4OAEA

Crystal structure of a gnat superfamily acetyltransferase pa4794 c29a/c117a/y128a mutant in complex with chloramphenicol
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
160
structure length
160
Chain Sequence
b'HMQLSHRPAETGDLETVAGFPQDRDELFYAYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISAFNANAAGLLLATQLGYQPRAIAERHDPDGRRVALIQMDKPLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GNAT superfamily acetyltransferase PA4794
publication title Crystal structure of a GNAT superfamily acetyltransferase PA4794 C29A/C117A/Y128A mutant in complex with chloramphenicol
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 43
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2014-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4oaeA00
4MY3A 3S6HA 5DWNA 1Y9WA 4R3KA 4YGOA 4YRHA 4ORFA 2QMLA 4MI4A 3FYNA 4KVXA 4KUBA 2BSWA 1S7NA 1KUYA 2Q4YA 2FCKA 2QIRA 3MGDA 1I21A 4FD7A 2Q4VA 1PUAA 1YVKA 2FIWA 2PSWA 2PR8A 1RXTA 4QUSA 3PZJA 5KTDA 4KOVA 2KCWA 4M85A 3GY9A 3RYOA 2B3UA 3EXNA 3DNSA 4YFJA 2BUEA 4KOSA 2PQ8A 3F0AA 3ZJ0A 3H4QA 4XPDB 3CXQA 3T9YA 4PK3A 1OZPA 2BL1A 2B3VA 4QC6A 3S6GA 3C26A 3FNCA 3BJ7A 4FD5A 4JLYA 2FS5A 1QSTA 5HMNA 3BJ8A 3R9EA 2WPXA 3CXSA 3LODA 5HH1A 2CNSA 1XIXA 4PSXA 2Z11A 3QB8A 4ONUA 5C82A 3CXPA 1YGHA 4OAEA 4LUAA 3EO4A 3TO6A 1S7FA 3R95A 4AVBA 2AE6A 5EBVA 2O28A 2K5TA 4HNXB 4XNHB 2VI7A 4U9ZA 1MJ9A 4AVAA 4KUAA 4LX9A 1YR0A 1Y9KA 2X7BA 3D3SA 2ZW7A 2ZW5A 3P2HA 5JQ4A 4JJXA 5KTCA 2BEIA 2P6EA 4H89A 3TO7A 4F6AA 2AJ6A 3W91A 3DR6A 2HUZA 2Q7BA 2Z0ZA 1Q2YA 1XEBA 1CM0A 2Q04A 1J4JA 1Q2DA 2FL4A 4PV6A 3VWEA 4JWPA 1MK4A 3JUWA 3FB3A 4AVCA 2G0BA 4I49A 3TO9A 3D8PA 4AG7A 4CRYB 3LD2A 3P2FA 2Q0YA 2WPWA 4E0AA 1I12A 5F49A 3SXNA 4QVTA 2D4PA 2J8MA 3FIXA 1YK3A 2ATRA 3IGRA 2B58A 1XE4A 2EVNA 2C27A 3TTHA 4UBRA 4KOYA 5DWMA 3R1KA 4F0YA 3R9FA 1ON0A 1BOBA 4FD6A 1U6MA 3UY5A 2CNMA 3NE7A 1Y7RA 5F46A 4DNCA 1VKCA 1WWZA 4KVOE 4KOTA 3R96A 1P0HA 2R8VA 5KTAA 1M44A 2Z10A 3N7ZA 3JVNA 4XPLA 2G3AA 1K4JA 2IL4A 2ZW6A 1Q2CA 2FIAA 1YX0A 4H6ZA 1NSLA 1RO5A 3W6XA 4QB9A 2P6FA 1Z9UA 2JDCA 1I1DA 2FSRA 1Z4RA 4L89A 1IYLA 3FBUA 2R7HA 2J8NA 4EVYA 2CY2A 3S6FA 4KOXA 2VBQA 3W6SA 4GS4A 5F47A 2JDDA 3SHPA 2EUIA 3EY5A 5I0CA 1CJWA 2OH1A 2ZXVA 2FT0A 2P6GA 2I00A 1M4DA 1S60A 2NMTA 2VZZA 2R1IA 4R3LA 4RI1A 2GIVA 3B8GA 1P4NA 4CS0B 4NEXA 1M1DA 4R87A 2FXFA 2HQYA 3SXOA 4HKFA 1M4IA 3I9SA 3PP9A 1QSOA 3GKRA 4MJ8A 2P0WA 1KZFA 4KLVA 5GCNA 4JD6A 4NCZA 4U9YA 1QSRA 5IV0A 4KOUA 1MJAA 1YLEA 4Y49C 4KVME 1XF8A 1S5KA 1PU9A 5IX3A 3V8IA 4X5KA 4CAVA 2PC1A 4NXYA 4HNWB 4L8AA 2OZUA 3TE4A 2REEA 4QBJA 5JPHA 4KORA 1KUXA 4OADA 2FE7A 2GE3A 1XMTA 5FVJA 3TOBA 2PDOA 3D2MA 4JXRA 3TFYA 2I79A 1S3ZA 2PRBA 2R98A 4E2AA 2ZPAA 3OWCA 4NSQA 4UA3A 1YREA 2DXQA 2RC4A 4RS2A 3WR7A 4HNYB 4PK2A 4J3GA 1S7KA 3DSBA 1IIDA 4CAWA 1FY7A 4KOWA 4AB7A 4BMHA 4KZTA 2J8RA 1QSMA 4JXQA 1VHSA 2HV2A 1SQHA 4IUSA 1GHEA 3IWGA 3KKWA 5J8CA 1R57A 2VXKA 4R9MA 4U5YA 1V0CA 2GANA 5C88A 5EC4A 5ISVA 3TOAA 1B6BA 3S6KA 2Y0MA 1LRZA 1M4GA 4PSWA 4MBUA 5F48A 2G3TA 3I3GA 4AG9A 3EC4A 1N71A 2OU2A 2OZHA 5CNPA 2OZGA 2D4OA 3DR8A 4Y49B 3PGPA 3EFAA 2QECA 3R9GA 2REFA 2B5GA 3T90A 1Z4EA 4B5PA 4XPKA 2B5GB 3G3SA 4B5PB 4II9A 1QSNA 1NE9A 2A4NA 1MJBA 4CAXA 2JEVA 4FD4A 2PR1A 1WK4A 4H6UA 3D2PA 1L0CA 4M3SA 1IICA 1TIQA 4XPDC 3E0KA 1IYKA 5H86A 3K9UA 4B5OA 3BLNA 2H5MA 4MHDA 3VWDA 2OB0A 4NF1A 3QAHA 1YVOA 3DDDA 4E8OA 1IB1E 3F5BA 1BO4A 4MY0A 4UWIA 1UFHA 5IB0A 2F5IA 3FXTA 4IF5A 3FRMA 4K30A 1KUVA 3TT2A 2VEZA 5E96A 4R57A 4CRZB 4UWJA 2Q44A 1NMTA 1B87A 2VZYA 3ZZIA 2B4BA 3TCVA 5H84A 3GYAA 4OLLA 2B4DA 2JLMA 1S7LA 3G8WA 2B4DB 5J8FA 4KLWA 2CNTA 4XNHC 4ZBGA 2VQYA 3F8KA 2ARHA 2ZW4A
chains in the Genus database with same CATH superfamily
4MY3A 4JZ0A 1CG2A 4CPAA 4ZY2A 3S6HA 2JBJA 4Q7AA 4NGSA 5DWNA 1Y9WA 4R3KA 4YGOA 4MFPA 2EK9A 2PJAA 4YRHA 2BO9A 4NFRA 4ORFA 3LMSA 2QMLA 2QVPA 1CBXA 4MI4A 3FYNA 1YQEA 2YNEA 4KVXA 3RNZA 2ZOFA 4KUBA 4KSIA 4MXUA 2BSWA 1S7NA 1KUYA 1HDUA 1YW4A 2Q4YA 2FCKA 2QIRA 3MGDA 1I21A 4F0XA 4FD7A 2C1CA 1CPSA 2Q4VA 3VATA 1PUAA 1YVKA 2FIWA 3KR4A 1X12A 2PSWA 2PR8A 3IU2A 4IK2A 4OC1A 1RXTA 2J9AA 4QUSA 4CYPA 2PJBA 2EBJA 3PZJA 5KTDA 2YGWA 4KOVA 2KCWA 4K3NA 4M85A 3GY9A 5ELYA 4MHYA 3SI1A 4X8IA 3RYOA 5HVGA 2B3UA 3EXNA 3DNSA 2ZOGA 3PB7X 4YFJA 2PJ2A 2FVGA 2BUEA 4KOSA 2PQ8A 3F0AA 3ZJ0A 3H4QA 4XPDB 3CXQA 1DTDA 3T9YA 4PK3A 3BI0A 1OZPA 2BL1A 2B3VA 4QC6A 4OIDA 3C26A 3FNCA 3S6GA 3B3VA 4P4FA 1AMPA 1ELMP 4FAIA 3BJ7A 1IU8A 1ZG9A 4CYQA 4FD5A 4JLYA 2GLJA 2ODFA 2ZEFA 4GM5A 2CXAA 2FS5A 3JRUA 4MRIA 4R6TA 1QSTA 3GIUA 2Z3MA 5HMNA 4P4JA 3BJ8A 3R9EA 1ZG7A 4Q36A 2WPXA 3CXSA 3LODA 5HH1A 2CNSA 3HUVA 4UFXA 3IJ3A 1XIXA 4PSXA 2Z11A 3QB8A 4ONUA 4P45A 5A27A 3FEEA 3KGQA 1VIXA 4M6GA 2RFHA 5C82A 3KHZA 3CXPA 4UCPA 1YGHA 3LWUA 1Z5RA 1YLOA 4OAEA 3LACA 4LUAA 1Z8WA 5A28A 3D7DA 3EO4A 3D7FA 4F9VA 3TO6A 1S7FA 4FWUA 4R7MA 2EK8A 3R95A 4AVBA 4Z65A 4C7IA 1TKJA 2AE6A 5EBVA 4BINA 2AFSA 3IO1A 2O28A 5J1QA 4FBEA 2Q4ZA 3B2YA 3KQXA 1HEEA 3L2NA 4MFJA 1CP6A 2K5TA 3H8FA 4HNXB 4XNHB 3TC8A 2VI7A 4OP4A 1LCPA 4MCQA 3D4UA 1XJOA 3FX6A 3IU1A 4U9ZA 1MJ9A 4AVAA 4KUAA 3K2KA 4BD9A 4LX9A 4R76A 4RUHA 2QYVA 2CTCA 3VH9A 1YR0A 4P4BA 1Y9KA 4MCRA 1Z8XA 2EWBA 1Z8TA 2X7BA 4BBHA 2PJ1A 2ZW7A 1LANA 2ZW5A 3D3SA 3P2HA 3V7ZA 1IOIA 5JQ4A 4WWVA 1TF9A 4JJXA 4NGTA 3IFEA 2BEIA 5HXDA 5KTCA 2P6EA 4UFVA 1Y7EA 3B35A 1ARMA 4H89A 4UIAA 3SJXA 3TO7A 2AJ6A 4F6AA 2AFMA 7CPAA 2ZEDA 1AYEA 5G1ZA 3RAMA 4ZY1A 5LRGA 3S9LA 4F8ZA 3IWEA 3BHXA 3NH4A 5D8NA 3W91A 3DR6A 3WC5A 2HUZA 4OMEA 2Q7BA 2Z0ZA 1Q2YA 1XEBA 1CM0A 1XFOA 4ZYQA 1Z8LA 2CTBA 1TXRA 5K8OA 2Q04A 3KHXA 3PEIA 4ZGYB 3B7IA 2O53A 3B3SA 5G21A 1J4JA 1Q2DA 1CX8A 2FL4A 4PV6A 3VWEA 4JWPA 1MK4A 2V8VA 2Z3PA 2PIZA 3JUWA 3A9LA 3FB3A 4AVCA 2G0BA 4I49A 3TO9A 2DEAA 3D8PA 2ZEMA 2YNDA 4AG7A 4MCPA 4CRYB 3LD2A 5K8MA 5LYLA 4UEFA 3CZXA 3P2FA 3SJEA 2Q0YA 2WPWA 4E0AA 1I12A 1IY7A 4KSAA 4PXDA 5F49A 2GFQA 4NGQA 3SXNA 2C6CA 4QVTA 4CGNA 2D4PA 2J8MA 3FIXA 3MRUA 4KS9A 1YK3A 2ATRA 4A39A 5JGFA 3IGRA 5HVHA 4Q38A 2B58A 3H5ZA 1XE4A 2EVNA 2C27A 4P4EA 3TTHA 4DUKA 4UBRA 5I4MA 2G9DA 2Z3LA 4KOYA 2WZNA 1EE3P 4UCMA 5DWMA 4PQAA 5D29A 3R1KA 4M6HA 4F0YA 1LFWA 3CDXA 5JH9A 3R9FA 1ON0A 1BOBA 4FD6A 4C2YA 2DPSA 4W9YA 1U6MA 1YSJA 3UY5A 2CNMA 3NE7A 1Y7RA 4C2XA 5F46A 4P44A 4DNCA 1VKCA 3D7HA 4OC5A 2PJCA 1WWZA 4KVOE 4KOTA 3R96A 1P0HA 4C7HA 2R8VA 3GUXA 3T8WA 5KTAA 1M44A 2Z10A 1TKFA 3N7ZA 3JVNA 4XPLA 4MFLA 4G1PA 2G3AA 1K4JA 2IL4A 2ZEPA 5BWAB 3CPAA 4LQ6A 4OC3A 2ZW6A 1Q2CA 1ARLA 2FIAA 1YX0A 1BLLE 4H6ZA 4LQGA 8CPAA 1QMUA 1NSLA 2Z3OA 3H8GA 1RO5A 3W6XA 5K8NA 4DJLA 4QB9A 4C2ZA 4NGMA 3ISZA 5AGEA 2P6FA 3VARA 1Z9UA 2JDCA 1I1DA 2FSRA 1Z4RA 2YNCC 2O4HA 4L89A 3NE8A 2AFXA 1IYLA 2PIYA 2VL1A 5AG6A 3FBUA 1TF8A 1FNOA 2F8HA 3BI1A 2R7HA 1ZO0A 2J8NA 1F2PA 1RTQA 4EVYA 5DS0A 5LYDA 2CY2A 5LYIA 4A37A 2ZEOA 3S6FA 4KOXA 2PJ4A 2VBQA 4OC2A 4CGOA 3W6SA 4GS4A 5F47A 4ONWA 2JDDA 3I1UA 3SHPA 3CPXA 3KZWA 3PB8X 2EUIA 3B3CA 4B11A 3EY5A 5I0CA 1CJWA 4OKOA 5IB9A 4NJRA 5THWA 4O23A 4A2ZA 2OH1A 4GXHA 2AFWA 2ZXVA 2FT0A 3DLJA 2P6GA 1LAPA 2I00A 1M4DA 1S60A 2OR4A 4B6ZA 2NMTA 2VZZA 2R1IA 4R3LA 3KI9A 4RI1A 2GIVA 2PJ0A 3B8GA 1Y0YA 3D67A 5EMIA 1P4NA 3PB4X 5LRJA 4NEXA 4CS0B 4WJBA 1M1DA 3V38A 4R87A 2FXFA 2C6GA 2NSMA 3S9MA 2WSAA 4P10A 2HQYA 2IMOA 5LYFA 3SXOA 4CAEA 4HKFA 2C6PA 4UF4A 1M4IA 3B3TA 2I3CA 3I9SA 3IIBA 3PP9A 1QSOA 2V8GA 3GKRA 4M6IA 4UEEA 3PRTA 4MJ8A 1Z2LA 4H2KA 2P0WA 1KZFA 1TKHA 2PJ3A 3PFEA 4KLVA 3RZAA 2PRQA 4UEZA 4EFDA 5F09A 1PYTB 3IC1A 5GCNA 4JD6A 4A31A 3CT9A 4NCZA 4U9YA 1QSRA 5IV0A 4KOUA 1MJAA 1XMBA 1YLEA 3KASA 4NGNA 4F9UA 4PXEA 4NGRA 4MHPA 2ANPA 4Y49C 2ZENA 1OBRA 4KVME 5CPAA 4B12A 1GYTA 1XF8A 1S5KA 3KQZA 1PU9A 2DPTA 2GLFA 5LRKA 2PJ5A 5IX3A 3V8IA 4X5KA 1XOVA 4MHNA 4NJQA 1DE4C 4CAVA 3IWWA 1A2ZA 2PC1A 4NXYA 4HNWB 1ZLIA 2V8HA 3FMCA 4JYWA 1M4LA 4A94A 4L8AA 3KR5A 2AFOA 2OZUA 3TE4A 2REEA 4AXVA 4DYOA 4X2TA 1BPMA 4B13A 4EWTA 4QBJA 5JPHA 3QAYA 4KORA 4R8FA 2YNCA 1KUXA 4OADA 1QQ9A 2ZEGA 2V77A 2FE7A 4PPZA 2GE3A 4FUUA 1F2OA 1XMTA 2XEFA 5FVJA 4EMEA 5G22A 3TOBA 2AFZA 2PDOA 1JQGA 3D2MA 4TWEA 4JXRA 1H8LA 2Z3KA 5CBMA 3TFYA 3KL9A 2I79A 1S3ZA 1VHEA 2DF5A 3FF3A 2PRBA 2IJZA 4RN7A 2R98A 4E2AA 2ZPAA 3OWCA 4NSQA 4UA3A 4UFWA 1YREA 2DXQA 2RC4A 4CYNA 4RS2A 3BXMA 3WR7A 2GU2A 1CP7A 4HNYB 4PK2A 2PJ9A 4C68A 1BPNA 1S7KA 4J3GA 1VHOA 3DSBA 3RBUA 1IIDA 3PFOA 4CAWA 1FY7A 1XRYA 4KOWA 4AB7A 4BMHA 4KZTA 3NFZA 2J8RA 3SI2A 1QSMA 4JXQA 1VHSA 4MCSA 1R43A 2HV2A 4MFKA 1SQHA 4IUSA 1GHEA 2Q51A 4KSFA 1NSAA 4MMOA 1YW6A 2QJ8A 3IWGA 3KKWA 4IAVA 3DGVA 3MN8A 4ZI6A 3FJUA 1AUGA 5J8CA 1R57A 2VXKA 4R9MA 4U5YA 1V0CA 2GANA 1F57A 3SJGA 5C88A 4OIWA 5EC4A 5ISVA 3TOAA 2PJ6A 1B6BA 4P4IA 3S6KA 2PCUA 2Y0MA 2NYQA 1LRZA 1M4GA 3GB0A 3IEHA 4A38A 4A30A 4A32A 4PSWA 4MBUA 5F48A 3H8EA 3WABA 2JBKA 2G3TA 4MHZA 3I3GA 1Q7LA 1IGBA 4AG9A 4CAFA 3EC4A 1N71A 4IHMA 2AFUA 4ZX8A 1ZG8A 2OU2A 2OZHA 5CNPA 2OZGA 3PBEA 1LOKA 2ABZA 3NA6A 4PXBA 2D4OA 4TNUA 5JM6A 5HVFA 4OC4A 3WC7A 3DR8A 2HC9A 3TX8A 4Y49B 4CGPA 3PGPA 1CPXA 3EFAA 3NH5A 2QECA 2POKA 2OOTA 4A33A 1PCAA 2GREA 3R9GA 1JWQA 2EO8A 3S9NA 1KWMA 2BOAA 2REFA 4P4DA 5G20A 1XBUA 2B5GA 3T90A 1LAMA 1Z4EA 4B5PA 4XPKA 2B5GB 2XEGA 3G3SA 4B5PB 2PVVA 3FVLA 4II9A 1QSNA 1NE9A 2A4NA 2PJ8A 1MJBA 4CAXA 2XEJA 3NH8A 1ELLP 3WT4A 5AG7A 4P6YA 1IOFA 4OC0A 5AG5A 2JEVA 4FD4A 2PR1A 3FECA 2F7VA 2PVWA 1WK4A 4H6UA 3D2PA 3K9TA 1L0CA 4PXCA 1FT7A 1IICA 1TIQA 2WYRA 4M3SA 4XPDC 3FH4A 2JEWA 2ZEEA 1ZLHA 3E0KA 1IYKA 5H86A 3K9UA 4B5OA 3BLNA 1R3NA 1BAVA 3PB6X 1VGYA 2XEIA 2H5MA 4MHDA 3VWDA 4YU9A 2OB0A 3SI0A 3FEDA 4NGPA 4NF1A 3SJFA 2HB6A 3QAHA 1YVOA 3DDDA 4E8OA 1IB1E 4CGMA 3F5BA 1BO4A 2WUUA 4MY0A 3HLPA 1UFHA 4UWIA 5IB0A 4MFZA 4B14A 2F5IA 3PBBA 3FXTA 3PB9X 2Q43A 4IF5A 1Y0RA 3FRMA 4K30A 1X10A 1KUVA 2V8DA 2Q7SA 2VEZA 3TT2A 3ISXA 3GLJA 5E96A 3N5FA 6CPAA 4R57A 3D7GA 1YMEA 4YWYA 4ZY0A 4CYOA 2IQ6A 4CRZB 2CIJA 4HPSA 2BCOA 4MFQA 4UIBA 4UWJA 3RO0A 4B10A 2Q44A 1NMTA 1B87A 1HDQA 2ZEHA 1UWYA 2RB7A 2VZYA 3B3WA 3D68A 5K8PA 4X3RA 3ZZIA 2ZELA 2B4BA 4UCNA 3D66A 4ZX9A 3GYAA 4OLLA 5H84A 3TCVA 3WC6A 4A95A 2CF4A 2B4DA 2JLMA 4CGLA 5AG4A 3JTKA 1S7LA 2Z3NA 3G8WA 2B4DB 2PE3A 5J8FA 3QNVA 4KLWA 2CNTA 4XNHC 4ZBGA 2VQYA 3F8KA 2ARHA 2PJ7A 2ZW4A
chains in the Genus database with same CATH topology
4MY3A 3S6HA 5DWNA 1Y9WA 4R3KA 4YGOA 4MFPA 4YRHA 4ORFA 2QMLA 4MI4A 3FYNA 2YNEA 4KVXA 4KUBA 2BSWA 1S7NA 1KUYA 2Q4YA 2FCKA 2QIRA 3MGDA 1I21A 4F0XA 4FD7A 2Q4VA 1PUAA 1YVKA 2FIWA 2PSWA 2PR8A 3IU2A 1RXTA 4QUSA 4CYPA 3PZJA 5KTDA 2YGWA 4KOVA 2KCWA 4M85A 3GY9A 3RYOA 2B3UA 3EXNA 3DNSA 4YFJA 2BUEA 4KOSA 2PQ8A 3F0AA 3ZJ0A 3H4QA 4XPDB 3CXQA 3T9YA 4PK3A 1OZPA 2BL1A 2B3VA 4QC6A 3S6GA 3C26A 3FNCA 3BJ7A 4CYQA 4FD5A 4JLYA 2CXAA 2FS5A 1QSTA 2Z3MA 5HMNA 3BJ8A 3R9EA 4Q36A 2WPXA 3CXSA 3LODA 5HH1A 2CNSA 4UFXA 1XIXA 4PSXA 2Z11A 3QB8A 4ONUA 5A27A 5C82A 3CXPA 4UCPA 1YGHA 4OAEA 4LUAA 5A28A 3EO4A 3TO6A 1S7FA 3R95A 4AVBA 4C7IA 2AE6A 5EBVA 2O28A 4MFJA 2K5TA 4HNXB 4XNHB 2VI7A 3IU1A 4U9ZA 1MJ9A 4AVAA 4KUAA 4LX9A 1YR0A 1Y9KA 4BBHA 2X7BA 3D3SA 2ZW7A 2ZW5A 3P2HA 5JQ4A 4JJXA 5KTCA 2BEIA 2P6EA 4UFVA 4H89A 3TO7A 4F6AA 2AJ6A 5G1ZA 3IWEA 3W91A 3DR6A 2HUZA 2Q7BA 2Z0ZA 1Q2YA 1XEBA 1CM0A 2Q04A 4ZGYB 5G21A 1J4JA 1Q2DA 2FL4A 4PV6A 3VWEA 4JWPA 1MK4A 2Z3PA 3JUWA 3A9LA 3FB3A 4AVCA 4I49A 2G0BA 3TO9A 3D8PA 4AG7A 2YNDA 4CRYB 3LD2A 3P2FA 2Q0YA 2WPWA 4E0AA 1I12A 4KSAA 5F49A 3SXNA 4QVTA 4CGNA 2D4PA 2J8MA 3FIXA 4KS9A 1YK3A 2ATRA 3IGRA 4Q38A 2B58A 3H5ZA 1XE4A 2EVNA 2C27A 3TTHA 4UBRA 2Z3LA 4KOYA 4UCMA 5DWMA 3R1KA 4F0YA 3R9FA 1ON0A 1BOBA 4FD6A 4C2YA 2DPSA 1U6MA 3UY5A 2CNMA 3NE7A 1Y7RA 4C2XA 5F46A 4DNCA 1VKCA 1WWZA 4KVOE 4KOTA 3R96A 1P0HA 4C7HA 2R8VA 5KTAA 1M44A 2Z10A 3N7ZA 3JVNA 4XPLA 4MFLA 5BWAB 2G3AA 1K4JA 2IL4A 2ZW6A 1Q2CA 2FIAA 1YX0A 4H6ZA 1NSLA 2Z3OA 1RO5A 3W6XA 4QB9A 4C2ZA 5AGEA 2P6FA 1Z9UA 2JDCA 1I1DA 2FSRA 1Z4RA 2YNCC 4L89A 1IYLA 5AG6A 3FBUA 2R7HA 1ZO0A 2J8NA 4EVYA 2CY2A 3S6FA 4KOXA 2VBQA 4CGOA 3W6SA 4GS4A 5F47A 2JDDA 3SHPA 4B11A 2EUIA 3EY5A 5I0CA 1CJWA 4A2ZA 2OH1A 2ZXVA 2FT0A 2P6GA 2I00A 1M4DA 1S60A 2NMTA 2VZZA 2R1IA 4R3LA 4RI1A 4CGPA 2GIVA 3B8GA 1P4NA 4CS0B 4NEXA 1M1DA 4R87A 2FXFA 2WSAA 2HQYA 3SXOA 4CAEA 4HKFA 1M4IA 3I9SA 3PP9A 1QSOA 3GKRA 4MJ8A 2P0WA 1KZFA 4KLVA 5GCNA 4JD6A 4NCZA 4U9YA 1QSRA 5IV0A 4KOUA 1MJAA 1YLEA 4Y49C 4KVME 4B12A 1XF8A 1S5KA 1PU9A 2DPTA 5IX3A 3V8IA 4X5KA 4CAVA 2PC1A 4NXYA 4HNWB 4L8AA 2OZUA 3TE4A 2REEA 4QBJA 4B13A 5JPHA 4KORA 2YNCA 1KUXA 4OADA 2FE7A 2GE3A 1XMTA 5FVJA 5G22A 3TOBA 2PDOA 3D2MA 4JXRA 2Z3KA 3TFYA 2I79A 1S3ZA 2PRBA 2R98A 4E2AA 2ZPAA 3OWCA 4NSQA 4UA3A 4UFWA 1YREA 2DXQA 2RC4A 4CYNA 4RS2A 3WR7A 4HNYB 4PK2A 4C68A 4J3GA 1S7KA 3DSBA 1IIDA 4CAWA 1FY7A 4KOWA 4AB7A 4BMHA 4KZTA 2J8RA 1QSMA 4JXQA 1VHSA 2HV2A 4MFKA 1SQHA 4IUSA 1GHEA 4KSFA 3IWGA 3KKWA 5J8CA 1R57A 2VXKA 4R9MA 4U5YA 1V0CA 2GANA 5C88A 5EC4A 5ISVA 3TOAA 1B6BA 3S6KA 2Y0MA 1LRZA 1M4GA 4A30A 4A32A 4PSWA 4MBUA 5F48A 2G3TA 3I3GA 4AG9A 4CAFA 3EC4A 1N71A 2OU2A 2OZHA 5CNPA 2OZGA 2D4OA 3DR8A 4Y49B 3PGPA 3EFAA 2QECA 4A33A 3R9GA 2REFA 5G20A 2B5GA 3T90A 1Z4EA 4B5PA 4XPKA 2B5GB 3G3SA 4B5PB 4II9A 1QSNA 1NE9A 2A4NA 1MJBA 4CAXA 5AG7A 5AG5A 2JEVA 4FD4A 2PR1A 1WK4A 4H6UA 3D2PA 1L0CA 4A31A 4M3SA 1IICA 1TIQA 4XPDC 3E0KA 1IYKA 5H86A 3K9UA 4B5OA 3BLNA 2H5MA 4MHDA 3VWDA 2OB0A 4NF1A 3QAHA 1YVOA 3DDDA 4E8OA 1IB1E 4CGMA 3F5BA 1BO4A 2WUUA 4MY0A 4UWIA 1UFHA 5IB0A 4MFZA 4B14A 2F5IA 3FXTA 4IF5A 3FRMA 4K30A 1KUVA 3TT2A 2VEZA 5E96A 4R57A 4CYOA 4CRZB 4MFQA 4UWJA 4B10A 2Q44A 1NMTA 1B87A 2VZYA 3ZZIA 2B4BA 4UCNA 3TCVA 5H84A 3GYAA 4OLLA 4A95A 2B4DA 2JLMA 4CGLA 5AG4A 3JTKA 1S7LA 2Z3NA 3G8WA 2B4DB 5J8FA 4KLWA 2CNTA 4XNHC 4ZBGA 2VQYA 3F8KA 2ARHA 2ZW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MY3 A;  3S6H A;  5DWN A;  1Y9W A;  4R3K A;  4YGO A;  4YRH A;  4ORF A;  2QML A;  4MI4 A;  3FYN A;  4KVX A;  4KUB A;  2BSW A;  1S7N A;  1KUY A;  2Q4Y A;  2FCK A;  2QIR A;  3MGD A;  1I21 A;  4FD7 A;  2Q4V A;  1PUA A;  1YVK A;  2FIW A;  2PSW A;  2PR8 A;  1RXT A;  4QUS A;  3PZJ A;  5KTD A;  4KOV A;  2KCW A;  4M85 A;  3GY9 A;  3RYO A;  2B3U A;  3EXN A;  3DNS A;  4YFJ A;  2BUE A;  4KOS A;  2PQ8 A;  3F0A A;  3ZJ0 A;  3H4Q A;  4XPD B;  3CXQ A;  3T9Y A;  4PK3 A;  1OZP A;  2BL1 A;  2B3V A;  4QC6 A;  3S6G A;  3C26 A;  3FNC A;  3BJ7 A;  4FD5 A;  4JLY A;  2FS5 A;  1QST A;  5HMN A;  3BJ8 A;  3R9E A;  2WPX A;  3CXS A;  3LOD A;  5HH1 A;  2CNS A;  1XIX A;  4PSX A;  2Z11 A;  3QB8 A;  4ONU A;  5C82 A;  3CXP A;  1YGH A;  4OAE A;  4LUA A;  3EO4 A;  3TO6 A;  1S7F A;  3R95 A;  4AVB A;  2AE6 A;  5EBV A;  2O28 A;  2K5T A;  4HNX B;  4XNH B;  2VI7 A;  4U9Z A;  1MJ9 A;  4AVA A;  4KUA A;  4LX9 A;  1YR0 A;  1Y9K A;  2X7B A;  3D3S A;  2ZW7 A;  2ZW5 A;  3P2H A;  5JQ4 A;  4JJX A;  5KTC A;  2BEI A;  2P6E A;  4H89 A;  3TO7 A;  4F6A A;  2AJ6 A;  3W91 A;  3DR6 A;  2HUZ A;  2Q7B A;  2Z0Z A;  1Q2Y A;  1XEB A;  1CM0 A;  2Q04 A;  1J4J A;  1Q2D A;  2FL4 A;  4PV6 A;  3VWE A;  4JWP A;  1MK4 A;  3JUW A;  3FB3 A;  4AVC A;  2G0B A;  4I49 A;  3TO9 A;  3D8P A;  4AG7 A;  4CRY B;  3LD2 A;  3P2F A;  2Q0Y A;  2WPW A;  4E0A A;  1I12 A;  5F49 A;  3SXN A;  4QVT A;  2D4P A;  2J8M A;  3FIX A;  1YK3 A;  2ATR A;  3IGR A;  2B58 A;  1XE4 A;  2EVN A;  2C27 A;  3TTH A;  4UBR A;  4KOY A;  5DWM A;  3R1K A;  4F0Y A;  3R9F A;  1ON0 A;  1BOB A;  4FD6 A;  1U6M A;  3UY5 A;  2CNM A;  3NE7 A;  1Y7R A;  5F46 A;  4DNC A;  1VKC A;  1WWZ A;  4KVO E;  4KOT A;  3R96 A;  1P0H A;  2R8V A;  5KTA A;  1M44 A;  2Z10 A;  3N7Z A;  3JVN A;  4XPL A;  2G3A A;  1K4J A;  2IL4 A;  2ZW6 A;  1Q2C A;  2FIA A;  1YX0 A;  4H6Z A;  1NSL A;  1RO5 A;  3W6X A;  4QB9 A;  2P6F A;  1Z9U A;  2JDC A;  1I1D A;  2FSR A;  1Z4R A;  4L89 A;  1IYL A;  3FBU A;  2R7H A;  2J8N A;  4EVY A;  2CY2 A;  3S6F A;  4KOX A;  2VBQ A;  3W6S A;  4GS4 A;  5F47 A;  2JDD A;  3SHP A;  2EUI A;  3EY5 A;  5I0C A;  1CJW A;  2OH1 A;  2ZXV A;  2FT0 A;  2P6G A;  2I00 A;  1M4D A;  1S60 A;  2NMT A;  2VZZ A;  2R1I A;  4R3L A;  4RI1 A;  2GIV A;  3B8G A;  1P4N A;  4CS0 B;  4NEX A;  1M1D A;  4R87 A;  2FXF A;  2HQY A;  3SXO A;  4HKF A;  1M4I A;  3I9S A;  3PP9 A;  1QSO A;  3GKR A;  4MJ8 A;  2P0W A;  1KZF A;  4KLV A;  5GCN A;  4JD6 A;  4NCZ A;  4U9Y A;  1QSR A;  5IV0 A;  4KOU A;  1MJA A;  1YLE A;  4Y49 C;  4KVM E;  1XF8 A;  1S5K A;  1PU9 A;  5IX3 A;  3V8I A;  4X5K A;  4CAV A;  2PC1 A;  4NXY A;  4HNW B;  4L8A A;  2OZU A;  3TE4 A;  2REE A;  4QBJ A;  5JPH A;  4KOR A;  1KUX A;  4OAD A;  2FE7 A;  2GE3 A;  1XMT A;  5FVJ A;  3TOB A;  2PDO A;  3D2M A;  4JXR A;  3TFY A;  2I79 A;  1S3Z A;  2PRB A;  2R98 A;  4E2A A;  2ZPA A;  3OWC A;  4NSQ A;  4UA3 A;  1YRE A;  2DXQ A;  2RC4 A;  4RS2 A;  3WR7 A;  4HNY B;  4PK2 A;  4J3G A;  1S7K A;  3DSB A;  1IID A;  4CAW A;  1FY7 A;  4KOW A;  4AB7 A;  4BMH A;  4KZT A;  2J8R A;  1QSM A;  4JXQ A;  1VHS A;  2HV2 A;  1SQH A;  4IUS A;  1GHE A;  3IWG A;  3KKW A;  5J8C A;  1R57 A;  2VXK A;  4R9M A;  4U5Y A;  1V0C A;  2GAN A;  5C88 A;  5EC4 A;  5ISV A;  3TOA A;  1B6B A;  3S6K A;  2Y0M A;  1LRZ A;  1M4G A;  4PSW A;  4MBU A;  5F48 A;  2G3T A;  3I3G A;  4AG9 A;  3EC4 A;  1N71 A;  2OU2 A;  2OZH A;  5CNP A;  2OZG A;  2D4O A;  3DR8 A;  4Y49 B;  3PGP A;  3EFA A;  2QEC A;  3R9G A;  2REF A;  2B5G A;  3T90 A;  1Z4E A;  4B5P A;  4XPK A;  2B5G B;  3G3S A;  4B5P B;  4II9 A;  1QSN A;  1NE9 A;  2A4N A;  1MJB A;  4CAX A;  2JEV A;  4FD4 A;  2PR1 A;  1WK4 A;  4H6U A;  3D2P A;  1L0C A;  4M3S A;  1IIC A;  1TIQ A;  4XPD C;  3E0K A;  1IYK A;  5H86 A;  3K9U A;  4B5O A;  3BLN A;  2H5M A;  4MHD A;  3VWD A;  2OB0 A;  4NF1 A;  3QAH A;  1YVO A;  3DDD A;  4E8O A;  1IB1 E;  3F5B A;  1BO4 A;  4MY0 A;  4UWI A;  1UFH A;  5IB0 A;  2F5I A;  3FXT A;  4IF5 A;  3FRM A;  4K30 A;  1KUV A;  3TT2 A;  2VEZ A;  5E96 A;  4R57 A;  4CRZ B;  4UWJ A;  2Q44 A;  1NMT A;  1B87 A;  2VZY A;  3ZZI A;  2B4B A;  3TCV A;  5H84 A;  3GYA A;  4OLL A;  2B4D A;  2JLM A;  1S7L A;  3G8W A;  2B4D B;  5J8F A;  4KLW A;  2CNT A;  4XNH C;  4ZBG A;  2VQY A;  3F8K A;  2ARH A;  2ZW4 A; 
#chains in the Genus database with same CATH topology
 4MY3 A;  4JZ0 A;  1CG2 A;  4CPA A;  4ZY2 A;  3S6H A;  2JBJ A;  4Q7A A;  4NGS A;  5DWN A;  1Y9W A;  4R3K A;  4YGO A;  4MFP A;  2EK9 A;  2PJA A;  4YRH A;  2BO9 A;  4NFR A;  4ORF A;  3LMS A;  2QML A;  2QVP A;  1CBX A;  4MI4 A;  3FYN A;  1YQE A;  2YNE A;  4KVX A;  3RNZ A;  2ZOF A;  4KUB A;  4KSI A;  4MXU A;  2BSW A;  1S7N A;  1KUY A;  1HDU A;  1YW4 A;  2Q4Y A;  2FCK A;  2QIR A;  3MGD A;  1I21 A;  4F0X A;  4FD7 A;  2C1C A;  1CPS A;  2Q4V A;  3VAT A;  1PUA A;  1YVK A;  2FIW A;  3KR4 A;  1X12 A;  2PSW A;  2PR8 A;  3IU2 A;  4IK2 A;  4OC1 A;  1RXT A;  2J9A A;  4QUS A;  4CYP A;  2PJB A;  2EBJ A;  3PZJ A;  5KTD A;  2YGW A;  4KOV A;  2KCW A;  4K3N A;  4M85 A;  3GY9 A;  5ELY A;  4MHY A;  3SI1 A;  4X8I A;  3RYO A;  5HVG A;  2B3U A;  3EXN A;  3DNS A;  2ZOG A;  3PB7 X;  4YFJ A;  2PJ2 A;  2FVG A;  2BUE A;  4KOS A;  2PQ8 A;  3F0A A;  3ZJ0 A;  3H4Q A;  4XPD B;  3CXQ A;  1DTD A;  3T9Y A;  4PK3 A;  3BI0 A;  1OZP A;  2BL1 A;  2B3V A;  4QC6 A;  4OID A;  3C26 A;  3FNC A;  3S6G A;  3B3V A;  4P4F A;  1AMP A;  1ELM P;  4FAI A;  3BJ7 A;  1IU8 A;  1ZG9 A;  4CYQ A;  4FD5 A;  4JLY A;  2GLJ A;  2ODF A;  2ZEF A;  4GM5 A;  2CXA A;  2FS5 A;  3JRU A;  4MRI A;  4R6T A;  1QST A;  3GIU A;  2Z3M A;  5HMN A;  4P4J A;  3BJ8 A;  3R9E A;  1ZG7 A;  4Q36 A;  2WPX A;  3CXS A;  3LOD A;  5HH1 A;  2CNS A;  3HUV A;  4UFX A;  3IJ3 A;  1XIX A;  4PSX A;  2Z11 A;  3QB8 A;  4ONU A;  4P45 A;  5A27 A;  3FEE A;  3KGQ A;  1VIX A;  4M6G A;  2RFH A;  5C82 A;  3KHZ A;  3CXP A;  4UCP A;  1YGH A;  3LWU A;  1Z5R A;  1YLO A;  4OAE A;  3LAC A;  4LUA A;  1Z8W A;  5A28 A;  3D7D A;  3EO4 A;  3D7F A;  4F9V A;  3TO6 A;  1S7F A;  4FWU A;  4R7M A;  2EK8 A;  3R95 A;  4AVB A;  4Z65 A;  4C7I A;  1TKJ A;  2AE6 A;  5EBV A;  4BIN A;  2AFS A;  3IO1 A;  2O28 A;  5J1Q A;  4FBE A;  2Q4Z A;  3B2Y A;  3KQX A;  1HEE A;  3L2N A;  4MFJ A;  1CP6 A;  2K5T A;  3H8F A;  4HNX B;  4XNH B;  3TC8 A;  2VI7 A;  4OP4 A;  1LCP A;  4MCQ A;  3D4U A;  1XJO A;  3FX6 A;  3IU1 A;  4U9Z A;  1MJ9 A;  4AVA A;  4KUA A;  3K2K A;  4BD9 A;  4LX9 A;  4R76 A;  4RUH A;  2QYV A;  2CTC A;  3VH9 A;  1YR0 A;  4P4B A;  1Y9K A;  4MCR A;  1Z8X A;  2EWB A;  1Z8T A;  2X7B A;  4BBH A;  2PJ1 A;  2ZW7 A;  1LAN A;  2ZW5 A;  3D3S A;  3P2H A;  3V7Z A;  1IOI A;  5JQ4 A;  4WWV A;  1TF9 A;  4JJX A;  4NGT A;  3IFE A;  2BEI A;  5HXD A;  5KTC A;  2P6E A;  4UFV A;  1Y7E A;  3B35 A;  1ARM A;  4H89 A;  4UIA A;  3SJX A;  3TO7 A;  2AJ6 A;  4F6A A;  2AFM A;  7CPA A;  2ZED A;  1AYE A;  5G1Z A;  3RAM A;  4ZY1 A;  5LRG A;  3S9L A;  4F8Z A;  3IWE A;  3BHX A;  3NH4 A;  5D8N A;  3W91 A;  3DR6 A;  3WC5 A;  2HUZ A;  4OME A;  2Q7B A;  2Z0Z A;  1Q2Y A;  1XEB A;  1CM0 A;  1XFO A;  4ZYQ A;  1Z8L A;  2CTB A;  1TXR A;  5K8O A;  2Q04 A;  3KHX A;  3PEI A;  4ZGY B;  3B7I A;  2O53 A;  3B3S A;  5G21 A;  1J4J A;  1Q2D A;  1CX8 A;  2FL4 A;  4PV6 A;  3VWE A;  4JWP A;  1MK4 A;  2V8V A;  2Z3P A;  2PIZ A;  3JUW A;  3A9L A;  3FB3 A;  4AVC A;  2G0B A;  4I49 A;  3TO9 A;  2DEA A;  3D8P A;  2ZEM A;  2YND A;  4AG7 A;  4MCP A;  4CRY B;  3LD2 A;  5K8M A;  5LYL A;  4UEF A;  3CZX A;  3P2F A;  3SJE A;  2Q0Y A;  2WPW A;  4E0A A;  1I12 A;  1IY7 A;  4KSA A;  4PXD A;  5F49 A;  2GFQ A;  4NGQ A;  3SXN A;  2C6C A;  4QVT A;  4CGN A;  2D4P A;  2J8M A;  3FIX A;  3MRU A;  4KS9 A;  1YK3 A;  2ATR A;  4A39 A;  5JGF A;  3IGR A;  5HVH A;  4Q38 A;  2B58 A;  3H5Z A;  1XE4 A;  2EVN A;  2C27 A;  4P4E A;  3TTH A;  4DUK A;  4UBR A;  5I4M A;  2G9D A;  2Z3L A;  4KOY A;  2WZN A;  1EE3 P;  4UCM A;  5DWM A;  4PQA A;  5D29 A;  3R1K A;  4M6H A;  4F0Y A;  1LFW A;  3CDX A;  5JH9 A;  3R9F A;  1ON0 A;  1BOB A;  4FD6 A;  4C2Y A;  2DPS A;  4W9Y A;  1U6M A;  1YSJ A;  3UY5 A;  2CNM A;  3NE7 A;  1Y7R A;  4C2X A;  5F46 A;  4P44 A;  4DNC A;  1VKC A;  3D7H A;  4OC5 A;  2PJC A;  1WWZ A;  4KVO E;  4KOT A;  3R96 A;  1P0H A;  4C7H A;  2R8V A;  3GUX A;  3T8W A;  5KTA A;  1M44 A;  2Z10 A;  1TKF A;  3N7Z A;  3JVN A;  4XPL A;  4MFL A;  4G1P A;  2G3A A;  1K4J A;  2IL4 A;  2ZEP A;  5BWA B;  3CPA A;  4LQ6 A;  4OC3 A;  2ZW6 A;  1Q2C A;  1ARL A;  2FIA A;  1YX0 A;  1BLL E;  4H6Z A;  4LQG A;  8CPA A;  1QMU A;  1NSL A;  2Z3O A;  3H8G A;  1RO5 A;  3W6X A;  5K8N A;  4DJL A;  4QB9 A;  4C2Z A;  4NGM A;  3ISZ A;  5AGE A;  2P6F A;  3VAR A;  1Z9U A;  2JDC A;  1I1D A;  2FSR A;  1Z4R A;  2YNC C;  2O4H A;  4L89 A;  3NE8 A;  2AFX A;  1IYL A;  2PIY A;  2VL1 A;  5AG6 A;  3FBU A;  1TF8 A;  1FNO A;  2F8H A;  3BI1 A;  2R7H A;  1ZO0 A;  2J8N A;  1F2P A;  1RTQ A;  4EVY A;  5DS0 A;  5LYD A;  2CY2 A;  5LYI A;  4A37 A;  2ZEO A;  3S6F A;  4KOX A;  2PJ4 A;  2VBQ A;  4OC2 A;  4CGO A;  3W6S A;  4GS4 A;  5F47 A;  4ONW A;  2JDD A;  3I1U A;  3SHP A;  3CPX A;  3KZW A;  3PB8 X;  2EUI A;  3B3C A;  4B11 A;  3EY5 A;  5I0C A;  1CJW A;  4OKO A;  5IB9 A;  4NJR A;  5THW A;  4O23 A;  4A2Z A;  2OH1 A;  4GXH A;  2AFW A;  2ZXV A;  2FT0 A;  3DLJ A;  2P6G A;  1LAP A;  2I00 A;  1M4D A;  1S60 A;  2OR4 A;  4B6Z A;  2NMT A;  2VZZ A;  2R1I A;  4R3L A;  3KI9 A;  4RI1 A;  2GIV A;  2PJ0 A;  3B8G A;  1Y0Y A;  3D67 A;  5EMI A;  1P4N A;  3PB4 X;  5LRJ A;  4NEX A;  4CS0 B;  4WJB A;  1M1D A;  3V38 A;  4R87 A;  2FXF A;  2C6G A;  2NSM A;  3S9M A;  2WSA A;  4P10 A;  2HQY A;  2IMO A;  5LYF A;  3SXO A;  4CAE A;  4HKF A;  2C6P A;  4UF4 A;  1M4I A;  3B3T A;  2I3C A;  3I9S A;  3IIB A;  3PP9 A;  1QSO A;  2V8G A;  3GKR A;  4M6I A;  4UEE A;  3PRT A;  4MJ8 A;  1Z2L A;  4H2K A;  2P0W A;  1KZF A;  1TKH A;  2PJ3 A;  3PFE A;  4KLV A;  3RZA A;  2PRQ A;  4UEZ A;  4EFD A;  5F09 A;  1PYT B;  3IC1 A;  5GCN A;  4JD6 A;  4A31 A;  3CT9 A;  4NCZ A;  4U9Y A;  1QSR A;  5IV0 A;  4KOU A;  1MJA A;  1XMB A;  1YLE A;  3KAS A;  4NGN A;  4F9U A;  4PXE A;  4NGR A;  4MHP A;  2ANP A;  4Y49 C;  2ZEN A;  1OBR A;  4KVM E;  5CPA A;  4B12 A;  1GYT A;  1XF8 A;  1S5K A;  3KQZ A;  1PU9 A;  2DPT A;  2GLF A;  5LRK A;  2PJ5 A;  5IX3 A;  3V8I A;  4X5K A;  1XOV A;  4MHN A;  4NJQ A;  1DE4 C;  4CAV A;  3IWW A;  1A2Z A;  2PC1 A;  4NXY A;  4HNW B;  1ZLI A;  2V8H A;  3FMC A;  4JYW A;  1M4L A;  4A94 A;  4L8A A;  3KR5 A;  2AFO A;  2OZU A;  3TE4 A;  2REE A;  4AXV A;  4DYO A;  4X2T A;  1BPM A;  4B13 A;  4EWT A;  4QBJ A;  5JPH A;  3QAY A;  4KOR A;  4R8F A;  2YNC A;  1KUX A;  4OAD A;  1QQ9 A;  2ZEG A;  2V77 A;  2FE7 A;  4PPZ A;  2GE3 A;  4FUU A;  1F2O A;  1XMT A;  2XEF A;  5FVJ A;  4EME A;  5G22 A;  3TOB A;  2AFZ A;  2PDO A;  1JQG A;  3D2M A;  4TWE A;  4JXR A;  1H8L A;  2Z3K A;  5CBM A;  3TFY A;  3KL9 A;  2I79 A;  1S3Z A;  1VHE A;  2DF5 A;  3FF3 A;  2PRB A;  2IJZ A;  4RN7 A;  2R98 A;  4E2A A;  2ZPA A;  3OWC A;  4NSQ A;  4UA3 A;  4UFW A;  1YRE A;  2DXQ A;  2RC4 A;  4CYN A;  4RS2 A;  3BXM A;  3WR7 A;  2GU2 A;  1CP7 A;  4HNY B;  4PK2 A;  2PJ9 A;  4C68 A;  1BPN A;  1S7K A;  4J3G A;  1VHO A;  3DSB A;  3RBU A;  1IID A;  3PFO A;  4CAW A;  1FY7 A;  1XRY A;  4KOW A;  4AB7 A;  4BMH A;  4KZT A;  3NFZ A;  2J8R A;  3SI2 A;  1QSM A;  4JXQ A;  1VHS A;  4MCS A;  1R43 A;  2HV2 A;  4MFK A;  1SQH A;  4IUS A;  1GHE A;  2Q51 A;  4KSF A;  1NSA A;  4MMO A;  1YW6 A;  2QJ8 A;  3IWG A;  3KKW A;  4IAV A;  3DGV A;  3MN8 A;  4ZI6 A;  3FJU A;  1AUG A;  5J8C A;  1R57 A;  2VXK A;  4R9M A;  4U5Y A;  1V0C A;  2GAN A;  1F57 A;  3SJG A;  5C88 A;  4OIW A;  5EC4 A;  5ISV A;  3TOA A;  2PJ6 A;  1B6B A;  4P4I A;  3S6K A;  2PCU A;  2Y0M A;  2NYQ A;  1LRZ A;  1M4G A;  3GB0 A;  3IEH A;  4A38 A;  4A30 A;  4A32 A;  4PSW A;  4MBU A;  5F48 A;  3H8E A;  3WAB A;  2JBK A;  2G3T A;  4MHZ A;  3I3G A;  1Q7L A;  1IGB A;  4AG9 A;  4CAF A;  3EC4 A;  1N71 A;  4IHM A;  2AFU A;  4ZX8 A;  1ZG8 A;  2OU2 A;  2OZH A;  5CNP A;  2OZG A;  3PBE A;  1LOK A;  2ABZ A;  3NA6 A;  4PXB A;  2D4O A;  4TNU A;  5JM6 A;  5HVF A;  4OC4 A;  3WC7 A;  3DR8 A;  2HC9 A;  3TX8 A;  4Y49 B;  4CGP A;  3PGP A;  1CPX A;  3EFA A;  3NH5 A;  2QEC A;  2POK A;  2OOT A;  4A33 A;  1PCA A;  2GRE A;  3R9G A;  1JWQ A;  2EO8 A;  3S9N A;  1KWM A;  2BOA A;  2REF A;  4P4D A;  5G20 A;  1XBU A;  2B5G A;  3T90 A;  1LAM A;  1Z4E A;  4B5P A;  4XPK A;  2B5G B;  2XEG A;  3G3S A;  4B5P B;  2PVV A;  3FVL A;  4II9 A;  1QSN A;  1NE9 A;  2A4N A;  2PJ8 A;  1MJB A;  4CAX A;  2XEJ A;  3NH8 A;  1ELL P;  3WT4 A;  5AG7 A;  4P6Y A;  1IOF A;  4OC0 A;  5AG5 A;  2JEV A;  4FD4 A;  2PR1 A;  3FEC A;  2F7V A;  2PVW A;  1WK4 A;  4H6U A;  3D2P A;  3K9T A;  1L0C A;  4PXC A;  1FT7 A;  1IIC A;  1TIQ A;  2WYR A;  4M3S A;  4XPD C;  3FH4 A;  2JEW A;  2ZEE A;  1ZLH A;  3E0K A;  1IYK A;  5H86 A;  3K9U A;  4B5O A;  3BLN A;  1R3N A;  1BAV A;  3PB6 X;  1VGY A;  2XEI A;  2H5M A;  4MHD A;  3VWD A;  4YU9 A;  2OB0 A;  3SI0 A;  3FED A;  4NGP A;  4NF1 A;  3SJF A;  2HB6 A;  3QAH A;  1YVO A;  3DDD A;  4E8O A;  1IB1 E;  4CGM A;  3F5B A;  1BO4 A;  2WUU A;  4MY0 A;  3HLP A;  1UFH A;  4UWI A;  5IB0 A;  4MFZ A;  4B14 A;  2F5I A;  3PBB A;  3FXT A;  3PB9 X;  2Q43 A;  4IF5 A;  1Y0R A;  3FRM A;  4K30 A;  1X10 A;  1KUV A;  2V8D A;  2Q7S A;  2VEZ A;  3TT2 A;  3ISX A;  3GLJ A;  5E96 A;  3N5F A;  6CPA A;  4R57 A;  3D7G A;  1YME A;  4YWY A;  4ZY0 A;  4CYO A;  2IQ6 A;  4CRZ B;  2CIJ A;  4HPS A;  2BCO A;  4MFQ A;  4UIB A;  4UWJ A;  3RO0 A;  4B10 A;  2Q44 A;  1NMT A;  1B87 A;  1HDQ A;  2ZEH A;  1UWY A;  2RB7 A;  2VZY A;  3B3W A;  3D68 A;  5K8P A;  4X3R A;  3ZZI A;  2ZEL A;  2B4B A;  4UCN A;  3D66 A;  4ZX9 A;  3GYA A;  4OLL A;  5H84 A;  3TCV A;  3WC6 A;  4A95 A;  2CF4 A;  2B4D A;  2JLM A;  4CGL A;  5AG4 A;  3JTK A;  1S7L A;  2Z3N A;  3G8W A;  2B4D B;  2PE3 A;  5J8F A;  3QNV A;  4KLW A;  2CNT A;  4XNH C;  4ZBG A;  2VQY A;  3F8K A;  2ARH A;  2PJ7 A;  2ZW4 A; 
#chains in the Genus database with same CATH homology
 4MY3 A;  3S6H A;  5DWN A;  1Y9W A;  4R3K A;  4YGO A;  4MFP A;  4YRH A;  4ORF A;  2QML A;  4MI4 A;  3FYN A;  2YNE A;  4KVX A;  4KUB A;  2BSW A;  1S7N A;  1KUY A;  2Q4Y A;  2FCK A;  2QIR A;  3MGD A;  1I21 A;  4F0X A;  4FD7 A;  2Q4V A;  1PUA A;  1YVK A;  2FIW A;  2PSW A;  2PR8 A;  3IU2 A;  1RXT A;  4QUS A;  4CYP A;  3PZJ A;  5KTD A;  2YGW A;  4KOV A;  2KCW A;  4M85 A;  3GY9 A;  3RYO A;  2B3U A;  3EXN A;  3DNS A;  4YFJ A;  2BUE A;  4KOS A;  2PQ8 A;  3F0A A;  3ZJ0 A;  3H4Q A;  4XPD B;  3CXQ A;  3T9Y A;  4PK3 A;  1OZP A;  2BL1 A;  2B3V A;  4QC6 A;  3S6G A;  3C26 A;  3FNC A;  3BJ7 A;  4CYQ A;  4FD5 A;  4JLY A;  2CXA A;  2FS5 A;  1QST A;  2Z3M A;  5HMN A;  3BJ8 A;  3R9E A;  4Q36 A;  2WPX A;  3CXS A;  3LOD A;  5HH1 A;  2CNS A;  4UFX A;  1XIX A;  4PSX A;  2Z11 A;  3QB8 A;  4ONU A;  5A27 A;  5C82 A;  3CXP A;  4UCP A;  1YGH A;  4OAE A;  4LUA A;  5A28 A;  3EO4 A;  3TO6 A;  1S7F A;  3R95 A;  4AVB A;  4C7I A;  2AE6 A;  5EBV A;  2O28 A;  4MFJ A;  2K5T A;  4HNX B;  4XNH B;  2VI7 A;  3IU1 A;  4U9Z A;  1MJ9 A;  4AVA A;  4KUA A;  4LX9 A;  1YR0 A;  1Y9K A;  4BBH A;  2X7B A;  3D3S A;  2ZW7 A;  2ZW5 A;  3P2H A;  5JQ4 A;  4JJX A;  5KTC A;  2BEI A;  2P6E A;  4UFV A;  4H89 A;  3TO7 A;  4F6A A;  2AJ6 A;  5G1Z A;  3IWE A;  3W91 A;  3DR6 A;  2HUZ A;  2Q7B A;  2Z0Z A;  1Q2Y A;  1XEB A;  1CM0 A;  2Q04 A;  4ZGY B;  5G21 A;  1J4J A;  1Q2D A;  2FL4 A;  4PV6 A;  3VWE A;  4JWP A;  1MK4 A;  2Z3P A;  3JUW A;  3A9L A;  3FB3 A;  4AVC A;  4I49 A;  2G0B A;  3TO9 A;  3D8P A;  4AG7 A;  2YND A;  4CRY B;  3LD2 A;  3P2F A;  2Q0Y A;  2WPW A;  4E0A A;  1I12 A;  4KSA A;  5F49 A;  3SXN A;  4QVT A;  4CGN A;  2D4P A;  2J8M A;  3FIX A;  4KS9 A;  1YK3 A;  2ATR A;  3IGR A;  4Q38 A;  2B58 A;  3H5Z A;  1XE4 A;  2EVN A;  2C27 A;  3TTH A;  4UBR A;  2Z3L A;  4KOY A;  4UCM A;  5DWM A;  3R1K A;  4F0Y A;  3R9F A;  1ON0 A;  1BOB A;  4FD6 A;  4C2Y A;  2DPS A;  1U6M A;  3UY5 A;  2CNM A;  3NE7 A;  1Y7R A;  4C2X A;  5F46 A;  4DNC A;  1VKC A;  1WWZ A;  4KVO E;  4KOT A;  3R96 A;  1P0H A;  4C7H A;  2R8V A;  5KTA A;  1M44 A;  2Z10 A;  3N7Z A;  3JVN A;  4XPL A;  4MFL A;  5BWA B;  2G3A A;  1K4J A;  2IL4 A;  2ZW6 A;  1Q2C A;  2FIA A;  1YX0 A;  4H6Z A;  1NSL A;  2Z3O A;  1RO5 A;  3W6X A;  4QB9 A;  4C2Z A;  5AGE A;  2P6F A;  1Z9U A;  2JDC A;  1I1D A;  2FSR A;  1Z4R A;  2YNC C;  4L89 A;  1IYL A;  5AG6 A;  3FBU A;  2R7H A;  1ZO0 A;  2J8N A;  4EVY A;  2CY2 A;  3S6F A;  4KOX A;  2VBQ A;  4CGO A;  3W6S A;  4GS4 A;  5F47 A;  2JDD A;  3SHP A;  4B11 A;  2EUI A;  3EY5 A;  5I0C A;  1CJW A;  4A2Z A;  2OH1 A;  2ZXV A;  2FT0 A;  2P6G A;  2I00 A;  1M4D A;  1S60 A;  2NMT A;  2VZZ A;  2R1I A;  4R3L A;  4RI1 A;  4CGP A;  2GIV A;  3B8G A;  1P4N A;  4CS0 B;  4NEX A;  1M1D A;  4R87 A;  2FXF A;  2WSA A;  2HQY A;  3SXO A;  4CAE A;  4HKF A;  1M4I A;  3I9S A;  3PP9 A;  1QSO A;  3GKR A;  4MJ8 A;  2P0W A;  1KZF A;  4KLV A;  5GCN A;  4JD6 A;  4NCZ A;  4U9Y A;  1QSR A;  5IV0 A;  4KOU A;  1MJA A;  1YLE A;  4Y49 C;  4KVM E;  4B12 A;  1XF8 A;  1S5K A;  1PU9 A;  2DPT A;  5IX3 A;  3V8I A;  4X5K A;  4CAV A;  2PC1 A;  4NXY A;  4HNW B;  4L8A A;  2OZU A;  3TE4 A;  2REE A;  4QBJ A;  4B13 A;  5JPH A;  4KOR A;  2YNC A;  1KUX A;  4OAD A;  2FE7 A;  2GE3 A;  1XMT A;  5FVJ A;  5G22 A;  3TOB A;  2PDO A;  3D2M A;  4JXR A;  2Z3K A;  3TFY A;  2I79 A;  1S3Z A;  2PRB A;  2R98 A;  4E2A A;  2ZPA A;  3OWC A;  4NSQ A;  4UA3 A;  4UFW A;  1YRE A;  2DXQ A;  2RC4 A;  4CYN A;  4RS2 A;  3WR7 A;  4HNY B;  4PK2 A;  4C68 A;  4J3G A;  1S7K A;  3DSB A;  1IID A;  4CAW A;  1FY7 A;  4KOW A;  4AB7 A;  4BMH A;  4KZT A;  2J8R A;  1QSM A;  4JXQ A;  1VHS A;  2HV2 A;  4MFK A;  1SQH A;  4IUS A;  1GHE A;  4KSF A;  3IWG A;  3KKW A;  5J8C A;  1R57 A;  2VXK A;  4R9M A;  4U5Y A;  1V0C A;  2GAN A;  5C88 A;  5EC4 A;  5ISV A;  3TOA A;  1B6B A;  3S6K A;  2Y0M A;  1LRZ A;  1M4G A;  4A30 A;  4A32 A;  4PSW A;  4MBU A;  5F48 A;  2G3T A;  3I3G A;  4AG9 A;  4CAF A;  3EC4 A;  1N71 A;  2OU2 A;  2OZH A;  5CNP A;  2OZG A;  2D4O A;  3DR8 A;  4Y49 B;  3PGP A;  3EFA A;  2QEC A;  4A33 A;  3R9G A;  2REF A;  5G20 A;  2B5G A;  3T90 A;  1Z4E A;  4B5P A;  4XPK A;  2B5G B;  3G3S A;  4B5P B;  4II9 A;  1QSN A;  1NE9 A;  2A4N A;  1MJB A;  4CAX A;  5AG7 A;  5AG5 A;  2JEV A;  4FD4 A;  2PR1 A;  1WK4 A;  4H6U A;  3D2P A;  1L0C A;  4A31 A;  4M3S A;  1IIC A;  1TIQ A;  4XPD C;  3E0K A;  1IYK A;  5H86 A;  3K9U A;  4B5O A;  3BLN A;  2H5M A;  4MHD A;  3VWD A;  2OB0 A;  4NF1 A;  3QAH A;  1YVO A;  3DDD A;  4E8O A;  1IB1 E;  4CGM A;  3F5B A;  1BO4 A;  2WUU A;  4MY0 A;  4UWI A;  1UFH A;  5IB0 A;  4MFZ A;  4B14 A;  2F5I A;  3FXT A;  4IF5 A;  3FRM A;  4K30 A;  1KUV A;  3TT2 A;  2VEZ A;  5E96 A;  4R57 A;  4CYO A;  4CRZ B;  4MFQ A;  4UWJ A;  4B10 A;  2Q44 A;  1NMT A;  1B87 A;  2VZY A;  3ZZI A;  2B4B A;  4UCN A;  3TCV A;  5H84 A;  3GYA A;  4OLL A;  4A95 A;  2B4D A;  2JLM A;  4CGL A;  5AG4 A;  3JTK A;  1S7L A;  2Z3N A;  3G8W A;  2B4D B;  5J8F A;  4KLW A;  2CNT A;  4XNH C;  4ZBG A;  2VQY A;  3F8K A;  2ARH A;  2ZW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...