1N71A

Crystal structure of aminoglycoside 6'-acetyltransferase type ii in complex with coenzyme a
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
180
structure length
180
Chain Sequence
MIISEFDRNNPVLKDQLSDLLRLTWPEEYGDSSAEEVEEMMNPERIAVAAVDQDELVGFIGAIPQYGITGWELHPLVVESSRRKNQIGTRLVNYLEKEVASRGGITIYLGTDDLDHGTTLSQTDLYEHTFDKVASIQNLREHPYEFYEKLGYKIVGVLPNANGWDKPDIWMAKTIIPRPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aac(6')-Ii
publication title X-ray structure of the AAC(6')-Ii antibiotic resistance enzyme at 1.8 A resolution; examination of oligomeric arrangements in GNAT superfamily members
pubmed doi rcsb
source organism Enterococcus faecium
molecule tags Transferase
total genus 50
structure length 180
sequence length 180
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1n71A00
4NEXA 5CNPA 3TCVA 2EUIA 1U6MA 2ZPAA 3GYAA 4FD5A 4RS2A 2VBQA 4H6UA 4KVXA 2H5MA 3V8IA 4KZTA 2REFA 3UY5A 2PDOA 5F49A 1XF8A 3LD2A 2ZXVA 1YREA 2O28A 3VWEA 4XPDB 3W91A 1Q2DA 2R1IA 1YR0A 2VEZA 3GKRA 1MJ9A 1RXTA 2VXKA 4IF5A 3C26A 4AB7A 3JUWA 1SQHA 2J8RA 5E96A 4R3LA 4OADA 4L8AA 3G3SA 2ATRA 2FL4A 4JJXA 2D4OA 2OZHA 3SXNA 1IYKA 3IGRA 4ZBGA 4AVAA 4R87A 4PK3A 4PSWA 5JQ4A 2F5IA 2DXQA 3JVNA 5FVJA 2JLMA 1K4JA 4KOXA 3TFYA 2ZW4A 2Q44A 2CNTA 2FS5A 2JDDA 4NCZA 4KOVA 4YFJA 3S6KA 4HNYB 2Z11A 4QB9A 3E0KA 4MY0A 1XEBA 3RYOA 3H4QA 3TOBA 2HV2A 3S6HA 1QSRA 1WWZA 4XNHC 4FD7A 3F5BA 2HQYA 1S7LA 4MJ8A 1PU9A 2REEA 3OWCA 4AVBA 4XPKA 2GIVA 2JEVA 3DSBA 1I1DA 4XPLA 2EVNA 1M44A 3D2PA 4J3GA 1QSTA 5HH1A 4MI4A 2R7HA 2OU2A 3FB3A 4ONUA 3I3GA 4UBRA 4JLYA 1P0HA 1S3ZA 1I12A 5KTAA 5F48A 3TE4A 1NE9A 1Z4RA 1NSLA 2Z0ZA 2AJ6A 2PQ8A 4Y49C 2A4NA 2B4DA 1MK4A 2ZW6A 4KOSA 1YVKA 1YVOA 2FXFA 2C27A 3KKWA 3B8GA 4KLVA 2VZYA 4CRYB 5EC4A 2B3UA 4XNHB 1UFHA 3FXTA 2ARHA 4LX9A 2PR8A 2FSRA 2NMTA 1B6BA 2Q04A 3DNSA 5C88A 3I9SA 2FE7A 5DWNA 2GE3A 4CRZB 4E0AA 3F0AA 3EY5A 3FYNA 4PV6A 1LRZA 2J8MA 3QAHA 3DDDA 1S60A 4E2AA 3PP9A 4L89A 3R9FA 4KVME 5EBVA 1KUVA 2Q7BA 2QMLA 5ISVA 2P6FA 4NXYA 4Y49B 4FD4A 2I79A 4KOYA 4I49A 1IICA 1GHEA 1KUYA 1Z9UA 4F0YA 2VI7A 1QSMA 4R9MA 4AVCA 1Y9KA 2BUEA 2PR1A 2HUZA 4IUSA 4KUBA 1N71A 4U9YA 3W6SA 1TIQA 2FCKA 2J8NA 5H86A 4HNXB 3CXQA 5IX3A 3BJ7A 1Q2CA 4MBUA 5GCNA 2P6GA 2CNSA 4H6ZA 1NMTA 4KUAA 2G3TA 4FD6A 4YRHA 2ZW5A 1XIXA 4DNCA 2FT0A 1V0CA 1YX0A 4II9A 3BJ8A 3T90A 2B5GB 2X7BA 3QB8A 3D8PA 1M1DA 1OZPA 4R57A 3PGPA 2KCWA 3TO9A 2BEIA 1R57A 4CAWA 2Q0YA 3LODA 3S6FA 1IB1E 1MJAA 2B3VA 4KOUA 3N7ZA 4F6AA 1Y7RA 1PUAA 5DWMA 1BOBA 1CM0A 4UWJA 1B87A 4AG9A 4QUSA 1VKCA 3GY9A 2QIRA 4B5PB 3TTHA 1P4NA 4CAXA 2R8VA 2P6EA 5I0CA 2JDCA 1KUXA 3R96A 2B4DB 3FNCA 2FIWA 2ZW7A 3W6XA 1M4IA 4M85A 5IB0A 1FY7A 2AE6A 3EXNA 3R1KA 4CS0B 4KVOE 3P2HA 5KTCA 2PRBA 1QSOA 2QECA 3BLNA 4JD6A 3DR6A 1M4GA 4GS4A 3FIXA 1L0CA 4PK2A 3VWDA 5F47A 3TOAA 2B58A 4NSQA 4QC6A 3S6GA 2R98A 2RC4A 1VHSA 2OH1A 1IYLA 1KZFA 3IWGA 3FBUA 3NE7A 4OAEA 3TO7A 2D4PA 3ZZIA 4KORA 1BO4A 4HNWB 4HKFA 1Z4EA 1YGHA 3P2FA 3R9EA 4BMHA 2PC1A 4OLLA 3TO6A 1XE4A 4U5YA 3MGDA 4LUAA 4MHDA 3DR8A 4CAVA 3R9GA 2OB0A 2P0WA 3D3SA 4KOWA 1Q2YA 2Q4YA 4H89A 2B4BA 1MJBA 1QSNA 1RO5A 3TT2A 4EVYA 4RI1A 2I00A 4JWPA 3T9YA 3EO4A 1S7NA 2K5TA 4UWIA 2VZZA 2B5GA 2WPXA 2BSWA 4M3SA 1S7FA 2IL4A 3K9UA 4AG7A 5H84A 3EC4A 4UA3A 1M4DA 2Q4VA 5IV0A 5J8CA 1J4JA 3SXOA 5JPHA 4YGOA 3R95A 3G8WA 2VQYA 3PZJA 1ON0A 2FIAA 4B5OA 5KTDA 4KOTA 4XPDC 2CY2A 1IIDA 4U9ZA 1CJWA 2CNMA 2WPWA 2GANA 4X5KA 2OZUA 5C82A 1I21A 2BL1A 2G3AA 3SHPA 4MY3A 4JXQA 1S7KA 2G0BA 4B5PA 4JXRA 4R3KA 4E8OA 2OZGA 1YLEA 5F46A 4NF1A 3FRMA 2Y0MA 2Z10A 4QBJA 5J8FA 3CXSA 4QVTA 1WK4A 3D2MA 1Y9WA 4PSXA 3CXPA 4K30A 4KLWA 5HMNA 1YK3A 3EFAA 3F8KA 3ZJ0A 4ORFA 1S5KA 1XMTA 3WR7A 2PSWA
chains in the Genus database with same CATH superfamily
3IC1A 1KWMA 4NEXA 5CNPA 2EUIA 3TCVA 4C2ZA 1U6MA 2ZPAA 3DGVA 3GYAA 4FD5A 4NGMA 2GLJA 1ARLA 4RS2A 2VBQA 4H6UA 4KVXA 3TC8A 4NGPA 2H5MA 4ZX9A 4KZTA 2REFA 3V8IA 3UY5A 2PDOA 5F49A 1XF8A 2EO8A 3LD2A 2C1CA 5THWA 2XEJA 2ZXVA 1YREA 1XOVA 2O28A 5DS0A 4ZI6A 3VWEA 4XPDB 3W91A 1Q2DA 2R1IA 3FF3A 1YR0A 4UEEA 3WC5A 3PB9X 4C68A 1FNOA 4KSIA 1YQEA 2YNDA 2VEZA 3GKRA 1MJ9A 1RXTA 4C7HA 2VXKA 4IF5A 4OIWA 4NJQA 1ZG9A 3C26A 4AB7A 2YGWA 2PIYA 3JUWA 1SQHA 4IHMA 1AUGA 4B14A 4F9UA 3FH4A 1LAPA 4EFDA 2GLFA 1TXRA 1YSJA 2J8RA 5E96A 4R3LA 4OADA 4L8AA 3G3SA 2ATRA 1M4LA 3CDXA 2FL4A 5AGEA 4JJXA 2D4OA 4PXBA 4PQAA 2AFOA 3PBBA 4DJLA 1DTDA 5EMIA 5A27A 2GFQA 2OZHA 3PB6X 2ZEEA 3SXNA 3IIBA 3VATA 4CGLA 1IYKA 2CTBA 3IGRA 1NSAA 4HPSA 4X2TA 4ZBGA 4AVAA 3KR4A 4R87A 4PK3A 4B6ZA 4PSWA 4IAVA 5JQ4A 3S9LA 2F5IA 4B12A 2DXQA 3JVNA 5FVJA 2JLMA 4M6IA 1K4JA 4KOXA 1EE3P 4BINA 3TFYA 2ZW4A 2Q44A 4BBHA 2CNTA 3MRUA 2FS5A 2JDDA 4NCZA 1LANA 4KOVA 4NFRA 4YFJA 4MFKA 3B7IA 1ARMA 3L2NA 4OC0A 3S6KA 2PJCA 4HNYB 4GM5A 4YU9A 3GIUA 2Z11A 4QB9A 2Z3PA 5G20A 3E0KA 2CF4A 3LWUA 1UWYA 4MY0A 1BPMA 1XEBA 3RYOA 3H4QA 3TOBA 2HV2A 3KASA 3S6HA 4NGTA 3WABA 1QSRA 1WWZA 2PJ7A 4MFQA 4XNHC 3SI2A 4FD7A 3F5BA 2PJ5A 2ZEOA 3HUVA 2HQYA 1S7LA 4NGQA 3N5FA 4MFPA 4MCPA 1A2ZA 2ODFA 4MJ8A 2V8GA 1PU9A 3NFZA 1LOKA 2REEA 2V77A 3OWCA 3DLJA 4AVBA 2OR4A 4XPKA 4CGMA 2GIVA 2C6PA 2ZEPA 2JEVA 3DSBA 2F8HA 1I1DA 5K8NA 4TNUA 4XPLA 4UCPA 3V7ZA 2EVNA 4PXEA 1M44A 3PB4X 3D2PA 4CGOA 3FVLA 4J3GA 1VHOA 1QSTA 1XBUA 4A39A 4MXUA 2PVWA 4MI4A 5HH1A 2R7HA 2OU2A 3FB3A 4ONUA 4FUUA 4ZX8A 3WC6A 3I3GA 2GU2A 1LAMA 4UBRA 4JLYA 1P0HA 4UFXA 1S3ZA 4UFVA 3NE8A 1I12A 4A32A 5KTAA 5F48A 3V38A 3TE4A 1NE9A 1Z4RA 2ABZA 3H8EA 1NSLA 4YWYA 2Z0ZA 2Z3LA 3PB7X 2AJ6A 2PQ8A 4G1PA 4OC5A 5AG5A 4Y49C 2A4NA 3B35A 1CBXA 1MK4A 2B4DA 3FX6A 1ZLIA 4MCQA 3H5ZA 2G9DA 2ZW6A 1OBRA 2QVPA 4KOSA 4UEFA 3SJGA 1YVKA 1FT7A 3RBUA 4KS9A 2NSMA 3SJFA 1YVOA 2FXFA 2C27A 3FECA 3NA6A 2EK8A 1CPXA 2HC9A 3I1UA 3KKWA 4FBEA 3B8GA 4P4BA 3B3WA 1CX8A 3QNVA 4KLVA 2VZYA 4OC1A 4CRYB 2NYQA 4OMEA 5EC4A 2B3UA 3IU2A 4XNHB 3CZXA 1UFHA 3SI1A 3FXTA 2ARHA 4LX9A 1VIXA 2PR8A 2FSRA 1LFWA 1B6BA 2NMTA 2Q04A 3DNSA 4A94A 5C88A 3I9SA 1PYTB 2FE7A 4PPZA 1TF9A 1XFOA 5DWNA 2GE3A 4PXDA 3IO1A 4CRZB 3VH9A 4E0AA 3F0AA 3EY5A 4P4EA 4RN7A 4F0XA 4MFLA 2V8VA 3FYNA 1QQ9A 4PV6A 1LRZA 4C2XA 1YMEA 4OP4A 4WWVA 2J8MA 3QAHA 4P10A 2PE3A 5CPAA 3PB8X 5LYDA 3DDDA 2J9AA 1S60A 3H8GA 4H2KA 4LQ6A 4OC4A 4E2AA 5D29A 3MN8A 3PP9A 4L89A 2EK9A 3R9FA 4KVME 5EBVA 4P4JA 3RNZA 2PVVA 3IFEA 1KUVA 4JZ0A 1IGBA 2C6GA 1TF8A 2Z3MA 2Q7BA 4P4FA 4Q36A 2QMLA 5ISVA 2P6FA 4NXYA 3IU1A 4Y49B 4FD4A 2O4HA 3KQZA 4EMEA 2I79A 4KOYA 4I49A 5D8NA 1IICA 4P44A 1Z8WA 2PJ1A 1LCPA 4P45A 4CAFA 1GHEA 1KUYA 4X8IA 1Z9UA 4F0YA 2VI7A 1QSMA 4R9MA 4A30A 4AVCA 1Y9KA 2BUEA 3CT9A 2PR1A 2HUZA 4A37A 1Q7LA 5K8MA 2AFWA 2ZOGA 1AYEA 4WJBA 4Q38A 1AMPA 4IUSA 4KUBA 1N71A 2AFXA 4U9YA 3B3TA 3W6SA 2C6CA 5AG6A 1TIQA 3KGQA 3LMSA 4MHYA 5A28A 2F7VA 2FCKA 3IJ3A 1ELLP 4NGNA 3B3VA 2POKA 4MMOA 2J8NA 1Z8TA 3FJUA 5H86A 3SJXA 4OKOA 2AFSA 3CXQA 4HNXB 5IX3A 1XJOA 3BJ7A 6CPAA 4MCRA 2FVGA 1Q2CA 1Y0RA 2PJ0A 4MBUA 5GCNA 3GB0A 4K3NA 4R6TA 2P6GA 2CNSA 4R7MA 4H6ZA 1NMTA 1CPSA 2PJAA 2XEIA 2Z3NA 3PEIA 1VGYA 4KUAA 4C2YA 2G3TA 4FD6A 4YRHA 2ZW5A 1XIXA 4DNCA 4RUHA 1XMBA 2FT0A 1Z5RA 1V0CA 2IMOA 1YX0A 4II9A 3BJ8A 3T90A 4A38A 2YNEA 1GYTA 2B5GB 2IJZA 4ZY1A 1PCAA 2PJ2A 2X7BA 3D8PA 1M1DA 3QB8A 1OZPA 4NGSA 5ELYA 2IQ6A 4R57A 3KHZA 3PGPA 1YLOA 2KCWA 3KQXA 4KSFA 3KR5A 3TO9A 2BEIA 1R57A 2PJ3A 4CAWA 2Q0YA 4CYPA 2JBJA 3LODA 3S6FA 2QYVA 2ZEHA 1IOFA 1IB1E 1MJAA 2B3VA 2ZEFA 4KOUA 3N7ZA 4F6AA 1YW4A 1XRYA 5K8OA 1Y7RA 3D7FA 1PUAA 2Q4ZA 4B13A 3GUXA 4R76A 5DWMA 3D7GA 1R3NA 2GREA 1BOBA 2XEFA 3KHXA 2VL1A 1CM0A 4B11A 4UWJA 1B87A 2YNCA 4AG9A 1F2OA 1JQGA 3D68A 2DEAA 3BI1A 5G1ZA 4QUSA 1VKCA 1F57A 3GY9A 4O23A 3D7DA 4P4DA 4CPAA 5LYLA 4KSAA 3TX8A 1ZG7A 2QIRA 4B5PB 5LYIA 3B2YA 3TTHA 1P4NA 4P4IA 4ZGYB 3BI0A 2R8VA 4CAXA 2P6EA 3KZWA 7CPAA 4UEZA 8CPAA 5I0CA 1IY7A 4CAEA 4MCSA 4OIDA 4CGNA 5JM6A 4LQGA 2JDCA 1KUXA 2V8HA 3R96A 2B4DB 3FNCA 2RB7A 3H8FA 2WZNA 2Z3OA 3HLPA 1R43A 3PRTA 1IU8A 5I4MA 3FMCA 2FIWA 2ZW7A 1BPNA 3W6XA 3S9NA 3IWEA 1M4IA 4M85A 5IB0A 2Q51A 3KL9A 1FY7A 2AE6A 4MRIA 3EXNA 1TKJA 3R1KA 4CS0B 4MFJA 3RZAA 4KVOE 3P2HA 3ISXA 4F8ZA 5CBMA 5KTCA 2PRBA 3PFEA 1QSOA 1Z8XA 2QECA 4F9VA 2ANPA 3WT4A 4M6HA 3BLNA 4JD6A 3DR6A 1ZO0A 1M4GA 4NJRA 4GS4A 4UCMA 3FIXA 1L0CA 2BOAA 3PBEA 4PK2A 3VWDA 1HDQA 2ZELA 5F47A 5G21A 4W9YA 5LRJA 3JTKA 3TOAA 2B58A 4NSQA 4QC6A 4B10A 1Y0YA 3S6GA 1CP7A 2R98A 5HXDA 1ELMP 2RC4A 1VHSA 2OH1A 2JBKA 1CG2A 1IYLA 1KZFA 2BCOA 3FBUA 3IWGA 3LACA 3NE7A 5LYFA 2DPSA 5IB9A 4OAEA 1Z2LA 4CYNA 3RAMA 3TO7A 2D4PA 3ZZIA 4KORA 5JGFA 4JYWA 1BO4A 4HNWB 3FEDA 3D7HA 4BD9A 4HKFA 1X12A 1YW6A 1Z4EA 1YGHA 2AFMA 2ZEDA 3NH8A 3P2FA 3R9EA 3D66A 2DF5A 4BMHA 3SJEA 2PC1A 4OLLA 2OOTA 2PJ8A 1XE4A 1IOIA 3NH5A 3TO6A 1QMUA 4ONWA 4U5YA 3T8WA 3MGDA 4LUAA 2WYRA 2ZEGA 4MHDA 4CYOA 3CPXA 3VARA 3DR8A 4CAVA 3R9GA 2PJBA 2PJ4A 2OB0A 4TWEA 2P0WA 3D3SA 3NH4A 4A33A 5F09A 1VHEA 3SI0A 4KOWA 1Q2YA 2Q43A 2XEGA 4DYOA 2Q4YA 1Z8LA 2EBJA 4H89A 2B4BA 1MJBA 4PXCA 1QSNA 4EWTA 1RO5A 3D4UA 3TT2A 5AG4A 4GXHA 4OC2A 4EVYA 4RI1A 2I00A 4JWPA 1ZLHA 2CXAA 1Y7EA 3T9YA 2RFHA 3BXMA 3JRUA 3B3SA 5LRKA 3EO4A 2AFUA 2YNCC 3IWWA 1BLLE 4UIBA 4DUKA 1JWQA 2CTCA 1S7NA 2K5TA 4UWIA 2HB6A 1TKHA 4NGRA 4MHPA 2VZZA 2B5GA 4A2ZA 2WPXA 2BSWA 4M3SA 1S7FA 2IL4A 1HEEA 3K9UA 1F2PA 4AG7A 5HVHA 5H84A 3WC7A 2ZENA 3EC4A 3IEHA 4UA3A 5G22A 1M4DA 4FAIA 5AG7A 3CPAA 2Q4VA 3QAYA 2I3CA 2QJ8A 5IV0A 4Q7AA 5J8CA 1J4JA 3SXOA 5JPHA 4YGOA 5JH9A 3R95A 4A95A 3G8WA 2VQYA 3PZJA 1ON0A 5J1QA 2PJ9A 4FWUA 3BHXA 4UFWA 5K8PA 2FIAA 4B5OA 5KTDA 2O53A 1RTQA 1TKFA 4KOTA 2JEWA 5HVFA 4ZY2A 4XPDC 4Z65A 2CY2A 4UIAA 4X3RA 1IIDA 4R8FA 1CJWA 4U9ZA 4UF4A 2CNMA 2WPWA 4CGPA 2GANA 2PRQA 1DE4C 2ZOFA 4X5KA 4MHZA 2OZUA 2DPTA 5C82A 1I21A 2BL1A 2G3AA 3SHPA 2Z3KA 4MY3A 4JXQA 4C7IA 1S7KA 2PIZA 2G0BA 4B5PA 2Q7SA 3FEEA 4JXRA 4R3KA 4E8OA 1CP6A 2OZGA 1YLEA 4ZY0A 4MHNA 4A31A 4IK2A 3PFOA 2PCUA 3D67A 3FRMA 4NF1A 5F46A 2Y0MA 2CIJA 4ZYQA 1ZG8A 4UCNA 4CYQA 4P6YA 2EWBA 2Z10A 4QBJA 3RO0A 5HVGA 3CXSA 5J8FA 4QVTA 2AFZA 2ZEMA 3S9MA 1WK4A 1BAVA 1X10A 3B3CA 1Y9WA 3D2MA 4AXVA 1H8LA 4PSXA 3GLJA 3ISZA 3K2KA 4MFZA 3CXPA 2BO9A 4K30A 4KLWA 5HMNA 4M6GA 2V8DA 1YK3A 3A9LA 3EFAA 3F8KA 3ZJ0A 5BWAB 2WSAA 2WUUA 3K9TA 5LRGA 4ORFA 1S5KA 1XMTA 3WR7A 2PJ6A 1HDUA 4OC3A 3KI9A 2PSWA
chains in the Genus database with same CATH topology
4NEXA 5CNPA 3TCVA 2EUIA 4C2ZA 1U6MA 2ZPAA 3GYAA 4FD5A 4RS2A 2VBQA 4H6UA 4KVXA 2H5MA 3V8IA 4KZTA 2REFA 3UY5A 2PDOA 5F49A 1XF8A 3LD2A 2ZXVA 1YREA 2O28A 3VWEA 4XPDB 3W91A 1Q2DA 2R1IA 1YR0A 4C68A 2YNDA 2VEZA 3GKRA 1MJ9A 1RXTA 4C7HA 2VXKA 4IF5A 3C26A 4AB7A 2YGWA 3JUWA 1SQHA 4B14A 2J8RA 5E96A 4R3LA 4OADA 4L8AA 3G3SA 2ATRA 2FL4A 5AGEA 4JJXA 2D4OA 5A27A 2OZHA 3SXNA 4CGLA 1IYKA 3IGRA 4ZBGA 4AVAA 4R87A 4PK3A 4PSWA 5JQ4A 2F5IA 4B12A 2DXQA 3JVNA 5FVJA 2JLMA 1K4JA 4KOXA 3TFYA 2ZW4A 2Q44A 4BBHA 2CNTA 2FS5A 2JDDA 4NCZA 4KOVA 4YFJA 4MFKA 3S6KA 4HNYB 2Z11A 4QB9A 2Z3PA 5G20A 3E0KA 4MY0A 1XEBA 3RYOA 3H4QA 3TOBA 2HV2A 3S6HA 1QSRA 1WWZA 4XNHC 4MFQA 4FD7A 3F5BA 2HQYA 1S7LA 4MFPA 4MJ8A 1PU9A 2REEA 3OWCA 4AVBA 4XPKA 4CGMA 2GIVA 2JEVA 3DSBA 1I1DA 4XPLA 4UCPA 2EVNA 1M44A 3D2PA 4CGOA 4J3GA 1QSTA 5HH1A 4MI4A 2R7HA 2OU2A 3FB3A 4ONUA 3I3GA 4UBRA 4JLYA 1P0HA 4UFXA 1S3ZA 4UFVA 1I12A 4A32A 5KTAA 5F48A 3TE4A 1NE9A 1Z4RA 1NSLA 2Z0ZA 2Z3LA 2AJ6A 2PQ8A 5AG5A 4Y49C 2A4NA 2B4DA 1MK4A 3H5ZA 2ZW6A 4KOSA 1YVKA 4KS9A 1YVOA 2FXFA 2C27A 3KKWA 3B8GA 4KLVA 2VZYA 4CRYB 5EC4A 2B3UA 3IU2A 4XNHB 1UFHA 3FXTA 2ARHA 4LX9A 2PR8A 2FSRA 2NMTA 1B6BA 2Q04A 3DNSA 5C88A 3I9SA 2FE7A 5DWNA 2GE3A 4CRZB 4E0AA 3F0AA 3EY5A 4F0XA 4MFLA 3FYNA 4PV6A 1LRZA 4C2XA 2J8MA 3QAHA 3DDDA 1S60A 4E2AA 3PP9A 4L89A 3R9FA 4KVME 5EBVA 1KUVA 2Z3MA 2Q7BA 4Q36A 2QMLA 5ISVA 2P6FA 4NXYA 3IU1A 4Y49B 4FD4A 2I79A 4KOYA 4I49A 1IICA 4CAFA 1GHEA 1KUYA 1Z9UA 4F0YA 2VI7A 1QSMA 4R9MA 4A30A 4AVCA 1Y9KA 2BUEA 2PR1A 2HUZA 4Q38A 4IUSA 4KUBA 1N71A 4U9YA 3W6SA 5AG6A 1TIQA 5A28A 2FCKA 2J8NA 5H86A 4HNXB 3CXQA 5IX3A 3BJ7A 1Q2CA 4MBUA 5GCNA 2P6GA 2CNSA 4H6ZA 1NMTA 2Z3NA 4C2YA 4KUAA 2G3TA 4FD6A 4YRHA 2ZW5A 1XIXA 4DNCA 2FT0A 1V0CA 1YX0A 4II9A 3BJ8A 3T90A 2YNEA 2B5GB 2X7BA 3QB8A 3D8PA 1M1DA 1OZPA 4R57A 3PGPA 2KCWA 4KSFA 3TO9A 2BEIA 1R57A 4CAWA 2Q0YA 4CYPA 3LODA 3S6FA 1IB1E 1MJAA 2B3VA 4KOUA 3N7ZA 4F6AA 1Y7RA 1PUAA 4B13A 5DWMA 1BOBA 1CM0A 4B11A 4UWJA 1B87A 2YNCA 4AG9A 5G1ZA 4QUSA 1VKCA 3GY9A 4KSAA 2QIRA 4B5PB 3TTHA 1P4NA 4ZGYB 4CAXA 2R8VA 2P6EA 5I0CA 4CAEA 4CGNA 2JDCA 1KUXA 3R96A 2B4DB 3FNCA 2Z3OA 2FIWA 2ZW7A 3W6XA 3IWEA 1M4IA 4M85A 5IB0A 1FY7A 2AE6A 3EXNA 3R1KA 4CS0B 4MFJA 4KVOE 3P2HA 5KTCA 2PRBA 1QSOA 2QECA 3BLNA 4JD6A 3DR6A 1ZO0A 1M4GA 4GS4A 4UCMA 3FIXA 1L0CA 4PK2A 3VWDA 5F47A 5G21A 3TOAA 3JTKA 2B58A 4NSQA 4QC6A 4B10A 3S6GA 2R98A 2RC4A 1VHSA 2OH1A 1IYLA 1KZFA 3IWGA 3FBUA 3NE7A 2DPSA 4OAEA 4CYNA 3TO7A 2D4PA 3ZZIA 4KORA 1BO4A 4HNWB 4HKFA 1Z4EA 1YGHA 3P2FA 3R9EA 4BMHA 2PC1A 4OLLA 3TO6A 1XE4A 4U5YA 3MGDA 4LUAA 4MHDA 4CYOA 3DR8A 4CAVA 3R9GA 2OB0A 2P0WA 3D3SA 4A33A 4KOWA 1Q2YA 2Q4YA 4H89A 2B4BA 1MJBA 1QSNA 1RO5A 3TT2A 5AG4A 4EVYA 4RI1A 2I00A 4JWPA 2CXAA 3T9YA 3EO4A 2YNCC 1S7NA 2K5TA 4UWIA 2VZZA 2B5GA 4A2ZA 2WPXA 2BSWA 4M3SA 1S7FA 2IL4A 3K9UA 4AG7A 5H84A 3EC4A 4UA3A 5G22A 1M4DA 5AG7A 2Q4VA 5IV0A 5J8CA 1J4JA 3SXOA 5JPHA 4YGOA 3R95A 4A95A 3G8WA 2VQYA 3PZJA 1ON0A 4UFWA 2FIAA 4B5OA 5KTDA 4KOTA 4XPDC 2CY2A 1IIDA 4U9ZA 1CJWA 2CNMA 2WPWA 4CGPA 2GANA 4X5KA 2OZUA 2DPTA 5C82A 1I21A 2BL1A 2G3AA 3SHPA 2Z3KA 4MY3A 4JXQA 4C7IA 1S7KA 2G0BA 4B5PA 4JXRA 4R3KA 4E8OA 2OZGA 1YLEA 4A31A 5F46A 4NF1A 3FRMA 2Y0MA 4UCNA 4CYQA 2Z10A 4QBJA 5J8FA 3CXSA 4QVTA 1WK4A 3D2MA 1Y9WA 4PSXA 4MFZA 3CXPA 4K30A 4KLWA 5HMNA 1YK3A 3A9LA 3EFAA 3F8KA 3ZJ0A 5BWAB 2WSAA 2WUUA 4ORFA 1S5KA 1XMTA 3WR7A 2PSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NEX A;  5CNP A;  3TCV A;  2EUI A;  1U6M A;  2ZPA A;  3GYA A;  4FD5 A;  4RS2 A;  2VBQ A;  4H6U A;  4KVX A;  2H5M A;  3V8I A;  4KZT A;  2REF A;  3UY5 A;  2PDO A;  5F49 A;  1XF8 A;  3LD2 A;  2ZXV A;  1YRE A;  2O28 A;  3VWE A;  4XPD B;  3W91 A;  1Q2D A;  2R1I A;  1YR0 A;  2VEZ A;  3GKR A;  1MJ9 A;  1RXT A;  2VXK A;  4IF5 A;  3C26 A;  4AB7 A;  3JUW A;  1SQH A;  2J8R A;  5E96 A;  4R3L A;  4OAD A;  4L8A A;  3G3S A;  2ATR A;  2FL4 A;  4JJX A;  2D4O A;  2OZH A;  3SXN A;  1IYK A;  3IGR A;  4ZBG A;  4AVA A;  4R87 A;  4PK3 A;  4PSW A;  5JQ4 A;  2F5I A;  2DXQ A;  3JVN A;  5FVJ A;  2JLM A;  1K4J A;  4KOX A;  3TFY A;  2ZW4 A;  2Q44 A;  2CNT A;  2FS5 A;  2JDD A;  4NCZ A;  4KOV A;  4YFJ A;  3S6K A;  4HNY B;  2Z11 A;  4QB9 A;  3E0K A;  4MY0 A;  1XEB A;  3RYO A;  3H4Q A;  3TOB A;  2HV2 A;  3S6H A;  1QSR A;  1WWZ A;  4XNH C;  4FD7 A;  3F5B A;  2HQY A;  1S7L A;  4MJ8 A;  1PU9 A;  2REE A;  3OWC A;  4AVB A;  4XPK A;  2GIV A;  2JEV A;  3DSB A;  1I1D A;  4XPL A;  2EVN A;  1M44 A;  3D2P A;  4J3G A;  1QST A;  5HH1 A;  4MI4 A;  2R7H A;  2OU2 A;  3FB3 A;  4ONU A;  3I3G A;  4UBR A;  4JLY A;  1P0H A;  1S3Z A;  1I12 A;  5KTA A;  5F48 A;  3TE4 A;  1NE9 A;  1Z4R A;  1NSL A;  2Z0Z A;  2AJ6 A;  2PQ8 A;  4Y49 C;  2A4N A;  2B4D A;  1MK4 A;  2ZW6 A;  4KOS A;  1YVK A;  1YVO A;  2FXF A;  2C27 A;  3KKW A;  3B8G A;  4KLV A;  2VZY A;  4CRY B;  5EC4 A;  2B3U A;  4XNH B;  1UFH A;  3FXT A;  2ARH A;  4LX9 A;  2PR8 A;  2FSR A;  2NMT A;  1B6B A;  2Q04 A;  3DNS A;  5C88 A;  3I9S A;  2FE7 A;  5DWN A;  2GE3 A;  4CRZ B;  4E0A A;  3F0A A;  3EY5 A;  3FYN A;  4PV6 A;  1LRZ A;  2J8M A;  3QAH A;  3DDD A;  1S60 A;  4E2A A;  3PP9 A;  4L89 A;  3R9F A;  4KVM E;  5EBV A;  1KUV A;  2Q7B A;  2QML A;  5ISV A;  2P6F A;  4NXY A;  4Y49 B;  4FD4 A;  2I79 A;  4KOY A;  4I49 A;  1IIC A;  1GHE A;  1KUY A;  1Z9U A;  4F0Y A;  2VI7 A;  1QSM A;  4R9M A;  4AVC A;  1Y9K A;  2BUE A;  2PR1 A;  2HUZ A;  4IUS A;  4KUB A;  1N71 A;  4U9Y A;  3W6S A;  1TIQ A;  2FCK A;  2J8N A;  5H86 A;  4HNX B;  3CXQ A;  5IX3 A;  3BJ7 A;  1Q2C A;  4MBU A;  5GCN A;  2P6G A;  2CNS A;  4H6Z A;  1NMT A;  4KUA A;  2G3T A;  4FD6 A;  4YRH A;  2ZW5 A;  1XIX A;  4DNC A;  2FT0 A;  1V0C A;  1YX0 A;  4II9 A;  3BJ8 A;  3T90 A;  2B5G B;  2X7B A;  3QB8 A;  3D8P A;  1M1D A;  1OZP A;  4R57 A;  3PGP A;  2KCW A;  3TO9 A;  2BEI A;  1R57 A;  4CAW A;  2Q0Y A;  3LOD A;  3S6F A;  1IB1 E;  1MJA A;  2B3V A;  4KOU A;  3N7Z A;  4F6A A;  1Y7R A;  1PUA A;  5DWM A;  1BOB A;  1CM0 A;  4UWJ A;  1B87 A;  4AG9 A;  4QUS A;  1VKC A;  3GY9 A;  2QIR A;  4B5P B;  3TTH A;  1P4N A;  4CAX A;  2R8V A;  2P6E A;  5I0C A;  2JDC A;  1KUX A;  3R96 A;  2B4D B;  3FNC A;  2FIW A;  2ZW7 A;  3W6X A;  1M4I A;  4M85 A;  5IB0 A;  1FY7 A;  2AE6 A;  3EXN A;  3R1K A;  4CS0 B;  4KVO E;  3P2H A;  5KTC A;  2PRB A;  1QSO A;  2QEC A;  3BLN A;  4JD6 A;  3DR6 A;  1M4G A;  4GS4 A;  3FIX A;  1L0C A;  4PK2 A;  3VWD A;  5F47 A;  3TOA A;  2B58 A;  4NSQ A;  4QC6 A;  3S6G A;  2R98 A;  2RC4 A;  1VHS A;  2OH1 A;  1IYL A;  1KZF A;  3IWG A;  3FBU A;  3NE7 A;  4OAE A;  3TO7 A;  2D4P A;  3ZZI A;  4KOR A;  1BO4 A;  4HNW B;  4HKF A;  1Z4E A;  1YGH A;  3P2F A;  3R9E A;  4BMH A;  2PC1 A;  4OLL A;  3TO6 A;  1XE4 A;  4U5Y A;  3MGD A;  4LUA A;  4MHD A;  3DR8 A;  4CAV A;  3R9G A;  2OB0 A;  2P0W A;  3D3S A;  4KOW A;  1Q2Y A;  2Q4Y A;  4H89 A;  2B4B A;  1MJB A;  1QSN A;  1RO5 A;  3TT2 A;  4EVY A;  4RI1 A;  2I00 A;  4JWP A;  3T9Y A;  3EO4 A;  1S7N A;  2K5T A;  4UWI A;  2VZZ A;  2B5G A;  2WPX A;  2BSW A;  4M3S A;  1S7F A;  2IL4 A;  3K9U A;  4AG7 A;  5H84 A;  3EC4 A;  4UA3 A;  1M4D A;  2Q4V A;  5IV0 A;  5J8C A;  1J4J A;  3SXO A;  5JPH A;  4YGO A;  3R95 A;  3G8W A;  2VQY A;  3PZJ A;  1ON0 A;  2FIA A;  4B5O A;  5KTD A;  4KOT A;  4XPD C;  2CY2 A;  1IID A;  4U9Z A;  1CJW A;  2CNM A;  2WPW A;  2GAN A;  4X5K A;  2OZU A;  5C82 A;  1I21 A;  2BL1 A;  2G3A A;  3SHP A;  4MY3 A;  4JXQ A;  1S7K A;  2G0B A;  4B5P A;  4JXR A;  4R3K A;  4E8O A;  2OZG A;  1YLE A;  5F46 A;  4NF1 A;  3FRM A;  2Y0M A;  2Z10 A;  4QBJ A;  5J8F A;  3CXS A;  4QVT A;  1WK4 A;  3D2M A;  1Y9W A;  4PSX A;  3CXP A;  4K30 A;  4KLW A;  5HMN A;  1YK3 A;  3EFA A;  3F8K A;  3ZJ0 A;  4ORF A;  1S5K A;  1XMT A;  3WR7 A;  2PSW A; 
#chains in the Genus database with same CATH topology
 3IC1 A;  1KWM A;  4NEX A;  5CNP A;  2EUI A;  3TCV A;  4C2Z A;  1U6M A;  2ZPA A;  3DGV A;  3GYA A;  4FD5 A;  4NGM A;  2GLJ A;  1ARL A;  4RS2 A;  2VBQ A;  4H6U A;  4KVX A;  3TC8 A;  4NGP A;  2H5M A;  4ZX9 A;  4KZT A;  2REF A;  3V8I A;  3UY5 A;  2PDO A;  5F49 A;  1XF8 A;  2EO8 A;  3LD2 A;  2C1C A;  5THW A;  2XEJ A;  2ZXV A;  1YRE A;  1XOV A;  2O28 A;  5DS0 A;  4ZI6 A;  3VWE A;  4XPD B;  3W91 A;  1Q2D A;  2R1I A;  3FF3 A;  1YR0 A;  4UEE A;  3WC5 A;  3PB9 X;  4C68 A;  1FNO A;  4KSI A;  1YQE A;  2YND A;  2VEZ A;  3GKR A;  1MJ9 A;  1RXT A;  4C7H A;  2VXK A;  4IF5 A;  4OIW A;  4NJQ A;  1ZG9 A;  3C26 A;  4AB7 A;  2YGW A;  2PIY A;  3JUW A;  1SQH A;  4IHM A;  1AUG A;  4B14 A;  4F9U A;  3FH4 A;  1LAP A;  4EFD A;  2GLF A;  1TXR A;  1YSJ A;  2J8R A;  5E96 A;  4R3L A;  4OAD A;  4L8A A;  3G3S A;  2ATR A;  1M4L A;  3CDX A;  2FL4 A;  5AGE A;  4JJX A;  2D4O A;  4PXB A;  4PQA A;  2AFO A;  3PBB A;  4DJL A;  1DTD A;  5EMI A;  5A27 A;  2GFQ A;  2OZH A;  3PB6 X;  2ZEE A;  3SXN A;  3IIB A;  3VAT A;  4CGL A;  1IYK A;  2CTB A;  3IGR A;  1NSA A;  4HPS A;  4X2T A;  4ZBG A;  4AVA A;  3KR4 A;  4R87 A;  4PK3 A;  4B6Z A;  4PSW A;  4IAV A;  5JQ4 A;  3S9L A;  2F5I A;  4B12 A;  2DXQ A;  3JVN A;  5FVJ A;  2JLM A;  4M6I A;  1K4J A;  4KOX A;  1EE3 P;  4BIN A;  3TFY A;  2ZW4 A;  2Q44 A;  4BBH A;  2CNT A;  3MRU A;  2FS5 A;  2JDD A;  4NCZ A;  1LAN A;  4KOV A;  4NFR A;  4YFJ A;  4MFK A;  3B7I A;  1ARM A;  3L2N A;  4OC0 A;  3S6K A;  2PJC A;  4HNY B;  4GM5 A;  4YU9 A;  3GIU A;  2Z11 A;  4QB9 A;  2Z3P A;  5G20 A;  3E0K A;  2CF4 A;  3LWU A;  1UWY A;  4MY0 A;  1BPM A;  1XEB A;  3RYO A;  3H4Q A;  3TOB A;  2HV2 A;  3KAS A;  3S6H A;  4NGT A;  3WAB A;  1QSR A;  1WWZ A;  2PJ7 A;  4MFQ A;  4XNH C;  3SI2 A;  4FD7 A;  3F5B A;  2PJ5 A;  2ZEO A;  3HUV A;  2HQY A;  1S7L A;  4NGQ A;  3N5F A;  4MFP A;  4MCP A;  1A2Z A;  2ODF A;  4MJ8 A;  2V8G A;  1PU9 A;  3NFZ A;  1LOK A;  2REE A;  2V77 A;  3OWC A;  3DLJ A;  4AVB A;  2OR4 A;  4XPK A;  4CGM A;  2GIV A;  2C6P A;  2ZEP A;  2JEV A;  3DSB A;  2F8H A;  1I1D A;  5K8N A;  4TNU A;  4XPL A;  4UCP A;  3V7Z A;  2EVN A;  4PXE A;  1M44 A;  3PB4 X;  3D2P A;  4CGO A;  3FVL A;  4J3G A;  1VHO A;  1QST A;  1XBU A;  4A39 A;  4MXU A;  2PVW A;  4MI4 A;  5HH1 A;  2R7H A;  2OU2 A;  3FB3 A;  4ONU A;  4FUU A;  4ZX8 A;  3WC6 A;  3I3G A;  2GU2 A;  1LAM A;  4UBR A;  4JLY A;  1P0H A;  4UFX A;  1S3Z A;  4UFV A;  3NE8 A;  1I12 A;  4A32 A;  5KTA A;  5F48 A;  3V38 A;  3TE4 A;  1NE9 A;  1Z4R A;  2ABZ A;  3H8E A;  1NSL A;  4YWY A;  2Z0Z A;  2Z3L A;  3PB7 X;  2AJ6 A;  2PQ8 A;  4G1P A;  4OC5 A;  5AG5 A;  4Y49 C;  2A4N A;  3B35 A;  1CBX A;  1MK4 A;  2B4D A;  3FX6 A;  1ZLI A;  4MCQ A;  3H5Z A;  2G9D A;  2ZW6 A;  1OBR A;  2QVP A;  4KOS A;  4UEF A;  3SJG A;  1YVK A;  1FT7 A;  3RBU A;  4KS9 A;  2NSM A;  3SJF A;  1YVO A;  2FXF A;  2C27 A;  3FEC A;  3NA6 A;  2EK8 A;  1CPX A;  2HC9 A;  3I1U A;  3KKW A;  4FBE A;  3B8G A;  4P4B A;  3B3W A;  1CX8 A;  3QNV A;  4KLV A;  2VZY A;  4OC1 A;  4CRY B;  2NYQ A;  4OME A;  5EC4 A;  2B3U A;  3IU2 A;  4XNH B;  3CZX A;  1UFH A;  3SI1 A;  3FXT A;  2ARH A;  4LX9 A;  1VIX A;  2PR8 A;  2FSR A;  1LFW A;  1B6B A;  2NMT A;  2Q04 A;  3DNS A;  4A94 A;  5C88 A;  3I9S A;  1PYT B;  2FE7 A;  4PPZ A;  1TF9 A;  1XFO A;  5DWN A;  2GE3 A;  4PXD A;  3IO1 A;  4CRZ B;  3VH9 A;  4E0A A;  3F0A A;  3EY5 A;  4P4E A;  4RN7 A;  4F0X A;  4MFL A;  2V8V A;  3FYN A;  1QQ9 A;  4PV6 A;  1LRZ A;  4C2X A;  1YME A;  4OP4 A;  4WWV A;  2J8M A;  3QAH A;  4P10 A;  2PE3 A;  5CPA A;  3PB8 X;  5LYD A;  3DDD A;  2J9A A;  1S60 A;  3H8G A;  4H2K A;  4LQ6 A;  4OC4 A;  4E2A A;  5D29 A;  3MN8 A;  3PP9 A;  4L89 A;  2EK9 A;  3R9F A;  4KVM E;  5EBV A;  4P4J A;  3RNZ A;  2PVV A;  3IFE A;  1KUV A;  4JZ0 A;  1IGB A;  2C6G A;  1TF8 A;  2Z3M A;  2Q7B A;  4P4F A;  4Q36 A;  2QML A;  5ISV A;  2P6F A;  4NXY A;  3IU1 A;  4Y49 B;  4FD4 A;  2O4H A;  3KQZ A;  4EME A;  2I79 A;  4KOY A;  4I49 A;  5D8N A;  1IIC A;  4P44 A;  1Z8W A;  2PJ1 A;  1LCP A;  4P45 A;  4CAF A;  1GHE A;  1KUY A;  4X8I A;  1Z9U A;  4F0Y A;  2VI7 A;  1QSM A;  4R9M A;  4A30 A;  4AVC A;  1Y9K A;  2BUE A;  3CT9 A;  2PR1 A;  2HUZ A;  4A37 A;  1Q7L A;  5K8M A;  2AFW A;  2ZOG A;  1AYE A;  4WJB A;  4Q38 A;  1AMP A;  4IUS A;  4KUB A;  1N71 A;  2AFX A;  4U9Y A;  3B3T A;  3W6S A;  2C6C A;  5AG6 A;  1TIQ A;  3KGQ A;  3LMS A;  4MHY A;  5A28 A;  2F7V A;  2FCK A;  3IJ3 A;  1ELL P;  4NGN A;  3B3V A;  2POK A;  4MMO A;  2J8N A;  1Z8T A;  3FJU A;  5H86 A;  3SJX A;  4OKO A;  2AFS A;  3CXQ A;  4HNX B;  5IX3 A;  1XJO A;  3BJ7 A;  6CPA A;  4MCR A;  2FVG A;  1Q2C A;  1Y0R A;  2PJ0 A;  4MBU A;  5GCN A;  3GB0 A;  4K3N A;  4R6T A;  2P6G A;  2CNS A;  4R7M A;  4H6Z A;  1NMT A;  1CPS A;  2PJA A;  2XEI A;  2Z3N A;  3PEI A;  1VGY A;  4KUA A;  4C2Y A;  2G3T A;  4FD6 A;  4YRH A;  2ZW5 A;  1XIX A;  4DNC A;  4RUH A;  1XMB A;  2FT0 A;  1Z5R A;  1V0C A;  2IMO A;  1YX0 A;  4II9 A;  3BJ8 A;  3T90 A;  4A38 A;  2YNE A;  1GYT A;  2B5G B;  2IJZ A;  4ZY1 A;  1PCA A;  2PJ2 A;  2X7B A;  3D8P A;  1M1D A;  3QB8 A;  1OZP A;  4NGS A;  5ELY A;  2IQ6 A;  4R57 A;  3KHZ A;  3PGP A;  1YLO A;  2KCW A;  3KQX A;  4KSF A;  3KR5 A;  3TO9 A;  2BEI A;  1R57 A;  2PJ3 A;  4CAW A;  2Q0Y A;  4CYP A;  2JBJ A;  3LOD A;  3S6F A;  2QYV A;  2ZEH A;  1IOF A;  1IB1 E;  1MJA A;  2B3V A;  2ZEF A;  4KOU A;  3N7Z A;  4F6A A;  1YW4 A;  1XRY A;  5K8O A;  1Y7R A;  3D7F A;  1PUA A;  2Q4Z A;  4B13 A;  3GUX A;  4R76 A;  5DWM A;  3D7G A;  1R3N A;  2GRE A;  1BOB A;  2XEF A;  3KHX A;  2VL1 A;  1CM0 A;  4B11 A;  4UWJ A;  1B87 A;  2YNC A;  4AG9 A;  1F2O A;  1JQG A;  3D68 A;  2DEA A;  3BI1 A;  5G1Z A;  4QUS A;  1VKC A;  1F57 A;  3GY9 A;  4O23 A;  3D7D A;  4P4D A;  4CPA A;  5LYL A;  4KSA A;  3TX8 A;  1ZG7 A;  2QIR A;  4B5P B;  5LYI A;  3B2Y A;  3TTH A;  1P4N A;  4P4I A;  4ZGY B;  3BI0 A;  2R8V A;  4CAX A;  2P6E A;  3KZW A;  7CPA A;  4UEZ A;  8CPA A;  5I0C A;  1IY7 A;  4CAE A;  4MCS A;  4OID A;  4CGN A;  5JM6 A;  4LQG A;  2JDC A;  1KUX A;  2V8H A;  3R96 A;  2B4D B;  3FNC A;  2RB7 A;  3H8F A;  2WZN A;  2Z3O A;  3HLP A;  1R43 A;  3PRT A;  1IU8 A;  5I4M A;  3FMC A;  2FIW A;  2ZW7 A;  1BPN A;  3W6X A;  3S9N A;  3IWE A;  1M4I A;  4M85 A;  5IB0 A;  2Q51 A;  3KL9 A;  1FY7 A;  2AE6 A;  4MRI A;  3EXN A;  1TKJ A;  3R1K A;  4CS0 B;  4MFJ A;  3RZA A;  4KVO E;  3P2H A;  3ISX A;  4F8Z A;  5CBM A;  5KTC A;  2PRB A;  3PFE A;  1QSO A;  1Z8X A;  2QEC A;  4F9V A;  2ANP A;  3WT4 A;  4M6H A;  3BLN A;  4JD6 A;  3DR6 A;  1ZO0 A;  1M4G A;  4NJR A;  4GS4 A;  4UCM A;  3FIX A;  1L0C A;  2BOA A;  3PBE A;  4PK2 A;  3VWD A;  1HDQ A;  2ZEL A;  5F47 A;  5G21 A;  4W9Y A;  5LRJ A;  3JTK A;  3TOA A;  2B58 A;  4NSQ A;  4QC6 A;  4B10 A;  1Y0Y A;  3S6G A;  1CP7 A;  2R98 A;  5HXD A;  1ELM P;  2RC4 A;  1VHS A;  2OH1 A;  2JBK A;  1CG2 A;  1IYL A;  1KZF A;  2BCO A;  3FBU A;  3IWG A;  3LAC A;  3NE7 A;  5LYF A;  2DPS A;  5IB9 A;  4OAE A;  1Z2L A;  4CYN A;  3RAM A;  3TO7 A;  2D4P A;  3ZZI A;  4KOR A;  5JGF A;  4JYW A;  1BO4 A;  4HNW B;  3FED A;  3D7H A;  4BD9 A;  4HKF A;  1X12 A;  1YW6 A;  1Z4E A;  1YGH A;  2AFM A;  2ZED A;  3NH8 A;  3P2F A;  3R9E A;  3D66 A;  2DF5 A;  4BMH A;  3SJE A;  2PC1 A;  4OLL A;  2OOT A;  2PJ8 A;  1XE4 A;  1IOI A;  3NH5 A;  3TO6 A;  1QMU A;  4ONW A;  4U5Y A;  3T8W A;  3MGD A;  4LUA A;  2WYR A;  2ZEG A;  4MHD A;  4CYO A;  3CPX A;  3VAR A;  3DR8 A;  4CAV A;  3R9G A;  2PJB A;  2PJ4 A;  2OB0 A;  4TWE A;  2P0W A;  3D3S A;  3NH4 A;  4A33 A;  5F09 A;  1VHE A;  3SI0 A;  4KOW A;  1Q2Y A;  2Q43 A;  2XEG A;  4DYO A;  2Q4Y A;  1Z8L A;  2EBJ A;  4H89 A;  2B4B A;  1MJB A;  4PXC A;  1QSN A;  4EWT A;  1RO5 A;  3D4U A;  3TT2 A;  5AG4 A;  4GXH A;  4OC2 A;  4EVY A;  4RI1 A;  2I00 A;  4JWP A;  1ZLH A;  2CXA A;  1Y7E A;  3T9Y A;  2RFH A;  3BXM A;  3JRU A;  3B3S A;  5LRK A;  3EO4 A;  2AFU A;  2YNC C;  3IWW A;  1BLL E;  4UIB A;  4DUK A;  1JWQ A;  2CTC A;  1S7N A;  2K5T A;  4UWI A;  2HB6 A;  1TKH A;  4NGR A;  4MHP A;  2VZZ A;  2B5G A;  4A2Z A;  2WPX A;  2BSW A;  4M3S A;  1S7F A;  2IL4 A;  1HEE A;  3K9U A;  1F2P A;  4AG7 A;  5HVH A;  5H84 A;  3WC7 A;  2ZEN A;  3EC4 A;  3IEH A;  4UA3 A;  5G22 A;  1M4D A;  4FAI A;  5AG7 A;  3CPA A;  2Q4V A;  3QAY A;  2I3C A;  2QJ8 A;  5IV0 A;  4Q7A A;  5J8C A;  1J4J A;  3SXO A;  5JPH A;  4YGO A;  5JH9 A;  3R95 A;  4A95 A;  3G8W A;  2VQY A;  3PZJ A;  1ON0 A;  5J1Q A;  2PJ9 A;  4FWU A;  3BHX A;  4UFW A;  5K8P A;  2FIA A;  4B5O A;  5KTD A;  2O53 A;  1RTQ A;  1TKF A;  4KOT A;  2JEW A;  5HVF A;  4ZY2 A;  4XPD C;  4Z65 A;  2CY2 A;  4UIA A;  4X3R A;  1IID A;  4R8F A;  1CJW A;  4U9Z A;  4UF4 A;  2CNM A;  2WPW A;  4CGP A;  2GAN A;  2PRQ A;  1DE4 C;  2ZOF A;  4X5K A;  4MHZ A;  2OZU A;  2DPT A;  5C82 A;  1I21 A;  2BL1 A;  2G3A A;  3SHP A;  2Z3K A;  4MY3 A;  4JXQ A;  4C7I A;  1S7K A;  2PIZ A;  2G0B A;  4B5P A;  2Q7S A;  3FEE A;  4JXR A;  4R3K A;  4E8O A;  1CP6 A;  2OZG A;  1YLE A;  4ZY0 A;  4MHN A;  4A31 A;  4IK2 A;  3PFO A;  2PCU A;  3D67 A;  3FRM A;  4NF1 A;  5F46 A;  2Y0M A;  2CIJ A;  4ZYQ A;  1ZG8 A;  4UCN A;  4CYQ A;  4P6Y A;  2EWB A;  2Z10 A;  4QBJ A;  3RO0 A;  5HVG A;  3CXS A;  5J8F A;  4QVT A;  2AFZ A;  2ZEM A;  3S9M A;  1WK4 A;  1BAV A;  1X10 A;  3B3C A;  1Y9W A;  3D2M A;  4AXV A;  1H8L A;  4PSX A;  3GLJ A;  3ISZ A;  3K2K A;  4MFZ A;  3CXP A;  2BO9 A;  4K30 A;  4KLW A;  5HMN A;  4M6G A;  2V8D A;  1YK3 A;  3A9L A;  3EFA A;  3F8K A;  3ZJ0 A;  5BWA B;  2WSA A;  2WUU A;  3K9T A;  5LRG A;  4ORF A;  1S5K A;  1XMT A;  3WR7 A;  2PJ6 A;  1HDU A;  4OC3 A;  3KI9 A;  2PSW A; 
#chains in the Genus database with same CATH homology
 4NEX A;  5CNP A;  3TCV A;  2EUI A;  4C2Z A;  1U6M A;  2ZPA A;  3GYA A;  4FD5 A;  4RS2 A;  2VBQ A;  4H6U A;  4KVX A;  2H5M A;  3V8I A;  4KZT A;  2REF A;  3UY5 A;  2PDO A;  5F49 A;  1XF8 A;  3LD2 A;  2ZXV A;  1YRE A;  2O28 A;  3VWE A;  4XPD B;  3W91 A;  1Q2D A;  2R1I A;  1YR0 A;  4C68 A;  2YND A;  2VEZ A;  3GKR A;  1MJ9 A;  1RXT A;  4C7H A;  2VXK A;  4IF5 A;  3C26 A;  4AB7 A;  2YGW A;  3JUW A;  1SQH A;  4B14 A;  2J8R A;  5E96 A;  4R3L A;  4OAD A;  4L8A A;  3G3S A;  2ATR A;  2FL4 A;  5AGE A;  4JJX A;  2D4O A;  5A27 A;  2OZH A;  3SXN A;  4CGL A;  1IYK A;  3IGR A;  4ZBG A;  4AVA A;  4R87 A;  4PK3 A;  4PSW A;  5JQ4 A;  2F5I A;  4B12 A;  2DXQ A;  3JVN A;  5FVJ A;  2JLM A;  1K4J A;  4KOX A;  3TFY A;  2ZW4 A;  2Q44 A;  4BBH A;  2CNT A;  2FS5 A;  2JDD A;  4NCZ A;  4KOV A;  4YFJ A;  4MFK A;  3S6K A;  4HNY B;  2Z11 A;  4QB9 A;  2Z3P A;  5G20 A;  3E0K A;  4MY0 A;  1XEB A;  3RYO A;  3H4Q A;  3TOB A;  2HV2 A;  3S6H A;  1QSR A;  1WWZ A;  4XNH C;  4MFQ A;  4FD7 A;  3F5B A;  2HQY A;  1S7L A;  4MFP A;  4MJ8 A;  1PU9 A;  2REE A;  3OWC A;  4AVB A;  4XPK A;  4CGM A;  2GIV A;  2JEV A;  3DSB A;  1I1D A;  4XPL A;  4UCP A;  2EVN A;  1M44 A;  3D2P A;  4CGO A;  4J3G A;  1QST A;  5HH1 A;  4MI4 A;  2R7H A;  2OU2 A;  3FB3 A;  4ONU A;  3I3G A;  4UBR A;  4JLY A;  1P0H A;  4UFX A;  1S3Z A;  4UFV A;  1I12 A;  4A32 A;  5KTA A;  5F48 A;  3TE4 A;  1NE9 A;  1Z4R A;  1NSL A;  2Z0Z A;  2Z3L A;  2AJ6 A;  2PQ8 A;  5AG5 A;  4Y49 C;  2A4N A;  2B4D A;  1MK4 A;  3H5Z A;  2ZW6 A;  4KOS A;  1YVK A;  4KS9 A;  1YVO A;  2FXF A;  2C27 A;  3KKW A;  3B8G A;  4KLV A;  2VZY A;  4CRY B;  5EC4 A;  2B3U A;  3IU2 A;  4XNH B;  1UFH A;  3FXT A;  2ARH A;  4LX9 A;  2PR8 A;  2FSR A;  2NMT A;  1B6B A;  2Q04 A;  3DNS A;  5C88 A;  3I9S A;  2FE7 A;  5DWN A;  2GE3 A;  4CRZ B;  4E0A A;  3F0A A;  3EY5 A;  4F0X A;  4MFL A;  3FYN A;  4PV6 A;  1LRZ A;  4C2X A;  2J8M A;  3QAH A;  3DDD A;  1S60 A;  4E2A A;  3PP9 A;  4L89 A;  3R9F A;  4KVM E;  5EBV A;  1KUV A;  2Z3M A;  2Q7B A;  4Q36 A;  2QML A;  5ISV A;  2P6F A;  4NXY A;  3IU1 A;  4Y49 B;  4FD4 A;  2I79 A;  4KOY A;  4I49 A;  1IIC A;  4CAF A;  1GHE A;  1KUY A;  1Z9U A;  4F0Y A;  2VI7 A;  1QSM A;  4R9M A;  4A30 A;  4AVC A;  1Y9K A;  2BUE A;  2PR1 A;  2HUZ A;  4Q38 A;  4IUS A;  4KUB A;  1N71 A;  4U9Y A;  3W6S A;  5AG6 A;  1TIQ A;  5A28 A;  2FCK A;  2J8N A;  5H86 A;  4HNX B;  3CXQ A;  5IX3 A;  3BJ7 A;  1Q2C A;  4MBU A;  5GCN A;  2P6G A;  2CNS A;  4H6Z A;  1NMT A;  2Z3N A;  4C2Y A;  4KUA A;  2G3T A;  4FD6 A;  4YRH A;  2ZW5 A;  1XIX A;  4DNC A;  2FT0 A;  1V0C A;  1YX0 A;  4II9 A;  3BJ8 A;  3T90 A;  2YNE A;  2B5G B;  2X7B A;  3QB8 A;  3D8P A;  1M1D A;  1OZP A;  4R57 A;  3PGP A;  2KCW A;  4KSF A;  3TO9 A;  2BEI A;  1R57 A;  4CAW A;  2Q0Y A;  4CYP A;  3LOD A;  3S6F A;  1IB1 E;  1MJA A;  2B3V A;  4KOU A;  3N7Z A;  4F6A A;  1Y7R A;  1PUA A;  4B13 A;  5DWM A;  1BOB A;  1CM0 A;  4B11 A;  4UWJ A;  1B87 A;  2YNC A;  4AG9 A;  5G1Z A;  4QUS A;  1VKC A;  3GY9 A;  4KSA A;  2QIR A;  4B5P B;  3TTH A;  1P4N A;  4ZGY B;  4CAX A;  2R8V A;  2P6E A;  5I0C A;  4CAE A;  4CGN A;  2JDC A;  1KUX A;  3R96 A;  2B4D B;  3FNC A;  2Z3O A;  2FIW A;  2ZW7 A;  3W6X A;  3IWE A;  1M4I A;  4M85 A;  5IB0 A;  1FY7 A;  2AE6 A;  3EXN A;  3R1K A;  4CS0 B;  4MFJ A;  4KVO E;  3P2H A;  5KTC A;  2PRB A;  1QSO A;  2QEC A;  3BLN A;  4JD6 A;  3DR6 A;  1ZO0 A;  1M4G A;  4GS4 A;  4UCM A;  3FIX A;  1L0C A;  4PK2 A;  3VWD A;  5F47 A;  5G21 A;  3TOA A;  3JTK A;  2B58 A;  4NSQ A;  4QC6 A;  4B10 A;  3S6G A;  2R98 A;  2RC4 A;  1VHS A;  2OH1 A;  1IYL A;  1KZF A;  3IWG A;  3FBU A;  3NE7 A;  2DPS A;  4OAE A;  4CYN A;  3TO7 A;  2D4P A;  3ZZI A;  4KOR A;  1BO4 A;  4HNW B;  4HKF A;  1Z4E A;  1YGH A;  3P2F A;  3R9E A;  4BMH A;  2PC1 A;  4OLL A;  3TO6 A;  1XE4 A;  4U5Y A;  3MGD A;  4LUA A;  4MHD A;  4CYO A;  3DR8 A;  4CAV A;  3R9G A;  2OB0 A;  2P0W A;  3D3S A;  4A33 A;  4KOW A;  1Q2Y A;  2Q4Y A;  4H89 A;  2B4B A;  1MJB A;  1QSN A;  1RO5 A;  3TT2 A;  5AG4 A;  4EVY A;  4RI1 A;  2I00 A;  4JWP A;  2CXA A;  3T9Y A;  3EO4 A;  2YNC C;  1S7N A;  2K5T A;  4UWI A;  2VZZ A;  2B5G A;  4A2Z A;  2WPX A;  2BSW A;  4M3S A;  1S7F A;  2IL4 A;  3K9U A;  4AG7 A;  5H84 A;  3EC4 A;  4UA3 A;  5G22 A;  1M4D A;  5AG7 A;  2Q4V A;  5IV0 A;  5J8C A;  1J4J A;  3SXO A;  5JPH A;  4YGO A;  3R95 A;  4A95 A;  3G8W A;  2VQY A;  3PZJ A;  1ON0 A;  4UFW A;  2FIA A;  4B5O A;  5KTD A;  4KOT A;  4XPD C;  2CY2 A;  1IID A;  4U9Z A;  1CJW A;  2CNM A;  2WPW A;  4CGP A;  2GAN A;  4X5K A;  2OZU A;  2DPT A;  5C82 A;  1I21 A;  2BL1 A;  2G3A A;  3SHP A;  2Z3K A;  4MY3 A;  4JXQ A;  4C7I A;  1S7K A;  2G0B A;  4B5P A;  4JXR A;  4R3K A;  4E8O A;  2OZG A;  1YLE A;  4A31 A;  5F46 A;  4NF1 A;  3FRM A;  2Y0M A;  4UCN A;  4CYQ A;  2Z10 A;  4QBJ A;  5J8F A;  3CXS A;  4QVT A;  1WK4 A;  3D2M A;  1Y9W A;  4PSX A;  4MFZ A;  3CXP A;  4K30 A;  4KLW A;  5HMN A;  1YK3 A;  3A9L A;  3EFA A;  3F8K A;  3ZJ0 A;  5BWA B;  2WSA A;  2WUU A;  4ORF A;  1S5K A;  1XMT A;  3WR7 A;  2PSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...