1N71A

Crystal structure of aminoglycoside 6'-acetyltransferase type ii in complex with coenzyme a
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
180
structure length
180
Chain Sequence
MIISEFDRNNPVLKDQLSDLLRLTWPEEYGDSSAEEVEEMMNPERIAVAAVDQDELVGFIGAIPQYGITGWELHPLVVESSRRKNQIGTRLVNYLEKEVASRGGITIYLGTDDLDHGTTLSQTDLYEHTFDKVASIQNLREHPYEFYEKLGYKIVGVLPNANGWDKPDIWMAKTIIPRPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords aac(6')-Ii
publication title X-ray structure of the AAC(6')-Ii antibiotic resistance enzyme at 1.8 A resolution; examination of oligomeric arrangements in GNAT superfamily members
pubmed doi rcsb
source organism Enterococcus faecium
total genus 50
structure length 180
sequence length 180
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1n71A00
4JLYA 3H4QA 2NMTA 3S6GA 3F5BA 2VZYA 4U9YA 3S6FA 5H86A 4Y49B 4MI4A 3BJ8A 3BLNA 4AG7A 1TIQA 4AVBA 4CS0B 1Z4RA 2OU2A 2PSWA 2I00A 2VXKA 1IICA 4KORA 1ON0A 1NMTA 3I9SA 3DDDA 2Z0ZA 3VWDA 4R87A 4R3KA 2REFA 4NEXA 4F6AA 4UWJA 5J8FA 2OB0A 2R1IA 4M85A 3TO6A 1QSRA 1VKCA 2J8MA 2Q4YA 3TTHA 1I1DA 2OZUA 3OWCA 2ZPAA 2HV2A 1XF8A 3D8PA 5F49A 4YRHA 3TOAA 3R96A 3CXSA 4XPLA 3DNSA 3FNCA 1I21A 1XEBA 3W6SA 4JXRA 5HMNA 1PUAA 4B5PA 3SXOA 2G0BA 4XNHB 4U9ZA 1QSMA 2EUIA 4L8AA 4BMHA 2Q4VA 1UFHA 2ZXVA 3B8GA 4E8OA 4R9MA 3VWEA 2B58A 5KTDA 1LRZA 1XMTA 2ZW4A 2WPXA 4XPDB 3GY9A 1MJBA 2JDDA 3SXNA 4AB7A 4CAVA 4HKFA 3FBUA 1BO4A 2Q04A 2Z10A 1P4NA 4QC6A 1YREA 3MGDA 1N71A 3N7ZA 4K30A 1BOBA 1YGHA 2Z11A 4KUBA 2P0WA 3TFYA 4MJ8A 2X7BA 5IV0A 3FB3A 4NCZA 1YR0A 2FSRA 3TO9A 3DR8A 4E0AA 4OAEA 4CRYB 3ZZIA 4KLWA 4MY3A 1PU9A 2CNSA 2ZW5A 3PGPA 2VQYA 3DSBA 5FVJA 5F47A 1M4DA 1RXTA 2JEVA 3QAHA 5C82A 2A4NA 2PR1A 2J8NA 5I0CA 2G3AA 2FIWA 1IIDA 2G3TA 4HNWB 3FIXA 3EFAA 1QSNA 4OADA 1Z9UA 4KVOE 4PV6A 2Q0YA 3TT2A 3LD2A 2Y0MA 3R9EA 3JUWA 1U6MA 4CAWA 2FCKA 3GKRA 5DWMA 3GYAA 1MK4A 2JDCA 4MBUA 4MY0A 2P6FA 3NE7A 1P0HA 2KCWA 4KZTA 2FL4A 2GIVA 3G8WA 3RYOA 4KOYA 2PQ8A 3W91A 3BJ7A 2VZZA 2CNTA 2OH1A 4FD4A 5E96A 4CAXA 3E0KA 2H5MA 4KVXA 4U5YA 1Y7RA 1Y9KA 1S60A 3D2PA 2ARHA 1S5KA 3R9GA 4EVYA 4KVME 4NXYA 4AVAA 2Q7BA 4JJXA 1WK4A 2P6EA 1CJWA 5EBVA 3LODA 3TCVA 3C26A 4PSWA 3IWGA 2C27A 1YVKA 2HQYA 5F48A 1R57A 4RI1A 1S3ZA 2O28A 1K4JA 4QUSA 2FE7A 1Y9WA 2R8VA 4FD6A 4KLVA 1M1DA 4H6ZA 1Q2DA 4L89A 3EY5A 1VHSA 4IF5A 4B5OA 4R3LA 1XIXA 2VEZA 1OZPA 3SHPA 1YK3A 3D2MA 2WPWA 2R7HA 3UY5A 1YX0A 1QSTA 4NSQA 2AE6A 3W6XA 2HUZA 2QMLA 4AG9A 2Q44A 1SQHA 3R95A 2BUEA 3JVNA 3PZJA 1CM0A 4PK3A 4JXQA 5DWNA 2FS5A 1RO5A 2GE3A 1FY7A 1YLEA 2B5GA 3P2FA 2D4PA 4II9A 5CNPA 3TO7A 2FIAA 4CRZB 2QECA 1M4GA 2ZW7A 2J8RA 4DNCA 4KOUA 2BL1A 4QBJA 2AJ6A 3CXQA 1GHEA 4MHDA 1M44A 3K9UA 1YVOA 4KOVA 2B3UA 3IGRA 1KZFA 4FD5A 4UWIA 4JD6A 1B87A 4KOXA 1S7KA 2B5GB 1IYKA 1B6BA 3TOBA 1WWZA 4KOWA 3F0AA 4M3SA 4H89A 1QSOA 4LX9A 2RC4A 5JQ4A 5KTCA 5EC4A 5IB0A 1Q2YA 2OZHA 4HNXB 3S6HA 1M4IA 3TE4A 1L0CA 3T90A 3G3SA 4FD7A 3QB8A 2VBQA 3P2HA 2I79A 1IYLA 1I12A 2BEIA 2B3VA 5KTAA 3FYNA 4IUSA 3ZJ0A 2EVNA 4KOTA 4Y49C 5IX3A 5F46A 1IB1E 1S7NA 3FXTA 3S6KA 3EC4A 3FRMA 3DR6A 2CY2A 2B4BA 2F5IA 3F8KA 4PK2A 3D3SA 4H6UA 4PSXA 2ZW6A 4X5KA 2FXFA 4KOSA 2GANA 3I3GA 1XE4A 4J3GA 1KUXA 4YGOA 4I49A 3PP9A 1NSLA 2IL4A 3V8IA 4KUAA 5HH1A 4AVCA 1V0CA 1MJAA 2ATRA 4JWPA 2CNMA 2DXQA 1KUYA 2VI7A 2JLMA 2QIRA 1S7LA 2PDOA 3R1KA 2FT0A 2BSWA 2PR8A 4RS2A 4QVTA 4B5PB 4UA3A 2B4DA 4HNYB 5C88A 3CXPA 4F0YA 4QB9A 1S7FA 3KKWA 3WR7A 4LUAA 1KUVA 4XNHC 4NF1A 4XPKA 1Q2CA 3EO4A 5H84A 4YFJA 5GCNA 4GS4A 2D4OA 2PRBA 4ORFA 2REEA 4XPDC 2R98A 5JPHA 4E2AA 3T9YA 4ZBGA 4ONUA 2P6GA 1MJ9A 2K5TA 4OLLA 1Z4EA 4UBRA 4R57A 3EXNA 2B4DB 5J8CA 2PC1A 1J4JA 3R9FA 1NE9A 5ISVA 2OZGA
chains in the Genus database with same CATH superfamily
4JLYA 4PQAA 3H4QA 2NMTA 2DPSA 4UEZA 3S6GA 3F5BA 8CPAA 4R7MA 4B10A 3DGVA 2VZYA 4U9YA 3S6FA 4B11A 5H86A 4UIAA 2C6CA 4Y49B 2BO9A 4MI4A 3KQZA 3BJ8A 4NGSA 5JGFA 5AG6A 1F2OA 3BLNA 3IWEA 1TIQA 4AG7A 4AVBA 4KS9A 3PFOA 4CS0B 1Z4RA 4HPSA 2OU2A 2PSWA 2I00A 3PFEA 5IB9A 2VXKA 4C2YA 1IICA 1RTQA 4JZ0A 2ZEDA 4KORA 1ON0A 5D8NA 4ONWA 5LYDA 5F09A 1NMTA 3I9SA 4FBEA 3DDDA 4OC0A 4WJBA 5BWAB 2Z0ZA 1ARMA 3VWDA 5EMIA 4R87A 3WABA 4R3KA 2REFA 5HXDA 3TX8A 1CP7A 4NEXA 4ZY2A 4F6AA 4UWJA 3CZXA 4YU9A 5J8FA 4ZX8A 2PJ7A 4R6TA 4X3RA 2OB0A 2R1IA 2GREA 3I1UA 1QQ9A 3WT4A 4M85A 3KR4A 4TNUA 3TO6A 1QSRA 1VKCA 3ISXA 1Y0YA 2J8MA 2Q4YA 2DEAA 3RAMA 3TTHA 2I3CA 3FJUA 4M6GA 4QBJA 2PCUA 2PJ0A 2POKA 1I1DA 5LYIA 2OZUA 3GB0A 3OWCA 2ZPAA 2HV2A 1TF9A 3CT9A 4YWYA 1CPSA 1XF8A 3D8PA 5DS0A 4YRHA 1FT7A 5F49A 4MFLA 1Z5RA 3KHZA 3TOAA 1Z8XA 3S9NA 1ARLA 3R96A 3D66A 4MHNA 3CXSA 4XPLA 3FEEA 3DNSA 3FNCA 1I21A 1XEBA 3W6SA 4LQGA 4A32A 4JXRA 3D7GA 2NYQA 5HMNA 4RUHA 2BOAA 1PUAA 3PB9X 3SXOA 2G0BA 4B5PA 2YGWA 2O4HA 4XNHB 2PJ6A 4CYOA 1JQGA 4U9ZA 1QSMA 2EUIA 4L8AA 4BMHA 2Q4VA 7CPAA 1UFHA 2ZXVA 1A2ZA 3B8GA 4Q36A 4E8OA 5J1QA 2EK9A 2WUUA 2ZEOA 3B3SA 2B58A 4R9MA 4UFXA 1LRZA 3VWEA 2XEFA 4CGMA 3B3VA 5A27A 1XMTA 2ZW4A 2WPXA 2F8HA 4XPDB 3VATA 2PJBA 3GY9A 3K2KA 4W9YA 1MJBA 2JDDA 3KL9A 1HEEA 4UCPA 4MMOA 1Z8LA 2ZEEA 3L2NA 1BPNA 3SXNA 4AB7A 4CAVA 4HKFA 3FBUA 3D4UA 1BO4A 1LANA 2Q04A 4WWVA 5G20A 1UWYA 4UFVA 5G21A 2ZELA 3JRUA 2Z10A 1P4NA 4NGPA 2PJ8A 3IU2A 1CPXA 2ABZA 2JBJA 1YREA 4QC6A 2Z3KA 3MGDA 1AYEA 3DLJA 2Q43A 4A94A 3JTKA 1N71A 3N7ZA 4OC1A 4K30A 5THWA 1BOBA 1YGHA 2Z11A 4KUBA 2P0WA 4PXDA 3TFYA 2YNEA 4MJ8A 2X7BA 1XRYA 5IV0A 3FB3A 3KQXA 4NCZA 4PXCA 1YR0A 2FSRA 4O23A 5HVHA 3TO9A 3D7DA 3DR8A 3KR5A 4E0AA 4C68A 4OAEA 4CRYB 3PB8X 3ZZIA 4KLWA 4MY3A 1PU9A 2CNSA 2ZW5A 3PGPA 4F8ZA 2VQYA 4OIDA 3DSBA 4MCPA 5FVJA 2O53A 4P6YA 1GYTA 5K8NA 4P4DA 2PVVA 3B3WA 2HC9A 3GUXA 2ZENA 5F47A 1M4DA 4F9VA 3NH8A 1RXTA 1XMBA 2JEVA 3BXMA 3KASA 1ELMP 2FVGA 3QAHA 2A4NA 4MRIA 3RNZA 2PR1A 5C82A 5JH9A 1AUGA 2G9DA 2J8NA 3RBUA 2G3AA 5I0CA 2FIWA 1YQEA 4Q38A 2PIZA 4UEFA 1IIDA 4OP4A 2ZEMA 2G3TA 4HNWB 3FIXA 4LQ6A 3EFAA 2J9AA 4UIBA 1QSNA 4OADA 1Z9UA 4KVOE 2PJ9A 4PV6A 4A95A 2Q0YA 3NA6A 4MHZA 3T8WA 3TT2A 4CAEA 4P44A 3LD2A 4UEEA 2GFQA 2Y0MA 3R9EA 3JUWA 1U6MA 4CAWA 2FCKA 4DUKA 5K8MA 3GKRA 3CPAA 3D7HA 1CG2A 5DWMA 5K8OA 2Z3NA 4P4BA 3WC6A 3FF3A 3GYAA 1MK4A 3D68A 2V8HA 2Z3LA 2JDCA 4NJQA 3NFZA 4MBUA 4MY0A 4MFZA 2F7VA 2P6FA 3H8EA 4NJRA 4M6IA 3NE7A 3QAYA 2JEWA 1P0HA 2KCWA 1CBXA 2FL4A 2GIVA 3G8WA 4KZTA 3RYOA 4KOYA 2PQ8A 2C1CA 3VARA 3W91A 3BJ7A 4F9UA 3B2YA 2PJCA 4A39A 1LCPA 4JYWA 2NSMA 2CNTA 2OH1A 2VZZA 4FD4A 5E96A 4CGOA 4CAFA 3RO0A 1BLLE 4CAXA 4EMEA 3E0KA 4A38A 2H5MA 4KVXA 4U5YA 1Y7RA 1Y9KA 1XOVA 1S60A 5ELYA 3D2PA 2ARHA 1S5KA 3R9GA 4EVYA 2JBKA 3A9LA 4KVME 4CYPA 1H8LA 3KZWA 4NXYA 4AVAA 2Q4ZA 4PXBA 2ZEGA 4A37A 2PJAA 2V77A 1DE4C 3FMCA 3H8GA 4OMEA 2Q7BA 4BD9A 4JJXA 1WK4A 1AMPA 2P6EA 1CJWA 3IIBA 4MCRA 6CPAA 4RN7A 3FECA 3LODA 3H5ZA 3PB4X 5EBVA 4EFDA 3TCVA 3C26A 4PSWA 1QMUA 3IWGA 1NSAA 2EWBA 4IHMA 2C27A 1YVKA 3PB7X 4P10A 2HQYA 5F48A 1PYTB 1R57A 3PRTA 1BAVA 2QVPA 4NFRA 4RI1A 1VIXA 1S3ZA 2O28A 3IU1A 3IFEA 1K4JA 4QUSA 2FE7A 3LACA 1Y9WA 5AG5A 2R8VA 4CGPA 4FD6A 3NH5A 1M1DA 4H6ZA 1Q2DA 4KLVA 4L89A 3EY5A 3SI1A 5JM6A 1VHSA 3SJEA 4F0XA 2YNDA 1TXRA 1XBUA 4IF5A 3IWWA 4B5OA 4R3LA 1XIXA 4CGNA 2VEZA 2Q7SA 4CGLA 1OZPA 3SHPA 2PJ2A 1YK3A 3D2MA 1XFOA 3WC7A 3FEDA 2WPWA 2R7HA 2EK8A 3UY5A 1YX0A 1F57A 1TKHA 1IU8A 1QSTA 2C6GA 2AE6A 2AFZA 2PRQA 4NSQA 3W6XA 2HUZA 4NGQA 3FX6A 2GU2A 2QMLA 4AG9A 2Q44A 1SQHA 3V38A 3R95A 1IOIA 1IOFA 1KWMA 1ZG7A 4MFPA 2BUEA 3TC8A 4ZGYB 2PIYA 3CDXA 3JVNA 5LYLA 1X12A 3PZJA 1CM0A 4PK3A 3WC5A 5LRKA 2ZEHA 4JXQA 5DWNA 4ZY1A 3PBEA 4C2XA 1Z8TA 1OBRA 1X10A 2FS5A 3K9TA 1RO5A 4ZYQA 1ZG9A 3BI0A 4Q7AA 2GE3A 4AXVA 1FY7A 1TKJA 2VL1A 2DF5A 2PJ5A 1YLEA 2B5GA 3P2FA 2D4PA 2GLFA 4P4EA 1LAMA 1F2PA 2FIAA 5CNPA 3TO7A 4CRZB 2QECA 4II9A 2ZEPA 1M4GA 2XEIA 2AFOA 2ZW7A 3SJGA 4KSAA 2J8RA 4DNCA 2ANPA 4B13A 4NGNA 3B3CA 3B3TA 3B35A 4GM5A 1M4LA 1HDUA 2BL1A 1LOKA 4KOUA 2AJ6A 2V8GA 2EO8A 4MFJA 1YW6A 1GHEA 3CXQA 3KGQA 1VHOA 2IJZA 4MHDA 1FNOA 2OOTA 1M44A 3K9UA 4FAIA 3D67A 4B14A 4FWUA 4CYNA 1YVOA 5LYFA 4K3NA 4KOVA 2B3UA 2WYRA 3KHXA 3IGRA 1KZFA 5G22A 4Z65A 4FD5A 4UWIA 4JD6A 2V8VA 3B7IA 1B87A 2CIJA 4KOXA 4UF4A 1YW4A 3NE8A 1S7KA 2RFHA 4UFWA 1LFWA 2B5GB 2ZOFA 2C6PA 1IYKA 1VGYA 1B6BA 5CPAA 3N5FA 2CXAA 3TOBA 3S9LA 1CP6A 1WWZA 4IK2A 3SI0A 4KOWA 4DYOA 4MHPA 5K8PA 4P45A 3IEHA 2CF4A 1TF8A 4KSIA 2QJ8A 3F0AA 5HVFA 2Z3PA 1R43A 4C7HA 4M3SA 3BHXA 1IGBA 4H89A 1QSOA 2IMOA 2WZNA 4G1PA 4LX9A 2RC4A 4X8IA 4MCSA 1Y0RA 5A28A 3LWUA 5JQ4A 3KI9A 2EBJA 5KTCA 4PPZA 2RB7A 1Q7LA 5EC4A 4DJLA 5IB0A 1Q2YA 2OZHA 3NH4A 4HNXB 4X2TA 1VHEA 4OC2A 4CYQA 2XEJA 2CTBA 2AFMA 3S6HA 1YLOA 3CPXA 1M4IA 2Z3OA 3TE4A 1L0CA 3PBBA 3VH9A 3T90A 4GXHA 4MFKA 3G3SA 4A31A 4FD7A 4P4JA 4OC4A 5G1ZA 4IAVA 2GLJA 3QB8A 2HB6A 4NGRA 4MFQA 4MHYA 2VBQA 3P2HA 1PCAA 2I79A 1IYLA 1I12A 1ELLP 3GIUA 2Q51A 2BEIA 4B12A 2AFXA 2B3VA 5KTAA 3FYNA 2AFSA 4IUSA 3ZJ0A 5HVGA 3MN8A 2V8DA 5KTDA 1TKFA 2EVNA 4KOTA 4Y49C 5IX3A 1YSJA 5F46A 1IB1E 4UCNA 1S7NA 1CX8A 3FXTA 5AG7A 3S6KA 4B6ZA 3EC4A 3FRMA 4NGTA 3DR6A 1ZLHA 2CY2A 2B4BA 2F5IA 3F8KA 4PK2A 1EE3P 1Y7EA 4R76A 3ISZA 3D3SA 2WSAA 1R3NA 4H6UA 4PSXA 4UCMA 4EWTA 3GLJA 4C7IA 2IQ6A 2AFWA 4P4FA 2ZW6A 2AFUA 4X5KA 1XJOA 2FXFA 4H2KA 3BI1A 4KOSA 2CTCA 3PEIA 3RZAA 2YNCC 3HLPA 5LRJA 2GANA 3FH4A 4ZI6A 4FUUA 3H8FA 1ZLIA 4ZX9A 3I3GA 1ZG8A 1XE4A 4J3GA 1KUXA 2Z3MA 2PJ4A 5CBMA 4YGOA 4I49A 3PP9A 5AGEA 5LRGA 1NSLA 2IL4A 3V8IA 3S9MA 4KUAA 5HH1A 4AVCA 1V0CA 1MJAA 2ATRA 3HUVA 4JWPA 5D29A 1BPMA 1IY7A 2CNMA 2BCOA 2DXQA 1LAPA 4OIWA 3SJFA 1KUYA 4P4IA 2VI7A 2JLMA 3MRUA 4A30A 2OR4A 3PB6X 4BINA 4ZY0A 4MCQA 3V7ZA 2QIRA 1DTDA 1S7LA 4OKOA 2PDOA 3R1KA 2FT0A 4NGMA 2BSWA 2PJ3A 2PR8A 4OC5A 4OC3A 1YMEA 3FVLA 4QVTA 4RS2A 4B5PB 4UA3A 4C2ZA 4BBHA 2B4DA 4MXUA 4HNYB 2PJ1A 2PE3A 2ZOGA 2DPTA 5C88A 3CXPA 4TWEA 4F0YA 3D7FA 5I4MA 3IC1A 2ODFA 3LMSA 4QB9A 1S7FA 3KKWA 3WR7A 4LUAA 1KUVA 4XNHC 2QYVA 4M6HA 4CPAA 4NF1A 1ZO0A 4XPKA 3SJXA 1Q2CA 3EO4A 4PXEA 5H84A 3SI2A 4YFJA 5GCNA 4GS4A 2D4OA 2PRBA 4ORFA 3QNVA 2REEA 4XPDC 2R98A 5JPHA 3IO1A 2XEGA 4A2ZA 2PVWA 4E2AA 1HDQA 4R8FA 3T9YA 4ZBGA 4ONUA 5AG4A 2P6GA 1MJ9A 2K5TA 4OLLA 1Z2LA 1Z4EA 1Z8WA 4UBRA 4R57A 3EXNA 2B4DB 2ZEFA 3IJ3A 4A33A 2PC1A 5J8CA 1J4JA 4KSFA 1JWQA 3R9FA 2YNCA 1NE9A 5ISVA 2OZGA
chains in the Genus database with same CATH topology
4JLYA 3H4QA 2NMTA 2DPSA 3S6GA 3F5BA 4B10A 2VZYA 4U9YA 3S6FA 4B11A 5H86A 4Y49B 4MI4A 3BJ8A 5AG6A 3BLNA 3IWEA 1TIQA 4AG7A 4AVBA 4KS9A 4CS0B 1Z4RA 2OU2A 2PSWA 2I00A 2VXKA 4C2YA 1IICA 4KORA 1ON0A 1NMTA 3I9SA 3DDDA 5BWAB 2Z0ZA 3VWDA 4R87A 4R3KA 2REFA 4NEXA 4F6AA 4UWJA 5J8FA 2OB0A 2R1IA 4M85A 3TO6A 1QSRA 1VKCA 2J8MA 2Q4YA 3TTHA 1I1DA 2OZUA 3OWCA 2ZPAA 2HV2A 1XF8A 3D8PA 5F49A 4YRHA 4MFLA 3TOAA 3R96A 3CXSA 4XPLA 3DNSA 3FNCA 1I21A 1XEBA 3W6SA 4A32A 4JXRA 5HMNA 1PUAA 4B5PA 3SXOA 2G0BA 2YGWA 4XNHB 4CYOA 4U9ZA 1QSMA 2EUIA 4L8AA 4BMHA 2Q4VA 1UFHA 2ZXVA 3B8GA 4Q36A 4E8OA 2WUUA 4R9MA 4UFXA 3VWEA 2B58A 5KTDA 1LRZA 4CGMA 5A27A 1XMTA 2ZW4A 2WPXA 4XPDB 3GY9A 1MJBA 2JDDA 4UCPA 3SXNA 4AB7A 4CAVA 4HKFA 3FBUA 1BO4A 2Q04A 5G20A 4UFVA 5G21A 2Z10A 1P4NA 3IU2A 4QC6A 1YREA 2Z3KA 3MGDA 3JTKA 1N71A 3N7ZA 4K30A 1BOBA 1YGHA 2Z11A 4KUBA 2P0WA 3TFYA 2YNEA 4MJ8A 2X7BA 5IV0A 3FB3A 4NCZA 1YR0A 2FSRA 3TO9A 3DR8A 4E0AA 4C68A 4OAEA 4CRYB 3ZZIA 4KLWA 4MY3A 1PU9A 2CNSA 2ZW5A 3PGPA 2VQYA 3DSBA 5FVJA 5F47A 1M4DA 1RXTA 2JEVA 3QAHA 5C82A 2A4NA 2PR1A 2J8NA 5I0CA 2G3AA 2FIWA 4Q38A 1IIDA 2G3TA 4HNWB 3FIXA 3EFAA 1QSNA 4OADA 1Z9UA 4KVOE 4PV6A 4A95A 2Q0YA 3TT2A 4CAEA 3LD2A 2Y0MA 3R9EA 3JUWA 1U6MA 4CAWA 2FCKA 3GKRA 5DWMA 2Z3NA 3GYAA 1MK4A 2Z3LA 2JDCA 4MBUA 4MY0A 4MFZA 2P6FA 3NE7A 1P0HA 2KCWA 4KZTA 2FL4A 2GIVA 3G8WA 3RYOA 4KOYA 2PQ8A 3W91A 3BJ7A 2VZZA 2CNTA 2OH1A 4FD4A 5E96A 4CGOA 4CAFA 4CAXA 3E0KA 2H5MA 4KVXA 4U5YA 1Y7RA 1Y9KA 1S60A 3D2PA 2ARHA 1S5KA 3R9GA 4EVYA 3A9LA 4KVME 4CYPA 4NXYA 4AVAA 2Q7BA 4JJXA 1WK4A 2P6EA 1CJWA 5EBVA 3LODA 3H5ZA 3TCVA 3C26A 4PSWA 3IWGA 2C27A 1YVKA 2HQYA 5F48A 1R57A 4RI1A 1S3ZA 2O28A 3IU1A 1K4JA 4QUSA 2FE7A 1Y9WA 5AG5A 2R8VA 4CGPA 4FD6A 4KLVA 1M1DA 4H6ZA 1Q2DA 4L89A 3EY5A 1VHSA 4F0XA 2YNDA 4IF5A 4B5OA 4R3LA 1XIXA 4CGNA 2VEZA 4CGLA 1OZPA 3SHPA 1YK3A 3D2MA 2WPWA 2R7HA 3UY5A 1YX0A 1QSTA 4NSQA 2AE6A 3W6XA 2HUZA 2QMLA 4AG9A 2Q44A 1SQHA 3R95A 4MFPA 2BUEA 4ZGYB 3JVNA 3PZJA 1CM0A 4PK3A 4JXQA 5DWNA 4C2XA 2FS5A 1RO5A 2GE3A 1FY7A 1YLEA 2B5GA 3P2FA 2D4PA 4II9A 5CNPA 3TO7A 2FIAA 4CRZB 2QECA 1M4GA 2ZW7A 4KSAA 2J8RA 4DNCA 4B13A 4KOUA 2BL1A 4QBJA 2AJ6A 4MFJA 3CXQA 1GHEA 4MHDA 1M44A 3K9UA 4B14A 4CYNA 1YVOA 4KOVA 2B3UA 3IGRA 1KZFA 5G22A 4FD5A 4UWIA 4JD6A 1B87A 4KOXA 1S7KA 4UFWA 2B5GB 1IYKA 1B6BA 2CXAA 3TOBA 1WWZA 4KOWA 3F0AA 2Z3PA 4C7HA 4M3SA 4H89A 1QSOA 4LX9A 2RC4A 5A28A 5JQ4A 5KTCA 5EC4A 5IB0A 1Q2YA 2OZHA 4HNXB 4CYQA 3S6HA 1M4IA 2Z3OA 3TE4A 1L0CA 3T90A 4MFKA 3G3SA 4A31A 4FD7A 5G1ZA 3QB8A 4MFQA 2VBQA 3P2HA 2I79A 1IYLA 1I12A 2BEIA 4B12A 2B3VA 5KTAA 3FYNA 4IUSA 3ZJ0A 2EVNA 4KOTA 4Y49C 5IX3A 5F46A 1IB1E 4UCNA 1S7NA 3FXTA 5AG7A 3S6KA 3EC4A 3FRMA 3DR6A 2CY2A 2B4BA 2F5IA 3F8KA 4PK2A 3D3SA 2WSAA 4H6UA 4PSXA 4UCMA 4C7IA 2ZW6A 4X5KA 2FXFA 4KOSA 2YNCC 2GANA 3I3GA 1XE4A 4J3GA 1KUXA 2Z3MA 4YGOA 4I49A 3PP9A 5AGEA 1NSLA 2IL4A 3V8IA 4KUAA 5HH1A 4AVCA 1V0CA 1MJAA 2ATRA 4JWPA 2CNMA 2DXQA 1KUYA 2VI7A 2JLMA 4A30A 2QIRA 1S7LA 2PDOA 3R1KA 2FT0A 2BSWA 2PR8A 4RS2A 4QVTA 4B5PB 4UA3A 4C2ZA 4BBHA 2B4DA 4HNYB 2DPTA 5C88A 3CXPA 4F0YA 4QB9A 1S7FA 3KKWA 3WR7A 4LUAA 1KUVA 4XNHC 4NF1A 1ZO0A 4XPKA 1Q2CA 3EO4A 5H84A 4YFJA 5GCNA 4GS4A 2D4OA 2PRBA 4ORFA 2REEA 4XPDC 2R98A 5JPHA 4A2ZA 4E2AA 3T9YA 4ZBGA 4ONUA 5AG4A 2P6GA 1MJ9A 2K5TA 4OLLA 1Z4EA 4UBRA 4R57A 3EXNA 2B4DB 4A33A 2PC1A 5J8CA 1J4JA 4KSFA 3R9FA 2YNCA 1NE9A 5ISVA 2OZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JLY A;  3H4Q A;  2NMT A;  3S6G A;  3F5B A;  2VZY A;  4U9Y A;  3S6F A;  5H86 A;  4Y49 B;  4MI4 A;  3BJ8 A;  3BLN A;  4AG7 A;  1TIQ A;  4AVB A;  4CS0 B;  1Z4R A;  2OU2 A;  2PSW A;  2I00 A;  2VXK A;  1IIC A;  4KOR A;  1ON0 A;  1NMT A;  3I9S A;  3DDD A;  2Z0Z A;  3VWD A;  4R87 A;  4R3K A;  2REF A;  4NEX A;  4F6A A;  4UWJ A;  5J8F A;  2OB0 A;  2R1I A;  4M85 A;  3TO6 A;  1QSR A;  1VKC A;  2J8M A;  2Q4Y A;  3TTH A;  1I1D A;  2OZU A;  3OWC A;  2ZPA A;  2HV2 A;  1XF8 A;  3D8P A;  5F49 A;  4YRH A;  3TOA A;  3R96 A;  3CXS A;  4XPL A;  3DNS A;  3FNC A;  1I21 A;  1XEB A;  3W6S A;  4JXR A;  5HMN A;  1PUA A;  4B5P A;  3SXO A;  2G0B A;  4XNH B;  4U9Z A;  1QSM A;  2EUI A;  4L8A A;  4BMH A;  2Q4V A;  1UFH A;  2ZXV A;  3B8G A;  4E8O A;  4R9M A;  3VWE A;  2B58 A;  5KTD A;  1LRZ A;  1XMT A;  2ZW4 A;  2WPX A;  4XPD B;  3GY9 A;  1MJB A;  2JDD A;  3SXN A;  4AB7 A;  4CAV A;  4HKF A;  3FBU A;  1BO4 A;  2Q04 A;  2Z10 A;  1P4N A;  4QC6 A;  1YRE A;  3MGD A;  1N71 A;  3N7Z A;  4K30 A;  1BOB A;  1YGH A;  2Z11 A;  4KUB A;  2P0W A;  3TFY A;  4MJ8 A;  2X7B A;  5IV0 A;  3FB3 A;  4NCZ A;  1YR0 A;  2FSR A;  3TO9 A;  3DR8 A;  4E0A A;  4OAE A;  4CRY B;  3ZZI A;  4KLW A;  4MY3 A;  1PU9 A;  2CNS A;  2ZW5 A;  3PGP A;  2VQY A;  3DSB A;  5FVJ A;  5F47 A;  1M4D A;  1RXT A;  2JEV A;  3QAH A;  5C82 A;  2A4N A;  2PR1 A;  2J8N A;  5I0C A;  2G3A A;  2FIW A;  1IID A;  2G3T A;  4HNW B;  3FIX A;  3EFA A;  1QSN A;  4OAD A;  1Z9U A;  4KVO E;  4PV6 A;  2Q0Y A;  3TT2 A;  3LD2 A;  2Y0M A;  3R9E A;  3JUW A;  1U6M A;  4CAW A;  2FCK A;  3GKR A;  5DWM A;  3GYA A;  1MK4 A;  2JDC A;  4MBU A;  4MY0 A;  2P6F A;  3NE7 A;  1P0H A;  2KCW A;  4KZT A;  2FL4 A;  2GIV A;  3G8W A;  3RYO A;  4KOY A;  2PQ8 A;  3W91 A;  3BJ7 A;  2VZZ A;  2CNT A;  2OH1 A;  4FD4 A;  5E96 A;  4CAX A;  3E0K A;  2H5M A;  4KVX A;  4U5Y A;  1Y7R A;  1Y9K A;  1S60 A;  3D2P A;  2ARH A;  1S5K A;  3R9G A;  4EVY A;  4KVM E;  4NXY A;  4AVA A;  2Q7B A;  4JJX A;  1WK4 A;  2P6E A;  1CJW A;  5EBV A;  3LOD A;  3TCV A;  3C26 A;  4PSW A;  3IWG A;  2C27 A;  1YVK A;  2HQY A;  5F48 A;  1R57 A;  4RI1 A;  1S3Z A;  2O28 A;  1K4J A;  4QUS A;  2FE7 A;  1Y9W A;  2R8V A;  4FD6 A;  4KLV A;  1M1D A;  4H6Z A;  1Q2D A;  4L89 A;  3EY5 A;  1VHS A;  4IF5 A;  4B5O A;  4R3L A;  1XIX A;  2VEZ A;  1OZP A;  3SHP A;  1YK3 A;  3D2M A;  2WPW A;  2R7H A;  3UY5 A;  1YX0 A;  1QST A;  4NSQ A;  2AE6 A;  3W6X A;  2HUZ A;  2QML A;  4AG9 A;  2Q44 A;  1SQH A;  3R95 A;  2BUE A;  3JVN A;  3PZJ A;  1CM0 A;  4PK3 A;  4JXQ A;  5DWN A;  2FS5 A;  1RO5 A;  2GE3 A;  1FY7 A;  1YLE A;  2B5G A;  3P2F A;  2D4P A;  4II9 A;  5CNP A;  3TO7 A;  2FIA A;  4CRZ B;  2QEC A;  1M4G A;  2ZW7 A;  2J8R A;  4DNC A;  4KOU A;  2BL1 A;  4QBJ A;  2AJ6 A;  3CXQ A;  1GHE A;  4MHD A;  1M44 A;  3K9U A;  1YVO A;  4KOV A;  2B3U A;  3IGR A;  1KZF A;  4FD5 A;  4UWI A;  4JD6 A;  1B87 A;  4KOX A;  1S7K A;  2B5G B;  1IYK A;  1B6B A;  3TOB A;  1WWZ A;  4KOW A;  3F0A A;  4M3S A;  4H89 A;  1QSO A;  4LX9 A;  2RC4 A;  5JQ4 A;  5KTC A;  5EC4 A;  5IB0 A;  1Q2Y A;  2OZH A;  4HNX B;  3S6H A;  1M4I A;  3TE4 A;  1L0C A;  3T90 A;  3G3S A;  4FD7 A;  3QB8 A;  2VBQ A;  3P2H A;  2I79 A;  1IYL A;  1I12 A;  2BEI A;  2B3V A;  5KTA A;  3FYN A;  4IUS A;  3ZJ0 A;  2EVN A;  4KOT A;  4Y49 C;  5IX3 A;  5F46 A;  1IB1 E;  1S7N A;  3FXT A;  3S6K A;  3EC4 A;  3FRM A;  3DR6 A;  2CY2 A;  2B4B A;  2F5I A;  3F8K A;  4PK2 A;  3D3S A;  4H6U A;  4PSX A;  2ZW6 A;  4X5K A;  2FXF A;  4KOS A;  2GAN A;  3I3G A;  1XE4 A;  4J3G A;  1KUX A;  4YGO A;  4I49 A;  3PP9 A;  1NSL A;  2IL4 A;  3V8I A;  4KUA A;  5HH1 A;  4AVC A;  1V0C A;  1MJA A;  2ATR A;  4JWP A;  2CNM A;  2DXQ A;  1KUY A;  2VI7 A;  2JLM A;  2QIR A;  1S7L A;  2PDO A;  3R1K A;  2FT0 A;  2BSW A;  2PR8 A;  4RS2 A;  4QVT A;  4B5P B;  4UA3 A;  2B4D A;  4HNY B;  5C88 A;  3CXP A;  4F0Y A;  4QB9 A;  1S7F A;  3KKW A;  3WR7 A;  4LUA A;  1KUV A;  4XNH C;  4NF1 A;  4XPK A;  1Q2C A;  3EO4 A;  5H84 A;  4YFJ A;  5GCN A;  4GS4 A;  2D4O A;  2PRB A;  4ORF A;  2REE A;  4XPD C;  2R98 A;  5JPH A;  4E2A A;  3T9Y A;  4ZBG A;  4ONU A;  2P6G A;  1MJ9 A;  2K5T A;  4OLL A;  1Z4E A;  4UBR A;  4R57 A;  3EXN A;  2B4D B;  5J8C A;  2PC1 A;  1J4J A;  3R9F A;  1NE9 A;  5ISV A;  2OZG A; 
#chains in the Genus database with same CATH topology
 4JLY A;  4PQA A;  3H4Q A;  2NMT A;  2DPS A;  4UEZ A;  3S6G A;  3F5B A;  8CPA A;  4R7M A;  4B10 A;  3DGV A;  2VZY A;  4U9Y A;  3S6F A;  4B11 A;  5H86 A;  4UIA A;  2C6C A;  4Y49 B;  2BO9 A;  4MI4 A;  3KQZ A;  3BJ8 A;  4NGS A;  5JGF A;  5AG6 A;  1F2O A;  3BLN A;  3IWE A;  1TIQ A;  4AG7 A;  4AVB A;  4KS9 A;  3PFO A;  4CS0 B;  1Z4R A;  4HPS A;  2OU2 A;  2PSW A;  2I00 A;  3PFE A;  5IB9 A;  2VXK A;  4C2Y A;  1IIC A;  1RTQ A;  4JZ0 A;  2ZED A;  4KOR A;  1ON0 A;  5D8N A;  4ONW A;  5LYD A;  5F09 A;  1NMT A;  3I9S A;  4FBE A;  3DDD A;  4OC0 A;  4WJB A;  5BWA B;  2Z0Z A;  1ARM A;  3VWD A;  5EMI A;  4R87 A;  3WAB A;  4R3K A;  2REF A;  5HXD A;  3TX8 A;  1CP7 A;  4NEX A;  4ZY2 A;  4F6A A;  4UWJ A;  3CZX A;  4YU9 A;  5J8F A;  4ZX8 A;  2PJ7 A;  4R6T A;  4X3R A;  2OB0 A;  2R1I A;  2GRE A;  3I1U A;  1QQ9 A;  3WT4 A;  4M85 A;  3KR4 A;  4TNU A;  3TO6 A;  1QSR A;  1VKC A;  3ISX A;  1Y0Y A;  2J8M A;  2Q4Y A;  2DEA A;  3RAM A;  3TTH A;  2I3C A;  3FJU A;  4M6G A;  4QBJ A;  2PCU A;  2PJ0 A;  2POK A;  1I1D A;  5LYI A;  2OZU A;  3GB0 A;  3OWC A;  2ZPA A;  2HV2 A;  1TF9 A;  3CT9 A;  4YWY A;  1CPS A;  1XF8 A;  3D8P A;  5DS0 A;  4YRH A;  1FT7 A;  5F49 A;  4MFL A;  1Z5R A;  3KHZ A;  3TOA A;  1Z8X A;  3S9N A;  1ARL A;  3R96 A;  3D66 A;  4MHN A;  3CXS A;  4XPL A;  3FEE A;  3DNS A;  3FNC A;  1I21 A;  1XEB A;  3W6S A;  4LQG A;  4A32 A;  4JXR A;  3D7G A;  2NYQ A;  5HMN A;  4RUH A;  2BOA A;  1PUA A;  3PB9 X;  3SXO A;  2G0B A;  4B5P A;  2YGW A;  2O4H A;  4XNH B;  2PJ6 A;  4CYO A;  1JQG A;  4U9Z A;  1QSM A;  2EUI A;  4L8A A;  4BMH A;  2Q4V A;  7CPA A;  1UFH A;  2ZXV A;  1A2Z A;  3B8G A;  4Q36 A;  4E8O A;  5J1Q A;  2EK9 A;  2WUU A;  2ZEO A;  3B3S A;  2B58 A;  4R9M A;  4UFX A;  1LRZ A;  3VWE A;  2XEF A;  4CGM A;  3B3V A;  5A27 A;  1XMT A;  2ZW4 A;  2WPX A;  2F8H A;  4XPD B;  3VAT A;  2PJB A;  3GY9 A;  3K2K A;  4W9Y A;  1MJB A;  2JDD A;  3KL9 A;  1HEE A;  4UCP A;  4MMO A;  1Z8L A;  2ZEE A;  3L2N A;  1BPN A;  3SXN A;  4AB7 A;  4CAV A;  4HKF A;  3FBU A;  3D4U A;  1BO4 A;  1LAN A;  2Q04 A;  4WWV A;  5G20 A;  1UWY A;  4UFV A;  5G21 A;  2ZEL A;  3JRU A;  2Z10 A;  1P4N A;  4NGP A;  2PJ8 A;  3IU2 A;  1CPX A;  2ABZ A;  2JBJ A;  1YRE A;  4QC6 A;  2Z3K A;  3MGD A;  1AYE A;  3DLJ A;  2Q43 A;  4A94 A;  3JTK A;  1N71 A;  3N7Z A;  4OC1 A;  4K30 A;  5THW A;  1BOB A;  1YGH A;  2Z11 A;  4KUB A;  2P0W A;  4PXD A;  3TFY A;  2YNE A;  4MJ8 A;  2X7B A;  1XRY A;  5IV0 A;  3FB3 A;  3KQX A;  4NCZ A;  4PXC A;  1YR0 A;  2FSR A;  4O23 A;  5HVH A;  3TO9 A;  3D7D A;  3DR8 A;  3KR5 A;  4E0A A;  4C68 A;  4OAE A;  4CRY B;  3PB8 X;  3ZZI A;  4KLW A;  4MY3 A;  1PU9 A;  2CNS A;  2ZW5 A;  3PGP A;  4F8Z A;  2VQY A;  4OID A;  3DSB A;  4MCP A;  5FVJ A;  2O53 A;  4P6Y A;  1GYT A;  5K8N A;  4P4D A;  2PVV A;  3B3W A;  2HC9 A;  3GUX A;  2ZEN A;  5F47 A;  1M4D A;  4F9V A;  3NH8 A;  1RXT A;  1XMB A;  2JEV A;  3BXM A;  3KAS A;  1ELM P;  2FVG A;  3QAH A;  2A4N A;  4MRI A;  3RNZ A;  2PR1 A;  5C82 A;  5JH9 A;  1AUG A;  2G9D A;  2J8N A;  3RBU A;  2G3A A;  5I0C A;  2FIW A;  1YQE A;  4Q38 A;  2PIZ A;  4UEF A;  1IID A;  4OP4 A;  2ZEM A;  2G3T A;  4HNW B;  3FIX A;  4LQ6 A;  3EFA A;  2J9A A;  4UIB A;  1QSN A;  4OAD A;  1Z9U A;  4KVO E;  2PJ9 A;  4PV6 A;  4A95 A;  2Q0Y A;  3NA6 A;  4MHZ A;  3T8W A;  3TT2 A;  4CAE A;  4P44 A;  3LD2 A;  4UEE A;  2GFQ A;  2Y0M A;  3R9E A;  3JUW A;  1U6M A;  4CAW A;  2FCK A;  4DUK A;  5K8M A;  3GKR A;  3CPA A;  3D7H A;  1CG2 A;  5DWM A;  5K8O A;  2Z3N A;  4P4B A;  3WC6 A;  3FF3 A;  3GYA A;  1MK4 A;  3D68 A;  2V8H A;  2Z3L A;  2JDC A;  4NJQ A;  3NFZ A;  4MBU A;  4MY0 A;  4MFZ A;  2F7V A;  2P6F A;  3H8E A;  4NJR A;  4M6I A;  3NE7 A;  3QAY A;  2JEW A;  1P0H A;  2KCW A;  1CBX A;  2FL4 A;  2GIV A;  3G8W A;  4KZT A;  3RYO A;  4KOY A;  2PQ8 A;  2C1C A;  3VAR A;  3W91 A;  3BJ7 A;  4F9U A;  3B2Y A;  2PJC A;  4A39 A;  1LCP A;  4JYW A;  2NSM A;  2CNT A;  2OH1 A;  2VZZ A;  4FD4 A;  5E96 A;  4CGO A;  4CAF A;  3RO0 A;  1BLL E;  4CAX A;  4EME A;  3E0K A;  4A38 A;  2H5M A;  4KVX A;  4U5Y A;  1Y7R A;  1Y9K A;  1XOV A;  1S60 A;  5ELY A;  3D2P A;  2ARH A;  1S5K A;  3R9G A;  4EVY A;  2JBK A;  3A9L A;  4KVM E;  4CYP A;  1H8L A;  3KZW A;  4NXY A;  4AVA A;  2Q4Z A;  4PXB A;  2ZEG A;  4A37 A;  2PJA A;  2V77 A;  1DE4 C;  3FMC A;  3H8G A;  4OME A;  2Q7B A;  4BD9 A;  4JJX A;  1WK4 A;  1AMP A;  2P6E A;  1CJW A;  3IIB A;  4MCR A;  6CPA A;  4RN7 A;  3FEC A;  3LOD A;  3H5Z A;  3PB4 X;  5EBV A;  4EFD A;  3TCV A;  3C26 A;  4PSW A;  1QMU A;  3IWG A;  1NSA A;  2EWB A;  4IHM A;  2C27 A;  1YVK A;  3PB7 X;  4P10 A;  2HQY A;  5F48 A;  1PYT B;  1R57 A;  3PRT A;  1BAV A;  2QVP A;  4NFR A;  4RI1 A;  1VIX A;  1S3Z A;  2O28 A;  3IU1 A;  3IFE A;  1K4J A;  4QUS A;  2FE7 A;  3LAC A;  1Y9W A;  5AG5 A;  2R8V A;  4CGP A;  4FD6 A;  3NH5 A;  1M1D A;  4H6Z A;  1Q2D A;  4KLV A;  4L89 A;  3EY5 A;  3SI1 A;  5JM6 A;  1VHS A;  3SJE A;  4F0X A;  2YND A;  1TXR A;  1XBU A;  4IF5 A;  3IWW A;  4B5O A;  4R3L A;  1XIX A;  4CGN A;  2VEZ A;  2Q7S A;  4CGL A;  1OZP A;  3SHP A;  2PJ2 A;  1YK3 A;  3D2M A;  1XFO A;  3WC7 A;  3FED A;  2WPW A;  2R7H A;  2EK8 A;  3UY5 A;  1YX0 A;  1F57 A;  1TKH A;  1IU8 A;  1QST A;  2C6G A;  2AE6 A;  2AFZ A;  2PRQ A;  4NSQ A;  3W6X A;  2HUZ A;  4NGQ A;  3FX6 A;  2GU2 A;  2QML A;  4AG9 A;  2Q44 A;  1SQH A;  3V38 A;  3R95 A;  1IOI A;  1IOF A;  1KWM A;  1ZG7 A;  4MFP A;  2BUE A;  3TC8 A;  4ZGY B;  2PIY A;  3CDX A;  3JVN A;  5LYL A;  1X12 A;  3PZJ A;  1CM0 A;  4PK3 A;  3WC5 A;  5LRK A;  2ZEH A;  4JXQ A;  5DWN A;  4ZY1 A;  3PBE A;  4C2X A;  1Z8T A;  1OBR A;  1X10 A;  2FS5 A;  3K9T A;  1RO5 A;  4ZYQ A;  1ZG9 A;  3BI0 A;  4Q7A A;  2GE3 A;  4AXV A;  1FY7 A;  1TKJ A;  2VL1 A;  2DF5 A;  2PJ5 A;  1YLE A;  2B5G A;  3P2F A;  2D4P A;  2GLF A;  4P4E A;  1LAM A;  1F2P A;  2FIA A;  5CNP A;  3TO7 A;  4CRZ B;  2QEC A;  4II9 A;  2ZEP A;  1M4G A;  2XEI A;  2AFO A;  2ZW7 A;  3SJG A;  4KSA A;  2J8R A;  4DNC A;  2ANP A;  4B13 A;  4NGN A;  3B3C A;  3B3T A;  3B35 A;  4GM5 A;  1M4L A;  1HDU A;  2BL1 A;  1LOK A;  4KOU A;  2AJ6 A;  2V8G A;  2EO8 A;  4MFJ A;  1YW6 A;  1GHE A;  3CXQ A;  3KGQ A;  1VHO A;  2IJZ A;  4MHD A;  1FNO A;  2OOT A;  1M44 A;  3K9U A;  4FAI A;  3D67 A;  4B14 A;  4FWU A;  4CYN A;  1YVO A;  5LYF A;  4K3N A;  4KOV A;  2B3U A;  2WYR A;  3KHX A;  3IGR A;  1KZF A;  5G22 A;  4Z65 A;  4FD5 A;  4UWI A;  4JD6 A;  2V8V A;  3B7I A;  1B87 A;  2CIJ A;  4KOX A;  4UF4 A;  1YW4 A;  3NE8 A;  1S7K A;  2RFH A;  4UFW A;  1LFW A;  2B5G B;  2ZOF A;  2C6P A;  1IYK A;  1VGY A;  1B6B A;  5CPA A;  3N5F A;  2CXA A;  3TOB A;  3S9L A;  1CP6 A;  1WWZ A;  4IK2 A;  3SI0 A;  4KOW A;  4DYO A;  4MHP A;  5K8P A;  4P45 A;  3IEH A;  2CF4 A;  1TF8 A;  4KSI A;  2QJ8 A;  3F0A A;  5HVF A;  2Z3P A;  1R43 A;  4C7H A;  4M3S A;  3BHX A;  1IGB A;  4H89 A;  1QSO A;  2IMO A;  2WZN A;  4G1P A;  4LX9 A;  2RC4 A;  4X8I A;  4MCS A;  1Y0R A;  5A28 A;  3LWU A;  5JQ4 A;  3KI9 A;  2EBJ A;  5KTC A;  4PPZ A;  2RB7 A;  1Q7L A;  5EC4 A;  4DJL A;  5IB0 A;  1Q2Y A;  2OZH A;  3NH4 A;  4HNX B;  4X2T A;  1VHE A;  4OC2 A;  4CYQ A;  2XEJ A;  2CTB A;  2AFM A;  3S6H A;  1YLO A;  3CPX A;  1M4I A;  2Z3O A;  3TE4 A;  1L0C A;  3PBB A;  3VH9 A;  3T90 A;  4GXH A;  4MFK A;  3G3S A;  4A31 A;  4FD7 A;  4P4J A;  4OC4 A;  5G1Z A;  4IAV A;  2GLJ A;  3QB8 A;  2HB6 A;  4NGR A;  4MFQ A;  4MHY A;  2VBQ A;  3P2H A;  1PCA A;  2I79 A;  1IYL A;  1I12 A;  1ELL P;  3GIU A;  2Q51 A;  2BEI A;  4B12 A;  2AFX A;  2B3V A;  5KTA A;  3FYN A;  2AFS A;  4IUS A;  3ZJ0 A;  5HVG A;  3MN8 A;  2V8D A;  5KTD A;  1TKF A;  2EVN A;  4KOT A;  4Y49 C;  5IX3 A;  1YSJ A;  5F46 A;  1IB1 E;  4UCN A;  1S7N A;  1CX8 A;  3FXT A;  5AG7 A;  3S6K A;  4B6Z A;  3EC4 A;  3FRM A;  4NGT A;  3DR6 A;  1ZLH A;  2CY2 A;  2B4B A;  2F5I A;  3F8K A;  4PK2 A;  1EE3 P;  1Y7E A;  4R76 A;  3ISZ A;  3D3S A;  2WSA A;  1R3N A;  4H6U A;  4PSX A;  4UCM A;  4EWT A;  3GLJ A;  4C7I A;  2IQ6 A;  2AFW A;  4P4F A;  2ZW6 A;  2AFU A;  4X5K A;  1XJO A;  2FXF A;  4H2K A;  3BI1 A;  4KOS A;  2CTC A;  3PEI A;  3RZA A;  2YNC C;  3HLP A;  5LRJ A;  2GAN A;  3FH4 A;  4ZI6 A;  4FUU A;  3H8F A;  1ZLI A;  4ZX9 A;  3I3G A;  1ZG8 A;  1XE4 A;  4J3G A;  1KUX A;  2Z3M A;  2PJ4 A;  5CBM A;  4YGO A;  4I49 A;  3PP9 A;  5AGE A;  5LRG A;  1NSL A;  2IL4 A;  3V8I A;  3S9M A;  4KUA A;  5HH1 A;  4AVC A;  1V0C A;  1MJA A;  2ATR A;  3HUV A;  4JWP A;  5D29 A;  1BPM A;  1IY7 A;  2CNM A;  2BCO A;  2DXQ A;  1LAP A;  4OIW A;  3SJF A;  1KUY A;  4P4I A;  2VI7 A;  2JLM A;  3MRU A;  4A30 A;  2OR4 A;  3PB6 X;  4BIN A;  4ZY0 A;  4MCQ A;  3V7Z A;  2QIR A;  1DTD A;  1S7L A;  4OKO A;  2PDO A;  3R1K A;  2FT0 A;  4NGM A;  2BSW A;  2PJ3 A;  2PR8 A;  4OC5 A;  4OC3 A;  1YME A;  3FVL A;  4QVT A;  4RS2 A;  4B5P B;  4UA3 A;  4C2Z A;  4BBH A;  2B4D A;  4MXU A;  4HNY B;  2PJ1 A;  2PE3 A;  2ZOG A;  2DPT A;  5C88 A;  3CXP A;  4TWE A;  4F0Y A;  3D7F A;  5I4M A;  3IC1 A;  2ODF A;  3LMS A;  4QB9 A;  1S7F A;  3KKW A;  3WR7 A;  4LUA A;  1KUV A;  4XNH C;  2QYV A;  4M6H A;  4CPA A;  4NF1 A;  1ZO0 A;  4XPK A;  3SJX A;  1Q2C A;  3EO4 A;  4PXE A;  5H84 A;  3SI2 A;  4YFJ A;  5GCN A;  4GS4 A;  2D4O A;  2PRB A;  4ORF A;  3QNV A;  2REE A;  4XPD C;  2R98 A;  5JPH A;  3IO1 A;  2XEG A;  4A2Z A;  2PVW A;  4E2A A;  1HDQ A;  4R8F A;  3T9Y A;  4ZBG A;  4ONU A;  5AG4 A;  2P6G A;  1MJ9 A;  2K5T A;  4OLL A;  1Z2L A;  1Z4E A;  1Z8W A;  4UBR A;  4R57 A;  3EXN A;  2B4D B;  2ZEF A;  3IJ3 A;  4A33 A;  2PC1 A;  5J8C A;  1J4J A;  4KSF A;  1JWQ A;  3R9F A;  2YNC A;  1NE9 A;  5ISV A;  2OZG A; 
#chains in the Genus database with same CATH homology
 4JLY A;  3H4Q A;  2NMT A;  2DPS A;  3S6G A;  3F5B A;  4B10 A;  2VZY A;  4U9Y A;  3S6F A;  4B11 A;  5H86 A;  4Y49 B;  4MI4 A;  3BJ8 A;  5AG6 A;  3BLN A;  3IWE A;  1TIQ A;  4AG7 A;  4AVB A;  4KS9 A;  4CS0 B;  1Z4R A;  2OU2 A;  2PSW A;  2I00 A;  2VXK A;  4C2Y A;  1IIC A;  4KOR A;  1ON0 A;  1NMT A;  3I9S A;  3DDD A;  5BWA B;  2Z0Z A;  3VWD A;  4R87 A;  4R3K A;  2REF A;  4NEX A;  4F6A A;  4UWJ A;  5J8F A;  2OB0 A;  2R1I A;  4M85 A;  3TO6 A;  1QSR A;  1VKC A;  2J8M A;  2Q4Y A;  3TTH A;  1I1D A;  2OZU A;  3OWC A;  2ZPA A;  2HV2 A;  1XF8 A;  3D8P A;  5F49 A;  4YRH A;  4MFL A;  3TOA A;  3R96 A;  3CXS A;  4XPL A;  3DNS A;  3FNC A;  1I21 A;  1XEB A;  3W6S A;  4A32 A;  4JXR A;  5HMN A;  1PUA A;  4B5P A;  3SXO A;  2G0B A;  2YGW A;  4XNH B;  4CYO A;  4U9Z A;  1QSM A;  2EUI A;  4L8A A;  4BMH A;  2Q4V A;  1UFH A;  2ZXV A;  3B8G A;  4Q36 A;  4E8O A;  2WUU A;  4R9M A;  4UFX A;  3VWE A;  2B58 A;  5KTD A;  1LRZ A;  4CGM A;  5A27 A;  1XMT A;  2ZW4 A;  2WPX A;  4XPD B;  3GY9 A;  1MJB A;  2JDD A;  4UCP A;  3SXN A;  4AB7 A;  4CAV A;  4HKF A;  3FBU A;  1BO4 A;  2Q04 A;  5G20 A;  4UFV A;  5G21 A;  2Z10 A;  1P4N A;  3IU2 A;  4QC6 A;  1YRE A;  2Z3K A;  3MGD A;  3JTK A;  1N71 A;  3N7Z A;  4K30 A;  1BOB A;  1YGH A;  2Z11 A;  4KUB A;  2P0W A;  3TFY A;  2YNE A;  4MJ8 A;  2X7B A;  5IV0 A;  3FB3 A;  4NCZ A;  1YR0 A;  2FSR A;  3TO9 A;  3DR8 A;  4E0A A;  4C68 A;  4OAE A;  4CRY B;  3ZZI A;  4KLW A;  4MY3 A;  1PU9 A;  2CNS A;  2ZW5 A;  3PGP A;  2VQY A;  3DSB A;  5FVJ A;  5F47 A;  1M4D A;  1RXT A;  2JEV A;  3QAH A;  5C82 A;  2A4N A;  2PR1 A;  2J8N A;  5I0C A;  2G3A A;  2FIW A;  4Q38 A;  1IID A;  2G3T A;  4HNW B;  3FIX A;  3EFA A;  1QSN A;  4OAD A;  1Z9U A;  4KVO E;  4PV6 A;  4A95 A;  2Q0Y A;  3TT2 A;  4CAE A;  3LD2 A;  2Y0M A;  3R9E A;  3JUW A;  1U6M A;  4CAW A;  2FCK A;  3GKR A;  5DWM A;  2Z3N A;  3GYA A;  1MK4 A;  2Z3L A;  2JDC A;  4MBU A;  4MY0 A;  4MFZ A;  2P6F A;  3NE7 A;  1P0H A;  2KCW A;  4KZT A;  2FL4 A;  2GIV A;  3G8W A;  3RYO A;  4KOY A;  2PQ8 A;  3W91 A;  3BJ7 A;  2VZZ A;  2CNT A;  2OH1 A;  4FD4 A;  5E96 A;  4CGO A;  4CAF A;  4CAX A;  3E0K A;  2H5M A;  4KVX A;  4U5Y A;  1Y7R A;  1Y9K A;  1S60 A;  3D2P A;  2ARH A;  1S5K A;  3R9G A;  4EVY A;  3A9L A;  4KVM E;  4CYP A;  4NXY A;  4AVA A;  2Q7B A;  4JJX A;  1WK4 A;  2P6E A;  1CJW A;  5EBV A;  3LOD A;  3H5Z A;  3TCV A;  3C26 A;  4PSW A;  3IWG A;  2C27 A;  1YVK A;  2HQY A;  5F48 A;  1R57 A;  4RI1 A;  1S3Z A;  2O28 A;  3IU1 A;  1K4J A;  4QUS A;  2FE7 A;  1Y9W A;  5AG5 A;  2R8V A;  4CGP A;  4FD6 A;  4KLV A;  1M1D A;  4H6Z A;  1Q2D A;  4L89 A;  3EY5 A;  1VHS A;  4F0X A;  2YND A;  4IF5 A;  4B5O A;  4R3L A;  1XIX A;  4CGN A;  2VEZ A;  4CGL A;  1OZP A;  3SHP A;  1YK3 A;  3D2M A;  2WPW A;  2R7H A;  3UY5 A;  1YX0 A;  1QST A;  4NSQ A;  2AE6 A;  3W6X A;  2HUZ A;  2QML A;  4AG9 A;  2Q44 A;  1SQH A;  3R95 A;  4MFP A;  2BUE A;  4ZGY B;  3JVN A;  3PZJ A;  1CM0 A;  4PK3 A;  4JXQ A;  5DWN A;  4C2X A;  2FS5 A;  1RO5 A;  2GE3 A;  1FY7 A;  1YLE A;  2B5G A;  3P2F A;  2D4P A;  4II9 A;  5CNP A;  3TO7 A;  2FIA A;  4CRZ B;  2QEC A;  1M4G A;  2ZW7 A;  4KSA A;  2J8R A;  4DNC A;  4B13 A;  4KOU A;  2BL1 A;  4QBJ A;  2AJ6 A;  4MFJ A;  3CXQ A;  1GHE A;  4MHD A;  1M44 A;  3K9U A;  4B14 A;  4CYN A;  1YVO A;  4KOV A;  2B3U A;  3IGR A;  1KZF A;  5G22 A;  4FD5 A;  4UWI A;  4JD6 A;  1B87 A;  4KOX A;  1S7K A;  4UFW A;  2B5G B;  1IYK A;  1B6B A;  2CXA A;  3TOB A;  1WWZ A;  4KOW A;  3F0A A;  2Z3P A;  4C7H A;  4M3S A;  4H89 A;  1QSO A;  4LX9 A;  2RC4 A;  5A28 A;  5JQ4 A;  5KTC A;  5EC4 A;  5IB0 A;  1Q2Y A;  2OZH A;  4HNX B;  4CYQ A;  3S6H A;  1M4I A;  2Z3O A;  3TE4 A;  1L0C A;  3T90 A;  4MFK A;  3G3S A;  4A31 A;  4FD7 A;  5G1Z A;  3QB8 A;  4MFQ A;  2VBQ A;  3P2H A;  2I79 A;  1IYL A;  1I12 A;  2BEI A;  4B12 A;  2B3V A;  5KTA A;  3FYN A;  4IUS A;  3ZJ0 A;  2EVN A;  4KOT A;  4Y49 C;  5IX3 A;  5F46 A;  1IB1 E;  4UCN A;  1S7N A;  3FXT A;  5AG7 A;  3S6K A;  3EC4 A;  3FRM A;  3DR6 A;  2CY2 A;  2B4B A;  2F5I A;  3F8K A;  4PK2 A;  3D3S A;  2WSA A;  4H6U A;  4PSX A;  4UCM A;  4C7I A;  2ZW6 A;  4X5K A;  2FXF A;  4KOS A;  2YNC C;  2GAN A;  3I3G A;  1XE4 A;  4J3G A;  1KUX A;  2Z3M A;  4YGO A;  4I49 A;  3PP9 A;  5AGE A;  1NSL A;  2IL4 A;  3V8I A;  4KUA A;  5HH1 A;  4AVC A;  1V0C A;  1MJA A;  2ATR A;  4JWP A;  2CNM A;  2DXQ A;  1KUY A;  2VI7 A;  2JLM A;  4A30 A;  2QIR A;  1S7L A;  2PDO A;  3R1K A;  2FT0 A;  2BSW A;  2PR8 A;  4RS2 A;  4QVT A;  4B5P B;  4UA3 A;  4C2Z A;  4BBH A;  2B4D A;  4HNY B;  2DPT A;  5C88 A;  3CXP A;  4F0Y A;  4QB9 A;  1S7F A;  3KKW A;  3WR7 A;  4LUA A;  1KUV A;  4XNH C;  4NF1 A;  1ZO0 A;  4XPK A;  1Q2C A;  3EO4 A;  5H84 A;  4YFJ A;  5GCN A;  4GS4 A;  2D4O A;  2PRB A;  4ORF A;  2REE A;  4XPD C;  2R98 A;  5JPH A;  4A2Z A;  4E2A A;  3T9Y A;  4ZBG A;  4ONU A;  5AG4 A;  2P6G A;  1MJ9 A;  2K5T A;  4OLL A;  1Z4E A;  4UBR A;  4R57 A;  3EXN A;  2B4D B;  4A33 A;  2PC1 A;  5J8C A;  1J4J A;  4KSF A;  3R9F A;  2YNC A;  1NE9 A;  5ISV A;  2OZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...