5AG5A

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a thiazolidinone ligand
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Development of Small-Molecule Trypanosoma Brucei N-Myristoyltransferase Inhibitors: Discovery and Optimisation of a Novel Binding Mode.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 123
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5ag5A00
5G21A 5G20A 4A33A 4CGOA 5G22A 4C2YA 2WSAA 2YNCA 4UFWA 3IU2A 4B12A 5G1ZA 4CYQA 2YNDA 5AG4A 4C7IA 4CAFA 3H5ZA 4CYOA 4A30A 3IU1A 4A31A 4B10A 3JTKA 4UCNA 4UCPA 4BBHA 4B13A 4A2ZA 4CGNA 5A28A 4A32A 4CGMA 4UFXA 2YNCC 4UFVA 5AG7A 4CAEA 4CYNA 5A27A 4C2XA 3IWEA 4C7HA 4C2ZA 5AG5A 2YNEA 5AGEA 4A95A 4CGPA 4B11A 5AG6A 4B14A 2WUUA 4UCMA 4CGLA 4CYPA 4C68A
chains in the Genus database with same CATH superfamily
3F0AA 5K8NA 1YREA 4KSFA 3RZAA 5HVHA 4NEXA 1SQHA 4R6TA 2VQYA 3B3TA 3SJXA 4CAFA 1Y9KA 2GU2A 3GB0A 3PEIA 3SI0A 4PSXA 4RI1A 5C88A 5LYLA 4JJXA 2GLFA 2IMOA 5HVFA 4B5PA 4UCPA 1S60A 5K8MA 2Z3KA 3FX6A 3EC4A 2EBJA 1RTQA 1Z8WA 2Q4ZA 2Z10A 3LMSA 2PCUA 2OZGA 2VZYA 1TKJA 2AFWA 3DDDA 4NGRA 4YU9A 5KTAA 4NGSA 2YGWA 4A38A 2RFHA 4OIDA 1IICA 5JGFA 4KOVA 3EO4A 4G1PA 2G9DA 4MHDA 4NXYA 3JVNA 2GIVA 2O4HA 2BCOA 2VI7A 2GE3A 3GUXA 1BPNA 5ELYA 5G21A 2XEGA 4MMOA 2GREA 4R87A 3RNZA 4HNWB 4IAVA 4EVYA 4HNXB 1HDQA 4ONWA 1TKHA 3KKWA 4PK3A 4HKFA 1QSOA 3H8GA 4EWTA 3JTKA 1XJOA 3KQZA 4ZYQA 4MHYA 2PE3A 4RUHA 2HV2A 3KHXA 4CAEA 2OB0A 2QYVA 1KUVA 4R3LA 1KZFA 3IJ3A 3SHPA 2CTCA 1XMTA 4PV6A 4PXCA 3I3GA 2OU2A 3GYAA 5HXDA 1WWZA 3PBEA 4M6HA 3BJ8A 3FJUA 3ZJ0A 3JRUA 4IHMA 1ZG7A 3BHXA 2GLJA 4DUKA 1KWMA 3PB4X 1LAMA 1XOVA 3K9TA 4UFWA 3FVLA 1OBRA 4KVXA 2AFXA 4JYWA 1BAVA 2J9AA 4CRYB 3EXNA 2PJCA 2ZEGA 2PJ5A 3IU1A 4A31A 2ARHA 2G0BA 4B10A 4ZY1A 2PVVA 4FUUA 4NGPA 2NSMA 2B3UA 4A2ZA 4B13A 4A32A 2BEIA 2Q4VA 4P45A 4PXBA 5LRKA 3PB9X 3DR6A 4JD6A 1DTDA 4MHPA 1NMTA 2OZHA 4LQGA 5LYFA 1KUXA 2B58A 2DF5A 4X5KA 3TOBA 4OC3A 1K4JA 4IF5A 1HEEA 2OR4A 4B5PB 2H5MA 4CGPA 3NH8A 2PJ7A 3GY9A 3KR5A 2RB7A 4CGLA 1VHEA 1MJAA 2HQYA 2X7BA 5DWMA 2Z3PA 3WC5A 1ZO0A 3LODA 3G8WA 3KASA 4KLVA 1YVKA 3R96A 2YNDA 4EFDA 3H5ZA 5EBVA 3FXTA 4A94A 4WWVA 2R98A 4J3GA 2Q7BA 4XNHC 1IOIA 4FD4A 1HDUA 3QNVA 1LFWA 3BXMA 1Z4EA 1QSTA 5THWA 3CDXA 2BUEA 1YLOA 4F9UA 4E2AA 3D4UA 2AE6A 3CPAA 4C7HA 1IYKA 2REEA 4FD6A 2B4BA 1ARMA 2CY2A 5DS0A 4B5OA 2Z3MA 3F5BA 4CAXA 1U6MA 1I21A 3JUWA 2VL1A 1H8LA 4OKOA 3TTHA 4B14A 4ZBGA 3SI1A 1AYEA 4P4BA 1CBXA 5F46A 3B8GA 2NMTA 3CXPA 4UEZA 3DLJA 4QB9A 5K8PA 2YNCA 4YWYA 1LCPA 2PIZA 3FMCA 2EVNA 3RAMA 2ZEMA 5JH9A 1DE4C 5HVGA 4F8ZA 1XRYA 1MK4A 2ZW4A 4OP4A 4UIAA 1YLEA 1AMPA 3FIXA 3KHZA 4DNCA 4JLYA 1IGBA 4MFZA 2B3VA 2GFQA 1YMEA 1YX0A 4Y49C 3RBUA 5KTDA 5ISVA 2AFUA 2WUUA 5H86A 2EUIA 3HUVA 2ZW5A 2XEFA 1B87A 2EWBA 2V8VA 2J8RA 4ONUA 5G1ZA 1VGYA 7CPAA 4OC5A 4MY0A 1JQGA 1AUGA 5C82A 2B5GA 3S9LA 4I49A 5CNPA 4UA3A 2OH1A 3ISXA 4HNYB 2JBKA 5A28A 3IFEA 4K30A 3NE7A 3HLPA 4UF4A 4P10A 4P4FA 3VARA 4AVBA 1ON0A 3TCVA 1BPMA 3KQXA 4UEEA 3W6SA 4MCSA 5J8FA 2CXAA 3IC1A 2QVPA 5D8NA 2ABZA 2RC4A 2VBQA 4X3RA 2PIYA 5EC4A 3S6GA 3FNCA 1A2ZA 2ZEHA 4GXHA 3WC6A 2V8HA 2PJAA 4OC1A 2D4OA 3B3VA 2HB6A 4R3KA 1PCAA 3RYOA 4ORFA 1JWQA 2PJ1A 1FY7A 4L89A 4BMHA 4IUSA 4MHNA 2EO8A 3TO9A 1YW6A 4MFQA 5LYDA 1S5KA 2FXFA 3B2YA 4UFXA 2C6PA 2YNCC 4MFLA 2ZEEA 4CPAA 3NH5A 4M85A 4HPSA 1YSJA 3IWEA 4PQAA 3PP9A 2AFSA 2J8MA 2PSWA 2BO9A 5I4MA 2CTBA 1Q2DA 1B6BA 5AG5A 3B3CA 3SI2A 4OC0A 4OADA 4AXVA 3ISZA 3SJGA 2Q4YA 1MJBA 4P6YA 4CGOA 4JXRA 4MFJA 3SXOA 4MFKA 3IEHA 4MJ8A 4C7IA 1CP7A 4UIBA 4JXQA 2CNMA 4P4DA 2IQ6A 1Z5RA 2EK9A 2A4NA 3NA6A 4F0XA 3BI0A 1Y7EA 1ZLHA 3L2NA 4P4IA 3IWGA 4UFVA 5J1QA 4FAIA 2DXQA 2CIJA 5A27A 2Y0MA 1S7LA 4PXDA 2ZXVA 3FYNA 4LX9A 5IV0A 1F2PA 2B5GB 4KVME 1BOBA 1CG2A 2JLMA 3PRTA 4L8AA 1F57A 4U5YA 1VIXA 2P6EA 3D66A 4CRZB 1MJ9A 5AG6A 2F7VA 4KVOE 5HH1A 4CYPA 4NCZA 5G20A 1Z9UA 4OLLA 1YR0A 1Q2YA 4H89A 4KUBA 3FB3A 2EK8A 2CF4A 3KI9A 3R95A 3R1KA 4MBUA 4X8IA 3D7HA 1ZLIA 3CT9A 1PU9A 3WR7A 4PSWA 2P6GA 3GKRA 3C26A 3TX8A 4UWIA 5CPAA 1GHEA 3CXSA 4BBHA 4GS4A 2PQ8A 2Z3LA 1Y9WA 1YVOA 3W6XA 4XPDB 4AG9A 4XPDC 2AFZA 1QSNA 2KCWA 2OZUA 3QAYA 4KOSA 1KUYA 4OIWA 3R9FA 2AFOA 1TKFA 1NSAA 2C27A 2JDDA 2PJ9A 2WPXA 2HUZA 2Q0YA 2FT0A 2Z3OA 3N7ZA 4R9MA 2ZW6A 2ZEPA 3VWDA 4B11A 4UCMA 4XPKA 4M3SA 1RO5A 3IGRA 3PB6X 2JEVA 4Z65A 4RS2A 1IYLA 4C2YA 1IY7A 3TO6A 2O28A 1M4GA 2JBJA 4MXUA 4QUSA 2AFMA 3D68A 2G3TA 3D7GA 4A39A 3T9YA 3S6HA 4BD9A 1XFOA 3FEEA 1TF8A 4KZTA 4MHZA 4GM5A 1TIQA 2ZEFA 1QMUA 3PGPA 4CGMA 1EE3P 3I9SA 4II9A 1GYTA 2AJ6A 2OOTA 1M44A 1XMBA 2CNSA 3IWWA 4NGNA 3CXQA 4KSIA 2VXKA 4ZI6A 2FE7A 3B7IA 4UWJA 3KZWA 3TT2A 1M4LA 3T90A 2FL4A 1S7KA 5JPHA 1XBUA 1FNOA 3WABA 4WJBA 1Z4RA 1P4NA 4KOTA 3TC8A 2XEJA 2ODFA 2PVWA 3R9GA 1QSRA 4AB7A 2C6CA 4CAWA 3DSBA 4KOXA 1I1DA 1X12A 4A30A 4ZY2A 2WYRA 4UCNA 1XF8A 1Q7LA 2B4DB 1OZPA 2PJ8A 2QECA 2VEZA 3KL9A 4P4EA 2P0WA 2Q04A 3MGDA 3S6KA 3WC7A 5AG7A 5IB0A 2ZEOA 3GIUA 3R9EA 4OC2A 5HMNA 3BJ7A 1Z8XA 4EMEA 5I0CA 3B3WA 3CZXA 4R7MA 4UEFA 2ZW7A 1LOKA 4TWEA 4IK2A 2YNEA 5IX3A 2PJ3A 2G3AA 5H84A 1P0HA 2ZEDA 1X10A 4LQ6A 2Z0ZA 2Q43A 4NGMA 4R76A 4A33A 1CJWA 1TF9A 1Z8TA 3D2MA 5G22A 4R8FA 1QQ9A 2Q51A 2Q7SA 3IIBA 4CYQA 1I12A 1Q2CA 2R7HA 2GANA 4KOUA 2WZNA 5IB9A 4U9ZA 3GLJA 4KLWA 1M4IA 2FS5A 2K5TA 2P6FA 5EMIA 2Z11A 6CPAA 3D67A 2ZOGA 4Q36A 2PC1A 1TXRA 1IIDA 4TNUA 2ATRA 4MI4A 2JEWA 1V0CA 1CX8A 1Y0YA 2I3CA 3DR8A 1M1DA 3K9UA 3PFEA 2JDCA 4MCRA 1ZG9A 1QSMA 4AG7A 4C2XA 2J8NA 4U9YA 1VHOA 3S6FA 4QVTA 3H8FA 2PJ0A 3EFAA 3IO1A 4A95A 2QMLA 3B35A 3LWUA 4M6IA 2QIRA 1L0CA 3VATA 1Z2LA 4XPLA 1M4DA 3WT4A 1N71A 4C68A 1WK4A 3FECA 1Y0RA 4JWPA 1VHSA 5FVJA 4MY3A 1LRZA 5GCNA 3W91A 1CM0A 3RO0A 4CS0B 3D8PA 4YGOA 3PFOA 1F2OA 4OC4A 4DYOA 4MFPA 3CPXA 3MN8A 4PPZA 5F09A 3V7ZA 2ZOFA 4FBEA 3A9LA 5DWNA 5LRJA 4RN7A 2PJ4A 3SJFA 1YQEA 4AVCA 1UWYA 3DGVA 4CYNA 3PB7X 4FD7A 1VKCA 4KSAA 3P2HA 2IJZA 4AVAA 2F5IA 2ZENA 3VH9A 3S9NA 3G3SA 1YGHA 5AGEA 1S3ZA 2FIWA 3K2KA 4M6GA 5F47A 4H2KA 2FVGA 1Z8LA 4ZX8A 2I00A 4JZ0A 1FT7A 2REFA 3KR4A 4BINA 1YK3A 1XE4A 5F48A 4KOYA 3NH4A 2WSAA 2B4DA 2F8HA 3BI1A 3IU2A 4KS9A 4MCQA 3SJEA 4QBJA 4H6ZA 4E0AA 1R57A 3FRMA 4LUAA 4X2TA 4MRIA 5AG4A 2FIAA 2R1IA 1ZG8A 4NFRA 1PUAA 3SXNA 3H8EA 2PRQA 3VWEA 1CP6A 3TE4A 2HC9A 2VZZA 5E96A 4B6ZA 3EY5A 4Q38A 3V38A 4UBRA 2PR8A 4K3NA 3P2FA 5CBMA 3N5FA 2PJ6A 2PDOA 3LACA 4C2ZA 1XEBA 2FCKA 2DEAA 2PR1A 2PRBA 3D7DA 1CPXA 1J4JA 2IL4A 2PJ2A 4E8OA 5D29A 3FH4A 1YW4A 3B3SA 1ARLA 2R8VA 3E0KA 4F9VA 3TFYA 3H4QA 4KUAA 3MRUA 3V8IA 2FSRA 2CNTA 2I79A 2PJBA 3D7FA 4F6AA 1LAPA 2Q44A 1S7FA 4P44A 4XNHB 3NE8A 2D4PA 4ZY0A 1NE9A 1BLLE 3TOAA 1XIXA 2V77A 2O53A 5LYIA 4CAVA 4KOWA 4CGNA 5K8OA 4NJRA 3F8KA 4O23A 2ZPAA 2POKA 4NGQA 4OMEA 2BOAA 4OAEA 2NYQA 3FBUA 3NFZA 4YRHA 1IB1E 2WPWA 1RXTA 4FD5A 4NJQA 4DJLA 2C6GA 3PB8X 4KORA 5LRGA 1BO4A 4ZX9A 1UFHA 3DNSA 2ANPA 2BL1A 4QC6A 3I1UA 3FF3A 3BLNA 2DPTA 2QJ8A 4FWUA 5JQ4A 4YFJA 1R43A 5KTCA 1IOFA 1R3NA 3PBBA 4B12A 4NGTA 2BSWA 4PXEA 2Z3NA 5F49A 3S9MA 4CYOA 8CPAA 3FEDA 4P4JA 1S7NA 2ZELA 1ELLP 1ELMP 1Y7RA 4R57A 4MCPA 4F0YA 4NSQA 1IU8A 3QAHA 1CPSA 3KGQA 4NF1A 2C1CA 3OWCA 3ZZIA 1LANA 2V8DA 2DPSA 4H6UA 4Y49B 3QB8A 3PZJA 3T8WA 1NSLA 3UY5A 5J8CA 4Q7AA 3TO7A 1PYTB 3D2PA 5JM6A 2XEIA 4ZGYB 2V8GA 4PK2A 5BWAB 3D3SA 4A37A 4W9YA 3LD2A
chains in the Genus database with same CATH topology
3F0AA 1YREA 4KSFA 4NEXA 1SQHA 2VQYA 4CAFA 1Y9KA 5C88A 4PSXA 4RI1A 4JJXA 4B5PA 4UCPA 1S60A 2Z3KA 3EC4A 2Z10A 2OZGA 2VZYA 3DDDA 5KTAA 2YGWA 1IICA 4KOVA 3EO4A 4MHDA 4NXYA 3JVNA 2GIVA 2VI7A 2GE3A 5G21A 4R87A 4HNWB 4EVYA 4HNXB 3KKWA 4PK3A 4HKFA 1QSOA 3JTKA 2HV2A 4CAEA 2OB0A 1KUVA 4R3LA 1KZFA 3SHPA 1XMTA 4PV6A 3I3GA 2OU2A 3GYAA 1WWZA 3BJ8A 3ZJ0A 4UFWA 4KVXA 4CRYB 3EXNA 3IU1A 4A31A 2ARHA 2G0BA 4B10A 2B3UA 4A2ZA 4B13A 4A32A 2BEIA 2Q4VA 3DR6A 4JD6A 1NMTA 2OZHA 1KUXA 2B58A 3TOBA 4X5KA 1K4JA 4IF5A 4B5PB 2H5MA 4CGPA 3GY9A 4CGLA 1MJAA 2HQYA 2X7BA 5DWMA 2Z3PA 1ZO0A 3LODA 3G8WA 4KLVA 1YVKA 3R96A 2YNDA 3H5ZA 5EBVA 3FXTA 2R98A 4J3GA 2Q7BA 4XNHC 4FD4A 1Z4EA 1QSTA 2BUEA 4E2AA 2AE6A 4C7HA 1IYKA 2REEA 4FD6A 2B4BA 2CY2A 4B5OA 2Z3MA 3F5BA 4CAXA 1U6MA 1I21A 3JUWA 3TTHA 4B14A 4ZBGA 5F46A 3B8GA 2NMTA 3CXPA 4QB9A 2YNCA 2EVNA 1MK4A 2ZW4A 1YLEA 3FIXA 4DNCA 4JLYA 4MFZA 2B3VA 4Y49C 1YX0A 5KTDA 5ISVA 2WUUA 5H86A 2EUIA 2ZW5A 1B87A 2J8RA 4ONUA 5G1ZA 4MY0A 5C82A 2B5GA 4I49A 5CNPA 4UA3A 2OH1A 4HNYB 5A28A 4K30A 3NE7A 4AVBA 1ON0A 3TCVA 5J8FA 3W6SA 2CXAA 2RC4A 2VBQA 5EC4A 3S6GA 3FNCA 2D4OA 4R3KA 3RYOA 4ORFA 1FY7A 4L89A 4BMHA 4IUSA 3TO9A 4MFQA 1S5KA 2FXFA 4UFXA 2YNCC 4MFLA 4M85A 3IWEA 3PP9A 2J8MA 2PSWA 1Q2DA 1B6BA 5AG5A 4OADA 2Q4YA 1MJBA 4CGOA 4JXRA 4MFJA 3SXOA 4MFKA 4MJ8A 4C7IA 4JXQA 2CNMA 2A4NA 4F0XA 3IWGA 4UFVA 2DXQA 5A27A 2Y0MA 1S7LA 2ZXVA 3FYNA 4LX9A 5IV0A 2B5GB 4KVME 1BOBA 2JLMA 4L8AA 4U5YA 2P6EA 4CRZB 1MJ9A 5AG6A 4KVOE 5HH1A 4CYPA 4NCZA 5G20A 1Z9UA 4OLLA 1YR0A 1Q2YA 4H89A 4KUBA 3FB3A 3R95A 3R1KA 4MBUA 1PU9A 3WR7A 4PSWA 2P6GA 3GKRA 3C26A 4UWIA 1GHEA 3CXSA 4BBHA 4GS4A 2PQ8A 2Z3LA 1Y9WA 1YVOA 3W6XA 4XPDB 4AG9A 4XPDC 1QSNA 2KCWA 2OZUA 4KOSA 1KUYA 3R9FA 2C27A 2JDDA 2WPXA 2HUZA 2Q0YA 2FT0A 2Z3OA 3N7ZA 4R9MA 2ZW6A 3VWDA 4B11A 4UCMA 4XPKA 4M3SA 1RO5A 3IGRA 2JEVA 4RS2A 1IYLA 4C2YA 3TO6A 2O28A 1M4GA 4QUSA 2G3TA 3T9YA 3S6HA 4KZTA 1TIQA 3PGPA 4CGMA 3I9SA 4II9A 2AJ6A 1M44A 2CNSA 3CXQA 2VXKA 2FE7A 4UWJA 3TT2A 3T90A 2FL4A 1S7KA 5JPHA 1Z4RA 1P4NA 4KOTA 3R9GA 1QSRA 4AB7A 4CAWA 3DSBA 4KOXA 1I1DA 4A30A 4UCNA 1XF8A 2B4DB 2VEZA 1OZPA 2QECA 2P0WA 2Q04A 3MGDA 3S6KA 5IB0A 5AG7A 3R9EA 5HMNA 3BJ7A 5I0CA 2ZW7A 5IX3A 2YNEA 2G3AA 5H84A 1P0HA 2Z0ZA 4A33A 1CJWA 3D2MA 5G22A 4CYQA 1I12A 1Q2CA 2R7HA 2GANA 4KOUA 4U9ZA 4KLWA 1M4IA 2FS5A 2K5TA 2P6FA 2Z11A 4Q36A 2PC1A 1IIDA 2ATRA 4MI4A 1V0CA 3DR8A 1M1DA 3K9UA 2JDCA 4AG7A 1QSMA 4C2XA 2J8NA 4U9YA 3S6FA 4QVTA 3EFAA 4A95A 2QMLA 2QIRA 1L0CA 4XPLA 1M4DA 1N71A 4C68A 1WK4A 4JWPA 1VHSA 5FVJA 4MY3A 1LRZA 5GCNA 3W91A 1CM0A 4CS0B 3D8PA 4YGOA 4MFPA 3A9LA 5DWNA 4AVCA 4CYNA 4FD7A 1VKCA 4KSAA 3P2HA 4AVAA 2F5IA 3G3SA 1YGHA 5AGEA 1S3ZA 2FIWA 5F47A 2I00A 2REFA 1YK3A 1XE4A 5F48A 4KOYA 2WSAA 2B4DA 3IU2A 4QBJA 4KS9A 4H6ZA 4E0AA 1R57A 3FRMA 4LUAA 5AG4A 2FIAA 2R1IA 1PUAA 3SXNA 3VWEA 3TE4A 2VZZA 5E96A 3EY5A 4Q38A 4UBRA 2PR8A 3P2FA 2PDOA 4C2ZA 1XEBA 2FCKA 2PR1A 2PRBA 1J4JA 2IL4A 4E8OA 2R8VA 3E0KA 3TFYA 3H4QA 4KUAA 3V8IA 2FSRA 2CNTA 2I79A 4F6AA 2Q44A 1S7FA 4XNHB 2D4PA 1NE9A 3TOAA 1XIXA 4CAVA 4KOWA 4CGNA 3F8KA 2ZPAA 4OAEA 3FBUA 4YRHA 1IB1E 2WPWA 1RXTA 4FD5A 4KORA 1BO4A 1UFHA 3DNSA 2BL1A 4QC6A 3BLNA 2DPTA 5JQ4A 4YFJA 5KTCA 4B12A 2BSWA 2Z3NA 5F49A 4CYOA 1S7NA 1Y7RA 4R57A 4F0YA 4NSQA 3QAHA 4NF1A 3OWCA 3ZZIA 2DPSA 4H6UA 4Y49B 3QB8A 3PZJA 3UY5A 1NSLA 5J8CA 3TO7A 3D2PA 4ZGYB 4PK2A 5BWAB 3D3SA 3LD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G21 A;  5G20 A;  4A33 A;  4CGO A;  5G22 A;  4C2Y A;  2WSA A;  2YNC A;  4UFW A;  3IU2 A;  4B12 A;  5G1Z A;  4CYQ A;  2YND A;  5AG4 A;  4C7I A;  4CAF A;  3H5Z A;  4CYO A;  4A30 A;  3IU1 A;  4A31 A;  4B10 A;  3JTK A;  4UCN A;  4UCP A;  4BBH A;  4B13 A;  4A2Z A;  4CGN A;  5A28 A;  4A32 A;  4CGM A;  4UFX A;  2YNC C;  4UFV A;  5AG7 A;  4CAE A;  4CYN A;  5A27 A;  4C2X A;  3IWE A;  4C7H A;  4C2Z A;  5AG5 A;  2YNE A;  5AGE A;  4A95 A;  4CGP A;  4B11 A;  5AG6 A;  4B14 A;  2WUU A;  4UCM A;  4CGL A;  4CYP A;  4C68 A; 
#chains in the Genus database with same CATH topology
 3F0A A;  5K8N A;  1YRE A;  4KSF A;  3RZA A;  5HVH A;  4NEX A;  1SQH A;  4R6T A;  2VQY A;  3B3T A;  3SJX A;  4CAF A;  1Y9K A;  2GU2 A;  3GB0 A;  3PEI A;  3SI0 A;  4PSX A;  4RI1 A;  5C88 A;  5LYL A;  4JJX A;  2GLF A;  2IMO A;  5HVF A;  4B5P A;  4UCP A;  1S60 A;  5K8M A;  2Z3K A;  3FX6 A;  3EC4 A;  2EBJ A;  1RTQ A;  1Z8W A;  2Q4Z A;  2Z10 A;  3LMS A;  2PCU A;  2OZG A;  2VZY A;  1TKJ A;  2AFW A;  3DDD A;  4NGR A;  4YU9 A;  5KTA A;  4NGS A;  2YGW A;  4A38 A;  2RFH A;  4OID A;  1IIC A;  5JGF A;  4KOV A;  3EO4 A;  4G1P A;  2G9D A;  4MHD A;  4NXY A;  3JVN A;  2GIV A;  2O4H A;  2BCO A;  2VI7 A;  2GE3 A;  3GUX A;  1BPN A;  5ELY A;  5G21 A;  2XEG A;  4MMO A;  2GRE A;  4R87 A;  3RNZ A;  4HNW B;  4IAV A;  4EVY A;  4HNX B;  1HDQ A;  4ONW A;  1TKH A;  3KKW A;  4PK3 A;  4HKF A;  1QSO A;  3H8G A;  4EWT A;  3JTK A;  1XJO A;  3KQZ A;  4ZYQ A;  4MHY A;  2PE3 A;  4RUH A;  2HV2 A;  3KHX A;  4CAE A;  2OB0 A;  2QYV A;  1KUV A;  4R3L A;  1KZF A;  3IJ3 A;  3SHP A;  2CTC A;  1XMT A;  4PV6 A;  4PXC A;  3I3G A;  2OU2 A;  3GYA A;  5HXD A;  1WWZ A;  3PBE A;  4M6H A;  3BJ8 A;  3FJU A;  3ZJ0 A;  3JRU A;  4IHM A;  1ZG7 A;  3BHX A;  2GLJ A;  4DUK A;  1KWM A;  3PB4 X;  1LAM A;  1XOV A;  3K9T A;  4UFW A;  3FVL A;  1OBR A;  4KVX A;  2AFX A;  4JYW A;  1BAV A;  2J9A A;  4CRY B;  3EXN A;  2PJC A;  2ZEG A;  2PJ5 A;  3IU1 A;  4A31 A;  2ARH A;  2G0B A;  4B10 A;  4ZY1 A;  2PVV A;  4FUU A;  4NGP A;  2NSM A;  2B3U A;  4A2Z A;  4B13 A;  4A32 A;  2BEI A;  2Q4V A;  4P45 A;  4PXB A;  5LRK A;  3PB9 X;  3DR6 A;  4JD6 A;  1DTD A;  4MHP A;  1NMT A;  2OZH A;  4LQG A;  5LYF A;  1KUX A;  2B58 A;  2DF5 A;  4X5K A;  3TOB A;  4OC3 A;  1K4J A;  4IF5 A;  1HEE A;  2OR4 A;  4B5P B;  2H5M A;  4CGP A;  3NH8 A;  2PJ7 A;  3GY9 A;  3KR5 A;  2RB7 A;  4CGL A;  1VHE A;  1MJA A;  2HQY A;  2X7B A;  5DWM A;  2Z3P A;  3WC5 A;  1ZO0 A;  3LOD A;  3G8W A;  3KAS A;  4KLV A;  1YVK A;  3R96 A;  2YND A;  4EFD A;  3H5Z A;  5EBV A;  3FXT A;  4A94 A;  4WWV A;  2R98 A;  4J3G A;  2Q7B A;  4XNH C;  1IOI A;  4FD4 A;  1HDU A;  3QNV A;  1LFW A;  3BXM A;  1Z4E A;  1QST A;  5THW A;  3CDX A;  2BUE A;  1YLO A;  4F9U A;  4E2A A;  3D4U A;  2AE6 A;  3CPA A;  4C7H A;  1IYK A;  2REE A;  4FD6 A;  2B4B A;  1ARM A;  2CY2 A;  5DS0 A;  4B5O A;  2Z3M A;  3F5B A;  4CAX A;  1U6M A;  1I21 A;  3JUW A;  2VL1 A;  1H8L A;  4OKO A;  3TTH A;  4B14 A;  4ZBG A;  3SI1 A;  1AYE A;  4P4B A;  1CBX A;  5F46 A;  3B8G A;  2NMT A;  3CXP A;  4UEZ A;  3DLJ A;  4QB9 A;  5K8P A;  2YNC A;  4YWY A;  1LCP A;  2PIZ A;  3FMC A;  2EVN A;  3RAM A;  2ZEM A;  5JH9 A;  1DE4 C;  5HVG A;  4F8Z A;  1XRY A;  1MK4 A;  2ZW4 A;  4OP4 A;  4UIA A;  1YLE A;  1AMP A;  3FIX A;  3KHZ A;  4DNC A;  4JLY A;  1IGB A;  4MFZ A;  2B3V A;  2GFQ A;  1YME A;  1YX0 A;  4Y49 C;  3RBU A;  5KTD A;  5ISV A;  2AFU A;  2WUU A;  5H86 A;  2EUI A;  3HUV A;  2ZW5 A;  2XEF A;  1B87 A;  2EWB A;  2V8V A;  2J8R A;  4ONU A;  5G1Z A;  1VGY A;  7CPA A;  4OC5 A;  4MY0 A;  1JQG A;  1AUG A;  5C82 A;  2B5G A;  3S9L A;  4I49 A;  5CNP A;  4UA3 A;  2OH1 A;  3ISX A;  4HNY B;  2JBK A;  5A28 A;  3IFE A;  4K30 A;  3NE7 A;  3HLP A;  4UF4 A;  4P10 A;  4P4F A;  3VAR A;  4AVB A;  1ON0 A;  3TCV A;  1BPM A;  3KQX A;  4UEE A;  3W6S A;  4MCS A;  5J8F A;  2CXA A;  3IC1 A;  2QVP A;  5D8N A;  2ABZ A;  2RC4 A;  2VBQ A;  4X3R A;  2PIY A;  5EC4 A;  3S6G A;  3FNC A;  1A2Z A;  2ZEH A;  4GXH A;  3WC6 A;  2V8H A;  2PJA A;  4OC1 A;  2D4O A;  3B3V A;  2HB6 A;  4R3K A;  1PCA A;  3RYO A;  4ORF A;  1JWQ A;  2PJ1 A;  1FY7 A;  4L89 A;  4BMH A;  4IUS A;  4MHN A;  2EO8 A;  3TO9 A;  1YW6 A;  4MFQ A;  5LYD A;  1S5K A;  2FXF A;  3B2Y A;  4UFX A;  2C6P A;  2YNC C;  4MFL A;  2ZEE A;  4CPA A;  3NH5 A;  4M85 A;  4HPS A;  1YSJ A;  3IWE A;  4PQA A;  3PP9 A;  2AFS A;  2J8M A;  2PSW A;  2BO9 A;  5I4M A;  2CTB A;  1Q2D A;  1B6B A;  5AG5 A;  3B3C A;  3SI2 A;  4OC0 A;  4OAD A;  4AXV A;  3ISZ A;  3SJG A;  2Q4Y A;  1MJB A;  4P6Y A;  4CGO A;  4JXR A;  4MFJ A;  3SXO A;  4MFK A;  3IEH A;  4MJ8 A;  4C7I A;  1CP7 A;  4UIB A;  4JXQ A;  2CNM A;  4P4D A;  2IQ6 A;  1Z5R A;  2EK9 A;  2A4N A;  3NA6 A;  4F0X A;  3BI0 A;  1Y7E A;  1ZLH A;  3L2N A;  4P4I A;  3IWG A;  4UFV A;  5J1Q A;  4FAI A;  2DXQ A;  2CIJ A;  5A27 A;  2Y0M A;  1S7L A;  4PXD A;  2ZXV A;  3FYN A;  4LX9 A;  5IV0 A;  1F2P A;  2B5G B;  4KVM E;  1BOB A;  1CG2 A;  2JLM A;  3PRT A;  4L8A A;  1F57 A;  4U5Y A;  1VIX A;  2P6E A;  3D66 A;  4CRZ B;  1MJ9 A;  5AG6 A;  2F7V A;  4KVO E;  5HH1 A;  4CYP A;  4NCZ A;  5G20 A;  1Z9U A;  4OLL A;  1YR0 A;  1Q2Y A;  4H89 A;  4KUB A;  3FB3 A;  2EK8 A;  2CF4 A;  3KI9 A;  3R95 A;  3R1K A;  4MBU A;  4X8I A;  3D7H A;  1ZLI A;  3CT9 A;  1PU9 A;  3WR7 A;  4PSW A;  2P6G A;  3GKR A;  3C26 A;  3TX8 A;  4UWI A;  5CPA A;  1GHE A;  3CXS A;  4BBH A;  4GS4 A;  2PQ8 A;  2Z3L A;  1Y9W A;  1YVO A;  3W6X A;  4XPD B;  4AG9 A;  4XPD C;  2AFZ A;  1QSN A;  2KCW A;  2OZU A;  3QAY A;  4KOS A;  1KUY A;  4OIW A;  3R9F A;  2AFO A;  1TKF A;  1NSA A;  2C27 A;  2JDD A;  2PJ9 A;  2WPX A;  2HUZ A;  2Q0Y A;  2FT0 A;  2Z3O A;  3N7Z A;  4R9M A;  2ZW6 A;  2ZEP A;  3VWD A;  4B11 A;  4UCM A;  4XPK A;  4M3S A;  1RO5 A;  3IGR A;  3PB6 X;  2JEV A;  4Z65 A;  4RS2 A;  1IYL A;  4C2Y A;  1IY7 A;  3TO6 A;  2O28 A;  1M4G A;  2JBJ A;  4MXU A;  4QUS A;  2AFM A;  3D68 A;  2G3T A;  3D7G A;  4A39 A;  3T9Y A;  3S6H A;  4BD9 A;  1XFO A;  3FEE A;  1TF8 A;  4KZT A;  4MHZ A;  4GM5 A;  1TIQ A;  2ZEF A;  1QMU A;  3PGP A;  4CGM A;  1EE3 P;  3I9S A;  4II9 A;  1GYT A;  2AJ6 A;  2OOT A;  1M44 A;  1XMB A;  2CNS A;  3IWW A;  4NGN A;  3CXQ A;  4KSI A;  2VXK A;  4ZI6 A;  2FE7 A;  3B7I A;  4UWJ A;  3KZW A;  3TT2 A;  1M4L A;  3T90 A;  2FL4 A;  1S7K A;  5JPH A;  1XBU A;  1FNO A;  3WAB A;  4WJB A;  1Z4R A;  1P4N A;  4KOT A;  3TC8 A;  2XEJ A;  2ODF A;  2PVW A;  3R9G A;  1QSR A;  4AB7 A;  2C6C A;  4CAW A;  3DSB A;  4KOX A;  1I1D A;  1X12 A;  4A30 A;  4ZY2 A;  2WYR A;  4UCN A;  1XF8 A;  1Q7L A;  2B4D B;  1OZP A;  2PJ8 A;  2QEC A;  2VEZ A;  3KL9 A;  4P4E A;  2P0W A;  2Q04 A;  3MGD A;  3S6K A;  3WC7 A;  5AG7 A;  5IB0 A;  2ZEO A;  3GIU A;  3R9E A;  4OC2 A;  5HMN A;  3BJ7 A;  1Z8X A;  4EME A;  5I0C A;  3B3W A;  3CZX A;  4R7M A;  4UEF A;  2ZW7 A;  1LOK A;  4TWE A;  4IK2 A;  2YNE A;  5IX3 A;  2PJ3 A;  2G3A A;  5H84 A;  1P0H A;  2ZED A;  1X10 A;  4LQ6 A;  2Z0Z A;  2Q43 A;  4NGM A;  4R76 A;  4A33 A;  1CJW A;  1TF9 A;  1Z8T A;  3D2M A;  5G22 A;  4R8F A;  1QQ9 A;  2Q51 A;  2Q7S A;  3IIB A;  4CYQ A;  1I12 A;  1Q2C A;  2R7H A;  2GAN A;  4KOU A;  2WZN A;  5IB9 A;  4U9Z A;  3GLJ A;  4KLW A;  1M4I A;  2FS5 A;  2K5T A;  2P6F A;  5EMI A;  2Z11 A;  6CPA A;  3D67 A;  2ZOG A;  4Q36 A;  2PC1 A;  1TXR A;  1IID A;  4TNU A;  2ATR A;  4MI4 A;  2JEW A;  1V0C A;  1CX8 A;  1Y0Y A;  2I3C A;  3DR8 A;  1M1D A;  3K9U A;  3PFE A;  2JDC A;  4MCR A;  1ZG9 A;  1QSM A;  4AG7 A;  4C2X A;  2J8N A;  4U9Y A;  1VHO A;  3S6F A;  4QVT A;  3H8F A;  2PJ0 A;  3EFA A;  3IO1 A;  4A95 A;  2QML A;  3B35 A;  3LWU A;  4M6I A;  2QIR A;  1L0C A;  3VAT A;  1Z2L A;  4XPL A;  1M4D A;  3WT4 A;  1N71 A;  4C68 A;  1WK4 A;  3FEC A;  1Y0R A;  4JWP A;  1VHS A;  5FVJ A;  4MY3 A;  1LRZ A;  5GCN A;  3W91 A;  1CM0 A;  3RO0 A;  4CS0 B;  3D8P A;  4YGO A;  3PFO A;  1F2O A;  4OC4 A;  4DYO A;  4MFP A;  3CPX A;  3MN8 A;  4PPZ A;  5F09 A;  3V7Z A;  2ZOF A;  4FBE A;  3A9L A;  5DWN A;  5LRJ A;  4RN7 A;  2PJ4 A;  3SJF A;  1YQE A;  4AVC A;  1UWY A;  3DGV A;  4CYN A;  3PB7 X;  4FD7 A;  1VKC A;  4KSA A;  3P2H A;  2IJZ A;  4AVA A;  2F5I A;  2ZEN A;  3VH9 A;  3S9N A;  3G3S A;  1YGH A;  5AGE A;  1S3Z A;  2FIW A;  3K2K A;  4M6G A;  5F47 A;  4H2K A;  2FVG A;  1Z8L A;  4ZX8 A;  2I00 A;  4JZ0 A;  1FT7 A;  2REF A;  3KR4 A;  4BIN A;  1YK3 A;  1XE4 A;  5F48 A;  4KOY A;  3NH4 A;  2WSA A;  2B4D A;  2F8H A;  3BI1 A;  3IU2 A;  4KS9 A;  4MCQ A;  3SJE A;  4QBJ A;  4H6Z A;  4E0A A;  1R57 A;  3FRM A;  4LUA A;  4X2T A;  4MRI A;  5AG4 A;  2FIA A;  2R1I A;  1ZG8 A;  4NFR A;  1PUA A;  3SXN A;  3H8E A;  2PRQ A;  3VWE A;  1CP6 A;  3TE4 A;  2HC9 A;  2VZZ A;  5E96 A;  4B6Z A;  3EY5 A;  4Q38 A;  3V38 A;  4UBR A;  2PR8 A;  4K3N A;  3P2F A;  5CBM A;  3N5F A;  2PJ6 A;  2PDO A;  3LAC A;  4C2Z A;  1XEB A;  2FCK A;  2DEA A;  2PR1 A;  2PRB A;  3D7D A;  1CPX A;  1J4J A;  2IL4 A;  2PJ2 A;  4E8O A;  5D29 A;  3FH4 A;  1YW4 A;  3B3S A;  1ARL A;  2R8V A;  3E0K A;  4F9V A;  3TFY A;  3H4Q A;  4KUA A;  3MRU A;  3V8I A;  2FSR A;  2CNT A;  2I79 A;  2PJB A;  3D7F A;  4F6A A;  1LAP A;  2Q44 A;  1S7F A;  4P44 A;  4XNH B;  3NE8 A;  2D4P A;  4ZY0 A;  1NE9 A;  1BLL E;  3TOA A;  1XIX A;  2V77 A;  2O53 A;  5LYI A;  4CAV A;  4KOW A;  4CGN A;  5K8O A;  4NJR A;  3F8K A;  4O23 A;  2ZPA A;  2POK A;  4NGQ A;  4OME A;  2BOA A;  4OAE A;  2NYQ A;  3FBU A;  3NFZ A;  4YRH A;  1IB1 E;  2WPW A;  1RXT A;  4FD5 A;  4NJQ A;  4DJL A;  2C6G A;  3PB8 X;  4KOR A;  5LRG A;  1BO4 A;  4ZX9 A;  1UFH A;  3DNS A;  2ANP A;  2BL1 A;  4QC6 A;  3I1U A;  3FF3 A;  3BLN A;  2DPT A;  2QJ8 A;  4FWU A;  5JQ4 A;  4YFJ A;  1R43 A;  5KTC A;  1IOF A;  1R3N A;  3PBB A;  4B12 A;  4NGT A;  2BSW A;  4PXE A;  2Z3N A;  5F49 A;  3S9M A;  4CYO A;  8CPA A;  3FED A;  4P4J A;  1S7N A;  2ZEL A;  1ELL P;  1ELM P;  1Y7R A;  4R57 A;  4MCP A;  4F0Y A;  4NSQ A;  1IU8 A;  3QAH A;  1CPS A;  3KGQ A;  4NF1 A;  2C1C A;  3OWC A;  3ZZI A;  1LAN A;  2V8D A;  2DPS A;  4H6U A;  4Y49 B;  3QB8 A;  3PZJ A;  3T8W A;  1NSL A;  3UY5 A;  5J8C A;  4Q7A A;  3TO7 A;  1PYT B;  3D2P A;  5JM6 A;  2XEI A;  4ZGY B;  2V8G A;  4PK2 A;  5BWA B;  3D3S A;  4A37 A;  4W9Y A;  3LD2 A; 
#chains in the Genus database with same CATH homology
 3F0A A;  1YRE A;  4KSF A;  4NEX A;  1SQH A;  2VQY A;  4CAF A;  1Y9K A;  5C88 A;  4PSX A;  4RI1 A;  4JJX A;  4B5P A;  4UCP A;  1S60 A;  2Z3K A;  3EC4 A;  2Z10 A;  2OZG A;  2VZY A;  3DDD A;  5KTA A;  2YGW A;  1IIC A;  4KOV A;  3EO4 A;  4MHD A;  4NXY A;  3JVN A;  2GIV A;  2VI7 A;  2GE3 A;  5G21 A;  4R87 A;  4HNW B;  4EVY A;  4HNX B;  3KKW A;  4PK3 A;  4HKF A;  1QSO A;  3JTK A;  2HV2 A;  4CAE A;  2OB0 A;  1KUV A;  4R3L A;  1KZF A;  3SHP A;  1XMT A;  4PV6 A;  3I3G A;  2OU2 A;  3GYA A;  1WWZ A;  3BJ8 A;  3ZJ0 A;  4UFW A;  4KVX A;  4CRY B;  3EXN A;  3IU1 A;  4A31 A;  2ARH A;  2G0B A;  4B10 A;  2B3U A;  4A2Z A;  4B13 A;  4A32 A;  2BEI A;  2Q4V A;  3DR6 A;  4JD6 A;  1NMT A;  2OZH A;  1KUX A;  2B58 A;  3TOB A;  4X5K A;  1K4J A;  4IF5 A;  4B5P B;  2H5M A;  4CGP A;  3GY9 A;  4CGL A;  1MJA A;  2HQY A;  2X7B A;  5DWM A;  2Z3P A;  1ZO0 A;  3LOD A;  3G8W A;  4KLV A;  1YVK A;  3R96 A;  2YND A;  3H5Z A;  5EBV A;  3FXT A;  2R98 A;  4J3G A;  2Q7B A;  4XNH C;  4FD4 A;  1Z4E A;  1QST A;  2BUE A;  4E2A A;  2AE6 A;  4C7H A;  1IYK A;  2REE A;  4FD6 A;  2B4B A;  2CY2 A;  4B5O A;  2Z3M A;  3F5B A;  4CAX A;  1U6M A;  1I21 A;  3JUW A;  3TTH A;  4B14 A;  4ZBG A;  5F46 A;  3B8G A;  2NMT A;  3CXP A;  4QB9 A;  2YNC A;  2EVN A;  1MK4 A;  2ZW4 A;  1YLE A;  3FIX A;  4DNC A;  4JLY A;  4MFZ A;  2B3V A;  4Y49 C;  1YX0 A;  5KTD A;  5ISV A;  2WUU A;  5H86 A;  2EUI A;  2ZW5 A;  1B87 A;  2J8R A;  4ONU A;  5G1Z A;  4MY0 A;  5C82 A;  2B5G A;  4I49 A;  5CNP A;  4UA3 A;  2OH1 A;  4HNY B;  5A28 A;  4K30 A;  3NE7 A;  4AVB A;  1ON0 A;  3TCV A;  5J8F A;  3W6S A;  2CXA A;  2RC4 A;  2VBQ A;  5EC4 A;  3S6G A;  3FNC A;  2D4O A;  4R3K A;  3RYO A;  4ORF A;  1FY7 A;  4L89 A;  4BMH A;  4IUS A;  3TO9 A;  4MFQ A;  1S5K A;  2FXF A;  4UFX A;  2YNC C;  4MFL A;  4M85 A;  3IWE A;  3PP9 A;  2J8M A;  2PSW A;  1Q2D A;  1B6B A;  5AG5 A;  4OAD A;  2Q4Y A;  1MJB A;  4CGO A;  4JXR A;  4MFJ A;  3SXO A;  4MFK A;  4MJ8 A;  4C7I A;  4JXQ A;  2CNM A;  2A4N A;  4F0X A;  3IWG A;  4UFV A;  2DXQ A;  5A27 A;  2Y0M A;  1S7L A;  2ZXV A;  3FYN A;  4LX9 A;  5IV0 A;  2B5G B;  4KVM E;  1BOB A;  2JLM A;  4L8A A;  4U5Y A;  2P6E A;  4CRZ B;  1MJ9 A;  5AG6 A;  4KVO E;  5HH1 A;  4CYP A;  4NCZ A;  5G20 A;  1Z9U A;  4OLL A;  1YR0 A;  1Q2Y A;  4H89 A;  4KUB A;  3FB3 A;  3R95 A;  3R1K A;  4MBU A;  1PU9 A;  3WR7 A;  4PSW A;  2P6G A;  3GKR A;  3C26 A;  4UWI A;  1GHE A;  3CXS A;  4BBH A;  4GS4 A;  2PQ8 A;  2Z3L A;  1Y9W A;  1YVO A;  3W6X A;  4XPD B;  4AG9 A;  4XPD C;  1QSN A;  2KCW A;  2OZU A;  4KOS A;  1KUY A;  3R9F A;  2C27 A;  2JDD A;  2WPX A;  2HUZ A;  2Q0Y A;  2FT0 A;  2Z3O A;  3N7Z A;  4R9M A;  2ZW6 A;  3VWD A;  4B11 A;  4UCM A;  4XPK A;  4M3S A;  1RO5 A;  3IGR A;  2JEV A;  4RS2 A;  1IYL A;  4C2Y A;  3TO6 A;  2O28 A;  1M4G A;  4QUS A;  2G3T A;  3T9Y A;  3S6H A;  4KZT A;  1TIQ A;  3PGP A;  4CGM A;  3I9S A;  4II9 A;  2AJ6 A;  1M44 A;  2CNS A;  3CXQ A;  2VXK A;  2FE7 A;  4UWJ A;  3TT2 A;  3T90 A;  2FL4 A;  1S7K A;  5JPH A;  1Z4R A;  1P4N A;  4KOT A;  3R9G A;  1QSR A;  4AB7 A;  4CAW A;  3DSB A;  4KOX A;  1I1D A;  4A30 A;  4UCN A;  1XF8 A;  2B4D B;  2VEZ A;  1OZP A;  2QEC A;  2P0W A;  2Q04 A;  3MGD A;  3S6K A;  5IB0 A;  5AG7 A;  3R9E A;  5HMN A;  3BJ7 A;  5I0C A;  2ZW7 A;  5IX3 A;  2YNE A;  2G3A A;  5H84 A;  1P0H A;  2Z0Z A;  4A33 A;  1CJW A;  3D2M A;  5G22 A;  4CYQ A;  1I12 A;  1Q2C A;  2R7H A;  2GAN A;  4KOU A;  4U9Z A;  4KLW A;  1M4I A;  2FS5 A;  2K5T A;  2P6F A;  2Z11 A;  4Q36 A;  2PC1 A;  1IID A;  2ATR A;  4MI4 A;  1V0C A;  3DR8 A;  1M1D A;  3K9U A;  2JDC A;  4AG7 A;  1QSM A;  4C2X A;  2J8N A;  4U9Y A;  3S6F A;  4QVT A;  3EFA A;  4A95 A;  2QML A;  2QIR A;  1L0C A;  4XPL A;  1M4D A;  1N71 A;  4C68 A;  1WK4 A;  4JWP A;  1VHS A;  5FVJ A;  4MY3 A;  1LRZ A;  5GCN A;  3W91 A;  1CM0 A;  4CS0 B;  3D8P A;  4YGO A;  4MFP A;  3A9L A;  5DWN A;  4AVC A;  4CYN A;  4FD7 A;  1VKC A;  4KSA A;  3P2H A;  4AVA A;  2F5I A;  3G3S A;  1YGH A;  5AGE A;  1S3Z A;  2FIW A;  5F47 A;  2I00 A;  2REF A;  1YK3 A;  1XE4 A;  5F48 A;  4KOY A;  2WSA A;  2B4D A;  3IU2 A;  4QBJ A;  4KS9 A;  4H6Z A;  4E0A A;  1R57 A;  3FRM A;  4LUA A;  5AG4 A;  2FIA A;  2R1I A;  1PUA A;  3SXN A;  3VWE A;  3TE4 A;  2VZZ A;  5E96 A;  3EY5 A;  4Q38 A;  4UBR A;  2PR8 A;  3P2F A;  2PDO A;  4C2Z A;  1XEB A;  2FCK A;  2PR1 A;  2PRB A;  1J4J A;  2IL4 A;  4E8O A;  2R8V A;  3E0K A;  3TFY A;  3H4Q A;  4KUA A;  3V8I A;  2FSR A;  2CNT A;  2I79 A;  4F6A A;  2Q44 A;  1S7F A;  4XNH B;  2D4P A;  1NE9 A;  3TOA A;  1XIX A;  4CAV A;  4KOW A;  4CGN A;  3F8K A;  2ZPA A;  4OAE A;  3FBU A;  4YRH A;  1IB1 E;  2WPW A;  1RXT A;  4FD5 A;  4KOR A;  1BO4 A;  1UFH A;  3DNS A;  2BL1 A;  4QC6 A;  3BLN A;  2DPT A;  5JQ4 A;  4YFJ A;  5KTC A;  4B12 A;  2BSW A;  2Z3N A;  5F49 A;  4CYO A;  1S7N A;  1Y7R A;  4R57 A;  4F0Y A;  4NSQ A;  3QAH A;  4NF1 A;  3OWC A;  3ZZI A;  2DPS A;  4H6U A;  4Y49 B;  3QB8 A;  3PZJ A;  3UY5 A;  1NSL A;  5J8C A;  3TO7 A;  3D2P A;  4ZGY B;  4PK2 A;  5BWA B;  3D3S A;  3LD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...