5AG5A

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a thiazolidinone ligand
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Development of Small-Molecule Trypanosoma Brucei N-Myristoyltransferase Inhibitors: Discovery and Optimisation of a Novel Binding Mode.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
total genus 123
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5ag5A00
2WUUA 4CGLA 4CYQA 4CYPA 4C2YA 3IU1A 4C2ZA 4CAFA 4CGNA 4C7IA 4CGPA 4A33A 4CAEA 3JTKA 4A32A 4B10A 4A30A 4B11A 3IWEA 5A27A 2YNCC 4B14A 4UFXA 5AG5A 4BBHA 5A28A 4C7HA 4CYNA 2WSAA 5AG4A 5G1ZA 4B13A 4B12A 4C2XA 4A2ZA 2YNEA 3IU2A 5AG6A 4C68A 5G20A 2YNDA 4A95A 5G21A 5AG7A 4UFWA 4A31A 3H5ZA 4UCPA 4UCNA 4UCMA 4CYOA 4CGOA 4UFVA 5AGEA 5G22A 4CGMA 2YNCA
chains in the Genus database with same CATH superfamily
2DPTA 1BPNA 2Q0YA 1CM0A 1X12A 4AVCA 5H84A 3SJXA 4F6AA 1FT7A 4IHMA 1Q2DA 5CBMA 5FVJA 2G3TA 2YNCC 4ZY2A 1M4DA 2ZEMA 3B2YA 1VKCA 4ZY0A 2IMOA 2FL4A 3TOAA 2JEWA 2ZEGA 3RNZA 3HUVA 3V38A 1ARMA 2Z3LA 3FX6A 4NSQA 2PQ8A 1R57A 1PYTB 1AMPA 2ZEFA 2X7BA 3W91A 4YU9A 5ELYA 3TCVA 4MJ8A 5HXDA 2FCKA 1XFOA 2AFUA 2PJ8A 2OB0A 3JVNA 4FWUA 2RFHA 3T9YA 4CYOA 4M6HA 2YNCA 3CXQA 4ZX9A 3BI0A 3WC7A 2ZEDA 3S9MA 4C7IA 1IIDA 2P6FA 2Q51A 4GM5A 1YREA 2CTCA 4P44A 4H89A 1HEEA 2VL1A 1BO4A 4P4DA 1JQGA 4K3NA 4E2AA 3PBEA 4ZGYB 3TFYA 4OKOA 4A38A 2O4HA 4KVOE 3FEDA 3NFZA 2EK8A 3LD2A 3DR6A 3B3WA 4GS4A 3TOBA 4AB7A 1R3NA 1IB1E 1YQEA 5C88A 4EWTA 5IB9A 4GXHA 1RO5A 3EY5A 1AYEA 5I0CA 3FBUA 4OC4A 2BL1A 3SI2A 4CGOA 1XOVA 2WYRA 1UFHA 1Q2CA 2PCUA 2ZXVA 3S6GA 1MJBA 4CYNA 3FYNA 1VIXA 3B3VA 3JUWA 1Q7LA 4F9VA 2POKA 3LODA 5CPAA 4OC2A 2Q7SA 3KHXA 4UIBA 2REFA 4R7MA 1X10A 3IWEA 2JLMA 5LYFA 2O53A 2JDDA 3WABA 3PZJA 1XEBA 2DEAA 1Z9UA 4MRIA 4Q38A 4CAVA 1M4LA 4Y49C 4PK2A 5LRGA 2DPSA 3KQZA 2AFWA 2K5TA 4ZYQA 2VBQA 1CP7A 4I49A 1Z4EA 1LOKA 4F0XA 1TKFA 3KASA 1YMEA 4MXUA 7CPAA 2FVGA 4P4JA 4JD6A 1QSOA 4Y49B 1V0CA 3D7GA 3VWEA 3R1KA 4CYPA 3B35A 1KUXA 2PDOA 2ZENA 2F8HA 4LQ6A 4PPZA 4JXQA 3KI9A 2CNMA 1IICA 4UFXA 2P6GA 4PXBA 4PXCA 1KUVA 1TKHA 1ZG7A 2EUIA 3TX8A 4CAWA 2ATRA 4E8OA 4A94A 1YVKA 4Q36A 4KSFA 2ANPA 2WPXA 4KOVA 4OIDA 4XPDC 4A95A 4FBEA 1TF8A 4KVME 4KSIA 4KSAA 5AG7A 4A39A 4CRZB 1U6MA 2OZGA 2HUZA 4UFWA 4UF4A 3SJEA 5IX3A 2D4PA 2ZW4A 4UCNA 4OC0A 1Z5RA 2D4OA 3I9SA 1LAPA 1IU8A 1MJ9A 2WUUA 4NXYA 5JM6A 4IUSA 5IV0A 3KHZA 2ZOGA 1CP6A 4KOWA 2PVVA 1LCPA 5EMIA 3ZZIA 3KR4A 2FT0A 1YLEA 4PK3A 2OH1A 3FJUA 3SJFA 1OBRA 1BPMA 3WT4A 2WPWA 2QJ8A 2BEIA 3B7IA 2CY2A 3TO9A 1VHSA 2IQ6A 5AG4A 4B13A 6CPAA 3FH4A 4ORFA 4ZBGA 1IY7A 2C6CA 4MFZA 3WR7A 3SXNA 5EBVA 2ODFA 3CPAA 2HQYA 4MI4A 4XPDB 1ZG8A 1RXTA 4RN7A 3DLJA 5F09A 4H2KA 3QAHA 1DE4C 4R87A 5DWNA 1FY7A 4JZ0A 1UWYA 3KZWA 3TTHA 3V7ZA 1S5KA 3FECA 5HVFA 2Z3OA 4TWEA 1M44A 3RZAA 2GLFA 4MHPA 4ZX8A 4RUHA 4HKFA 1H8LA 3R9GA 3NE8A 1VHOA 4CAFA 3IO1A 2ZEEA 4FD4A 4PV6A 2G0BA 4M3SA 4L8AA 4B14A 4OC1A 4EMEA 3DGVA 4MFPA 2R98A 2V8VA 3D7HA 3FNCA 5LRKA 2ABZA 2AFMA 2FSRA 3FF3A 2B3UA 2GU2A 2J8RA 2C6PA 2YGWA 2DF5A 2C27A 4H6UA 5G20A 2R1IA 2FE7A 4XPKA 2QMLA 3JRUA 2HC9A 4ZY1A 2OR4A 1Z8XA 4UFVA 5AGEA 1CJWA 4MHDA 1KZFA 4OAEA 2PJ5A 2R8VA 4J3GA 4MFQA 1NSLA 1XF8A 4BINA 4OLLA 1A2ZA 2DXQA 4KZTA 1Q2YA 1QSRA 4ONUA 3CT9A 3K2KA 5F49A 4YGOA 4UWJA 4MY3A 5AG5A 3LACA 5H86A 3B3TA 1HDQA 4LUAA 5G1ZA 1P0HA 2B4DB 2EO8A 1CPXA 5LYLA 1ZG9A 2EBJA 2I79A 5LRJA 1QMUA 2YNDA 2PJ7A 4FD7A 4DUKA 1NSAA 5KTAA 4O23A 4P10A 5K8MA 4G1PA 3N5FA 4LX9A 1M4GA 1S7LA 1DTDA 4E0AA 4PQAA 3UY5A 4RI1A 2HV2A 5BWAB 3CZXA 4K30A 4CRYB 2Q44A 2PRBA 4NGNA 2PJ6A 4C2ZA 1TXRA 3LMSA 3PB7X 4EVYA 3VARA 1NE9A 4KOUA 3PFOA 2EK9A 2QVPA 4JYWA 5LYIA 4P45A 4KS9A 4B6ZA 3PB4X 4M6GA 5K8OA 3IJ3A 4X2TA 5GCNA 1Y0YA 4H6ZA 1L0CA 4KOYA 4C68A 2G9DA 1B6BA 3IWWA 3E0KA 3F5BA 1IYLA 1Z2LA 2PR1A 2CIJA 3FEEA 4JJXA 4OMEA 5D8NA 2PRQA 3SI1A 2Z11A 1MK4A 4NGMA 3D68A 3KL9A 1M1DA 2JEVA 2PR8A 3K9UA 1F2OA 4NGRA 3SHPA 3KKWA 1TF9A 1GHEA 1Z8LA 2PJCA 3F0AA 4X8IA 4YWYA 4NEXA 4II9A 1MJAA 4CAEA 4NCZA 3L2NA 1WWZA 5HVHA 3PB6X 4OADA 3D66A 2PJ3A 3R9EA 1I21A 2AFXA 1CPSA 5F48A 4MHNA 5THWA 2VI7A 1N71A 4NJRA 3MRUA 2OOTA 2PJ9A 3R9FA 3MGDA 3GKRA 2NMTA 2I3CA 1YSJA 2BSWA 3KR5A 3PB8X 3QNVA 3HLPA 4MCQA 4QC6A 3VWDA 4HNWB 5JPHA 2G3AA 3N7ZA 2Z3NA 3PGPA 4OC3A 3FRMA 5CNPA 3IC1A 4X3RA 3R95A 3RAMA 3DSBA 2FXFA 2RB7A 3CDXA 2EWBA 3C26A 3RYOA 2VEZA 4MFKA 3EO4A 2XEIA 4OIWA 1ARLA 2Q4VA 2PJ1A 2P6EA 1AUGA 3GUXA 4HPSA 4PXEA 3JTKA 3VATA 4QB9A 4BMHA 3D7DA 3I3GA 1CBXA 2PJ0A 3ISZA 3RBUA 3SI0A 5A27A 5K8PA 1YGHA 3D67A 3B3CA 3EC4A 4NGTA 5KTDA 2O28A 1YW6A 3PFEA 2GLJA 3ZJ0A 3D2PA 4IF5A 3IIBA 5LYDA 4NGPA 1NMTA 2HB6A 2F5IA 4FAIA 5KTCA 2PJ2A 4MY0A 4NFRA 1TKJA 2OU2A 4B5PB 5I4MA 4CPAA 2I00A 2ARHA 3NA6A 5JH9A 4MMOA 3TT2A 5C82A 4R9MA 1ELLP 3FMCA 2XEGA 5G22A 4P6YA 1PU9A 2B4DA 3GYAA 1KWMA 3GB0A 4ONWA 4IK2A 2BO9A 2AFZA 1IOFA 2GFQA 2Y0MA 5HVGA 8CPAA 1QSMA 4RS2A 2H5MA 4YRHA 1BOBA 4A32A 3BJ7A 2Z10A 3I1UA 1IGBA 4KORA 4PXDA 4P4BA 2JBKA 2WSAA 4PSWA 4KVXA 4R3LA 3R96A 1ZO0A 3FVLA 2P0WA 3WC6A 1BLLE 3T90A 4UWIA 5J1QA 2PJAA 2XEJA 5JQ4A 3BJ8A 4KOXA 2V8HA 1BAVA 2B4BA 3QAYA 3SXOA 3V8IA 3W6SA 4CAXA 2WZNA 4NJQA 2J8NA 4UCPA 3NH5A 4F9UA 1LANA 3BHXA 4UIAA 4ZI6A 4DYOA 4U9ZA 4YFJA 5J8CA 2Z3PA 4B5OA 3TO6A 4M85A 3CXPA 4AXVA 1PCAA 2C6GA 3D2MA 3GLJA 5J8FA 3BI1A 2ZEOA 1YR0A 4UEZA 3VH9A 4R57A 4B10A 5EC4A 1Z8WA 4KUBA 4NF1A 3MN8A 1S3ZA 3PP9A 4DJLA 1M4IA 3FXTA 2CXAA 4LQGA 3H8EA 3LWUA 4X5KA 1LFWA 4FD5A 4W9YA 3SJGA 2VZYA 3S6HA 3IFEA 4PSXA 3W6XA 2YNEA 1TIQA 1P4NA 1K4JA 2ZPAA 3BLNA 4U5YA 1LRZA 1YVOA 5G21A 4MCRA 4XPLA 2IJZA 1YK3A 4AG7A 4UA3A 3TO7A 4IAVA 4Q7AA 2V77A 3NH4A 4DNCA 1XE4A 1Z4RA 2RC4A 1Y9WA 4L89A 4AVBA 1IYKA 1ZLIA 4CGLA 3H8GA 3F8KA 4U9YA 3CXSA 4A37A 1GYTA 3BXMA 4A33A 2BUEA 4EFDA 4A30A 4QBJA 2GANA 2PIYA 1Y7RA 3IWGA 4C7HA 3NE7A 3EXNA 3DR8A 1KUYA 2JBJA 2V8DA 3IGRA 1ZLHA 2PIZA 1I12A 3S9NA 1EE3P 2B58A 5D29A 2PVWA 4XNHB 2CTBA 1B87A 2NSMA 3IEHA 1Y0RA 3G8WA 3IU2A 5AG6A 4NGSA 3H8FA 2VZZA 2FS5A 5F46A 3S6FA 3T8WA 2ZW7A 3PB9X 3QB8A 1YLOA 2OZHA 4AVAA 2KCWA 2REEA 3OWCA 4P4EA 3P2FA 4AG9A 2BOAA 2C1CA 1Y9KA 3GIUA 4R3KA 3P2HA 4JXRA 1R43A 1RTQA 4WJBA 4P4IA 4CGPA 3D8PA 4R6TA 1F57A 1JWQA 3FB3A 1S7KA 2EVNA 4Z65A 4MBUA 4BBHA 1XIXA 3DNSA 2AFOA 1XJOA 1XMTA 1QSNA 4KLVA 4R8FA 1SQHA 4B12A 3D4UA 1XBUA 3DDDA 2FIWA 4A2ZA 1CG2A 4JWPA 1CX8A 2CF4A 1ELMP 2ZELA 4MCPA 1QQ9A 4MFLA 4HNXB 4UEFA 2IL4A 4P4FA 3RO0A 4A31A 2R7HA 5F47A 2V8GA 2Q4YA 2NYQA 3TC8A 4UCMA 2AFSA 4M6IA 4MHYA 5HH1A 1S7NA 4F8ZA 2J8MA 2PJBA 4QVTA 2GE3A 4CYQA 5HMNA 4MFJA 3IU1A 2PE3A 4OC5A 4FD6A 4B5PA 3D7FA 1WK4A 2Z3KA 3CPXA 3ISXA 5A28A 2ZEPA 1YW4A 3G3SA 3PEIA 4KUAA 1YX0A 3K9TA 2Z0ZA 4QUSA 3B3SA 2OZUA 1HDUA 1S7FA 2AE6A 4OP4A 4R76A 1OZPA 4XNHC 2B3VA 3EFAA 1F2PA 1IOIA 2FIAA 2Q7BA 4BD9A 3GY9A 4KOSA 3PRTA 1VHEA 2CNTA 2ZOFA 3B8GA 4KOTA 2ZEHA 2PC1A 1PUAA 3S9LA 2VXKA 4KLWA 4F0YA 2Q43A 4MHZA 1XRYA 1S60A 3NH8A 5DWMA 1FNOA 5DS0A 4C2YA 4CS0B 4CGNA 2B5GB 1J4JA 1LAMA 2CNSA 2ZW5A 1QSTA 3H4QA 1ON0A 5IB0A 2Q4ZA 4B11A 4UBRA 2QYVA 5E96A 1Y7EA 4NGQA 2B5GA 3D3SA 2JDCA 3KQXA 3S6KA 5JGFA 2QIRA 4C2XA 5K8NA 2XEFA 2QECA 2GREA 4FUUA 1I1DA 2AJ6A 2A4NA 2VQYA 2F7VA 4WWVA 2J9AA 2BCOA 1VGYA 4TNUA 3KGQA 4HNYB 4MCSA 2Z3MA 2ZW6A 3H5ZA 3WC5A 3TE4A 5ISVA 3PBBA 4JLYA 1XMBA 2PSWA 3FIXA 2GIVA 4UEEA 2Q04A 2PJ4A 4CGMA 1Z8TA 3A9LA
chains in the Genus database with same CATH topology
2DPTA 2Q0YA 1CM0A 4AVCA 5H84A 4F6AA 1Q2DA 5FVJA 2G3TA 2YNCC 1M4DA 1VKCA 2FL4A 3TOAA 2Z3LA 4NSQA 2PQ8A 1R57A 2X7BA 3W91A 3TCVA 4MJ8A 2FCKA 3JVNA 3T9YA 2OB0A 4CYOA 2YNCA 3CXQA 4C7IA 1IIDA 2P6FA 1YREA 4H89A 1BO4A 4E2AA 4ZGYB 3TFYA 4KVOE 3LD2A 3DR6A 4GS4A 3TOBA 4AB7A 1IB1E 5C88A 1RO5A 3EY5A 5I0CA 3FBUA 2BL1A 4CGOA 1UFHA 1Q2CA 2ZXVA 4CYNA 3S6GA 1MJBA 3FYNA 3JUWA 3LODA 2REFA 3IWEA 2JLMA 2JDDA 3PZJA 1XEBA 1Z9UA 4CAVA 4Q38A 4Y49C 4PK2A 2DPSA 2K5TA 2VBQA 4I49A 1Z4EA 4F0XA 4JD6A 1QSOA 4Y49B 1V0CA 3VWEA 3R1KA 4CYPA 1KUXA 2PDOA 4JXQA 2CNMA 1IICA 4UFXA 2P6GA 1KUVA 2EUIA 4CAWA 2ATRA 4E8OA 1YVKA 4Q36A 4KSFA 2WPXA 4KOVA 4XPDC 4A95A 4KVME 4KSAA 5AG7A 4CRZB 1U6MA 2OZGA 2HUZA 4UFWA 5IX3A 2D4PA 2ZW4A 4UCNA 2D4OA 3I9SA 1MJ9A 2WUUA 4NXYA 4IUSA 5IV0A 4KOWA 3ZZIA 2FT0A 1YLEA 4PK3A 2OH1A 2WPWA 2BEIA 2CY2A 3TO9A 1VHSA 5AG4A 4B13A 4ORFA 4ZBGA 4MFZA 3WR7A 3SXNA 5EBVA 2HQYA 4MI4A 4XPDB 1RXTA 5DWNA 3QAHA 4R87A 1FY7A 3TTHA 1S5KA 2Z3OA 1M44A 4HKFA 3R9GA 4CAFA 4FD4A 4PV6A 2G0BA 4M3SA 4L8AA 4B14A 4MFPA 2R98A 3FNCA 2FSRA 2B3UA 2J8RA 2YGWA 2C27A 4H6UA 5G20A 2R1IA 2FE7A 4XPKA 2QMLA 4UFVA 5AGEA 1CJWA 4MHDA 1KZFA 4OAEA 2R8VA 4J3GA 4MFQA 1NSLA 1XF8A 4OLLA 2DXQA 4KZTA 1Q2YA 1QSRA 4ONUA 5F49A 4YGOA 4UWJA 4MY3A 5AG5A 5H86A 4LUAA 5G1ZA 1P0HA 2B4DB 2I79A 2YNDA 4FD7A 5KTAA 4LX9A 1M4GA 1S7LA 4E0AA 3UY5A 4RI1A 2HV2A 5BWAB 4K30A 4CRYB 2Q44A 2PRBA 4C2ZA 4EVYA 1NE9A 4KOUA 4KS9A 5GCNA 4H6ZA 1L0CA 4KOYA 4C68A 1B6BA 3F5BA 3E0KA 1IYLA 2PR1A 4JJXA 2Z11A 1MK4A 1M1DA 2JEVA 2PR8A 3K9UA 3SHPA 3KKWA 1GHEA 3F0AA 4NEXA 4II9A 1MJAA 4CAEA 4NCZA 1WWZA 4OADA 3R9EA 1I21A 5F48A 2VI7A 1N71A 3R9FA 3MGDA 3GKRA 2NMTA 2BSWA 4QC6A 3VWDA 5JPHA 4HNWB 2G3AA 3N7ZA 2Z3NA 3PGPA 3FRMA 5CNPA 3R95A 3DSBA 2FXFA 3C26A 3RYOA 2VEZA 4MFKA 3EO4A 2Q4VA 2P6EA 3JTKA 4BMHA 4QB9A 3I3GA 5A27A 1YGHA 3EC4A 5KTDA 2O28A 3ZJ0A 3D2PA 4IF5A 1NMTA 5KTCA 2F5IA 4B5PB 4MY0A 2OU2A 2I00A 2ARHA 3TT2A 5C82A 4R9MA 5G22A 1PU9A 2B4DA 3GYAA 2Y0MA 1QSMA 4RS2A 2H5MA 4YRHA 1BOBA 4A32A 3BJ7A 2Z10A 4KORA 2WSAA 4PSWA 4KVXA 4R3LA 3R96A 1ZO0A 2P0WA 3T90A 4UWIA 5JQ4A 3BJ8A 4KOXA 4CAXA 2B4BA 3SXOA 3W6SA 3V8IA 2J8NA 4UCPA 4U9ZA 4YFJA 5J8CA 2Z3PA 4B5OA 3TO6A 4M85A 3CXPA 3D2MA 5J8FA 1YR0A 4R57A 4B10A 5EC4A 4KUBA 4NF1A 1S3ZA 3PP9A 1M4IA 3FXTA 2CXAA 4X5KA 4FD5A 2VZYA 3S6HA 4PSXA 3W6XA 2YNEA 1TIQA 2ZPAA 1K4JA 1P4NA 3BLNA 4U5YA 1LRZA 1YVOA 5G21A 4XPLA 1YK3A 4AG7A 4UA3A 3TO7A 4DNCA 1XE4A 1Z4RA 2RC4A 1Y9WA 4L89A 4AVBA 1IYKA 4CGLA 3F8KA 4U9YA 3CXSA 4A33A 2BUEA 4A30A 4QBJA 2GANA 1Y7RA 3IWGA 4C7HA 3NE7A 3EXNA 3DR8A 1KUYA 3IGRA 1I12A 2B58A 4XNHB 3IU2A 1B87A 5AG6A 3G8WA 2VZZA 2FS5A 5F46A 3S6FA 2ZW7A 3QB8A 2OZHA 4AVAA 2KCWA 2REEA 3OWCA 3P2FA 4AG9A 1Y9KA 4R3KA 3P2HA 4JXRA 4CGPA 3D8PA 3FB3A 1S7KA 2EVNA 4MBUA 4BBHA 1XIXA 3DNSA 4KLVA 1XMTA 1QSNA 1SQHA 4B12A 4A2ZA 3DDDA 2FIWA 4JWPA 4MFLA 4HNXB 2IL4A 4A31A 2R7HA 5F47A 2Q4YA 4UCMA 5HH1A 1S7NA 2J8MA 4QVTA 4CYQA 2GE3A 5HMNA 4MFJA 3IU1A 4FD6A 4B5PA 1WK4A 2Z3KA 5A28A 3G3SA 4KUAA 1YX0A 2Z0ZA 4QUSA 2AE6A 1S7FA 2OZUA 1OZPA 4XNHC 2B3VA 3EFAA 2FIAA 2Q7BA 3GY9A 4KOSA 2CNTA 3B8GA 4KOTA 2PC1A 1PUAA 2VXKA 4KLWA 4F0YA 1S60A 5DWMA 4C2YA 4CS0B 4CGNA 2B5GB 1J4JA 2CNSA 2ZW5A 1QSTA 3H4QA 1ON0A 5IB0A 4B11A 4UBRA 5E96A 2B5GA 3D3SA 2JDCA 3S6KA 2QIRA 4C2XA 2QECA 1I1DA 2AJ6A 2A4NA 2VQYA 4HNYB 2Z3MA 2ZW6A 3H5ZA 3TE4A 5ISVA 4JLYA 2PSWA 3FIXA 2GIVA 2Q04A 4CGMA 3A9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WUU A;  4CGL A;  4CYQ A;  4CYP A;  4C2Y A;  3IU1 A;  4C2Z A;  4CAF A;  4CGN A;  4C7I A;  4CGP A;  4A33 A;  4CAE A;  3JTK A;  4A32 A;  4B10 A;  4A30 A;  4B11 A;  3IWE A;  5A27 A;  2YNC C;  4B14 A;  4UFX A;  5AG5 A;  4BBH A;  5A28 A;  4C7H A;  4CYN A;  2WSA A;  5AG4 A;  5G1Z A;  4B13 A;  4B12 A;  4C2X A;  4A2Z A;  2YNE A;  3IU2 A;  5AG6 A;  4C68 A;  5G20 A;  2YND A;  4A95 A;  5G21 A;  5AG7 A;  4UFW A;  4A31 A;  3H5Z A;  4UCP A;  4UCN A;  4UCM A;  4CYO A;  4CGO A;  4UFV A;  5AGE A;  5G22 A;  4CGM A;  2YNC A; 
#chains in the Genus database with same CATH topology
 2DPT A;  1BPN A;  2Q0Y A;  1CM0 A;  1X12 A;  4AVC A;  5H84 A;  3SJX A;  4F6A A;  1FT7 A;  4IHM A;  1Q2D A;  5CBM A;  5FVJ A;  2G3T A;  2YNC C;  4ZY2 A;  1M4D A;  2ZEM A;  3B2Y A;  1VKC A;  4ZY0 A;  2IMO A;  2FL4 A;  3TOA A;  2JEW A;  2ZEG A;  3RNZ A;  3HUV A;  3V38 A;  1ARM A;  2Z3L A;  3FX6 A;  4NSQ A;  2PQ8 A;  1R57 A;  1PYT B;  1AMP A;  2ZEF A;  2X7B A;  3W91 A;  4YU9 A;  5ELY A;  3TCV A;  4MJ8 A;  5HXD A;  2FCK A;  1XFO A;  2AFU A;  2PJ8 A;  2OB0 A;  3JVN A;  4FWU A;  2RFH A;  3T9Y A;  4CYO A;  4M6H A;  2YNC A;  3CXQ A;  4ZX9 A;  3BI0 A;  3WC7 A;  2ZED A;  3S9M A;  4C7I A;  1IID A;  2P6F A;  2Q51 A;  4GM5 A;  1YRE A;  2CTC A;  4P44 A;  4H89 A;  1HEE A;  2VL1 A;  1BO4 A;  4P4D A;  1JQG A;  4K3N A;  4E2A A;  3PBE A;  4ZGY B;  3TFY A;  4OKO A;  4A38 A;  2O4H A;  4KVO E;  3FED A;  3NFZ A;  2EK8 A;  3LD2 A;  3DR6 A;  3B3W A;  4GS4 A;  3TOB A;  4AB7 A;  1R3N A;  1IB1 E;  1YQE A;  5C88 A;  4EWT A;  5IB9 A;  4GXH A;  1RO5 A;  3EY5 A;  1AYE A;  5I0C A;  3FBU A;  4OC4 A;  2BL1 A;  3SI2 A;  4CGO A;  1XOV A;  2WYR A;  1UFH A;  1Q2C A;  2PCU A;  2ZXV A;  3S6G A;  1MJB A;  4CYN A;  3FYN A;  1VIX A;  3B3V A;  3JUW A;  1Q7L A;  4F9V A;  2POK A;  3LOD A;  5CPA A;  4OC2 A;  2Q7S A;  3KHX A;  4UIB A;  2REF A;  4R7M A;  1X10 A;  3IWE A;  2JLM A;  5LYF A;  2O53 A;  2JDD A;  3WAB A;  3PZJ A;  1XEB A;  2DEA A;  1Z9U A;  4MRI A;  4Q38 A;  4CAV A;  1M4L A;  4Y49 C;  4PK2 A;  5LRG A;  2DPS A;  3KQZ A;  2AFW A;  2K5T A;  4ZYQ A;  2VBQ A;  1CP7 A;  4I49 A;  1Z4E A;  1LOK A;  4F0X A;  1TKF A;  3KAS A;  1YME A;  4MXU A;  7CPA A;  2FVG A;  4P4J A;  4JD6 A;  1QSO A;  4Y49 B;  1V0C A;  3D7G A;  3VWE A;  3R1K A;  4CYP A;  3B35 A;  1KUX A;  2PDO A;  2ZEN A;  2F8H A;  4LQ6 A;  4PPZ A;  4JXQ A;  3KI9 A;  2CNM A;  1IIC A;  4UFX A;  2P6G A;  4PXB A;  4PXC A;  1KUV A;  1TKH A;  1ZG7 A;  2EUI A;  3TX8 A;  4CAW A;  2ATR A;  4E8O A;  4A94 A;  1YVK A;  4Q36 A;  4KSF A;  2ANP A;  2WPX A;  4KOV A;  4OID A;  4XPD C;  4A95 A;  4FBE A;  1TF8 A;  4KVM E;  4KSI A;  4KSA A;  5AG7 A;  4A39 A;  4CRZ B;  1U6M A;  2OZG A;  2HUZ A;  4UFW A;  4UF4 A;  3SJE A;  5IX3 A;  2D4P A;  2ZW4 A;  4UCN A;  4OC0 A;  1Z5R A;  2D4O A;  3I9S A;  1LAP A;  1IU8 A;  1MJ9 A;  2WUU A;  4NXY A;  5JM6 A;  4IUS A;  5IV0 A;  3KHZ A;  2ZOG A;  1CP6 A;  4KOW A;  2PVV A;  1LCP A;  5EMI A;  3ZZI A;  3KR4 A;  2FT0 A;  1YLE A;  4PK3 A;  2OH1 A;  3FJU A;  3SJF A;  1OBR A;  1BPM A;  3WT4 A;  2WPW A;  2QJ8 A;  2BEI A;  3B7I A;  2CY2 A;  3TO9 A;  1VHS A;  2IQ6 A;  5AG4 A;  4B13 A;  6CPA A;  3FH4 A;  4ORF A;  4ZBG A;  1IY7 A;  2C6C A;  4MFZ A;  3WR7 A;  3SXN A;  5EBV A;  2ODF A;  3CPA A;  2HQY A;  4MI4 A;  4XPD B;  1ZG8 A;  1RXT A;  4RN7 A;  3DLJ A;  5F09 A;  4H2K A;  3QAH A;  1DE4 C;  4R87 A;  5DWN A;  1FY7 A;  4JZ0 A;  1UWY A;  3KZW A;  3TTH A;  3V7Z A;  1S5K A;  3FEC A;  5HVF A;  2Z3O A;  4TWE A;  1M44 A;  3RZA A;  2GLF A;  4MHP A;  4ZX8 A;  4RUH A;  4HKF A;  1H8L A;  3R9G A;  3NE8 A;  1VHO A;  4CAF A;  3IO1 A;  2ZEE A;  4FD4 A;  4PV6 A;  2G0B A;  4M3S A;  4L8A A;  4B14 A;  4OC1 A;  4EME A;  3DGV A;  4MFP A;  2R98 A;  2V8V A;  3D7H A;  3FNC A;  5LRK A;  2ABZ A;  2AFM A;  2FSR A;  3FF3 A;  2B3U A;  2GU2 A;  2J8R A;  2C6P A;  2YGW A;  2DF5 A;  2C27 A;  4H6U A;  5G20 A;  2R1I A;  2FE7 A;  4XPK A;  2QML A;  3JRU A;  2HC9 A;  4ZY1 A;  2OR4 A;  1Z8X A;  4UFV A;  5AGE A;  1CJW A;  4MHD A;  1KZF A;  4OAE A;  2PJ5 A;  2R8V A;  4J3G A;  4MFQ A;  1NSL A;  1XF8 A;  4BIN A;  4OLL A;  1A2Z A;  2DXQ A;  4KZT A;  1Q2Y A;  1QSR A;  4ONU A;  3CT9 A;  3K2K A;  5F49 A;  4YGO A;  4UWJ A;  4MY3 A;  5AG5 A;  3LAC A;  5H86 A;  3B3T A;  1HDQ A;  4LUA A;  5G1Z A;  1P0H A;  2B4D B;  2EO8 A;  1CPX A;  5LYL A;  1ZG9 A;  2EBJ A;  2I79 A;  5LRJ A;  1QMU A;  2YND A;  2PJ7 A;  4FD7 A;  4DUK A;  1NSA A;  5KTA A;  4O23 A;  4P10 A;  5K8M A;  4G1P A;  3N5F A;  4LX9 A;  1M4G A;  1S7L A;  1DTD A;  4E0A A;  4PQA A;  3UY5 A;  4RI1 A;  2HV2 A;  5BWA B;  3CZX A;  4K30 A;  4CRY B;  2Q44 A;  2PRB A;  4NGN A;  2PJ6 A;  4C2Z A;  1TXR A;  3LMS A;  3PB7 X;  4EVY A;  3VAR A;  1NE9 A;  4KOU A;  3PFO A;  2EK9 A;  2QVP A;  4JYW A;  5LYI A;  4P45 A;  4KS9 A;  4B6Z A;  3PB4 X;  4M6G A;  5K8O A;  3IJ3 A;  4X2T A;  5GCN A;  1Y0Y A;  4H6Z A;  1L0C A;  4KOY A;  4C68 A;  2G9D A;  1B6B A;  3IWW A;  3E0K A;  3F5B A;  1IYL A;  1Z2L A;  2PR1 A;  2CIJ A;  3FEE A;  4JJX A;  4OME A;  5D8N A;  2PRQ A;  3SI1 A;  2Z11 A;  1MK4 A;  4NGM A;  3D68 A;  3KL9 A;  1M1D A;  2JEV A;  2PR8 A;  3K9U A;  1F2O A;  4NGR A;  3SHP A;  3KKW A;  1TF9 A;  1GHE A;  1Z8L A;  2PJC A;  3F0A A;  4X8I A;  4YWY A;  4NEX A;  4II9 A;  1MJA A;  4CAE A;  4NCZ A;  3L2N A;  1WWZ A;  5HVH A;  3PB6 X;  4OAD A;  3D66 A;  2PJ3 A;  3R9E A;  1I21 A;  2AFX A;  1CPS A;  5F48 A;  4MHN A;  5THW A;  2VI7 A;  1N71 A;  4NJR A;  3MRU A;  2OOT A;  2PJ9 A;  3R9F A;  3MGD A;  3GKR A;  2NMT A;  2I3C A;  1YSJ A;  2BSW A;  3KR5 A;  3PB8 X;  3QNV A;  3HLP A;  4MCQ A;  4QC6 A;  3VWD A;  4HNW B;  5JPH A;  2G3A A;  3N7Z A;  2Z3N A;  3PGP A;  4OC3 A;  3FRM A;  5CNP A;  3IC1 A;  4X3R A;  3R95 A;  3RAM A;  3DSB A;  2FXF A;  2RB7 A;  3CDX A;  2EWB A;  3C26 A;  3RYO A;  2VEZ A;  4MFK A;  3EO4 A;  2XEI A;  4OIW A;  1ARL A;  2Q4V A;  2PJ1 A;  2P6E A;  1AUG A;  3GUX A;  4HPS A;  4PXE A;  3JTK A;  3VAT A;  4QB9 A;  4BMH A;  3D7D A;  3I3G A;  1CBX A;  2PJ0 A;  3ISZ A;  3RBU A;  3SI0 A;  5A27 A;  5K8P A;  1YGH A;  3D67 A;  3B3C A;  3EC4 A;  4NGT A;  5KTD A;  2O28 A;  1YW6 A;  3PFE A;  2GLJ A;  3ZJ0 A;  3D2P A;  4IF5 A;  3IIB A;  5LYD A;  4NGP A;  1NMT A;  2HB6 A;  2F5I A;  4FAI A;  5KTC A;  2PJ2 A;  4MY0 A;  4NFR A;  1TKJ A;  2OU2 A;  4B5P B;  5I4M A;  4CPA A;  2I00 A;  2ARH A;  3NA6 A;  5JH9 A;  4MMO A;  3TT2 A;  5C82 A;  4R9M A;  1ELL P;  3FMC A;  2XEG A;  5G22 A;  4P6Y A;  1PU9 A;  2B4D A;  3GYA A;  1KWM A;  3GB0 A;  4ONW A;  4IK2 A;  2BO9 A;  2AFZ A;  1IOF A;  2GFQ A;  2Y0M A;  5HVG A;  8CPA A;  1QSM A;  4RS2 A;  2H5M A;  4YRH A;  1BOB A;  4A32 A;  3BJ7 A;  2Z10 A;  3I1U A;  1IGB A;  4KOR A;  4PXD A;  4P4B A;  2JBK A;  2WSA A;  4PSW A;  4KVX A;  4R3L A;  3R96 A;  1ZO0 A;  3FVL A;  2P0W A;  3WC6 A;  1BLL E;  3T90 A;  4UWI A;  5J1Q A;  2PJA A;  2XEJ A;  5JQ4 A;  3BJ8 A;  4KOX A;  2V8H A;  1BAV A;  2B4B A;  3QAY A;  3SXO A;  3V8I A;  3W6S A;  4CAX A;  2WZN A;  4NJQ A;  2J8N A;  4UCP A;  3NH5 A;  4F9U A;  1LAN A;  3BHX A;  4UIA A;  4ZI6 A;  4DYO A;  4U9Z A;  4YFJ A;  5J8C A;  2Z3P A;  4B5O A;  3TO6 A;  4M85 A;  3CXP A;  4AXV A;  1PCA A;  2C6G A;  3D2M A;  3GLJ A;  5J8F A;  3BI1 A;  2ZEO A;  1YR0 A;  4UEZ A;  3VH9 A;  4R57 A;  4B10 A;  5EC4 A;  1Z8W A;  4KUB A;  4NF1 A;  3MN8 A;  1S3Z A;  3PP9 A;  4DJL A;  1M4I A;  3FXT A;  2CXA A;  4LQG A;  3H8E A;  3LWU A;  4X5K A;  1LFW A;  4FD5 A;  4W9Y A;  3SJG A;  2VZY A;  3S6H A;  3IFE A;  4PSX A;  3W6X A;  2YNE A;  1TIQ A;  1P4N A;  1K4J A;  2ZPA A;  3BLN A;  4U5Y A;  1LRZ A;  1YVO A;  5G21 A;  4MCR A;  4XPL A;  2IJZ A;  1YK3 A;  4AG7 A;  4UA3 A;  3TO7 A;  4IAV A;  4Q7A A;  2V77 A;  3NH4 A;  4DNC A;  1XE4 A;  1Z4R A;  2RC4 A;  1Y9W A;  4L89 A;  4AVB A;  1IYK A;  1ZLI A;  4CGL A;  3H8G A;  3F8K A;  4U9Y A;  3CXS A;  4A37 A;  1GYT A;  3BXM A;  4A33 A;  2BUE A;  4EFD A;  4A30 A;  4QBJ A;  2GAN A;  2PIY A;  1Y7R A;  3IWG A;  4C7H A;  3NE7 A;  3EXN A;  3DR8 A;  1KUY A;  2JBJ A;  2V8D A;  3IGR A;  1ZLH A;  2PIZ A;  1I12 A;  3S9N A;  1EE3 P;  2B58 A;  5D29 A;  2PVW A;  4XNH B;  2CTB A;  1B87 A;  2NSM A;  3IEH A;  1Y0R A;  3G8W A;  3IU2 A;  5AG6 A;  4NGS A;  3H8F A;  2VZZ A;  2FS5 A;  5F46 A;  3S6F A;  3T8W A;  2ZW7 A;  3PB9 X;  3QB8 A;  1YLO A;  2OZH A;  4AVA A;  2KCW A;  2REE A;  3OWC A;  4P4E A;  3P2F A;  4AG9 A;  2BOA A;  2C1C A;  1Y9K A;  3GIU A;  4R3K A;  3P2H A;  4JXR A;  1R43 A;  1RTQ A;  4WJB A;  4P4I A;  4CGP A;  3D8P A;  4R6T A;  1F57 A;  1JWQ A;  3FB3 A;  1S7K A;  2EVN A;  4Z65 A;  4MBU A;  4BBH A;  1XIX A;  3DNS A;  2AFO A;  1XJO A;  1XMT A;  1QSN A;  4KLV A;  4R8F A;  1SQH A;  4B12 A;  3D4U A;  1XBU A;  3DDD A;  2FIW A;  4A2Z A;  1CG2 A;  4JWP A;  1CX8 A;  2CF4 A;  1ELM P;  2ZEL A;  4MCP A;  1QQ9 A;  4MFL A;  4HNX B;  4UEF A;  2IL4 A;  4P4F A;  3RO0 A;  4A31 A;  2R7H A;  5F47 A;  2V8G A;  2Q4Y A;  2NYQ A;  3TC8 A;  4UCM A;  2AFS A;  4M6I A;  4MHY A;  5HH1 A;  1S7N A;  4F8Z A;  2J8M A;  2PJB A;  4QVT A;  2GE3 A;  4CYQ A;  5HMN A;  4MFJ A;  3IU1 A;  2PE3 A;  4OC5 A;  4FD6 A;  4B5P A;  3D7F A;  1WK4 A;  2Z3K A;  3CPX A;  3ISX A;  5A28 A;  2ZEP A;  1YW4 A;  3G3S A;  3PEI A;  4KUA A;  1YX0 A;  3K9T A;  2Z0Z A;  4QUS A;  3B3S A;  2OZU A;  1HDU A;  1S7F A;  2AE6 A;  4OP4 A;  4R76 A;  1OZP A;  4XNH C;  2B3V A;  3EFA A;  1F2P A;  1IOI A;  2FIA A;  2Q7B A;  4BD9 A;  3GY9 A;  4KOS A;  3PRT A;  1VHE A;  2CNT A;  2ZOF A;  3B8G A;  4KOT A;  2ZEH A;  2PC1 A;  1PUA A;  3S9L A;  2VXK A;  4KLW A;  4F0Y A;  2Q43 A;  4MHZ A;  1XRY A;  1S60 A;  3NH8 A;  5DWM A;  1FNO A;  5DS0 A;  4C2Y A;  4CS0 B;  4CGN A;  2B5G B;  1J4J A;  1LAM A;  2CNS A;  2ZW5 A;  1QST A;  3H4Q A;  1ON0 A;  5IB0 A;  2Q4Z A;  4B11 A;  4UBR A;  2QYV A;  5E96 A;  1Y7E A;  4NGQ A;  2B5G A;  3D3S A;  2JDC A;  3KQX A;  3S6K A;  5JGF A;  2QIR A;  4C2X A;  5K8N A;  2XEF A;  2QEC A;  2GRE A;  4FUU A;  1I1D A;  2AJ6 A;  2A4N A;  2VQY A;  2F7V A;  4WWV A;  2J9A A;  2BCO A;  1VGY A;  4TNU A;  3KGQ A;  4HNY B;  4MCS A;  2Z3M A;  2ZW6 A;  3H5Z A;  3WC5 A;  3TE4 A;  5ISV A;  3PBB A;  4JLY A;  1XMB A;  2PSW A;  3FIX A;  2GIV A;  4UEE A;  2Q04 A;  2PJ4 A;  4CGM A;  1Z8T A;  3A9L A; 
#chains in the Genus database with same CATH homology
 2DPT A;  2Q0Y A;  1CM0 A;  4AVC A;  5H84 A;  4F6A A;  1Q2D A;  5FVJ A;  2G3T A;  2YNC C;  1M4D A;  1VKC A;  2FL4 A;  3TOA A;  2Z3L A;  4NSQ A;  2PQ8 A;  1R57 A;  2X7B A;  3W91 A;  3TCV A;  4MJ8 A;  2FCK A;  3JVN A;  3T9Y A;  2OB0 A;  4CYO A;  2YNC A;  3CXQ A;  4C7I A;  1IID A;  2P6F A;  1YRE A;  4H89 A;  1BO4 A;  4E2A A;  4ZGY B;  3TFY A;  4KVO E;  3LD2 A;  3DR6 A;  4GS4 A;  3TOB A;  4AB7 A;  1IB1 E;  5C88 A;  1RO5 A;  3EY5 A;  5I0C A;  3FBU A;  2BL1 A;  4CGO A;  1UFH A;  1Q2C A;  2ZXV A;  4CYN A;  3S6G A;  1MJB A;  3FYN A;  3JUW A;  3LOD A;  2REF A;  3IWE A;  2JLM A;  2JDD A;  3PZJ A;  1XEB A;  1Z9U A;  4CAV A;  4Q38 A;  4Y49 C;  4PK2 A;  2DPS A;  2K5T A;  2VBQ A;  4I49 A;  1Z4E A;  4F0X A;  4JD6 A;  1QSO A;  4Y49 B;  1V0C A;  3VWE A;  3R1K A;  4CYP A;  1KUX A;  2PDO A;  4JXQ A;  2CNM A;  1IIC A;  4UFX A;  2P6G A;  1KUV A;  2EUI A;  4CAW A;  2ATR A;  4E8O A;  1YVK A;  4Q36 A;  4KSF A;  2WPX A;  4KOV A;  4XPD C;  4A95 A;  4KVM E;  4KSA A;  5AG7 A;  4CRZ B;  1U6M A;  2OZG A;  2HUZ A;  4UFW A;  5IX3 A;  2D4P A;  2ZW4 A;  4UCN A;  2D4O A;  3I9S A;  1MJ9 A;  2WUU A;  4NXY A;  4IUS A;  5IV0 A;  4KOW A;  3ZZI A;  2FT0 A;  1YLE A;  4PK3 A;  2OH1 A;  2WPW A;  2BEI A;  2CY2 A;  3TO9 A;  1VHS A;  5AG4 A;  4B13 A;  4ORF A;  4ZBG A;  4MFZ A;  3WR7 A;  3SXN A;  5EBV A;  2HQY A;  4MI4 A;  4XPD B;  1RXT A;  5DWN A;  3QAH A;  4R87 A;  1FY7 A;  3TTH A;  1S5K A;  2Z3O A;  1M44 A;  4HKF A;  3R9G A;  4CAF A;  4FD4 A;  4PV6 A;  2G0B A;  4M3S A;  4L8A A;  4B14 A;  4MFP A;  2R98 A;  3FNC A;  2FSR A;  2B3U A;  2J8R A;  2YGW A;  2C27 A;  4H6U A;  5G20 A;  2R1I A;  2FE7 A;  4XPK A;  2QML A;  4UFV A;  5AGE A;  1CJW A;  4MHD A;  1KZF A;  4OAE A;  2R8V A;  4J3G A;  4MFQ A;  1NSL A;  1XF8 A;  4OLL A;  2DXQ A;  4KZT A;  1Q2Y A;  1QSR A;  4ONU A;  5F49 A;  4YGO A;  4UWJ A;  4MY3 A;  5AG5 A;  5H86 A;  4LUA A;  5G1Z A;  1P0H A;  2B4D B;  2I79 A;  2YND A;  4FD7 A;  5KTA A;  4LX9 A;  1M4G A;  1S7L A;  4E0A A;  3UY5 A;  4RI1 A;  2HV2 A;  5BWA B;  4K30 A;  4CRY B;  2Q44 A;  2PRB A;  4C2Z A;  4EVY A;  1NE9 A;  4KOU A;  4KS9 A;  5GCN A;  4H6Z A;  1L0C A;  4KOY A;  4C68 A;  1B6B A;  3F5B A;  3E0K A;  1IYL A;  2PR1 A;  4JJX A;  2Z11 A;  1MK4 A;  1M1D A;  2JEV A;  2PR8 A;  3K9U A;  3SHP A;  3KKW A;  1GHE A;  3F0A A;  4NEX A;  4II9 A;  1MJA A;  4CAE A;  4NCZ A;  1WWZ A;  4OAD A;  3R9E A;  1I21 A;  5F48 A;  2VI7 A;  1N71 A;  3R9F A;  3MGD A;  3GKR A;  2NMT A;  2BSW A;  4QC6 A;  3VWD A;  5JPH A;  4HNW B;  2G3A A;  3N7Z A;  2Z3N A;  3PGP A;  3FRM A;  5CNP A;  3R95 A;  3DSB A;  2FXF A;  3C26 A;  3RYO A;  2VEZ A;  4MFK A;  3EO4 A;  2Q4V A;  2P6E A;  3JTK A;  4BMH A;  4QB9 A;  3I3G A;  5A27 A;  1YGH A;  3EC4 A;  5KTD A;  2O28 A;  3ZJ0 A;  3D2P A;  4IF5 A;  1NMT A;  5KTC A;  2F5I A;  4B5P B;  4MY0 A;  2OU2 A;  2I00 A;  2ARH A;  3TT2 A;  5C82 A;  4R9M A;  5G22 A;  1PU9 A;  2B4D A;  3GYA A;  2Y0M A;  1QSM A;  4RS2 A;  2H5M A;  4YRH A;  1BOB A;  4A32 A;  3BJ7 A;  2Z10 A;  4KOR A;  2WSA A;  4PSW A;  4KVX A;  4R3L A;  3R96 A;  1ZO0 A;  2P0W A;  3T90 A;  4UWI A;  5JQ4 A;  3BJ8 A;  4KOX A;  4CAX A;  2B4B A;  3SXO A;  3W6S A;  3V8I A;  2J8N A;  4UCP A;  4U9Z A;  4YFJ A;  5J8C A;  2Z3P A;  4B5O A;  3TO6 A;  4M85 A;  3CXP A;  3D2M A;  5J8F A;  1YR0 A;  4R57 A;  4B10 A;  5EC4 A;  4KUB A;  4NF1 A;  1S3Z A;  3PP9 A;  1M4I A;  3FXT A;  2CXA A;  4X5K A;  4FD5 A;  2VZY A;  3S6H A;  4PSX A;  3W6X A;  2YNE A;  1TIQ A;  2ZPA A;  1K4J A;  1P4N A;  3BLN A;  4U5Y A;  1LRZ A;  1YVO A;  5G21 A;  4XPL A;  1YK3 A;  4AG7 A;  4UA3 A;  3TO7 A;  4DNC A;  1XE4 A;  1Z4R A;  2RC4 A;  1Y9W A;  4L89 A;  4AVB A;  1IYK A;  4CGL A;  3F8K A;  4U9Y A;  3CXS A;  4A33 A;  2BUE A;  4A30 A;  4QBJ A;  2GAN A;  1Y7R A;  3IWG A;  4C7H A;  3NE7 A;  3EXN A;  3DR8 A;  1KUY A;  3IGR A;  1I12 A;  2B58 A;  4XNH B;  3IU2 A;  1B87 A;  5AG6 A;  3G8W A;  2VZZ A;  2FS5 A;  5F46 A;  3S6F A;  2ZW7 A;  3QB8 A;  2OZH A;  4AVA A;  2KCW A;  2REE A;  3OWC A;  3P2F A;  4AG9 A;  1Y9K A;  4R3K A;  3P2H A;  4JXR A;  4CGP A;  3D8P A;  3FB3 A;  1S7K A;  2EVN A;  4MBU A;  4BBH A;  1XIX A;  3DNS A;  4KLV A;  1XMT A;  1QSN A;  1SQH A;  4B12 A;  4A2Z A;  3DDD A;  2FIW A;  4JWP A;  4MFL A;  4HNX B;  2IL4 A;  4A31 A;  2R7H A;  5F47 A;  2Q4Y A;  4UCM A;  5HH1 A;  1S7N A;  2J8M A;  4QVT A;  4CYQ A;  2GE3 A;  5HMN A;  4MFJ A;  3IU1 A;  4FD6 A;  4B5P A;  1WK4 A;  2Z3K A;  5A28 A;  3G3S A;  4KUA A;  1YX0 A;  2Z0Z A;  4QUS A;  2AE6 A;  1S7F A;  2OZU A;  1OZP A;  4XNH C;  2B3V A;  3EFA A;  2FIA A;  2Q7B A;  3GY9 A;  4KOS A;  2CNT A;  3B8G A;  4KOT A;  2PC1 A;  1PUA A;  2VXK A;  4KLW A;  4F0Y A;  1S60 A;  5DWM A;  4C2Y A;  4CS0 B;  4CGN A;  2B5G B;  1J4J A;  2CNS A;  2ZW5 A;  1QST A;  3H4Q A;  1ON0 A;  5IB0 A;  4B11 A;  4UBR A;  5E96 A;  2B5G A;  3D3S A;  2JDC A;  3S6K A;  2QIR A;  4C2X A;  2QEC A;  1I1D A;  2AJ6 A;  2A4N A;  2VQY A;  4HNY B;  2Z3M A;  2ZW6 A;  3H5Z A;  3TE4 A;  5ISV A;  4JLY A;  2PSW A;  3FIX A;  2GIV A;  2Q04 A;  4CGM A;  3A9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...