5AG5A

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a thiazolidinone ligand
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Development of Small-Molecule Trypanosoma Brucei N-Myristoyltransferase Inhibitors: Discovery and Optimisation of a Novel Binding Mode.
pubmed doi rcsb
source organism Leishmania major
total genus 123
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5ag5A00
4C2ZA 4C7HA 4CGPA 4CGOA 4CYNA 4CAEA 4B13A 5A28A 4UCMA 4A33A 5AG5A 2YNCC 4CYPA 5AGEA 4UFWA 4BBHA 5AG4A 4B11A 4CYOA 4B10A 4A32A 4A2ZA 4C7IA 3JTKA 5G1ZA 5G20A 4C2XA 4CGLA 4CYQA 4UFXA 2WSAA 4UCNA 2WUUA 3IU1A 5AG7A 4CAFA 4CGMA 5AG6A 3IWEA 2YNDA 4UCPA 5G22A 4C68A 4CGNA 4B14A 4UFVA 5G21A 3H5ZA 5A27A 4A95A 4B12A 3IU2A 2YNCA 4A30A 2YNEA 4C2YA 4A31A
chains in the Genus database with same CATH superfamily
5E96A 4NGSA 1ELLP 5THWA 1ZG9A 2B4DA 3CXQA 3PP9A 4HNWB 4LX9A 1M4IA 4MFJA 4II9A 4U5YA 1FNOA 3N7ZA 3D8PA 2BO9A 5HVFA 4KUBA 3B3WA 3LMSA 2RB7A 4ZBGA 1LFWA 3CZXA 2P0WA 2WPWA 5G20A 4KOUA 3BHXA 1KWMA 4UCNA 1M4GA 3RBUA 2YGWA 1XJOA 2GE3A 1YLEA 3FYNA 4HNXB 1IGBA 1TF9A 3LWUA 4KS9A 3MN8A 4Q7AA 4CGNA 3D7DA 2CIJA 2FIWA 4KVXA 4R57A 4KOWA 4R87A 2VEZA 2BL1A 4A95A 1FT7A 1VHOA 5GCNA 2ZW4A 2YNCA 3KHZA 3PB9X 4AVBA 3EXNA 2QMLA 4KORA 2VXKA 4XPKA 2AFUA 4ZY2A 1YLOA 2B3VA 2XEFA 2FVGA 4IF5A 4GXHA 4FD4A 4ZX9A 1ZG8A 4M6HA 1ARLA 2PJCA 4MHYA 2B5GB 3E0KA 1KZFA 1ZLHA 1YK3A 3GY9A 4C7IA 1A2ZA 4NCZA 1P4NA 4CYQA 2B58A 4J3GA 3WABA 1U6MA 3IO1A 4NF1A 3SI1A 1I21A 3KKWA 3NE8A 5C88A 2VL1A 2AFXA 1AYEA 3EC4A 2OR4A 4GS4A 2DPSA 3QNVA 4OC5A 1XF8A 3R9EA 4NJRA 4CRZB 2Q44A 4FWUA 4MY3A 2VBQA 5IV0A 4X8IA 3UY5A 2GLJA 1VKCA 4RUHA 4B5PB 2G3AA 2CY2A 2PJ1A 2YNEA 3FIXA 4FD7A 4JWPA 4PXCA 5FVJA 3V8IA 1S5KA 2G0BA 2ZEMA 2JEWA 2ABZA 2CNTA 3B3CA 2VQYA 3KQZA 4MCSA 2ZW6A 4K3NA 2FSRA 4UWJA 1UFHA 2XEJA 1NSLA 3TT2A 4NJQA 3D7GA 2PQ8A 1NE9A 4MCRA 4JXQA 1KUXA 5K8PA 1AMPA 5LYDA 2O53A 4LUAA 2X7BA 5JGFA 1ZLIA 2HB6A 2ANPA 2B4DB 3GIUA 4PK2A 4RS2A 5LYIA 3FBUA 4ONUA 3RYOA 3IFEA 2JDDA 2FCKA 1QMUA 2POKA 1CG2A 2J9AA 2C6CA 4CAWA 1R57A 4L89A 3H8EA 2OU2A 4IK2A 1XBUA 2DPTA 3IEHA 1IYKA 3VWDA 5LRKA 2P6FA 2QIRA 4B13A 4JXRA 3SI0A 2QYVA 4MFLA 4CAXA 2HC9A 3D4UA 4KSAA 2PJBA 2IMOA 3PBEA 1MK4A 5AG4A 1Z8LA 4IUSA 1FY7A 4B10A 4R3KA 4K30A 4FD5A 3PB4X 4B6ZA 3R95A 2YNDA 5ISVA 2BOAA 2F5IA 3C26A 5G22A 3IWWA 4F0YA 1XEBA 3D66A 1I12A 4CAVA 1IY7A 4MFZA 1YSJA 2AFWA 2Q7SA 3D2PA 4ZY1A 3PFOA 1VIXA 4IHMA 5I4MA 4OMEA 3I3GA 3R9GA 4C7HA 2XEIA 2ZEOA 3FNCA 3S9MA 4KLWA 3GB0A 3K9TA 1RXTA 4NGNA 3V38A 3WR7A 2HQYA 1OBRA 2IQ6A 2CXAA 2Y0MA 2YNCC 1NSAA 1YX0A 3FB3A 3DLJA 3ISZA 1YR0A 2AFSA 5AGEA 1ARMA 6CPAA 2EVNA 1BPNA 1KUYA 3CDXA 1VHEA 3FH4A 4UEZA 2PR8A 4UFXA 5LRJA 3SJGA 2PJ5A 4NGRA 4P44A 3CXSA 4CGMA 1PYTB 1YW4A 4MHZA 3L2NA 3D68A 2AJ6A 4YU9A 4X3RA 2PJ3A 1RTQA 3A9LA 4QVTA 4H2KA 1R43A 2ZEHA 5G21A 4MFKA 2KCWA 4QC6A 3SXOA 3R96A 5EBVA 2AE6A 3IIBA 4KOVA 2EO8A 2Z3KA 2OH1A 4NGMA 1N71A 1PUAA 3PRTA 1S7FA 1JWQA 3CT9A 3ZZIA 3KQXA 3MRUA 4ZX8A 4F0XA 4F9VA 5I0CA 4BMHA 4UCMA 4G1PA 4F6AA 2FIAA 3T8WA 1BAVA 5H84A 3RAMA 1CP6A 5F46A 1CM0A 1PCAA 2HV2A 2I3CA 2OZGA 2PRQA 4AVCA 2GFQA 2REEA 4ORFA 4DNCA 5HMNA 2J8NA 3EFAA 1X12A 1Z2LA 4KOYA 4M6IA 4P4DA 4Q36A 3D7HA 4UFVA 4A94A 3TOAA 4YGOA 3KASA 3B2YA 5JM6A 3IU2A 1DTDA 5KTCA 3H8FA 4FAIA 2Q04A 3CPAA 3FVLA 2BEIA 1CX8A 2NYQA 1YGHA 4M3SA 2D4OA 4AVAA 1I1DA 2ARHA 2PVWA 1Q2CA 1TXRA 2AFZA 4NGQA 3S6KA 3PFEA 4UBRA 4CPAA 2FS5A 3B3TA 3D7FA 3IJ3A 4XPDB 4BBHA 2ZEPA 4OADA 1F2PA 4UWIA 2K5TA 3DR8A 1IOFA 2JLMA 2O4HA 5HVGA 4E8OA 3FECA 3TC8A 4MMOA 2CF4A 3D3SA 4TNUA 1K4JA 1Z8WA 1ON0A 3VARA 2DXQA 2GLFA 2ZPAA 3SHPA 3SI2A 4CRYB 3KZWA 4E0AA 5JH9A 4P4FA 2ZXVA 1GHEA 3PZJA 3ZJ0A 2Q51A 4KSFA 4MHPA 4R9MA 4CGOA 4E2AA 3FX6A 1LAPA 1Y7EA 3TO7A 2OOTA 4JYWA 4XPDC 3BJ8A 1LRZA 1M4DA 4NFRA 4U9ZA 2A4NA 1CJWA 3IWGA 4OKOA 3WC7A 2EUIA 2G3TA 1LCPA 2C6GA 4MBUA 1CP7A 4PK3A 4P4JA 2WSAA 2ZW7A 4YRHA 1SQHA 2PJ4A 2RFHA 5AG7A 3IWEA 2JBJA 3SJFA 3JRUA 4P6YA 4YWYA 3NFZA 4OIWA 4TWEA 5HH1A 1MJAA 3TX8A 4KOXA 4OC3A 2GANA 3FF3A 2AFOA 3B35A 2CNSA 4OC2A 4RN7A 5F47A 4DUKA 2OB0A 3CPXA 4YFJA 2Z11A 2DEAA 1BOBA 2IJZA 4CYNA 5F09A 1AUGA 1RO5A 3F8KA 1QSMA 4KVME 1Q2YA 1QSOA 1Y0RA 3EY5A 5IB9A 4NXYA 3WC5A 2PIZA 4H89A 2ZEGA 1XIXA 3QB8A 3P2HA 3RZAA 1IICA 2PJ2A 2WPXA 5KTAA 4MY0A 4UCPA 1HEEA 2V8DA 4GM5A 1Z8TA 3FMCA 4KZTA 1YVOA 2Q4VA 4P4BA 4P4EA 3HUVA 4B12A 4FBEA 1ELMP 2ZEFA 1KUVA 2REFA 2RC4A 4Z65A 3B3SA 2PJ6A 1M44A 4ZI6A 3K9UA 1P0HA 4NSQA 2C6PA 2FXFA 4PSXA 4M6GA 4CYPA 3TE4A 5K8NA 4L8AA 3PBBA 4LQGA 4UF4A 4A32A 1WK4A 2PIYA 3GYAA 4A2ZA 5HXDA 2C1CA 1GYTA 2Z3PA 3IU1A 1L0CA 2FT0A 3PB8X 1IIDA 3EO4A 1VHSA 1Z9UA 5AG6A 5D8NA 4KSIA 3VH9A 3TFYA 1XMTA 4ZY0A 1S60A 4NGPA 4C68A 5HVHA 3FJUA 4R7MA 4EFDA 4OC0A 3BXMA 4UEEA 3S9NA 3S9LA 3FEEA 1LANA 5F48A 3S6GA 2I00A 2VI7A 4AXVA 2J8RA 4C2YA 4A31A 3H8GA 1Q2DA 3PB6X 4CGPA 2V8VA 5DWNA 1PU9A 3I9SA 2VZZA 4MFPA 7CPAA 4ZYQA 4JD6A 5J8FA 4EVYA 4UFWA 2HUZA 2PRBA 5CPAA 3SJEA 2EWBA 3PGPA 2PVVA 2Z3MA 3BJ7A 1CPSA 8CPAA 1Y0YA 1Z4EA 3R1KA 4QB9A 4MXUA 3KR4A 1TKJA 2IL4A 3KHXA 1XFOA 2D4PA 2DF5A 1Y7RA 3VWEA 4C2ZA 3FEDA 2Z3OA 3NE7A 1YMEA 4WJBA 3BI1A 1HDQA 4MCPA 4PXBA 2QECA 2CTCA 4MHNA 5CNPA 2WYRA 2G9DA 3KGQA 4H6UA 4OC1A 3K2KA 2PC1A 2H5MA 2JEVA 1V0CA 2VZYA 4CYOA 1EE3P 3B3VA 4ZGYB 3SJXA 5G1ZA 1Y9WA 2R7HA 1B87A 2ZENA 4F8ZA 4R76A 4KLVA 3RNZA 3QAYA 4UIBA 1QSRA 3R9FA 4AG9A 3H5ZA 2R8VA 4NGTA 4BINA 1MJBA 1R3NA 5LYLA 3V7ZA 5DWMA 3T9YA 4OP4A 2Z3NA 2ZOFA 1UWYA 2ZEEA 1IU8A 4JJXA 3TO6A 1YQEA 2CNMA 1YVKA 4QBJA 1Z4RA 4BD9A 1XE4A 4O23A 1Y9KA 4UA3A 3WT4A 3QAHA 1CPXA 4XNHB 3TOBA 4B11A 2QJ8A 1OZPA 3MGDA 4Q38A 2V8GA 5KTDA 3CXPA 2JBKA 5K8MA 2Q4YA 1JQGA 2Z3LA 1BLLE 4JLYA 2V77A 4A37A 2BUEA 2PJ8A 3B8GA 1Z8XA 4U9YA 2O28A 5C82A 2PJ9A 3DGVA 2WZNA 4LQ6A 1LAMA 2C27A 3GKRA 2FE7A 4P10A 4R3LA 1HDUA 2FL4A 1TKHA 2PJ7A 3DR6A 2EK8A 5BWAB 4RI1A 1S7LA 3OWCA 3BLNA 4XPLA 3NH8A 2CTBA 5EC4A 4H6ZA 2OZUA 2PJAA 1XOVA 2EK9A 2P6GA 4IAVA 3NA6A 3W91A 1QQ9A 4XNHC 4CAEA 5JQ4A 3ISXA 4FD6A 4R8FA 1TF8A 3DSBA 4KOTA 4X5KA 2P6EA 2ZW5A 4Y49B 4DYOA 4MHDA 1J4JA 3LD2A 3JTKA 4C2XA 4CGLA 5IB0A 1F57A 2ZELA 1ZG7A 2Z0ZA 3F0AA 2R98A 2ZOGA 4CAFA 5J8CA 3T90A 2XEGA 2V8HA 2Q7BA 3FRMA 1Q7LA 4PXEA 1BO4A 5LRGA 5A27A 5LYFA 5JPHA 4MRIA 4AG7A 1IB1E 1TKFA 2OZHA 3JUWA 3PEIA 2B4BA 3B7IA 1XRYA 3D2MA 4HKFA 5DS0A 2F8HA 3DNSA 4PSWA 3TTHA 4A33A 2R1IA 1NMTA 3G3SA 4FUUA 4EWTA 5D29A 3P2FA 5J1QA 2Z10A 5EMIA 2ODFA 4R6TA 2BSWA 4KOSA 1VGYA 5A28A 4X2TA 2AFMA 2ZEDA 4Y49C 5AG5A 4EMEA 3SXNA 4OLLA 4OAEA 1YREA 4PV6A 3WC6A 2PCUA 3KR5A 1DE4C 3S6HA 2WUUA 4B5OA 3KI9A 3NH5A 2EBJA 3PB7X 5K8OA 4JZ0A 3BI0A 4MCQA 1IYLA 2BCOA 2PDOA 2PR1A 2QVPA 1QSNA 2NSMA 3RO0A 5CBMA 3GLJA 5ELYA 3VATA 2Q43A 3NH4A 4KUAA 4I49A 1TIQA 4UEFA 1WWZA 1CBXA 3JVNA 4KVOE 2B5GA 1LOKA 5F49A 2NMTA 4A38A 5IX3A 2ATRA 2F7VA 1QSTA 3FXTA 1S7NA 1IOIA 2B3UA 2J8MA 3IGRA 4PQAA 4PXDA 2PJ0A 4WWVA 4A39A 3G8WA 4P45A 3KL9A 2GU2A 3LACA 1F2OA 4PPZA 4QUSA 1M4LA 3HLPA 3H4QA 4MJ8A 4W9YA 3W6XA 4CS0B 3IC1A 1B6BA 4OC4A 4F9UA 2GREA 1XMBA 3GUXA 2PE3A 4MI4A 4B5PA 3TO9A 1S3ZA 3I1UA 1X10A 4NEXA 1MJ9A 1Z5RA 3F5BA 2I79A 4P4IA 1M1DA 1H8LA 4OIDA 4MFQA 4HPSA 1YW6A 2Q0YA 3N5FA 4HNYB 4B14A 1ZO0A 1S7KA 3S6FA 3TCVA 3D67A 3LODA 4UIAA 4AB7A 4M85A 2Q4ZA 4ONWA 3W6SA 2GIVA 2PSWA 3DDDA 2JDCA 4A30A 4DJLA 1BPMA 5H86A
chains in the Genus database with same CATH topology
5E96A 2B4DA 3CXQA 3PP9A 4HNWB 4LX9A 1M4IA 4MFJA 4II9A 4U5YA 3N7ZA 3D8PA 4KUBA 4ZBGA 2P0WA 2WPWA 5G20A 4KOUA 4UCNA 1M4GA 2YGWA 2GE3A 1YLEA 3FYNA 4HNXB 4KS9A 4CGNA 2FIWA 4KVXA 4R57A 4KOWA 4R87A 2VEZA 2BL1A 4A95A 5GCNA 2ZW4A 2YNCA 4AVBA 3EXNA 2QMLA 4KORA 2VXKA 4XPKA 2B3VA 4IF5A 4FD4A 2B5GB 3E0KA 1KZFA 3GY9A 1YK3A 4C7IA 4NCZA 1P4NA 4CYQA 2B58A 4J3GA 1U6MA 4NF1A 1I21A 3KKWA 5C88A 3EC4A 4GS4A 2DPSA 1XF8A 3R9EA 4CRZB 2Q44A 4MY3A 2VBQA 5IV0A 3UY5A 1VKCA 4B5PB 2G3AA 2CY2A 2YNEA 3FIXA 4FD7A 4JWPA 5FVJA 3V8IA 1S5KA 2G0BA 2CNTA 2VQYA 2ZW6A 2FSRA 4UWJA 1UFHA 1NSLA 3TT2A 2PQ8A 1NE9A 4JXQA 1KUXA 4LUAA 2X7BA 4RS2A 4PK2A 2B4DB 3FBUA 4ONUA 3RYOA 2JDDA 2FCKA 4CAWA 1R57A 4L89A 2OU2A 2DPTA 1IYKA 3VWDA 2P6FA 2QIRA 4B13A 4JXRA 4MFLA 4CAXA 4KSAA 1MK4A 5AG4A 4IUSA 1FY7A 4B10A 4R3KA 4K30A 4FD5A 3R95A 2YNDA 5ISVA 2F5IA 3C26A 5G22A 4F0YA 1XEBA 1I12A 4CAVA 4MFZA 3D2PA 3I3GA 3R9GA 4C7HA 3FNCA 4KLWA 1RXTA 3WR7A 2HQYA 2CXAA 2Y0MA 2YNCC 1YX0A 3FB3A 5AGEA 1YR0A 2EVNA 3S6KA 1KUYA 2PR8A 4UFXA 3CXSA 4CGMA 2AJ6A 3A9LA 4QVTA 5G21A 4MFKA 2KCWA 4QC6A 3SXOA 5EBVA 2AE6A 4KOVA 2Z3KA 2OH1A 1N71A 1PUAA 1S7FA 3ZZIA 5I0CA 4F0XA 4BMHA 4UCMA 4F6AA 2FIAA 5H84A 5F46A 1CM0A 2HV2A 2OZGA 4AVCA 4ORFA 2REEA 4DNCA 5HMNA 2J8NA 3EFAA 4Q36A 4KOYA 4UFVA 3TOAA 4YGOA 3IU2A 5KTCA 2Q04A 2BEIA 1YGHA 4M3SA 2D4OA 4AVAA 1I1DA 2ARHA 1Q2CA 4UBRA 2FS5A 4XPDB 4BBHA 4OADA 4UWIA 2K5TA 3DR8A 2JLMA 4E8OA 3D3SA 1K4JA 1ON0A 2DXQA 4CRYB 2ZPAA 3SHPA 4E0AA 2ZXVA 1GHEA 3PZJA 3ZJ0A 4KSFA 4R9MA 4CGOA 4E2AA 3TO7A 4XPDC 3BJ8A 1LRZA 1M4DA 4U9ZA 2A4NA 1CJWA 3IWGA 2EUIA 2G3TA 4MBUA 4PK3A 4YRHA 2WSAA 2ZW7A 1SQHA 5AG7A 3IWEA 5HH1A 1MJAA 4KOXA 2GANA 2CNSA 5F47A 2OB0A 4YFJA 2Z11A 1BOBA 4CYNA 1RO5A 3F8KA 4KVME 1QSMA 1Q2YA 1QSOA 3EY5A 4NXYA 4H89A 1XIXA 3QB8A 3P2HA 1IICA 2WPXA 5KTAA 4MY0A 4UCPA 4KZTA 1YVOA 2Q4VA 4B12A 1KUVA 2REFA 2RC4A 1M44A 3K9UA 1P0HA 4NSQA 2FXFA 4PSXA 4CYPA 3TE4A 4L8AA 4A32A 4A2ZA 1WK4A 3GYAA 2Z3PA 3IU1A 1L0CA 2FT0A 1IIDA 3EO4A 1VHSA 1Z9UA 5AG6A 3TFYA 1XMTA 1S60A 4C68A 5F48A 3S6GA 2I00A 2VI7A 2J8RA 4C2YA 4A31A 1Q2DA 4CGPA 5DWNA 1PU9A 3I9SA 2VZZA 4MFPA 4JD6A 5J8FA 4EVYA 4UFWA 2HUZA 2PRBA 3PGPA 2Z3MA 3BJ7A 1Z4EA 3R1KA 4QB9A 2IL4A 2D4PA 1Y7RA 3VWEA 4C2ZA 2Z3OA 3NE7A 2QECA 5CNPA 4H6UA 2PC1A 2H5MA 2JEVA 1V0CA 2VZYA 4CYOA 4ZGYB 5G1ZA 1Y9WA 2R7HA 1B87A 4KLVA 1QSRA 3R9FA 4AG9A 3H5ZA 2R8VA 1MJBA 5DWMA 3T9YA 2Z3NA 4JJXA 3TO6A 2CNMA 1YVKA 4QBJA 1Z4RA 1XE4A 1Y9KA 4UA3A 3QAHA 4XNHB 3TOBA 4B11A 1OZPA 3MGDA 4Q38A 5KTDA 3CXPA 2Q4YA 2Z3LA 4JLYA 2BUEA 3B8GA 4U9YA 2O28A 5C82A 3GKRA 2C27A 2FE7A 4R3LA 2FL4A 3DR6A 5BWAB 4RI1A 1S7LA 3OWCA 3BLNA 4XPLA 5EC4A 4H6ZA 2OZUA 3W91A 4CAEA 2P6GA 4XNHC 5JQ4A 4FD6A 3DSBA 4KOTA 4X5KA 2P6EA 2ZW5A 4Y49B 4MHDA 1J4JA 3LD2A 3JTKA 4C2XA 4CGLA 5IB0A 2Z0ZA 3F0AA 2R98A 4CAFA 5J8CA 3T90A 2Q7BA 3FRMA 1BO4A 5A27A 5JPHA 4AG7A 1IB1E 2OZHA 3JUWA 4HKFA 3R96A 2B4BA 3D2MA 3DNSA 3TTHA 4PSWA 4A33A 2R1IA 1NMTA 3G3SA 3P2FA 2Z10A 2BSWA 4KOSA 5A28A 4Y49C 5AG5A 3SXNA 4OLLA 4OAEA 1YREA 4PV6A 3S6HA 2WUUA 4B5OA 1IYLA 2PDOA 2PR1A 1QSNA 4KUAA 4I49A 1TIQA 1WWZA 3JVNA 5F49A 4KVOE 2B5GA 5IX3A 2NMTA 2ATRA 3FXTA 1QSTA 1S7NA 2B3UA 2J8MA 3IGRA 3G8WA 4QUSA 3H4QA 4MJ8A 3W6XA 4CS0B 1B6BA 4MI4A 4B5PA 3TO9A 1S3ZA 4NEXA 1MJ9A 3F5BA 2I79A 1M1DA 4MFQA 2Q0YA 4HNYB 4B14A 1ZO0A 1S7KA 3S6FA 3TCVA 4AB7A 3LODA 4M85A 3W6SA 2GIVA 2PSWA 3DDDA 2JDCA 4A30A 5H86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C2Z A;  4C7H A;  4CGP A;  4CGO A;  4CYN A;  4CAE A;  4B13 A;  5A28 A;  4UCM A;  4A33 A;  5AG5 A;  2YNC C;  4CYP A;  5AGE A;  4UFW A;  4BBH A;  5AG4 A;  4B11 A;  4CYO A;  4B10 A;  4A32 A;  4A2Z A;  4C7I A;  3JTK A;  5G1Z A;  5G20 A;  4C2X A;  4CGL A;  4CYQ A;  4UFX A;  2WSA A;  4UCN A;  2WUU A;  3IU1 A;  5AG7 A;  4CAF A;  4CGM A;  5AG6 A;  3IWE A;  2YND A;  4UCP A;  5G22 A;  4C68 A;  4CGN A;  4B14 A;  4UFV A;  5G21 A;  3H5Z A;  5A27 A;  4A95 A;  4B12 A;  3IU2 A;  2YNC A;  4A30 A;  2YNE A;  4C2Y A;  4A31 A; 
#chains in the Genus database with same CATH topology
 5E96 A;  4NGS A;  1ELL P;  5THW A;  1ZG9 A;  2B4D A;  3CXQ A;  3PP9 A;  4HNW B;  4LX9 A;  1M4I A;  4MFJ A;  4II9 A;  4U5Y A;  1FNO A;  3N7Z A;  3D8P A;  2BO9 A;  5HVF A;  4KUB A;  3B3W A;  3LMS A;  2RB7 A;  4ZBG A;  1LFW A;  3CZX A;  2P0W A;  2WPW A;  5G20 A;  4KOU A;  3BHX A;  1KWM A;  4UCN A;  1M4G A;  3RBU A;  2YGW A;  1XJO A;  2GE3 A;  1YLE A;  3FYN A;  4HNX B;  1IGB A;  1TF9 A;  3LWU A;  4KS9 A;  3MN8 A;  4Q7A A;  4CGN A;  3D7D A;  2CIJ A;  2FIW A;  4KVX A;  4R57 A;  4KOW A;  4R87 A;  2VEZ A;  2BL1 A;  4A95 A;  1FT7 A;  1VHO A;  5GCN A;  2ZW4 A;  2YNC A;  3KHZ A;  3PB9 X;  4AVB A;  3EXN A;  2QML A;  4KOR A;  2VXK A;  4XPK A;  2AFU A;  4ZY2 A;  1YLO A;  2B3V A;  2XEF A;  2FVG A;  4IF5 A;  4GXH A;  4FD4 A;  4ZX9 A;  1ZG8 A;  4M6H A;  1ARL A;  2PJC A;  4MHY A;  2B5G B;  3E0K A;  1KZF A;  1ZLH A;  1YK3 A;  3GY9 A;  4C7I A;  1A2Z A;  4NCZ A;  1P4N A;  4CYQ A;  2B58 A;  4J3G A;  3WAB A;  1U6M A;  3IO1 A;  4NF1 A;  3SI1 A;  1I21 A;  3KKW A;  3NE8 A;  5C88 A;  2VL1 A;  2AFX A;  1AYE A;  3EC4 A;  2OR4 A;  4GS4 A;  2DPS A;  3QNV A;  4OC5 A;  1XF8 A;  3R9E A;  4NJR A;  4CRZ B;  2Q44 A;  4FWU A;  4MY3 A;  2VBQ A;  5IV0 A;  4X8I A;  3UY5 A;  2GLJ A;  1VKC A;  4RUH A;  4B5P B;  2G3A A;  2CY2 A;  2PJ1 A;  2YNE A;  3FIX A;  4FD7 A;  4JWP A;  4PXC A;  5FVJ A;  3V8I A;  1S5K A;  2G0B A;  2ZEM A;  2JEW A;  2ABZ A;  2CNT A;  3B3C A;  2VQY A;  3KQZ A;  4MCS A;  2ZW6 A;  4K3N A;  2FSR A;  4UWJ A;  1UFH A;  2XEJ A;  1NSL A;  3TT2 A;  4NJQ A;  3D7G A;  2PQ8 A;  1NE9 A;  4MCR A;  4JXQ A;  1KUX A;  5K8P A;  1AMP A;  5LYD A;  2O53 A;  4LUA A;  2X7B A;  5JGF A;  1ZLI A;  2HB6 A;  2ANP A;  2B4D B;  3GIU A;  4PK2 A;  4RS2 A;  5LYI A;  3FBU A;  4ONU A;  3RYO A;  3IFE A;  2JDD A;  2FCK A;  1QMU A;  2POK A;  1CG2 A;  2J9A A;  2C6C A;  4CAW A;  1R57 A;  4L89 A;  3H8E A;  2OU2 A;  4IK2 A;  1XBU A;  2DPT A;  3IEH A;  1IYK A;  3VWD A;  5LRK A;  2P6F A;  2QIR A;  4B13 A;  4JXR A;  3SI0 A;  2QYV A;  4MFL A;  4CAX A;  2HC9 A;  3D4U A;  4KSA A;  2PJB A;  2IMO A;  3PBE A;  1MK4 A;  5AG4 A;  1Z8L A;  4IUS A;  1FY7 A;  4B10 A;  4R3K A;  4K30 A;  4FD5 A;  3PB4 X;  4B6Z A;  3R95 A;  2YND A;  5ISV A;  2BOA A;  2F5I A;  3C26 A;  5G22 A;  3IWW A;  4F0Y A;  1XEB A;  3D66 A;  1I12 A;  4CAV A;  1IY7 A;  4MFZ A;  1YSJ A;  2AFW A;  2Q7S A;  3D2P A;  4ZY1 A;  3PFO A;  1VIX A;  4IHM A;  5I4M A;  4OME A;  3I3G A;  3R9G A;  4C7H A;  2XEI A;  2ZEO A;  3FNC A;  3S9M A;  4KLW A;  3GB0 A;  3K9T A;  1RXT A;  4NGN A;  3V38 A;  3WR7 A;  2HQY A;  1OBR A;  2IQ6 A;  2CXA A;  2Y0M A;  2YNC C;  1NSA A;  1YX0 A;  3FB3 A;  3DLJ A;  3ISZ A;  1YR0 A;  2AFS A;  5AGE A;  1ARM A;  6CPA A;  2EVN A;  1BPN A;  1KUY A;  3CDX A;  1VHE A;  3FH4 A;  4UEZ A;  2PR8 A;  4UFX A;  5LRJ A;  3SJG A;  2PJ5 A;  4NGR A;  4P44 A;  3CXS A;  4CGM A;  1PYT B;  1YW4 A;  4MHZ A;  3L2N A;  3D68 A;  2AJ6 A;  4YU9 A;  4X3R A;  2PJ3 A;  1RTQ A;  3A9L A;  4QVT A;  4H2K A;  1R43 A;  2ZEH A;  5G21 A;  4MFK A;  2KCW A;  4QC6 A;  3SXO A;  3R96 A;  5EBV A;  2AE6 A;  3IIB A;  4KOV A;  2EO8 A;  2Z3K A;  2OH1 A;  4NGM A;  1N71 A;  1PUA A;  3PRT A;  1S7F A;  1JWQ A;  3CT9 A;  3ZZI A;  3KQX A;  3MRU A;  4ZX8 A;  4F0X A;  4F9V A;  5I0C A;  4BMH A;  4UCM A;  4G1P A;  4F6A A;  2FIA A;  3T8W A;  1BAV A;  5H84 A;  3RAM A;  1CP6 A;  5F46 A;  1CM0 A;  1PCA A;  2HV2 A;  2I3C A;  2OZG A;  2PRQ A;  4AVC A;  2GFQ A;  2REE A;  4ORF A;  4DNC A;  5HMN A;  2J8N A;  3EFA A;  1X12 A;  1Z2L A;  4KOY A;  4M6I A;  4P4D A;  4Q36 A;  3D7H A;  4UFV A;  4A94 A;  3TOA A;  4YGO A;  3KAS A;  3B2Y A;  5JM6 A;  3IU2 A;  1DTD A;  5KTC A;  3H8F A;  4FAI A;  2Q04 A;  3CPA A;  3FVL A;  2BEI A;  1CX8 A;  2NYQ A;  1YGH A;  4M3S A;  2D4O A;  4AVA A;  1I1D A;  2ARH A;  2PVW A;  1Q2C A;  1TXR A;  2AFZ A;  4NGQ A;  3S6K A;  3PFE A;  4UBR A;  4CPA A;  2FS5 A;  3B3T A;  3D7F A;  3IJ3 A;  4XPD B;  4BBH A;  2ZEP A;  4OAD A;  1F2P A;  4UWI A;  2K5T A;  3DR8 A;  1IOF A;  2JLM A;  2O4H A;  5HVG A;  4E8O A;  3FEC A;  3TC8 A;  4MMO A;  2CF4 A;  3D3S A;  4TNU A;  1K4J A;  1Z8W A;  1ON0 A;  3VAR A;  2DXQ A;  2GLF A;  2ZPA A;  3SHP A;  3SI2 A;  4CRY B;  3KZW A;  4E0A A;  5JH9 A;  4P4F A;  2ZXV A;  1GHE A;  3PZJ A;  3ZJ0 A;  2Q51 A;  4KSF A;  4MHP A;  4R9M A;  4CGO A;  4E2A A;  3FX6 A;  1LAP A;  1Y7E A;  3TO7 A;  2OOT A;  4JYW A;  4XPD C;  3BJ8 A;  1LRZ A;  1M4D A;  4NFR A;  4U9Z A;  2A4N A;  1CJW A;  3IWG A;  4OKO A;  3WC7 A;  2EUI A;  2G3T A;  1LCP A;  2C6G A;  4MBU A;  1CP7 A;  4PK3 A;  4P4J A;  2WSA A;  2ZW7 A;  4YRH A;  1SQH A;  2PJ4 A;  2RFH A;  5AG7 A;  3IWE A;  2JBJ A;  3SJF A;  3JRU A;  4P6Y A;  4YWY A;  3NFZ A;  4OIW A;  4TWE A;  5HH1 A;  1MJA A;  3TX8 A;  4KOX A;  4OC3 A;  2GAN A;  3FF3 A;  2AFO A;  3B35 A;  2CNS A;  4OC2 A;  4RN7 A;  5F47 A;  4DUK A;  2OB0 A;  3CPX A;  4YFJ A;  2Z11 A;  2DEA A;  1BOB A;  2IJZ A;  4CYN A;  5F09 A;  1AUG A;  1RO5 A;  3F8K A;  1QSM A;  4KVM E;  1Q2Y A;  1QSO A;  1Y0R A;  3EY5 A;  5IB9 A;  4NXY A;  3WC5 A;  2PIZ A;  4H89 A;  2ZEG A;  1XIX A;  3QB8 A;  3P2H A;  3RZA A;  1IIC A;  2PJ2 A;  2WPX A;  5KTA A;  4MY0 A;  4UCP A;  1HEE A;  2V8D A;  4GM5 A;  1Z8T A;  3FMC A;  4KZT A;  1YVO A;  2Q4V A;  4P4B A;  4P4E A;  3HUV A;  4B12 A;  4FBE A;  1ELM P;  2ZEF A;  1KUV A;  2REF A;  2RC4 A;  4Z65 A;  3B3S A;  2PJ6 A;  1M44 A;  4ZI6 A;  3K9U A;  1P0H A;  4NSQ A;  2C6P A;  2FXF A;  4PSX A;  4M6G A;  4CYP A;  3TE4 A;  5K8N A;  4L8A A;  3PBB A;  4LQG A;  4UF4 A;  4A32 A;  1WK4 A;  2PIY A;  3GYA A;  4A2Z A;  5HXD A;  2C1C A;  1GYT A;  2Z3P A;  3IU1 A;  1L0C A;  2FT0 A;  3PB8 X;  1IID A;  3EO4 A;  1VHS A;  1Z9U A;  5AG6 A;  5D8N A;  4KSI A;  3VH9 A;  3TFY A;  1XMT A;  4ZY0 A;  1S60 A;  4NGP A;  4C68 A;  5HVH A;  3FJU A;  4R7M A;  4EFD A;  4OC0 A;  3BXM A;  4UEE A;  3S9N A;  3S9L A;  3FEE A;  1LAN A;  5F48 A;  3S6G A;  2I00 A;  2VI7 A;  4AXV A;  2J8R A;  4C2Y A;  4A31 A;  3H8G A;  1Q2D A;  3PB6 X;  4CGP A;  2V8V A;  5DWN A;  1PU9 A;  3I9S A;  2VZZ A;  4MFP A;  7CPA A;  4ZYQ A;  4JD6 A;  5J8F A;  4EVY A;  4UFW A;  2HUZ A;  2PRB A;  5CPA A;  3SJE A;  2EWB A;  3PGP A;  2PVV A;  2Z3M A;  3BJ7 A;  1CPS A;  8CPA A;  1Y0Y A;  1Z4E A;  3R1K A;  4QB9 A;  4MXU A;  3KR4 A;  1TKJ A;  2IL4 A;  3KHX A;  1XFO A;  2D4P A;  2DF5 A;  1Y7R A;  3VWE A;  4C2Z A;  3FED A;  2Z3O A;  3NE7 A;  1YME A;  4WJB A;  3BI1 A;  1HDQ A;  4MCP A;  4PXB A;  2QEC A;  2CTC A;  4MHN A;  5CNP A;  2WYR A;  2G9D A;  3KGQ A;  4H6U A;  4OC1 A;  3K2K A;  2PC1 A;  2H5M A;  2JEV A;  1V0C A;  2VZY A;  4CYO A;  1EE3 P;  3B3V A;  4ZGY B;  3SJX A;  5G1Z A;  1Y9W A;  2R7H A;  1B87 A;  2ZEN A;  4F8Z A;  4R76 A;  4KLV A;  3RNZ A;  3QAY A;  4UIB A;  1QSR A;  3R9F A;  4AG9 A;  3H5Z A;  2R8V A;  4NGT A;  4BIN A;  1MJB A;  1R3N A;  5LYL A;  3V7Z A;  5DWM A;  3T9Y A;  4OP4 A;  2Z3N A;  2ZOF A;  1UWY A;  2ZEE A;  1IU8 A;  4JJX A;  3TO6 A;  1YQE A;  2CNM A;  1YVK A;  4QBJ A;  1Z4R A;  4BD9 A;  1XE4 A;  4O23 A;  1Y9K A;  4UA3 A;  3WT4 A;  3QAH A;  1CPX A;  4XNH B;  3TOB A;  4B11 A;  2QJ8 A;  1OZP A;  3MGD A;  4Q38 A;  2V8G A;  5KTD A;  3CXP A;  2JBK A;  5K8M A;  2Q4Y A;  1JQG A;  2Z3L A;  1BLL E;  4JLY A;  2V77 A;  4A37 A;  2BUE A;  2PJ8 A;  3B8G A;  1Z8X A;  4U9Y A;  2O28 A;  5C82 A;  2PJ9 A;  3DGV A;  2WZN A;  4LQ6 A;  1LAM A;  2C27 A;  3GKR A;  2FE7 A;  4P10 A;  4R3L A;  1HDU A;  2FL4 A;  1TKH A;  2PJ7 A;  3DR6 A;  2EK8 A;  5BWA B;  4RI1 A;  1S7L A;  3OWC A;  3BLN A;  4XPL A;  3NH8 A;  2CTB A;  5EC4 A;  4H6Z A;  2OZU A;  2PJA A;  1XOV A;  2EK9 A;  2P6G A;  4IAV A;  3NA6 A;  3W91 A;  1QQ9 A;  4XNH C;  4CAE A;  5JQ4 A;  3ISX A;  4FD6 A;  4R8F A;  1TF8 A;  3DSB A;  4KOT A;  4X5K A;  2P6E A;  2ZW5 A;  4Y49 B;  4DYO A;  4MHD A;  1J4J A;  3LD2 A;  3JTK A;  4C2X A;  4CGL A;  5IB0 A;  1F57 A;  2ZEL A;  1ZG7 A;  2Z0Z A;  3F0A A;  2R98 A;  2ZOG A;  4CAF A;  5J8C A;  3T90 A;  2XEG A;  2V8H A;  2Q7B A;  3FRM A;  1Q7L A;  4PXE A;  1BO4 A;  5LRG A;  5A27 A;  5LYF A;  5JPH A;  4MRI A;  4AG7 A;  1IB1 E;  1TKF A;  2OZH A;  3JUW A;  3PEI A;  2B4B A;  3B7I A;  1XRY A;  3D2M A;  4HKF A;  5DS0 A;  2F8H A;  3DNS A;  4PSW A;  3TTH A;  4A33 A;  2R1I A;  1NMT A;  3G3S A;  4FUU A;  4EWT A;  5D29 A;  3P2F A;  5J1Q A;  2Z10 A;  5EMI A;  2ODF A;  4R6T A;  2BSW A;  4KOS A;  1VGY A;  5A28 A;  4X2T A;  2AFM A;  2ZED A;  4Y49 C;  5AG5 A;  4EME A;  3SXN A;  4OLL A;  4OAE A;  1YRE A;  4PV6 A;  3WC6 A;  2PCU A;  3KR5 A;  1DE4 C;  3S6H A;  2WUU A;  4B5O A;  3KI9 A;  3NH5 A;  2EBJ A;  3PB7 X;  5K8O A;  4JZ0 A;  3BI0 A;  4MCQ A;  1IYL A;  2BCO A;  2PDO A;  2PR1 A;  2QVP A;  1QSN A;  2NSM A;  3RO0 A;  5CBM A;  3GLJ A;  5ELY A;  3VAT A;  2Q43 A;  3NH4 A;  4KUA A;  4I49 A;  1TIQ A;  4UEF A;  1WWZ A;  1CBX A;  3JVN A;  4KVO E;  2B5G A;  1LOK A;  5F49 A;  2NMT A;  4A38 A;  5IX3 A;  2ATR A;  2F7V A;  1QST A;  3FXT A;  1S7N A;  1IOI A;  2B3U A;  2J8M A;  3IGR A;  4PQA A;  4PXD A;  2PJ0 A;  4WWV A;  4A39 A;  3G8W A;  4P45 A;  3KL9 A;  2GU2 A;  3LAC A;  1F2O A;  4PPZ A;  4QUS A;  1M4L A;  3HLP A;  3H4Q A;  4MJ8 A;  4W9Y A;  3W6X A;  4CS0 B;  3IC1 A;  1B6B A;  4OC4 A;  4F9U A;  2GRE A;  1XMB A;  3GUX A;  2PE3 A;  4MI4 A;  4B5P A;  3TO9 A;  1S3Z A;  3I1U A;  1X10 A;  4NEX A;  1MJ9 A;  1Z5R A;  3F5B A;  2I79 A;  4P4I A;  1M1D A;  1H8L A;  4OID A;  4MFQ A;  4HPS A;  1YW6 A;  2Q0Y A;  3N5F A;  4HNY B;  4B14 A;  1ZO0 A;  1S7K A;  3S6F A;  3TCV A;  3D67 A;  3LOD A;  4UIA A;  4AB7 A;  4M85 A;  2Q4Z A;  4ONW A;  3W6S A;  2GIV A;  2PSW A;  3DDD A;  2JDC A;  4A30 A;  4DJL A;  1BPM A;  5H86 A; 
#chains in the Genus database with same CATH homology
 5E96 A;  2B4D A;  3CXQ A;  3PP9 A;  4HNW B;  4LX9 A;  1M4I A;  4MFJ A;  4II9 A;  4U5Y A;  3N7Z A;  3D8P A;  4KUB A;  4ZBG A;  2P0W A;  2WPW A;  5G20 A;  4KOU A;  4UCN A;  1M4G A;  2YGW A;  2GE3 A;  1YLE A;  3FYN A;  4HNX B;  4KS9 A;  4CGN A;  2FIW A;  4KVX A;  4R57 A;  4KOW A;  4R87 A;  2VEZ A;  2BL1 A;  4A95 A;  5GCN A;  2ZW4 A;  2YNC A;  4AVB A;  3EXN A;  2QML A;  4KOR A;  2VXK A;  4XPK A;  2B3V A;  4IF5 A;  4FD4 A;  2B5G B;  3E0K A;  1KZF A;  3GY9 A;  1YK3 A;  4C7I A;  4NCZ A;  1P4N A;  4CYQ A;  2B58 A;  4J3G A;  1U6M A;  4NF1 A;  1I21 A;  3KKW A;  5C88 A;  3EC4 A;  4GS4 A;  2DPS A;  1XF8 A;  3R9E A;  4CRZ B;  2Q44 A;  4MY3 A;  2VBQ A;  5IV0 A;  3UY5 A;  1VKC A;  4B5P B;  2G3A A;  2CY2 A;  2YNE A;  3FIX A;  4FD7 A;  4JWP A;  5FVJ A;  3V8I A;  1S5K A;  2G0B A;  2CNT A;  2VQY A;  2ZW6 A;  2FSR A;  4UWJ A;  1UFH A;  1NSL A;  3TT2 A;  2PQ8 A;  1NE9 A;  4JXQ A;  1KUX A;  4LUA A;  2X7B A;  4RS2 A;  4PK2 A;  2B4D B;  3FBU A;  4ONU A;  3RYO A;  2JDD A;  2FCK A;  4CAW A;  1R57 A;  4L89 A;  2OU2 A;  2DPT A;  1IYK A;  3VWD A;  2P6F A;  2QIR A;  4B13 A;  4JXR A;  4MFL A;  4CAX A;  4KSA A;  1MK4 A;  5AG4 A;  4IUS A;  1FY7 A;  4B10 A;  4R3K A;  4K30 A;  4FD5 A;  3R95 A;  2YND A;  5ISV A;  2F5I A;  3C26 A;  5G22 A;  4F0Y A;  1XEB A;  1I12 A;  4CAV A;  4MFZ A;  3D2P A;  3I3G A;  3R9G A;  4C7H A;  3FNC A;  4KLW A;  1RXT A;  3WR7 A;  2HQY A;  2CXA A;  2Y0M A;  2YNC C;  1YX0 A;  3FB3 A;  5AGE A;  1YR0 A;  2EVN A;  3S6K A;  1KUY A;  2PR8 A;  4UFX A;  3CXS A;  4CGM A;  2AJ6 A;  3A9L A;  4QVT A;  5G21 A;  4MFK A;  2KCW A;  4QC6 A;  3SXO A;  5EBV A;  2AE6 A;  4KOV A;  2Z3K A;  2OH1 A;  1N71 A;  1PUA A;  1S7F A;  3ZZI A;  5I0C A;  4F0X A;  4BMH A;  4UCM A;  4F6A A;  2FIA A;  5H84 A;  5F46 A;  1CM0 A;  2HV2 A;  2OZG A;  4AVC A;  4ORF A;  2REE A;  4DNC A;  5HMN A;  2J8N A;  3EFA A;  4Q36 A;  4KOY A;  4UFV A;  3TOA A;  4YGO A;  3IU2 A;  5KTC A;  2Q04 A;  2BEI A;  1YGH A;  4M3S A;  2D4O A;  4AVA A;  1I1D A;  2ARH A;  1Q2C A;  4UBR A;  2FS5 A;  4XPD B;  4BBH A;  4OAD A;  4UWI A;  2K5T A;  3DR8 A;  2JLM A;  4E8O A;  3D3S A;  1K4J A;  1ON0 A;  2DXQ A;  4CRY B;  2ZPA A;  3SHP A;  4E0A A;  2ZXV A;  1GHE A;  3PZJ A;  3ZJ0 A;  4KSF A;  4R9M A;  4CGO A;  4E2A A;  3TO7 A;  4XPD C;  3BJ8 A;  1LRZ A;  1M4D A;  4U9Z A;  2A4N A;  1CJW A;  3IWG A;  2EUI A;  2G3T A;  4MBU A;  4PK3 A;  4YRH A;  2WSA A;  2ZW7 A;  1SQH A;  5AG7 A;  3IWE A;  5HH1 A;  1MJA A;  4KOX A;  2GAN A;  2CNS A;  5F47 A;  2OB0 A;  4YFJ A;  2Z11 A;  1BOB A;  4CYN A;  1RO5 A;  3F8K A;  4KVM E;  1QSM A;  1Q2Y A;  1QSO A;  3EY5 A;  4NXY A;  4H89 A;  1XIX A;  3QB8 A;  3P2H A;  1IIC A;  2WPX A;  5KTA A;  4MY0 A;  4UCP A;  4KZT A;  1YVO A;  2Q4V A;  4B12 A;  1KUV A;  2REF A;  2RC4 A;  1M44 A;  3K9U A;  1P0H A;  4NSQ A;  2FXF A;  4PSX A;  4CYP A;  3TE4 A;  4L8A A;  4A32 A;  4A2Z A;  1WK4 A;  3GYA A;  2Z3P A;  3IU1 A;  1L0C A;  2FT0 A;  1IID A;  3EO4 A;  1VHS A;  1Z9U A;  5AG6 A;  3TFY A;  1XMT A;  1S60 A;  4C68 A;  5F48 A;  3S6G A;  2I00 A;  2VI7 A;  2J8R A;  4C2Y A;  4A31 A;  1Q2D A;  4CGP A;  5DWN A;  1PU9 A;  3I9S A;  2VZZ A;  4MFP A;  4JD6 A;  5J8F A;  4EVY A;  4UFW A;  2HUZ A;  2PRB A;  3PGP A;  2Z3M A;  3BJ7 A;  1Z4E A;  3R1K A;  4QB9 A;  2IL4 A;  2D4P A;  1Y7R A;  3VWE A;  4C2Z A;  2Z3O A;  3NE7 A;  2QEC A;  5CNP A;  4H6U A;  2PC1 A;  2H5M A;  2JEV A;  1V0C A;  2VZY A;  4CYO A;  4ZGY B;  5G1Z A;  1Y9W A;  2R7H A;  1B87 A;  4KLV A;  1QSR A;  3R9F A;  4AG9 A;  3H5Z A;  2R8V A;  1MJB A;  5DWM A;  3T9Y A;  2Z3N A;  4JJX A;  3TO6 A;  2CNM A;  1YVK A;  4QBJ A;  1Z4R A;  1XE4 A;  1Y9K A;  4UA3 A;  3QAH A;  4XNH B;  3TOB A;  4B11 A;  1OZP A;  3MGD A;  4Q38 A;  5KTD A;  3CXP A;  2Q4Y A;  2Z3L A;  4JLY A;  2BUE A;  3B8G A;  4U9Y A;  2O28 A;  5C82 A;  3GKR A;  2C27 A;  2FE7 A;  4R3L A;  2FL4 A;  3DR6 A;  5BWA B;  4RI1 A;  1S7L A;  3OWC A;  3BLN A;  4XPL A;  5EC4 A;  4H6Z A;  2OZU A;  3W91 A;  4CAE A;  2P6G A;  4XNH C;  5JQ4 A;  4FD6 A;  3DSB A;  4KOT A;  4X5K A;  2P6E A;  2ZW5 A;  4Y49 B;  4MHD A;  1J4J A;  3LD2 A;  3JTK A;  4C2X A;  4CGL A;  5IB0 A;  2Z0Z A;  3F0A A;  2R98 A;  4CAF A;  5J8C A;  3T90 A;  2Q7B A;  3FRM A;  1BO4 A;  5A27 A;  5JPH A;  4AG7 A;  1IB1 E;  2OZH A;  3JUW A;  4HKF A;  3R96 A;  2B4B A;  3D2M A;  3DNS A;  3TTH A;  4PSW A;  4A33 A;  2R1I A;  1NMT A;  3G3S A;  3P2F A;  2Z10 A;  2BSW A;  4KOS A;  5A28 A;  4Y49 C;  5AG5 A;  3SXN A;  4OLL A;  4OAE A;  1YRE A;  4PV6 A;  3S6H A;  2WUU A;  4B5O A;  1IYL A;  2PDO A;  2PR1 A;  1QSN A;  4KUA A;  4I49 A;  1TIQ A;  1WWZ A;  3JVN A;  5F49 A;  4KVO E;  2B5G A;  5IX3 A;  2NMT A;  2ATR A;  3FXT A;  1QST A;  1S7N A;  2B3U A;  2J8M A;  3IGR A;  3G8W A;  4QUS A;  3H4Q A;  4MJ8 A;  3W6X A;  4CS0 B;  1B6B A;  4MI4 A;  4B5P A;  3TO9 A;  1S3Z A;  4NEX A;  1MJ9 A;  3F5B A;  2I79 A;  1M1D A;  4MFQ A;  2Q0Y A;  4HNY B;  4B14 A;  1ZO0 A;  1S7K A;  3S6F A;  3TCV A;  4AB7 A;  3LOD A;  4M85 A;  3W6S A;  2GIV A;  2PSW A;  3DDD A;  2JDC A;  4A30 A;  5H86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...