1N71A

Crystal structure of aminoglycoside 6'-acetyltransferase type ii in complex with coenzyme a
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
180
structure length
180
Chain Sequence
b'MIISEFDRNNPVLKDQLSDLLRLTWPEEYGDSSAEEVEEMMNPERIAVAAVDQDELVGFIGAIPQYGITGWELHPLVVESSRRKNQIGTRLVNYLEKEVASRGGITIYLGTDDLDHGTTLSQTDLYEHTFDKVASIQNLREHPYEFYEKLGYKIVGVLPNANGWDKPDIWMAKTIIPRPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aac(6')-Ii
publication title X-ray structure of the AAC(6')-Ii antibiotic resistance enzyme at 1.8 A resolution; examination of oligomeric arrangements in GNAT superfamily members
pubmed doi rcsb
source organism Enterococcus faecium
molecule tags Transferase
total genus 50
structure length 180
sequence length 180
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1n71A00
3F0AA 4Y49B 3FNCA 2H5MA 1R57A 4II9A 3CXQA 1LRZA 2Q0YA 5JQ4A 3UY5A 4KZTA 4MJ8A 4FD7A 1I12A 4R3KA 2PC1A 5GCNA 2B4BA 3R9FA 4FD4A 3OWCA 4M3SA 3SHPA 4JD6A 3D8PA 4QB9A 3CXPA 4NXYA 2ZW4A 3WR7A 2HUZA 2I00A 5F46A 4M85A 1KUVA 5IV0A 1NMTA 3IGRA 4L8AA 4R87A 1S7LA 1MK4A 1IICA 4MY3A 5EBVA 3D2MA 3SXNA 1I1DA 4K30A 3R95A 2WPWA 3R9EA 3W6XA 2DXQA 2QIRA 3LODA 4CAWA 5C82A 4KOYA 5C88A 3DR6A 5KTCA 4XNHC 1TIQA 3TCVA 4LUAA 4R3LA 2FE7A 2NMTA 1J4JA 5DWMA 4XNHB 4H6ZA 2PDOA 2G3TA 2FL4A 2P0WA 2O28A 2VXKA 1KUYA 2CNSA 4U9YA 2FIWA 4PK3A 3VWDA 2ATRA 4AG7A 3LD2A 1IB1E 1QSMA 3QAHA 4KOUA 4KLVA 2FSRA 3GKRA 2BL1A 1S5KA 4NSQA 4UA3A 3S6GA 2EUIA 1Y9WA 1M4IA 4L89A 3H4QA 2KCWA 3R1KA 4OAEA 3DSBA 2R98A 3I9SA 4RS2A 4IF5A 4PSWA 4HNYB 2R1IA 1V0CA 3F8KA 1VKCA 3D3SA 4H6UA 2AJ6A 5H84A 3S6HA 2FT0A 3FRMA 4HKFA 2B58A 4KUBA 3EY5A 3C26A 1S7FA 2REEA 3W91A 4OLLA 1N71A 4J3GA 2PR1A 4KUAA 2IL4A 4FD5A 3BJ7A 4U9ZA 2ARHA 2QMLA 4DNCA 4B5OA 2JLMA 4PSXA 3SXOA 3FXTA 1IIDA 5IB0A 3IWGA 1Y9KA 3KKWA 1MJAA 4JJXA 1RXTA 4XPDC 2Z11A 1SQHA 1Q2CA 2JEVA 2VQYA 2OH1A 2AE6A 2Y0MA 4RI1A 3FYNA 2Q7BA 3EXNA 5E96A 4XPDB 2HV2A 2FCKA 4AVCA 3GYAA 5ISVA 2FS5A 4KORA 3DNSA 2R7HA 4AVAA 1B87A 2JDCA 4QBJA 1XMTA 5KTAA 3VWEA 4CAXA 2FXFA 1WWZA 4E2AA 1S60A 3TE4A 4XPLA 1M4GA 2K5TA 2VZZA 3T9YA 5J8FA 4JWPA 5IX3A 4FD6A 4QUSA 1NE9A 2WPXA 5I0CA 5HH1A 1KZFA 4KOTA 3CXSA 1Y7RA 2PSWA 2CY2A 3B8GA 2Z0ZA 4OADA 2QECA 4AB7A 4JXQA 5FVJA 3BLNA 4KOWA 2OZUA 4YRHA 4CRYB 4HNXB 2Z10A 1YVOA 4MI4A 1P4NA 1IYLA 2BUEA 1Z4EA 3N7ZA 1M4DA 1M1DA 3F5BA 2G3AA 1KUXA 2HQYA 2FIAA 2Q44A 5F47A 5CNPA 2Q4YA 4E0AA 4NCZA 2VZYA 1K4JA 4LX9A 2ZPAA 2J8RA 2OZGA 3TT2A 2OZHA 2REFA 4PV6A 1P0HA 3R9GA 3TOAA 1WK4A 4MBUA 2GIVA 5F49A 5JPHA 2D4PA 2ZW7A 5H86A 4AVBA 4H89A 4UWJA 1NSLA 2P6GA 3DDDA 2F5IA 2P6FA 3TO6A 4CS0B 4KOVA 1I21A 1RO5A 1IYKA 4ORFA 4JXRA 4HNWB 4PK2A 4CAVA 4E8OA 2JDDA 5KTDA 1CJWA 2CNTA 4JLYA 3D2PA 3FBUA 5J8CA 2VI7A 2A4NA 1MJ9A 2B3VA 3S6KA 1S7NA 2C27A 4KVXA 2J8MA 1ON0A 3P2HA 2X7BA 2GANA 3JVNA 1XIXA 4KLWA 4QVTA 3MGDA 1QSNA 3K9UA 3PP9A 1S7KA 4I49A 4YGOA 1VHSA 1PUAA 4UWIA 3JUWA 4ONUA 3TO9A 2CNMA 1QSOA 5HMNA 1YVKA 2ZW5A 1Z4RA 3TOBA 3FB3A 2ZW6A 3E0KA 3R96A 4F6AA 4ZBGA 4F0YA 4QC6A 2PQ8A 2G0BA 3RYOA 1XEBA 4U5YA 2OU2A 1MJBA 3DR8A 4KOSA 2Q4VA 2R8VA 2OB0A 4EVYA 1PU9A 4BMHA 4R57A 3PGPA 4X5KA 3TO7A 4B5PB 1YK3A 5F48A 3ZJ0A 1Q2YA 1L0CA 2ZXVA 4CRZB 4UBRA 2VEZA 2Q04A 1Q2DA 4KVOE 1YGHA 3V8IA 1GHEA 1Z9UA 4KOXA 5DWNA 3W6SA 1U6MA 3TFYA 1CM0A 4B5PA 1QSRA 3PZJA 2B5GB 3EC4A 1OZPA 3FIXA 3P2FA 1UFHA 2I79A 2PRBA 1S3ZA 1FY7A 3G3SA 5EC4A 1BO4A 2EVNA 3ZZIA 2RC4A 1XF8A 3EO4A 2B5GA 4YFJA 3NE7A 4NEXA 3T90A 1BOBA 2BSWA 4AG9A 3EFAA 4IUSA 3TTHA 4MY0A 2D4OA 3QB8A 1QSTA 4MHDA 2VBQA 1B6BA 2B3UA 1YLEA 3I3GA 1M44A 2B4DB 4XPKA 3G8WA 4NF1A 2P6EA 2BEIA 4R9MA 4Y49C 1YX0A 2PR8A 3BJ8A 4GS4A 2J8NA 4KVME 2GE3A 3S6FA 1XE4A 1YR0A 2B4DA 1YREA 3GY9A
chains in the Genus database with same CATH superfamily
3F0AA 4Y49B 3WT4A 3FNCA 5HVGA 2YNCC 4R7MA 3RAMA 5LRKA 2H5MA 1R57A 4P44A 4B11A 4II9A 1IOIA 4MCRA 3CXQA 1PYTB 1LRZA 4MFLA 3VARA 5D29A 2Q0YA 1CPXA 3JTKA 5JQ4A 3UY5A 2PVWA 3D68A 4KZTA 4FUUA 3PBBA 2O53A 2CTBA 4MJ8A 4FD7A 4UIAA 1YMEA 4ZY0A 3CDXA 3PFEA 2PJ2A 4ONWA 1I12A 2Q51A 4O23A 2PC1A 4KSIA 4R3KA 5GCNA 2B4BA 3R9FA 1FNOA 3OWCA 4FD4A 4M3SA 2ODFA 3K9TA 4WJBA 2VL1A 4UCPA 4X3RA 3SHPA 1AUGA 1LFWA 4ZX9A 4JD6A 3D8PA 2AFWA 4QB9A 3CXPA 4NXYA 2ZW4A 3WR7A 1ZLHA 2YNCA 3CPXA 2HUZA 4BINA 2I00A 4OC1A 5G21A 3N5FA 5F46A 3ISXA 4M85A 1KUVA 5IV0A 3IU1A 1NMTA 3IGRA 4L8AA 4R87A 1S7LA 2PJ6A 2IMOA 1Y0RA 1MK4A 5F09A 1IICA 4MY3A 3S9LA 1RTQA 1CX8A 4K3NA 1YQEA 2CXAA 3D2MA 5EBVA 3SXNA 4A38A 1I1DA 4OC3A 1BPMA 4K30A 3R95A 2NSMA 2DPTA 4MCPA 4PXCA 2WPWA 1FT7A 5EMIA 3R9EA 3W6XA 2DXQA 1XBUA 2QIRA 2IJZA 4FAIA 2NYQA 3LODA 4CAWA 3BI0A 4KOYA 5C82A 3NH5A 4P45A 3D7DA 2ZEDA 2AFZA 2ZELA 1ELMP 3PEIA 4RN7A 3DR6A 5C88A 1TKFA 5KTCA 3NE8A 4XNHC 2AFOA 5HVHA 1TIQA 2PJ1A 2PJCA 1ZLIA 3PB4X 4DUKA 2XEGA 3TCVA 4LUAA 3KQXA 4R3LA 1HEEA 5K8OA 2Q4ZA 3PFOA 2FE7A 2NMTA 2PE3A 4OP4A 4PXEA 3BI1A 3IFEA 2F7VA 2BO9A 1J4JA 1BPNA 4XNHB 5DWMA 4EWTA 2I3CA 3WC7A 4H6ZA 4AXVA 2PDOA 4CGNA 4MCSA 2G3TA 2FL4A 2P0WA 2O28A 2VXKA 1KUYA 2CNSA 4U9YA 2FIWA 4PK3A 3VWDA 2ATRA 4AG7A 3S9NA 4MFJA 3LD2A 1IB1E 4IAVA 3LWUA 4OMEA 1QSMA 3NA6A 3QAHA 5D8NA 4ZYQA 4ZI6A 4KOUA 4KLVA 4NGSA 2FSRA 3GKRA 2BL1A 1S5KA 4NSQA 4UA3A 3S6GA 4OC0A 5AG6A 1IY7A 2EUIA 1Y9WA 2PJ7A 1M4IA 4L89A 4WWVA 4FWUA 2EBJA 3H4QA 2KCWA 3R1KA 2AFMA 1CBXA 4OAEA 3VATA 3DSBA 2R98A 4ZGYB 3I1UA 1CP6A 4P10A 3I9SA 4RS2A 4IF5A 2JBKA 4GXHA 4HNYB 4PSWA 2OOTA 2R1IA 5ELYA 1V0CA 3KHXA 3F8KA 1VKCA 3D3SA 4H6UA 3KZWA 4A32A 2RB7A 4MHNA 2V77A 4HPSA 2AJ6A 2DF5A 2HB6A 1VGYA 5H84A 3S6HA 3B3VA 3PB9X 4IHMA 4OC5A 1PCAA 2FT0A 3BHXA 4ZY1A 3SI1A 1IU8A 2EK8A 4W9YA 3FRMA 5A28A 2WZNA 3H5ZA 4HKFA 4P4DA 2B58A 4KUBA 3EY5A 4OC2A 4EFDA 2PIYA 1Z2LA 1LOKA 3C26A 3DLJA 1S7FA 4M6HA 2REEA 3D4UA 2YNDA 3W91A 3IJ3A 4OLLA 3WABA 1N71A 5LRJA 1EE3P 2CTCA 4J3GA 4TWEA 2PR1A 4C68A 4KUAA 4PPZA 5LYDA 2IL4A 4C2ZA 4KSFA 3B7IA 3FH4A 4FD5A 4MXUA 1DE4C 3BJ7A 1ZG7A 1DTDA 4U9ZA 4UFXA 2ARHA 2QMLA 4YU9A 4B5OA 1HDUA 4DNCA 2JLMA 4A33A 1CPSA 4PSXA 3GUXA 2QYVA 3CZXA 3KR5A 3SXOA 3FXTA 5AG4A 1IIDA 2YGWA 4MFPA 4BD9A 5IB0A 1GYTA 5HXDA 4PQAA 4MHYA 3SI0A 4KS9A 3IWGA 1Y9KA 3KKWA 4NFRA 4MCQA 2ZENA 1AYEA 3B35A 1MJAA 3IO1A 4JJXA 1RXTA 4XPDC 2Z11A 3IIBA 4R6TA 1SQHA 1Q2CA 4UIBA 3FEDA 3KHZA 2JEVA 2VQYA 4JZ0A 3B2YA 3ISZA 4C2YA 4C2XA 2OH1A 2AE6A 2Y0MA 5JH9A 1Z5RA 4RI1A 3FYNA 2Q7BA 3NH4A 4DJLA 3EXNA 5E96A 3D7HA 3PB7X 4XPDB 2XEFA 2ZEEA 4R76A 5JGFA 2HV2A 5CPAA 7CPAA 4NGMA 2YNEA 2ZEOA 2FCKA 2J9AA 3NH8A 3GYAA 4AVCA 4B6ZA 5ISVA 3HUVA 2FS5A 4TNUA 3DNSA 4KORA 2R7HA 3FEEA 4AVAA 2JDCA 1B87A 4QBJA 1XMTA 5K8PA 5KTAA 1A2ZA 1CP7A 3TC8A 3VWEA 2FXFA 4CAXA 1WWZA 1Z8LA 3D66A 1Q7LA 1S60A 4IK2A 4E2AA 4A94A 2GU2A 3TE4A 4XPLA 5G20A 4Q38A 1M4GA 2K5TA 2VZZA 3VH9A 3T9YA 5J8FA 4JWPA 5IX3A 1XFOA 2Z3MA 4FD6A 4QUSA 1NE9A 2WPXA 3DGVA 1TF8A 2Z3PA 1XOVA 2PJ0A 4UCNA 1VHOA 5I0CA 5HH1A 4G1PA 4A95A 1KZFA 2EK9A 2XEJA 2G9DA 2BOAA 4KOTA 4Q7AA 4MHPA 3V7ZA 3KR4A 4CYNA 3CXSA 3HLPA 1Y7RA 2PSWA 2PVVA 2CY2A 5AG7A 2Z3OA 3JRUA 3B8GA 3D7GA 2Z0ZA 4OADA 3FX6A 2C6CA 2QECA 2PJ3A 4AB7A 1BLLE 4JXQA 5I4MA 1TKJA 4MFKA 4LQGA 5FVJA 3WC5A 4UCMA 3BLNA 1ELLP 1BAVA 2OZUA 2PIZA 3QNVA 4KOWA 4YRHA 1LAPA 2ZEHA 1X10A 2Z3LA 2V8HA 4PXBA 4CRYB 4HNXB 2Z10A 1YVOA 4MI4A 1P4NA 4A30A 4MHZA 1IYLA 4GM5A 2BUEA 1Z4EA 4CAFA 3N7ZA 3RNZA 2AFUA 5AGEA 3T8WA 5K8NA 1M4DA 1M1DA 3F5BA 2G3AA 1KUXA 2HQYA 2FIAA 2XEIA 2Q44A 4B10A 3GB0A 5F47A 5CNPA 2Q4YA 3SJEA 2Q7SA 4E0AA 3B3TA 2QVPA 2PCUA 3WC6A 4UFWA 2RFHA 4NCZA 2VZYA 1K4JA 4LX9A 2ZPAA 4UFVA 1F2OA 2POKA 1ZG9A 2J8RA 4M6IA 4ZX8A 4KSAA 2OZGA 3IWEA 1YLOA 3RO0A 1ARLA 2OZHA 3TT2A 4CGLA 3B3SA 2REFA 2IQ6A 3FF3A 4PV6A 1P0HA 1YW6A 2EWBA 3H8EA 3K2KA 3R9GA 3RBUA 3TOAA 3B3CA 1WK4A 4MBUA 2GIVA 2ZOFA 4NGPA 5F49A 4EMEA 1H8LA 2JEWA 5JPHA 1NSAA 2D4PA 2ZW7A 3GLJA 5H86A 4AVBA 4CYPA 3PB6X 4X8IA 4H89A 4A37A 1R3NA 4UWJA 1NSLA 1TXRA 2P6GA 2PRQA 4A39A 1HDQA 3DDDA 5DS0A 4X2TA 4CAEA 2F5IA 2P6FA 1Z8WA 2GFQA 3TO6A 2PJ8A 4MFZA 4KOVA 4CPAA 4CS0B 4CYOA 1I21A 1JWQA 1IYKA 1RO5A 4ORFA 4JXRA 4HNWB 4H2KA 4PK2A 3LACA 5G1ZA 2JDDA 4CAVA 4E8OA 5K8MA 5JM6A 5KTDA 1CJWA 2CIJA 2CNTA 4UEEA 4JLYA 3D2PA 2ZEMA 3FBUA 5J8CA 4P4IA 2VI7A 5IB9A 2A4NA 3SJFA 1MJ9A 2Q43A 2B3VA 3S6KA 4NJQA 4OKOA 1S7NA 2C27A 3H8GA 4KVXA 4MFQA 1ZG8A 2J8MA 1ON0A 3P2HA 3NFZA 2X7BA 2WSAA 2ZEFA 3SI2A 5BWAB 2GANA 3IC1A 3FMCA 3JVNA 1XIXA 1Y0YA 3QAYA 2V8DA 4F8ZA 2V8GA 4KLWA 2GLJA 4QVTA 3MGDA 1QSNA 2ZEGA 3K9UA 1YW4A 3SJXA 1Y7EA 3CT9A 3L2NA 3PP9A 5LRGA 2WUUA 4F9VA 1S7KA 2O4HA 4I49A 4YGOA 1VHSA 1JQGA 3FECA 2OR4A 1PUAA 1QMUA 3IEHA 3KQZA 1YSJA 4UWIA 3JUWA 3A9LA 4ONUA 3TO9A 2CNMA 1QSOA 5HMNA 1YVKA 4A2ZA 1AMPA 1VHEA 1Z4RA 2ZW5A 3B3WA 4P4FA 3TOBA 2ANPA 3FB3A 2C6PA 1IGBA 2ZW6A 1Z8XA 5A27A 2BCOA 3E0KA 3R96A 4F6AA 4ZBGA 2JBJA 2PJBA 4F0YA 4QC6A 2PQ8A 4MMOA 2G0BA 2DEAA 5G22A 3RYOA 1XEBA 3KL9A 4U5YA 2PJ5A 2OU2A 5THWA 5LYFA 1MJBA 3DR8A 4KOSA 1TF9A 2Q4VA 2ZOGA 4OC4A 4B13A 2R8VA 2OB0A 3BXMA 4EVYA 5LYLA 1PU9A 4BMHA 4R57A 3PGPA 4X5KA 1CG2A 4NGQA 3KI9A 3TO7A 4B5PB 1YK3A 5F48A 4P4EA 3ZJ0A 1Q2YA 1L0CA 2ZXVA 1ZO0A 1F57A 4CRZB 4UBRA 3MN8A 2VEZA 1IOFA 2Q04A 1Q2DA 4KVOE 1R43A 1XRYA 1YGHA 4ZY2A 2Z3KA 3IU2A 3V8IA 4M6GA 1GHEA 1Z9UA 1QQ9A 2PJ4A 3H8FA 4KOXA 1U6MA 4MRIA 4UEFA 4UF4A 5DWNA 3W6SA 4B12A 6CPAA 3TFYA 1CM0A 1LAMA 2PJAA 2V8VA 1QSRA 1Z8TA 4B5PA 4P4BA 4NJRA 4UEZA 5J1QA 3PZJA 2B5GB 4B14A 1M4LA 4NGNA 3EC4A 2GLFA 1OZPA 4CGMA 3FIXA 4NGRA 4DYOA 4C7HA 3P2FA 1UFHA 2HC9A 2CF4A 2I79A 4BBHA 2PRBA 1S3ZA 3FVLA 1UWYA 4P4JA 4YWYA 1FY7A 4A31A 3G3SA 2ZEPA 4JYWA 5EC4A 8CPAA 1BO4A 2ABZA 3S9MA 2EVNA 3ZZIA 4C7IA 2RC4A 1XF8A 3EO4A 2B5GA 4YFJA 3NE7A 4F0XA 4NEXA 4NGTA 3T90A 1ARMA 2Z3NA 1BOBA 2PJ9A 3PB8X 2C6GA 2QJ8A 2BSWA 4Z65A 4AG9A 4P6YA 3EFAA 3D7FA 4LQ6A 4CGOA 5CBMA 4IUSA 4CYQA 2AFXA 2FVGA 5HVFA 1LCPA 3TTHA 4MY0A 4OIDA 2D4OA 3QB8A 3LMSA 1KWMA 3MRUA 1QSTA 3RZAA 3PBEA 3CPAA 2F8HA 4MHDA 3PRTA 2VBQA 4Q36A 1B6BA 2B3UA 1YLEA 3I3GA 3V38A 4F9UA 1OBRA 3D67A 1M44A 3FJUA 2B4DB 2WYRA 3G8WA 4XPKA 3TX8A 4NF1A 2P6EA 2C1CA 3KGQA 2BEIA 2AFSA 4PXDA 4R9MA 4CGPA 3GIUA 4Y49C 1X12A 1XMBA 4OIWA 4FBEA 1YX0A 5LYIA 2DPSA 2PR8A 4RUHA 3BJ8A 1XJOA 2J8NA 4GS4A 4KVME 2GREA 1F2PA 2EO8A 2GE3A 3S6FA 3IWWA 4R8FA 3SJGA 1LANA 1TKHA 3KASA 5AG5A 1XE4A 1YR0A 2B4DA 1VIXA 1YREA 3GY9A
chains in the Genus database with same CATH topology
3F0AA 4Y49B 3FNCA 2YNCC 2H5MA 1R57A 4B11A 4II9A 3CXQA 1LRZA 4MFLA 2Q0YA 3JTKA 5JQ4A 3UY5A 4KZTA 4MJ8A 4FD7A 1I12A 4R3KA 2PC1A 5GCNA 2B4BA 3R9FA 4FD4A 3OWCA 4M3SA 3SHPA 4UCPA 4JD6A 3D8PA 4QB9A 3CXPA 4NXYA 2ZW4A 3WR7A 2YNCA 2HUZA 2I00A 5G21A 5F46A 4M85A 1KUVA 5IV0A 3IU1A 1NMTA 3IGRA 4L8AA 4R87A 1S7LA 1MK4A 1IICA 4MY3A 5EBVA 2CXAA 3D2MA 3SXNA 1I1DA 4K30A 3R95A 2DPTA 2WPWA 3R9EA 3W6XA 2DXQA 2QIRA 3LODA 4CAWA 5C82A 4KOYA 5C88A 3DR6A 5KTCA 4XNHC 1TIQA 3TCVA 4LUAA 4R3LA 2FE7A 2NMTA 1J4JA 5DWMA 4XNHB 4H6ZA 2PDOA 4CGNA 2G3TA 2FL4A 2P0WA 2O28A 2VXKA 1KUYA 2CNSA 4U9YA 2FIWA 4PK3A 3VWDA 2ATRA 4AG7A 4MFJA 3LD2A 1IB1E 1QSMA 3QAHA 4KOUA 4KLVA 2FSRA 3GKRA 2BL1A 1S5KA 4NSQA 4UA3A 3S6GA 5AG6A 2EUIA 1Y9WA 1M4IA 4L89A 3H4QA 2KCWA 3R1KA 4OAEA 3DSBA 2R98A 4ZGYB 3I9SA 4RS2A 4IF5A 4PSWA 4HNYB 2R1IA 1V0CA 3F8KA 1VKCA 3D3SA 4H6UA 4A32A 2AJ6A 5H84A 3S6HA 2FT0A 5A28A 3FRMA 3H5ZA 4HKFA 2B58A 4KUBA 3EY5A 3C26A 1S7FA 2REEA 3W91A 2YNDA 4OLLA 1N71A 4J3GA 2PR1A 4C68A 4KUAA 2IL4A 4C2ZA 4KSFA 4FD5A 3BJ7A 4U9ZA 4UFXA 2ARHA 2QMLA 4DNCA 4B5OA 2JLMA 4A33A 4PSXA 3SXOA 3FXTA 5AG4A 1IIDA 2YGWA 4MFPA 5IB0A 4KS9A 3IWGA 1Y9KA 3KKWA 1MJAA 4JJXA 1RXTA 4XPDC 2Z11A 1SQHA 1Q2CA 2JEVA 2VQYA 4C2YA 4C2XA 2OH1A 2AE6A 2Y0MA 4RI1A 3FYNA 2Q7BA 3EXNA 5E96A 4XPDB 2HV2A 2YNEA 2FCKA 4AVCA 3GYAA 5ISVA 2FS5A 3DNSA 4KORA 2R7HA 4AVAA 1B87A 2JDCA 4QBJA 1XMTA 5KTAA 3VWEA 4CAXA 2FXFA 1WWZA 4E2AA 1S60A 3TE4A 4XPLA 5G20A 4Q38A 1M4GA 2K5TA 2VZZA 3T9YA 5J8FA 4JWPA 5IX3A 2Z3MA 4FD6A 4QUSA 1NE9A 2WPXA 2Z3PA 5I0CA 4UCNA 5HH1A 4A95A 1KZFA 4KOTA 4CYNA 3CXSA 5AG7A 1Y7RA 2PSWA 2CY2A 2Z3OA 3B8GA 2Z0ZA 4OADA 2QECA 4AB7A 4JXQA 4MFKA 5FVJA 4UCMA 3BLNA 4KOWA 2OZUA 4YRHA 2Z3LA 4CRYB 4HNXB 2Z10A 1YVOA 4MI4A 1P4NA 4A30A 1IYLA 2BUEA 1Z4EA 4CAFA 3N7ZA 5AGEA 1M4DA 1M1DA 3F5BA 2G3AA 1KUXA 2HQYA 2FIAA 4B10A 2Q44A 5F47A 5CNPA 2Q4YA 4E0AA 4UFWA 4NCZA 2VZYA 1K4JA 4LX9A 2ZPAA 4UFVA 2J8RA 4KSAA 2OZGA 3IWEA 3TT2A 4CGLA 2OZHA 2REFA 4PV6A 1P0HA 3R9GA 3TOAA 1WK4A 4MBUA 2GIVA 5F49A 5JPHA 2D4PA 2ZW7A 5H86A 4AVBA 4CYPA 4H89A 4UWJA 1NSLA 2P6GA 3DDDA 4CAEA 2F5IA 2P6FA 3TO6A 4MFZA 4CS0B 4KOVA 4CYOA 1I21A 1RO5A 1IYKA 4ORFA 4JXRA 4HNWB 4PK2A 4CAVA 5G1ZA 2JDDA 4E8OA 5KTDA 1CJWA 2CNTA 4JLYA 3D2PA 3FBUA 5J8CA 2VI7A 2A4NA 1MJ9A 2B3VA 3S6KA 1S7NA 2C27A 4KVXA 4MFQA 2J8MA 1ON0A 3P2HA 2X7BA 2WSAA 5BWAB 2GANA 3JVNA 1XIXA 4KLWA 4QVTA 3MGDA 1QSNA 3K9UA 3PP9A 2WUUA 1S7KA 4I49A 4YGOA 1VHSA 1PUAA 4UWIA 3JUWA 3A9LA 4ONUA 3TO9A 2CNMA 1QSOA 5HMNA 1YVKA 4A2ZA 2ZW5A 1Z4RA 3TOBA 3FB3A 2ZW6A 5A27A 3E0KA 3R96A 4F6AA 4ZBGA 4F0YA 4QC6A 2PQ8A 2G0BA 5G22A 3RYOA 1XEBA 4U5YA 2OU2A 1MJBA 3DR8A 4KOSA 2Q4VA 4B13A 2R8VA 2OB0A 4EVYA 1PU9A 4BMHA 4R57A 3PGPA 4X5KA 3TO7A 4B5PB 1YK3A 5F48A 3ZJ0A 1Q2YA 1L0CA 2ZXVA 1ZO0A 4CRZB 4UBRA 2VEZA 2Q04A 1Q2DA 4KVOE 1YGHA 2Z3KA 3IU2A 3V8IA 1GHEA 1Z9UA 4KOXA 5DWNA 3W6SA 1U6MA 3TFYA 4B12A 1CM0A 4B5PA 1QSRA 3PZJA 2B5GB 4B14A 3EC4A 1OZPA 4CGMA 3FIXA 4C7HA 3P2FA 1UFHA 4BBHA 2I79A 2PRBA 1S3ZA 4A31A 1FY7A 3G3SA 5EC4A 1BO4A 2EVNA 3ZZIA 4C7IA 2RC4A 1XF8A 3EO4A 2B5GA 4YFJA 3NE7A 4F0XA 4NEXA 3T90A 2Z3NA 1BOBA 2BSWA 4AG9A 4CGOA 3EFAA 4IUSA 4CYQA 3TTHA 4MY0A 2D4OA 3QB8A 1QSTA 4MHDA 2VBQA 4Q36A 1B6BA 2B3UA 1YLEA 3I3GA 1M44A 2B4DB 4XPKA 3G8WA 4NF1A 2P6EA 2BEIA 4R9MA 4CGPA 4Y49C 1YX0A 2DPSA 2PR8A 3BJ8A 4GS4A 2J8NA 4KVME 2GE3A 3S6FA 5AG5A 1XE4A 1YR0A 2B4DA 1YREA 3GY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F0A A;  4Y49 B;  3FNC A;  2H5M A;  1R57 A;  4II9 A;  3CXQ A;  1LRZ A;  2Q0Y A;  5JQ4 A;  3UY5 A;  4KZT A;  4MJ8 A;  4FD7 A;  1I12 A;  4R3K A;  2PC1 A;  5GCN A;  2B4B A;  3R9F A;  4FD4 A;  3OWC A;  4M3S A;  3SHP A;  4JD6 A;  3D8P A;  4QB9 A;  3CXP A;  4NXY A;  2ZW4 A;  3WR7 A;  2HUZ A;  2I00 A;  5F46 A;  4M85 A;  1KUV A;  5IV0 A;  1NMT A;  3IGR A;  4L8A A;  4R87 A;  1S7L A;  1MK4 A;  1IIC A;  4MY3 A;  5EBV A;  3D2M A;  3SXN A;  1I1D A;  4K30 A;  3R95 A;  2WPW A;  3R9E A;  3W6X A;  2DXQ A;  2QIR A;  3LOD A;  4CAW A;  5C82 A;  4KOY A;  5C88 A;  3DR6 A;  5KTC A;  4XNH C;  1TIQ A;  3TCV A;  4LUA A;  4R3L A;  2FE7 A;  2NMT A;  1J4J A;  5DWM A;  4XNH B;  4H6Z A;  2PDO A;  2G3T A;  2FL4 A;  2P0W A;  2O28 A;  2VXK A;  1KUY A;  2CNS A;  4U9Y A;  2FIW A;  4PK3 A;  3VWD A;  2ATR A;  4AG7 A;  3LD2 A;  1IB1 E;  1QSM A;  3QAH A;  4KOU A;  4KLV A;  2FSR A;  3GKR A;  2BL1 A;  1S5K A;  4NSQ A;  4UA3 A;  3S6G A;  2EUI A;  1Y9W A;  1M4I A;  4L89 A;  3H4Q A;  2KCW A;  3R1K A;  4OAE A;  3DSB A;  2R98 A;  3I9S A;  4RS2 A;  4IF5 A;  4PSW A;  4HNY B;  2R1I A;  1V0C A;  3F8K A;  1VKC A;  3D3S A;  4H6U A;  2AJ6 A;  5H84 A;  3S6H A;  2FT0 A;  3FRM A;  4HKF A;  2B58 A;  4KUB A;  3EY5 A;  3C26 A;  1S7F A;  2REE A;  3W91 A;  4OLL A;  1N71 A;  4J3G A;  2PR1 A;  4KUA A;  2IL4 A;  4FD5 A;  3BJ7 A;  4U9Z A;  2ARH A;  2QML A;  4DNC A;  4B5O A;  2JLM A;  4PSX A;  3SXO A;  3FXT A;  1IID A;  5IB0 A;  3IWG A;  1Y9K A;  3KKW A;  1MJA A;  4JJX A;  1RXT A;  4XPD C;  2Z11 A;  1SQH A;  1Q2C A;  2JEV A;  2VQY A;  2OH1 A;  2AE6 A;  2Y0M A;  4RI1 A;  3FYN A;  2Q7B A;  3EXN A;  5E96 A;  4XPD B;  2HV2 A;  2FCK A;  4AVC A;  3GYA A;  5ISV A;  2FS5 A;  4KOR A;  3DNS A;  2R7H A;  4AVA A;  1B87 A;  2JDC A;  4QBJ A;  1XMT A;  5KTA A;  3VWE A;  4CAX A;  2FXF A;  1WWZ A;  4E2A A;  1S60 A;  3TE4 A;  4XPL A;  1M4G A;  2K5T A;  2VZZ A;  3T9Y A;  5J8F A;  4JWP A;  5IX3 A;  4FD6 A;  4QUS A;  1NE9 A;  2WPX A;  5I0C A;  5HH1 A;  1KZF A;  4KOT A;  3CXS A;  1Y7R A;  2PSW A;  2CY2 A;  3B8G A;  2Z0Z A;  4OAD A;  2QEC A;  4AB7 A;  4JXQ A;  5FVJ A;  3BLN A;  4KOW A;  2OZU A;  4YRH A;  4CRY B;  4HNX B;  2Z10 A;  1YVO A;  4MI4 A;  1P4N A;  1IYL A;  2BUE A;  1Z4E A;  3N7Z A;  1M4D A;  1M1D A;  3F5B A;  2G3A A;  1KUX A;  2HQY A;  2FIA A;  2Q44 A;  5F47 A;  5CNP A;  2Q4Y A;  4E0A A;  4NCZ A;  2VZY A;  1K4J A;  4LX9 A;  2ZPA A;  2J8R A;  2OZG A;  3TT2 A;  2OZH A;  2REF A;  4PV6 A;  1P0H A;  3R9G A;  3TOA A;  1WK4 A;  4MBU A;  2GIV A;  5F49 A;  5JPH A;  2D4P A;  2ZW7 A;  5H86 A;  4AVB A;  4H89 A;  4UWJ A;  1NSL A;  2P6G A;  3DDD A;  2F5I A;  2P6F A;  3TO6 A;  4CS0 B;  4KOV A;  1I21 A;  1RO5 A;  1IYK A;  4ORF A;  4JXR A;  4HNW B;  4PK2 A;  4CAV A;  4E8O A;  2JDD A;  5KTD A;  1CJW A;  2CNT A;  4JLY A;  3D2P A;  3FBU A;  5J8C A;  2VI7 A;  2A4N A;  1MJ9 A;  2B3V A;  3S6K A;  1S7N A;  2C27 A;  4KVX A;  2J8M A;  1ON0 A;  3P2H A;  2X7B A;  2GAN A;  3JVN A;  1XIX A;  4KLW A;  4QVT A;  3MGD A;  1QSN A;  3K9U A;  3PP9 A;  1S7K A;  4I49 A;  4YGO A;  1VHS A;  1PUA A;  4UWI A;  3JUW A;  4ONU A;  3TO9 A;  2CNM A;  1QSO A;  5HMN A;  1YVK A;  2ZW5 A;  1Z4R A;  3TOB A;  3FB3 A;  2ZW6 A;  3E0K A;  3R96 A;  4F6A A;  4ZBG A;  4F0Y A;  4QC6 A;  2PQ8 A;  2G0B A;  3RYO A;  1XEB A;  4U5Y A;  2OU2 A;  1MJB A;  3DR8 A;  4KOS A;  2Q4V A;  2R8V A;  2OB0 A;  4EVY A;  1PU9 A;  4BMH A;  4R57 A;  3PGP A;  4X5K A;  3TO7 A;  4B5P B;  1YK3 A;  5F48 A;  3ZJ0 A;  1Q2Y A;  1L0C A;  2ZXV A;  4CRZ B;  4UBR A;  2VEZ A;  2Q04 A;  1Q2D A;  4KVO E;  1YGH A;  3V8I A;  1GHE A;  1Z9U A;  4KOX A;  5DWN A;  3W6S A;  1U6M A;  3TFY A;  1CM0 A;  4B5P A;  1QSR A;  3PZJ A;  2B5G B;  3EC4 A;  1OZP A;  3FIX A;  3P2F A;  1UFH A;  2I79 A;  2PRB A;  1S3Z A;  1FY7 A;  3G3S A;  5EC4 A;  1BO4 A;  2EVN A;  3ZZI A;  2RC4 A;  1XF8 A;  3EO4 A;  2B5G A;  4YFJ A;  3NE7 A;  4NEX A;  3T90 A;  1BOB A;  2BSW A;  4AG9 A;  3EFA A;  4IUS A;  3TTH A;  4MY0 A;  2D4O A;  3QB8 A;  1QST A;  4MHD A;  2VBQ A;  1B6B A;  2B3U A;  1YLE A;  3I3G A;  1M44 A;  2B4D B;  4XPK A;  3G8W A;  4NF1 A;  2P6E A;  2BEI A;  4R9M A;  4Y49 C;  1YX0 A;  2PR8 A;  3BJ8 A;  4GS4 A;  2J8N A;  4KVM E;  2GE3 A;  3S6F A;  1XE4 A;  1YR0 A;  2B4D A;  1YRE A;  3GY9 A; 
#chains in the Genus database with same CATH topology
 3F0A A;  4Y49 B;  3WT4 A;  3FNC A;  5HVG A;  2YNC C;  4R7M A;  3RAM A;  5LRK A;  2H5M A;  1R57 A;  4P44 A;  4B11 A;  4II9 A;  1IOI A;  4MCR A;  3CXQ A;  1PYT B;  1LRZ A;  4MFL A;  3VAR A;  5D29 A;  2Q0Y A;  1CPX A;  3JTK A;  5JQ4 A;  3UY5 A;  2PVW A;  3D68 A;  4KZT A;  4FUU A;  3PBB A;  2O53 A;  2CTB A;  4MJ8 A;  4FD7 A;  4UIA A;  1YME A;  4ZY0 A;  3CDX A;  3PFE A;  2PJ2 A;  4ONW A;  1I12 A;  2Q51 A;  4O23 A;  2PC1 A;  4KSI A;  4R3K A;  5GCN A;  2B4B A;  3R9F A;  1FNO A;  3OWC A;  4FD4 A;  4M3S A;  2ODF A;  3K9T A;  4WJB A;  2VL1 A;  4UCP A;  4X3R A;  3SHP A;  1AUG A;  1LFW A;  4ZX9 A;  4JD6 A;  3D8P A;  2AFW A;  4QB9 A;  3CXP A;  4NXY A;  2ZW4 A;  3WR7 A;  1ZLH A;  2YNC A;  3CPX A;  2HUZ A;  4BIN A;  2I00 A;  4OC1 A;  5G21 A;  3N5F A;  5F46 A;  3ISX A;  4M85 A;  1KUV A;  5IV0 A;  3IU1 A;  1NMT A;  3IGR A;  4L8A A;  4R87 A;  1S7L A;  2PJ6 A;  2IMO A;  1Y0R A;  1MK4 A;  5F09 A;  1IIC A;  4MY3 A;  3S9L A;  1RTQ A;  1CX8 A;  4K3N A;  1YQE A;  2CXA A;  3D2M A;  5EBV A;  3SXN A;  4A38 A;  1I1D A;  4OC3 A;  1BPM A;  4K30 A;  3R95 A;  2NSM A;  2DPT A;  4MCP A;  4PXC A;  2WPW A;  1FT7 A;  5EMI A;  3R9E A;  3W6X A;  2DXQ A;  1XBU A;  2QIR A;  2IJZ A;  4FAI A;  2NYQ A;  3LOD A;  4CAW A;  3BI0 A;  4KOY A;  5C82 A;  3NH5 A;  4P45 A;  3D7D A;  2ZED A;  2AFZ A;  2ZEL A;  1ELM P;  3PEI A;  4RN7 A;  3DR6 A;  5C88 A;  1TKF A;  5KTC A;  3NE8 A;  4XNH C;  2AFO A;  5HVH A;  1TIQ A;  2PJ1 A;  2PJC A;  1ZLI A;  3PB4 X;  4DUK A;  2XEG A;  3TCV A;  4LUA A;  3KQX A;  4R3L A;  1HEE A;  5K8O A;  2Q4Z A;  3PFO A;  2FE7 A;  2NMT A;  2PE3 A;  4OP4 A;  4PXE A;  3BI1 A;  3IFE A;  2F7V A;  2BO9 A;  1J4J A;  1BPN A;  4XNH B;  5DWM A;  4EWT A;  2I3C A;  3WC7 A;  4H6Z A;  4AXV A;  2PDO A;  4CGN A;  4MCS A;  2G3T A;  2FL4 A;  2P0W A;  2O28 A;  2VXK A;  1KUY A;  2CNS A;  4U9Y A;  2FIW A;  4PK3 A;  3VWD A;  2ATR A;  4AG7 A;  3S9N A;  4MFJ A;  3LD2 A;  1IB1 E;  4IAV A;  3LWU A;  4OME A;  1QSM A;  3NA6 A;  3QAH A;  5D8N A;  4ZYQ A;  4ZI6 A;  4KOU A;  4KLV A;  4NGS A;  2FSR A;  3GKR A;  2BL1 A;  1S5K A;  4NSQ A;  4UA3 A;  3S6G A;  4OC0 A;  5AG6 A;  1IY7 A;  2EUI A;  1Y9W A;  2PJ7 A;  1M4I A;  4L89 A;  4WWV A;  4FWU A;  2EBJ A;  3H4Q A;  2KCW A;  3R1K A;  2AFM A;  1CBX A;  4OAE A;  3VAT A;  3DSB A;  2R98 A;  4ZGY B;  3I1U A;  1CP6 A;  4P10 A;  3I9S A;  4RS2 A;  4IF5 A;  2JBK A;  4GXH A;  4HNY B;  4PSW A;  2OOT A;  2R1I A;  5ELY A;  1V0C A;  3KHX A;  3F8K A;  1VKC A;  3D3S A;  4H6U A;  3KZW A;  4A32 A;  2RB7 A;  4MHN A;  2V77 A;  4HPS A;  2AJ6 A;  2DF5 A;  2HB6 A;  1VGY A;  5H84 A;  3S6H A;  3B3V A;  3PB9 X;  4IHM A;  4OC5 A;  1PCA A;  2FT0 A;  3BHX A;  4ZY1 A;  3SI1 A;  1IU8 A;  2EK8 A;  4W9Y A;  3FRM A;  5A28 A;  2WZN A;  3H5Z A;  4HKF A;  4P4D A;  2B58 A;  4KUB A;  3EY5 A;  4OC2 A;  4EFD A;  2PIY A;  1Z2L A;  1LOK A;  3C26 A;  3DLJ A;  1S7F A;  4M6H A;  2REE A;  3D4U A;  2YND A;  3W91 A;  3IJ3 A;  4OLL A;  3WAB A;  1N71 A;  5LRJ A;  1EE3 P;  2CTC A;  4J3G A;  4TWE A;  2PR1 A;  4C68 A;  4KUA A;  4PPZ A;  5LYD A;  2IL4 A;  4C2Z A;  4KSF A;  3B7I A;  3FH4 A;  4FD5 A;  4MXU A;  1DE4 C;  3BJ7 A;  1ZG7 A;  1DTD A;  4U9Z A;  4UFX A;  2ARH A;  2QML A;  4YU9 A;  4B5O A;  1HDU A;  4DNC A;  2JLM A;  4A33 A;  1CPS A;  4PSX A;  3GUX A;  2QYV A;  3CZX A;  3KR5 A;  3SXO A;  3FXT A;  5AG4 A;  1IID A;  2YGW A;  4MFP A;  4BD9 A;  5IB0 A;  1GYT A;  5HXD A;  4PQA A;  4MHY A;  3SI0 A;  4KS9 A;  3IWG A;  1Y9K A;  3KKW A;  4NFR A;  4MCQ A;  2ZEN A;  1AYE A;  3B35 A;  1MJA A;  3IO1 A;  4JJX A;  1RXT A;  4XPD C;  2Z11 A;  3IIB A;  4R6T A;  1SQH A;  1Q2C A;  4UIB A;  3FED A;  3KHZ A;  2JEV A;  2VQY A;  4JZ0 A;  3B2Y A;  3ISZ A;  4C2Y A;  4C2X A;  2OH1 A;  2AE6 A;  2Y0M A;  5JH9 A;  1Z5R A;  4RI1 A;  3FYN A;  2Q7B A;  3NH4 A;  4DJL A;  3EXN A;  5E96 A;  3D7H A;  3PB7 X;  4XPD B;  2XEF A;  2ZEE A;  4R76 A;  5JGF A;  2HV2 A;  5CPA A;  7CPA A;  4NGM A;  2YNE A;  2ZEO A;  2FCK A;  2J9A A;  3NH8 A;  3GYA A;  4AVC A;  4B6Z A;  5ISV A;  3HUV A;  2FS5 A;  4TNU A;  3DNS A;  4KOR A;  2R7H A;  3FEE A;  4AVA A;  2JDC A;  1B87 A;  4QBJ A;  1XMT A;  5K8P A;  5KTA A;  1A2Z A;  1CP7 A;  3TC8 A;  3VWE A;  2FXF A;  4CAX A;  1WWZ A;  1Z8L A;  3D66 A;  1Q7L A;  1S60 A;  4IK2 A;  4E2A A;  4A94 A;  2GU2 A;  3TE4 A;  4XPL A;  5G20 A;  4Q38 A;  1M4G A;  2K5T A;  2VZZ A;  3VH9 A;  3T9Y A;  5J8F A;  4JWP A;  5IX3 A;  1XFO A;  2Z3M A;  4FD6 A;  4QUS A;  1NE9 A;  2WPX A;  3DGV A;  1TF8 A;  2Z3P A;  1XOV A;  2PJ0 A;  4UCN A;  1VHO A;  5I0C A;  5HH1 A;  4G1P A;  4A95 A;  1KZF A;  2EK9 A;  2XEJ A;  2G9D A;  2BOA A;  4KOT A;  4Q7A A;  4MHP A;  3V7Z A;  3KR4 A;  4CYN A;  3CXS A;  3HLP A;  1Y7R A;  2PSW A;  2PVV A;  2CY2 A;  5AG7 A;  2Z3O A;  3JRU A;  3B8G A;  3D7G A;  2Z0Z A;  4OAD A;  3FX6 A;  2C6C A;  2QEC A;  2PJ3 A;  4AB7 A;  1BLL E;  4JXQ A;  5I4M A;  1TKJ A;  4MFK A;  4LQG A;  5FVJ A;  3WC5 A;  4UCM A;  3BLN A;  1ELL P;  1BAV A;  2OZU A;  2PIZ A;  3QNV A;  4KOW A;  4YRH A;  1LAP A;  2ZEH A;  1X10 A;  2Z3L A;  2V8H A;  4PXB A;  4CRY B;  4HNX B;  2Z10 A;  1YVO A;  4MI4 A;  1P4N A;  4A30 A;  4MHZ A;  1IYL A;  4GM5 A;  2BUE A;  1Z4E A;  4CAF A;  3N7Z A;  3RNZ A;  2AFU A;  5AGE A;  3T8W A;  5K8N A;  1M4D A;  1M1D A;  3F5B A;  2G3A A;  1KUX A;  2HQY A;  2FIA A;  2XEI A;  2Q44 A;  4B10 A;  3GB0 A;  5F47 A;  5CNP A;  2Q4Y A;  3SJE A;  2Q7S A;  4E0A A;  3B3T A;  2QVP A;  2PCU A;  3WC6 A;  4UFW A;  2RFH A;  4NCZ A;  2VZY A;  1K4J A;  4LX9 A;  2ZPA A;  4UFV A;  1F2O A;  2POK A;  1ZG9 A;  2J8R A;  4M6I A;  4ZX8 A;  4KSA A;  2OZG A;  3IWE A;  1YLO A;  3RO0 A;  1ARL A;  2OZH A;  3TT2 A;  4CGL A;  3B3S A;  2REF A;  2IQ6 A;  3FF3 A;  4PV6 A;  1P0H A;  1YW6 A;  2EWB A;  3H8E A;  3K2K A;  3R9G A;  3RBU A;  3TOA A;  3B3C A;  1WK4 A;  4MBU A;  2GIV A;  2ZOF A;  4NGP A;  5F49 A;  4EME A;  1H8L A;  2JEW A;  5JPH A;  1NSA A;  2D4P A;  2ZW7 A;  3GLJ A;  5H86 A;  4AVB A;  4CYP A;  3PB6 X;  4X8I A;  4H89 A;  4A37 A;  1R3N A;  4UWJ A;  1NSL A;  1TXR A;  2P6G A;  2PRQ A;  4A39 A;  1HDQ A;  3DDD A;  5DS0 A;  4X2T A;  4CAE A;  2F5I A;  2P6F A;  1Z8W A;  2GFQ A;  3TO6 A;  2PJ8 A;  4MFZ A;  4KOV A;  4CPA A;  4CS0 B;  4CYO A;  1I21 A;  1JWQ A;  1IYK A;  1RO5 A;  4ORF A;  4JXR A;  4HNW B;  4H2K A;  4PK2 A;  3LAC A;  5G1Z A;  2JDD A;  4CAV A;  4E8O A;  5K8M A;  5JM6 A;  5KTD A;  1CJW A;  2CIJ A;  2CNT A;  4UEE A;  4JLY A;  3D2P A;  2ZEM A;  3FBU A;  5J8C A;  4P4I A;  2VI7 A;  5IB9 A;  2A4N A;  3SJF A;  1MJ9 A;  2Q43 A;  2B3V A;  3S6K A;  4NJQ A;  4OKO A;  1S7N A;  2C27 A;  3H8G A;  4KVX A;  4MFQ A;  1ZG8 A;  2J8M A;  1ON0 A;  3P2H A;  3NFZ A;  2X7B A;  2WSA A;  2ZEF A;  3SI2 A;  5BWA B;  2GAN A;  3IC1 A;  3FMC A;  3JVN A;  1XIX A;  1Y0Y A;  3QAY A;  2V8D A;  4F8Z A;  2V8G A;  4KLW A;  2GLJ A;  4QVT A;  3MGD A;  1QSN A;  2ZEG A;  3K9U A;  1YW4 A;  3SJX A;  1Y7E A;  3CT9 A;  3L2N A;  3PP9 A;  5LRG A;  2WUU A;  4F9V A;  1S7K A;  2O4H A;  4I49 A;  4YGO A;  1VHS A;  1JQG A;  3FEC A;  2OR4 A;  1PUA A;  1QMU A;  3IEH A;  3KQZ A;  1YSJ A;  4UWI A;  3JUW A;  3A9L A;  4ONU A;  3TO9 A;  2CNM A;  1QSO A;  5HMN A;  1YVK A;  4A2Z A;  1AMP A;  1VHE A;  1Z4R A;  2ZW5 A;  3B3W A;  4P4F A;  3TOB A;  2ANP A;  3FB3 A;  2C6P A;  1IGB A;  2ZW6 A;  1Z8X A;  5A27 A;  2BCO A;  3E0K A;  3R96 A;  4F6A A;  4ZBG A;  2JBJ A;  2PJB A;  4F0Y A;  4QC6 A;  2PQ8 A;  4MMO A;  2G0B A;  2DEA A;  5G22 A;  3RYO A;  1XEB A;  3KL9 A;  4U5Y A;  2PJ5 A;  2OU2 A;  5THW A;  5LYF A;  1MJB A;  3DR8 A;  4KOS A;  1TF9 A;  2Q4V A;  2ZOG A;  4OC4 A;  4B13 A;  2R8V A;  2OB0 A;  3BXM A;  4EVY A;  5LYL A;  1PU9 A;  4BMH A;  4R57 A;  3PGP A;  4X5K A;  1CG2 A;  4NGQ A;  3KI9 A;  3TO7 A;  4B5P B;  1YK3 A;  5F48 A;  4P4E A;  3ZJ0 A;  1Q2Y A;  1L0C A;  2ZXV A;  1ZO0 A;  1F57 A;  4CRZ B;  4UBR A;  3MN8 A;  2VEZ A;  1IOF A;  2Q04 A;  1Q2D A;  4KVO E;  1R43 A;  1XRY A;  1YGH A;  4ZY2 A;  2Z3K A;  3IU2 A;  3V8I A;  4M6G A;  1GHE A;  1Z9U A;  1QQ9 A;  2PJ4 A;  3H8F A;  4KOX A;  1U6M A;  4MRI A;  4UEF A;  4UF4 A;  5DWN A;  3W6S A;  4B12 A;  6CPA A;  3TFY A;  1CM0 A;  1LAM A;  2PJA A;  2V8V A;  1QSR A;  1Z8T A;  4B5P A;  4P4B A;  4NJR A;  4UEZ A;  5J1Q A;  3PZJ A;  2B5G B;  4B14 A;  1M4L A;  4NGN A;  3EC4 A;  2GLF A;  1OZP A;  4CGM A;  3FIX A;  4NGR A;  4DYO A;  4C7H A;  3P2F A;  1UFH A;  2HC9 A;  2CF4 A;  2I79 A;  4BBH A;  2PRB A;  1S3Z A;  3FVL A;  1UWY A;  4P4J A;  4YWY A;  1FY7 A;  4A31 A;  3G3S A;  2ZEP A;  4JYW A;  5EC4 A;  8CPA A;  1BO4 A;  2ABZ A;  3S9M A;  2EVN A;  3ZZI A;  4C7I A;  2RC4 A;  1XF8 A;  3EO4 A;  2B5G A;  4YFJ A;  3NE7 A;  4F0X A;  4NEX A;  4NGT A;  3T90 A;  1ARM A;  2Z3N A;  1BOB A;  2PJ9 A;  3PB8 X;  2C6G A;  2QJ8 A;  2BSW A;  4Z65 A;  4AG9 A;  4P6Y A;  3EFA A;  3D7F A;  4LQ6 A;  4CGO A;  5CBM A;  4IUS A;  4CYQ A;  2AFX A;  2FVG A;  5HVF A;  1LCP A;  3TTH A;  4MY0 A;  4OID A;  2D4O A;  3QB8 A;  3LMS A;  1KWM A;  3MRU A;  1QST A;  3RZA A;  3PBE A;  3CPA A;  2F8H A;  4MHD A;  3PRT A;  2VBQ A;  4Q36 A;  1B6B A;  2B3U A;  1YLE A;  3I3G A;  3V38 A;  4F9U A;  1OBR A;  3D67 A;  1M44 A;  3FJU A;  2B4D B;  2WYR A;  3G8W A;  4XPK A;  3TX8 A;  4NF1 A;  2P6E A;  2C1C A;  3KGQ A;  2BEI A;  2AFS A;  4PXD A;  4R9M A;  4CGP A;  3GIU A;  4Y49 C;  1X12 A;  1XMB A;  4OIW A;  4FBE A;  1YX0 A;  5LYI A;  2DPS A;  2PR8 A;  4RUH A;  3BJ8 A;  1XJO A;  2J8N A;  4GS4 A;  4KVM E;  2GRE A;  1F2P A;  2EO8 A;  2GE3 A;  3S6F A;  3IWW A;  4R8F A;  3SJG A;  1LAN A;  1TKH A;  3KAS A;  5AG5 A;  1XE4 A;  1YR0 A;  2B4D A;  1VIX A;  1YRE A;  3GY9 A; 
#chains in the Genus database with same CATH homology
 3F0A A;  4Y49 B;  3FNC A;  2YNC C;  2H5M A;  1R57 A;  4B11 A;  4II9 A;  3CXQ A;  1LRZ A;  4MFL A;  2Q0Y A;  3JTK A;  5JQ4 A;  3UY5 A;  4KZT A;  4MJ8 A;  4FD7 A;  1I12 A;  4R3K A;  2PC1 A;  5GCN A;  2B4B A;  3R9F A;  4FD4 A;  3OWC A;  4M3S A;  3SHP A;  4UCP A;  4JD6 A;  3D8P A;  4QB9 A;  3CXP A;  4NXY A;  2ZW4 A;  3WR7 A;  2YNC A;  2HUZ A;  2I00 A;  5G21 A;  5F46 A;  4M85 A;  1KUV A;  5IV0 A;  3IU1 A;  1NMT A;  3IGR A;  4L8A A;  4R87 A;  1S7L A;  1MK4 A;  1IIC A;  4MY3 A;  5EBV A;  2CXA A;  3D2M A;  3SXN A;  1I1D A;  4K30 A;  3R95 A;  2DPT A;  2WPW A;  3R9E A;  3W6X A;  2DXQ A;  2QIR A;  3LOD A;  4CAW A;  5C82 A;  4KOY A;  5C88 A;  3DR6 A;  5KTC A;  4XNH C;  1TIQ A;  3TCV A;  4LUA A;  4R3L A;  2FE7 A;  2NMT A;  1J4J A;  5DWM A;  4XNH B;  4H6Z A;  2PDO A;  4CGN A;  2G3T A;  2FL4 A;  2P0W A;  2O28 A;  2VXK A;  1KUY A;  2CNS A;  4U9Y A;  2FIW A;  4PK3 A;  3VWD A;  2ATR A;  4AG7 A;  4MFJ A;  3LD2 A;  1IB1 E;  1QSM A;  3QAH A;  4KOU A;  4KLV A;  2FSR A;  3GKR A;  2BL1 A;  1S5K A;  4NSQ A;  4UA3 A;  3S6G A;  5AG6 A;  2EUI A;  1Y9W A;  1M4I A;  4L89 A;  3H4Q A;  2KCW A;  3R1K A;  4OAE A;  3DSB A;  2R98 A;  4ZGY B;  3I9S A;  4RS2 A;  4IF5 A;  4PSW A;  4HNY B;  2R1I A;  1V0C A;  3F8K A;  1VKC A;  3D3S A;  4H6U A;  4A32 A;  2AJ6 A;  5H84 A;  3S6H A;  2FT0 A;  5A28 A;  3FRM A;  3H5Z A;  4HKF A;  2B58 A;  4KUB A;  3EY5 A;  3C26 A;  1S7F A;  2REE A;  3W91 A;  2YND A;  4OLL A;  1N71 A;  4J3G A;  2PR1 A;  4C68 A;  4KUA A;  2IL4 A;  4C2Z A;  4KSF A;  4FD5 A;  3BJ7 A;  4U9Z A;  4UFX A;  2ARH A;  2QML A;  4DNC A;  4B5O A;  2JLM A;  4A33 A;  4PSX A;  3SXO A;  3FXT A;  5AG4 A;  1IID A;  2YGW A;  4MFP A;  5IB0 A;  4KS9 A;  3IWG A;  1Y9K A;  3KKW A;  1MJA A;  4JJX A;  1RXT A;  4XPD C;  2Z11 A;  1SQH A;  1Q2C A;  2JEV A;  2VQY A;  4C2Y A;  4C2X A;  2OH1 A;  2AE6 A;  2Y0M A;  4RI1 A;  3FYN A;  2Q7B A;  3EXN A;  5E96 A;  4XPD B;  2HV2 A;  2YNE A;  2FCK A;  4AVC A;  3GYA A;  5ISV A;  2FS5 A;  3DNS A;  4KOR A;  2R7H A;  4AVA A;  1B87 A;  2JDC A;  4QBJ A;  1XMT A;  5KTA A;  3VWE A;  4CAX A;  2FXF A;  1WWZ A;  4E2A A;  1S60 A;  3TE4 A;  4XPL A;  5G20 A;  4Q38 A;  1M4G A;  2K5T A;  2VZZ A;  3T9Y A;  5J8F A;  4JWP A;  5IX3 A;  2Z3M A;  4FD6 A;  4QUS A;  1NE9 A;  2WPX A;  2Z3P A;  5I0C A;  4UCN A;  5HH1 A;  4A95 A;  1KZF A;  4KOT A;  4CYN A;  3CXS A;  5AG7 A;  1Y7R A;  2PSW A;  2CY2 A;  2Z3O A;  3B8G A;  2Z0Z A;  4OAD A;  2QEC A;  4AB7 A;  4JXQ A;  4MFK A;  5FVJ A;  4UCM A;  3BLN A;  4KOW A;  2OZU A;  4YRH A;  2Z3L A;  4CRY B;  4HNX B;  2Z10 A;  1YVO A;  4MI4 A;  1P4N A;  4A30 A;  1IYL A;  2BUE A;  1Z4E A;  4CAF A;  3N7Z A;  5AGE A;  1M4D A;  1M1D A;  3F5B A;  2G3A A;  1KUX A;  2HQY A;  2FIA A;  4B10 A;  2Q44 A;  5F47 A;  5CNP A;  2Q4Y A;  4E0A A;  4UFW A;  4NCZ A;  2VZY A;  1K4J A;  4LX9 A;  2ZPA A;  4UFV A;  2J8R A;  4KSA A;  2OZG A;  3IWE A;  3TT2 A;  4CGL A;  2OZH A;  2REF A;  4PV6 A;  1P0H A;  3R9G A;  3TOA A;  1WK4 A;  4MBU A;  2GIV A;  5F49 A;  5JPH A;  2D4P A;  2ZW7 A;  5H86 A;  4AVB A;  4CYP A;  4H89 A;  4UWJ A;  1NSL A;  2P6G A;  3DDD A;  4CAE A;  2F5I A;  2P6F A;  3TO6 A;  4MFZ A;  4CS0 B;  4KOV A;  4CYO A;  1I21 A;  1RO5 A;  1IYK A;  4ORF A;  4JXR A;  4HNW B;  4PK2 A;  4CAV A;  5G1Z A;  2JDD A;  4E8O A;  5KTD A;  1CJW A;  2CNT A;  4JLY A;  3D2P A;  3FBU A;  5J8C A;  2VI7 A;  2A4N A;  1MJ9 A;  2B3V A;  3S6K A;  1S7N A;  2C27 A;  4KVX A;  4MFQ A;  2J8M A;  1ON0 A;  3P2H A;  2X7B A;  2WSA A;  5BWA B;  2GAN A;  3JVN A;  1XIX A;  4KLW A;  4QVT A;  3MGD A;  1QSN A;  3K9U A;  3PP9 A;  2WUU A;  1S7K A;  4I49 A;  4YGO A;  1VHS A;  1PUA A;  4UWI A;  3JUW A;  3A9L A;  4ONU A;  3TO9 A;  2CNM A;  1QSO A;  5HMN A;  1YVK A;  4A2Z A;  2ZW5 A;  1Z4R A;  3TOB A;  3FB3 A;  2ZW6 A;  5A27 A;  3E0K A;  3R96 A;  4F6A A;  4ZBG A;  4F0Y A;  4QC6 A;  2PQ8 A;  2G0B A;  5G22 A;  3RYO A;  1XEB A;  4U5Y A;  2OU2 A;  1MJB A;  3DR8 A;  4KOS A;  2Q4V A;  4B13 A;  2R8V A;  2OB0 A;  4EVY A;  1PU9 A;  4BMH A;  4R57 A;  3PGP A;  4X5K A;  3TO7 A;  4B5P B;  1YK3 A;  5F48 A;  3ZJ0 A;  1Q2Y A;  1L0C A;  2ZXV A;  1ZO0 A;  4CRZ B;  4UBR A;  2VEZ A;  2Q04 A;  1Q2D A;  4KVO E;  1YGH A;  2Z3K A;  3IU2 A;  3V8I A;  1GHE A;  1Z9U A;  4KOX A;  5DWN A;  3W6S A;  1U6M A;  3TFY A;  4B12 A;  1CM0 A;  4B5P A;  1QSR A;  3PZJ A;  2B5G B;  4B14 A;  3EC4 A;  1OZP A;  4CGM A;  3FIX A;  4C7H A;  3P2F A;  1UFH A;  4BBH A;  2I79 A;  2PRB A;  1S3Z A;  4A31 A;  1FY7 A;  3G3S A;  5EC4 A;  1BO4 A;  2EVN A;  3ZZI A;  4C7I A;  2RC4 A;  1XF8 A;  3EO4 A;  2B5G A;  4YFJ A;  3NE7 A;  4F0X A;  4NEX A;  3T90 A;  2Z3N A;  1BOB A;  2BSW A;  4AG9 A;  4CGO A;  3EFA A;  4IUS A;  4CYQ A;  3TTH A;  4MY0 A;  2D4O A;  3QB8 A;  1QST A;  4MHD A;  2VBQ A;  4Q36 A;  1B6B A;  2B3U A;  1YLE A;  3I3G A;  1M44 A;  2B4D B;  4XPK A;  3G8W A;  4NF1 A;  2P6E A;  2BEI A;  4R9M A;  4CGP A;  4Y49 C;  1YX0 A;  2DPS A;  2PR8 A;  3BJ8 A;  4GS4 A;  2J8N A;  4KVM E;  2GE3 A;  3S6F A;  5AG5 A;  1XE4 A;  1YR0 A;  2B4D A;  1YRE A;  3GY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...