4OAEA

Crystal structure of a gnat superfamily acetyltransferase pa4794 c29a/c117a/y128a mutant in complex with chloramphenicol
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
160
structure length
160
Chain Sequence
HMQLSHRPAETGDLETVAGFPQDRDELFYAYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISAFNANAAGLLLATQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GNAT superfamily acetyltransferase PA4794
publication title Crystal structure of a GNAT superfamily acetyltransferase PA4794 C29A/C117A/Y128A mutant in complex with chloramphenicol
rcsb
source organism Pseudomonas aeruginosa
total genus 43
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2014-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4oaeA00
4DNCA 4HNWB 2FCKA 1YVKA 3R9EA 1IICA 4KLWA 2Q04A 3D2PA 2CNMA 1CJWA 3D8PA 2ZPAA 1KZFA 4B5OA 1YREA 3IGRA 5JPHA 2PQ8A 3QB8A 1IB1E 3P2HA 3G8WA 4KOVA 4XNHB 3ZJ0A 1B87A 2F5IA 4CRYB 2PC1A 4HKFA 3BLNA 2PR1A 4JJXA 4KZTA 5F49A 2B4DA 4H6UA 2HV2A 3CXQA 3R9FA 5HMNA 1S3ZA 2OZUA 3N7ZA 4QB9A 3S6FA 1M44A 4KOYA 3TO9A 3SXNA 4CS0B 1MK4A 3JUWA 1QSMA 5DWNA 3TOBA 4FD4A 2CNSA 3PGPA 2BL1A 3TOAA 3E0KA 1Z4EA 2VBQA 1N71A 1CM0A 4Y49C 4RS2A 5IX3A 2G3AA 4F0YA 2WPWA 4KOUA 1KUYA 5HH1A 4NSQA 1VKCA 4U9ZA 2RC4A 4PSWA 1Y7RA 3W6XA 3TTHA 3S6KA 4H89A 2VZZA 2BUEA 5F48A 1M4IA 1MJ9A 3D3SA 2HUZA 2GIVA 3KKWA 1PU9A 3PZJA 3R9GA 2P0WA 4UA3A 5H86A 2Z11A 1I21A 2Q4VA 1KUXA 1VHSA 4J3GA 2OH1A 1YR0A 1Z4RA 3BJ8A 1IIDA 4AB7A 1IYLA 3JVNA 4AG9A 3DDDA 4XPKA 2PDOA 1NE9A 2Y0MA 4UBRA 2ZW6A 4II9A 1KUVA 1ON0A 3TCVA 1LRZA 2JDCA 3SXOA 1WK4A 3TE4A 1NMTA 4NF1A 1XE4A 2REEA 1MJAA 2B3VA 2IL4A 5IV0A 2VEZA 4ZBGA 4KVME 3UY5A 1P0HA 2BSWA 2R1IA 3FIXA 5C88A 4CAWA 2KCWA 1QSNA 4PK3A 1Z9UA 3CXPA 3R96A 4XNHC 1S7FA 2B5GA 4AVBA 5DWMA 3TFYA 4UWJA 2D4OA 2VZYA 4HNYB 2R8VA 1NSLA 1M4DA 2X7BA 2ZW7A 2I00A 4QUSA 3MGDA 2A4NA 3F8KA 3P2FA 3V8IA 1Y9KA 1XIXA 2Q44A 2B4DB 3DR6A 3T90A 4BMHA 5JQ4A 2VI7A 1M1DA 2REFA 4FD6A 5EC4A 4KVXA 4YRHA 4H6ZA 4KLVA 2FSRA 1I1DA 2K5TA 2GANA 1XF8A 4E2AA 4KOXA 1S5KA 3LODA 5FVJA 1QSRA 2Q0YA 2J8NA 2WPXA 4JD6A 4MY3A 3QAHA 1WWZA 2CY2A 2OB0A 2FS5A 3FRMA 4MI4A 1YLEA 1MJBA 3B8GA 2ATRA 2AE6A 5ISVA 4KORA 2QMLA 1YGHA 5IB0A 1R57A 2G0BA 3TO6A 4UWIA 4L89A 4JXRA 2FIWA 2Q7BA 3VWDA 4QC6A 3EC4A 1K4JA 1PUAA 1QSTA 1UFHA 3DR8A 2PSWA 3FXTA 4QVTA 5F46A 4JWPA 3H4QA 4NXYA 2EVNA 3W91A 2B58A 4XPDC 4XPLA 4PK2A 1SQHA 4R3KA 3GKRA 4OAEA 4CRZB 1V0CA 2BEIA 3FNCA 4MJ8A 4ONUA 1RXTA 4KOSA 4B5PB 1YX0A 2FT0A 3I9SA 4IF5A 4Y49B 1B6BA 3EY5A 1L0CA 2FE7A 3FYNA 1TIQA 4HNXB 2HQYA 1J4JA 2ZW5A 3DSBA 3F5BA 2Q4YA 5J8FA 2J8MA 2JDDA 4PV6A 2NMTA 3K9UA 4KVOE 1S7NA 1S60A 3C26A 4R87A 4KUBA 4R57A 2OZGA 2C27A 3RYOA 1S7KA 2FL4A 3T9YA 3TO7A 1BO4A 3OWCA 1Y9WA 2B5GB 4K30A 3EXNA 1YK3A 1Q2CA 5F47A 5CNPA 1Q2YA 1OZPA 3GY9A 1IYKA 2G3TA 3DNSA 4FD7A 3GYAA 4U5YA 3EO4A 4LUAA 4OLLA 2JEVA 3ZZIA 3F0AA 2DXQA 2AJ6A 4FD5A 2PR8A 3NE7A 5C82A 3WR7A 2I79A 3D2MA 2P6EA 1FY7A 4MHDA 4CAVA 1M4GA 2P6FA 2PRBA 3R95A 2J8RA 1XMTA 4L8AA 2OU2A 2QIRA 3LD2A 4RI1A 1RO5A 4LX9A 4X5KA 4JLYA 1I12A 1Q2DA 2OZHA 2Z10A 4E0AA 3VWEA 3TT2A 5KTCA 4M3SA 3S6HA 2Z0ZA 2H5MA 3R1KA 2ZXVA 4I49A 4KOWA 3G3SA 2ARHA 3IWGA 2P6GA 5J8CA 5EBVA 2FIAA 2D4PA 4U9YA 4EVYA 4AVCA 4OADA 4F6AA 1QSOA 2JLMA 2R98A 5E96A 4E8OA 3S6GA 2B4BA 2VQYA 4M85A 1P4NA 2R7HA 2CNTA 4R3LA 5I0CA 1BOBA 2GE3A 2ZW4A 1U6MA 4QBJA 4PSXA 3FBUA 4GS4A 4JXQA 3PP9A 4NCZA 3SHPA 4IUSA 1S7LA 1YVOA 3EFAA 2FXFA 3I3GA 4ORFA 4AG7A 4KOTA 5GCNA 5H84A 4MBUA 5KTAA 5KTDA 1GHEA 4XPDB 3W6SA 2B3UA 4NEXA 4YFJA 4B5PA 4MY0A 4YGOA 2EUIA 3BJ7A 4KUAA 2VXKA 4CAXA 2O28A 4AVAA 2QECA 3FB3A 1XEBA 4R9MA 3CXSA
chains in the Genus database with same CATH superfamily
2V8GA 1FT7A 4DNCA 4PXBA 2EK9A 4HNWB 1CPXA 2FCKA 3V38A 4P6YA 3CT9A 1YVKA 4P4FA 4YU9A 2RB7A 4MCPA 1IICA 3R9EA 4KLWA 4NGQA 4C68A 2AFUA 3FECA 4MXUA 4C2XA 2AFOA 2Q04A 5HXDA 1BPNA 2DEAA 2V8DA 3NH8A 4JZ0A 4ZY1A 3D2PA 3GLJA 2CNMA 4UEZA 1CJWA 4M6HA 1YW4A 2ZPAA 1KZFA 3D8PA 1TKJA 4B5OA 4WWVA 1YREA 1ZLIA 5CPAA 2JBKA 3IGRA 1Q7LA 3PB4X 4MRIA 5JPHA 4DJLA 5K8PA 2C6PA 2PQ8A 3QB8A 1CG2A 1IB1E 3B3WA 3P2HA 4MHNA 1ARLA 3G8WA 4KOVA 4NGPA 4XNHB 2PJ3A 3ZJ0A 4YWYA 1B87A 2F5IA 4CRYB 1FNOA 2PC1A 1R43A 4GXHA 3NA6A 2HB6A 3B3TA 2JEWA 4HKFA 2PCUA 1A2ZA 1RTQA 3BLNA 3D4UA 4M6IA 2BOAA 2PR1A 5ELYA 4A94A 4CYPA 4F0XA 4JJXA 4KZTA 4CAFA 2EO8A 2B4DA 1R3NA 5F49A 1ELLP 4H6UA 2HV2A 1XRYA 3CXQA 1LFWA 3GB0A 1JQGA 3PEIA 3R9FA 1CBXA 5HMNA 1S3ZA 2OZUA 3N7ZA 3KZWA 4F8ZA 3IIBA 4Q38A 4QB9A 4UCPA 3S6FA 4B10A 4A37A 4RN7A 1M44A 4KOYA 3TO9A 4Z65A 3SXNA 4CS0B 1MK4A 4X8IA 3JUWA 2EBJA 1QSMA 5A28A 4ZX9A 3N5FA 5DWNA 4UEEA 3TOBA 4FD4A 2Z3OA 3MN8A 2CNSA 3PGPA 2YNCC 2Q7SA 1HDUA 1VIXA 3S9LA 1YSJA 2BL1A 3TOAA 3E0KA 4B11A 1Z4EA 2Q4ZA 2VBQA 5EMIA 3SJGA 3KI9A 4A33A 4CAEA 1N71A 4UCNA 3BI0A 3S9NA 1CM0A 1QMUA 2CTCA 4RS2A 4Y49C 5IX3A 1CP6A 2G3AA 4UIBA 1IOIA 2WPWA 3FEDA 1KUYA 4KOUA 4P45A 4Q36A 5HH1A 3IO1A 4F0YA 4NSQA 1VKCA 2YNEA 4IAVA 1DE4C 4U9ZA 5G22A 2RC4A 4PSWA 1Y7RA 4C7IA 3D68A 1ZG9A 3W6XA 3TTHA 4NGSA 1Z8TA 3S6KA 4H89A 2VZZA 4H2KA 2BUEA 4A32A 5F48A 1M4IA 1MJ9A 2AFSA 2PJAA 4EFDA 3D3SA 2HUZA 2C1CA 2GIVA 3KKWA 5LYLA 3WC7A 1PU9A 3PZJA 4ZX8A 3R9GA 4G1PA 2GLFA 2P0WA 4UA3A 1M4LA 5H86A 4ZI6A 2Z11A 2Q51A 1VGYA 1IY7A 1I21A 3H8GA 3IC1A 1IOFA 2Q4VA 2YNCA 4R8FA 1KUXA 1VHSA 4J3GA 2OH1A 4PXCA 3RO0A 1YR0A 3T8WA 3DLJA 4F9UA 1H8LA 1Z4RA 3B2YA 5JH9A 1LANA 3BJ8A 1IIDA 2PJ5A 3PB8X 5LYDA 2RFHA 4AB7A 1IYLA 3JVNA 1ZO0A 5AG5A 4AG9A 5G20A 3DDDA 4XPKA 2PDOA 2Z3NA 1NE9A 2Y0MA 7CPAA 4UBRA 2ZW6A 1XOVA 4II9A 3TC8A 1CPSA 1KUVA 1ON0A 3FEEA 4PQAA 3TCVA 1LRZA 2JDCA 3SXOA 3TX8A 1WK4A 1GYTA 3PBBA 3TE4A 1NMTA 3KR4A 2YNDA 2ZEEA 3JTKA 1XE4A 2REEA 4NF1A 4OIDA 1MJAA 2B3VA 2G9DA 2IL4A 2ZEGA 3CPXA 5IV0A 2VEZA 1Y0YA 4ZBGA 4A39A 4KVME 4A2ZA 3UY5A 2ZEFA 1BAVA 1TF8A 1P0HA 4B12A 3B7IA 3CDXA 2BSWA 2R1IA 1CX8A 3FIXA 5C88A 2DPTA 1LCPA 4MCQA 4CAWA 2KCWA 2BCOA 4M6GA 4BD9A 1QSNA 2XEGA 2AFWA 4PK3A 2QJ8A 2Z3MA 5G21A 1Z9UA 4A95A 3CXPA 3S9MA 1YLOA 3R96A 2O4HA 4R6TA 2PJCA 4XNHC 1S7FA 2B5GA 4AVBA 4ZY0A 1F2PA 5DWMA 5LYIA 4CYNA 3TFYA 4UWJA 2D4OA 3B3SA 1IGBA 4PXDA 2VZYA 4HNYB 2R8VA 2V8VA 1NSLA 2PVVA 1M4DA 2CF4A 2X7BA 4C7HA 2ZW7A 3GIUA 2I00A 4QUSA 1XFOA 3MGDA 2A4NA 3IEHA 3L2NA 3F8KA 3IJ3A 3P2FA 3KHZA 4ZY2A 2PJ6A 2ODFA 4CGNA 3B3VA 3V8IA 4CYOA 1Y9KA 5HVFA 1XIXA 2DF5A 2B4DB 2Q44A 3DR6A 3T90A 4BMHA 5JQ4A 4NGTA 4KSAA 1ZLHA 4FUUA 2VI7A 2XEIA 3D67A 1M1DA 2F7VA 2I3CA 4P4EA 5JM6A 2PJ1A 2REFA 4FD6A 1TXRA 4R7MA 4UIAA 5EC4A 4KVXA 4ZYQA 1EE3P 3PFOA 2C6GA 2QYVA 4H6ZA 4KLVA 2FSRA 1VHEA 1I1DA 4YRHA 2K5TA 4NGRA 2GANA 1XF8A 2PJ9A 4E2AA 5I4MA 3I1UA 4KOXA 1S5KA 3LODA 3PFEA 5AG7A 5FVJA 1OBRA 4K3NA 1QSRA 4B6ZA 1ARMA 3IFEA 2Q0YA 2J8NA 2WPXA 1ELMP 4JD6A 4MY3A 3QAHA 1WWZA 2CY2A 2OB0A 2AFMA 2BO9A 2FS5A 3FRMA 1YLEA 2ABZA 3GUXA 4MI4A 1AMPA 3SJEA 4OP4A 4OIWA 3VATA 4A30A 1MJBA 1PCAA 4P10A 4NJRA 5LRKA 1LAMA 3B8GA 4F9VA 2ATRA 2AE6A 2PJ0A 2EWBA 5ISVA 4KORA 3H8FA 2QMLA 2PRQA 1YGHA 5IB0A 1R57A 2G0BA 1F57A 4OKOA 3TO6A 4UWIA 2IMOA 2CTBA 4L89A 1QQ9A 4JXRA 3D7FA 2FIWA 2XEJA 2Q7BA 3VWDA 5BWAB 4QC6A 3HUVA 3EC4A 3K9TA 3NE8A 1Z5RA 2Z3KA 1K4JA 4A31A 1PUAA 1QSTA 1UFHA 4C2ZA 3DR8A 5G1ZA 4CGMA 2PSWA 3FXTA 4LQGA 4QVTA 2PIYA 4JWPA 3H4QA 5F46A 4UCMA 4B13A 4NXYA 1XJOA 2PE3A 4FWUA 4UF4A 3D66A 4OC1A 3VARA 1ZG8A 2EVNA 3W91A 3WC6A 2B58A 3BHXA 4XPDC 5AG4A 4XPLA 3D7GA 4BINA 2C6CA 1BLLE 4PK2A 4R76A 1SQHA 2GLJA 2V77A 3KQXA 4R3KA 5AGEA 3GKRA 4OAEA 3A9LA 3KQZA 4MCRA 4CRZB 1HEEA 1V0CA 2BEIA 3FNCA 4MJ8A 1Z8WA 4ONUA 4MHYA 3SJXA 1RXTA 1F2OA 2YGWA 1YX0A 2FT0A 3DGVA 3I9SA 4KOSA 4OMEA 4IF5A 4X3RA 4B5PB 4EWTA 4Y49B 4RUHA 3V7ZA 1B6BA 8CPAA 3EY5A 1L0CA 4MFPA 2FE7A 2ANPA 3FYNA 4GM5A 1TIQA 2PVWA 4HNXB 4CYQA 4X2TA 2HQYA 1J4JA 2ZW5A 3DSBA 3F5BA 2Q4YA 5J8FA 2J8MA 2AFZA 4UFXA 2JDDA 4AXVA 4PV6A 2OR4A 3PRTA 2NMTA 3K9UA 4OC2A 4KVOE 1S7NA 3SJFA 4CGPA 4CGOA 1S60A 3C26A 2IQ6A 4R87A 2Q43A 4ZGYB 4MFJA 2ZEPA 4NGNA 3CPAA 2ZELA 3FJUA 3IWWA 4KUBA 2O53A 3RNZA 4R57A 1ZG7A 3NH5A 2OZGA 2C27A 3RYOA 2WSAA 2PIZA 1S7KA 2FL4A 3T9YA 3TO7A 5IB9A 1BO4A 4IK2A 2PJ7A 3OWCA 2PJBA 1Y9WA 2B5GB 4NFRA 4K30A 3EXNA 4Q7AA 4P4DA 1YK3A 1Q2CA 4WJBA 2WZNA 5F47A 5CNPA 3PB9X 3RBUA 1BPMA 1Q2YA 4OC5A 5HVGA 1OZPA 3GY9A 1HDQA 2GFQA 1IYKA 4FAIA 1LOKA 4ONWA 2CIJA 2G3TA 2XEFA 3B3CA 3DNSA 3RZAA 4W9YA 4FD7A 4BBHA 3KASA 4KS9A 4MFQA 1X10A 3GYAA 2J9AA 4U5YA 3EO4A 4LUAA 4IHMA 4OLLA 1Y7EA 3JRUA 2AFXA 5K8MA 3WABA 2JEVA 2ZEDA 3F0AA 4NGMA 2DXQA 3ZZIA 4TWEA 2AJ6A 4FD5A 5AG6A 4A38A 2PR8A 3NE7A 3QAYA 5C82A 4MHZA 4OC0A 1NSAA 3IWEA 4O23A 3D7HA 5LYFA 3WR7A 2GU2A 2VL1A 2F8HA 5LRGA 3FX6A 2I79A 2OOTA 3D2MA 2P6EA 1FY7A 3SI0A 3FMCA 3PB6X 4MHDA 4MFZA 4UFWA 5K8OA 4CAVA 1M4GA 2P6FA 2PRBA 3R95A 3H5ZA 2J8RA 1VHOA 1XMTA 4KSFA 4OC4A 4B14A 4L8AA 2OU2A 2POKA 2QIRA 3LD2A 4RI1A 4C2YA 1RO5A 4UEFA 2WYRA 3IU1A 2HC9A 4MFKA 2PJ2A 4LX9A 2JBJA 4X5KA 4JLYA 5HVHA 3PBEA 3KL9A 5DS0A 1I12A 1Q2DA 2OZHA 2Z10A 4E0AA 4DYOA 1DTDA 3VWEA 2EK8A 3TT2A 1Y0RA 5KTCA 4CPAA 5LRJA 2ZOGA 4M3SA 3MRUA 3WT4A 3S6HA 2Z3LA 2Z0ZA 3H8EA 4KSIA 2H5MA 1CP7A 3R1KA 3D7DA 2ZXVA 3FVLA 5D8NA 5THWA 3WC5A 3NFZA 4P4JA 2NYQA 1YMEA 1IU8A 2CXAA 4I49A 4KOWA 2FVGA 4CGLA 3G3SA 2ARHA 3IWGA 1JWQA 2P6GA 4MFLA 5J8CA 1UWYA 2IJZA 4MCSA 2FIAA 5EBVA 4EMEA 2D4PA 4U9YA 4EVYA 4AVCA 4OADA 4F6AA 3LACA 1QSOA 2PJ8A 4OC3A 2JLMA 5A27A 5F09A 2R98A 5E96A 3LMSA 4E8OA 5CBMA 4NJQA 3B35A 3S6GA 2B4BA 2VQYA 4M85A 5J1QA 3IU2A 1Z8XA 3KHXA 1P4NA 2R7HA 2CNTA 2GREA 4R3LA 2PJ4A 5I0CA 4PPZA 1BOBA 2GE3A 2ZW4A 1U6MA 4DUKA 4QBJA 3VH9A 4PSXA 5K8NA 3FBUA 2V8HA 4MMOA 1PYTB 4GS4A 4JXQA 3PP9A 4NCZA 3SHPA 4IUSA 1S7LA 4FBEA 2ZEMA 3K2KA 1YVOA 2ZENA 3EFAA 2FXFA 3I3GA 1X12A 4ORFA 4AG7A 4KOTA 1XMBA 3BI1A 2QVPA 1AYEA 5GCNA 1XBUA 3CZXA 5H84A 3SI1A 1YQEA 4MHPA 4P44A 5D29A 3SI2A 4MBUA 5KTAA 3HLPA 4JYWA 5JGFA 1GHEA 4XPDB 3W6SA 1TKHA 5KTDA 1LAPA 2NSMA 2B3UA 3KGQA 4TNUA 1Z8LA 2ZEHA 4P4BA 4NEXA 4YFJA 3ISZA 4B5PA 2ZEOA 2ZOFA 3KR5A 4MY0A 1AUGA 4YGOA 3RAMA 2EUIA 3BJ7A 4HPSA 2DPSA 3FH4A 2VXKA 3NH4A 3QNVA 2O28A 1YW6A 4KUAA 4P4IA 4UFVA 4AVAA 4CAXA 4LQ6A 2QECA 6CPAA 3PB7X 3FF3A 3FB3A 1Z2LA 2Z3PA 3ISXA 4PXEA 1XEBA 1KWMA 4R9MA 2WUUA 3CXSA 1TF9A 3BXMA 3LWUA 1TKFA
chains in the Genus database with same CATH topology
4DNCA 4HNWB 2FCKA 1YVKA 3R9EA 1IICA 4KLWA 4C68A 4C2XA 2Q04A 3D2PA 2CNMA 1CJWA 3D8PA 2ZPAA 1KZFA 4B5OA 1YREA 3IGRA 5JPHA 2PQ8A 3QB8A 1IB1E 3P2HA 3G8WA 4KOVA 4XNHB 3ZJ0A 1B87A 2F5IA 4CRYB 2PC1A 4HKFA 3BLNA 2PR1A 4CYPA 4F0XA 4JJXA 4KZTA 4CAFA 5F49A 2B4DA 4H6UA 2HV2A 3CXQA 3R9FA 5HMNA 1S3ZA 2OZUA 3N7ZA 4Q38A 4QB9A 4UCPA 3S6FA 4B10A 1M44A 4KOYA 3TO9A 3SXNA 4CS0B 1MK4A 3JUWA 1QSMA 5A28A 5DWNA 3TOBA 4FD4A 2Z3OA 2CNSA 3PGPA 2YNCC 2BL1A 3TOAA 3E0KA 4B11A 1Z4EA 2VBQA 4A33A 4CAEA 1N71A 4UCNA 1CM0A 4Y49C 4RS2A 5IX3A 2G3AA 4F0YA 2WPWA 4KOUA 1KUYA 4Q36A 5HH1A 4NSQA 1VKCA 2YNEA 4U9ZA 5G22A 2RC4A 4PSWA 1Y7RA 4C7IA 3W6XA 3TTHA 3S6KA 4H89A 2VZZA 4A32A 2BUEA 5F48A 1M4IA 1MJ9A 3D3SA 2HUZA 2GIVA 3KKWA 1PU9A 3PZJA 3R9GA 2P0WA 4UA3A 5H86A 2Z11A 1I21A 2Q4VA 2YNCA 1KUXA 1VHSA 4J3GA 2OH1A 1YR0A 1Z4RA 3BJ8A 1IIDA 4AB7A 1IYLA 3JVNA 1ZO0A 5AG5A 4AG9A 5G20A 3DDDA 4XPKA 2PDOA 2Z3NA 1NE9A 2Y0MA 4UBRA 2ZW6A 4II9A 1KUVA 1ON0A 3TCVA 1LRZA 2JDCA 3SXOA 1WK4A 3TE4A 1NMTA 2YNDA 3JTKA 1XE4A 2REEA 4NF1A 1MJAA 2B3VA 2IL4A 5IV0A 2VEZA 4ZBGA 4KVME 4A2ZA 3UY5A 1P0HA 4B12A 2BSWA 2R1IA 3FIXA 5C88A 2DPTA 4CAWA 2KCWA 1QSNA 4PK3A 2Z3MA 5G21A 1Z9UA 4A95A 3CXPA 3R96A 4XNHC 1S7FA 2B5GA 4AVBA 5DWMA 4CYNA 3TFYA 4UWJA 2D4OA 2VZYA 4HNYB 2R8VA 1NSLA 1M4DA 2X7BA 4C7HA 2ZW7A 2I00A 4QUSA 3MGDA 2A4NA 3F8KA 3P2FA 4CGNA 3V8IA 4CYOA 1Y9KA 1XIXA 2Q44A 2B4DB 3DR6A 3T90A 4BMHA 5JQ4A 4KSAA 2VI7A 1M1DA 2REFA 4FD6A 5EC4A 4KVXA 4YRHA 4H6ZA 4KLVA 2FSRA 1I1DA 2K5TA 2GANA 1XF8A 4E2AA 4KOXA 1S5KA 3LODA 5AG7A 5FVJA 1QSRA 2Q0YA 2J8NA 2WPXA 4JD6A 4MY3A 3QAHA 1WWZA 2CY2A 2OB0A 2FS5A 3FRMA 4MI4A 1YLEA 4A30A 1MJBA 3B8GA 2ATRA 2AE6A 5ISVA 4KORA 2QMLA 1YGHA 5IB0A 1R57A 2G0BA 3TO6A 4UWIA 4L89A 4JXRA 2FIWA 2Q7BA 3VWDA 5BWAB 4QC6A 3EC4A 4A31A 2Z3KA 1K4JA 1PUAA 1QSTA 1UFHA 4C2ZA 3DR8A 5G1ZA 4CGMA 2PSWA 3FXTA 4QVTA 5F46A 4JWPA 3H4QA 4UCMA 4B13A 4NXYA 2EVNA 3W91A 2B58A 4XPDC 5AG4A 4XPLA 4PK2A 1SQHA 4R3KA 5AGEA 3GKRA 4OAEA 3A9LA 4CRZB 1V0CA 2BEIA 3FNCA 4MJ8A 4ONUA 1RXTA 2YGWA 4KOSA 1YX0A 2FT0A 3I9SA 4B5PB 4IF5A 4Y49B 1B6BA 3EY5A 1L0CA 4MFPA 2FE7A 3FYNA 1TIQA 4HNXB 4CYQA 2HQYA 1J4JA 2ZW5A 3DSBA 3F5BA 2Q4YA 5J8FA 2J8MA 4UFXA 2JDDA 4PV6A 2NMTA 3K9UA 4CGOA 4KVOE 1S7NA 4CGPA 1S60A 3C26A 4R87A 4ZGYB 4MFJA 4KUBA 4R57A 2OZGA 2C27A 3RYOA 2WSAA 1S7KA 2FL4A 3T9YA 3TO7A 1BO4A 3OWCA 1Y9WA 2B5GB 4K30A 3EXNA 1YK3A 1Q2CA 5F47A 5CNPA 1Q2YA 1OZPA 3GY9A 1IYKA 2G3TA 3DNSA 4FD7A 4BBHA 4KS9A 4MFQA 3GYAA 4U5YA 3EO4A 4LUAA 4OLLA 2JEVA 3ZZIA 3F0AA 2DXQA 2AJ6A 4FD5A 5AG6A 2PR8A 3NE7A 5C82A 3IWEA 3WR7A 2I79A 3D2MA 2P6EA 1FY7A 4MHDA 4MFZA 4UFWA 4CAVA 1M4GA 2P6FA 2PRBA 3R95A 3H5ZA 2J8RA 1XMTA 4KSFA 4B14A 4L8AA 2OU2A 2QIRA 3LD2A 4RI1A 4C2YA 1RO5A 3IU1A 4MFKA 4LX9A 4X5KA 4JLYA 1I12A 1Q2DA 2OZHA 2Z10A 4E0AA 3VWEA 3TT2A 5KTCA 4M3SA 3S6HA 2Z3LA 2Z0ZA 2H5MA 3R1KA 2ZXVA 2CXAA 4I49A 4KOWA 4CGLA 3G3SA 2ARHA 3IWGA 2P6GA 4MFLA 5J8CA 5EBVA 2FIAA 2D4PA 4U9YA 4EVYA 4AVCA 4OADA 4F6AA 1QSOA 5A27A 2JLMA 2R98A 5E96A 4E8OA 3S6GA 2B4BA 2VQYA 4M85A 3IU2A 1P4NA 2R7HA 2CNTA 4R3LA 5I0CA 1BOBA 2GE3A 2ZW4A 1U6MA 4QBJA 4PSXA 3FBUA 4GS4A 4JXQA 3PP9A 4NCZA 3SHPA 4IUSA 1S7LA 1YVOA 3EFAA 2FXFA 3I3GA 4ORFA 4AG7A 4KOTA 5GCNA 5H84A 4MBUA 5KTAA 5KTDA 1GHEA 4XPDB 3W6SA 2B3UA 4NEXA 4YFJA 4B5PA 4MY0A 4YGOA 2EUIA 3BJ7A 2DPSA 4KUAA 2VXKA 4CAXA 2O28A 4UFVA 4AVAA 2QECA 3FB3A 2Z3PA 1XEBA 4R9MA 2WUUA 3CXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DNC A;  4HNW B;  2FCK A;  1YVK A;  3R9E A;  1IIC A;  4KLW A;  2Q04 A;  3D2P A;  2CNM A;  1CJW A;  3D8P A;  2ZPA A;  1KZF A;  4B5O A;  1YRE A;  3IGR A;  5JPH A;  2PQ8 A;  3QB8 A;  1IB1 E;  3P2H A;  3G8W A;  4KOV A;  4XNH B;  3ZJ0 A;  1B87 A;  2F5I A;  4CRY B;  2PC1 A;  4HKF A;  3BLN A;  2PR1 A;  4JJX A;  4KZT A;  5F49 A;  2B4D A;  4H6U A;  2HV2 A;  3CXQ A;  3R9F A;  5HMN A;  1S3Z A;  2OZU A;  3N7Z A;  4QB9 A;  3S6F A;  1M44 A;  4KOY A;  3TO9 A;  3SXN A;  4CS0 B;  1MK4 A;  3JUW A;  1QSM A;  5DWN A;  3TOB A;  4FD4 A;  2CNS A;  3PGP A;  2BL1 A;  3TOA A;  3E0K A;  1Z4E A;  2VBQ A;  1N71 A;  1CM0 A;  4Y49 C;  4RS2 A;  5IX3 A;  2G3A A;  4F0Y A;  2WPW A;  4KOU A;  1KUY A;  5HH1 A;  4NSQ A;  1VKC A;  4U9Z A;  2RC4 A;  4PSW A;  1Y7R A;  3W6X A;  3TTH A;  3S6K A;  4H89 A;  2VZZ A;  2BUE A;  5F48 A;  1M4I A;  1MJ9 A;  3D3S A;  2HUZ A;  2GIV A;  3KKW A;  1PU9 A;  3PZJ A;  3R9G A;  2P0W A;  4UA3 A;  5H86 A;  2Z11 A;  1I21 A;  2Q4V A;  1KUX A;  1VHS A;  4J3G A;  2OH1 A;  1YR0 A;  1Z4R A;  3BJ8 A;  1IID A;  4AB7 A;  1IYL A;  3JVN A;  4AG9 A;  3DDD A;  4XPK A;  2PDO A;  1NE9 A;  2Y0M A;  4UBR A;  2ZW6 A;  4II9 A;  1KUV A;  1ON0 A;  3TCV A;  1LRZ A;  2JDC A;  3SXO A;  1WK4 A;  3TE4 A;  1NMT A;  4NF1 A;  1XE4 A;  2REE A;  1MJA A;  2B3V A;  2IL4 A;  5IV0 A;  2VEZ A;  4ZBG A;  4KVM E;  3UY5 A;  1P0H A;  2BSW A;  2R1I A;  3FIX A;  5C88 A;  4CAW A;  2KCW A;  1QSN A;  4PK3 A;  1Z9U A;  3CXP A;  3R96 A;  4XNH C;  1S7F A;  2B5G A;  4AVB A;  5DWM A;  3TFY A;  4UWJ A;  2D4O A;  2VZY A;  4HNY B;  2R8V A;  1NSL A;  1M4D A;  2X7B A;  2ZW7 A;  2I00 A;  4QUS A;  3MGD A;  2A4N A;  3F8K A;  3P2F A;  3V8I A;  1Y9K A;  1XIX A;  2Q44 A;  2B4D B;  3DR6 A;  3T90 A;  4BMH A;  5JQ4 A;  2VI7 A;  1M1D A;  2REF A;  4FD6 A;  5EC4 A;  4KVX A;  4YRH A;  4H6Z A;  4KLV A;  2FSR A;  1I1D A;  2K5T A;  2GAN A;  1XF8 A;  4E2A A;  4KOX A;  1S5K A;  3LOD A;  5FVJ A;  1QSR A;  2Q0Y A;  2J8N A;  2WPX A;  4JD6 A;  4MY3 A;  3QAH A;  1WWZ A;  2CY2 A;  2OB0 A;  2FS5 A;  3FRM A;  4MI4 A;  1YLE A;  1MJB A;  3B8G A;  2ATR A;  2AE6 A;  5ISV A;  4KOR A;  2QML A;  1YGH A;  5IB0 A;  1R57 A;  2G0B A;  3TO6 A;  4UWI A;  4L89 A;  4JXR A;  2FIW A;  2Q7B A;  3VWD A;  4QC6 A;  3EC4 A;  1K4J A;  1PUA A;  1QST A;  1UFH A;  3DR8 A;  2PSW A;  3FXT A;  4QVT A;  5F46 A;  4JWP A;  3H4Q A;  4NXY A;  2EVN A;  3W91 A;  2B58 A;  4XPD C;  4XPL A;  4PK2 A;  1SQH A;  4R3K A;  3GKR A;  4OAE A;  4CRZ B;  1V0C A;  2BEI A;  3FNC A;  4MJ8 A;  4ONU A;  1RXT A;  4KOS A;  4B5P B;  1YX0 A;  2FT0 A;  3I9S A;  4IF5 A;  4Y49 B;  1B6B A;  3EY5 A;  1L0C A;  2FE7 A;  3FYN A;  1TIQ A;  4HNX B;  2HQY A;  1J4J A;  2ZW5 A;  3DSB A;  3F5B A;  2Q4Y A;  5J8F A;  2J8M A;  2JDD A;  4PV6 A;  2NMT A;  3K9U A;  4KVO E;  1S7N A;  1S60 A;  3C26 A;  4R87 A;  4KUB A;  4R57 A;  2OZG A;  2C27 A;  3RYO A;  1S7K A;  2FL4 A;  3T9Y A;  3TO7 A;  1BO4 A;  3OWC A;  1Y9W A;  2B5G B;  4K30 A;  3EXN A;  1YK3 A;  1Q2C A;  5F47 A;  5CNP A;  1Q2Y A;  1OZP A;  3GY9 A;  1IYK A;  2G3T A;  3DNS A;  4FD7 A;  3GYA A;  4U5Y A;  3EO4 A;  4LUA A;  4OLL A;  2JEV A;  3ZZI A;  3F0A A;  2DXQ A;  2AJ6 A;  4FD5 A;  2PR8 A;  3NE7 A;  5C82 A;  3WR7 A;  2I79 A;  3D2M A;  2P6E A;  1FY7 A;  4MHD A;  4CAV A;  1M4G A;  2P6F A;  2PRB A;  3R95 A;  2J8R A;  1XMT A;  4L8A A;  2OU2 A;  2QIR A;  3LD2 A;  4RI1 A;  1RO5 A;  4LX9 A;  4X5K A;  4JLY A;  1I12 A;  1Q2D A;  2OZH A;  2Z10 A;  4E0A A;  3VWE A;  3TT2 A;  5KTC A;  4M3S A;  3S6H A;  2Z0Z A;  2H5M A;  3R1K A;  2ZXV A;  4I49 A;  4KOW A;  3G3S A;  2ARH A;  3IWG A;  2P6G A;  5J8C A;  5EBV A;  2FIA A;  2D4P A;  4U9Y A;  4EVY A;  4AVC A;  4OAD A;  4F6A A;  1QSO A;  2JLM A;  2R98 A;  5E96 A;  4E8O A;  3S6G A;  2B4B A;  2VQY A;  4M85 A;  1P4N A;  2R7H A;  2CNT A;  4R3L A;  5I0C A;  1BOB A;  2GE3 A;  2ZW4 A;  1U6M A;  4QBJ A;  4PSX A;  3FBU A;  4GS4 A;  4JXQ A;  3PP9 A;  4NCZ A;  3SHP A;  4IUS A;  1S7L A;  1YVO A;  3EFA A;  2FXF A;  3I3G A;  4ORF A;  4AG7 A;  4KOT A;  5GCN A;  5H84 A;  4MBU A;  5KTA A;  5KTD A;  1GHE A;  4XPD B;  3W6S A;  2B3U A;  4NEX A;  4YFJ A;  4B5P A;  4MY0 A;  4YGO A;  2EUI A;  3BJ7 A;  4KUA A;  2VXK A;  4CAX A;  2O28 A;  4AVA A;  2QEC A;  3FB3 A;  1XEB A;  4R9M A;  3CXS A; 
#chains in the Genus database with same CATH topology
 2V8G A;  1FT7 A;  4DNC A;  4PXB A;  2EK9 A;  4HNW B;  1CPX A;  2FCK A;  3V38 A;  4P6Y A;  3CT9 A;  1YVK A;  4P4F A;  4YU9 A;  2RB7 A;  4MCP A;  1IIC A;  3R9E A;  4KLW A;  4NGQ A;  4C68 A;  2AFU A;  3FEC A;  4MXU A;  4C2X A;  2AFO A;  2Q04 A;  5HXD A;  1BPN A;  2DEA A;  2V8D A;  3NH8 A;  4JZ0 A;  4ZY1 A;  3D2P A;  3GLJ A;  2CNM A;  4UEZ A;  1CJW A;  4M6H A;  1YW4 A;  2ZPA A;  1KZF A;  3D8P A;  1TKJ A;  4B5O A;  4WWV A;  1YRE A;  1ZLI A;  5CPA A;  2JBK A;  3IGR A;  1Q7L A;  3PB4 X;  4MRI A;  5JPH A;  4DJL A;  5K8P A;  2C6P A;  2PQ8 A;  3QB8 A;  1CG2 A;  1IB1 E;  3B3W A;  3P2H A;  4MHN A;  1ARL A;  3G8W A;  4KOV A;  4NGP A;  4XNH B;  2PJ3 A;  3ZJ0 A;  4YWY A;  1B87 A;  2F5I A;  4CRY B;  1FNO A;  2PC1 A;  1R43 A;  4GXH A;  3NA6 A;  2HB6 A;  3B3T A;  2JEW A;  4HKF A;  2PCU A;  1A2Z A;  1RTQ A;  3BLN A;  3D4U A;  4M6I A;  2BOA A;  2PR1 A;  5ELY A;  4A94 A;  4CYP A;  4F0X A;  4JJX A;  4KZT A;  4CAF A;  2EO8 A;  2B4D A;  1R3N A;  5F49 A;  1ELL P;  4H6U A;  2HV2 A;  1XRY A;  3CXQ A;  1LFW A;  3GB0 A;  1JQG A;  3PEI A;  3R9F A;  1CBX A;  5HMN A;  1S3Z A;  2OZU A;  3N7Z A;  3KZW A;  4F8Z A;  3IIB A;  4Q38 A;  4QB9 A;  4UCP A;  3S6F A;  4B10 A;  4A37 A;  4RN7 A;  1M44 A;  4KOY A;  3TO9 A;  4Z65 A;  3SXN A;  4CS0 B;  1MK4 A;  4X8I A;  3JUW A;  2EBJ A;  1QSM A;  5A28 A;  4ZX9 A;  3N5F A;  5DWN A;  4UEE A;  3TOB A;  4FD4 A;  2Z3O A;  3MN8 A;  2CNS A;  3PGP A;  2YNC C;  2Q7S A;  1HDU A;  1VIX A;  3S9L A;  1YSJ A;  2BL1 A;  3TOA A;  3E0K A;  4B11 A;  1Z4E A;  2Q4Z A;  2VBQ A;  5EMI A;  3SJG A;  3KI9 A;  4A33 A;  4CAE A;  1N71 A;  4UCN A;  3BI0 A;  3S9N A;  1CM0 A;  1QMU A;  2CTC A;  4RS2 A;  4Y49 C;  5IX3 A;  1CP6 A;  2G3A A;  4UIB A;  1IOI A;  2WPW A;  3FED A;  1KUY A;  4KOU A;  4P45 A;  4Q36 A;  5HH1 A;  3IO1 A;  4F0Y A;  4NSQ A;  1VKC A;  2YNE A;  4IAV A;  1DE4 C;  4U9Z A;  5G22 A;  2RC4 A;  4PSW A;  1Y7R A;  4C7I A;  3D68 A;  1ZG9 A;  3W6X A;  3TTH A;  4NGS A;  1Z8T A;  3S6K A;  4H89 A;  2VZZ A;  4H2K A;  2BUE A;  4A32 A;  5F48 A;  1M4I A;  1MJ9 A;  2AFS A;  2PJA A;  4EFD A;  3D3S A;  2HUZ A;  2C1C A;  2GIV A;  3KKW A;  5LYL A;  3WC7 A;  1PU9 A;  3PZJ A;  4ZX8 A;  3R9G A;  4G1P A;  2GLF A;  2P0W A;  4UA3 A;  1M4L A;  5H86 A;  4ZI6 A;  2Z11 A;  2Q51 A;  1VGY A;  1IY7 A;  1I21 A;  3H8G A;  3IC1 A;  1IOF A;  2Q4V A;  2YNC A;  4R8F A;  1KUX A;  1VHS A;  4J3G A;  2OH1 A;  4PXC A;  3RO0 A;  1YR0 A;  3T8W A;  3DLJ A;  4F9U A;  1H8L A;  1Z4R A;  3B2Y A;  5JH9 A;  1LAN A;  3BJ8 A;  1IID A;  2PJ5 A;  3PB8 X;  5LYD A;  2RFH A;  4AB7 A;  1IYL A;  3JVN A;  1ZO0 A;  5AG5 A;  4AG9 A;  5G20 A;  3DDD A;  4XPK A;  2PDO A;  2Z3N A;  1NE9 A;  2Y0M A;  7CPA A;  4UBR A;  2ZW6 A;  1XOV A;  4II9 A;  3TC8 A;  1CPS A;  1KUV A;  1ON0 A;  3FEE A;  4PQA A;  3TCV A;  1LRZ A;  2JDC A;  3SXO A;  3TX8 A;  1WK4 A;  1GYT A;  3PBB A;  3TE4 A;  1NMT A;  3KR4 A;  2YND A;  2ZEE A;  3JTK A;  1XE4 A;  2REE A;  4NF1 A;  4OID A;  1MJA A;  2B3V A;  2G9D A;  2IL4 A;  2ZEG A;  3CPX A;  5IV0 A;  2VEZ A;  1Y0Y A;  4ZBG A;  4A39 A;  4KVM E;  4A2Z A;  3UY5 A;  2ZEF A;  1BAV A;  1TF8 A;  1P0H A;  4B12 A;  3B7I A;  3CDX A;  2BSW A;  2R1I A;  1CX8 A;  3FIX A;  5C88 A;  2DPT A;  1LCP A;  4MCQ A;  4CAW A;  2KCW A;  2BCO A;  4M6G A;  4BD9 A;  1QSN A;  2XEG A;  2AFW A;  4PK3 A;  2QJ8 A;  2Z3M A;  5G21 A;  1Z9U A;  4A95 A;  3CXP A;  3S9M A;  1YLO A;  3R96 A;  2O4H A;  4R6T A;  2PJC A;  4XNH C;  1S7F A;  2B5G A;  4AVB A;  4ZY0 A;  1F2P A;  5DWM A;  5LYI A;  4CYN A;  3TFY A;  4UWJ A;  2D4O A;  3B3S A;  1IGB A;  4PXD A;  2VZY A;  4HNY B;  2R8V A;  2V8V A;  1NSL A;  2PVV A;  1M4D A;  2CF4 A;  2X7B A;  4C7H A;  2ZW7 A;  3GIU A;  2I00 A;  4QUS A;  1XFO A;  3MGD A;  2A4N A;  3IEH A;  3L2N A;  3F8K A;  3IJ3 A;  3P2F A;  3KHZ A;  4ZY2 A;  2PJ6 A;  2ODF A;  4CGN A;  3B3V A;  3V8I A;  4CYO A;  1Y9K A;  5HVF A;  1XIX A;  2DF5 A;  2B4D B;  2Q44 A;  3DR6 A;  3T90 A;  4BMH A;  5JQ4 A;  4NGT A;  4KSA A;  1ZLH A;  4FUU A;  2VI7 A;  2XEI A;  3D67 A;  1M1D A;  2F7V A;  2I3C A;  4P4E A;  5JM6 A;  2PJ1 A;  2REF A;  4FD6 A;  1TXR A;  4R7M A;  4UIA A;  5EC4 A;  4KVX A;  4ZYQ A;  1EE3 P;  3PFO A;  2C6G A;  2QYV A;  4H6Z A;  4KLV A;  2FSR A;  1VHE A;  1I1D A;  4YRH A;  2K5T A;  4NGR A;  2GAN A;  1XF8 A;  2PJ9 A;  4E2A A;  5I4M A;  3I1U A;  4KOX A;  1S5K A;  3LOD A;  3PFE A;  5AG7 A;  5FVJ A;  1OBR A;  4K3N A;  1QSR A;  4B6Z A;  1ARM A;  3IFE A;  2Q0Y A;  2J8N A;  2WPX A;  1ELM P;  4JD6 A;  4MY3 A;  3QAH A;  1WWZ A;  2CY2 A;  2OB0 A;  2AFM A;  2BO9 A;  2FS5 A;  3FRM A;  1YLE A;  2ABZ A;  3GUX A;  4MI4 A;  1AMP A;  3SJE A;  4OP4 A;  4OIW A;  3VAT A;  4A30 A;  1MJB A;  1PCA A;  4P10 A;  4NJR A;  5LRK A;  1LAM A;  3B8G A;  4F9V A;  2ATR A;  2AE6 A;  2PJ0 A;  2EWB A;  5ISV A;  4KOR A;  3H8F A;  2QML A;  2PRQ A;  1YGH A;  5IB0 A;  1R57 A;  2G0B A;  1F57 A;  4OKO A;  3TO6 A;  4UWI A;  2IMO A;  2CTB A;  4L89 A;  1QQ9 A;  4JXR A;  3D7F A;  2FIW A;  2XEJ A;  2Q7B A;  3VWD A;  5BWA B;  4QC6 A;  3HUV A;  3EC4 A;  3K9T A;  3NE8 A;  1Z5R A;  2Z3K A;  1K4J A;  4A31 A;  1PUA A;  1QST A;  1UFH A;  4C2Z A;  3DR8 A;  5G1Z A;  4CGM A;  2PSW A;  3FXT A;  4LQG A;  4QVT A;  2PIY A;  4JWP A;  3H4Q A;  5F46 A;  4UCM A;  4B13 A;  4NXY A;  1XJO A;  2PE3 A;  4FWU A;  4UF4 A;  3D66 A;  4OC1 A;  3VAR A;  1ZG8 A;  2EVN A;  3W91 A;  3WC6 A;  2B58 A;  3BHX A;  4XPD C;  5AG4 A;  4XPL A;  3D7G A;  4BIN A;  2C6C A;  1BLL E;  4PK2 A;  4R76 A;  1SQH A;  2GLJ A;  2V77 A;  3KQX A;  4R3K A;  5AGE A;  3GKR A;  4OAE A;  3A9L A;  3KQZ A;  4MCR A;  4CRZ B;  1HEE A;  1V0C A;  2BEI A;  3FNC A;  4MJ8 A;  1Z8W A;  4ONU A;  4MHY A;  3SJX A;  1RXT A;  1F2O A;  2YGW A;  1YX0 A;  2FT0 A;  3DGV A;  3I9S A;  4KOS A;  4OME A;  4IF5 A;  4X3R A;  4B5P B;  4EWT A;  4Y49 B;  4RUH A;  3V7Z A;  1B6B A;  8CPA A;  3EY5 A;  1L0C A;  4MFP A;  2FE7 A;  2ANP A;  3FYN A;  4GM5 A;  1TIQ A;  2PVW A;  4HNX B;  4CYQ A;  4X2T A;  2HQY A;  1J4J A;  2ZW5 A;  3DSB A;  3F5B A;  2Q4Y A;  5J8F A;  2J8M A;  2AFZ A;  4UFX A;  2JDD A;  4AXV A;  4PV6 A;  2OR4 A;  3PRT A;  2NMT A;  3K9U A;  4OC2 A;  4KVO E;  1S7N A;  3SJF A;  4CGP A;  4CGO A;  1S60 A;  3C26 A;  2IQ6 A;  4R87 A;  2Q43 A;  4ZGY B;  4MFJ A;  2ZEP A;  4NGN A;  3CPA A;  2ZEL A;  3FJU A;  3IWW A;  4KUB A;  2O53 A;  3RNZ A;  4R57 A;  1ZG7 A;  3NH5 A;  2OZG A;  2C27 A;  3RYO A;  2WSA A;  2PIZ A;  1S7K A;  2FL4 A;  3T9Y A;  3TO7 A;  5IB9 A;  1BO4 A;  4IK2 A;  2PJ7 A;  3OWC A;  2PJB A;  1Y9W A;  2B5G B;  4NFR A;  4K30 A;  3EXN A;  4Q7A A;  4P4D A;  1YK3 A;  1Q2C A;  4WJB A;  2WZN A;  5F47 A;  5CNP A;  3PB9 X;  3RBU A;  1BPM A;  1Q2Y A;  4OC5 A;  5HVG A;  1OZP A;  3GY9 A;  1HDQ A;  2GFQ A;  1IYK A;  4FAI A;  1LOK A;  4ONW A;  2CIJ A;  2G3T A;  2XEF A;  3B3C A;  3DNS A;  3RZA A;  4W9Y A;  4FD7 A;  4BBH A;  3KAS A;  4KS9 A;  4MFQ A;  1X10 A;  3GYA A;  2J9A A;  4U5Y A;  3EO4 A;  4LUA A;  4IHM A;  4OLL A;  1Y7E A;  3JRU A;  2AFX A;  5K8M A;  3WAB A;  2JEV A;  2ZED A;  3F0A A;  4NGM A;  2DXQ A;  3ZZI A;  4TWE A;  2AJ6 A;  4FD5 A;  5AG6 A;  4A38 A;  2PR8 A;  3NE7 A;  3QAY A;  5C82 A;  4MHZ A;  4OC0 A;  1NSA A;  3IWE A;  4O23 A;  3D7H A;  5LYF A;  3WR7 A;  2GU2 A;  2VL1 A;  2F8H A;  5LRG A;  3FX6 A;  2I79 A;  2OOT A;  3D2M A;  2P6E A;  1FY7 A;  3SI0 A;  3FMC A;  3PB6 X;  4MHD A;  4MFZ A;  4UFW A;  5K8O A;  4CAV A;  1M4G A;  2P6F A;  2PRB A;  3R95 A;  3H5Z A;  2J8R A;  1VHO A;  1XMT A;  4KSF A;  4OC4 A;  4B14 A;  4L8A A;  2OU2 A;  2POK A;  2QIR A;  3LD2 A;  4RI1 A;  4C2Y A;  1RO5 A;  4UEF A;  2WYR A;  3IU1 A;  2HC9 A;  4MFK A;  2PJ2 A;  4LX9 A;  2JBJ A;  4X5K A;  4JLY A;  5HVH A;  3PBE A;  3KL9 A;  5DS0 A;  1I12 A;  1Q2D A;  2OZH A;  2Z10 A;  4E0A A;  4DYO A;  1DTD A;  3VWE A;  2EK8 A;  3TT2 A;  1Y0R A;  5KTC A;  4CPA A;  5LRJ A;  2ZOG A;  4M3S A;  3MRU A;  3WT4 A;  3S6H A;  2Z3L A;  2Z0Z A;  3H8E A;  4KSI A;  2H5M A;  1CP7 A;  3R1K A;  3D7D A;  2ZXV A;  3FVL A;  5D8N A;  5THW A;  3WC5 A;  3NFZ A;  4P4J A;  2NYQ A;  1YME A;  1IU8 A;  2CXA A;  4I49 A;  4KOW A;  2FVG A;  4CGL A;  3G3S A;  2ARH A;  3IWG A;  1JWQ A;  2P6G A;  4MFL A;  5J8C A;  1UWY A;  2IJZ A;  4MCS A;  2FIA A;  5EBV A;  4EME A;  2D4P A;  4U9Y A;  4EVY A;  4AVC A;  4OAD A;  4F6A A;  3LAC A;  1QSO A;  2PJ8 A;  4OC3 A;  2JLM A;  5A27 A;  5F09 A;  2R98 A;  5E96 A;  3LMS A;  4E8O A;  5CBM A;  4NJQ A;  3B35 A;  3S6G A;  2B4B A;  2VQY A;  4M85 A;  5J1Q A;  3IU2 A;  1Z8X A;  3KHX A;  1P4N A;  2R7H A;  2CNT A;  2GRE A;  4R3L A;  2PJ4 A;  5I0C A;  4PPZ A;  1BOB A;  2GE3 A;  2ZW4 A;  1U6M A;  4DUK A;  4QBJ A;  3VH9 A;  4PSX A;  5K8N A;  3FBU A;  2V8H A;  4MMO A;  1PYT B;  4GS4 A;  4JXQ A;  3PP9 A;  4NCZ A;  3SHP A;  4IUS A;  1S7L A;  4FBE A;  2ZEM A;  3K2K A;  1YVO A;  2ZEN A;  3EFA A;  2FXF A;  3I3G A;  1X12 A;  4ORF A;  4AG7 A;  4KOT A;  1XMB A;  3BI1 A;  2QVP A;  1AYE A;  5GCN A;  1XBU A;  3CZX A;  5H84 A;  3SI1 A;  1YQE A;  4MHP A;  4P44 A;  5D29 A;  3SI2 A;  4MBU A;  5KTA A;  3HLP A;  4JYW A;  5JGF A;  1GHE A;  4XPD B;  3W6S A;  1TKH A;  5KTD A;  1LAP A;  2NSM A;  2B3U A;  3KGQ A;  4TNU A;  1Z8L A;  2ZEH A;  4P4B A;  4NEX A;  4YFJ A;  3ISZ A;  4B5P A;  2ZEO A;  2ZOF A;  3KR5 A;  4MY0 A;  1AUG A;  4YGO A;  3RAM A;  2EUI A;  3BJ7 A;  4HPS A;  2DPS A;  3FH4 A;  2VXK A;  3NH4 A;  3QNV A;  2O28 A;  1YW6 A;  4KUA A;  4P4I A;  4UFV A;  4AVA A;  4CAX A;  4LQ6 A;  2QEC A;  6CPA A;  3PB7 X;  3FF3 A;  3FB3 A;  1Z2L A;  2Z3P A;  3ISX A;  4PXE A;  1XEB A;  1KWM A;  4R9M A;  2WUU A;  3CXS A;  1TF9 A;  3BXM A;  3LWU A;  1TKF A; 
#chains in the Genus database with same CATH homology
 4DNC A;  4HNW B;  2FCK A;  1YVK A;  3R9E A;  1IIC A;  4KLW A;  4C68 A;  4C2X A;  2Q04 A;  3D2P A;  2CNM A;  1CJW A;  3D8P A;  2ZPA A;  1KZF A;  4B5O A;  1YRE A;  3IGR A;  5JPH A;  2PQ8 A;  3QB8 A;  1IB1 E;  3P2H A;  3G8W A;  4KOV A;  4XNH B;  3ZJ0 A;  1B87 A;  2F5I A;  4CRY B;  2PC1 A;  4HKF A;  3BLN A;  2PR1 A;  4CYP A;  4F0X A;  4JJX A;  4KZT A;  4CAF A;  5F49 A;  2B4D A;  4H6U A;  2HV2 A;  3CXQ A;  3R9F A;  5HMN A;  1S3Z A;  2OZU A;  3N7Z A;  4Q38 A;  4QB9 A;  4UCP A;  3S6F A;  4B10 A;  1M44 A;  4KOY A;  3TO9 A;  3SXN A;  4CS0 B;  1MK4 A;  3JUW A;  1QSM A;  5A28 A;  5DWN A;  3TOB A;  4FD4 A;  2Z3O A;  2CNS A;  3PGP A;  2YNC C;  2BL1 A;  3TOA A;  3E0K A;  4B11 A;  1Z4E A;  2VBQ A;  4A33 A;  4CAE A;  1N71 A;  4UCN A;  1CM0 A;  4Y49 C;  4RS2 A;  5IX3 A;  2G3A A;  4F0Y A;  2WPW A;  4KOU A;  1KUY A;  4Q36 A;  5HH1 A;  4NSQ A;  1VKC A;  2YNE A;  4U9Z A;  5G22 A;  2RC4 A;  4PSW A;  1Y7R A;  4C7I A;  3W6X A;  3TTH A;  3S6K A;  4H89 A;  2VZZ A;  4A32 A;  2BUE A;  5F48 A;  1M4I A;  1MJ9 A;  3D3S A;  2HUZ A;  2GIV A;  3KKW A;  1PU9 A;  3PZJ A;  3R9G A;  2P0W A;  4UA3 A;  5H86 A;  2Z11 A;  1I21 A;  2Q4V A;  2YNC A;  1KUX A;  1VHS A;  4J3G A;  2OH1 A;  1YR0 A;  1Z4R A;  3BJ8 A;  1IID A;  4AB7 A;  1IYL A;  3JVN A;  1ZO0 A;  5AG5 A;  4AG9 A;  5G20 A;  3DDD A;  4XPK A;  2PDO A;  2Z3N A;  1NE9 A;  2Y0M A;  4UBR A;  2ZW6 A;  4II9 A;  1KUV A;  1ON0 A;  3TCV A;  1LRZ A;  2JDC A;  3SXO A;  1WK4 A;  3TE4 A;  1NMT A;  2YND A;  3JTK A;  1XE4 A;  2REE A;  4NF1 A;  1MJA A;  2B3V A;  2IL4 A;  5IV0 A;  2VEZ A;  4ZBG A;  4KVM E;  4A2Z A;  3UY5 A;  1P0H A;  4B12 A;  2BSW A;  2R1I A;  3FIX A;  5C88 A;  2DPT A;  4CAW A;  2KCW A;  1QSN A;  4PK3 A;  2Z3M A;  5G21 A;  1Z9U A;  4A95 A;  3CXP A;  3R96 A;  4XNH C;  1S7F A;  2B5G A;  4AVB A;  5DWM A;  4CYN A;  3TFY A;  4UWJ A;  2D4O A;  2VZY A;  4HNY B;  2R8V A;  1NSL A;  1M4D A;  2X7B A;  4C7H A;  2ZW7 A;  2I00 A;  4QUS A;  3MGD A;  2A4N A;  3F8K A;  3P2F A;  4CGN A;  3V8I A;  4CYO A;  1Y9K A;  1XIX A;  2Q44 A;  2B4D B;  3DR6 A;  3T90 A;  4BMH A;  5JQ4 A;  4KSA A;  2VI7 A;  1M1D A;  2REF A;  4FD6 A;  5EC4 A;  4KVX A;  4YRH A;  4H6Z A;  4KLV A;  2FSR A;  1I1D A;  2K5T A;  2GAN A;  1XF8 A;  4E2A A;  4KOX A;  1S5K A;  3LOD A;  5AG7 A;  5FVJ A;  1QSR A;  2Q0Y A;  2J8N A;  2WPX A;  4JD6 A;  4MY3 A;  3QAH A;  1WWZ A;  2CY2 A;  2OB0 A;  2FS5 A;  3FRM A;  4MI4 A;  1YLE A;  4A30 A;  1MJB A;  3B8G A;  2ATR A;  2AE6 A;  5ISV A;  4KOR A;  2QML A;  1YGH A;  5IB0 A;  1R57 A;  2G0B A;  3TO6 A;  4UWI A;  4L89 A;  4JXR A;  2FIW A;  2Q7B A;  3VWD A;  5BWA B;  4QC6 A;  3EC4 A;  4A31 A;  2Z3K A;  1K4J A;  1PUA A;  1QST A;  1UFH A;  4C2Z A;  3DR8 A;  5G1Z A;  4CGM A;  2PSW A;  3FXT A;  4QVT A;  5F46 A;  4JWP A;  3H4Q A;  4UCM A;  4B13 A;  4NXY A;  2EVN A;  3W91 A;  2B58 A;  4XPD C;  5AG4 A;  4XPL A;  4PK2 A;  1SQH A;  4R3K A;  5AGE A;  3GKR A;  4OAE A;  3A9L A;  4CRZ B;  1V0C A;  2BEI A;  3FNC A;  4MJ8 A;  4ONU A;  1RXT A;  2YGW A;  4KOS A;  1YX0 A;  2FT0 A;  3I9S A;  4B5P B;  4IF5 A;  4Y49 B;  1B6B A;  3EY5 A;  1L0C A;  4MFP A;  2FE7 A;  3FYN A;  1TIQ A;  4HNX B;  4CYQ A;  2HQY A;  1J4J A;  2ZW5 A;  3DSB A;  3F5B A;  2Q4Y A;  5J8F A;  2J8M A;  4UFX A;  2JDD A;  4PV6 A;  2NMT A;  3K9U A;  4CGO A;  4KVO E;  1S7N A;  4CGP A;  1S60 A;  3C26 A;  4R87 A;  4ZGY B;  4MFJ A;  4KUB A;  4R57 A;  2OZG A;  2C27 A;  3RYO A;  2WSA A;  1S7K A;  2FL4 A;  3T9Y A;  3TO7 A;  1BO4 A;  3OWC A;  1Y9W A;  2B5G B;  4K30 A;  3EXN A;  1YK3 A;  1Q2C A;  5F47 A;  5CNP A;  1Q2Y A;  1OZP A;  3GY9 A;  1IYK A;  2G3T A;  3DNS A;  4FD7 A;  4BBH A;  4KS9 A;  4MFQ A;  3GYA A;  4U5Y A;  3EO4 A;  4LUA A;  4OLL A;  2JEV A;  3ZZI A;  3F0A A;  2DXQ A;  2AJ6 A;  4FD5 A;  5AG6 A;  2PR8 A;  3NE7 A;  5C82 A;  3IWE A;  3WR7 A;  2I79 A;  3D2M A;  2P6E A;  1FY7 A;  4MHD A;  4MFZ A;  4UFW A;  4CAV A;  1M4G A;  2P6F A;  2PRB A;  3R95 A;  3H5Z A;  2J8R A;  1XMT A;  4KSF A;  4B14 A;  4L8A A;  2OU2 A;  2QIR A;  3LD2 A;  4RI1 A;  4C2Y A;  1RO5 A;  3IU1 A;  4MFK A;  4LX9 A;  4X5K A;  4JLY A;  1I12 A;  1Q2D A;  2OZH A;  2Z10 A;  4E0A A;  3VWE A;  3TT2 A;  5KTC A;  4M3S A;  3S6H A;  2Z3L A;  2Z0Z A;  2H5M A;  3R1K A;  2ZXV A;  2CXA A;  4I49 A;  4KOW A;  4CGL A;  3G3S A;  2ARH A;  3IWG A;  2P6G A;  4MFL A;  5J8C A;  5EBV A;  2FIA A;  2D4P A;  4U9Y A;  4EVY A;  4AVC A;  4OAD A;  4F6A A;  1QSO A;  5A27 A;  2JLM A;  2R98 A;  5E96 A;  4E8O A;  3S6G A;  2B4B A;  2VQY A;  4M85 A;  3IU2 A;  1P4N A;  2R7H A;  2CNT A;  4R3L A;  5I0C A;  1BOB A;  2GE3 A;  2ZW4 A;  1U6M A;  4QBJ A;  4PSX A;  3FBU A;  4GS4 A;  4JXQ A;  3PP9 A;  4NCZ A;  3SHP A;  4IUS A;  1S7L A;  1YVO A;  3EFA A;  2FXF A;  3I3G A;  4ORF A;  4AG7 A;  4KOT A;  5GCN A;  5H84 A;  4MBU A;  5KTA A;  5KTD A;  1GHE A;  4XPD B;  3W6S A;  2B3U A;  4NEX A;  4YFJ A;  4B5P A;  4MY0 A;  4YGO A;  2EUI A;  3BJ7 A;  2DPS A;  4KUA A;  2VXK A;  4CAX A;  2O28 A;  4UFV A;  4AVA A;  2QEC A;  3FB3 A;  2Z3P A;  1XEB A;  4R9M A;  2WUU A;  3CXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...