5AG5A

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a thiazolidinone ligand
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Development of Small-Molecule Trypanosoma Brucei N-Myristoyltransferase Inhibitors: Discovery and Optimisation of a Novel Binding Mode.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
total genus 123
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5ag5A00
4B11A 4C7HA 4A95A 4CAFA 4C2YA 4CGNA 5AG7A 5AG6A 4UFWA 4CGPA 4CGOA 4UCMA 5G22A 4CGMA 5AGEA 4A33A 4CGLA 5AG5A 4B10A 5G20A 4C7IA 5A27A 4B12A 3IU1A 4A2ZA 4C2XA 4UCNA 2YNDA 2WUUA 4UFXA 2YNCA 4CAEA 4A30A 4BBHA 4C2ZA 4CYQA 4B14A 5G21A 4C68A 4UCPA 4CYNA 2YNEA 4CYPA 2WSAA 4A31A 4UFVA 5A28A 3H5ZA 2YNCC 3IWEA 3IU2A 5AG4A 5G1ZA 4B13A 4A32A 4CYOA 3JTKA
chains in the Genus database with same CATH superfamily
2QJ8A 4PXDA 1PU9A 5AG6A 2HB6A 4P4DA 2G3AA 3SXNA 1VHEA 4ORFA 4JZ0A 1RO5A 2PRBA 1IYKA 2REEA 3KHZA 4M6GA 3WC5A 4A30A 1CM0A 3B3TA 1P0HA 3T8WA 3R9FA 5IX3A 2H5MA 4M6HA 2IMOA 4UIAA 4P6YA 3BHXA 2OU2A 3GYAA 1Z5RA 3I1UA 2CNTA 2EK8A 1H8LA 1AMPA 1XEBA 4B5PB 2PJBA 4PK2A 4Q38A 3R96A 2I00A 3DSBA 3TX8A 4DUKA 1I21A 4QC6A 3W6XA 1YW6A 3DLJA 3DR8A 4MCSA 4C7HA 2HV2A 1NSAA 4NGTA 3MN8A 3S6FA 4XPKA 1XIXA 3LWUA 1YREA 2ZENA 2ZW5A 4CRYB 2BEIA 3H4QA 3K9UA 4GM5A 2FE7A 2PJ1A 1Q2CA 5J1QA 4QUSA 3WC7A 2FIAA 2K5TA 1KUYA 5C82A 1L0CA 1LOKA 2WUUA 4G1PA 2BO9A 3QB8A 5LRGA 2NMTA 2JDCA 2WPXA 5F49A 1Y9KA 1ZO0A 3DGVA 4PV6A 4H6UA 5BWAB 2P6GA 3FVLA 1Z8XA 2P6FA 4BD9A 2PJ4A 3IWGA 2FT0A 2C6GA 1XMTA 5EBVA 3GUXA 3R9EA 1KUXA 4AG9A 4A39A 1EE3P 2WYRA 2HQYA 4YU9A 4NEXA 1P4NA 4FD6A 3VWEA 5GCNA 5LRKA 1AUGA 2P6EA 2ZW7A 2B5GA 4GXHA 4M3SA 5AG7A 1I1DA 3KASA 5J8CA 4O23A 4MHZA 4R6TA 4A33A 3CXSA 3TFYA 3SI1A 4ZI6A 1CP7A 4Z65A 2PC1A 1MJBA 2JBJA 2RC4A 3D7HA 4R3LA 4U5YA 4UIBA 2Q0YA 4QBJA 4LX9A 3QAYA 3CT9A 1TF8A 5CBMA 4OC2A 1Z2LA 3SJFA 2GU2A 4AG7A 3GIUA 3GB0A 1TXRA 4NFRA 2PCUA 1NE9A 2PJCA 3FF3A 4K3NA 3FIXA 3L2NA 2KCWA 2C1CA 3BI0A 4KOWA 4XNHC 3TT2A 4ONUA 2CY2A 2J8NA 4K30A 4F9UA 7CPAA 3H5ZA 2V77A 3I3GA 1S7FA 1MK4A 1OBRA 4KSFA 3BI1A 4MMOA 3JVNA 2CF4A 2PJ5A 2PJ9A 4PSXA 1JWQA 4CGPA 1V0CA 1QSMA 5G22A 3W91A 2PDOA 4PXBA 3FB3A 4H89A 2ARHA 2ZOGA 5LYFA 4A2ZA 1DE4C 1Z9UA 1VHOA 4RUHA 4KLWA 1QSNA 3IO1A 1XMBA 3S9MA 1LFWA 4HPSA 2Q7SA 4KSAA 2Q44A 3FXTA 3D68A 3WR7A 4P4EA 5DWMA 4A31A 4OMEA 2ZEDA 5JGFA 2VZZA 2OZGA 4AVAA 3JTKA 1BOBA 4B11A 1CJWA 2V8DA 4OC3A 4YRHA 4A95A 1I12A 1QSOA 1VHSA 3KQXA 4UFWA 4CAFA 1A2ZA 4AB7A 4HNXB 4JXQA 2B58A 2CIJA 4B10A 4HNYB 1LAMA 2NYQA 1Y9WA 2ZW6A 3BXMA 1Q2DA 5CPAA 1Y7EA 5K8OA 3B3CA 5K8PA 1YVKA 2QMLA 3IC1A 3ISXA 2R98A 3IJ3A 4C2ZA 2VZYA 5ELYA 1CP6A 5F09A 2DPSA 3PBBA 3QAHA 4MHPA 2QYVA 1S3ZA 2PJ3A 2YNEA 3PB7X 4IAVA 2D4OA 3VARA 2JBKA 3ZZIA 4PXCA 3R9GA 1ELMP 3FEEA 1M4DA 3D4UA 1ELLP 2B5GB 2AE6A 3PB8X 4MCRA 1BAVA 1ZLHA 1UFHA 4PSWA 2PRQA 2Q7BA 3RBUA 4OC0A 2PQ8A 3RO0A 1XF8A 3DDDA 4FD4A 3SHPA 3MGDA 1LANA 4OAEA 4KORA 2ABZA 4X3RA 1N71A 4KOUA 2V8HA 4CGLA 4NGRA 1B87A 3FNCA 4NCZA 3LD2A 4FD5A 4ZY2A 4X2TA 2PIZA 2Q43A 4P4BA 2EBJA 4MFZA 3VH9A 4U9YA 3LMSA 4MY0A 2VEZA 4GS4A 4MI4A 2Z3MA 1AYEA 2VI7A 2OH1A 4E0AA 4KSIA 3I9SA 4RN7A 4B6ZA 1RTQA 5I0CA 4OKOA 2Z3LA 4OADA 4NGNA 3D8PA 3B8GA 2HC9A 1XBUA 1XRYA 2C6PA 2Y0MA 4U9ZA 4UFVA 4OC4A 2HUZA 3FYNA 2A4NA 4M85A 2AFUA 5EMIA 3ISZA 4NXYA 4NGPA 4CYOA 4EVYA 4P45A 3CXPA 4OLLA 3KQZA 4CGNA 2GANA 1XFOA 1YMEA 4MHDA 4PXEA 4UA3A 4R7MA 4C7IA 4ZBGA 1IU8A 1IGBA 3FECA 3IU1A 3FBUA 4C2XA 2PJAA 4ZY1A 2I79A 1S7NA 1CG2A 1MJAA 2ZEEA 1J4JA 5LYDA 1ARLA 1KUVA 1OZPA 4H2KA 4CS0B 2V8VA 3VATA 3T9YA 2J8RA 1LRZA 3K2KA 4OP4A 5C88A 2JEWA 1ARMA 1GHEA 3P2FA 3PB4X 4OC5A 1NSLA 4Q36A 5AG4A 3B35A 1BPNA 5K8MA 4LQ6A 5HVFA 1QSRA 1ZLIA 2XEFA 2OZHA 2AFMA 3SI2A 6CPAA 3B2YA 1R3NA 3PBEA 4R3KA 3KL9A 1Z8TA 2YGWA 3K9TA 2PR1A 4P10A 4JJXA 4Y49B 2ZEGA 5G20A 3PZJA 4RI1A 5F47A 1QMUA 5KTDA 2ZOFA 2GLFA 3FX6A 2WZNA 3DR6A 3IIBA 1X10A 4M6IA 4ZX9A 1YLOA 3TCVA 4KOYA 1Q2YA 4PPZA 2AFSA 2FVGA 4TWEA 3B3SA 2ZELA 5KTCA 5DWNA 4ZYQA 3EC4A 4R87A 3C26A 4AVCA 2PJ7A 2C6CA 3N5FA 2OR4A 1TF9A 3NH5A 4MFJA 4AVBA 2XEJA 4E8OA 3FMCA 1ON0A 1Y0RA 1U6MA 2GREA 4KUBA 4JLYA 3TTHA 4CGOA 4MCPA 3G3SA 2GFQA 3SJXA 4RS2A 3D2MA 1TKFA 3PP9A 4MBUA 4NJRA 3KR4A 4ZGYB 1S60A 2O53A 3D7GA 4Y49C 5A27A 5HXDA 1YGHA 1PYTB 2IQ6A 2Q4YA 1HDQA 1VKCA 1S7LA 1TIQA 3EFAA 1YQEA 2QIRA 2FCKA 1VIXA 4FD7A 2Z10A 5THWA 4CYNA 1BLLE 3PB6X 1XJOA 3B7IA 3FEDA 5HH1A 4FWUA 4BINA 4MHNA 2VBQA 2ZXVA 4ZX8A 2AFWA 1ZG8A 5ISVA 2B3UA 2B4DB 2Z0ZA 3KI9A 3D67A 3S6KA 3D7DA 3KZWA 2Q4ZA 4P4FA 3T90A 1IOIA 3IGRA 4KVME 2NSMA 1YX0A 4UCMA 2GE3A 4LQGA 4II9A 5H86A 4ZY0A 3SI0A 4W9YA 3EY5A 1YSJA 2R8VA 1WWZA 2AFZA 4KOSA 4MFQA 4B12A 5HMNA 4I49A 4CRZB 4UWJA 4UEFA 5DS0A 1F2PA 5JH9A 2ZPAA 4IHMA 4UFXA 3FJUA 5KTAA 1XOVA 3F0AA 3CPAA 1R57A 3MRUA 4MRIA 1NMTA 1S5KA 4UCPA 2ODFA 4TNUA 4FBEA 2B4DA 2F7VA 2QVPA 2EWBA 2WSAA 2BSWA 1UWYA 4NSQA 3H8EA 2C27A 2PJ8A 3IU2A 3ZJ0A 4J3GA 2D4PA 1DTDA 3IWWA 3PEIA 3H8GA 4QB9A 3GY9A 3E0KA 3D7FA 2PVWA 4B5PA 4WJBA 3R95A 4F0XA 2FXFA 3CXQA 3TO6A 1LCPA 4F9VA 3S9NA 4YWYA 2BCOA 1YW4A 1IB1E 1CX8A 3FH4A 4IK2A 3KHXA 1IIDA 4XNHB 1CPSA 4CAXA 2GIVA 4F0YA 3SJEA 2G0BA 1M4GA 1CBXA 2O28A 2ZEPA 2RFHA 2YNDA 1S7KA 1QSTA 1WK4A 2DF5A 2CNSA 3A9LA 2Q51A 3F5BA 3JUWA 4H6ZA 5CNPA 3EXNA 4A37A 4UEEA 4B14A 4CYQA 2PR8A 3BJ8A 3PFOA 4XPDB 1Y0YA 2CNMA 2PJ6A 1M4IA 4NGMA 2ZEMA 5F48A 4EFDA 5A28A 2CTCA 2FL4A 1GYTA 1Q7LA 1Z4RA 4KOTA 2Z3KA 2CTBA 4LUAA 5FVJA 4A32A 4B13A 1PUAA 2EO8A 4IF5A 3HUVA 1KZFA 3D3SA 4EWTA 1X12A 2XEIA 3IFEA 8CPAA 5JQ4A 4C2YA 5HVGA 1BO4A 4MHYA 2V8GA 3V8IA 4DYOA 3PGPA 3B3WA 4MFKA 5I4MA 4OIWA 4X5KA 3WABA 2J9AA 2CXAA 4R76A 5HVHA 1XE4A 4PK3A 4MFPA 3TOBA 2WPWA 4KVOE 4MY3A 4ONWA 3TO9A 2ZEFA 1SQHA 2O4HA 2DXQA 3BJ7A 4KLVA 4UBRA 2PVVA 2AJ6A 3RZAA 4IUSA 1M44A 3NA6A 2JDDA 2ZEHA 4E2AA 3D66A 1Y7RA 4AXVA 3CPXA 3IEHA 1HDUA 5G1ZA 1VGYA 4KZTA 1Z4EA 4DJLA 5G21A 2OOTA 3GKRA 3S9LA 5J8FA 3UY5A 4PQAA 4UEZA 2G9DA 1YR0A 3BLNA 3NH4A 1TKJA 5AG5A 1ZG9A 2DEAA 4MXUA 4KS9A 4OIDA 3WC6A 3QNVA 2EVNA 4L89A 4X8IA 4MFLA 2Z3PA 4UCNA 3RYOA 4F8ZA 3H8FA 4CAEA 4DNCA 2QECA 3NFZA 4BBHA 4JD6A 2IJZA 3N7ZA 3LODA 5LYIA 2B3VA 3RNZA 4A94A 1M4LA 3TC8A 1FT7A 4CYPA 2OB0A 1QQ9A 3P2HA 4BMHA 2VL1A 3EO4A 4Q7AA 4CAWA 3KKWA 2YNCC 2R1IA 4R9MA 3IWEA 1PCAA 4R57A 5D8NA 4YFJA 4HKFA 1RXTA 3RAMA 1K4JA 5IV0A 4P4JA 2XEGA 5IB0A 5JPHA 4FUUA 2VXKA 4CGMA 4B5OA 2JLMA 3TO7A 4QVTA 4P4IA 5E96A 1Z8WA 1HEEA 4XPLA 3LACA 4HNWB 1TKHA 4L8AA 1R43A 3PRTA 1IYLA 2BOAA 2J8MA 1BPMA 1YK3A 2G3TA 2PJ0A 4CPAA 1JQGA 2F8HA 5LYLA 4XPDC 4NGSA 3SXOA 4OC1A 2JEVA 4FAIA 3V7ZA 2PE3A 3DNSA 5H84A 5IB9A 2VQYA 3TE4A 2FSRA 2ATRA 2ZW4A 3NH8A 1CPXA 1F57A 3JRUA 3KR5A 2F5IA 5K8NA 5F46A 4EMEA 2DPTA 3PFEA 4P44A 3R1KA 3B3VA 2IL4A 2AFOA 3F8KA 4F6AA 3NE7A 1F2OA 2Z11A 2B4BA 3V38A 4A38A 4JXRA 4NGQA 3KGQA 3W6SA 3TOAA 2Z3OA 3NE8A 3S6GA 2PJ2A 1IY7A 5LRJA 3G8WA 2BUEA 4MJ8A 4UWIA 1Z8LA 1B6BA 1YLEA 4KVXA 3GLJA 2Q4VA 2Z3NA 3CZXA 2OZUA 2I3CA 3D2PA 1FY7A 2EUIA 4WWVA 4KUAA 4R8FA 5JM6A 2BL1A 3VWDA 3CDXA 1LAPA 5D29A 4MCQA 2Q04A 4YGOA 5AGEA 3WT4A 4CAVA 1IICA 2P0WA 1ZG7A 1KWMA 2ANPA 4KOXA 4JYWA 4NF1A 5EC4A 2POKA 2FS5A 4UF4A 3SJGA 2YNCA 1M1DA 3FRMA 1FNOA 4KOVA 2FIWA 2ZEOA 4JWPA 2GLJA 4C68A 2RB7A 3OWCA 2R7HA 3PB9X 1MJ9A 2PIYA 2PSWA 1IOFA 2REFA 4NJQA 2AFXA 2X7BA 1YVOA 2EK9A 3HLPA 3S6HA
chains in the Genus database with same CATH topology
1PU9A 5AG6A 2G3AA 3SXNA 4ORFA 1RO5A 2PRBA 1IYKA 2REEA 4A30A 1CM0A 1P0HA 3R9FA 5IX3A 2H5MA 2OU2A 3GYAA 2CNTA 1XEBA 4B5PB 4PK2A 4Q38A 3R96A 2I00A 3DSBA 1I21A 4QC6A 3W6XA 3DR8A 4C7HA 2HV2A 3S6FA 4XPKA 1XIXA 1YREA 2ZW5A 4CRYB 2BEIA 3H4QA 3K9UA 2FE7A 1Q2CA 4QUSA 2FIAA 2K5TA 1KUYA 5C82A 1L0CA 2WUUA 3QB8A 2NMTA 2JDCA 2WPXA 5F49A 1Y9KA 1ZO0A 4PV6A 4H6UA 5BWAB 2P6GA 2P6FA 3IWGA 2FT0A 1XMTA 5EBVA 3R9EA 4AG9A 1KUXA 2HQYA 4NEXA 1P4NA 4FD6A 3VWEA 5GCNA 2P6EA 2ZW7A 2B5GA 4M3SA 5AG7A 1I1DA 5J8CA 4A33A 3CXSA 3TFYA 2PC1A 1MJBA 2RC4A 4U5YA 4R3LA 4QBJA 2Q0YA 4LX9A 4AG7A 1NE9A 3FIXA 2KCWA 4KOWA 4XNHC 3TT2A 4ONUA 2CY2A 2J8NA 4K30A 3H5ZA 3I3GA 1S7FA 1MK4A 4KSFA 3JVNA 4PSXA 4CGPA 1V0CA 1QSMA 5G22A 3W91A 2PDOA 3FB3A 4H89A 2ARHA 4A2ZA 1Z9UA 4KLWA 1QSNA 4KSAA 2Q44A 3FXTA 3WR7A 5DWMA 4A31A 2VZZA 2OZGA 4AVAA 3JTKA 1BOBA 4B11A 1CJWA 4YRHA 4A95A 4CAFA 1I12A 1QSOA 1VHSA 4UFWA 4AB7A 4HNXB 4JXQA 2B58A 4B10A 4HNYB 2ZW6A 1Y9WA 1Q2DA 1YVKA 2QMLA 2R98A 4C2ZA 2VZYA 2DPSA 3QAHA 2YNEA 1S3ZA 2D4OA 3ZZIA 3R9GA 4F0XA 1M4DA 2B5GB 2AE6A 1UFHA 4PSWA 2Q7BA 2PQ8A 1XF8A 3DDDA 4FD4A 3SHPA 3MGDA 4OAEA 4KORA 1N71A 4KOUA 4CGLA 1B87A 3FNCA 4NCZA 3LD2A 4FD5A 4MFZA 4U9YA 4MY0A 4GS4A 2VEZA 4MI4A 2Z3MA 2VI7A 2OH1A 4E0AA 3I9SA 5I0CA 2Z3LA 4OADA 3D8PA 3B8GA 2Y0MA 4U9ZA 4UFVA 2HUZA 3FYNA 2A4NA 4M85A 4NXYA 4CYOA 4EVYA 3CXPA 4OLLA 4CGNA 2GANA 4MHDA 4UA3A 4C7IA 4ZBGA 3IU1A 3FBUA 4C2XA 2I79A 1S7NA 1MJAA 1J4JA 1KUVA 1OZPA 4CS0B 3T9YA 2J8RA 1LRZA 5C88A 3P2FA 1GHEA 1NSLA 4Q36A 5AG4A 1QSRA 2OZHA 4R3KA 2YGWA 2PR1A 4JJXA 4Y49B 5G20A 3PZJA 4RI1A 5F47A 5KTDA 3DR6A 3TCVA 4KOYA 1Q2YA 5KTCA 5DWNA 3EC4A 4R87A 3C26A 4AVCA 4MFJA 4AVBA 4E8OA 1ON0A 4KUBA 1U6MA 3TTHA 4CGOA 4JLYA 3G3SA 4RS2A 3D2MA 3PP9A 4MBUA 4ZGYB 1S60A 4Y49C 5A27A 1YGHA 2Q4YA 1VKCA 1S7LA 1TIQA 3EFAA 2QIRA 2FCKA 4FD7A 4CYNA 2Z10A 5HH1A 5ISVA 2VBQA 2ZXVA 2B3UA 2B4DB 2Z0ZA 3S6KA 3T90A 3IGRA 4KVME 1YX0A 4UCMA 2GE3A 4II9A 5H86A 3EY5A 2R8VA 4KOSA 1WWZA 4MFQA 4B12A 5HMNA 4I49A 4CRZB 4UWJA 2ZPAA 4UFXA 5KTAA 3F0AA 1R57A 1NMTA 1S5KA 4UCPA 2B4DA 2WSAA 2BSWA 4NSQA 2C27A 3IU2A 3ZJ0A 4J3GA 2D4PA 4QB9A 3GY9A 3E0KA 4B5PA 3R95A 2FXFA 3CXQA 3TO6A 1IB1E 1IIDA 4XNHB 4CAXA 2GIVA 4F0YA 2G0BA 1M4GA 2O28A 2YNDA 3A9LA 1S7KA 1QSTA 1WK4A 3F5BA 2CNSA 3JUWA 4H6ZA 5CNPA 3EXNA 4CYQA 4B14A 2PR8A 3BJ8A 4XPDB 2CNMA 1M4IA 5F48A 5A28A 2FL4A 1Z4RA 4KOTA 2Z3KA 4LUAA 5FVJA 4A32A 4B13A 1PUAA 4IF5A 1KZFA 3D3SA 5JQ4A 4C2YA 1BO4A 3V8IA 3PGPA 4MFKA 4X5KA 2CXAA 1XE4A 4PK3A 4MFPA 3TOBA 2WPWA 4KVOE 4MY3A 3TO9A 1SQHA 2DXQA 3BJ7A 4KLVA 4UBRA 2AJ6A 4IUSA 1M44A 2JDDA 4E2AA 1Y7RA 5G1ZA 4KZTA 1Z4EA 5G21A 3GKRA 5J8FA 3UY5A 1YR0A 3BLNA 5AG5A 4KS9A 2EVNA 4L89A 4MFLA 2Z3PA 4UCNA 3RYOA 4CAEA 4DNCA 2QECA 4BBHA 4JD6A 3N7ZA 3LODA 2B3VA 4CYPA 2OB0A 3P2HA 4BMHA 3EO4A 4CAWA 3KKWA 2YNCC 2R1IA 4R9MA 3IWEA 4R57A 4YFJA 4HKFA 1RXTA 1K4JA 5IV0A 5IB0A 5JPHA 2VXKA 4CGMA 4B5OA 2JLMA 3TO7A 4QVTA 5E96A 4XPLA 4HNWB 4L8AA 1IYLA 2J8MA 1YK3A 2G3TA 4XPDC 3SXOA 2JEVA 3DNSA 5H84A 2VQYA 3TE4A 2FSRA 2ATRA 2ZW4A 2F5IA 5F46A 2DPTA 3R1KA 2IL4A 3F8KA 4F6AA 3NE7A 2Z11A 2B4BA 4JXRA 3W6SA 3TOAA 2Z3OA 3S6GA 3G8WA 2BUEA 4MJ8A 4UWIA 1B6BA 1YLEA 4KVXA 2Q4VA 2Z3NA 2OZUA 3D2PA 1FY7A 2EUIA 4KUAA 2BL1A 3VWDA 2Q04A 4YGOA 5AGEA 4CAVA 1IICA 2P0WA 5EC4A 4KOXA 4NF1A 2FS5A 2YNCA 1M1DA 3FRMA 4KOVA 2FIWA 4JWPA 4C68A 3OWCA 2R7HA 1MJ9A 2PSWA 2REFA 2X7BA 1YVOA 3S6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B11 A;  4C7H A;  4A95 A;  4CAF A;  4C2Y A;  4CGN A;  5AG7 A;  5AG6 A;  4UFW A;  4CGP A;  4CGO A;  4UCM A;  5G22 A;  4CGM A;  5AGE A;  4A33 A;  4CGL A;  5AG5 A;  4B10 A;  5G20 A;  4C7I A;  5A27 A;  4B12 A;  3IU1 A;  4A2Z A;  4C2X A;  4UCN A;  2YND A;  2WUU A;  4UFX A;  2YNC A;  4CAE A;  4A30 A;  4BBH A;  4C2Z A;  4CYQ A;  4B14 A;  5G21 A;  4C68 A;  4UCP A;  4CYN A;  2YNE A;  4CYP A;  2WSA A;  4A31 A;  4UFV A;  5A28 A;  3H5Z A;  2YNC C;  3IWE A;  3IU2 A;  5AG4 A;  5G1Z A;  4B13 A;  4A32 A;  4CYO A;  3JTK A; 
#chains in the Genus database with same CATH topology
 2QJ8 A;  4PXD A;  1PU9 A;  5AG6 A;  2HB6 A;  4P4D A;  2G3A A;  3SXN A;  1VHE A;  4ORF A;  4JZ0 A;  1RO5 A;  2PRB A;  1IYK A;  2REE A;  3KHZ A;  4M6G A;  3WC5 A;  4A30 A;  1CM0 A;  3B3T A;  1P0H A;  3T8W A;  3R9F A;  5IX3 A;  2H5M A;  4M6H A;  2IMO A;  4UIA A;  4P6Y A;  3BHX A;  2OU2 A;  3GYA A;  1Z5R A;  3I1U A;  2CNT A;  2EK8 A;  1H8L A;  1AMP A;  1XEB A;  4B5P B;  2PJB A;  4PK2 A;  4Q38 A;  3R96 A;  2I00 A;  3DSB A;  3TX8 A;  4DUK A;  1I21 A;  4QC6 A;  3W6X A;  1YW6 A;  3DLJ A;  3DR8 A;  4MCS A;  4C7H A;  2HV2 A;  1NSA A;  4NGT A;  3MN8 A;  3S6F A;  4XPK A;  1XIX A;  3LWU A;  1YRE A;  2ZEN A;  2ZW5 A;  4CRY B;  2BEI A;  3H4Q A;  3K9U A;  4GM5 A;  2FE7 A;  2PJ1 A;  1Q2C A;  5J1Q A;  4QUS A;  3WC7 A;  2FIA A;  2K5T A;  1KUY A;  5C82 A;  1L0C A;  1LOK A;  2WUU A;  4G1P A;  2BO9 A;  3QB8 A;  5LRG A;  2NMT A;  2JDC A;  2WPX A;  5F49 A;  1Y9K A;  1ZO0 A;  3DGV A;  4PV6 A;  4H6U A;  5BWA B;  2P6G A;  3FVL A;  1Z8X A;  2P6F A;  4BD9 A;  2PJ4 A;  3IWG A;  2FT0 A;  2C6G A;  1XMT A;  5EBV A;  3GUX A;  3R9E A;  1KUX A;  4AG9 A;  4A39 A;  1EE3 P;  2WYR A;  2HQY A;  4YU9 A;  4NEX A;  1P4N A;  4FD6 A;  3VWE A;  5GCN A;  5LRK A;  1AUG A;  2P6E A;  2ZW7 A;  2B5G A;  4GXH A;  4M3S A;  5AG7 A;  1I1D A;  3KAS A;  5J8C A;  4O23 A;  4MHZ A;  4R6T A;  4A33 A;  3CXS A;  3TFY A;  3SI1 A;  4ZI6 A;  1CP7 A;  4Z65 A;  2PC1 A;  1MJB A;  2JBJ A;  2RC4 A;  3D7H A;  4R3L A;  4U5Y A;  4UIB A;  2Q0Y A;  4QBJ A;  4LX9 A;  3QAY A;  3CT9 A;  1TF8 A;  5CBM A;  4OC2 A;  1Z2L A;  3SJF A;  2GU2 A;  4AG7 A;  3GIU A;  3GB0 A;  1TXR A;  4NFR A;  2PCU A;  1NE9 A;  2PJC A;  3FF3 A;  4K3N A;  3FIX A;  3L2N A;  2KCW A;  2C1C A;  3BI0 A;  4KOW A;  4XNH C;  3TT2 A;  4ONU A;  2CY2 A;  2J8N A;  4K30 A;  4F9U A;  7CPA A;  3H5Z A;  2V77 A;  3I3G A;  1S7F A;  1MK4 A;  1OBR A;  4KSF A;  3BI1 A;  4MMO A;  3JVN A;  2CF4 A;  2PJ5 A;  2PJ9 A;  4PSX A;  1JWQ A;  4CGP A;  1V0C A;  1QSM A;  5G22 A;  3W91 A;  2PDO A;  4PXB A;  3FB3 A;  4H89 A;  2ARH A;  2ZOG A;  5LYF A;  4A2Z A;  1DE4 C;  1Z9U A;  1VHO A;  4RUH A;  4KLW A;  1QSN A;  3IO1 A;  1XMB A;  3S9M A;  1LFW A;  4HPS A;  2Q7S A;  4KSA A;  2Q44 A;  3FXT A;  3D68 A;  3WR7 A;  4P4E A;  5DWM A;  4A31 A;  4OME A;  2ZED A;  5JGF A;  2VZZ A;  2OZG A;  4AVA A;  3JTK A;  1BOB A;  4B11 A;  1CJW A;  2V8D A;  4OC3 A;  4YRH A;  4A95 A;  1I12 A;  1QSO A;  1VHS A;  3KQX A;  4UFW A;  4CAF A;  1A2Z A;  4AB7 A;  4HNX B;  4JXQ A;  2B58 A;  2CIJ A;  4B10 A;  4HNY B;  1LAM A;  2NYQ A;  1Y9W A;  2ZW6 A;  3BXM A;  1Q2D A;  5CPA A;  1Y7E A;  5K8O A;  3B3C A;  5K8P A;  1YVK A;  2QML A;  3IC1 A;  3ISX A;  2R98 A;  3IJ3 A;  4C2Z A;  2VZY A;  5ELY A;  1CP6 A;  5F09 A;  2DPS A;  3PBB A;  3QAH A;  4MHP A;  2QYV A;  1S3Z A;  2PJ3 A;  2YNE A;  3PB7 X;  4IAV A;  2D4O A;  3VAR A;  2JBK A;  3ZZI A;  4PXC A;  3R9G A;  1ELM P;  3FEE A;  1M4D A;  3D4U A;  1ELL P;  2B5G B;  2AE6 A;  3PB8 X;  4MCR A;  1BAV A;  1ZLH A;  1UFH A;  4PSW A;  2PRQ A;  2Q7B A;  3RBU A;  4OC0 A;  2PQ8 A;  3RO0 A;  1XF8 A;  3DDD A;  4FD4 A;  3SHP A;  3MGD A;  1LAN A;  4OAE A;  4KOR A;  2ABZ A;  4X3R A;  1N71 A;  4KOU A;  2V8H A;  4CGL A;  4NGR A;  1B87 A;  3FNC A;  4NCZ A;  3LD2 A;  4FD5 A;  4ZY2 A;  4X2T A;  2PIZ A;  2Q43 A;  4P4B A;  2EBJ A;  4MFZ A;  3VH9 A;  4U9Y A;  3LMS A;  4MY0 A;  2VEZ A;  4GS4 A;  4MI4 A;  2Z3M A;  1AYE A;  2VI7 A;  2OH1 A;  4E0A A;  4KSI A;  3I9S A;  4RN7 A;  4B6Z A;  1RTQ A;  5I0C A;  4OKO A;  2Z3L A;  4OAD A;  4NGN A;  3D8P A;  3B8G A;  2HC9 A;  1XBU A;  1XRY A;  2C6P A;  2Y0M A;  4U9Z A;  4UFV A;  4OC4 A;  2HUZ A;  3FYN A;  2A4N A;  4M85 A;  2AFU A;  5EMI A;  3ISZ A;  4NXY A;  4NGP A;  4CYO A;  4EVY A;  4P45 A;  3CXP A;  4OLL A;  3KQZ A;  4CGN A;  2GAN A;  1XFO A;  1YME A;  4MHD A;  4PXE A;  4UA3 A;  4R7M A;  4C7I A;  4ZBG A;  1IU8 A;  1IGB A;  3FEC A;  3IU1 A;  3FBU A;  4C2X A;  2PJA A;  4ZY1 A;  2I79 A;  1S7N A;  1CG2 A;  1MJA A;  2ZEE A;  1J4J A;  5LYD A;  1ARL A;  1KUV A;  1OZP A;  4H2K A;  4CS0 B;  2V8V A;  3VAT A;  3T9Y A;  2J8R A;  1LRZ A;  3K2K A;  4OP4 A;  5C88 A;  2JEW A;  1ARM A;  1GHE A;  3P2F A;  3PB4 X;  4OC5 A;  1NSL A;  4Q36 A;  5AG4 A;  3B35 A;  1BPN A;  5K8M A;  4LQ6 A;  5HVF A;  1QSR A;  1ZLI A;  2XEF A;  2OZH A;  2AFM A;  3SI2 A;  6CPA A;  3B2Y A;  1R3N A;  3PBE A;  4R3K A;  3KL9 A;  1Z8T A;  2YGW A;  3K9T A;  2PR1 A;  4P10 A;  4JJX A;  4Y49 B;  2ZEG A;  5G20 A;  3PZJ A;  4RI1 A;  5F47 A;  1QMU A;  5KTD A;  2ZOF A;  2GLF A;  3FX6 A;  2WZN A;  3DR6 A;  3IIB A;  1X10 A;  4M6I A;  4ZX9 A;  1YLO A;  3TCV A;  4KOY A;  1Q2Y A;  4PPZ A;  2AFS A;  2FVG A;  4TWE A;  3B3S A;  2ZEL A;  5KTC A;  5DWN A;  4ZYQ A;  3EC4 A;  4R87 A;  3C26 A;  4AVC A;  2PJ7 A;  2C6C A;  3N5F A;  2OR4 A;  1TF9 A;  3NH5 A;  4MFJ A;  4AVB A;  2XEJ A;  4E8O A;  3FMC A;  1ON0 A;  1Y0R A;  1U6M A;  2GRE A;  4KUB A;  4JLY A;  3TTH A;  4CGO A;  4MCP A;  3G3S A;  2GFQ A;  3SJX A;  4RS2 A;  3D2M A;  1TKF A;  3PP9 A;  4MBU A;  4NJR A;  3KR4 A;  4ZGY B;  1S60 A;  2O53 A;  3D7G A;  4Y49 C;  5A27 A;  5HXD A;  1YGH A;  1PYT B;  2IQ6 A;  2Q4Y A;  1HDQ A;  1VKC A;  1S7L A;  1TIQ A;  3EFA A;  1YQE A;  2QIR A;  2FCK A;  1VIX A;  4FD7 A;  2Z10 A;  5THW A;  4CYN A;  1BLL E;  3PB6 X;  1XJO A;  3B7I A;  3FED A;  5HH1 A;  4FWU A;  4BIN A;  4MHN A;  2VBQ A;  2ZXV A;  4ZX8 A;  2AFW A;  1ZG8 A;  5ISV A;  2B3U A;  2B4D B;  2Z0Z A;  3KI9 A;  3D67 A;  3S6K A;  3D7D A;  3KZW A;  2Q4Z A;  4P4F A;  3T90 A;  1IOI A;  3IGR A;  4KVM E;  2NSM A;  1YX0 A;  4UCM A;  2GE3 A;  4LQG A;  4II9 A;  5H86 A;  4ZY0 A;  3SI0 A;  4W9Y A;  3EY5 A;  1YSJ A;  2R8V A;  1WWZ A;  2AFZ A;  4KOS A;  4MFQ A;  4B12 A;  5HMN A;  4I49 A;  4CRZ B;  4UWJ A;  4UEF A;  5DS0 A;  1F2P A;  5JH9 A;  2ZPA A;  4IHM A;  4UFX A;  3FJU A;  5KTA A;  1XOV A;  3F0A A;  3CPA A;  1R57 A;  3MRU A;  4MRI A;  1NMT A;  1S5K A;  4UCP A;  2ODF A;  4TNU A;  4FBE A;  2B4D A;  2F7V A;  2QVP A;  2EWB A;  2WSA A;  2BSW A;  1UWY A;  4NSQ A;  3H8E A;  2C27 A;  2PJ8 A;  3IU2 A;  3ZJ0 A;  4J3G A;  2D4P A;  1DTD A;  3IWW A;  3PEI A;  3H8G A;  4QB9 A;  3GY9 A;  3E0K A;  3D7F A;  2PVW A;  4B5P A;  4WJB A;  3R95 A;  4F0X A;  2FXF A;  3CXQ A;  3TO6 A;  1LCP A;  4F9V A;  3S9N A;  4YWY A;  2BCO A;  1YW4 A;  1IB1 E;  1CX8 A;  3FH4 A;  4IK2 A;  3KHX A;  1IID A;  4XNH B;  1CPS A;  4CAX A;  2GIV A;  4F0Y A;  3SJE A;  2G0B A;  1M4G A;  1CBX A;  2O28 A;  2ZEP A;  2RFH A;  2YND A;  1S7K A;  1QST A;  1WK4 A;  2DF5 A;  2CNS A;  3A9L A;  2Q51 A;  3F5B A;  3JUW A;  4H6Z A;  5CNP A;  3EXN A;  4A37 A;  4UEE A;  4B14 A;  4CYQ A;  2PR8 A;  3BJ8 A;  3PFO A;  4XPD B;  1Y0Y A;  2CNM A;  2PJ6 A;  1M4I A;  4NGM A;  2ZEM A;  5F48 A;  4EFD A;  5A28 A;  2CTC A;  2FL4 A;  1GYT A;  1Q7L A;  1Z4R A;  4KOT A;  2Z3K A;  2CTB A;  4LUA A;  5FVJ A;  4A32 A;  4B13 A;  1PUA A;  2EO8 A;  4IF5 A;  3HUV A;  1KZF A;  3D3S A;  4EWT A;  1X12 A;  2XEI A;  3IFE A;  8CPA A;  5JQ4 A;  4C2Y A;  5HVG A;  1BO4 A;  4MHY A;  2V8G A;  3V8I A;  4DYO A;  3PGP A;  3B3W A;  4MFK A;  5I4M A;  4OIW A;  4X5K A;  3WAB A;  2J9A A;  2CXA A;  4R76 A;  5HVH A;  1XE4 A;  4PK3 A;  4MFP A;  3TOB A;  2WPW A;  4KVO E;  4MY3 A;  4ONW A;  3TO9 A;  2ZEF A;  1SQH A;  2O4H A;  2DXQ A;  3BJ7 A;  4KLV A;  4UBR A;  2PVV A;  2AJ6 A;  3RZA A;  4IUS A;  1M44 A;  3NA6 A;  2JDD A;  2ZEH A;  4E2A A;  3D66 A;  1Y7R A;  4AXV A;  3CPX A;  3IEH A;  1HDU A;  5G1Z A;  1VGY A;  4KZT A;  1Z4E A;  4DJL A;  5G21 A;  2OOT A;  3GKR A;  3S9L A;  5J8F A;  3UY5 A;  4PQA A;  4UEZ A;  2G9D A;  1YR0 A;  3BLN A;  3NH4 A;  1TKJ A;  5AG5 A;  1ZG9 A;  2DEA A;  4MXU A;  4KS9 A;  4OID A;  3WC6 A;  3QNV A;  2EVN A;  4L89 A;  4X8I A;  4MFL A;  2Z3P A;  4UCN A;  3RYO A;  4F8Z A;  3H8F A;  4CAE A;  4DNC A;  2QEC A;  3NFZ A;  4BBH A;  4JD6 A;  2IJZ A;  3N7Z A;  3LOD A;  5LYI A;  2B3V A;  3RNZ A;  4A94 A;  1M4L A;  3TC8 A;  1FT7 A;  4CYP A;  2OB0 A;  1QQ9 A;  3P2H A;  4BMH A;  2VL1 A;  3EO4 A;  4Q7A A;  4CAW A;  3KKW A;  2YNC C;  2R1I A;  4R9M A;  3IWE A;  1PCA A;  4R57 A;  5D8N A;  4YFJ A;  4HKF A;  1RXT A;  3RAM A;  1K4J A;  5IV0 A;  4P4J A;  2XEG A;  5IB0 A;  5JPH A;  4FUU A;  2VXK A;  4CGM A;  4B5O A;  2JLM A;  3TO7 A;  4QVT A;  4P4I A;  5E96 A;  1Z8W A;  1HEE A;  4XPL A;  3LAC A;  4HNW B;  1TKH A;  4L8A A;  1R43 A;  3PRT A;  1IYL A;  2BOA A;  2J8M A;  1BPM A;  1YK3 A;  2G3T A;  2PJ0 A;  4CPA A;  1JQG A;  2F8H A;  5LYL A;  4XPD C;  4NGS A;  3SXO A;  4OC1 A;  2JEV A;  4FAI A;  3V7Z A;  2PE3 A;  3DNS A;  5H84 A;  5IB9 A;  2VQY A;  3TE4 A;  2FSR A;  2ATR A;  2ZW4 A;  3NH8 A;  1CPX A;  1F57 A;  3JRU A;  3KR5 A;  2F5I A;  5K8N A;  5F46 A;  4EME A;  2DPT A;  3PFE A;  4P44 A;  3R1K A;  3B3V A;  2IL4 A;  2AFO A;  3F8K A;  4F6A A;  3NE7 A;  1F2O A;  2Z11 A;  2B4B A;  3V38 A;  4A38 A;  4JXR A;  4NGQ A;  3KGQ A;  3W6S A;  3TOA A;  2Z3O A;  3NE8 A;  3S6G A;  2PJ2 A;  1IY7 A;  5LRJ A;  3G8W A;  2BUE A;  4MJ8 A;  4UWI A;  1Z8L A;  1B6B A;  1YLE A;  4KVX A;  3GLJ A;  2Q4V A;  2Z3N A;  3CZX A;  2OZU A;  2I3C A;  3D2P A;  1FY7 A;  2EUI A;  4WWV A;  4KUA A;  4R8F A;  5JM6 A;  2BL1 A;  3VWD A;  3CDX A;  1LAP A;  5D29 A;  4MCQ A;  2Q04 A;  4YGO A;  5AGE A;  3WT4 A;  4CAV A;  1IIC A;  2P0W A;  1ZG7 A;  1KWM A;  2ANP A;  4KOX A;  4JYW A;  4NF1 A;  5EC4 A;  2POK A;  2FS5 A;  4UF4 A;  3SJG A;  2YNC A;  1M1D A;  3FRM A;  1FNO A;  4KOV A;  2FIW A;  2ZEO A;  4JWP A;  2GLJ A;  4C68 A;  2RB7 A;  3OWC A;  2R7H A;  3PB9 X;  1MJ9 A;  2PIY A;  2PSW A;  1IOF A;  2REF A;  4NJQ A;  2AFX A;  2X7B A;  1YVO A;  2EK9 A;  3HLP A;  3S6H A; 
#chains in the Genus database with same CATH homology
 1PU9 A;  5AG6 A;  2G3A A;  3SXN A;  4ORF A;  1RO5 A;  2PRB A;  1IYK A;  2REE A;  4A30 A;  1CM0 A;  1P0H A;  3R9F A;  5IX3 A;  2H5M A;  2OU2 A;  3GYA A;  2CNT A;  1XEB A;  4B5P B;  4PK2 A;  4Q38 A;  3R96 A;  2I00 A;  3DSB A;  1I21 A;  4QC6 A;  3W6X A;  3DR8 A;  4C7H A;  2HV2 A;  3S6F A;  4XPK A;  1XIX A;  1YRE A;  2ZW5 A;  4CRY B;  2BEI A;  3H4Q A;  3K9U A;  2FE7 A;  1Q2C A;  4QUS A;  2FIA A;  2K5T A;  1KUY A;  5C82 A;  1L0C A;  2WUU A;  3QB8 A;  2NMT A;  2JDC A;  2WPX A;  5F49 A;  1Y9K A;  1ZO0 A;  4PV6 A;  4H6U A;  5BWA B;  2P6G A;  2P6F A;  3IWG A;  2FT0 A;  1XMT A;  5EBV A;  3R9E A;  4AG9 A;  1KUX A;  2HQY A;  4NEX A;  1P4N A;  4FD6 A;  3VWE A;  5GCN A;  2P6E A;  2ZW7 A;  2B5G A;  4M3S A;  5AG7 A;  1I1D A;  5J8C A;  4A33 A;  3CXS A;  3TFY A;  2PC1 A;  1MJB A;  2RC4 A;  4U5Y A;  4R3L A;  4QBJ A;  2Q0Y A;  4LX9 A;  4AG7 A;  1NE9 A;  3FIX A;  2KCW A;  4KOW A;  4XNH C;  3TT2 A;  4ONU A;  2CY2 A;  2J8N A;  4K30 A;  3H5Z A;  3I3G A;  1S7F A;  1MK4 A;  4KSF A;  3JVN A;  4PSX A;  4CGP A;  1V0C A;  1QSM A;  5G22 A;  3W91 A;  2PDO A;  3FB3 A;  4H89 A;  2ARH A;  4A2Z A;  1Z9U A;  4KLW A;  1QSN A;  4KSA A;  2Q44 A;  3FXT A;  3WR7 A;  5DWM A;  4A31 A;  2VZZ A;  2OZG A;  4AVA A;  3JTK A;  1BOB A;  4B11 A;  1CJW A;  4YRH A;  4A95 A;  4CAF A;  1I12 A;  1QSO A;  1VHS A;  4UFW A;  4AB7 A;  4HNX B;  4JXQ A;  2B58 A;  4B10 A;  4HNY B;  2ZW6 A;  1Y9W A;  1Q2D A;  1YVK A;  2QML A;  2R98 A;  4C2Z A;  2VZY A;  2DPS A;  3QAH A;  2YNE A;  1S3Z A;  2D4O A;  3ZZI A;  3R9G A;  4F0X A;  1M4D A;  2B5G B;  2AE6 A;  1UFH A;  4PSW A;  2Q7B A;  2PQ8 A;  1XF8 A;  3DDD A;  4FD4 A;  3SHP A;  3MGD A;  4OAE A;  4KOR A;  1N71 A;  4KOU A;  4CGL A;  1B87 A;  3FNC A;  4NCZ A;  3LD2 A;  4FD5 A;  4MFZ A;  4U9Y A;  4MY0 A;  4GS4 A;  2VEZ A;  4MI4 A;  2Z3M A;  2VI7 A;  2OH1 A;  4E0A A;  3I9S A;  5I0C A;  2Z3L A;  4OAD A;  3D8P A;  3B8G A;  2Y0M A;  4U9Z A;  4UFV A;  2HUZ A;  3FYN A;  2A4N A;  4M85 A;  4NXY A;  4CYO A;  4EVY A;  3CXP A;  4OLL A;  4CGN A;  2GAN A;  4MHD A;  4UA3 A;  4C7I A;  4ZBG A;  3IU1 A;  3FBU A;  4C2X A;  2I79 A;  1S7N A;  1MJA A;  1J4J A;  1KUV A;  1OZP A;  4CS0 B;  3T9Y A;  2J8R A;  1LRZ A;  5C88 A;  3P2F A;  1GHE A;  1NSL A;  4Q36 A;  5AG4 A;  1QSR A;  2OZH A;  4R3K A;  2YGW A;  2PR1 A;  4JJX A;  4Y49 B;  5G20 A;  3PZJ A;  4RI1 A;  5F47 A;  5KTD A;  3DR6 A;  3TCV A;  4KOY A;  1Q2Y A;  5KTC A;  5DWN A;  3EC4 A;  4R87 A;  3C26 A;  4AVC A;  4MFJ A;  4AVB A;  4E8O A;  1ON0 A;  4KUB A;  1U6M A;  3TTH A;  4CGO A;  4JLY A;  3G3S A;  4RS2 A;  3D2M A;  3PP9 A;  4MBU A;  4ZGY B;  1S60 A;  4Y49 C;  5A27 A;  1YGH A;  2Q4Y A;  1VKC A;  1S7L A;  1TIQ A;  3EFA A;  2QIR A;  2FCK A;  4FD7 A;  4CYN A;  2Z10 A;  5HH1 A;  5ISV A;  2VBQ A;  2ZXV A;  2B3U A;  2B4D B;  2Z0Z A;  3S6K A;  3T90 A;  3IGR A;  4KVM E;  1YX0 A;  4UCM A;  2GE3 A;  4II9 A;  5H86 A;  3EY5 A;  2R8V A;  4KOS A;  1WWZ A;  4MFQ A;  4B12 A;  5HMN A;  4I49 A;  4CRZ B;  4UWJ A;  2ZPA A;  4UFX A;  5KTA A;  3F0A A;  1R57 A;  1NMT A;  1S5K A;  4UCP A;  2B4D A;  2WSA A;  2BSW A;  4NSQ A;  2C27 A;  3IU2 A;  3ZJ0 A;  4J3G A;  2D4P A;  4QB9 A;  3GY9 A;  3E0K A;  4B5P A;  3R95 A;  2FXF A;  3CXQ A;  3TO6 A;  1IB1 E;  1IID A;  4XNH B;  4CAX A;  2GIV A;  4F0Y A;  2G0B A;  1M4G A;  2O28 A;  2YND A;  3A9L A;  1S7K A;  1QST A;  1WK4 A;  3F5B A;  2CNS A;  3JUW A;  4H6Z A;  5CNP A;  3EXN A;  4CYQ A;  4B14 A;  2PR8 A;  3BJ8 A;  4XPD B;  2CNM A;  1M4I A;  5F48 A;  5A28 A;  2FL4 A;  1Z4R A;  4KOT A;  2Z3K A;  4LUA A;  5FVJ A;  4A32 A;  4B13 A;  1PUA A;  4IF5 A;  1KZF A;  3D3S A;  5JQ4 A;  4C2Y A;  1BO4 A;  3V8I A;  3PGP A;  4MFK A;  4X5K A;  2CXA A;  1XE4 A;  4PK3 A;  4MFP A;  3TOB A;  2WPW A;  4KVO E;  4MY3 A;  3TO9 A;  1SQH A;  2DXQ A;  3BJ7 A;  4KLV A;  4UBR A;  2AJ6 A;  4IUS A;  1M44 A;  2JDD A;  4E2A A;  1Y7R A;  5G1Z A;  4KZT A;  1Z4E A;  5G21 A;  3GKR A;  5J8F A;  3UY5 A;  1YR0 A;  3BLN A;  5AG5 A;  4KS9 A;  2EVN A;  4L89 A;  4MFL A;  2Z3P A;  4UCN A;  3RYO A;  4CAE A;  4DNC A;  2QEC A;  4BBH A;  4JD6 A;  3N7Z A;  3LOD A;  2B3V A;  4CYP A;  2OB0 A;  3P2H A;  4BMH A;  3EO4 A;  4CAW A;  3KKW A;  2YNC C;  2R1I A;  4R9M A;  3IWE A;  4R57 A;  4YFJ A;  4HKF A;  1RXT A;  1K4J A;  5IV0 A;  5IB0 A;  5JPH A;  2VXK A;  4CGM A;  4B5O A;  2JLM A;  3TO7 A;  4QVT A;  5E96 A;  4XPL A;  4HNW B;  4L8A A;  1IYL A;  2J8M A;  1YK3 A;  2G3T A;  4XPD C;  3SXO A;  2JEV A;  3DNS A;  5H84 A;  2VQY A;  3TE4 A;  2FSR A;  2ATR A;  2ZW4 A;  2F5I A;  5F46 A;  2DPT A;  3R1K A;  2IL4 A;  3F8K A;  4F6A A;  3NE7 A;  2Z11 A;  2B4B A;  4JXR A;  3W6S A;  3TOA A;  2Z3O A;  3S6G A;  3G8W A;  2BUE A;  4MJ8 A;  4UWI A;  1B6B A;  1YLE A;  4KVX A;  2Q4V A;  2Z3N A;  2OZU A;  3D2P A;  1FY7 A;  2EUI A;  4KUA A;  2BL1 A;  3VWD A;  2Q04 A;  4YGO A;  5AGE A;  4CAV A;  1IIC A;  2P0W A;  5EC4 A;  4KOX A;  4NF1 A;  2FS5 A;  2YNC A;  1M1D A;  3FRM A;  4KOV A;  2FIW A;  4JWP A;  4C68 A;  3OWC A;  2R7H A;  1MJ9 A;  2PSW A;  2REF A;  2X7B A;  1YVO A;  3S6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...