1QSRA

Crystal structure of tetrahymena gcn5 with bound acetyl-coenzyme a
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
162
structure length
162
Chain Sequence
LDFDILTNDGTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMVILKNKQKVIGGICFRQYKPQRFAEVAFLAVTANEQVRGYGTRLMNKFKDHMQKQNIEYLLTYADNFAIGYFKKQGFTKEHRMPQEKWKGYIKDYDGGTLMECYIHPYVDYGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Tetrahymena GCN5 bound to coenzyme A and a histone H3 peptide.
pubmed doi rcsb
source organism Tetrahymena thermophila
molecule tags Transferase
molecule keywords TGCN5 HISTONE ACETYL TRANSFERASE
total genus 47
structure length 162
sequence length 162
ec nomenclature ec 2.3.1.-:
pdb deposition date 1999-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1qsrA00
5JPHA 2Z0ZA 2J8NA 4F6AA 2B3VA 3P2HA 1OZPA 3F0AA 1QSMA 1YREA 1BOBA 4KVME 4AVBA 4KOXA 3TTHA 2P6EA 4EVYA 4DNCA 4E8OA 2I00A 1NMTA 1IB1E 1Y9KA 4PSXA 3P2FA 3S6GA 2Q0YA 1XEBA 2ZW4A 3EY5A 2Z10A 1ON0A 2PR8A 3MGDA 3V8IA 3TOAA 2H5MA 4NEXA 1S7FA 3R9GA 2WPXA 4U9ZA 2AE6A 3S6FA 3VWEA 2B58A 1M1DA 2Q44A 3GY9A 2JDCA 1TIQA 4RS2A 4KORA 4HNYB 1WK4A 2VQYA 2Q7BA 2K5TA 4NSQA 4CRZB 2VI7A 2JDDA 3FNCA 2Q04A 4B5PA 4KLWA 4MJ8A 1XIXA 1CM0A 3OWCA 5H86A 4YGOA 3SXOA 2R7HA 2EVNA 4L8AA 5GCNA 3LD2A 4PK3A 2G3TA 1YK3A 2ZW7A 2D4PA 4B5OA 1FY7A 2OH1A 5C88A 4QC6A 4KOYA 4KLVA 4KUBA 1RXTA 2PRBA 2QMLA 1XMTA 5IX3A 1Y7RA 1IICA 4FD5A 4NF1A 1YX0A 4JWPA 1Q2CA 1P4NA 4QBJA 1YLEA 2P6FA 1B6BA 3KKWA 2DXQA 2R98A 4UWIA 2PC1A 1S60A 4CS0B 2P6GA 4ONUA 5I0CA 4JJXA 3SHPA 3PZJA 4R57A 4GS4A 3FYNA 3CXQA 4Y49B 2X7BA 3WR7A 4CRYB 5F49A 4ORFA 2JEVA 1QSOA 2F5IA 3R9EA 4JXRA 4CAXA 3DDDA 3R96A 2VBQA 2B4DB 5F47A 4YRHA 2OZUA 3RYOA 1Q2DA 5H84A 4KOSA 1VHSA 2R8VA 3DSBA 5ISVA 3CXSA 1I1DA 3W6XA 3FBUA 3T90A 2GANA 3IGRA 1MK4A 3DR8A 2B5GA 3TE4A 4E2AA 2BL1A 4XPLA 2PR1A 2OZGA 2PQ8A 2VZZA 3ZZIA 1YGHA 4XNHB 4U5YA 3G8WA 1QSNA 2BSWA 3FIXA 4F0YA 2HUZA 2P0WA 5DWMA 2ZW6A 3VWDA 3BLNA 1Z4RA 3R95A 4OADA 5J8FA 3H4QA 1K4JA 3B8GA 3JVNA 4R3KA 4NXYA 1M4GA 4HNXB 4MBUA 1BO4A 5C82A 3PP9A 1IIDA 2O28A 4K30A 1V0CA 2B3UA 3K9UA 4FD6A 4M85A 1NSLA 2FIAA 4M3SA 5FVJA 4XPDC 3BJ8A 4CAVA 2GE3A 2QIRA 1VKCA 2ARHA 3I3GA 4KOWA 4LX9A 1IYKA 2JLMA 4UWJA 4XPDB 2Z11A 4PK2A 1MJAA 3FRMA 4AVCA 1XE4A 1Z9UA 2ATRA 5F48A 2FT0A 2EUIA 4MHDA 3S6HA 1PUAA 4PSWA 2G0BA 2OB0A 3TT2A 2FXFA 4IF5A 3T9YA 3G3SA 4KOUA 4RI1A 4FD4A 1KUYA 1YVOA 5IV0A 1U6MA 2ZXVA 3CXPA 5KTCA 1N71A 1R57A 2ZW5A 3LODA 2FE7A 2D4OA 4MY0A 1M4IA 2VXKA 4IUSA 2RC4A 2Y0MA 2ZPAA 4XPKA 1M44A 1WWZA 4JXQA 3TCVA 5HMNA 1S5KA 4B5PB 3TO7A 4UA3A 3R1KA 4KOTA 2I79A 2REFA 3BJ7A 1MJ9A 2HV2A 3E0KA 1GHEA 4KVXA 2WPWA 4H6UA 3TO6A 1Y9WA 2FCKA 1QSTA 2NMTA 3TFYA 2FIWA 4KUAA 2B4BA 1S7KA 3TOBA 3N7ZA 2CNMA 3GKRA 2OZHA 4KZTA 3QAHA 1UFHA 4X5KA 1XF8A 3EC4A 3F5BA 5J8CA 1CJWA 4XNHC 1YVKA 1L0CA 4R87A 5F46A 5E96A 5EBVA 2R1IA 3DR6A 3D3SA 1B87A 1S3ZA 5CNPA 3NE7A 3W91A 4PV6A 2CY2A 4U9YA 4AG7A 2QECA 4H89A 3I9SA 4NCZA 3FB3A 1IYLA 5KTAA 3D8PA 1RO5A 3IWGA 4BMHA 2VEZA 1NE9A 4HKFA 4OLLA 4MY3A 4CAWA 4I49A 3UY5A 3C26A 4JD6A 2PDOA 4HNWB 2J8RA 2FSRA 2Q4YA 1Q2YA 4R3LA 3FXTA 4E0AA 1QSRA 2GIVA 4II9A 1I12A 1M4DA 3EXNA 5KTDA 2B4DA 2HQYA 2G3AA 4AB7A 2VZYA 4AG9A 4MI4A 5EC4A 2BUEA 2FL4A 4H6ZA 3SXNA 5DWNA 3D2MA 4ZBGA 2REEA 2B5GB 4KVOE 4R9MA 4J3GA 2Q4VA 3ZJ0A 3D2PA 2CNSA 4QUSA 1MJBA 1J4JA 5HH1A 2KCWA 3W6SA 1S7NA 3TO9A 1YR0A 2BEIA 4KOVA 4QB9A 1S7LA 2A4NA 2AJ6A 4LUAA 4FD7A 3R9FA 2PSWA 2OU2A 3F8KA 3DNSA 4JLYA 3GYAA 4OAEA 5IB0A 1KUVA 3S6KA 1KZFA 3JUWA 2J8MA 1KUXA 4AVAA 2FS5A 3PGPA 4L89A 4QVTA 2IL4A 1P0HA 2C27A 4Y49C 3QB8A 1PU9A 5JQ4A 1Z4EA 2CNTA 4YFJA 4UBRA 1I21A 1LRZA 3EFAA 3EO4A 1SQHA
chains in the Genus database with same CATH superfamily
5JPHA 2Z0ZA 1Y0YA 2ABZA 2J8NA 4EFDA 4F6AA 3PFEA 2B3VA 5BWAB 3P2HA 1HDQA 4WJBA 1OZPA 3F0AA 4OC0A 4P10A 1QSMA 1YREA 4BBHA 1BOBA 4KVME 4AVBA 4CGMA 4KOXA 3TTHA 2P6EA 1TF8A 4EVYA 5LYDA 4DNCA 4E8OA 3FEEA 2HC9A 2I00A 1NMTA 1IB1E 1Y9KA 4PSXA 1X10A 2ZEPA 4OIWA 3B3SA 3KHXA 3P2FA 3S6GA 4NFRA 3PBBA 4UFVA 2Q0YA 3SI0A 1XEBA 2ZW4A 3EY5A 5G21A 7CPAA 4F9UA 2Z10A 1ELMP 4PXCA 1ON0A 2DPTA 2IJZA 2V8DA 4CYQA 1NSAA 2PR8A 3MGDA 3V8IA 3S9MA 3TOAA 2H5MA 4NEXA 1ZG9A 4TNUA 4EMEA 1S7FA 3R9GA 2WPXA 1BLLE 4U9ZA 2AE6A 3S6FA 3VWEA 3IU1A 2B58A 3BI0A 3IU2A 1M1DA 2IMOA 2ZEFA 4NGQA 2Q44A 2PJ0A 1TXRA 3GY9A 5CBMA 2JDCA 3CPAA 4P6YA 1TIQA 2PJ7A 1JWQA 2F7VA 4KORA 3BXMA 4RS2A 4HNYB 4GM5A 1WK4A 2CTCA 2VQYA 4JZ0A 2Q7BA 2K5TA 4NSQA 5LRKA 4NGSA 3PB8X 4CRZB 1F57A 2VI7A 2JDDA 3PFOA 2V8VA 2XEJA 3PBEA 3FNCA 4UIAA 2Q04A 4B5PA 2POKA 1ARMA 4CAFA 1LCPA 4ONWA 4KLWA 3S9NA 4NGMA 1XMBA 1TKHA 2Q4ZA 4AXVA 1Z5RA 1A2ZA 5K8MA 4MJ8A 1RTQA 1XIXA 4P44A 4BINA 3PRTA 3KGQA 4NJRA 3V38A 1CM0A 3OWCA 5H86A 4C7HA 2JBKA 2WSAA 1TKFA 4YGOA 3SXOA 1AUGA 1XOVA 2R7HA 3DGVA 5IB0A 4PXDA 3SJXA 3D7FA 4A39A 2EVNA 4L8AA 5A28A 4EWTA 4KS9A 4C7IA 4CYNA 5GCNA 4MFZA 3LD2A 3HUVA 2Z3LA 4PK3A 3CDXA 2QYVA 2G3TA 4JYWA 2ANPA 1YK3A 2ZW7A 4MFQA 5AG7A 2D4PA 2AFMA 4B5OA 1FY7A 2Z3PA 3CPXA 2PE3A 2XEGA 4B10A 4NGNA 2NSMA 1ELLP 5EMIA 2F8HA 2OH1A 4P45A 4CAEA 5C88A 4FAIA 4QC6A 4ZY0A 5D8NA 3SJFA 3WT4A 4KOYA 3I1UA 4KSFA 4UFWA 4OC5A 2BOAA 4KLVA 3CZXA 1Z2LA 4KUBA 1F2PA 1RXTA 5K8NA 4IAVA 4X3RA 1PCAA 2PRBA 3B3VA 2QMLA 4TWEA 1XMTA 5IX3A 1Y7RA 5G22A 1CBXA 4W9YA 1IICA 2G9DA 4CGNA 4FD5A 5THWA 4CGPA 4NF1A 4A2ZA 3A9LA 2XEFA 1YX0A 2AFWA 4JWPA 1Q2CA 1GYTA 1P4NA 4QBJA 1YLEA 2P6FA 1B6BA 3KKWA 2DXQA 2R98A 4KSAA 2PC1A 1S60A 2WZNA 4UWIA 3RZAA 4CS0B 2P6GA 4ONUA 4H2KA 2C1CA 4JJXA 3SHPA 5I0CA 3PZJA 1DE4C 2OOTA 4R57A 1FNOA 4GS4A 3ISZA 3FYNA 2HB6A 3CXQA 4Y49B 1YW4A 3JRUA 2X7BA 4C2ZA 3IEHA 5G1ZA 3WR7A 1CPXA 2AFXA 4CRYB 5F49A 4ORFA 3IJ3A 2JEVA 5LRGA 4ZX8A 2GFQA 4A38A 1QSOA 2F5IA 3TC8A 4UEFA 3RO0A 3R9EA 4JXRA 4CAXA 3DDDA 3R96A 2VBQA 4HPSA 4B13A 2B4DB 1VHOA 3KZWA 1FT7A 5F47A 5AG6A 4YRHA 3MRUA 2PJBA 5CPAA 4LQGA 2OZUA 3D66A 4OIDA 5ELYA 3RYOA 3KI9A 3IIBA 1Q2DA 1DTDA 3K2KA 5H84A 4KOSA 1UWYA 5HVHA 1VHSA 2R8VA 3DSBA 5ISVA 5J1QA 1TF9A 2PJ6A 3CXSA 1I1DA 3W6XA 3FBUA 4OC2A 2GANA 2WYRA 3IGRA 5HVFA 1MK4A 3T90A 3DR8A 3LACA 3MN8A 3NH8A 2B5GA 2Q51A 4E2AA 3K9TA 3TE4A 3BHXA 2BL1A 4XPLA 1JQGA 2GREA 2PR1A 4Q36A 3L2NA 2OZGA 2PJ1A 3D68A 2GU2A 1TKJA 1LAPA 2PQ8A 4M6IA 2VZZA 4ZY1A 3B3TA 3ZZIA 1YGHA 2J9AA 1AMPA 2YNDA 4XNHB 2JEWA 4U5YA 3G8WA 1QSNA 2BSWA 3FIXA 4F0YA 2HUZA 1Y0RA 3S9LA 2P0WA 5DWMA 4P4JA 4MHNA 2ZW6A 3VWDA 3BLNA 3TX8A 1Z4RA 3R95A 4OADA 2ZENA 2O53A 2ZOGA 3FJUA 3FX6A 5A27A 2YNCA 5J8FA 4FWUA 3H4QA 1K4JA 3B8GA 3JVNA 4MHYA 4R3KA 5LYLA 4NXYA 1OBRA 4CGLA 6CPAA 3QNVA 2PJ3A 3SJGA 3GUXA 1M4GA 4HNXB 4MFJA 4MBUA 4MFPA 3PB7X 1BO4A 4BD9A 5C82A 2ZEMA 3PP9A 4DJLA 1EE3P 1IIDA 2O28A 2C6CA 8CPAA 4K30A 2CIJA 3KR5A 4YU9A 2GLFA 1V0CA 2B3UA 3K9UA 4FD6A 1LOKA 4UIBA 1BPMA 1ZG8A 4FBEA 3BI1A 4M85A 1NSLA 2FIAA 2PCUA 3FF3A 4M3SA 4MCRA 5FVJA 1ZLIA 4XPDC 2RFHA 3BJ8A 4B11A 2DPSA 2PJ2A 2GE3A 4CAVA 2QIRA 1PYTB 1VKCA 2ARHA 3I3GA 3JTKA 3KL9A 4KOWA 4LX9A 4UEEA 1IYKA 1M4LA 2JLMA 4IK2A 4UF4A 4UWJA 4XPDB 5AG4A 2Z11A 5D29A 4PK2A 1MJAA 4CPAA 4NJQA 4RUHA 3FRMA 3T8WA 2PRQA 4C2YA 4AVCA 1XE4A 4Q7AA 1Z9UA 2ATRA 4A31A 1X12A 4NGPA 3FH4A 4F8ZA 5F48A 2FT0A 2EUIA 3ISXA 4MHDA 3S6HA 3FMCA 1PUAA 2Z3OA 4PSWA 2G0BA 2OB0A 3TT2A 2FXFA 4IF5A 3T9YA 3G3SA 1Z8XA 4KOUA 2EK9A 2PVWA 3GB0A 1BPNA 4RI1A 3NH4A 1F2OA 3DLJA 4FD4A 1KUYA 1YVOA 2V8HA 5IB9A 1Z8WA 3NH5A 4MFKA 4OKOA 1U6MA 2ZXVA 3CXPA 4NGTA 5LYIA 5IV0A 5KTCA 5LYFA 1YLOA 4A33A 1N71A 1R57A 2ZW5A 3LODA 4Q38A 2BO9A 4OC4A 2FE7A 3D4UA 3FVLA 1XFOA 4MHZA 2ZEHA 4MMOA 3H5ZA 2D4OA 4MY0A 1M4IA 4AG9A 2VXKA 4IUSA 4P4EA 1IOIA 2RC4A 2Y0MA 2ZPAA 4XPKA 4MXUA 4R7MA 1M44A 1WWZA 3NFZA 4JXQA 4PPZA 2RB7A 3TCVA 5HMNA 1VIXA 3B3CA 4WWVA 2CF4A 2XEIA 5HXDA 2ZELA 1S5KA 4B5PB 2BCOA 4A32A 3TO7A 4UA3A 3R1KA 4KOTA 2I79A 2REFA 3BJ7A 2YGWA 4UCMA 3QAYA 2PVVA 1MJ9A 2HV2A 3E0KA 1GHEA 2PIYA 1YQEA 4KVXA 2WPWA 1XJOA 2O4HA 3LMSA 4H6UA 1R3NA 3TO6A 3IWWA 1CX8A 3VATA 2EBJA 1ARLA 4M6HA 2GLJA 1Y9WA 2FCKA 4OC1A 1QSTA 1VGYA 2NMTA 3TFYA 2ZEOA 2JBJA 2DF5A 1LFWA 2FIWA 4C68A 1IOFA 4KUAA 4DYOA 2B4BA 2ZEDA 3H8FA 4UCNA 1S7KA 4X8IA 3TOBA 3B2YA 5JGFA 4FUUA 3N5FA 4KSIA 2CNMA 3GKRA 2OZHA 3KQXA 3N7ZA 2PJAA 4KZTA 1CPSA 3QAHA 1UFHA 4X5KA 4RN7A 3B35A 4X2TA 1XF8A 4ZGYB 3EC4A 2V8GA 3F5BA 1CJWA 5J8CA 2Z3NA 4Z65A 1XRYA 4XNHC 4CYPA 2Q43A 3IWEA 1YVKA 1IY7A 1L0CA 3SJEA 3IFEA 4R87A 2OR4A 4MCQA 5F46A 5E96A 5EBVA 3WC5A 4UEZA 2IQ6A 2ZEGA 2R1IA 3DR6A 1LAMA 3CT9A 2AFSA 4UFXA 3RBUA 3D3SA 1B87A 1S3ZA 5CNPA 3NE7A 3W91A 4PV6A 5K8PA 3RNZA 2CY2A 3KR4A 4B12A 1Y7EA 4U9YA 4AG7A 1Z8TA 2QECA 4H89A 3I9SA 3B3WA 4NCZA 3FB3A 4P4IA 1IYLA 2PJCA 5KTAA 3PEIA 2FVGA 1RO5A 3D8PA 4ZI6A 3IWGA 2EWBA 4BMHA 1QQ9A 3D7GA 2VEZA 3D7HA 1NE9A 4HKFA 4OLLA 4C2XA 4MY3A 3VARA 4CAWA 3D67A 3SI2A 4I49A 5HVGA 3UY5A 3C26A 1HEEA 4M6GA 4CGOA 2Q7SA 4JD6A 2PDOA 4HNWB 2J8RA 3NA6A 2FSRA 4A37A 2Q4YA 1Q2YA 4R3LA 2V77A 2CTBA 3FXTA 4E0AA 1QSRA 2GIVA 4II9A 3WC6A 3LWUA 5AG5A 1HDUA 1I12A 1YMEA 2DEAA 1M4DA 2VL1A 4OMEA 3EXNA 4OP4A 4MCSA 2B4DA 2HQYA 3SI1A 4CYOA 2PJ9A 2CXAA 5KTDA 2G3AA 4OC3A 4PXBA 4AB7A 4K3NA 2C6GA 3GIUA 5JM6A 2VZYA 3IC1A 4R76A 4LQ6A 4MI4A 5EC4A 2BUEA 2PJ5A 1VHEA 5G20A 2FL4A 4A30A 3RAMA 1QMUA 5JH9A 4H6ZA 3D7DA 3SXNA 1Q7LA 5DWNA 3KHZA 2Z3MA 4G1PA 3D2MA 4YWYA 4ZX9A 4F0XA 1ZLHA 3KQZA 4ZBGA 2REEA 1ZG7A 2B5GB 4KVOE 5K8OA 4R9MA 4IHMA 1YW6A 4J3GA 3PB9X 2Q4VA 3ZJ0A 3D2PA 2QVPA 1R43A 2EO8A 2CNSA 3B7IA 5AGEA 4QUSA 1MJBA 2ODFA 4MHPA 1J4JA 4B6ZA 5LRJA 5HH1A 2KCWA 3W6SA 1S7NA 4MRIA 1KWMA 3TO9A 1YR0A 4A95A 2BEIA 4KOVA 1IGBA 4QB9A 4A94A 1S7LA 2C6PA 1CP6A 2A4NA 4ZYQA 4MCPA 2AJ6A 2PIZA 4B14A 1XBUA 3KASA 1ZO0A 4LUAA 2PJ8A 3FEDA 2YNCC 4FD7A 4R8FA 3R9FA 1AYEA 3FECA 2PSWA 2OU2A 2NYQA 1H8LA 3F8KA 2ZEEA 3DNSA 4JLYA 3GYAA 4OAEA 3GLJA 4P4DA 1KUVA 4P4FA 1KZFA 3JUWA 4UCPA 1LANA 3S6KA 2J8MA 3WABA 2EK8A 1CG2A 4GXHA 5F09A 1KUXA 4PQAA 1BAVA 4AVAA 2FS5A 2PJ4A 1YSJA 2YNEA 2ZOFA 2AFUA 2QJ8A 3PGPA 4L89A 4O23A 2IL4A 4QVTA 1P0HA 2C27A 4Y49C 5DS0A 3QB8A 3HLPA 5I4MA 1CP7A 4R6TA 3VH9A 4F9VA 4NGRA 4ZY2A 1PU9A 5JQ4A 1Z4EA 3V7ZA 2CNTA 1Z8LA 2AFZA 3PB4X 3PB6X 2I3CA 3H8EA 4YFJA 3NE8A 4UBRA 3WC7A 4DUKA 4P4BA 3IO1A 2AFOA 1I21A 2Z3KA 1IU8A 1LRZA 3EFAA 3H8GA 3EO4A 1SQHA 2WUUA 4PXEA 4MFLA
chains in the Genus database with same CATH topology
5JPHA 2Z0ZA 2J8NA 4F6AA 2B3VA 5BWAB 3P2HA 1OZPA 3F0AA 1QSMA 1YREA 4BBHA 1BOBA 4KVME 4AVBA 4CGMA 4KOXA 3TTHA 2P6EA 4EVYA 4DNCA 4E8OA 2I00A 1NMTA 1IB1E 1Y9KA 4PSXA 3P2FA 3S6GA 4UFVA 2Q0YA 1XEBA 2ZW4A 3EY5A 5G21A 2Z10A 1ON0A 2DPTA 4CYQA 2PR8A 3MGDA 3V8IA 3TOAA 2H5MA 4NEXA 1S7FA 3R9GA 2WPXA 4U9ZA 2AE6A 3S6FA 3VWEA 3IU1A 2B58A 3IU2A 1M1DA 2Q44A 3GY9A 2JDCA 1TIQA 4RS2A 4KORA 4HNYB 1WK4A 2VQYA 2Q7BA 2K5TA 4NSQA 4CRZB 2VI7A 2JDDA 3FNCA 2Q04A 4B5PA 4CAFA 4KLWA 4MJ8A 1XIXA 1CM0A 3OWCA 5H86A 4C7HA 2WSAA 4YGOA 3SXOA 2R7HA 2EVNA 4L8AA 5A28A 4KS9A 4C7IA 4CYNA 5GCNA 4MFZA 3LD2A 2Z3LA 4PK3A 2G3TA 4MFQA 5AG7A 1YK3A 2ZW7A 2D4PA 4B5OA 1FY7A 2Z3PA 4B10A 2OH1A 4CAEA 5C88A 4QC6A 4KOYA 4KSFA 4UFWA 4KLVA 4KUBA 1RXTA 2PRBA 2QMLA 1XMTA 5IX3A 1Y7RA 5G22A 1IICA 4CGNA 4FD5A 4CGPA 4NF1A 4A2ZA 3A9LA 1YX0A 4JWPA 1Q2CA 1P4NA 4QBJA 1YLEA 2P6FA 1B6BA 3KKWA 2DXQA 2R98A 4KSAA 2PC1A 1S60A 4UWIA 4CS0B 2P6GA 4ONUA 5I0CA 4JJXA 3SHPA 3PZJA 4R57A 4GS4A 3FYNA 3CXQA 4Y49B 2X7BA 4C2ZA 5G1ZA 3WR7A 4CRYB 5F49A 4ORFA 2JEVA 1QSOA 2F5IA 3R9EA 4JXRA 4CAXA 3DDDA 3R96A 2VBQA 4B13A 2B4DB 5F47A 5AG6A 4YRHA 2OZUA 3RYOA 1Q2DA 5H84A 4KOSA 1VHSA 2R8VA 3DSBA 5ISVA 3CXSA 1I1DA 3W6XA 3FBUA 3T90A 2GANA 3IGRA 1MK4A 3DR8A 2B5GA 3TE4A 4E2AA 2BL1A 4XPLA 2PR1A 4Q36A 2OZGA 2PQ8A 2VZZA 3ZZIA 1YGHA 2YNDA 4XNHB 4U5YA 3G8WA 1QSNA 2BSWA 3FIXA 4F0YA 2HUZA 2P0WA 5DWMA 2ZW6A 3VWDA 3BLNA 1Z4RA 3R95A 4OADA 5A27A 2YNCA 5J8FA 3H4QA 1K4JA 3B8GA 3JVNA 4R3KA 4NXYA 4CGLA 1M4GA 4HNXB 4MFJA 4MBUA 4MFPA 1BO4A 5C82A 3PP9A 1IIDA 2O28A 4K30A 1V0CA 2B3UA 3K9UA 4FD6A 4M85A 1NSLA 2FIAA 4M3SA 5FVJA 4XPDC 4B11A 3BJ8A 4CAVA 2DPSA 2GE3A 2QIRA 1VKCA 2ARHA 3I3GA 3JTKA 4KOWA 4LX9A 1IYKA 2JLMA 4UWJA 4XPDB 5AG4A 2Z11A 4PK2A 1MJAA 3FRMA 4C2YA 4AVCA 1XE4A 1Z9UA 2ATRA 4A31A 5F48A 2FT0A 2EUIA 4MHDA 3S6HA 1PUAA 2Z3OA 4PSWA 2G0BA 2OB0A 3TT2A 2FXFA 4IF5A 3T9YA 3G3SA 4KOUA 4RI1A 4FD4A 1KUYA 1YVOA 4MFKA 5IV0A 1U6MA 2ZXVA 3CXPA 5KTCA 4A33A 1N71A 1R57A 2ZW5A 3LODA 4Q38A 2FE7A 3H5ZA 2D4OA 4MY0A 1M4IA 2VXKA 4IUSA 2RC4A 2Y0MA 2ZPAA 4XPKA 1M44A 1WWZA 4JXQA 3TCVA 5HMNA 1S5KA 4B5PB 4A32A 3TO7A 4UA3A 3R1KA 4KOTA 2I79A 2REFA 3BJ7A 2YGWA 4UCMA 1MJ9A 2HV2A 3E0KA 1GHEA 4KVXA 2WPWA 4H6UA 3TO6A 1Y9WA 2FCKA 1QSTA 2NMTA 3TFYA 2FIWA 4C68A 4KUAA 2B4BA 4UCNA 1S7KA 3TOBA 3N7ZA 2CNMA 2OZHA 3GKRA 4KZTA 3QAHA 1UFHA 4X5KA 1XF8A 4ZGYB 3EC4A 3F5BA 5J8CA 1CJWA 2Z3NA 4XNHC 4CYPA 3IWEA 1YVKA 1L0CA 4R87A 5F46A 5E96A 5EBVA 2R1IA 3DR6A 4UFXA 3D3SA 1B87A 1S3ZA 5CNPA 3NE7A 3W91A 4PV6A 2CY2A 4B12A 4U9YA 4AG7A 2QECA 4H89A 3I9SA 4NCZA 3FB3A 1IYLA 5KTAA 3D8PA 1RO5A 3IWGA 4BMHA 2VEZA 1NE9A 4HKFA 4OLLA 4C2XA 4MY3A 4CAWA 4I49A 3UY5A 3C26A 4CGOA 4JD6A 2PDOA 4HNWB 2J8RA 2FSRA 2Q4YA 1Q2YA 4R3LA 3FXTA 4E0AA 1QSRA 2GIVA 4II9A 5AG5A 1I12A 1M4DA 3EXNA 5KTDA 2B4DA 2HQYA 4CYOA 2CXAA 2G3AA 4AB7A 2VZYA 4AG9A 4MI4A 5EC4A 2BUEA 4A30A 5G20A 2FL4A 4H6ZA 3SXNA 5DWNA 2Z3MA 3D2MA 4F0XA 4ZBGA 2REEA 2B5GB 4KVOE 4R9MA 4J3GA 2Q4VA 3ZJ0A 3D2PA 2CNSA 5AGEA 4QUSA 1MJBA 1J4JA 5HH1A 2KCWA 3W6SA 1S7NA 3TO9A 1YR0A 4A95A 2BEIA 4KOVA 4QB9A 1S7LA 2A4NA 2AJ6A 4B14A 1ZO0A 4LUAA 4FD7A 2YNCC 3R9FA 2PSWA 2OU2A 3F8KA 3DNSA 4JLYA 3GYAA 4OAEA 5IB0A 1KUVA 3S6KA 1KZFA 3JUWA 4UCPA 2J8MA 1KUXA 4AVAA 2FS5A 2YNEA 3PGPA 4L89A 4QVTA 2IL4A 1P0HA 2C27A 4Y49C 3QB8A 1PU9A 5JQ4A 1Z4EA 2CNTA 4YFJA 4UBRA 1I21A 2Z3KA 1LRZA 3EFAA 3EO4A 1SQHA 2WUUA 4MFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JPH A;  2Z0Z A;  2J8N A;  4F6A A;  2B3V A;  3P2H A;  1OZP A;  3F0A A;  1QSM A;  1YRE A;  1BOB A;  4KVM E;  4AVB A;  4KOX A;  3TTH A;  2P6E A;  4EVY A;  4DNC A;  4E8O A;  2I00 A;  1NMT A;  1IB1 E;  1Y9K A;  4PSX A;  3P2F A;  3S6G A;  2Q0Y A;  1XEB A;  2ZW4 A;  3EY5 A;  2Z10 A;  1ON0 A;  2PR8 A;  3MGD A;  3V8I A;  3TOA A;  2H5M A;  4NEX A;  1S7F A;  3R9G A;  2WPX A;  4U9Z A;  2AE6 A;  3S6F A;  3VWE A;  2B58 A;  1M1D A;  2Q44 A;  3GY9 A;  2JDC A;  1TIQ A;  4RS2 A;  4KOR A;  4HNY B;  1WK4 A;  2VQY A;  2Q7B A;  2K5T A;  4NSQ A;  4CRZ B;  2VI7 A;  2JDD A;  3FNC A;  2Q04 A;  4B5P A;  4KLW A;  4MJ8 A;  1XIX A;  1CM0 A;  3OWC A;  5H86 A;  4YGO A;  3SXO A;  2R7H A;  2EVN A;  4L8A A;  5GCN A;  3LD2 A;  4PK3 A;  2G3T A;  1YK3 A;  2ZW7 A;  2D4P A;  4B5O A;  1FY7 A;  2OH1 A;  5C88 A;  4QC6 A;  4KOY A;  4KLV A;  4KUB A;  1RXT A;  2PRB A;  2QML A;  1XMT A;  5IX3 A;  1Y7R A;  1IIC A;  4FD5 A;  4NF1 A;  1YX0 A;  4JWP A;  1Q2C A;  1P4N A;  4QBJ A;  1YLE A;  2P6F A;  1B6B A;  3KKW A;  2DXQ A;  2R98 A;  4UWI A;  2PC1 A;  1S60 A;  4CS0 B;  2P6G A;  4ONU A;  5I0C A;  4JJX A;  3SHP A;  3PZJ A;  4R57 A;  4GS4 A;  3FYN A;  3CXQ A;  4Y49 B;  2X7B A;  3WR7 A;  4CRY B;  5F49 A;  4ORF A;  2JEV A;  1QSO A;  2F5I A;  3R9E A;  4JXR A;  4CAX A;  3DDD A;  3R96 A;  2VBQ A;  2B4D B;  5F47 A;  4YRH A;  2OZU A;  3RYO A;  1Q2D A;  5H84 A;  4KOS A;  1VHS A;  2R8V A;  3DSB A;  5ISV A;  3CXS A;  1I1D A;  3W6X A;  3FBU A;  3T90 A;  2GAN A;  3IGR A;  1MK4 A;  3DR8 A;  2B5G A;  3TE4 A;  4E2A A;  2BL1 A;  4XPL A;  2PR1 A;  2OZG A;  2PQ8 A;  2VZZ A;  3ZZI A;  1YGH A;  4XNH B;  4U5Y A;  3G8W A;  1QSN A;  2BSW A;  3FIX A;  4F0Y A;  2HUZ A;  2P0W A;  5DWM A;  2ZW6 A;  3VWD A;  3BLN A;  1Z4R A;  3R95 A;  4OAD A;  5J8F A;  3H4Q A;  1K4J A;  3B8G A;  3JVN A;  4R3K A;  4NXY A;  1M4G A;  4HNX B;  4MBU A;  1BO4 A;  5C82 A;  3PP9 A;  1IID A;  2O28 A;  4K30 A;  1V0C A;  2B3U A;  3K9U A;  4FD6 A;  4M85 A;  1NSL A;  2FIA A;  4M3S A;  5FVJ A;  4XPD C;  3BJ8 A;  4CAV A;  2GE3 A;  2QIR A;  1VKC A;  2ARH A;  3I3G A;  4KOW A;  4LX9 A;  1IYK A;  2JLM A;  4UWJ A;  4XPD B;  2Z11 A;  4PK2 A;  1MJA A;  3FRM A;  4AVC A;  1XE4 A;  1Z9U A;  2ATR A;  5F48 A;  2FT0 A;  2EUI A;  4MHD A;  3S6H A;  1PUA A;  4PSW A;  2G0B A;  2OB0 A;  3TT2 A;  2FXF A;  4IF5 A;  3T9Y A;  3G3S A;  4KOU A;  4RI1 A;  4FD4 A;  1KUY A;  1YVO A;  5IV0 A;  1U6M A;  2ZXV A;  3CXP A;  5KTC A;  1N71 A;  1R57 A;  2ZW5 A;  3LOD A;  2FE7 A;  2D4O A;  4MY0 A;  1M4I A;  2VXK A;  4IUS A;  2RC4 A;  2Y0M A;  2ZPA A;  4XPK A;  1M44 A;  1WWZ A;  4JXQ A;  3TCV A;  5HMN A;  1S5K A;  4B5P B;  3TO7 A;  4UA3 A;  3R1K A;  4KOT A;  2I79 A;  2REF A;  3BJ7 A;  1MJ9 A;  2HV2 A;  3E0K A;  1GHE A;  4KVX A;  2WPW A;  4H6U A;  3TO6 A;  1Y9W A;  2FCK A;  1QST A;  2NMT A;  3TFY A;  2FIW A;  4KUA A;  2B4B A;  1S7K A;  3TOB A;  3N7Z A;  2CNM A;  3GKR A;  2OZH A;  4KZT A;  3QAH A;  1UFH A;  4X5K A;  1XF8 A;  3EC4 A;  3F5B A;  5J8C A;  1CJW A;  4XNH C;  1YVK A;  1L0C A;  4R87 A;  5F46 A;  5E96 A;  5EBV A;  2R1I A;  3DR6 A;  3D3S A;  1B87 A;  1S3Z A;  5CNP A;  3NE7 A;  3W91 A;  4PV6 A;  2CY2 A;  4U9Y A;  4AG7 A;  2QEC A;  4H89 A;  3I9S A;  4NCZ A;  3FB3 A;  1IYL A;  5KTA A;  3D8P A;  1RO5 A;  3IWG A;  4BMH A;  2VEZ A;  1NE9 A;  4HKF A;  4OLL A;  4MY3 A;  4CAW A;  4I49 A;  3UY5 A;  3C26 A;  4JD6 A;  2PDO A;  4HNW B;  2J8R A;  2FSR A;  2Q4Y A;  1Q2Y A;  4R3L A;  3FXT A;  4E0A A;  1QSR A;  2GIV A;  4II9 A;  1I12 A;  1M4D A;  3EXN A;  5KTD A;  2B4D A;  2HQY A;  2G3A A;  4AB7 A;  2VZY A;  4AG9 A;  4MI4 A;  5EC4 A;  2BUE A;  2FL4 A;  4H6Z A;  3SXN A;  5DWN A;  3D2M A;  4ZBG A;  2REE A;  2B5G B;  4KVO E;  4R9M A;  4J3G A;  2Q4V A;  3ZJ0 A;  3D2P A;  2CNS A;  4QUS A;  1MJB A;  1J4J A;  5HH1 A;  2KCW A;  3W6S A;  1S7N A;  3TO9 A;  1YR0 A;  2BEI A;  4KOV A;  4QB9 A;  1S7L A;  2A4N A;  2AJ6 A;  4LUA A;  4FD7 A;  3R9F A;  2PSW A;  2OU2 A;  3F8K A;  3DNS A;  4JLY A;  3GYA A;  4OAE A;  5IB0 A;  1KUV A;  3S6K A;  1KZF A;  3JUW A;  2J8M A;  1KUX A;  4AVA A;  2FS5 A;  3PGP A;  4L89 A;  4QVT A;  2IL4 A;  1P0H A;  2C27 A;  4Y49 C;  3QB8 A;  1PU9 A;  5JQ4 A;  1Z4E A;  2CNT A;  4YFJ A;  4UBR A;  1I21 A;  1LRZ A;  3EFA A;  3EO4 A;  1SQH A; 
#chains in the Genus database with same CATH topology
 5JPH A;  2Z0Z A;  1Y0Y A;  2ABZ A;  2J8N A;  4EFD A;  4F6A A;  3PFE A;  2B3V A;  5BWA B;  3P2H A;  1HDQ A;  4WJB A;  1OZP A;  3F0A A;  4OC0 A;  4P10 A;  1QSM A;  1YRE A;  4BBH A;  1BOB A;  4KVM E;  4AVB A;  4CGM A;  4KOX A;  3TTH A;  2P6E A;  1TF8 A;  4EVY A;  5LYD A;  4DNC A;  4E8O A;  3FEE A;  2HC9 A;  2I00 A;  1NMT A;  1IB1 E;  1Y9K A;  4PSX A;  1X10 A;  2ZEP A;  4OIW A;  3B3S A;  3KHX A;  3P2F A;  3S6G A;  4NFR A;  3PBB A;  4UFV A;  2Q0Y A;  3SI0 A;  1XEB A;  2ZW4 A;  3EY5 A;  5G21 A;  7CPA A;  4F9U A;  2Z10 A;  1ELM P;  4PXC A;  1ON0 A;  2DPT A;  2IJZ A;  2V8D A;  4CYQ A;  1NSA A;  2PR8 A;  3MGD A;  3V8I A;  3S9M A;  3TOA A;  2H5M A;  4NEX A;  1ZG9 A;  4TNU A;  4EME A;  1S7F A;  3R9G A;  2WPX A;  1BLL E;  4U9Z A;  2AE6 A;  3S6F A;  3VWE A;  3IU1 A;  2B58 A;  3BI0 A;  3IU2 A;  1M1D A;  2IMO A;  2ZEF A;  4NGQ A;  2Q44 A;  2PJ0 A;  1TXR A;  3GY9 A;  5CBM A;  2JDC A;  3CPA A;  4P6Y A;  1TIQ A;  2PJ7 A;  1JWQ A;  2F7V A;  4KOR A;  3BXM A;  4RS2 A;  4HNY B;  4GM5 A;  1WK4 A;  2CTC A;  2VQY A;  4JZ0 A;  2Q7B A;  2K5T A;  4NSQ A;  5LRK A;  4NGS A;  3PB8 X;  4CRZ B;  1F57 A;  2VI7 A;  2JDD A;  3PFO A;  2V8V A;  2XEJ A;  3PBE A;  3FNC A;  4UIA A;  2Q04 A;  4B5P A;  2POK A;  1ARM A;  4CAF A;  1LCP A;  4ONW A;  4KLW A;  3S9N A;  4NGM A;  1XMB A;  1TKH A;  2Q4Z A;  4AXV A;  1Z5R A;  1A2Z A;  5K8M A;  4MJ8 A;  1RTQ A;  1XIX A;  4P44 A;  4BIN A;  3PRT A;  3KGQ A;  4NJR A;  3V38 A;  1CM0 A;  3OWC A;  5H86 A;  4C7H A;  2JBK A;  2WSA A;  1TKF A;  4YGO A;  3SXO A;  1AUG A;  1XOV A;  2R7H A;  3DGV A;  5IB0 A;  4PXD A;  3SJX A;  3D7F A;  4A39 A;  2EVN A;  4L8A A;  5A28 A;  4EWT A;  4KS9 A;  4C7I A;  4CYN A;  5GCN A;  4MFZ A;  3LD2 A;  3HUV A;  2Z3L A;  4PK3 A;  3CDX A;  2QYV A;  2G3T A;  4JYW A;  2ANP A;  1YK3 A;  2ZW7 A;  4MFQ A;  5AG7 A;  2D4P A;  2AFM A;  4B5O A;  1FY7 A;  2Z3P A;  3CPX A;  2PE3 A;  2XEG A;  4B10 A;  4NGN A;  2NSM A;  1ELL P;  5EMI A;  2F8H A;  2OH1 A;  4P45 A;  4CAE A;  5C88 A;  4FAI A;  4QC6 A;  4ZY0 A;  5D8N A;  3SJF A;  3WT4 A;  4KOY A;  3I1U A;  4KSF A;  4UFW A;  4OC5 A;  2BOA A;  4KLV A;  3CZX A;  1Z2L A;  4KUB A;  1F2P A;  1RXT A;  5K8N A;  4IAV A;  4X3R A;  1PCA A;  2PRB A;  3B3V A;  2QML A;  4TWE A;  1XMT A;  5IX3 A;  1Y7R A;  5G22 A;  1CBX A;  4W9Y A;  1IIC A;  2G9D A;  4CGN A;  4FD5 A;  5THW A;  4CGP A;  4NF1 A;  4A2Z A;  3A9L A;  2XEF A;  1YX0 A;  2AFW A;  4JWP A;  1Q2C A;  1GYT A;  1P4N A;  4QBJ A;  1YLE A;  2P6F A;  1B6B A;  3KKW A;  2DXQ A;  2R98 A;  4KSA A;  2PC1 A;  1S60 A;  2WZN A;  4UWI A;  3RZA A;  4CS0 B;  2P6G A;  4ONU A;  4H2K A;  2C1C A;  4JJX A;  3SHP A;  5I0C A;  3PZJ A;  1DE4 C;  2OOT A;  4R57 A;  1FNO A;  4GS4 A;  3ISZ A;  3FYN A;  2HB6 A;  3CXQ A;  4Y49 B;  1YW4 A;  3JRU A;  2X7B A;  4C2Z A;  3IEH A;  5G1Z A;  3WR7 A;  1CPX A;  2AFX A;  4CRY B;  5F49 A;  4ORF A;  3IJ3 A;  2JEV A;  5LRG A;  4ZX8 A;  2GFQ A;  4A38 A;  1QSO A;  2F5I A;  3TC8 A;  4UEF A;  3RO0 A;  3R9E A;  4JXR A;  4CAX A;  3DDD A;  3R96 A;  2VBQ A;  4HPS A;  4B13 A;  2B4D B;  1VHO A;  3KZW A;  1FT7 A;  5F47 A;  5AG6 A;  4YRH A;  3MRU A;  2PJB A;  5CPA A;  4LQG A;  2OZU A;  3D66 A;  4OID A;  5ELY A;  3RYO A;  3KI9 A;  3IIB A;  1Q2D A;  1DTD A;  3K2K A;  5H84 A;  4KOS A;  1UWY A;  5HVH A;  1VHS A;  2R8V A;  3DSB A;  5ISV A;  5J1Q A;  1TF9 A;  2PJ6 A;  3CXS A;  1I1D A;  3W6X A;  3FBU A;  4OC2 A;  2GAN A;  2WYR A;  3IGR A;  5HVF A;  1MK4 A;  3T90 A;  3DR8 A;  3LAC A;  3MN8 A;  3NH8 A;  2B5G A;  2Q51 A;  4E2A A;  3K9T A;  3TE4 A;  3BHX A;  2BL1 A;  4XPL A;  1JQG A;  2GRE A;  2PR1 A;  4Q36 A;  3L2N A;  2OZG A;  2PJ1 A;  3D68 A;  2GU2 A;  1TKJ A;  1LAP A;  2PQ8 A;  4M6I A;  2VZZ A;  4ZY1 A;  3B3T A;  3ZZI A;  1YGH A;  2J9A A;  1AMP A;  2YND A;  4XNH B;  2JEW A;  4U5Y A;  3G8W A;  1QSN A;  2BSW A;  3FIX A;  4F0Y A;  2HUZ A;  1Y0R A;  3S9L A;  2P0W A;  5DWM A;  4P4J A;  4MHN A;  2ZW6 A;  3VWD A;  3BLN A;  3TX8 A;  1Z4R A;  3R95 A;  4OAD A;  2ZEN A;  2O53 A;  2ZOG A;  3FJU A;  3FX6 A;  5A27 A;  2YNC A;  5J8F A;  4FWU A;  3H4Q A;  1K4J A;  3B8G A;  3JVN A;  4MHY A;  4R3K A;  5LYL A;  4NXY A;  1OBR A;  4CGL A;  6CPA A;  3QNV A;  2PJ3 A;  3SJG A;  3GUX A;  1M4G A;  4HNX B;  4MFJ A;  4MBU A;  4MFP A;  3PB7 X;  1BO4 A;  4BD9 A;  5C82 A;  2ZEM A;  3PP9 A;  4DJL A;  1EE3 P;  1IID A;  2O28 A;  2C6C A;  8CPA A;  4K30 A;  2CIJ A;  3KR5 A;  4YU9 A;  2GLF A;  1V0C A;  2B3U A;  3K9U A;  4FD6 A;  1LOK A;  4UIB A;  1BPM A;  1ZG8 A;  4FBE A;  3BI1 A;  4M85 A;  1NSL A;  2FIA A;  2PCU A;  3FF3 A;  4M3S A;  4MCR A;  5FVJ A;  1ZLI A;  4XPD C;  2RFH A;  3BJ8 A;  4B11 A;  2DPS A;  2PJ2 A;  2GE3 A;  4CAV A;  2QIR A;  1PYT B;  1VKC A;  2ARH A;  3I3G A;  3JTK A;  3KL9 A;  4KOW A;  4LX9 A;  4UEE A;  1IYK A;  1M4L A;  2JLM A;  4IK2 A;  4UF4 A;  4UWJ A;  4XPD B;  5AG4 A;  2Z11 A;  5D29 A;  4PK2 A;  1MJA A;  4CPA A;  4NJQ A;  4RUH A;  3FRM A;  3T8W A;  2PRQ A;  4C2Y A;  4AVC A;  1XE4 A;  4Q7A A;  1Z9U A;  2ATR A;  4A31 A;  1X12 A;  4NGP A;  3FH4 A;  4F8Z A;  5F48 A;  2FT0 A;  2EUI A;  3ISX A;  4MHD A;  3S6H A;  3FMC A;  1PUA A;  2Z3O A;  4PSW A;  2G0B A;  2OB0 A;  3TT2 A;  2FXF A;  4IF5 A;  3T9Y A;  3G3S A;  1Z8X A;  4KOU A;  2EK9 A;  2PVW A;  3GB0 A;  1BPN A;  4RI1 A;  3NH4 A;  1F2O A;  3DLJ A;  4FD4 A;  1KUY A;  1YVO A;  2V8H A;  5IB9 A;  1Z8W A;  3NH5 A;  4MFK A;  4OKO A;  1U6M A;  2ZXV A;  3CXP A;  4NGT A;  5LYI A;  5IV0 A;  5KTC A;  5LYF A;  1YLO A;  4A33 A;  1N71 A;  1R57 A;  2ZW5 A;  3LOD A;  4Q38 A;  2BO9 A;  4OC4 A;  2FE7 A;  3D4U A;  3FVL A;  1XFO A;  4MHZ A;  2ZEH A;  4MMO A;  3H5Z A;  2D4O A;  4MY0 A;  1M4I A;  4AG9 A;  2VXK A;  4IUS A;  4P4E A;  1IOI A;  2RC4 A;  2Y0M A;  2ZPA A;  4XPK A;  4MXU A;  4R7M A;  1M44 A;  1WWZ A;  3NFZ A;  4JXQ A;  4PPZ A;  2RB7 A;  3TCV A;  5HMN A;  1VIX A;  3B3C A;  4WWV A;  2CF4 A;  2XEI A;  5HXD A;  2ZEL A;  1S5K A;  4B5P B;  2BCO A;  4A32 A;  3TO7 A;  4UA3 A;  3R1K A;  4KOT A;  2I79 A;  2REF A;  3BJ7 A;  2YGW A;  4UCM A;  3QAY A;  2PVV A;  1MJ9 A;  2HV2 A;  3E0K A;  1GHE A;  2PIY A;  1YQE A;  4KVX A;  2WPW A;  1XJO A;  2O4H A;  3LMS A;  4H6U A;  1R3N A;  3TO6 A;  3IWW A;  1CX8 A;  3VAT A;  2EBJ A;  1ARL A;  4M6H A;  2GLJ A;  1Y9W A;  2FCK A;  4OC1 A;  1QST A;  1VGY A;  2NMT A;  3TFY A;  2ZEO A;  2JBJ A;  2DF5 A;  1LFW A;  2FIW A;  4C68 A;  1IOF A;  4KUA A;  4DYO A;  2B4B A;  2ZED A;  3H8F A;  4UCN A;  1S7K A;  4X8I A;  3TOB A;  3B2Y A;  5JGF A;  4FUU A;  3N5F A;  4KSI A;  2CNM A;  3GKR A;  2OZH A;  3KQX A;  3N7Z A;  2PJA A;  4KZT A;  1CPS A;  3QAH A;  1UFH A;  4X5K A;  4RN7 A;  3B35 A;  4X2T A;  1XF8 A;  4ZGY B;  3EC4 A;  2V8G A;  3F5B A;  1CJW A;  5J8C A;  2Z3N A;  4Z65 A;  1XRY A;  4XNH C;  4CYP A;  2Q43 A;  3IWE A;  1YVK A;  1IY7 A;  1L0C A;  3SJE A;  3IFE A;  4R87 A;  2OR4 A;  4MCQ A;  5F46 A;  5E96 A;  5EBV A;  3WC5 A;  4UEZ A;  2IQ6 A;  2ZEG A;  2R1I A;  3DR6 A;  1LAM A;  3CT9 A;  2AFS A;  4UFX A;  3RBU A;  3D3S A;  1B87 A;  1S3Z A;  5CNP A;  3NE7 A;  3W91 A;  4PV6 A;  5K8P A;  3RNZ A;  2CY2 A;  3KR4 A;  4B12 A;  1Y7E A;  4U9Y A;  4AG7 A;  1Z8T A;  2QEC A;  4H89 A;  3I9S A;  3B3W A;  4NCZ A;  3FB3 A;  4P4I A;  1IYL A;  2PJC A;  5KTA A;  3PEI A;  2FVG A;  1RO5 A;  3D8P A;  4ZI6 A;  3IWG A;  2EWB A;  4BMH A;  1QQ9 A;  3D7G A;  2VEZ A;  3D7H A;  1NE9 A;  4HKF A;  4OLL A;  4C2X A;  4MY3 A;  3VAR A;  4CAW A;  3D67 A;  3SI2 A;  4I49 A;  5HVG A;  3UY5 A;  3C26 A;  1HEE A;  4M6G A;  4CGO A;  2Q7S A;  4JD6 A;  2PDO A;  4HNW B;  2J8R A;  3NA6 A;  2FSR A;  4A37 A;  2Q4Y A;  1Q2Y A;  4R3L A;  2V77 A;  2CTB A;  3FXT A;  4E0A A;  1QSR A;  2GIV A;  4II9 A;  3WC6 A;  3LWU A;  5AG5 A;  1HDU A;  1I12 A;  1YME A;  2DEA A;  1M4D A;  2VL1 A;  4OME A;  3EXN A;  4OP4 A;  4MCS A;  2B4D A;  2HQY A;  3SI1 A;  4CYO A;  2PJ9 A;  2CXA A;  5KTD A;  2G3A A;  4OC3 A;  4PXB A;  4AB7 A;  4K3N A;  2C6G A;  3GIU A;  5JM6 A;  2VZY A;  3IC1 A;  4R76 A;  4LQ6 A;  4MI4 A;  5EC4 A;  2BUE A;  2PJ5 A;  1VHE A;  5G20 A;  2FL4 A;  4A30 A;  3RAM A;  1QMU A;  5JH9 A;  4H6Z A;  3D7D A;  3SXN A;  1Q7L A;  5DWN A;  3KHZ A;  2Z3M A;  4G1P A;  3D2M A;  4YWY A;  4ZX9 A;  4F0X A;  1ZLH A;  3KQZ A;  4ZBG A;  2REE A;  1ZG7 A;  2B5G B;  4KVO E;  5K8O A;  4R9M A;  4IHM A;  1YW6 A;  4J3G A;  3PB9 X;  2Q4V A;  3ZJ0 A;  3D2P A;  2QVP A;  1R43 A;  2EO8 A;  2CNS A;  3B7I A;  5AGE A;  4QUS A;  1MJB A;  2ODF A;  4MHP A;  1J4J A;  4B6Z A;  5LRJ A;  5HH1 A;  2KCW A;  3W6S A;  1S7N A;  4MRI A;  1KWM A;  3TO9 A;  1YR0 A;  4A95 A;  2BEI A;  4KOV A;  1IGB A;  4QB9 A;  4A94 A;  1S7L A;  2C6P A;  1CP6 A;  2A4N A;  4ZYQ A;  4MCP A;  2AJ6 A;  2PIZ A;  4B14 A;  1XBU A;  3KAS A;  1ZO0 A;  4LUA A;  2PJ8 A;  3FED A;  2YNC C;  4FD7 A;  4R8F A;  3R9F A;  1AYE A;  3FEC A;  2PSW A;  2OU2 A;  2NYQ A;  1H8L A;  3F8K A;  2ZEE A;  3DNS A;  4JLY A;  3GYA A;  4OAE A;  3GLJ A;  4P4D A;  1KUV A;  4P4F A;  1KZF A;  3JUW A;  4UCP A;  1LAN A;  3S6K A;  2J8M A;  3WAB A;  2EK8 A;  1CG2 A;  4GXH A;  5F09 A;  1KUX A;  4PQA A;  1BAV A;  4AVA A;  2FS5 A;  2PJ4 A;  1YSJ A;  2YNE A;  2ZOF A;  2AFU A;  2QJ8 A;  3PGP A;  4L89 A;  4O23 A;  2IL4 A;  4QVT A;  1P0H A;  2C27 A;  4Y49 C;  5DS0 A;  3QB8 A;  3HLP A;  5I4M A;  1CP7 A;  4R6T A;  3VH9 A;  4F9V A;  4NGR A;  4ZY2 A;  1PU9 A;  5JQ4 A;  1Z4E A;  3V7Z A;  2CNT A;  1Z8L A;  2AFZ A;  3PB4 X;  3PB6 X;  2I3C A;  3H8E A;  4YFJ A;  3NE8 A;  4UBR A;  3WC7 A;  4DUK A;  4P4B A;  3IO1 A;  2AFO A;  1I21 A;  2Z3K A;  1IU8 A;  1LRZ A;  3EFA A;  3H8G A;  3EO4 A;  1SQH A;  2WUU A;  4PXE A;  4MFL A; 
#chains in the Genus database with same CATH homology
 5JPH A;  2Z0Z A;  2J8N A;  4F6A A;  2B3V A;  5BWA B;  3P2H A;  1OZP A;  3F0A A;  1QSM A;  1YRE A;  4BBH A;  1BOB A;  4KVM E;  4AVB A;  4CGM A;  4KOX A;  3TTH A;  2P6E A;  4EVY A;  4DNC A;  4E8O A;  2I00 A;  1NMT A;  1IB1 E;  1Y9K A;  4PSX A;  3P2F A;  3S6G A;  4UFV A;  2Q0Y A;  1XEB A;  2ZW4 A;  3EY5 A;  5G21 A;  2Z10 A;  1ON0 A;  2DPT A;  4CYQ A;  2PR8 A;  3MGD A;  3V8I A;  3TOA A;  2H5M A;  4NEX A;  1S7F A;  3R9G A;  2WPX A;  4U9Z A;  2AE6 A;  3S6F A;  3VWE A;  3IU1 A;  2B58 A;  3IU2 A;  1M1D A;  2Q44 A;  3GY9 A;  2JDC A;  1TIQ A;  4RS2 A;  4KOR A;  4HNY B;  1WK4 A;  2VQY A;  2Q7B A;  2K5T A;  4NSQ A;  4CRZ B;  2VI7 A;  2JDD A;  3FNC A;  2Q04 A;  4B5P A;  4CAF A;  4KLW A;  4MJ8 A;  1XIX A;  1CM0 A;  3OWC A;  5H86 A;  4C7H A;  2WSA A;  4YGO A;  3SXO A;  2R7H A;  2EVN A;  4L8A A;  5A28 A;  4KS9 A;  4C7I A;  4CYN A;  5GCN A;  4MFZ A;  3LD2 A;  2Z3L A;  4PK3 A;  2G3T A;  4MFQ A;  5AG7 A;  1YK3 A;  2ZW7 A;  2D4P A;  4B5O A;  1FY7 A;  2Z3P A;  4B10 A;  2OH1 A;  4CAE A;  5C88 A;  4QC6 A;  4KOY A;  4KSF A;  4UFW A;  4KLV A;  4KUB A;  1RXT A;  2PRB A;  2QML A;  1XMT A;  5IX3 A;  1Y7R A;  5G22 A;  1IIC A;  4CGN A;  4FD5 A;  4CGP A;  4NF1 A;  4A2Z A;  3A9L A;  1YX0 A;  4JWP A;  1Q2C A;  1P4N A;  4QBJ A;  1YLE A;  2P6F A;  1B6B A;  3KKW A;  2DXQ A;  2R98 A;  4KSA A;  2PC1 A;  1S60 A;  4UWI A;  4CS0 B;  2P6G A;  4ONU A;  5I0C A;  4JJX A;  3SHP A;  3PZJ A;  4R57 A;  4GS4 A;  3FYN A;  3CXQ A;  4Y49 B;  2X7B A;  4C2Z A;  5G1Z A;  3WR7 A;  4CRY B;  5F49 A;  4ORF A;  2JEV A;  1QSO A;  2F5I A;  3R9E A;  4JXR A;  4CAX A;  3DDD A;  3R96 A;  2VBQ A;  4B13 A;  2B4D B;  5F47 A;  5AG6 A;  4YRH A;  2OZU A;  3RYO A;  1Q2D A;  5H84 A;  4KOS A;  1VHS A;  2R8V A;  3DSB A;  5ISV A;  3CXS A;  1I1D A;  3W6X A;  3FBU A;  3T90 A;  2GAN A;  3IGR A;  1MK4 A;  3DR8 A;  2B5G A;  3TE4 A;  4E2A A;  2BL1 A;  4XPL A;  2PR1 A;  4Q36 A;  2OZG A;  2PQ8 A;  2VZZ A;  3ZZI A;  1YGH A;  2YND A;  4XNH B;  4U5Y A;  3G8W A;  1QSN A;  2BSW A;  3FIX A;  4F0Y A;  2HUZ A;  2P0W A;  5DWM A;  2ZW6 A;  3VWD A;  3BLN A;  1Z4R A;  3R95 A;  4OAD A;  5A27 A;  2YNC A;  5J8F A;  3H4Q A;  1K4J A;  3B8G A;  3JVN A;  4R3K A;  4NXY A;  4CGL A;  1M4G A;  4HNX B;  4MFJ A;  4MBU A;  4MFP A;  1BO4 A;  5C82 A;  3PP9 A;  1IID A;  2O28 A;  4K30 A;  1V0C A;  2B3U A;  3K9U A;  4FD6 A;  4M85 A;  1NSL A;  2FIA A;  4M3S A;  5FVJ A;  4XPD C;  4B11 A;  3BJ8 A;  4CAV A;  2DPS A;  2GE3 A;  2QIR A;  1VKC A;  2ARH A;  3I3G A;  3JTK A;  4KOW A;  4LX9 A;  1IYK A;  2JLM A;  4UWJ A;  4XPD B;  5AG4 A;  2Z11 A;  4PK2 A;  1MJA A;  3FRM A;  4C2Y A;  4AVC A;  1XE4 A;  1Z9U A;  2ATR A;  4A31 A;  5F48 A;  2FT0 A;  2EUI A;  4MHD A;  3S6H A;  1PUA A;  2Z3O A;  4PSW A;  2G0B A;  2OB0 A;  3TT2 A;  2FXF A;  4IF5 A;  3T9Y A;  3G3S A;  4KOU A;  4RI1 A;  4FD4 A;  1KUY A;  1YVO A;  4MFK A;  5IV0 A;  1U6M A;  2ZXV A;  3CXP A;  5KTC A;  4A33 A;  1N71 A;  1R57 A;  2ZW5 A;  3LOD A;  4Q38 A;  2FE7 A;  3H5Z A;  2D4O A;  4MY0 A;  1M4I A;  2VXK A;  4IUS A;  2RC4 A;  2Y0M A;  2ZPA A;  4XPK A;  1M44 A;  1WWZ A;  4JXQ A;  3TCV A;  5HMN A;  1S5K A;  4B5P B;  4A32 A;  3TO7 A;  4UA3 A;  3R1K A;  4KOT A;  2I79 A;  2REF A;  3BJ7 A;  2YGW A;  4UCM A;  1MJ9 A;  2HV2 A;  3E0K A;  1GHE A;  4KVX A;  2WPW A;  4H6U A;  3TO6 A;  1Y9W A;  2FCK A;  1QST A;  2NMT A;  3TFY A;  2FIW A;  4C68 A;  4KUA A;  2B4B A;  4UCN A;  1S7K A;  3TOB A;  3N7Z A;  2CNM A;  2OZH A;  3GKR A;  4KZT A;  3QAH A;  1UFH A;  4X5K A;  1XF8 A;  4ZGY B;  3EC4 A;  3F5B A;  5J8C A;  1CJW A;  2Z3N A;  4XNH C;  4CYP A;  3IWE A;  1YVK A;  1L0C A;  4R87 A;  5F46 A;  5E96 A;  5EBV A;  2R1I A;  3DR6 A;  4UFX A;  3D3S A;  1B87 A;  1S3Z A;  5CNP A;  3NE7 A;  3W91 A;  4PV6 A;  2CY2 A;  4B12 A;  4U9Y A;  4AG7 A;  2QEC A;  4H89 A;  3I9S A;  4NCZ A;  3FB3 A;  1IYL A;  5KTA A;  3D8P A;  1RO5 A;  3IWG A;  4BMH A;  2VEZ A;  1NE9 A;  4HKF A;  4OLL A;  4C2X A;  4MY3 A;  4CAW A;  4I49 A;  3UY5 A;  3C26 A;  4CGO A;  4JD6 A;  2PDO A;  4HNW B;  2J8R A;  2FSR A;  2Q4Y A;  1Q2Y A;  4R3L A;  3FXT A;  4E0A A;  1QSR A;  2GIV A;  4II9 A;  5AG5 A;  1I12 A;  1M4D A;  3EXN A;  5KTD A;  2B4D A;  2HQY A;  4CYO A;  2CXA A;  2G3A A;  4AB7 A;  2VZY A;  4AG9 A;  4MI4 A;  5EC4 A;  2BUE A;  4A30 A;  5G20 A;  2FL4 A;  4H6Z A;  3SXN A;  5DWN A;  2Z3M A;  3D2M A;  4F0X A;  4ZBG A;  2REE A;  2B5G B;  4KVO E;  4R9M A;  4J3G A;  2Q4V A;  3ZJ0 A;  3D2P A;  2CNS A;  5AGE A;  4QUS A;  1MJB A;  1J4J A;  5HH1 A;  2KCW A;  3W6S A;  1S7N A;  3TO9 A;  1YR0 A;  4A95 A;  2BEI A;  4KOV A;  4QB9 A;  1S7L A;  2A4N A;  2AJ6 A;  4B14 A;  1ZO0 A;  4LUA A;  4FD7 A;  2YNC C;  3R9F A;  2PSW A;  2OU2 A;  3F8K A;  3DNS A;  4JLY A;  3GYA A;  4OAE A;  5IB0 A;  1KUV A;  3S6K A;  1KZF A;  3JUW A;  4UCP A;  2J8M A;  1KUX A;  4AVA A;  2FS5 A;  2YNE A;  3PGP A;  4L89 A;  4QVT A;  2IL4 A;  1P0H A;  2C27 A;  4Y49 C;  3QB8 A;  1PU9 A;  5JQ4 A;  1Z4E A;  2CNT A;  4YFJ A;  4UBR A;  1I21 A;  2Z3K A;  1LRZ A;  3EFA A;  3EO4 A;  1SQH A;  2WUU A;  4MFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...