3MRU A;  2ZOG A;  4L8A A;  3GB0 A;  4KUA A;  4KLV A;  4OC5 A;  4MXU A;  5DWM A;  3LMS A;  1ELL P;  5JM6 A;  2NSM A;  3FIX A;  4WJB A;  4A31 A;  3S9N A;  1PCA A;  2QML A;  3FNC A;  2J8N A;  1Z5R A;  4UEZ A;  4B14 A;  1K4J A;  1S7K A;  2B4D A;  5CPA A;  4F9V A;  4Z65 A;  2AFU A;  4PXE A;  5G21 A;  2WPX A;  5EBV A;  4KOY A;  3GY9 A;  1TKF A;  1PU9 A;  3D7H A;  1ARM A;  3HLP A;  3A9L A;  3EFA A;  4PXD A;  3QB8 A;  1XEB A;  2CTB A;  3FH4 A;  4CS0 B;  1GYT A;  2PDO A;  3SI0 A;  5AG5 A;  2ODF A;  2Y0M A;  1YK3 A;  4JJX A;  5LRG A;  4CYP A;  3PBB A;  4AVA A;  2Z0Z A;  1Z4R A;  2REF A;  4CYN A;  3FX6 A;  2Q4Y A;  4BBH A;  4EME A;  4XPD C;  4QC6 A;  3FRM A;  2AFW A;  2PIY A;  4KOT A;  1F2O A;  3B2Y A;  3SJE A;  3FXT A;  2EK8 A;  3EXN A;  1QQ9 A;  1XIX A;  3BLN A;  1CJW A;  2EO8 A;  2REE A;  1Y9W A;  2I79 A;  1XMB A;  2PVV A;  3D66 A;  1ON0 A;  3DLJ A;  2G9D A;  2V8V A;  2IMO A;  4NSQ A;  4JWP A;  3P2F A;  4JXR A;  4NJR A;  4PPZ A;  4XPK A;  3TT2 A;  1Z8T A;  5DWN A;  2WSA A;  4AVC A;  3FF3 A;  3IFE A;  2EBJ A;  4HNY B;  5A27 A;  2Z3K A;  2VL1 A;  5KTC A;  4UF4 A;  2AJ6 A;  1WWZ A;  4KOX A;  1S60 A;  3IWE A;  3IWW A;  3PB8 X;  4MFQ A;  4NGQ A;  5ELY A;  4CGP A;  1MJ9 A;  2ZEL A;  3RO0 A;  3ISZ A;  4B10 A;  4FWU A;  5JH9 A;  3R95 A;  3CDX A;  2Q0Y A;  2ZEP A;  1LRZ A;  3CXS A;  3G8W A;  2O4H A;  3LWU A;  4UBR A;  3TX8 A;  4ZI6 A;  4AVB A;  5H86 A;  2RB7 A;  1I21 A;  4X8I A;  1X12 A;  1PYT B;  1SQH A;  1Z2L A;  3SI1 A;  4CGM A;  3VAR A;  3TTH A;  5K8P A;  4A94 A;  1FNO A;  1KWM A;  3K9T A;  4C68 A;  2V77 A;  4P10 A;  1YGH A;  2PJ1 A;  4B5O A;  2FIA A;  1PUA A;  4KOR A;  3SJG A;  4R3L A;  4ZY0 A;  1ZG8 A;  2P6F A;  2IJZ A;  1Z4E A;  4M6H A;  1F2P A;  1ZG9 A;  5ISV A;  4P45 A;  2B4D B;  4Q38 A;  4MFK A;  1CPS A;  2AE6 A;  1BOB A;  3N7Z A;  1YLO A;  2O28 A;  2YNE A;  3PBE A;  4OC2 A;  2WUU A;  4W9Y A;  2OOT A;  4MHN A;  4A33 A;  1YX0 A;  4P4B A;  4PQA A;  3BI1 A;  2VEZ A;  2ZEE A;  2Q7B A;  4RN7 A;  4CRY B;  5BWA B;  1I12 A;  3B35 A;  2BSW A;  3NH8 A;  4ONU A;  5LYF A;  1YVO A;  1M4G A;  3FJU A;  2JBJ A;  1AMP A;  4ZY1 A;  2VZZ A;  2PJ5 A;  2J8R A;  5AG6 A;  4B11 A;  3B3W A;  4BMH A;  4CAX A;  2ZPA A;  2CIJ A;  3V38 A;  1IYL A;  5A28 A;  4JD6 A;  3F5B A;  1S7L A;  2AFS A;  4C2X A;  1KUX A;  2J9A A;  2POK A;  4P6Y A;  5LYI A;  2NMT A;  4HNX B;  2CNM A;  1VGY A;  3D4U A;  2VXK A;  2VZY A;  4NGR A;  2YNC A;  4CPA A;  1Z8L A;  3PRT A;  3SI2 A;  4DNC A;  2B4B A;  4MHZ A;  1CP7 A;  4A2Z A;  3BHX A;  1H8L A;  4E0A A;  4NGM A;  2ZOF A;  3CXQ A;  3D8P A;  3KKW A;  1Y7E A;  3SJF A;  3S9L A;  1XRY A;  3R9F A;  5F49 A;  2R7H A;  2GLF A;  4QUS A;  1TIQ A;  3IJ3 A;  4UWI A;  3PFO A;  4U9Z A;  2A4N A;  3HUV A;  5LYD A;  3ZJ0 A;  2CTC A;  2YGW A;  4KSA A;  4P4D A;  1NSL A;  1DE4 C;  1ELM P;  2PJ2 A;  2XEF A;  1IY7 A;  3IU1 A;  4PK2 A;  2ZW6 A;  4ORF A;  2B5G A;  4RS2 A;  4UA3 A;  4F0X A;  2WYR A;  4MI4 A;  5KTA A;  1LAP A;  2ANP A;  5CBM A;  2FE7 A;  4NJQ A;  4UEE A;  3R9G A;  3S6G A;  4NGP A;  2ZEM A;  2PIZ A;  4NFR A;  1Y7R A;  1Z8W A;  1RO5 A;  2OR4 A;  3PFE A;  2R1I A; 
#chains in the Genus database with same CATH homology
 1QSR A;  2Q44 A;  3IWG A;  2BUE A;  2B58 A;  3TOA A;  4KSF A;  2PR8 A;  3C26 A;  4CGN A;  2OB0 A;  2Z3O A;  3E0K A;  5I0C A;  3JTK A;  1P4N A;  5C88 A;  3DDD A;  5FVJ A;  3R96 A;  2DPT A;  3D2M A;  1QSM A;  2JDD A;  3FB3 A;  4A32 A;  1IYK A;  3W91 A;  4Y49 C;  3VWE A;  4AG7 A;  5KTD A;  4XNH B;  3T9Y A;  3TO9 A;  4IF5 A;  2J8M A;  3F0A A;  4C2Y A;  3FBU A;  3LD2 A;  3ZZI A;  3S6H A;  4CYO A;  4UFV A;  2ZW7 A;  1Q2C A;  5IB0 A;  2CXA A;  4R87 A;  2DXQ A;  4U9Y A;  2DPS A;  4PV6 A;  2FCK A;  3DSB A;  2Z3N A;  4CAF A;  2B5G B;  2QEC A;  4B5P A;  4ZGY B;  2OZU A;  4CRZ B;  4CAE A;  3IU2 A;  4MHD A;  4AB7 A;  4UCM A;  4C7H A;  3DR6 A;  2YND A;  2JLM A;  5F46 A;  2OZG A;  1IB1 E;  4KLW A;  2G3T A;  4CAV A;  1M1D A;  4MFJ A;  2HV2 A;  1S7N A;  4KOV A;  1Q2D A;  1YRE A;  2FS5 A;  2Q04 A;  2VBQ A;  3I3G A;  3OWC A;  2EVN A;  3GYA A;  4OAE A;  4YGO A;  2HQY A;  4UCN A;  2OH1 A;  3TOB A;  2P6E A;  4QB9 A;  3S6F A;  4LUA A;  1QSO A;  4KOW A;  4JXQ A;  4NEX A;  4XNH C;  2B3V A;  2FXF A;  4UWJ A;  3VWD A;  2CY2 A;  1IID A;  1FY7 A;  2ZW4 A;  2IL4 A;  2EUI A;  1V0C A;  4CAW A;  4EVY A;  4MY0 A;  3PGP A;  4X5K A;  4OAD A;  2PR1 A;  3EC4 A;  2QIR A;  3R9E A;  4NCZ A;  1WK4 A;  2HUZ A;  5GCN A;  3JVN A;  2BEI A;  1MJB A;  2GIV A;  3LOD A;  3MGD A;  5G1Z A;  4XPD B;  4B12 A;  4B5P B;  2Q4V A;  1S3Z A;  3TCV A;  4E2A A;  2PQ8 A;  1VHS A;  4CGL A;  4LX9 A;  4PSW A;  5AG4 A;  2BL1 A;  1I1D A;  3K9U A;  4R3K A;  1L0C A;  3NE7 A;  1CM0 A;  3H5Z A;  4C7I A;  4F6A A;  5C82 A;  4HKF A;  5AG7 A;  1N71 A;  5F48 A;  4UCP A;  1QSN A;  4QVT A;  3V8I A;  3W6X A;  5IX3 A;  2ATR A;  1KUV A;  3F8K A;  4ZBG A;  2R98 A;  2B3U A;  4YRH A;  1XMT A;  1J4J A;  2KCW A;  4C2Z A;  4KVX A;  2Z11 A;  3S6K A;  1S5K A;  4K30 A;  1IIC A;  4M3S A;  1Z9U A;  2CNT A;  4II9 A;  1M4D A;  4XPL A;  1MJA A;  2ZXV A;  4AG9 A;  3TO6 A;  4MJ8 A;  2PRB A;  3TE4 A;  4H6Z A;  2R8V A;  3CXP A;  4HNW B;  2D4O A;  2GAN A;  4UFW A;  2GE3 A;  5HH1 A;  4U5Y A;  3DR8 A;  1OZP A;  1RXT A;  4YFJ A;  4NXY A;  2Z3M A;  5J8F A;  1MK4 A;  4I49 A;  3BJ8 A;  3TFY A;  3R1K A;  2ARH A;  4RI1 A;  4PSX A;  4OLL A;  5G20 A;  4FD4 A;  1YVK A;  2VQY A;  5EC4 A;  4A30 A;  1U6M A;  1YR0 A;  5AGE A;  1B87 A;  2I00 A;  3QAH A;  1UFH A;  3BJ7 A;  1BO4 A;  2H5M A;  3IGR A;  4MY3 A;  2D4P A;  5JPH A;  3GKR A;  4Q36 A;  2Z3P A;  3WR7 A;  3PP9 A;  4MBU A;  4NF1 A;  1S7F A;  2FSR A;  4R57 A;  2Z3L A;  2OZH A;  3D2P A;  4A95 A;  3FYN A;  4FD7 A;  4PK3 A;  3EO4 A;  3B8G A;  4MFL A;  3W6S A;  4KZT A;  3JUW A;  2OU2 A;  4KOU A;  1R57 A;  5JQ4 A;  1NE9 A;  3SXO A;  1Y9K A;  2PC1 A;  2YNC C;  2JDC A;  2G0B A;  5HMN A;  2ZW5 A;  4MFP A;  3SXN A;  4M85 A;  1GHE A;  2CNS A;  2VI7 A;  2P6G A;  1P0H A;  1XE4 A;  2X7B A;  1Q2Y A;  3D3S A;  4CYQ A;  1M44 A;  4E8O A;  1KUY A;  4CGO A;  2FL4 A;  2JEV A;  4FD5 A;  2RC4 A;  5F47 A;  2FIW A;  3G3S A;  4GS4 A;  2WPW A;  4FD6 A;  4KVM E;  4KUB A;  4MFZ A;  4Y49 B;  1B6B A;  3UY5 A;  1KZF A;  3P2H A;  4QBJ A;  2PSW A;  4JLY A;  3I9S A;  5G22 A;  2FT0 A;  3RYO A;  5CNP A;  4UFX A;  3EY5 A;  3SHP A;  3T90 A;  4L89 A;  4F0Y A;  1XF8 A;  5H84 A;  1VKC A;  1M4I A;  1ZO0 A;  3TO7 A;  2K5T A;  4R9M A;  2C27 A;  4H89 A;  2G3A A;  4H6U A;  4IUS A;  4J3G A;  5J8C A;  1NMT A;  5E96 A;  2F5I A;  1QST A;  5IV0 A;  4KVO E;  2Z10 A;  2P0W A;  4B13 A;  3PZJ A;  4KOS A;  3H4Q A;  3DNS A;  4KS9 A;  1YLE A;  5DWM A;  4L8A A;  4KUA A;  4KLV A;  3FIX A;  4A31 A;  2QML A;  3FNC A;  2J8N A;  4B14 A;  1K4J A;  1S7K A;  2B4D A;  5G21 A;  2WPX A;  5EBV A;  4KOY A;  3GY9 A;  1PU9 A;  3A9L A;  3EFA A;  3QB8 A;  1XEB A;  4CS0 B;  2PDO A;  5AG5 A;  2Y0M A;  4JJX A;  1YK3 A;  4CYP A;  4AVA A;  2Z0Z A;  1Z4R A;  2REF A;  4CYN A;  2Q4Y A;  4BBH A;  4XPD C;  4QC6 A;  3FRM A;  4KOT A;  3FXT A;  3EXN A;  1XIX A;  3BLN A;  1CJW A;  2REE A;  1Y9W A;  2I79 A;  1ON0 A;  4NSQ A;  4JWP A;  3P2F A;  4JXR A;  4XPK A;  3TT2 A;  5DWN A;  2WSA A;  4AVC A;  4HNY B;  5A27 A;  2Z3K A;  5KTC A;  2AJ6 A;  1WWZ A;  4KOX A;  1S60 A;  3IWE A;  4MFQ A;  4CGP A;  1MJ9 A;  4B10 A;  3R95 A;  2Q0Y A;  1LRZ A;  3CXS A;  3G8W A;  4UBR A;  4AVB A;  5H86 A;  1I21 A;  1SQH A;  4CGM A;  3TTH A;  4C68 A;  4B5O A;  1YGH A;  2FIA A;  1PUA A;  4KOR A;  4R3L A;  2P6F A;  1Z4E A;  5ISV A;  2B4D B;  4Q38 A;  4MFK A;  2AE6 A;  1BOB A;  3N7Z A;  2O28 A;  2YNE A;  4A33 A;  2WUU A;  1YX0 A;  2VEZ A;  2Q7B A;  4CRY B;  5BWA B;  1I12 A;  4ONU A;  2BSW A;  1YVO A;  1M4G A;  2VZZ A;  4CAX A;  2J8R A;  5AG6 A;  4B11 A;  4BMH A;  2ZPA A;  1IYL A;  5A28 A;  4JD6 A;  3F5B A;  1S7L A;  4C2X A;  1KUX A;  2NMT A;  4HNX B;  2CNM A;  2VXK A;  2VZY A;  2YNC A;  4DNC A;  2B4B A;  4A2Z A;  4E0A A;  3CXQ A;  3KKW A;  3D8P A;  3R9F A;  5F49 A;  2R7H A;  4QUS A;  1TIQ A;  4UWI A;  4U9Z A;  2A4N A;  3ZJ0 A;  2YGW A;  4KSA A;  1NSL A;  4PK2 A;  3IU1 A;  2ZW6 A;  4ORF A;  2B5G A;  4RS2 A;  4UA3 A;  4F0X A;  4MI4 A;  5KTA A;  2FE7 A;  3R9G A;  3S6G A;  1Y7R A;  1RO5 A;  2R1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...