4OAEA

Crystal structure of a gnat superfamily acetyltransferase pa4794 c29a/c117a/y128a mutant in complex with chloramphenicol
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
160
structure length
160
Chain Sequence
HMQLSHRPAETGDLETVAGFPQDRDELFYAYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISAFNANAAGLLLATQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GNAT superfamily acetyltransferase PA4794
publication title Crystal structure of a GNAT superfamily acetyltransferase PA4794 C29A/C117A/Y128A mutant in complex with chloramphenicol
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 43
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2014-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4oaeA00
3D2PA 2BUEA 5F49A 4R3LA 1XE4A 4B5OA 4PK3A 4R3KA 5EC4A 4XNHC 2QMLA 2EUIA 3NE7A 4XPDC 4DNCA 2ARHA 1Y9KA 3JUWA 2AJ6A 5GCNA 3TCVA 2HV2A 2VQYA 1Q2YA 2FSRA 2JLMA 1OZPA 4EVYA 4KOVA 2CNMA 4L8AA 5FVJA 4AVAA 5E96A 2Z10A 2EVNA 1NMTA 4RI1A 3FB3A 3KKWA 1XIXA 1NSLA 4CAWA 5IB0A 4R9MA 5ISVA 5F47A 2Q4YA 1B6BA 3EXNA 4HNYB 1ON0A 4QBJA 3G8WA 1WK4A 4KZTA 1M4IA 4F0YA 3DR8A 1QSRA 2WPXA 3EC4A 2VZZA 4MI4A 4NF1A 3TT2A 1RXTA 2Y0MA 2JDCA 5DWNA 2D4OA 2P0WA 1QSOA 4KOWA 2DXQA 4I49A 1I21A 3SXOA 3I9SA 4KLWA 4X5KA 1IYLA 3S6GA 2JEVA 1YREA 2Z11A 4B5PB 4PV6A 2GIVA 1GHEA 5KTDA 1VKCA 4HNXB 2Z0ZA 3G3SA 4NEXA 3W6XA 4CRZB 2ZPAA 2B3UA 3RYOA 3TO7A 4LUAA 3TOBA 2B4BA 4XPLA 2WPWA 2J8NA 3MGDA 3B8GA 4KOTA 2CY2A 4FD5A 5H84A 1S3ZA 3SHPA 5IX3A 3CXQA 2PR1A 2FT0A 4KOSA 2FIAA 4KLVA 3DSBA 1QSNA 2G0BA 1S7NA 3F8KA 4MHDA 4U9YA 1KUYA 1PU9A 5F48A 4FD6A 1Y7RA 1IB1E 1MJBA 1PUAA 4PSXA 1Y9WA 1Z4RA 5EBVA 3P2FA 4ZBGA 3FIXA 2J8MA 4OADA 2FE7A 2PQ8A 2FS5A 3QB8A 3C26A 2VBQA 1YX0A 4IF5A 2REEA 1V0CA 2VI7A 3D2MA 2VEZA 1R57A 5H86A 4NSQA 2D4PA 3W91A 4F6AA 2OU2A 4YGOA 1QSTA 2FL4A 1IYKA 3V8IA 2PRBA 3FRMA 3IGRA 3TOAA 5C88A 4FD7A 2PR8A 4ONUA 3ZZIA 3UY5A 3DDDA 2Q7BA 3R9GA 1K4JA 2F5IA 4KOYA 3I3GA 3VWEA 2FXFA 1S7FA 4CAVA 2QECA 4YFJA 4E0AA 2FIWA 2J8RA 1U6MA 3R9EA 3P2HA 5IV0A 4XNHB 2GE3A 4CAXA 4XPDB 1N71A 1QSMA 2Q44A 3TE4A 3TTHA 2HQYA 1UFHA 4B5PA 2R98A 2CNSA 2OH1A 4FD4A 2G3TA 4UWJA 3W6SA 2KCWA 4E8OA 4AVBA 2B5GA 1KZFA 4KUBA 3S6HA 1SQHA 1B87A 3K9UA 1M44A 2RC4A 4MY3A 4QC6A 2OB0A 2B5GB 1YK3A 1I12A 1YLEA 3LODA 3CXPA 5I0CA 4OLLA 1KUXA 3OWCA 3TO6A 4AB7A 3DR6A 4MY0A 4L89A 3VWDA 1J4JA 3BLNA 4RS2A 3BJ8A 5KTAA 4JWPA 2HUZA 3PZJA 4KOXA 4JJXA 3N7ZA 1M4DA 1S7KA 4PSWA 3IWGA 2O28A 3FBUA 2I79A 4XPKA 3FXTA 4BMHA 2Q4VA 4UWIA 3EO4A 4UA3A 4MJ8A 4H89A 1XF8A 3T9YA 4AG7A 2BSWA 2OZHA 2P6GA 5KTCA 3PGPA 3JVNA 4H6ZA 4UBRA 1Z4EA 5J8CA 4U9ZA 4AVCA 1P4NA 1S60A 3R9FA 1NE9A 2K5TA 3R96A 4YRHA 2QIRA 2Q0YA 2B58A 3GYAA 5HH1A 4LX9A 3WR7A 1L0CA 4Y49B 2PSWA 4H6UA 1FY7A 1Z9UA 3FYNA 4KVOE 2H5MA 3F5BA 1MJAA 3TO9A 1S7LA 1YVOA 2R1IA 3TFYA 3CXSA 2P6EA 4JD6A 3F0AA 2IL4A 2VZYA 2REFA 2ZW6A 3LD2A 3PP9A 5C82A 1CM0A 4JXRA 4QB9A 2G3AA 2Q04A 4KUAA 4M85A 2FCKA 1P0HA 1Q2DA 5JPHA 1MJ9A 4JLYA 2OZGA 1IICA 2BEIA 2NMTA 4J3GA 4HKFA 2C27A 4KVXA 1XEBA 3E0KA 3BJ7A 2B3VA 4KVME 1BOBA 3H4QA 3T90A 3R95A 1MK4A 4HNWB 4PK2A 1LRZA 4M3SA 2PDOA 1YVKA 2R8VA 2R7HA 1M1DA 1RO5A 4U5YA 2ZW4A 3ZJ0A 3QAHA 5JQ4A 1VHSA 1WWZA 3DNSA 2VXKA 1IIDA 4NCZA 4IUSA 4II9A 2X7BA 4QVTA 5DWMA 3GKRA 4JXQA 3D3SA 3EFAA 4NXYA 4KORA 1S5KA 2B4DA 1M4GA 2BL1A 2ZXVA 3FNCA 1KUVA 1Q2CA 1YGHA 2ZW5A 4KOUA 4OAEA 2B4DB 2JDDA 2OZUA 1BO4A 3EY5A 1I1DA 5J8FA 5HMNA 3S6FA 4MBUA 4E2AA 4GS4A 1TIQA 4Y49C 2GANA 2ZW7A 4CRYB 5CNPA 2ATRA 2PC1A 2CNTA 2A4NA 4K30A 1YR0A 3R1KA 4AG9A 4CS0B 3D8PA 3GY9A 4QUSA 1XMTA 1CJWA 4R57A 2P6FA 3S6KA 2AE6A 3SXNA 2I00A 4ORFA 4R87A 5F46A
chains in the Genus database with same CATH superfamily
1LAMA 4B13A 4A39A 4PPZA 3D2PA 5D29A 5AG4A 5LRJA 2BUEA 3IWEA 5F49A 2QJ8A 4R3LA 3IC1A 4PXBA 1YMEA 1XE4A 5HVFA 2GFQA 1TF8A 4B5OA 4ZYQA 4PK3A 4R3KA 5EC4A 4C7IA 1ARLA 4FWUA 4B12A 4XNHC 2PIYA 2QMLA 4MHZA 1GYTA 2EUIA 2JBJA 4NGNA 3NE7A 2RB7A 4XPDC 4DNCA 3GB0A 2ARHA 2AFOA 1Y9KA 3JUWA 2AJ6A 5GCNA 2AFWA 1XMBA 3TCVA 2HV2A 3PB7X 2VQYA 1Q2YA 1ZG8A 4IK2A 2FSRA 4ZY2A 2PVVA 2JLMA 3D7DA 2PE3A 3NH5A 1A2ZA 4NGRA 1OZPA 1QMUA 4P10A 2ZENA 2Q43A 4EVYA 3FVLA 2BO9A 4LQ6A 2RFHA 4P44A 2XEFA 4DUKA 4ZY0A 4GXHA 3B3VA 3KR5A 4KOVA 2CNMA 2PJ5A 3DGVA 3PFEA 4L8AA 5FVJA 4KSIA 4AVAA 4YU9A 2WYRA 5E96A 2Z10A 3JRUA 2EVNA 4PQAA 4Q7AA 1XRYA 1ZLHA 4EMEA 1IU8A 2WUUA 1NMTA 3IWWA 5I4MA 3N5FA 4RI1A 1Y7EA 3FB3A 4PXDA 1Z8LA 3KKWA 1QQ9A 1XIXA 1NSLA 4CAWA 5IB0A 4R9MA 1YLOA 3B3CA 5F47A 3I1UA 5ISVA 3S9NA 1IOFA 4F9UA 2V8HA 2Q4YA 1B6BA 3EXNA 5LRKA 4HNYB 4UFWA 1Y0YA 1ON0A 4QBJA 5JH9A 3CPXA 1WK4A 3G8WA 1M4IA 4KZTA 4F0YA 3DR8A 1QSRA 4CGOA 2CIJA 2WPXA 3EC4A 2VZZA 3FJUA 4MI4A 4NF1A 3TT2A 1RXTA 2Y0MA 2JDCA 5DWNA 1CBXA 3S9MA 2D4OA 2P0WA 2GREA 1QSOA 4KOWA 4R7MA 2V77A 2DXQA 3IO1A 4I49A 2NSMA 3GIUA 1I21A 4M6IA 3SXOA 3I9SA 4IAVA 4KLWA 2BCOA 3H5ZA 4X5KA 4B6ZA 3CT9A 1IYLA 4B11A 3S6GA 2XEGA 2JEVA 2V8GA 4C2XA 1YREA 4UFXA 1DTDA 2Z11A 4B5PB 4R6TA 4UIAA 3IFEA 4PV6A 2GIVA 1GHEA 5KTDA 4MFQA 1VKCA 4HNXB 4DYOA 2Z0ZA 3G3SA 4TNUA 4NEXA 2EK8A 3W6XA 4CRZB 4CGMA 3MRUA 1UWYA 2ZPAA 3BI1A 4M6HA 2B3UA 5LYLA 3RYOA 1ELLP 3TO7A 4LUAA 3TOBA 2B4BA 4XPLA 4FAIA 2WPWA 2J8NA 3B8GA 3MGDA 2CY2A 4KOTA 1HDUA 4FD5A 1IOIA 5H84A 4A30A 2QYVA 4F8ZA 1S3ZA 3SHPA 4MCPA 2CTCA 2PCUA 3JTKA 3CXQA 4OIDA 5IX3A 2PR1A 5K8NA 4P4IA 2FT0A 4UCPA 1TXRA 3H8GA 4CYNA 3BI0A 4KOSA 2FIAA 4KLVA 2PIZA 3DSBA 1QSNA 2PJAA 2G0BA 5LYDA 4X2TA 3NH4A 1S7NA 3F8KA 4MHDA 3IU1A 4U9YA 4X3RA 1XBUA 4MHNA 1KUYA 1PU9A 2ABZA 2C6CA 3CPAA 4UCNA 1ZLIA 5F48A 4FD6A 1Y7RA 3B7IA 4OP4A 5K8PA 1IB1E 2XEIA 3PEIA 1CPSA 1MJBA 3S9LA 1PUAA 4PSXA 1CP6A 1Y9WA 1Z4RA 5EBVA 1M4LA 4RUHA 3P2FA 2Z3MA 4MFKA 2G9DA 2F8HA 2YNCC 1IY7A 4ZBGA 3FIXA 2J8MA 3KHXA 3QAYA 4OADA 2Q51A 2AFZA 4WWVA 1YW4A 2FE7A 3FMCA 2PQ8A 4ONWA 4PXCA 2FS5A 3QB8A 3C26A 3RNZA 4P4FA 5IB9A 1LCPA 3PB4X 2VBQA 1YW6A 1LFWA 3ISXA 1YX0A 3PB9X 4IF5A 2REEA 1V0CA 2VI7A 3D2MA 2VEZA 1R57A 4CGNA 1JWQA 3KZWA 2GLFA 2C6GA 1X10A 5H86A 4NSQA 2D4PA 1IGBA 1VHOA 4MCQA 3W91A 1JQGA 4NGSA 1BPNA 4F6AA 1TKHA 4UEEA 1CP7A 3ISZA 1ZO0A 2OU2A 4YGOA 1QSTA 3VATA 4CYPA 4A32A 2FL4A 2PJ4A 5AG7A 1IYKA 1ZG9A 5THWA 3V8IA 4UIBA 2ZEPA 2PRBA 3FRMA 3IGRA 5EMIA 2ZEHA 2PJCA 2Z3OA 1Z8WA 4NJQA 4OC3A 3TOAA 2ZEOA 2PJ2A 3L2NA 5C88A 4FD7A 4CYQA 2PR8A 4ONUA 3BHXA 3SI0A 3UY5A 3ZZIA 3DDDA 2Q7BA 3R9GA 1BPMA 1K4JA 2F5IA 2PJ0A 4KOYA 5DS0A 3D4UA 3I3GA 4ZI6A 4MHPA 3VWEA 1CG2A 3VH9A 1HEEA 2Q4ZA 3SJGA 3PFOA 2FXFA 2V8VA 1S7FA 4P4BA 4CAVA 5K8MA 2QECA 4YWYA 4YFJA 2EBJA 2V8DA 4JZ0A 3KL9A 4E0AA 2FIWA 2J8RA 1U6MA 3R9EA 3P2HA 5IV0A 3FX6A 4H2KA 1Z8XA 4HPSA 4OC4A 4XNHB 2GE3A 3SJFA 3B3SA 4C68A 4CAXA 3K2KA 3H8EA 4A2ZA 2F7VA 4XPDB 1Q7LA 2WSAA 1AMPA 3PB8X 1N71A 1QSMA 2Q44A 3TE4A 3TTHA 2HQYA 1OBRA 1UFHA 4MXUA 5CPAA 2CXAA 4KSAA 4A31A 4CAEA 4B5PA 2DF5A 2R98A 2CNSA 1F2PA 3RAMA 2OH1A 3PB6X 4FD4A 2G3TA 3QNVA 3KQXA 4UWJA 3W6SA 2KCWA 4E8OA 4AVBA 2OOTA 1BLLE 2B5GA 4A94A 1KZFA 4WJBA 1BAVA 1H8LA 2POKA 1SQHA 4KUBA 3S6HA 1B87A 2OR4A 3K9UA 4OC0A 1M44A 5BWAB 2RC4A 1XOVA 4ZGYB 4MY3A 4QC6A 2OB0A 3D68A 4OIWA 3T8WA 2B5GB 3DLJA 3BXMA 1CX8A 1I12A 1YK3A 1YLEA 3LODA 3CXPA 5I0CA 2DEAA 3WT4A 4OLLA 1KUXA 1R3NA 1AYEA 3OWCA 3TO6A 4AB7A 1FT7A 3V7ZA 1Z2LA 2DPTA 3DR6A 1ZG7A 2WZNA 4MY0A 1TF9A 4C2ZA 4L89A 3IEHA 3VWDA 1J4JA 4OC1A 2IJZA 3BLNA 1Z8TA 2BOAA 4RS2A 3VARA 1AUGA 3D7HA 3BJ8A 3CZXA 5G1ZA 5KTAA 4JWPA 2YNEA 2HB6A 2HUZA 3PZJA 5AG6A 4OC2A 3FH4A 3RO0A 3FECA 4CYOA 1Z5RA 4KOXA 4JJXA 3PBBA 1LOKA 3N7ZA 1M4DA 1F57A 1S7KA 4PSWA 3LMSA 2EWBA 3IWGA 4NJRA 2O28A 2AFSA 3FBUA 4JYWA 2J9AA 2I79A 4XPKA 3FXTA 4W9YA 1XJOA 3IIBA 4NGPA 4BMHA 5ELYA 4PXEA 1XFOA 4MFZA 4M6GA 2Q4VA 4UWIA 3LACA 5AG5A 3EO4A 4MHYA 4NGTA 2YGWA 4MJ8A 4H89A 4UA3A 2PRQA 1XF8A 4AXVA 3D7GA 4EFDA 4K3NA 3WC6A 3RZAA 2ZOFA 3NH8A 3T9YA 2CTBA 5G21A 4AG7A 2BSWA 5CBMA 2OZHA 1RTQA 2VL1A 2P6GA 3KQZA 3TX8A 4F9VA 5KTCA 2PJ3A 3JVNA 3PGPA 4H6ZA 4UBRA 1Z4EA 5J8CA 1PYTB 1X12A 3FEDA 1P4NA 3HLPA 4U9ZA 1S60A 4R8FA 4AVCA 3R9FA 1NE9A 2K5TA 2ZEEA 2PJ1A 3R96A 5A28A 4P4EA 4YRHA 1EE3P 3FF3A 2QIRA 2Q0YA 4CPAA 2B58A 2XEJA 3GYAA 3B35A 4LX9A 5HH1A 4A38A 3WR7A 4BD9A 1L0CA 2IQ6A 4F0XA 1LAPA 4Y49B 1ARMA 4B10A 2PSWA 4H6UA 1FY7A 1Z9UA 4MFPA 3FYNA 3PBEA 4NGMA 2PJ6A 4KVOE 2H5MA 3F5BA 5LYIA 1MJAA 3TO9A 1S7LA 1YVOA 2R1IA 3KR4A 4A37A 4Z65A 2I3CA 4TWEA 5JM6A 3TFYA 1DE4C 3B3WA 3CXSA 2P6EA 2EO8A 4JD6A 3F0AA 4FBEA 3NFZA 2IL4A 2VZYA 4CGLA 5HVGA 2AFUA 2FVGA 1CPXA 2REFA 3PRTA 3B3TA 2ZW6A 3LD2A 4P45A 3PP9A 5C82A 2YNCA 1CM0A 3B2YA 6CPAA 2CF4A 2YNDA 2JEWA 1LANA 4JXRA 4QB9A 4Q36A 4IHMA 2PJ7A 2G3AA 1VIXA 4UEZA 2ZEDA 2Q04A 4KUAA 4M85A 5LRGA 1YSJA 4R76A 4FUUA 4B14A 2FCKA 2GLJA 1P0HA 2ZEGA 2QVPA 2Z3LA 4BINA 3KI9A 1Q2DA 5JPHA 1MJ9A 4JLYA 4UEFA 2HC9A 4RN7A 8CPAA 2OZGA 1IICA 4UFVA 4O23A 2BEIA 3LWUA 4KSFA 1TKFA 4EWTA 4C2YA 4G1PA 5D8NA 2NMTA 2ZELA 4J3GA 2C6PA 3KHZA 2C27A 4HKFA 4KVXA 2GU2A 3TC8A 3WC7A 7CPAA 1ELMP 3RBUA 4P4DA 1XEBA 3E0KA 2O53A 3BJ7A 3CDXA 5K8OA 1F2OA 2B3VA 4KVME 1BOBA 3H4QA 5HVHA 3KASA 3T90A 3R95A 1FNOA 1MK4A 4KS9A 4HNWB 4DJLA 4PK2A 1LRZA 4M3SA 2PDOA 3NE8A 1YVKA 3IU2A 4UCMA 4ZX9A 2R8VA 2R7HA 1M1DA 1RO5A 2AFXA 4U5YA 4ZY1A 5JGFA 3WC5A 4A95A 2ZW4A 2ZEFA 3ZJ0A 3QAHA 3SI1A 1VHSA 4C7HA 5JQ4A 1WWZA 2ANPA 2PJBA 1KWMA 3DNSA 5J1QA 3H8FA 2VXKA 1IIDA 4NCZA 4IUSA 2NYQA 4OC5A 4II9A 2X7BA 4BBHA 4QVTA 5DWMA 1R43A 3GKRA 4P4JA 2PJ9A 3SI2A 1Y0RA 3D3SA 4JXQA 3GUXA 4CAFA 3EFAA 4NXYA 3D66A 2PVWA 2ODFA 3KGQA 4KORA 1S5KA 1VGYA 3HUVA 1VHEA 2Z3KA 4MCSA 2B4DA 2AFMA 3WABA 4LQGA 1M4GA 3IJ3A 2BL1A 2JBKA 2ZXVA 3FNCA 4MCRA 1KUVA 1Q2CA 1YGHA 2ZOGA 2ZW5A 4KOUA 4OAEA 2PJ8A 4X8IA 2DPSA 1HDQA 3NA6A 2B4DB 2JDDA 2OZUA 4P6YA 1BO4A 3K9TA 3SJEA 4NFRA 3EY5A 4MMOA 5F09A 1I1DA 3A9LA 5HMNA 3S6FA 4MBUA 2C1CA 4E2AA 5J8FA 4GS4A 1TIQA 4NGQA 4Y49C 4CGPA 2EK9A 3MN8A 2GANA 3D7FA 3D67A 3GLJA 5HXDA 1TKJA 2Z3PA 2ZW7A 4ZX8A 4CRYB 4UF4A 5CNPA 2Q7SA 2ATRA 2ZEMA 4Q38A 5G20A 1PCAA 3FEEA 4MFJA 2PC1A 2CNTA 2A4NA 5A27A 4K30A 3SJXA 1YR0A 3R1KA 4A33A 4AG9A 4CS0B 3D8PA 2O4HA 3GY9A 4QUSA 1XMTA 1CJWA 4OMEA 4R57A 1YQEA 2P6FA 4OKOA 2IMOA 5AGEA 5G22A 3S6KA 2Z3NA 2AE6A 3SXNA 1NSAA 2I00A 5LYFA 4ORFA 4R87A 5F46A 4MFLA 3V38A 4MRIA 4GM5A
chains in the Genus database with same CATH topology
4B13A 5AG4A 3D2PA 2BUEA 3IWEA 5F49A 4R3LA 1XE4A 4B5OA 4PK3A 4R3KA 5EC4A 4C7IA 4B12A 4XNHC 2QMLA 2EUIA 3NE7A 4XPDC 4DNCA 2ARHA 1Y9KA 3JUWA 2AJ6A 5GCNA 3TCVA 2HV2A 2VQYA 1Q2YA 2FSRA 2JLMA 1OZPA 4EVYA 4KOVA 2CNMA 4L8AA 5FVJA 4AVAA 5E96A 2Z10A 2EVNA 2WUUA 1NMTA 4RI1A 3FB3A 3KKWA 1XIXA 1NSLA 4CAWA 5IB0A 4R9MA 5ISVA 5F47A 2Q4YA 1B6BA 3EXNA 4HNYB 4UFWA 1ON0A 4QBJA 3G8WA 1WK4A 4KZTA 1M4IA 4F0YA 3DR8A 1QSRA 4CGOA 2WPXA 3EC4A 2VZZA 4MI4A 4NF1A 3TT2A 1RXTA 2Y0MA 2JDCA 5DWNA 2D4OA 2P0WA 1QSOA 4KOWA 2DXQA 4I49A 1I21A 3SXOA 3I9SA 4KLWA 3H5ZA 4X5KA 1IYLA 4B11A 3S6GA 2JEVA 4C2XA 1YREA 4UFXA 2Z11A 4B5PB 4PV6A 2GIVA 1GHEA 5KTDA 4MFQA 1VKCA 4HNXB 2Z0ZA 3G3SA 4NEXA 3W6XA 4CRZB 4CGMA 2ZPAA 2B3UA 3RYOA 3TO7A 4LUAA 3TOBA 2B4BA 4XPLA 2WPWA 2J8NA 3MGDA 3B8GA 2CY2A 4KOTA 4FD5A 5H84A 4A30A 1S3ZA 3SHPA 3JTKA 3CXQA 5IX3A 2PR1A 2FT0A 4UCPA 4CYNA 4KOSA 2FIAA 4KLVA 3DSBA 1QSNA 2G0BA 1S7NA 3F8KA 4MHDA 3IU1A 4U9YA 1KUYA 1PU9A 4UCNA 5F48A 4FD6A 1Y7RA 1IB1E 1MJBA 1PUAA 4PSXA 1Y9WA 1Z4RA 5EBVA 3P2FA 2Z3MA 4MFKA 2YNCC 4ZBGA 3FIXA 2J8MA 4OADA 2FE7A 2PQ8A 2FS5A 3QB8A 3C26A 2VBQA 1YX0A 4IF5A 2REEA 1V0CA 2VI7A 3D2MA 2VEZA 1R57A 4CGNA 5H86A 4NSQA 2D4PA 3W91A 4F6AA 1ZO0A 2OU2A 4YGOA 1QSTA 4CYPA 4A32A 2FL4A 5AG7A 1IYKA 3V8IA 2PRBA 3FRMA 3IGRA 2Z3OA 3TOAA 5C88A 4FD7A 4CYQA 2PR8A 4ONUA 3ZZIA 3UY5A 3DDDA 2Q7BA 3R9GA 1K4JA 2F5IA 4KOYA 3I3GA 3VWEA 2FXFA 1S7FA 4CAVA 2QECA 4YFJA 4E0AA 2FIWA 2J8RA 1U6MA 3R9EA 3P2HA 5IV0A 4XNHB 2GE3A 4C68A 4CAXA 4A2ZA 4XPDB 2WSAA 1N71A 1QSMA 2Q44A 3TE4A 3TTHA 2HQYA 4CAEA 1UFHA 2CXAA 4KSAA 4A31A 4B5PA 2R98A 2CNSA 2OH1A 4FD4A 2G3TA 4UWJA 3W6SA 2KCWA 4E8OA 4AVBA 2B5GA 1KZFA 4KUBA 3S6HA 1SQHA 1B87A 3K9UA 1M44A 5BWAB 2RC4A 4ZGYB 4MY3A 4QC6A 2OB0A 2B5GB 1YK3A 1I12A 1YLEA 3LODA 3CXPA 5I0CA 4OLLA 1KUXA 3OWCA 3TO6A 4AB7A 2DPTA 3DR6A 4MY0A 4C2ZA 4L89A 3VWDA 1J4JA 3BLNA 4RS2A 3BJ8A 5G1ZA 5KTAA 4JWPA 2YNEA 2HUZA 3PZJA 5AG6A 4CYOA 4KOXA 4JJXA 3N7ZA 1M4DA 1S7KA 4PSWA 3IWGA 2O28A 3FBUA 2I79A 4XPKA 3FXTA 4BMHA 4MFZA 2Q4VA 4UWIA 5AG5A 3EO4A 4UA3A 2YGWA 4MJ8A 4H89A 1XF8A 3T9YA 5G21A 4AG7A 2BSWA 2OZHA 2P6GA 5KTCA 3PGPA 3JVNA 4H6ZA 4UBRA 1Z4EA 5J8CA 4U9ZA 4AVCA 1P4NA 1S60A 3R9FA 1NE9A 2K5TA 3R96A 5A28A 4YRHA 2QIRA 2Q0YA 2B58A 3GYAA 5HH1A 4LX9A 3WR7A 1L0CA 4F0XA 4Y49B 4B10A 2PSWA 4H6UA 1FY7A 1Z9UA 4MFPA 3FYNA 4KVOE 2H5MA 3F5BA 1MJAA 3TO9A 1S7LA 1YVOA 2R1IA 3TFYA 3CXSA 2P6EA 4JD6A 3F0AA 2IL4A 2VZYA 4CGLA 2REFA 2ZW6A 3LD2A 3PP9A 5C82A 2YNCA 1CM0A 2YNDA 4JXRA 4QB9A 4Q36A 2G3AA 2Q04A 4KUAA 4M85A 4B14A 2FCKA 1P0HA 2Z3LA 1Q2DA 5JPHA 1MJ9A 4JLYA 2OZGA 1IICA 4UFVA 2BEIA 4KSFA 4C2YA 2NMTA 4J3GA 4HKFA 2C27A 4KVXA 1XEBA 3E0KA 3BJ7A 2B3VA 4KVME 1BOBA 3H4QA 3T90A 3R95A 1MK4A 4KS9A 4HNWB 4PK2A 1LRZA 4M3SA 2PDOA 1YVKA 3IU2A 4UCMA 2R8VA 2R7HA 1M1DA 1RO5A 4U5YA 4A95A 2ZW4A 3ZJ0A 3QAHA 5JQ4A 1VHSA 4C7HA 1WWZA 3DNSA 2VXKA 1IIDA 4NCZA 4IUSA 4II9A 2X7BA 4BBHA 4QVTA 5DWMA 3GKRA 4JXQA 3D3SA 4CAFA 3EFAA 4NXYA 4KORA 1S5KA 2Z3KA 2B4DA 1M4GA 2BL1A 2ZXVA 3FNCA 1KUVA 1Q2CA 1YGHA 2ZW5A 4KOUA 4OAEA 2DPSA 2B4DB 2JDDA 2OZUA 1BO4A 3EY5A 1I1DA 3A9LA 5HMNA 3S6FA 4MBUA 4E2AA 5J8FA 4GS4A 1TIQA 4Y49C 4CGPA 2GANA 2Z3PA 2ZW7A 4CRYB 5CNPA 2ATRA 4Q38A 5G20A 4MFJA 2PC1A 2CNTA 2A4NA 5A27A 4K30A 1YR0A 3R1KA 4A33A 4AG9A 4CS0B 3D8PA 3GY9A 4QUSA 1XMTA 1CJWA 4R57A 2P6FA 5AGEA 5G22A 3S6KA 2Z3NA 2AE6A 3SXNA 2I00A 4ORFA 4R87A 5F46A 4MFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D2P A;  2BUE A;  5F49 A;  4R3L A;  1XE4 A;  4B5O A;  4PK3 A;  4R3K A;  5EC4 A;  4XNH C;  2QML A;  2EUI A;  3NE7 A;  4XPD C;  4DNC A;  2ARH A;  1Y9K A;  3JUW A;  2AJ6 A;  5GCN A;  3TCV A;  2HV2 A;  2VQY A;  1Q2Y A;  2FSR A;  2JLM A;  1OZP A;  4EVY A;  4KOV A;  2CNM A;  4L8A A;  5FVJ A;  4AVA A;  5E96 A;  2Z10 A;  2EVN A;  1NMT A;  4RI1 A;  3FB3 A;  3KKW A;  1XIX A;  1NSL A;  4CAW A;  5IB0 A;  4R9M A;  5ISV A;  5F47 A;  2Q4Y A;  1B6B A;  3EXN A;  4HNY B;  1ON0 A;  4QBJ A;  3G8W A;  1WK4 A;  4KZT A;  1M4I A;  4F0Y A;  3DR8 A;  1QSR A;  2WPX A;  3EC4 A;  2VZZ A;  4MI4 A;  4NF1 A;  3TT2 A;  1RXT A;  2Y0M A;  2JDC A;  5DWN A;  2D4O A;  2P0W A;  1QSO A;  4KOW A;  2DXQ A;  4I49 A;  1I21 A;  3SXO A;  3I9S A;  4KLW A;  4X5K A;  1IYL A;  3S6G A;  2JEV A;  1YRE A;  2Z11 A;  4B5P B;  4PV6 A;  2GIV A;  1GHE A;  5KTD A;  1VKC A;  4HNX B;  2Z0Z A;  3G3S A;  4NEX A;  3W6X A;  4CRZ B;  2ZPA A;  2B3U A;  3RYO A;  3TO7 A;  4LUA A;  3TOB A;  2B4B A;  4XPL A;  2WPW A;  2J8N A;  3MGD A;  3B8G A;  4KOT A;  2CY2 A;  4FD5 A;  5H84 A;  1S3Z A;  3SHP A;  5IX3 A;  3CXQ A;  2PR1 A;  2FT0 A;  4KOS A;  2FIA A;  4KLV A;  3DSB A;  1QSN A;  2G0B A;  1S7N A;  3F8K A;  4MHD A;  4U9Y A;  1KUY A;  1PU9 A;  5F48 A;  4FD6 A;  1Y7R A;  1IB1 E;  1MJB A;  1PUA A;  4PSX A;  1Y9W A;  1Z4R A;  5EBV A;  3P2F A;  4ZBG A;  3FIX A;  2J8M A;  4OAD A;  2FE7 A;  2PQ8 A;  2FS5 A;  3QB8 A;  3C26 A;  2VBQ A;  1YX0 A;  4IF5 A;  2REE A;  1V0C A;  2VI7 A;  3D2M A;  2VEZ A;  1R57 A;  5H86 A;  4NSQ A;  2D4P A;  3W91 A;  4F6A A;  2OU2 A;  4YGO A;  1QST A;  2FL4 A;  1IYK A;  3V8I A;  2PRB A;  3FRM A;  3IGR A;  3TOA A;  5C88 A;  4FD7 A;  2PR8 A;  4ONU A;  3ZZI A;  3UY5 A;  3DDD A;  2Q7B A;  3R9G A;  1K4J A;  2F5I A;  4KOY A;  3I3G A;  3VWE A;  2FXF A;  1S7F A;  4CAV A;  2QEC A;  4YFJ A;  4E0A A;  2FIW A;  2J8R A;  1U6M A;  3R9E A;  3P2H A;  5IV0 A;  4XNH B;  2GE3 A;  4CAX A;  4XPD B;  1N71 A;  1QSM A;  2Q44 A;  3TE4 A;  3TTH A;  2HQY A;  1UFH A;  4B5P A;  2R98 A;  2CNS A;  2OH1 A;  4FD4 A;  2G3T A;  4UWJ A;  3W6S A;  2KCW A;  4E8O A;  4AVB A;  2B5G A;  1KZF A;  4KUB A;  3S6H A;  1SQH A;  1B87 A;  3K9U A;  1M44 A;  2RC4 A;  4MY3 A;  4QC6 A;  2OB0 A;  2B5G B;  1YK3 A;  1I12 A;  1YLE A;  3LOD A;  3CXP A;  5I0C A;  4OLL A;  1KUX A;  3OWC A;  3TO6 A;  4AB7 A;  3DR6 A;  4MY0 A;  4L89 A;  3VWD A;  1J4J A;  3BLN A;  4RS2 A;  3BJ8 A;  5KTA A;  4JWP A;  2HUZ A;  3PZJ A;  4KOX A;  4JJX A;  3N7Z A;  1M4D A;  1S7K A;  4PSW A;  3IWG A;  2O28 A;  3FBU A;  2I79 A;  4XPK A;  3FXT A;  4BMH A;  2Q4V A;  4UWI A;  3EO4 A;  4UA3 A;  4MJ8 A;  4H89 A;  1XF8 A;  3T9Y A;  4AG7 A;  2BSW A;  2OZH A;  2P6G A;  5KTC A;  3PGP A;  3JVN A;  4H6Z A;  4UBR A;  1Z4E A;  5J8C A;  4U9Z A;  4AVC A;  1P4N A;  1S60 A;  3R9F A;  1NE9 A;  2K5T A;  3R96 A;  4YRH A;  2QIR A;  2Q0Y A;  2B58 A;  3GYA A;  5HH1 A;  4LX9 A;  3WR7 A;  1L0C A;  4Y49 B;  2PSW A;  4H6U A;  1FY7 A;  1Z9U A;  3FYN A;  4KVO E;  2H5M A;  3F5B A;  1MJA A;  3TO9 A;  1S7L A;  1YVO A;  2R1I A;  3TFY A;  3CXS A;  2P6E A;  4JD6 A;  3F0A A;  2IL4 A;  2VZY A;  2REF A;  2ZW6 A;  3LD2 A;  3PP9 A;  5C82 A;  1CM0 A;  4JXR A;  4QB9 A;  2G3A A;  2Q04 A;  4KUA A;  4M85 A;  2FCK A;  1P0H A;  1Q2D A;  5JPH A;  1MJ9 A;  4JLY A;  2OZG A;  1IIC A;  2BEI A;  2NMT A;  4J3G A;  4HKF A;  2C27 A;  4KVX A;  1XEB A;  3E0K A;  3BJ7 A;  2B3V A;  4KVM E;  1BOB A;  3H4Q A;  3T90 A;  3R95 A;  1MK4 A;  4HNW B;  4PK2 A;  1LRZ A;  4M3S A;  2PDO A;  1YVK A;  2R8V A;  2R7H A;  1M1D A;  1RO5 A;  4U5Y A;  2ZW4 A;  3ZJ0 A;  3QAH A;  5JQ4 A;  1VHS A;  1WWZ A;  3DNS A;  2VXK A;  1IID A;  4NCZ A;  4IUS A;  4II9 A;  2X7B A;  4QVT A;  5DWM A;  3GKR A;  4JXQ A;  3D3S A;  3EFA A;  4NXY A;  4KOR A;  1S5K A;  2B4D A;  1M4G A;  2BL1 A;  2ZXV A;  3FNC A;  1KUV A;  1Q2C A;  1YGH A;  2ZW5 A;  4KOU A;  4OAE A;  2B4D B;  2JDD A;  2OZU A;  1BO4 A;  3EY5 A;  1I1D A;  5J8F A;  5HMN A;  3S6F A;  4MBU A;  4E2A A;  4GS4 A;  1TIQ A;  4Y49 C;  2GAN A;  2ZW7 A;  4CRY B;  5CNP A;  2ATR A;  2PC1 A;  2CNT A;  2A4N A;  4K30 A;  1YR0 A;  3R1K A;  4AG9 A;  4CS0 B;  3D8P A;  3GY9 A;  4QUS A;  1XMT A;  1CJW A;  4R57 A;  2P6F A;  3S6K A;  2AE6 A;  3SXN A;  2I00 A;  4ORF A;  4R87 A;  5F46 A; 
#chains in the Genus database with same CATH topology
 1LAM A;  4B13 A;  4A39 A;  4PPZ A;  3D2P A;  5D29 A;  5AG4 A;  5LRJ A;  2BUE A;  3IWE A;  5F49 A;  2QJ8 A;  4R3L A;  3IC1 A;  4PXB A;  1YME A;  1XE4 A;  5HVF A;  2GFQ A;  1TF8 A;  4B5O A;  4ZYQ A;  4PK3 A;  4R3K A;  5EC4 A;  4C7I A;  1ARL A;  4FWU A;  4B12 A;  4XNH C;  2PIY A;  2QML A;  4MHZ A;  1GYT A;  2EUI A;  2JBJ A;  4NGN A;  3NE7 A;  2RB7 A;  4XPD C;  4DNC A;  3GB0 A;  2ARH A;  2AFO A;  1Y9K A;  3JUW A;  2AJ6 A;  5GCN A;  2AFW A;  1XMB A;  3TCV A;  2HV2 A;  3PB7 X;  2VQY A;  1Q2Y A;  1ZG8 A;  4IK2 A;  2FSR A;  4ZY2 A;  2PVV A;  2JLM A;  3D7D A;  2PE3 A;  3NH5 A;  1A2Z A;  4NGR A;  1OZP A;  1QMU A;  4P10 A;  2ZEN A;  2Q43 A;  4EVY A;  3FVL A;  2BO9 A;  4LQ6 A;  2RFH A;  4P44 A;  2XEF A;  4DUK A;  4ZY0 A;  4GXH A;  3B3V A;  3KR5 A;  4KOV A;  2CNM A;  2PJ5 A;  3DGV A;  3PFE A;  4L8A A;  5FVJ A;  4KSI A;  4AVA A;  4YU9 A;  2WYR A;  5E96 A;  2Z10 A;  3JRU A;  2EVN A;  4PQA A;  4Q7A A;  1XRY A;  1ZLH A;  4EME A;  1IU8 A;  2WUU A;  1NMT A;  3IWW A;  5I4M A;  3N5F A;  4RI1 A;  1Y7E A;  3FB3 A;  4PXD A;  1Z8L A;  3KKW A;  1QQ9 A;  1XIX A;  1NSL A;  4CAW A;  5IB0 A;  4R9M A;  1YLO A;  3B3C A;  5F47 A;  3I1U A;  5ISV A;  3S9N A;  1IOF A;  4F9U A;  2V8H A;  2Q4Y A;  1B6B A;  3EXN A;  5LRK A;  4HNY B;  4UFW A;  1Y0Y A;  1ON0 A;  4QBJ A;  5JH9 A;  3CPX A;  1WK4 A;  3G8W A;  1M4I A;  4KZT A;  4F0Y A;  3DR8 A;  1QSR A;  4CGO A;  2CIJ A;  2WPX A;  3EC4 A;  2VZZ A;  3FJU A;  4MI4 A;  4NF1 A;  3TT2 A;  1RXT A;  2Y0M A;  2JDC A;  5DWN A;  1CBX A;  3S9M A;  2D4O A;  2P0W A;  2GRE A;  1QSO A;  4KOW A;  4R7M A;  2V77 A;  2DXQ A;  3IO1 A;  4I49 A;  2NSM A;  3GIU A;  1I21 A;  4M6I A;  3SXO A;  3I9S A;  4IAV A;  4KLW A;  2BCO A;  3H5Z A;  4X5K A;  4B6Z A;  3CT9 A;  1IYL A;  4B11 A;  3S6G A;  2XEG A;  2JEV A;  2V8G A;  4C2X A;  1YRE A;  4UFX A;  1DTD A;  2Z11 A;  4B5P B;  4R6T A;  4UIA A;  3IFE A;  4PV6 A;  2GIV A;  1GHE A;  5KTD A;  4MFQ A;  1VKC A;  4HNX B;  4DYO A;  2Z0Z A;  3G3S A;  4TNU A;  4NEX A;  2EK8 A;  3W6X A;  4CRZ B;  4CGM A;  3MRU A;  1UWY A;  2ZPA A;  3BI1 A;  4M6H A;  2B3U A;  5LYL A;  3RYO A;  1ELL P;  3TO7 A;  4LUA A;  3TOB A;  2B4B A;  4XPL A;  4FAI A;  2WPW A;  2J8N A;  3B8G A;  3MGD A;  2CY2 A;  4KOT A;  1HDU A;  4FD5 A;  1IOI A;  5H84 A;  4A30 A;  2QYV A;  4F8Z A;  1S3Z A;  3SHP A;  4MCP A;  2CTC A;  2PCU A;  3JTK A;  3CXQ A;  4OID A;  5IX3 A;  2PR1 A;  5K8N A;  4P4I A;  2FT0 A;  4UCP A;  1TXR A;  3H8G A;  4CYN A;  3BI0 A;  4KOS A;  2FIA A;  4KLV A;  2PIZ A;  3DSB A;  1QSN A;  2PJA A;  2G0B A;  5LYD A;  4X2T A;  3NH4 A;  1S7N A;  3F8K A;  4MHD A;  3IU1 A;  4U9Y A;  4X3R A;  1XBU A;  4MHN A;  1KUY A;  1PU9 A;  2ABZ A;  2C6C A;  3CPA A;  4UCN A;  1ZLI A;  5F48 A;  4FD6 A;  1Y7R A;  3B7I A;  4OP4 A;  5K8P A;  1IB1 E;  2XEI A;  3PEI A;  1CPS A;  1MJB A;  3S9L A;  1PUA A;  4PSX A;  1CP6 A;  1Y9W A;  1Z4R A;  5EBV A;  1M4L A;  4RUH A;  3P2F A;  2Z3M A;  4MFK A;  2G9D A;  2F8H A;  2YNC C;  1IY7 A;  4ZBG A;  3FIX A;  2J8M A;  3KHX A;  3QAY A;  4OAD A;  2Q51 A;  2AFZ A;  4WWV A;  1YW4 A;  2FE7 A;  3FMC A;  2PQ8 A;  4ONW A;  4PXC A;  2FS5 A;  3QB8 A;  3C26 A;  3RNZ A;  4P4F A;  5IB9 A;  1LCP A;  3PB4 X;  2VBQ A;  1YW6 A;  1LFW A;  3ISX A;  1YX0 A;  3PB9 X;  4IF5 A;  2REE A;  1V0C A;  2VI7 A;  3D2M A;  2VEZ A;  1R57 A;  4CGN A;  1JWQ A;  3KZW A;  2GLF A;  2C6G A;  1X10 A;  5H86 A;  4NSQ A;  2D4P A;  1IGB A;  1VHO A;  4MCQ A;  3W91 A;  1JQG A;  4NGS A;  1BPN A;  4F6A A;  1TKH A;  4UEE A;  1CP7 A;  3ISZ A;  1ZO0 A;  2OU2 A;  4YGO A;  1QST A;  3VAT A;  4CYP A;  4A32 A;  2FL4 A;  2PJ4 A;  5AG7 A;  1IYK A;  1ZG9 A;  5THW A;  3V8I A;  4UIB A;  2ZEP A;  2PRB A;  3FRM A;  3IGR A;  5EMI A;  2ZEH A;  2PJC A;  2Z3O A;  1Z8W A;  4NJQ A;  4OC3 A;  3TOA A;  2ZEO A;  2PJ2 A;  3L2N A;  5C88 A;  4FD7 A;  4CYQ A;  2PR8 A;  4ONU A;  3BHX A;  3SI0 A;  3UY5 A;  3ZZI A;  3DDD A;  2Q7B A;  3R9G A;  1BPM A;  1K4J A;  2F5I A;  2PJ0 A;  4KOY A;  5DS0 A;  3D4U A;  3I3G A;  4ZI6 A;  4MHP A;  3VWE A;  1CG2 A;  3VH9 A;  1HEE A;  2Q4Z A;  3SJG A;  3PFO A;  2FXF A;  2V8V A;  1S7F A;  4P4B A;  4CAV A;  5K8M A;  2QEC A;  4YWY A;  4YFJ A;  2EBJ A;  2V8D A;  4JZ0 A;  3KL9 A;  4E0A A;  2FIW A;  2J8R A;  1U6M A;  3R9E A;  3P2H A;  5IV0 A;  3FX6 A;  4H2K A;  1Z8X A;  4HPS A;  4OC4 A;  4XNH B;  2GE3 A;  3SJF A;  3B3S A;  4C68 A;  4CAX A;  3K2K A;  3H8E A;  4A2Z A;  2F7V A;  4XPD B;  1Q7L A;  2WSA A;  1AMP A;  3PB8 X;  1N71 A;  1QSM A;  2Q44 A;  3TE4 A;  3TTH A;  2HQY A;  1OBR A;  1UFH A;  4MXU A;  5CPA A;  2CXA A;  4KSA A;  4A31 A;  4CAE A;  4B5P A;  2DF5 A;  2R98 A;  2CNS A;  1F2P A;  3RAM A;  2OH1 A;  3PB6 X;  4FD4 A;  2G3T A;  3QNV A;  3KQX A;  4UWJ A;  3W6S A;  2KCW A;  4E8O A;  4AVB A;  2OOT A;  1BLL E;  2B5G A;  4A94 A;  1KZF A;  4WJB A;  1BAV A;  1H8L A;  2POK A;  1SQH A;  4KUB A;  3S6H A;  1B87 A;  2OR4 A;  3K9U A;  4OC0 A;  1M44 A;  5BWA B;  2RC4 A;  1XOV A;  4ZGY B;  4MY3 A;  4QC6 A;  2OB0 A;  3D68 A;  4OIW A;  3T8W A;  2B5G B;  3DLJ A;  3BXM A;  1CX8 A;  1I12 A;  1YK3 A;  1YLE A;  3LOD A;  3CXP A;  5I0C A;  2DEA A;  3WT4 A;  4OLL A;  1KUX A;  1R3N A;  1AYE A;  3OWC A;  3TO6 A;  4AB7 A;  1FT7 A;  3V7Z A;  1Z2L A;  2DPT A;  3DR6 A;  1ZG7 A;  2WZN A;  4MY0 A;  1TF9 A;  4C2Z A;  4L89 A;  3IEH A;  3VWD A;  1J4J A;  4OC1 A;  2IJZ A;  3BLN A;  1Z8T A;  2BOA A;  4RS2 A;  3VAR A;  1AUG A;  3D7H A;  3BJ8 A;  3CZX A;  5G1Z A;  5KTA A;  4JWP A;  2YNE A;  2HB6 A;  2HUZ A;  3PZJ A;  5AG6 A;  4OC2 A;  3FH4 A;  3RO0 A;  3FEC A;  4CYO A;  1Z5R A;  4KOX A;  4JJX A;  3PBB A;  1LOK A;  3N7Z A;  1M4D A;  1F57 A;  1S7K A;  4PSW A;  3LMS A;  2EWB A;  3IWG A;  4NJR A;  2O28 A;  2AFS A;  3FBU A;  4JYW A;  2J9A A;  2I79 A;  4XPK A;  3FXT A;  4W9Y A;  1XJO A;  3IIB A;  4NGP A;  4BMH A;  5ELY A;  4PXE A;  1XFO A;  4MFZ A;  4M6G A;  2Q4V A;  4UWI A;  3LAC A;  5AG5 A;  3EO4 A;  4MHY A;  4NGT A;  2YGW A;  4MJ8 A;  4H89 A;  4UA3 A;  2PRQ A;  1XF8 A;  4AXV A;  3D7G A;  4EFD A;  4K3N A;  3WC6 A;  3RZA A;  2ZOF A;  3NH8 A;  3T9Y A;  2CTB A;  5G21 A;  4AG7 A;  2BSW A;  5CBM A;  2OZH A;  1RTQ A;  2VL1 A;  2P6G A;  3KQZ A;  3TX8 A;  4F9V A;  5KTC A;  2PJ3 A;  3JVN A;  3PGP A;  4H6Z A;  4UBR A;  1Z4E A;  5J8C A;  1PYT B;  1X12 A;  3FED A;  1P4N A;  3HLP A;  4U9Z A;  1S60 A;  4R8F A;  4AVC A;  3R9F A;  1NE9 A;  2K5T A;  2ZEE A;  2PJ1 A;  3R96 A;  5A28 A;  4P4E A;  4YRH A;  1EE3 P;  3FF3 A;  2QIR A;  2Q0Y A;  4CPA A;  2B58 A;  2XEJ A;  3GYA A;  3B35 A;  4LX9 A;  5HH1 A;  4A38 A;  3WR7 A;  4BD9 A;  1L0C A;  2IQ6 A;  4F0X A;  1LAP A;  4Y49 B;  1ARM A;  4B10 A;  2PSW A;  4H6U A;  1FY7 A;  1Z9U A;  4MFP A;  3FYN A;  3PBE A;  4NGM A;  2PJ6 A;  4KVO E;  2H5M A;  3F5B A;  5LYI A;  1MJA A;  3TO9 A;  1S7L A;  1YVO A;  2R1I A;  3KR4 A;  4A37 A;  4Z65 A;  2I3C A;  4TWE A;  5JM6 A;  3TFY A;  1DE4 C;  3B3W A;  3CXS A;  2P6E A;  2EO8 A;  4JD6 A;  3F0A A;  4FBE A;  3NFZ A;  2IL4 A;  2VZY A;  4CGL A;  5HVG A;  2AFU A;  2FVG A;  1CPX A;  2REF A;  3PRT A;  3B3T A;  2ZW6 A;  3LD2 A;  4P45 A;  3PP9 A;  5C82 A;  2YNC A;  1CM0 A;  3B2Y A;  6CPA A;  2CF4 A;  2YND A;  2JEW A;  1LAN A;  4JXR A;  4QB9 A;  4Q36 A;  4IHM A;  2PJ7 A;  2G3A A;  1VIX A;  4UEZ A;  2ZED A;  2Q04 A;  4KUA A;  4M85 A;  5LRG A;  1YSJ A;  4R76 A;  4FUU A;  4B14 A;  2FCK A;  2GLJ A;  1P0H A;  2ZEG A;  2QVP A;  2Z3L A;  4BIN A;  3KI9 A;  1Q2D A;  5JPH A;  1MJ9 A;  4JLY A;  4UEF A;  2HC9 A;  4RN7 A;  8CPA A;  2OZG A;  1IIC A;  4UFV A;  4O23 A;  2BEI A;  3LWU A;  4KSF A;  1TKF A;  4EWT A;  4C2Y A;  4G1P A;  5D8N A;  2NMT A;  2ZEL A;  4J3G A;  2C6P A;  3KHZ A;  2C27 A;  4HKF A;  4KVX A;  2GU2 A;  3TC8 A;  3WC7 A;  7CPA A;  1ELM P;  3RBU A;  4P4D A;  1XEB A;  3E0K A;  2O53 A;  3BJ7 A;  3CDX A;  5K8O A;  1F2O A;  2B3V A;  4KVM E;  1BOB A;  3H4Q A;  5HVH A;  3KAS A;  3T90 A;  3R95 A;  1FNO A;  1MK4 A;  4KS9 A;  4HNW B;  4DJL A;  4PK2 A;  1LRZ A;  4M3S A;  2PDO A;  3NE8 A;  1YVK A;  3IU2 A;  4UCM A;  4ZX9 A;  2R8V A;  2R7H A;  1M1D A;  1RO5 A;  2AFX A;  4U5Y A;  4ZY1 A;  5JGF A;  3WC5 A;  4A95 A;  2ZW4 A;  2ZEF A;  3ZJ0 A;  3QAH A;  3SI1 A;  1VHS A;  4C7H A;  5JQ4 A;  1WWZ A;  2ANP A;  2PJB A;  1KWM A;  3DNS A;  5J1Q A;  3H8F A;  2VXK A;  1IID A;  4NCZ A;  4IUS A;  2NYQ A;  4OC5 A;  4II9 A;  2X7B A;  4BBH A;  4QVT A;  5DWM A;  1R43 A;  3GKR A;  4P4J A;  2PJ9 A;  3SI2 A;  1Y0R A;  3D3S A;  4JXQ A;  3GUX A;  4CAF A;  3EFA A;  4NXY A;  3D66 A;  2PVW A;  2ODF A;  3KGQ A;  4KOR A;  1S5K A;  1VGY A;  3HUV A;  1VHE A;  2Z3K A;  4MCS A;  2B4D A;  2AFM A;  3WAB A;  4LQG A;  1M4G A;  3IJ3 A;  2BL1 A;  2JBK A;  2ZXV A;  3FNC A;  4MCR A;  1KUV A;  1Q2C A;  1YGH A;  2ZOG A;  2ZW5 A;  4KOU A;  4OAE A;  2PJ8 A;  4X8I A;  2DPS A;  1HDQ A;  3NA6 A;  2B4D B;  2JDD A;  2OZU A;  4P6Y A;  1BO4 A;  3K9T A;  3SJE A;  4NFR A;  3EY5 A;  4MMO A;  5F09 A;  1I1D A;  3A9L A;  5HMN A;  3S6F A;  4MBU A;  2C1C A;  4E2A A;  5J8F A;  4GS4 A;  1TIQ A;  4NGQ A;  4Y49 C;  4CGP A;  2EK9 A;  3MN8 A;  2GAN A;  3D7F A;  3D67 A;  3GLJ A;  5HXD A;  1TKJ A;  2Z3P A;  2ZW7 A;  4ZX8 A;  4CRY B;  4UF4 A;  5CNP A;  2Q7S A;  2ATR A;  2ZEM A;  4Q38 A;  5G20 A;  1PCA A;  3FEE A;  4MFJ A;  2PC1 A;  2CNT A;  2A4N A;  5A27 A;  4K30 A;  3SJX A;  1YR0 A;  3R1K A;  4A33 A;  4AG9 A;  4CS0 B;  3D8P A;  2O4H A;  3GY9 A;  4QUS A;  1XMT A;  1CJW A;  4OME A;  4R57 A;  1YQE A;  2P6F A;  4OKO A;  2IMO A;  5AGE A;  5G22 A;  3S6K A;  2Z3N A;  2AE6 A;  3SXN A;  1NSA A;  2I00 A;  5LYF A;  4ORF A;  4R87 A;  5F46 A;  4MFL A;  3V38 A;  4MRI A;  4GM5 A; 
#chains in the Genus database with same CATH homology
 4B13 A;  5AG4 A;  3D2P A;  2BUE A;  3IWE A;  5F49 A;  4R3L A;  1XE4 A;  4B5O A;  4PK3 A;  4R3K A;  5EC4 A;  4C7I A;  4B12 A;  4XNH C;  2QML A;  2EUI A;  3NE7 A;  4XPD C;  4DNC A;  2ARH A;  1Y9K A;  3JUW A;  2AJ6 A;  5GCN A;  3TCV A;  2HV2 A;  2VQY A;  1Q2Y A;  2FSR A;  2JLM A;  1OZP A;  4EVY A;  4KOV A;  2CNM A;  4L8A A;  5FVJ A;  4AVA A;  5E96 A;  2Z10 A;  2EVN A;  2WUU A;  1NMT A;  4RI1 A;  3FB3 A;  3KKW A;  1XIX A;  1NSL A;  4CAW A;  5IB0 A;  4R9M A;  5ISV A;  5F47 A;  2Q4Y A;  1B6B A;  3EXN A;  4HNY B;  4UFW A;  1ON0 A;  4QBJ A;  3G8W A;  1WK4 A;  4KZT A;  1M4I A;  4F0Y A;  3DR8 A;  1QSR A;  4CGO A;  2WPX A;  3EC4 A;  2VZZ A;  4MI4 A;  4NF1 A;  3TT2 A;  1RXT A;  2Y0M A;  2JDC A;  5DWN A;  2D4O A;  2P0W A;  1QSO A;  4KOW A;  2DXQ A;  4I49 A;  1I21 A;  3SXO A;  3I9S A;  4KLW A;  3H5Z A;  4X5K A;  1IYL A;  4B11 A;  3S6G A;  2JEV A;  4C2X A;  1YRE A;  4UFX A;  2Z11 A;  4B5P B;  4PV6 A;  2GIV A;  1GHE A;  5KTD A;  4MFQ A;  1VKC A;  4HNX B;  2Z0Z A;  3G3S A;  4NEX A;  3W6X A;  4CRZ B;  4CGM A;  2ZPA A;  2B3U A;  3RYO A;  3TO7 A;  4LUA A;  3TOB A;  2B4B A;  4XPL A;  2WPW A;  2J8N A;  3MGD A;  3B8G A;  2CY2 A;  4KOT A;  4FD5 A;  5H84 A;  4A30 A;  1S3Z A;  3SHP A;  3JTK A;  3CXQ A;  5IX3 A;  2PR1 A;  2FT0 A;  4UCP A;  4CYN A;  4KOS A;  2FIA A;  4KLV A;  3DSB A;  1QSN A;  2G0B A;  1S7N A;  3F8K A;  4MHD A;  3IU1 A;  4U9Y A;  1KUY A;  1PU9 A;  4UCN A;  5F48 A;  4FD6 A;  1Y7R A;  1IB1 E;  1MJB A;  1PUA A;  4PSX A;  1Y9W A;  1Z4R A;  5EBV A;  3P2F A;  2Z3M A;  4MFK A;  2YNC C;  4ZBG A;  3FIX A;  2J8M A;  4OAD A;  2FE7 A;  2PQ8 A;  2FS5 A;  3QB8 A;  3C26 A;  2VBQ A;  1YX0 A;  4IF5 A;  2REE A;  1V0C A;  2VI7 A;  3D2M A;  2VEZ A;  1R57 A;  4CGN A;  5H86 A;  4NSQ A;  2D4P A;  3W91 A;  4F6A A;  1ZO0 A;  2OU2 A;  4YGO A;  1QST A;  4CYP A;  4A32 A;  2FL4 A;  5AG7 A;  1IYK A;  3V8I A;  2PRB A;  3FRM A;  3IGR A;  2Z3O A;  3TOA A;  5C88 A;  4FD7 A;  4CYQ A;  2PR8 A;  4ONU A;  3ZZI A;  3UY5 A;  3DDD A;  2Q7B A;  3R9G A;  1K4J A;  2F5I A;  4KOY A;  3I3G A;  3VWE A;  2FXF A;  1S7F A;  4CAV A;  2QEC A;  4YFJ A;  4E0A A;  2FIW A;  2J8R A;  1U6M A;  3R9E A;  3P2H A;  5IV0 A;  4XNH B;  2GE3 A;  4C68 A;  4CAX A;  4A2Z A;  4XPD B;  2WSA A;  1N71 A;  1QSM A;  2Q44 A;  3TE4 A;  3TTH A;  2HQY A;  4CAE A;  1UFH A;  2CXA A;  4KSA A;  4A31 A;  4B5P A;  2R98 A;  2CNS A;  2OH1 A;  4FD4 A;  2G3T A;  4UWJ A;  3W6S A;  2KCW A;  4E8O A;  4AVB A;  2B5G A;  1KZF A;  4KUB A;  3S6H A;  1SQH A;  1B87 A;  3K9U A;  1M44 A;  5BWA B;  2RC4 A;  4ZGY B;  4MY3 A;  4QC6 A;  2OB0 A;  2B5G B;  1YK3 A;  1I12 A;  1YLE A;  3LOD A;  3CXP A;  5I0C A;  4OLL A;  1KUX A;  3OWC A;  3TO6 A;  4AB7 A;  2DPT A;  3DR6 A;  4MY0 A;  4C2Z A;  4L89 A;  3VWD A;  1J4J A;  3BLN A;  4RS2 A;  3BJ8 A;  5G1Z A;  5KTA A;  4JWP A;  2YNE A;  2HUZ A;  3PZJ A;  5AG6 A;  4CYO A;  4KOX A;  4JJX A;  3N7Z A;  1M4D A;  1S7K A;  4PSW A;  3IWG A;  2O28 A;  3FBU A;  2I79 A;  4XPK A;  3FXT A;  4BMH A;  4MFZ A;  2Q4V A;  4UWI A;  5AG5 A;  3EO4 A;  4UA3 A;  2YGW A;  4MJ8 A;  4H89 A;  1XF8 A;  3T9Y A;  5G21 A;  4AG7 A;  2BSW A;  2OZH A;  2P6G A;  5KTC A;  3PGP A;  3JVN A;  4H6Z A;  4UBR A;  1Z4E A;  5J8C A;  4U9Z A;  4AVC A;  1P4N A;  1S60 A;  3R9F A;  1NE9 A;  2K5T A;  3R96 A;  5A28 A;  4YRH A;  2QIR A;  2Q0Y A;  2B58 A;  3GYA A;  5HH1 A;  4LX9 A;  3WR7 A;  1L0C A;  4F0X A;  4Y49 B;  4B10 A;  2PSW A;  4H6U A;  1FY7 A;  1Z9U A;  4MFP A;  3FYN A;  4KVO E;  2H5M A;  3F5B A;  1MJA A;  3TO9 A;  1S7L A;  1YVO A;  2R1I A;  3TFY A;  3CXS A;  2P6E A;  4JD6 A;  3F0A A;  2IL4 A;  2VZY A;  4CGL A;  2REF A;  2ZW6 A;  3LD2 A;  3PP9 A;  5C82 A;  2YNC A;  1CM0 A;  2YND A;  4JXR A;  4QB9 A;  4Q36 A;  2G3A A;  2Q04 A;  4KUA A;  4M85 A;  4B14 A;  2FCK A;  1P0H A;  2Z3L A;  1Q2D A;  5JPH A;  1MJ9 A;  4JLY A;  2OZG A;  1IIC A;  4UFV A;  2BEI A;  4KSF A;  4C2Y A;  2NMT A;  4J3G A;  4HKF A;  2C27 A;  4KVX A;  1XEB A;  3E0K A;  3BJ7 A;  2B3V A;  4KVM E;  1BOB A;  3H4Q A;  3T90 A;  3R95 A;  1MK4 A;  4KS9 A;  4HNW B;  4PK2 A;  1LRZ A;  4M3S A;  2PDO A;  1YVK A;  3IU2 A;  4UCM A;  2R8V A;  2R7H A;  1M1D A;  1RO5 A;  4U5Y A;  4A95 A;  2ZW4 A;  3ZJ0 A;  3QAH A;  5JQ4 A;  1VHS A;  4C7H A;  1WWZ A;  3DNS A;  2VXK A;  1IID A;  4NCZ A;  4IUS A;  4II9 A;  2X7B A;  4BBH A;  4QVT A;  5DWM A;  3GKR A;  4JXQ A;  3D3S A;  4CAF A;  3EFA A;  4NXY A;  4KOR A;  1S5K A;  2Z3K A;  2B4D A;  1M4G A;  2BL1 A;  2ZXV A;  3FNC A;  1KUV A;  1Q2C A;  1YGH A;  2ZW5 A;  4KOU A;  4OAE A;  2DPS A;  2B4D B;  2JDD A;  2OZU A;  1BO4 A;  3EY5 A;  1I1D A;  3A9L A;  5HMN A;  3S6F A;  4MBU A;  4E2A A;  5J8F A;  4GS4 A;  1TIQ A;  4Y49 C;  4CGP A;  2GAN A;  2Z3P A;  2ZW7 A;  4CRY B;  5CNP A;  2ATR A;  4Q38 A;  5G20 A;  4MFJ A;  2PC1 A;  2CNT A;  2A4N A;  5A27 A;  4K30 A;  1YR0 A;  3R1K A;  4A33 A;  4AG9 A;  4CS0 B;  3D8P A;  3GY9 A;  4QUS A;  1XMT A;  1CJW A;  4R57 A;  2P6F A;  5AGE A;  5G22 A;  3S6K A;  2Z3N A;  2AE6 A;  3SXN A;  2I00 A;  4ORF A;  4R87 A;  5F46 A;  4MFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...