4OAEA

Crystal structure of a gnat superfamily acetyltransferase pa4794 c29a/c117a/y128a mutant in complex with chloramphenicol
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
160
structure length
160
Chain Sequence
HMQLSHRPAETGDLETVAGFPQDRDELFYAYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISAFNANAAGLLLATQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a GNAT superfamily acetyltransferase PA4794 C29A/C117A/Y128A mutant in complex with chloramphenicol
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
molecule keywords GNAT superfamily acetyltransferase PA4794
total genus 43
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2014-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4oaeA00
1S7NA 1Y9WA 2BL1A 2EVNA 3P2HA 2QECA 5FVJA 2VEZA 3TOBA 4NF1A 2JDCA 1KUXA 4RI1A 5JPHA 4XNHC 1I21A 2D4OA 4M85A 3FB3A 1IB1E 4CRZB 2R1IA 4KOWA 2X7BA 3H4QA 2J8RA 1IICA 2R98A 2PQ8A 4PV6A 4DNCA 1UFHA 2JEVA 2HQYA 4H6UA 4E0AA 1P0HA 2Q0YA 4JWPA 3R9FA 2NMTA 1U6MA 3G3SA 4I49A 4E2AA 3GKRA 4KZTA 1SQHA 2C27A 3S6KA 5F48A 3D8PA 5E96A 5C82A 4JJXA 3FIXA 2OZGA 3TCVA 2JDDA 2CNMA 4R3KA 3SHPA 3PZJA 2F5IA 3D3SA 1M1DA 3T90A 1MJ9A 4IUSA 3RYOA 4EVYA 4FD7A 1YX0A 2PRBA 3TE4A 2G3TA 4K30A 2JLMA 2BUEA 4PSWA 2OZHA 4UWJA 1S5KA 1V0CA 4PSXA 2B4BA 4KOYA 4LX9A 4FD4A 4HNYB 2VQYA 2K5TA 2P6FA 2FIWA 3CXQA 1VKCA 2R7HA 1Z4RA 1Q2DA 3T9YA 1Q2YA 1S7KA 4MY0A 1XE4A 2VI7A 4OAEA 3S6FA 5IB0A 4NSQA 1K4JA 4NXYA 3BJ8A 2FIAA 3TFYA 2D4PA 2Q04A 4UBRA 3TO9A 3SXNA 5JQ4A 3VWDA 1VHSA 4CAWA 4MI4A 3R9EA 2B3VA 3ZZIA 2Z10A 2HV2A 3MGDA 3R95A 2OB0A 1QSTA 1KZFA 3F0AA 4AB7A 5IV0A 1I12A 4BMHA 3DR8A 2FSRA 3I9SA 4MY3A 4YFJA 1ON0A 1IIDA 4R9MA 1BO4A 2G3AA 3EXNA 4KLVA 3DDDA 4F6AA 1MJAA 2Z11A 4ZBGA 1M4GA 2ZPAA 3R9GA 3R96A 1YREA 3F5BA 4AVBA 3KKWA 3CXPA 3NE7A 4KOUA 2ATRA 4KOXA 4PK2A 4B5OA 4KVXA 4MJ8A 3JUWA 5F47A 2J8MA 3I3GA 4U9ZA 1M4IA 4B5PA 2FE7A 2HUZA 2VXKA 3ZJ0A 4KUBA 2KCWA 4Y49C 1YGHA 1N71A 1S60A 4RS2A 4ORFA 2Q4VA 2PC1A 5EBVA 3SXOA 4QUSA 2PR8A 3WR7A 1LRZA 4FD6A 4JD6A 3B8GA 4NEXA 4UWIA 2Z0ZA 4X5KA 2OU2A 5C88A 2BEIA 5EC4A 2ZW4A 2FXFA 2RC4A 2GIVA 1Q2CA 1QSRA 4QB9A 4CRYB 1J4JA 2GE3A 2VZZA 1RXTA 1OZPA 4YRHA 5ISVA 1Y9KA 2O28A 4NCZA 3LODA 1WWZA 3QAHA 1CM0A 1Z4EA 1YVKA 4QC6A 2VZYA 2FS5A 2ZXVA 5H86A 1NMTA 5CNPA 3PP9A 1QSMA 4YGOA 3BLNA 1B6BA 2CNSA 3C26A 4LUAA 1PU9A 2FL4A 5F49A 2QIRA 2BSWA 3V8IA 1BOBA 4KOVA 4PK3A 4AG7A 4B5PB 2ZW6A 2B5GB 3W91A 1IYKA 3FBUA 2AJ6A 2A4NA 3TO6A 4HNWB 1WK4A 2FCKA 3FXTA 3K9UA 4XPDC 4JXQA 3JVNA 4KOSA 4KVME 2I79A 4R87A 1CJWA 2EUIA 4QBJA 1R57A 1FY7A 1MK4A 4IF5A 5KTDA 2Q44A 1P4NA 1GHEA 3VWEA 1QSOA 1IYLA 4OADA 4E8OA 3R1KA 4KLWA 3D2MA 4OLLA 1L0CA 2Y0MA 1KUYA 5HMNA 5KTCA 2Q7BA 1B87A 3F8KA 3IWGA 4H6ZA 4FD5A 3EFAA 4AVAA 4U5YA 1S7FA 2FT0A 2ZW7A 5KTAA 2AE6A 4CS0B 1S7LA 4II9A 1M4DA 1KUVA 4XPLA 3EC4A 3PGPA 4XPKA 4M3SA 5H84A 2B5GA 4JLYA 2B4DB 2VBQA 3G8WA 2QMLA 1XEBA 1Y7RA 4KVOE 4H89A 2P6GA 3GYAA 1QSNA 3UY5A 3TTHA 3S6HA 4XPDB 4F0YA 4ONUA 3OWCA 3DSBA 3LD2A 1YVOA 4HKFA 5DWMA 2GANA 3D2PA 1NSLA 2REEA 2CNTA 3DR6A 4KUAA 4L8AA 3EO4A 3EY5A 4KOTA 5IX3A 5J8CA 1PUAA 1YK3A 3TT2A 1S3ZA 2PSWA 3W6SA 3QB8A 2Q4YA 2H5MA 2ARHA 4AVCA 2R8VA 2B3UA 4JXRA 4MHDA 4GS4A 2I00A 2CY2A 2DXQA 2REFA 4HNXB 1Z9UA 2WPXA 2J8NA 3BJ7A 1I1DA 4XNHB 3IGRA 3N7ZA 4QVTA 3P2FA 1YR0A 1M44A 4R57A 4UA3A 3GY9A 1RO5A 4U9YA 1NE9A 2OZUA 3S6GA 2B4DA 3FYNA 3E0KA 4CAXA 3FNCA 5DWNA 1YLEA 1MJBA 4J3GA 4L89A 1XMTA 2PR1A 2ZW5A 1XF8A 2B58A 3DNSA 3TO7A 4CAVA 5HH1A 2P0WA 5I0CA 4MBUA 2WPWA 5J8FA 4Y49B 1TIQA 3W6XA 5GCNA 3CXSA 2PDOA 2P6EA 2OH1A 2G0BA 3FRMA 3TOAA 2IL4A 4KORA 4R3LA 5F46A 4AG9A 1XIXA
chains in the Genus database with same CATH superfamily
3WT4A 1S7NA 1Y9WA 2BL1A 4UIBA 2EVNA 2PJCA 3P2HA 3PEIA 1FNOA 2PJ9A 2QECA 5FVJA 1HEEA 2VEZA 3TOBA 4NF1A 2JDCA 2PJ2A 3D7FA 4OC4A 3QNVA 1KUXA 2ABZA 4RI1A 4PXBA 2YNEA 4MHPA 3IO1A 4RUHA 5JPHA 4XNHC 1ZLIA 2HC9A 4M6GA 5F09A 2PVWA 1I21A 2D4OA 3BXMA 1ZG9A 3PB4X 4M85A 3FB3A 1HDQA 2PCUA 5LRJA 1IB1E 1YSJA 4CRZB 2R1IA 4KOWA 2X7BA 3H4QA 1ZO0A 2J8RA 3BHXA 1IICA 2R98A 2PQ8A 4PV6A 1UWYA 2DPSA 3NA6A 3S9MA 3FJUA 1YW6A 4DNCA 4OC3A 1H8LA 1IU8A 3H8EA 1UFHA 2XEGA 5HVFA 2DF5A 2JEVA 2PIYA 3WABA 2HQYA 4H6UA 4E0AA 4FAIA 4C2XA 1ELLP 4A37A 1P0HA 1VHEA 2Q0YA 3PB9X 4JWPA 3R9FA 2NMTA 4MRIA 4UFWA 2G9DA 4K3NA 1U6MA 3G3SA 2NYQA 4I49A 4E2AA 3GKRA 4KZTA 1GYTA 2EO8A 4NGSA 5G1ZA 4MMOA 1SQHA 1A2ZA 2V8GA 2C27A 3S6KA 5F48A 3D8PA 3B2YA 5E96A 4CGPA 3VARA 5C82A 3NH5A 2PIZA 4X3RA 5JH9A 4JJXA 5G21A 2WSAA 4R8FA 1LCPA 1ARMA 3HLPA 5THWA 3FIXA 2OZGA 4F9VA 1F57A 3TCVA 3GB0A 4UCPA 3S9NA 3B35A 2JDDA 2CNMA 4R3KA 5G20A 3SHPA 3PZJA 2CXAA 4UFVA 3VATA 4Z65A 2F5IA 4GM5A 4EMEA 3D3SA 1M1DA 3T90A 4OIDA 4FBEA 1MJ9A 1F2PA 4IUSA 3RYOA 3LMSA 4EVYA 4FD7A 1YX0A 2PRBA 4HPSA 3TE4A 2G3TA 1Y0RA 1VIXA 3RAMA 3S9LA 4F8ZA 4K30A 2Z3PA 2JLMA 1BPNA 1Z8WA 2BUEA 4IHMA 4PSWA 2OZHA 2V8VA 4UWJA 3B3SA 3TX8A 1VGYA 4UEEA 4C2ZA 1S5KA 1R3NA 4MCRA 1V0CA 5D8NA 2PJ3A 4PSXA 2VL1A 2B4BA 4KOYA 5HXDA 4LX9A 5K8PA 3JTKA 4OKOA 4FD4A 4HNYB 4CAFA 2VQYA 2K5TA 4MFKA 5AG7A 3SI1A 1OBRA 4BD9A 2P6FA 3H8GA 4C2YA 2FIWA 3SJEA 2R7HA 1VKCA 3CXQA 5AG6A 2F7VA 4CGNA 1QMUA 1IOIA 1Z4RA 1Q2DA 2CF4A 3T9YA 1R43A 2Z3LA 5HVHA 1Q2YA 1QQ9A 1S7KA 4MY0A 2Q7SA 1XE4A 2BCOA 2RFHA 4P4EA 2VI7A 2Z3KA 4OAEA 4WWVA 3S6FA 5IB0A 1LAPA 4CYNA 4NSQA 3A9LA 2PJBA 1K4JA 4IAVA 1BLLE 2OOTA 5LYFA 4NXYA 3FEDA 3BJ8A 2FIAA 3TFYA 3IJ3A 4OC5A 2D4PA 2Q04A 3FH4A 4UBRA 4NGQA 1CPXA 5AGEA 3TO9A 3SXNA 5JQ4A 4OP4A 3VWDA 4KSIA 1VHSA 4CAWA 4ZY0A 2ODFA 4MI4A 3R9EA 2B3VA 2ZOGA 2Q51A 5HVGA 3ZZIA 4X8IA 3KR5A 4NJQA 2YNDA 4NJRA 4TWEA 4NGNA 1Y0YA 2EK9A 2Z10A 3IC1A 2EK8A 1TF8A 2GU2A 2HV2A 4KS9A 2IJZA 3MGDA 3R95A 2OB0A 1QSTA 1KZFA 3F0AA 4AB7A 4MCPA 3D4UA 4ZX8A 3B7IA 5IV0A 1I12A 3KI9A 4BMHA 4MFZA 3DR8A 4F0XA 2FSRA 3I9SA 4PQAA 4MY3A 4YFJA 2GLFA 1ON0A 5ELYA 1IIDA 4R6TA 3SJGA 4R9MA 2JEWA 1BO4A 1Z8TA 2G3AA 2Q4ZA 3EXNA 3B3VA 4KLVA 3DDDA 4F6AA 1MJAA 2Z11A 4MXUA 1IY7A 1M4GA 4Q7AA 4ZBGA 2ZEDA 3MN8A 1FT7A 2F8HA 2ZPAA 3R9GA 1BAVA 3R96A 3PRTA 5K8OA 3CDXA 1YREA 4EWTA 3F5BA 2PJ8A 4B13A 4AVBA 3KKWA 3L2NA 3CXPA 4A30A 2GREA 3IIBA 3NE7A 4KOUA 2ATRA 4KOXA 4PK2A 3DLJA 2ANPA 2ZELA 4KVXA 4B5OA 4CPAA 4MJ8A 3WC6A 3JUWA 4A33A 4P44A 5F47A 4C68A 3D66A 1JQGA 4PPZA 2V8DA 1LOKA 3SI0A 3LWUA 2J8MA 3I3GA 3ISZA 4UCNA 4PXCA 4M6HA 4U9ZA 2EWBA 1M4IA 4B5PA 2FE7A 2HUZA 5IB9A 4MFQA 1JWQA 4UF4A 2VXKA 1LFWA 3ZJ0A 2ZEGA 4A31A 2C6CA 4MHNA 4KUBA 2KCWA 1CBXA 1CX8A 2ZEPA 1YGHA 2PJ7A 4Y49C 1N71A 1S60A 3PFOA 4R7MA 4ZY1A 3D68A 4RS2A 4ORFA 1CP7A 2PC1A 2Q4VA 4P45A 5EBVA 3SXOA 4QUSA 5K8MA 2PR8A 4MFPA 3WR7A 1LRZA 2YNCC 4FD6A 4JD6A 3B8GA 4NEXA 4O23A 4UWIA 2Z0ZA 2ZEOA 2QVPA 5JM6A 1DE4C 2WZNA 2OU2A 1PYTB 4X5KA 5C88A 2BEIA 5EC4A 4JZ0A 4PXDA 2ZW4A 2FXFA 1YLOA 3FMCA 2RC4A 2YGWA 1XMBA 4A32A 2GIVA 1XJOA 5AG4A 3KHXA 1Q2CA 1QSRA 4WJBA 3KGQA 3B3TA 2POKA 2QJ8A 4OC0A 3KR4A 2PJ5A 2Q43A 4QB9A 2PVVA 4CRYB 1J4JA 2GE3A 2VZZA 2AFWA 4CGOA 1RXTA 1OZPA 2Z3OA 3CZXA 4YRHA 3HUVA 1Y9KA 2O28A 4NCZA 4CYOA 5ISVA 5LYLA 3GLJA 3LODA 3N5FA 1WWZA 2V8HA 3QAHA 4B6ZA 1CM0A 1Y7EA 3PB8X 3PBBA 1Z4EA 1YMEA 1YVKA 3D7DA 4QC6A 4BBHA 2VZYA 2FS5A 2XEJA 4CYPA 2PJ1A 2ZXVA 5H86A 1NMTA 4R76A 2OR4A 2ZEEA 5A27A 5CNPA 3IWEA 3PP9A 1QSMA 4YGOA 3BLNA 3KZWA 1B6BA 2ZEFA 4DJLA 3GUXA 2PJ6A 4MFJA 2CNSA 4CYQA 3C26A 4LUAA 4YU9A 1PU9A 2FL4A 2AFSA 4UIAA 1YW4A 4AG9A 3B3CA 5F49A 2QIRA 2BSWA 3V8IA 2AFUA 3BI1A 1BOBA 1IOFA 4KOVA 4PK3A 5EMIA 4AG7A 2DPTA 4P4DA 4B5PB 1DTDA 1Z8XA 2B5GB 1ARLA 2ZW6A 3W91A 1IYKA 3PB6X 4MHZA 3FBUA 5LRKA 2ZENA 2JBJA 3IU1A 2AJ6A 2PJAA 2A4NA 2Z3MA 4HNWB 4MCSA 3TO6A 1WK4A 2ZEHA 2FCKA 3DGVA 3FXTA 2PRQA 4NGPA 5LYDA 3K9UA 3RNZA 1Z2LA 4XPDC 4JXQA 3WC5A 3FF3A 3JVNA 4KOSA 4KVME 2I79A 4LQGA 4R87A 1CJWA 2JBKA 2V77A 2IQ6A 3CT9A 2EUIA 4QBJA 4NGMA 2I3CA 1R57A 1F2OA 1FY7A 2BOAA 1PCAA 2O4HA 1MK4A 4IF5A 3KQZA 3KQXA 5KTDA 1XRYA 2Q44A 3B3WA 1P4NA 5CPAA 3IWWA 1GHEA 3VWEA 1QSOA 1CG2A 4A2ZA 4B14A 3GIUA 4OC1A 3VH9A 1IYLA 4CAEA 3H8FA 4OADA 4B12A 2HB6A 4E8OA 4DYOA 2PJ0A 3R1KA 4LQ6A 4KLWA 4UCMA 4OC2A 1Z5RA 3D2MA 4P4FA 4OLLA 4CGLA 1L0CA 2Y0MA 4YWYA 5G22A 1KUYA 3CPAA 5HMNA 3RZAA 4MHYA 5KTCA 4M6IA 4OMEA 2Q7BA 2WUUA 2Z3NA 3NH8A 4P4IA 4GXHA 1EE3P 5LRGA 3PBEA 2IMOA 4P6YA 3NH4A 4ZYQA 1B87A 2RB7A 3F8KA 3IWGA 1CPSA 4H6ZA 2NSMA 4FD5A 2ZOFA 5AG5A 3EFAA 4AVAA 4NGTA 4DUKA 3PB7X 4IK2A 3D7GA 4U5YA 1S7FA 3IEHA 3IU2A 2FT0A 3V7ZA 3KL9A 2ZW7A 5KTAA 2AE6A 4CS0B 4H2KA 1S7LA 1ZG7A 4II9A 1M4DA 4RN7A 4A39A 1KUVA 4XPLA 2WYRA 4JYWA 3EC4A 1RTQA 3PGPA 4XPKA 2C1CA 3QAYA 4M3SA 5H84A 1CP6A 1LAMA 2B5GA 2B4DB 2VBQA 4JLYA 3G8WA 2QMLA 4Q38A 1XEBA 2CIJA 3H5ZA 1Y7RA 4G1PA 4H89A 4KVOE 1BPMA 1TF9A 1YQEA 3WC7A 2P6GA 5JGFA 1AYEA 2QYVA 4FWUA 2C6GA 3GYAA 1M4LA 1QSNA 1IGBA 3UY5A 4B11A 3TTHA 3S6HA 4XPDB 2GFQA 4F0YA 4ONUA 3OWCA 3DSBA 3LD2A 1YVOA 4HKFA 3SI2A 1KWMA 3ISXA 2GANA 5DWMA 5A28A 3D2PA 3KHZA 7CPAA 1NSLA 2YNCA 3NE8A 4FUUA 2REEA 2CNTA 1X10A 5D29A 3DR6A 2CTBA 4KUAA 4L8AA 3EO4A 3SJXA 3EY5A 4KOTA 5IX3A 2AFZA 3V38A 3T8WA 4A94A 5J8CA 1PUAA 1TKHA 4UEZA 3RO0A 2EBJA 2BO9A 1YK3A 4C7HA 3TT2A 4ZY2A 3JRUA 1S3ZA 2PSWA 3W6SA 3FVLA 1XFOA 1AUGA 2AFMA 2Q4YA 3QB8A 2H5MA 2J9AA 5J1QA 2ARHA 1Q7LA 3CPXA 4AVCA 2R8VA 2AFXA 2B3UA 4JXRA 4MHDA 4GS4A 2O53A 4ONWA 3K2KA 2I00A 4PXEA 2XEIA 1TKJA 1AMPA 4P10A 4UFXA 2ZEMA 2CY2A 2DXQA 4OIWA 1LANA 5I4MA 4C7IA 2REFA 5LYIA 4HNXB 1Z9UA 2WPXA 2J8NA 4KSFA 3RBUA 3BJ7A 3KASA 1TKFA 1I1DA 3LACA 3FX6A 4XNHB 3PFEA 3IGRA 3N7ZA 4QVTA 3P2FA 3SJFA 1YR0A 3FECA 3FEEA 4TNUA 1M44A 2CTCA 4R57A 1Z8LA 1TXRA 4A95A 4CGMA 6CPAA 4UA3A 2C6PA 2FVGA 3GY9A 3MRUA 4ZGYB 1RO5A 2PJ4A 4U9YA 4MCQA 1NE9A 3TC8A 5CBMA 5BWAB 2OZUA 3S6GA 2XEFA 5K8NA 1XBUA 2B4DA 3FYNA 3E0KA 1VHOA 4P4BA 4A38A 4KSAA 3K9TA 4CAXA 3FNCA 5DWNA 4ZI6A 4MFLA 1NSAA 1ZG8A 4EFDA 2GLJA 3D67A 1YLEA 4NFRA 5DS0A 1MJBA 1XOVA 4J3GA 4AXVA 1X12A 4L89A 1XMTA 2PR1A 3D7HA 2ZW5A 1XF8A 2B58A 3DNSA 3I1UA 4W9YA 3TO7A 4B10A 4CAVA 4ZX9A 2DEAA 5HH1A 2P0WA 5I0CA 4MBUA 1ELMP 2WPWA 3IFEA 8CPAA 5J8FA 4X2TA 4Y49B 4UEFA 1TIQA 3W6XA 2PE3A 5GCNA 3CXSA 2PDOA 2P6EA 4Q36A 1ZLHA 3BI0A 3NFZA 4NGRA 2OH1A 2G0BA 3FRMA 3TOAA 4F9UA 2IL4A 4KORA 4R3LA 5F46A 4BINA 1HDUA 2AFOA 1XIXA 4P4JA
chains in the Genus database with same CATH topology
1S7NA 1Y9WA 2BL1A 2EVNA 3P2HA 2QECA 5FVJA 2VEZA 3TOBA 4NF1A 2JDCA 1KUXA 4RI1A 2YNEA 5JPHA 4XNHC 1I21A 2D4OA 4M85A 3FB3A 1IB1E 4CRZB 2R1IA 4KOWA 2X7BA 3H4QA 1ZO0A 2J8RA 1IICA 2R98A 2PQ8A 4PV6A 2DPSA 4DNCA 1UFHA 2JEVA 2HQYA 4H6UA 4E0AA 4C2XA 1P0HA 2Q0YA 4JWPA 3R9FA 2NMTA 4UFWA 1U6MA 3G3SA 4I49A 4E2AA 3GKRA 4KZTA 5G1ZA 1SQHA 2C27A 3S6KA 5F48A 3D8PA 5E96A 4CGPA 5C82A 4JJXA 5G21A 2WSAA 3FIXA 2OZGA 3TCVA 4UCPA 2JDDA 2CNMA 4R3KA 5G20A 3SHPA 3PZJA 2CXAA 4UFVA 2F5IA 3D3SA 1M1DA 3T90A 1MJ9A 4IUSA 3RYOA 4EVYA 4FD7A 1YX0A 2PRBA 3TE4A 2G3TA 4K30A 2Z3PA 2JLMA 2BUEA 4PSWA 2OZHA 4UWJA 4C2ZA 1S5KA 1V0CA 4PSXA 2B4BA 4KOYA 4LX9A 3JTKA 4CAFA 4FD4A 4HNYB 2VQYA 4MFKA 2K5TA 5AG7A 2P6FA 4C2YA 2FIWA 3CXQA 1VKCA 2R7HA 5AG6A 4CGNA 1Z4RA 1Q2DA 3T9YA 2Z3LA 1Q2YA 1S7KA 4MY0A 1XE4A 2VI7A 2Z3KA 4OAEA 3S6FA 5IB0A 4CYNA 4NSQA 3A9LA 1K4JA 4NXYA 3BJ8A 2FIAA 3TFYA 2D4PA 2Q04A 4UBRA 5AGEA 3TO9A 3SXNA 5JQ4A 3VWDA 1VHSA 4CAWA 4MI4A 3R9EA 2B3VA 3ZZIA 2YNDA 2Z10A 2HV2A 4KS9A 3MGDA 3R95A 2OB0A 1QSTA 1KZFA 3F0AA 4AB7A 5IV0A 1I12A 4BMHA 4MFZA 3DR8A 4F0XA 2FSRA 3I9SA 4MY3A 4YFJA 1ON0A 1IIDA 4R9MA 1BO4A 2G3AA 3EXNA 4KLVA 3DDDA 4F6AA 1MJAA 2Z11A 4ZBGA 1M4GA 2ZPAA 3R9GA 3R96A 1YREA 3F5BA 4B13A 4AVBA 3KKWA 4A30A 3CXPA 3NE7A 4KOUA 2ATRA 4KOXA 4PK2A 4B5OA 4KVXA 4MJ8A 3JUWA 4A33A 5F47A 4C68A 2J8MA 3I3GA 4UCNA 4U9ZA 1M4IA 4B5PA 2FE7A 2HUZA 4MFQA 2VXKA 3ZJ0A 4A31A 4KUBA 2KCWA 4Y49C 1YGHA 1N71A 1S60A 4RS2A 4ORFA 2Q4VA 2PC1A 5EBVA 3SXOA 4QUSA 2PR8A 4MFPA 3WR7A 1LRZA 2YNCC 4FD6A 4JD6A 3B8GA 4NEXA 4UWIA 2Z0ZA 4X5KA 2OU2A 5C88A 2BEIA 5EC4A 2ZW4A 2FXFA 2RC4A 2YGWA 4A32A 5AG4A 2GIVA 1Q2CA 1QSRA 4QB9A 4CRYB 1J4JA 2GE3A 2VZZA 4CGOA 1RXTA 1OZPA 2Z3OA 4YRHA 5ISVA 1Y9KA 2O28A 4NCZA 4CYOA 3LODA 1WWZA 3QAHA 1CM0A 1Z4EA 1YVKA 4QC6A 4BBHA 2VZYA 2FS5A 4CYPA 2ZXVA 5H86A 1NMTA 5A27A 5CNPA 3IWEA 3PP9A 1QSMA 4YGOA 3BLNA 1B6BA 4MFJA 2CNSA 4CYQA 3C26A 4LUAA 1PU9A 2FL4A 5F49A 2QIRA 2BSWA 3V8IA 1BOBA 4KOVA 4PK3A 4AG7A 2DPTA 4B5PB 2ZW6A 2B5GB 3W91A 1IYKA 3FBUA 3IU1A 2AJ6A 2A4NA 2Z3MA 4HNWB 3TO6A 1WK4A 2FCKA 3FXTA 3K9UA 4XPDC 4JXQA 3JVNA 4KOSA 4KVME 2I79A 4R87A 1CJWA 2EUIA 4QBJA 1R57A 1FY7A 1MK4A 4IF5A 5KTDA 2Q44A 1P4NA 1GHEA 3VWEA 1QSOA 4A2ZA 4B14A 1IYLA 4CAEA 4OADA 4B12A 4E8OA 3R1KA 4KLWA 4UCMA 3D2MA 4CGLA 4OLLA 1L0CA 2Y0MA 5G22A 1KUYA 5HMNA 5KTCA 2Q7BA 2WUUA 2Z3NA 1B87A 3F8KA 3IWGA 4H6ZA 4FD5A 5AG5A 3EFAA 4AVAA 4U5YA 1S7FA 3IU2A 2FT0A 2ZW7A 5KTAA 2AE6A 4CS0B 1S7LA 4II9A 1M4DA 1KUVA 4XPLA 3EC4A 3PGPA 4XPKA 4M3SA 5H84A 2B5GA 4JLYA 2B4DB 2VBQA 3G8WA 2QMLA 4Q38A 1XEBA 3H5ZA 1Y7RA 4KVOE 4H89A 2P6GA 3GYAA 1QSNA 3UY5A 4B11A 3TTHA 3S6HA 4XPDB 4F0YA 4ONUA 3OWCA 3DSBA 3LD2A 1YVOA 4HKFA 5DWMA 2GANA 5A28A 3D2PA 1NSLA 2YNCA 2REEA 2CNTA 3DR6A 4KUAA 4L8AA 3EO4A 3EY5A 4KOTA 5IX3A 5J8CA 1PUAA 4C7HA 1YK3A 3TT2A 1S3ZA 2PSWA 3W6SA 3QB8A 2Q4YA 2H5MA 2ARHA 4AVCA 2R8VA 2B3UA 4JXRA 4MHDA 4GS4A 2I00A 4UFXA 2CY2A 2DXQA 4C7IA 2REFA 4HNXB 1Z9UA 2WPXA 2J8NA 4KSFA 3BJ7A 1I1DA 4XNHB 3IGRA 3N7ZA 4QVTA 3P2FA 1YR0A 4A95A 1M44A 4R57A 4CGMA 4UA3A 3GY9A 4ZGYB 1RO5A 4U9YA 1NE9A 5BWAB 2OZUA 3S6GA 2B4DA 3FYNA 3E0KA 4CAXA 4KSAA 3FNCA 5DWNA 4MFLA 1YLEA 1MJBA 4J3GA 4L89A 1XMTA 2PR1A 2ZW5A 1XF8A 2B58A 3DNSA 3TO7A 4CAVA 4B10A 5HH1A 2P0WA 5I0CA 4MBUA 2WPWA 5J8FA 4Y49B 1TIQA 3W6XA 5GCNA 3CXSA 2PDOA 2P6EA 4Q36A 2OH1A 2G0BA 3FRMA 3TOAA 2IL4A 4KORA 4R3LA 5F46A 4AG9A 1XIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S7N A;  1Y9W A;  2BL1 A;  2EVN A;  3P2H A;  2QEC A;  5FVJ A;  2VEZ A;  3TOB A;  4NF1 A;  2JDC A;  1KUX A;  4RI1 A;  5JPH A;  4XNH C;  1I21 A;  2D4O A;  4M85 A;  3FB3 A;  1IB1 E;  4CRZ B;  2R1I A;  4KOW A;  2X7B A;  3H4Q A;  2J8R A;  1IIC A;  2R98 A;  2PQ8 A;  4PV6 A;  4DNC A;  1UFH A;  2JEV A;  2HQY A;  4H6U A;  4E0A A;  1P0H A;  2Q0Y A;  4JWP A;  3R9F A;  2NMT A;  1U6M A;  3G3S A;  4I49 A;  4E2A A;  3GKR A;  4KZT A;  1SQH A;  2C27 A;  3S6K A;  5F48 A;  3D8P A;  5E96 A;  5C82 A;  4JJX A;  3FIX A;  2OZG A;  3TCV A;  2JDD A;  2CNM A;  4R3K A;  3SHP A;  3PZJ A;  2F5I A;  3D3S A;  1M1D A;  3T90 A;  1MJ9 A;  4IUS A;  3RYO A;  4EVY A;  4FD7 A;  1YX0 A;  2PRB A;  3TE4 A;  2G3T A;  4K30 A;  2JLM A;  2BUE A;  4PSW A;  2OZH A;  4UWJ A;  1S5K A;  1V0C A;  4PSX A;  2B4B A;  4KOY A;  4LX9 A;  4FD4 A;  4HNY B;  2VQY A;  2K5T A;  2P6F A;  2FIW A;  3CXQ A;  1VKC A;  2R7H A;  1Z4R A;  1Q2D A;  3T9Y A;  1Q2Y A;  1S7K A;  4MY0 A;  1XE4 A;  2VI7 A;  4OAE A;  3S6F A;  5IB0 A;  4NSQ A;  1K4J A;  4NXY A;  3BJ8 A;  2FIA A;  3TFY A;  2D4P A;  2Q04 A;  4UBR A;  3TO9 A;  3SXN A;  5JQ4 A;  3VWD A;  1VHS A;  4CAW A;  4MI4 A;  3R9E A;  2B3V A;  3ZZI A;  2Z10 A;  2HV2 A;  3MGD A;  3R95 A;  2OB0 A;  1QST A;  1KZF A;  3F0A A;  4AB7 A;  5IV0 A;  1I12 A;  4BMH A;  3DR8 A;  2FSR A;  3I9S A;  4MY3 A;  4YFJ A;  1ON0 A;  1IID A;  4R9M A;  1BO4 A;  2G3A A;  3EXN A;  4KLV A;  3DDD A;  4F6A A;  1MJA A;  2Z11 A;  4ZBG A;  1M4G A;  2ZPA A;  3R9G A;  3R96 A;  1YRE A;  3F5B A;  4AVB A;  3KKW A;  3CXP A;  3NE7 A;  4KOU A;  2ATR A;  4KOX A;  4PK2 A;  4B5O A;  4KVX A;  4MJ8 A;  3JUW A;  5F47 A;  2J8M A;  3I3G A;  4U9Z A;  1M4I A;  4B5P A;  2FE7 A;  2HUZ A;  2VXK A;  3ZJ0 A;  4KUB A;  2KCW A;  4Y49 C;  1YGH A;  1N71 A;  1S60 A;  4RS2 A;  4ORF A;  2Q4V A;  2PC1 A;  5EBV A;  3SXO A;  4QUS A;  2PR8 A;  3WR7 A;  1LRZ A;  4FD6 A;  4JD6 A;  3B8G A;  4NEX A;  4UWI A;  2Z0Z A;  4X5K A;  2OU2 A;  5C88 A;  2BEI A;  5EC4 A;  2ZW4 A;  2FXF A;  2RC4 A;  2GIV A;  1Q2C A;  1QSR A;  4QB9 A;  4CRY B;  1J4J A;  2GE3 A;  2VZZ A;  1RXT A;  1OZP A;  4YRH A;  5ISV A;  1Y9K A;  2O28 A;  4NCZ A;  3LOD A;  1WWZ A;  3QAH A;  1CM0 A;  1Z4E A;  1YVK A;  4QC6 A;  2VZY A;  2FS5 A;  2ZXV A;  5H86 A;  1NMT A;  5CNP A;  3PP9 A;  1QSM A;  4YGO A;  3BLN A;  1B6B A;  2CNS A;  3C26 A;  4LUA A;  1PU9 A;  2FL4 A;  5F49 A;  2QIR A;  2BSW A;  3V8I A;  1BOB A;  4KOV A;  4PK3 A;  4AG7 A;  4B5P B;  2ZW6 A;  2B5G B;  3W91 A;  1IYK A;  3FBU A;  2AJ6 A;  2A4N A;  3TO6 A;  4HNW B;  1WK4 A;  2FCK A;  3FXT A;  3K9U A;  4XPD C;  4JXQ A;  3JVN A;  4KOS A;  4KVM E;  2I79 A;  4R87 A;  1CJW A;  2EUI A;  4QBJ A;  1R57 A;  1FY7 A;  1MK4 A;  4IF5 A;  5KTD A;  2Q44 A;  1P4N A;  1GHE A;  3VWE A;  1QSO A;  1IYL A;  4OAD A;  4E8O A;  3R1K A;  4KLW A;  3D2M A;  4OLL A;  1L0C A;  2Y0M A;  1KUY A;  5HMN A;  5KTC A;  2Q7B A;  1B87 A;  3F8K A;  3IWG A;  4H6Z A;  4FD5 A;  3EFA A;  4AVA A;  4U5Y A;  1S7F A;  2FT0 A;  2ZW7 A;  5KTA A;  2AE6 A;  4CS0 B;  1S7L A;  4II9 A;  1M4D A;  1KUV A;  4XPL A;  3EC4 A;  3PGP A;  4XPK A;  4M3S A;  5H84 A;  2B5G A;  4JLY A;  2B4D B;  2VBQ A;  3G8W A;  2QML A;  1XEB A;  1Y7R A;  4KVO E;  4H89 A;  2P6G A;  3GYA A;  1QSN A;  3UY5 A;  3TTH A;  3S6H A;  4XPD B;  4F0Y A;  4ONU A;  3OWC A;  3DSB A;  3LD2 A;  1YVO A;  4HKF A;  5DWM A;  2GAN A;  3D2P A;  1NSL A;  2REE A;  2CNT A;  3DR6 A;  4KUA A;  4L8A A;  3EO4 A;  3EY5 A;  4KOT A;  5IX3 A;  5J8C A;  1PUA A;  1YK3 A;  3TT2 A;  1S3Z A;  2PSW A;  3W6S A;  3QB8 A;  2Q4Y A;  2H5M A;  2ARH A;  4AVC A;  2R8V A;  2B3U A;  4JXR A;  4MHD A;  4GS4 A;  2I00 A;  2CY2 A;  2DXQ A;  2REF A;  4HNX B;  1Z9U A;  2WPX A;  2J8N A;  3BJ7 A;  1I1D A;  4XNH B;  3IGR A;  3N7Z A;  4QVT A;  3P2F A;  1YR0 A;  1M44 A;  4R57 A;  4UA3 A;  3GY9 A;  1RO5 A;  4U9Y A;  1NE9 A;  2OZU A;  3S6G A;  2B4D A;  3FYN A;  3E0K A;  4CAX A;  3FNC A;  5DWN A;  1YLE A;  1MJB A;  4J3G A;  4L89 A;  1XMT A;  2PR1 A;  2ZW5 A;  1XF8 A;  2B58 A;  3DNS A;  3TO7 A;  4CAV A;  5HH1 A;  2P0W A;  5I0C A;  4MBU A;  2WPW A;  5J8F A;  4Y49 B;  1TIQ A;  3W6X A;  5GCN A;  3CXS A;  2PDO A;  2P6E A;  2OH1 A;  2G0B A;  3FRM A;  3TOA A;  2IL4 A;  4KOR A;  4R3L A;  5F46 A;  4AG9 A;  1XIX A; 
#chains in the Genus database with same CATH topology
 3WT4 A;  1S7N A;  1Y9W A;  2BL1 A;  4UIB A;  2EVN A;  2PJC A;  3P2H A;  3PEI A;  1FNO A;  2PJ9 A;  2QEC A;  5FVJ A;  1HEE A;  2VEZ A;  3TOB A;  4NF1 A;  2JDC A;  2PJ2 A;  3D7F A;  4OC4 A;  3QNV A;  1KUX A;  2ABZ A;  4RI1 A;  4PXB A;  2YNE A;  4MHP A;  3IO1 A;  4RUH A;  5JPH A;  4XNH C;  1ZLI A;  2HC9 A;  4M6G A;  5F09 A;  2PVW A;  1I21 A;  2D4O A;  3BXM A;  1ZG9 A;  3PB4 X;  4M85 A;  3FB3 A;  1HDQ A;  2PCU A;  5LRJ A;  1IB1 E;  1YSJ A;  4CRZ B;  2R1I A;  4KOW A;  2X7B A;  3H4Q A;  1ZO0 A;  2J8R A;  3BHX A;  1IIC A;  2R98 A;  2PQ8 A;  4PV6 A;  1UWY A;  2DPS A;  3NA6 A;  3S9M A;  3FJU A;  1YW6 A;  4DNC A;  4OC3 A;  1H8L A;  1IU8 A;  3H8E A;  1UFH A;  2XEG A;  5HVF A;  2DF5 A;  2JEV A;  2PIY A;  3WAB A;  2HQY A;  4H6U A;  4E0A A;  4FAI A;  4C2X A;  1ELL P;  4A37 A;  1P0H A;  1VHE A;  2Q0Y A;  3PB9 X;  4JWP A;  3R9F A;  2NMT A;  4MRI A;  4UFW A;  2G9D A;  4K3N A;  1U6M A;  3G3S A;  2NYQ A;  4I49 A;  4E2A A;  3GKR A;  4KZT A;  1GYT A;  2EO8 A;  4NGS A;  5G1Z A;  4MMO A;  1SQH A;  1A2Z A;  2V8G A;  2C27 A;  3S6K A;  5F48 A;  3D8P A;  3B2Y A;  5E96 A;  4CGP A;  3VAR A;  5C82 A;  3NH5 A;  2PIZ A;  4X3R A;  5JH9 A;  4JJX A;  5G21 A;  2WSA A;  4R8F A;  1LCP A;  1ARM A;  3HLP A;  5THW A;  3FIX A;  2OZG A;  4F9V A;  1F57 A;  3TCV A;  3GB0 A;  4UCP A;  3S9N A;  3B35 A;  2JDD A;  2CNM A;  4R3K A;  5G20 A;  3SHP A;  3PZJ A;  2CXA A;  4UFV A;  3VAT A;  4Z65 A;  2F5I A;  4GM5 A;  4EME A;  3D3S A;  1M1D A;  3T90 A;  4OID A;  4FBE A;  1MJ9 A;  1F2P A;  4IUS A;  3RYO A;  3LMS A;  4EVY A;  4FD7 A;  1YX0 A;  2PRB A;  4HPS A;  3TE4 A;  2G3T A;  1Y0R A;  1VIX A;  3RAM A;  3S9L A;  4F8Z A;  4K30 A;  2Z3P A;  2JLM A;  1BPN A;  1Z8W A;  2BUE A;  4IHM A;  4PSW A;  2OZH A;  2V8V A;  4UWJ A;  3B3S A;  3TX8 A;  1VGY A;  4UEE A;  4C2Z A;  1S5K A;  1R3N A;  4MCR A;  1V0C A;  5D8N A;  2PJ3 A;  4PSX A;  2VL1 A;  2B4B A;  4KOY A;  5HXD A;  4LX9 A;  5K8P A;  3JTK A;  4OKO A;  4FD4 A;  4HNY B;  4CAF A;  2VQY A;  2K5T A;  4MFK A;  5AG7 A;  3SI1 A;  1OBR A;  4BD9 A;  2P6F A;  3H8G A;  4C2Y A;  2FIW A;  3SJE A;  2R7H A;  1VKC A;  3CXQ A;  5AG6 A;  2F7V A;  4CGN A;  1QMU A;  1IOI A;  1Z4R A;  1Q2D A;  2CF4 A;  3T9Y A;  1R43 A;  2Z3L A;  5HVH A;  1Q2Y A;  1QQ9 A;  1S7K A;  4MY0 A;  2Q7S A;  1XE4 A;  2BCO A;  2RFH A;  4P4E A;  2VI7 A;  2Z3K A;  4OAE A;  4WWV A;  3S6F A;  5IB0 A;  1LAP A;  4CYN A;  4NSQ A;  3A9L A;  2PJB A;  1K4J A;  4IAV A;  1BLL E;  2OOT A;  5LYF A;  4NXY A;  3FED A;  3BJ8 A;  2FIA A;  3TFY A;  3IJ3 A;  4OC5 A;  2D4P A;  2Q04 A;  3FH4 A;  4UBR A;  4NGQ A;  1CPX A;  5AGE A;  3TO9 A;  3SXN A;  5JQ4 A;  4OP4 A;  3VWD A;  4KSI A;  1VHS A;  4CAW A;  4ZY0 A;  2ODF A;  4MI4 A;  3R9E A;  2B3V A;  2ZOG A;  2Q51 A;  5HVG A;  3ZZI A;  4X8I A;  3KR5 A;  4NJQ A;  2YND A;  4NJR A;  4TWE A;  4NGN A;  1Y0Y A;  2EK9 A;  2Z10 A;  3IC1 A;  2EK8 A;  1TF8 A;  2GU2 A;  2HV2 A;  4KS9 A;  2IJZ A;  3MGD A;  3R95 A;  2OB0 A;  1QST A;  1KZF A;  3F0A A;  4AB7 A;  4MCP A;  3D4U A;  4ZX8 A;  3B7I A;  5IV0 A;  1I12 A;  3KI9 A;  4BMH A;  4MFZ A;  3DR8 A;  4F0X A;  2FSR A;  3I9S A;  4PQA A;  4MY3 A;  4YFJ A;  2GLF A;  1ON0 A;  5ELY A;  1IID A;  4R6T A;  3SJG A;  4R9M A;  2JEW A;  1BO4 A;  1Z8T A;  2G3A A;  2Q4Z A;  3EXN A;  3B3V A;  4KLV A;  3DDD A;  4F6A A;  1MJA A;  2Z11 A;  4MXU A;  1IY7 A;  1M4G A;  4Q7A A;  4ZBG A;  2ZED A;  3MN8 A;  1FT7 A;  2F8H A;  2ZPA A;  3R9G A;  1BAV A;  3R96 A;  3PRT A;  5K8O A;  3CDX A;  1YRE A;  4EWT A;  3F5B A;  2PJ8 A;  4B13 A;  4AVB A;  3KKW A;  3L2N A;  3CXP A;  4A30 A;  2GRE A;  3IIB A;  3NE7 A;  4KOU A;  2ATR A;  4KOX A;  4PK2 A;  3DLJ A;  2ANP A;  2ZEL A;  4KVX A;  4B5O A;  4CPA A;  4MJ8 A;  3WC6 A;  3JUW A;  4A33 A;  4P44 A;  5F47 A;  4C68 A;  3D66 A;  1JQG A;  4PPZ A;  2V8D A;  1LOK A;  3SI0 A;  3LWU A;  2J8M A;  3I3G A;  3ISZ A;  4UCN A;  4PXC A;  4M6H A;  4U9Z A;  2EWB A;  1M4I A;  4B5P A;  2FE7 A;  2HUZ A;  5IB9 A;  4MFQ A;  1JWQ A;  4UF4 A;  2VXK A;  1LFW A;  3ZJ0 A;  2ZEG A;  4A31 A;  2C6C A;  4MHN A;  4KUB A;  2KCW A;  1CBX A;  1CX8 A;  2ZEP A;  1YGH A;  2PJ7 A;  4Y49 C;  1N71 A;  1S60 A;  3PFO A;  4R7M A;  4ZY1 A;  3D68 A;  4RS2 A;  4ORF A;  1CP7 A;  2PC1 A;  2Q4V A;  4P45 A;  5EBV A;  3SXO A;  4QUS A;  5K8M A;  2PR8 A;  4MFP A;  3WR7 A;  1LRZ A;  2YNC C;  4FD6 A;  4JD6 A;  3B8G A;  4NEX A;  4O23 A;  4UWI A;  2Z0Z A;  2ZEO A;  2QVP A;  5JM6 A;  1DE4 C;  2WZN A;  2OU2 A;  1PYT B;  4X5K A;  5C88 A;  2BEI A;  5EC4 A;  4JZ0 A;  4PXD A;  2ZW4 A;  2FXF A;  1YLO A;  3FMC A;  2RC4 A;  2YGW A;  1XMB A;  4A32 A;  2GIV A;  1XJO A;  5AG4 A;  3KHX A;  1Q2C A;  1QSR A;  4WJB A;  3KGQ A;  3B3T A;  2POK A;  2QJ8 A;  4OC0 A;  3KR4 A;  2PJ5 A;  2Q43 A;  4QB9 A;  2PVV A;  4CRY B;  1J4J A;  2GE3 A;  2VZZ A;  2AFW A;  4CGO A;  1RXT A;  1OZP A;  2Z3O A;  3CZX A;  4YRH A;  3HUV A;  1Y9K A;  2O28 A;  4NCZ A;  4CYO A;  5ISV A;  5LYL A;  3GLJ A;  3LOD A;  3N5F A;  1WWZ A;  2V8H A;  3QAH A;  4B6Z A;  1CM0 A;  1Y7E A;  3PB8 X;  3PBB A;  1Z4E A;  1YME A;  1YVK A;  3D7D A;  4QC6 A;  4BBH A;  2VZY A;  2FS5 A;  2XEJ A;  4CYP A;  2PJ1 A;  2ZXV A;  5H86 A;  1NMT A;  4R76 A;  2OR4 A;  2ZEE A;  5A27 A;  5CNP A;  3IWE A;  3PP9 A;  1QSM A;  4YGO A;  3BLN A;  3KZW A;  1B6B A;  2ZEF A;  4DJL A;  3GUX A;  2PJ6 A;  4MFJ A;  2CNS A;  4CYQ A;  3C26 A;  4LUA A;  4YU9 A;  1PU9 A;  2FL4 A;  2AFS A;  4UIA A;  1YW4 A;  4AG9 A;  3B3C A;  5F49 A;  2QIR A;  2BSW A;  3V8I A;  2AFU A;  3BI1 A;  1BOB A;  1IOF A;  4KOV A;  4PK3 A;  5EMI A;  4AG7 A;  2DPT A;  4P4D A;  4B5P B;  1DTD A;  1Z8X A;  2B5G B;  1ARL A;  2ZW6 A;  3W91 A;  1IYK A;  3PB6 X;  4MHZ A;  3FBU A;  5LRK A;  2ZEN A;  2JBJ A;  3IU1 A;  2AJ6 A;  2PJA A;  2A4N A;  2Z3M A;  4HNW B;  4MCS A;  3TO6 A;  1WK4 A;  2ZEH A;  2FCK A;  3DGV A;  3FXT A;  2PRQ A;  4NGP A;  5LYD A;  3K9U A;  3RNZ A;  1Z2L A;  4XPD C;  4JXQ A;  3WC5 A;  3FF3 A;  3JVN A;  4KOS A;  4KVM E;  2I79 A;  4LQG A;  4R87 A;  1CJW A;  2JBK A;  2V77 A;  2IQ6 A;  3CT9 A;  2EUI A;  4QBJ A;  4NGM A;  2I3C A;  1R57 A;  1F2O A;  1FY7 A;  2BOA A;  1PCA A;  2O4H A;  1MK4 A;  4IF5 A;  3KQZ A;  3KQX A;  5KTD A;  1XRY A;  2Q44 A;  3B3W A;  1P4N A;  5CPA A;  3IWW A;  1GHE A;  3VWE A;  1QSO A;  1CG2 A;  4A2Z A;  4B14 A;  3GIU A;  4OC1 A;  3VH9 A;  1IYL A;  4CAE A;  3H8F A;  4OAD A;  4B12 A;  2HB6 A;  4E8O A;  4DYO A;  2PJ0 A;  3R1K A;  4LQ6 A;  4KLW A;  4UCM A;  4OC2 A;  1Z5R A;  3D2M A;  4P4F A;  4OLL A;  4CGL A;  1L0C A;  2Y0M A;  4YWY A;  5G22 A;  1KUY A;  3CPA A;  5HMN A;  3RZA A;  4MHY A;  5KTC A;  4M6I A;  4OME A;  2Q7B A;  2WUU A;  2Z3N A;  3NH8 A;  4P4I A;  4GXH A;  1EE3 P;  5LRG A;  3PBE A;  2IMO A;  4P6Y A;  3NH4 A;  4ZYQ A;  1B87 A;  2RB7 A;  3F8K A;  3IWG A;  1CPS A;  4H6Z A;  2NSM A;  4FD5 A;  2ZOF A;  5AG5 A;  3EFA A;  4AVA A;  4NGT A;  4DUK A;  3PB7 X;  4IK2 A;  3D7G A;  4U5Y A;  1S7F A;  3IEH A;  3IU2 A;  2FT0 A;  3V7Z A;  3KL9 A;  2ZW7 A;  5KTA A;  2AE6 A;  4CS0 B;  4H2K A;  1S7L A;  1ZG7 A;  4II9 A;  1M4D A;  4RN7 A;  4A39 A;  1KUV A;  4XPL A;  2WYR A;  4JYW A;  3EC4 A;  1RTQ A;  3PGP A;  4XPK A;  2C1C A;  3QAY A;  4M3S A;  5H84 A;  1CP6 A;  1LAM A;  2B5G A;  2B4D B;  2VBQ A;  4JLY A;  3G8W A;  2QML A;  4Q38 A;  1XEB A;  2CIJ A;  3H5Z A;  1Y7R A;  4G1P A;  4H89 A;  4KVO E;  1BPM A;  1TF9 A;  1YQE A;  3WC7 A;  2P6G A;  5JGF A;  1AYE A;  2QYV A;  4FWU A;  2C6G A;  3GYA A;  1M4L A;  1QSN A;  1IGB A;  3UY5 A;  4B11 A;  3TTH A;  3S6H A;  4XPD B;  2GFQ A;  4F0Y A;  4ONU A;  3OWC A;  3DSB A;  3LD2 A;  1YVO A;  4HKF A;  3SI2 A;  1KWM A;  3ISX A;  2GAN A;  5DWM A;  5A28 A;  3D2P A;  3KHZ A;  7CPA A;  1NSL A;  2YNC A;  3NE8 A;  4FUU A;  2REE A;  2CNT A;  1X10 A;  5D29 A;  3DR6 A;  2CTB A;  4KUA A;  4L8A A;  3EO4 A;  3SJX A;  3EY5 A;  4KOT A;  5IX3 A;  2AFZ A;  3V38 A;  3T8W A;  4A94 A;  5J8C A;  1PUA A;  1TKH A;  4UEZ A;  3RO0 A;  2EBJ A;  2BO9 A;  1YK3 A;  4C7H A;  3TT2 A;  4ZY2 A;  3JRU A;  1S3Z A;  2PSW A;  3W6S A;  3FVL A;  1XFO A;  1AUG A;  2AFM A;  2Q4Y A;  3QB8 A;  2H5M A;  2J9A A;  5J1Q A;  2ARH A;  1Q7L A;  3CPX A;  4AVC A;  2R8V A;  2AFX A;  2B3U A;  4JXR A;  4MHD A;  4GS4 A;  2O53 A;  4ONW A;  3K2K A;  2I00 A;  4PXE A;  2XEI A;  1TKJ A;  1AMP A;  4P10 A;  4UFX A;  2ZEM A;  2CY2 A;  2DXQ A;  4OIW A;  1LAN A;  5I4M A;  4C7I A;  2REF A;  5LYI A;  4HNX B;  1Z9U A;  2WPX A;  2J8N A;  4KSF A;  3RBU A;  3BJ7 A;  3KAS A;  1TKF A;  1I1D A;  3LAC A;  3FX6 A;  4XNH B;  3PFE A;  3IGR A;  3N7Z A;  4QVT A;  3P2F A;  3SJF A;  1YR0 A;  3FEC A;  3FEE A;  4TNU A;  1M44 A;  2CTC A;  4R57 A;  1Z8L A;  1TXR A;  4A95 A;  4CGM A;  6CPA A;  4UA3 A;  2C6P A;  2FVG A;  3GY9 A;  3MRU A;  4ZGY B;  1RO5 A;  2PJ4 A;  4U9Y A;  4MCQ A;  1NE9 A;  3TC8 A;  5CBM A;  5BWA B;  2OZU A;  3S6G A;  2XEF A;  5K8N A;  1XBU A;  2B4D A;  3FYN A;  3E0K A;  1VHO A;  4P4B A;  4A38 A;  4KSA A;  3K9T A;  4CAX A;  3FNC A;  5DWN A;  4ZI6 A;  4MFL A;  1NSA A;  1ZG8 A;  4EFD A;  2GLJ A;  3D67 A;  1YLE A;  4NFR A;  5DS0 A;  1MJB A;  1XOV A;  4J3G A;  4AXV A;  1X12 A;  4L89 A;  1XMT A;  2PR1 A;  3D7H A;  2ZW5 A;  1XF8 A;  2B58 A;  3DNS A;  3I1U A;  4W9Y A;  3TO7 A;  4B10 A;  4CAV A;  4ZX9 A;  2DEA A;  5HH1 A;  2P0W A;  5I0C A;  4MBU A;  1ELM P;  2WPW A;  3IFE A;  8CPA A;  5J8F A;  4X2T A;  4Y49 B;  4UEF A;  1TIQ A;  3W6X A;  2PE3 A;  5GCN A;  3CXS A;  2PDO A;  2P6E A;  4Q36 A;  1ZLH A;  3BI0 A;  3NFZ A;  4NGR A;  2OH1 A;  2G0B A;  3FRM A;  3TOA A;  4F9U A;  2IL4 A;  4KOR A;  4R3L A;  5F46 A;  4BIN A;  1HDU A;  2AFO A;  1XIX A;  4P4J A; 
#chains in the Genus database with same CATH homology
 1S7N A;  1Y9W A;  2BL1 A;  2EVN A;  3P2H A;  2QEC A;  5FVJ A;  2VEZ A;  3TOB A;  4NF1 A;  2JDC A;  1KUX A;  4RI1 A;  2YNE A;  5JPH A;  4XNH C;  1I21 A;  2D4O A;  4M85 A;  3FB3 A;  1IB1 E;  4CRZ B;  2R1I A;  4KOW A;  2X7B A;  3H4Q A;  1ZO0 A;  2J8R A;  1IIC A;  2R98 A;  2PQ8 A;  4PV6 A;  2DPS A;  4DNC A;  1UFH A;  2JEV A;  2HQY A;  4H6U A;  4E0A A;  4C2X A;  1P0H A;  2Q0Y A;  4JWP A;  3R9F A;  2NMT A;  4UFW A;  1U6M A;  3G3S A;  4I49 A;  4E2A A;  3GKR A;  4KZT A;  5G1Z A;  1SQH A;  2C27 A;  3S6K A;  5F48 A;  3D8P A;  5E96 A;  4CGP A;  5C82 A;  4JJX A;  5G21 A;  2WSA A;  3FIX A;  2OZG A;  3TCV A;  4UCP A;  2JDD A;  2CNM A;  4R3K A;  5G20 A;  3SHP A;  3PZJ A;  2CXA A;  4UFV A;  2F5I A;  3D3S A;  1M1D A;  3T90 A;  1MJ9 A;  4IUS A;  3RYO A;  4EVY A;  4FD7 A;  1YX0 A;  2PRB A;  3TE4 A;  2G3T A;  4K30 A;  2Z3P A;  2JLM A;  2BUE A;  4PSW A;  2OZH A;  4UWJ A;  4C2Z A;  1S5K A;  1V0C A;  4PSX A;  2B4B A;  4KOY A;  4LX9 A;  3JTK A;  4CAF A;  4FD4 A;  4HNY B;  2VQY A;  4MFK A;  2K5T A;  5AG7 A;  2P6F A;  4C2Y A;  2FIW A;  3CXQ A;  1VKC A;  2R7H A;  5AG6 A;  4CGN A;  1Z4R A;  1Q2D A;  3T9Y A;  2Z3L A;  1Q2Y A;  1S7K A;  4MY0 A;  1XE4 A;  2VI7 A;  2Z3K A;  4OAE A;  3S6F A;  5IB0 A;  4CYN A;  4NSQ A;  3A9L A;  1K4J A;  4NXY A;  3BJ8 A;  2FIA A;  3TFY A;  2D4P A;  2Q04 A;  4UBR A;  5AGE A;  3TO9 A;  3SXN A;  5JQ4 A;  3VWD A;  1VHS A;  4CAW A;  4MI4 A;  3R9E A;  2B3V A;  3ZZI A;  2YND A;  2Z10 A;  2HV2 A;  4KS9 A;  3MGD A;  3R95 A;  2OB0 A;  1QST A;  1KZF A;  3F0A A;  4AB7 A;  5IV0 A;  1I12 A;  4BMH A;  4MFZ A;  3DR8 A;  4F0X A;  2FSR A;  3I9S A;  4MY3 A;  4YFJ A;  1ON0 A;  1IID A;  4R9M A;  1BO4 A;  2G3A A;  3EXN A;  4KLV A;  3DDD A;  4F6A A;  1MJA A;  2Z11 A;  4ZBG A;  1M4G A;  2ZPA A;  3R9G A;  3R96 A;  1YRE A;  3F5B A;  4B13 A;  4AVB A;  3KKW A;  4A30 A;  3CXP A;  3NE7 A;  4KOU A;  2ATR A;  4KOX A;  4PK2 A;  4B5O A;  4KVX A;  4MJ8 A;  3JUW A;  4A33 A;  5F47 A;  4C68 A;  2J8M A;  3I3G A;  4UCN A;  4U9Z A;  1M4I A;  4B5P A;  2FE7 A;  2HUZ A;  4MFQ A;  2VXK A;  3ZJ0 A;  4A31 A;  4KUB A;  2KCW A;  4Y49 C;  1YGH A;  1N71 A;  1S60 A;  4RS2 A;  4ORF A;  2Q4V A;  2PC1 A;  5EBV A;  3SXO A;  4QUS A;  2PR8 A;  4MFP A;  3WR7 A;  1LRZ A;  2YNC C;  4FD6 A;  4JD6 A;  3B8G A;  4NEX A;  4UWI A;  2Z0Z A;  4X5K A;  2OU2 A;  5C88 A;  2BEI A;  5EC4 A;  2ZW4 A;  2FXF A;  2RC4 A;  2YGW A;  4A32 A;  5AG4 A;  2GIV A;  1Q2C A;  1QSR A;  4QB9 A;  4CRY B;  1J4J A;  2GE3 A;  2VZZ A;  4CGO A;  1RXT A;  1OZP A;  2Z3O A;  4YRH A;  5ISV A;  1Y9K A;  2O28 A;  4NCZ A;  4CYO A;  3LOD A;  1WWZ A;  3QAH A;  1CM0 A;  1Z4E A;  1YVK A;  4QC6 A;  4BBH A;  2VZY A;  2FS5 A;  4CYP A;  2ZXV A;  5H86 A;  1NMT A;  5A27 A;  5CNP A;  3IWE A;  3PP9 A;  1QSM A;  4YGO A;  3BLN A;  1B6B A;  4MFJ A;  2CNS A;  4CYQ A;  3C26 A;  4LUA A;  1PU9 A;  2FL4 A;  5F49 A;  2QIR A;  2BSW A;  3V8I A;  1BOB A;  4KOV A;  4PK3 A;  4AG7 A;  2DPT A;  4B5P B;  2ZW6 A;  2B5G B;  3W91 A;  1IYK A;  3FBU A;  3IU1 A;  2AJ6 A;  2A4N A;  2Z3M A;  4HNW B;  3TO6 A;  1WK4 A;  2FCK A;  3FXT A;  3K9U A;  4XPD C;  4JXQ A;  3JVN A;  4KOS A;  4KVM E;  2I79 A;  4R87 A;  1CJW A;  2EUI A;  4QBJ A;  1R57 A;  1FY7 A;  1MK4 A;  4IF5 A;  5KTD A;  2Q44 A;  1P4N A;  1GHE A;  3VWE A;  1QSO A;  4A2Z A;  4B14 A;  1IYL A;  4CAE A;  4OAD A;  4B12 A;  4E8O A;  3R1K A;  4KLW A;  4UCM A;  3D2M A;  4CGL A;  4OLL A;  1L0C A;  2Y0M A;  5G22 A;  1KUY A;  5HMN A;  5KTC A;  2Q7B A;  2WUU A;  2Z3N A;  1B87 A;  3F8K A;  3IWG A;  4H6Z A;  4FD5 A;  5AG5 A;  3EFA A;  4AVA A;  4U5Y A;  1S7F A;  3IU2 A;  2FT0 A;  2ZW7 A;  5KTA A;  2AE6 A;  4CS0 B;  1S7L A;  4II9 A;  1M4D A;  1KUV A;  4XPL A;  3EC4 A;  3PGP A;  4XPK A;  4M3S A;  5H84 A;  2B5G A;  4JLY A;  2B4D B;  2VBQ A;  3G8W A;  2QML A;  4Q38 A;  1XEB A;  3H5Z A;  1Y7R A;  4KVO E;  4H89 A;  2P6G A;  3GYA A;  1QSN A;  3UY5 A;  4B11 A;  3TTH A;  3S6H A;  4XPD B;  4F0Y A;  4ONU A;  3OWC A;  3DSB A;  3LD2 A;  1YVO A;  4HKF A;  5DWM A;  2GAN A;  5A28 A;  3D2P A;  1NSL A;  2YNC A;  2REE A;  2CNT A;  3DR6 A;  4KUA A;  4L8A A;  3EO4 A;  3EY5 A;  4KOT A;  5IX3 A;  5J8C A;  1PUA A;  4C7H A;  1YK3 A;  3TT2 A;  1S3Z A;  2PSW A;  3W6S A;  3QB8 A;  2Q4Y A;  2H5M A;  2ARH A;  4AVC A;  2R8V A;  2B3U A;  4JXR A;  4MHD A;  4GS4 A;  2I00 A;  4UFX A;  2CY2 A;  2DXQ A;  4C7I A;  2REF A;  4HNX B;  1Z9U A;  2WPX A;  2J8N A;  4KSF A;  3BJ7 A;  1I1D A;  4XNH B;  3IGR A;  3N7Z A;  4QVT A;  3P2F A;  1YR0 A;  4A95 A;  1M44 A;  4R57 A;  4CGM A;  4UA3 A;  3GY9 A;  4ZGY B;  1RO5 A;  4U9Y A;  1NE9 A;  5BWA B;  2OZU A;  3S6G A;  2B4D A;  3FYN A;  3E0K A;  4CAX A;  4KSA A;  3FNC A;  5DWN A;  4MFL A;  1YLE A;  1MJB A;  4J3G A;  4L89 A;  1XMT A;  2PR1 A;  2ZW5 A;  1XF8 A;  2B58 A;  3DNS A;  3TO7 A;  4CAV A;  4B10 A;  5HH1 A;  2P0W A;  5I0C A;  4MBU A;  2WPW A;  5J8F A;  4Y49 B;  1TIQ A;  3W6X A;  5GCN A;  3CXS A;  2PDO A;  2P6E A;  4Q36 A;  2OH1 A;  2G0B A;  3FRM A;  3TOA A;  2IL4 A;  4KOR A;  4R3L A;  5F46 A;  4AG9 A;  1XIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...