4B6ZA

Crystal structure of metallo-carboxypeptidase from burkholderia cenocepacia
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
382
structure length
380
Chain Sequence
TLSITSNFDAGAIDVVSCDSPDAIRLRVRGDNRSEFAQWFYYRLTGARGERCVMTFENAAECAYPSGWRNYSAVASYDRVDWFRVPTTFDGKTMTIDHTPEFDSIYYAYFEPYSEERHAAFLGAVQQLPQASVVELGRTVEGRPMSLLTLGTPETAPKKKVWIIARQHPGESMAEWFVEGLVKRLAGWGDWAGDPVARKLYDRVTFHIVPNMNPDGSVHGNLRTNAAGANLNREWMAPDAERSPEVLAVRDAIHAIGCDMFFDIHGDEDLPYVFVAGSEMLPSFTEQQGKEQTAFIEAFKVASPDFQTEHGYAASKYKEDALKLASKYIGHQFGCLSLTLEMPFKDNANLPDERVGWNGERSAALGAAMLAAILVHVDTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title High-Resolution Structure of the M14-Type Cytosolic Carboxypeptidase from Burkholderia Cenocepacia Refined Exploiting Pdb_Redo Strategies.
pubmed doi rcsb
source organism Burkholderia cenocepacia
molecule tags Hydrolase
molecule keywords FAMILY M14 UNASSIGNED PEPTIDASE
total genus 140
structure length 380
sequence length 382
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
A PF18027 Pepdidase_M14_N Cytosolic carboxypeptidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3120 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4b6zA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4b6zA02
2HB6A 3LMSA 1BPNA 4NGSA 1GYTA 3PBBA 4UEEA 4IAVA 1CPSA 2OR4A 2V8DA 3VARA 4OC5A 5JGFA 4UEFA 4DYOA 2PJ8A 3SJXA 2ZEPA 4DUKA 2C6PA 3KQZA 4PXBA 3S9MA 1CP7A 4PXDA 2O4HA 6CPAA 3CDXA 1OBRA 2F8HA 1NSAA 4WWVA 2PJ7A 2PJAA 4F8ZA 3L2NA 4AXVA 3PFEA 2V77A 1BAVA 2PE3A 4P4DA 3I1UA 2ZEOA 1EE3P 3VH9A 3GB0A 3PB7X 1R43A 4TWEA 2XEGA 4R6TA 4MCRA 2ANPA 2PJ6A 2QYVA 1LAMA 3D7DA 2JEWA 2PJBA 3MRUA 4P45A 2V8GA 3SJEA 1QQ9A 4FBEA 1RTQA 2ZEHA 4A94A 2F7VA 3H8FA 1XMBA 4NJQA 3IEHA 3KR4A 3TC8A 2RB7A 4UIBA 4FWUA 2C6CA 1TKJA 1M4LA 3WT4A 4P44A 1IY7A 3KZWA 2PVWA 4MMOA 3B3TA 5K8OA 1R3NA 4MCQA 2PJ0A 3GLJA 4OIDA 4NFRA 1DE4C 3KR5A 4BD9A 4A38A 2RFHA 5JM6A 1ZG7A 4OC4A 5I4MA 4UF4A 3FF3A 2CTBA 1HEEA 3ISZA 4F9UA 2AFZA 2HC9A 5LYDA 2EK9A 1Z5RA 2IMOA 4P4FA 4W9YA 1BPMA 3D7FA 2ZOGA 3IIBA 7CPAA 1H8LA 3GUXA 1CPXA 2AFXA 3D68A 4P4JA 4A37A 2VL1A 3SI2A 1PCAA 3PRTA 4NGTA 3MN8A 2OOTA 2PJ2A 5ELYA 1TF9A 2G9DA 4A39A 8CPAA 3BI1A 1LOKA 1VIXA 3TX8A 5D29A 1YLOA 2AFUA 2J9AA 2ZEEA 2PJ3A 4GM5A 2PVVA 4X3RA 3SJFA 1TXRA 2WYRA 4ZX9A 3KGQA 2Q4ZA 3FX6A 4NGPA 2PJ9A 3QNVA 1IGBA 5IB9A 3D4UA 4PXEA 5J1QA 5F09A 3FECA 1VHEA 1VGYA 3WC7A 3PEIA 4MHPA 2GLJA 1ARLA 4ZY2A 1YMEA 2ZEDA 1XFOA 3K9TA 5LYFA 2ZENA 3CT9A 5D8NA 4ZY0A 1CX8A 3B3SA 3RZAA 3IC1A 1LCPA 3NH5A 4MHZA 2C6GA 3DLJA 4FAIA 4NGMA 4P10A 3B35A 4PQAA 1XRYA 3LWUA 2GLFA 4IK2A 1CBXA 2EWBA 3SJGA 3FJUA 1XBUA 3PB9X 1Q7LA 2AFWA 2FVGA 2AFMA 1UWYA 2PIYA 3SI1A 5HXDA 1Y0YA 2ZEMA 3NFZA 3KI9A 4FUUA 4MXUA 4UIAA 3KHXA 3D7HA 1CG2A 4ZI6A 4OMEA 1LFWA 3B7IA 5LYLA 3N5FA 2XEIA 1ELMP 3WC5A 1QMUA 2C1CA 2EK8A 4OKOA 3H8EA 3BXMA 4B6ZA 4NGRA 5JH9A 4DJLA 3KL9A 3PFOA 2AFOA 1ELLP 1ARMA 3PB4X 1YSJA 3FEEA 4R8FA 3B3WA 1TF8A 4OC3A 2PJ5A 4Q7AA 3JRUA 3PBEA 4OC2A 4MHNA 3PB6X 4R76A 1Z8LA 4Z65A 4NJRA 3D66A 4MHYA 3S9NA 5LRGA 2I3CA 1Z2LA 4P4EA 5DS0A 4P4IA 3KQXA 1DTDA 4ONWA 1FT7A 2BO9A 4OC1A 4EMEA 2JBKA 2XEFA 3WABA 2O53A 4G1PA 1F2OA 1CP6A 2PJCA 4MCPA 3SI0A 1HDQA 2ABZA 4K3NA 3D7GA 4ZY1A 4YU9A 1ZLIA 2WZNA 5HVGA 3FEDA 3IFEA 5K8MA 1TKFA 4EFDA 5K8PA 3D67A 2V8HA 3BI0A 4LQGA 3B3VA 3NH8A 3VATA 3NA6A 1FNOA 4MRIA 4H2KA 4CPAA 4ZYQA 4UEZA 2PIZA 2AFSA 1AYEA 4RUHA 1HDUA 2ZEGA 3KASA 5THWA 1JQGA 1KWMA 2CF4A 2BCOA 3CPAA 3IWWA 3H8GA 3FH4A 2BOAA 2XEJA 2GREA 1XJOA 1LAPA 4P6YA 5K8NA 1F57A 4NGNA 1AMPA 4JYWA 2NSMA 2PJ4A 3HUVA 5CPAA 5LYIA 5LRJA 2IJZA 1YW4A 4IHMA 5HVFA 4X2TA 2QVPA 3HLPA 4PPZA 3B3CA 3WC6A 1YW6A 2V8VA 3RBUA 1ZLHA 1LANA 1ZG9A 3PB8X 1TKHA 3IJ3A 3FMCA 2ZOFA 3V38A 2ZEFA 3CPXA 4ZX8A 1F2PA 2DEAA 1Y0RA 3FVLA 4P4BA 4YWYA 2Q51A 3V7ZA 3DGVA 2Q43A 1ZG8A 4O23A 4OIWA 4OC0A 3B2YA 4R7MA 4MCSA 2IQ6A 4WJBA 5HVHA 2POKA 4OP4A 2PRQA 3KHZA 2NYQA 2GU2A 4KSIA 1PYTB 4PXCA 3BHXA 2PCUA 3T8WA 2ZELA 3RAMA 1BLLE 5LRKA 4X8IA 4NGQA 4TNUA 3NH4A 4EWTA 1VHOA 2PJ1A 1Y7EA 2JBJA 4JZ0A 2CIJA 4F9VA 3S9LA 3IO1A 2CTCA 3ISXA 5CBMA 3K2KA 2QJ8A
chains in the Genus database with same CATH superfamily
3CMGA 2F9BT 4PI0A 3DSFH 4LPCA 4PI2A 4NGSA 4R5VA 1NINA 5IT2L 43CAA 3EDEA 1BGXL 3FO0H 5IROC 3II1A 2WXGA 3VE0B 4K3JL 3RL2A 4HOWA 1JZ7A 5I8OH 4UEEA 1UWEH 3M8OL 4M8QA 1UASA 2KPNA 1HL4A 2XQBL 3D0VB 3NG5A 1UGKA 4ZUTA 3V4PA 3HI5L 3P2TA 2OSYA 3EXJA 4F33A 1U93B 1EZSA 5CBEB 4A67A 1ZV9A 2PJ8A 2D03L 1UKSA 2APBA 3UTPE 3O6LL 5K9OB 5EU6B 4MHDA 2ZE0A 4OZIE 3C60B 4U4IA 3HNSH 4RBPH 1OBRA 1LWHA 3EF7A 3O3EA 4Y1AE 3CBJB 2R27A 4MD0A 2PJ7A 2GKIA 4HJSA 3WLBA 3ARZA 1LILA 5J9PA 4ODUB 4XVUD 3SN6N 3B9AA 1JRHI 3MACH 1P4IL 5FYKL 1SXCA 3HLAA 2XTJE 1OGSA 2Q8AL 2FJHA 3ULSA 3MUGB 1AQKH 5G22A 1JPFA 4WK2B 2X4RA 3GB0A 1Q1JL 4TQ8A 4F7CB 2X4PB 2VDLH 2VW4A 4HKBB 5L9DL 3RVUD 4KTGA 3TFKD 2ZOOA 1ZLSH 1VFAA 4KXBA 4RIRB 2ANPA 3MLWL 3ME0A 5HHMD 2VDML 3BVXA 4PGBA 5IMLA 4JDZA 2P8MA 5C6TH 1MSPA 5DUBB 4FE9A 5AB0A 4TLTA 1CDBA 3GSWA 4GI6A 3VGDA 2G9HB 3HFML 2NMSA 3DDGA 3QPXL 2XKNB 5T1MA 2FNWA 2VLRB 2QMJA 5DJ6B 4LSPH 5D7JA 4ZK8A 3U79A 2A74B 4JUSA 2DKMA 4G3YH 3GHEL 4MSWA 3IDJB 3ARWA 3SKJH 3DTXB 2CNZA 2BSDA 1INEL 1DHKA 3D2UD 2VSKB 2FTAA 3IEHA 3QPQD 4HIIA 2AJUL 3GUTB 2RB7A 4U2ZA 4NZUL 3QDME 3PJNA 4UIBA 4K8RL 2PWFA 3B43A 1GZPB 5JZ7C 1WGVA 2N59A 4L8DB 2B2XL 3GSVA 4L1BA 5CIPH 4URKA 1RQ5A 1NDTA 2NW3A 5AAPA 3QDHA 3ROLA 2CO6A 1BFVL 2ZXGA 3ZTNL 4N8VA 1ETJA 3ULUF 1NC4A 5BS0A 2C3GA 4JM2B 5EPMB 4H8WH 4DWHA 1WWWX 2F8IA 3LNIA 3Q13A 1OCRB 4YIQA 4DTGH 4N2CA 5JYLA 1PZSA 3ZKSD 2WXNA 3B2MA 1INDH 2V0AA 5DJYA 4HZ1A 2AHIA 3TBVB 5FGBA 1DQLH 4ONGL 2JXMB 3MYJA 4CGNA 3D39E 4DN4H 4KQ4H 4PN6A 4HU8A 1MNUL 4FQCL 5LN8A 1Q9KB 5JR1H 1HX0A 4UOQA 2OCCB 5I4MA 1E5BA 4NZFA 1MWAH 2NZ1A 1EHKB 1MCWW 5JPMA 5GGQH 2WIIA 1T21B 3WG7B 2CTBA 3HI6L 1YRKA 4X7DC 4P4KD 4XXWA 3H55A 2Z3NA 4E9QA 2ZXEB 4IBYA 2WVVA 2WNGA 4YLBA 1LEGA 4E2AA 2OA9A 3JV6B 5E5MB 1Z5RA 3N44F 3WFEH 2BY1A 3Q9PA 5I76B 2FBRA 4N8UA 1YMHB 5IOPB 3INOA 5B39B 1BVLB 1IMHC 3RTLA 1OGPA 4L9LC 1CGSH 1SVZA 3IIBA 4F7EB 2GJPA 4X4ME 2EIZB 4CW1A 1L3WA 1A4KA 4UIMA 1J0JA 3CFIC 4ZMZA 4PMFA 4CVUA 3U0TB 1J9CT 5E4EB 5B8CA 1II4E 5HDOA 4JPSA 4ENEC 3F7YA 3ETSA 3RP1A 3FHQA 4KKBD 3U6RB 1FFQA 3AWFA 3D08A 5DC4B 1OAKH 4QRFA 1T83C 3BDYL 1NFAA 5H94B 2OMXA 3WL9A 4LPYA 4HLZH 5I9QB 1EGJA 1YAIA 3CLFH 3QP3A 2BIOA 5I23A 2MKLC 5KYNA 1QP1A 3GRGA 2GB2A 2Z31A 4ZODA 5DYOB 5D1XA 2W59A 1TKWB 1W8OA 3NIDB 1UEYA 3OBAA 4QRRB 1JZ3A 2J9AA 1YEJL 4WU7B 4Z7WA 4AJYV 5C0JB 5JR1L 1HSBB 3PREA 3G6DL 3N44B 4I13B 2F53B 5CLYA 1TXRA 3KGQA 3CVBA 1D5IL 3ZXAC 2CXGA 1RZ8B 4A55A 2Q3AA 2Z4QA 3G5ZA 4QHMA 4LDOB 3VRLE 3F04A 2OS7A 3GMOA 3M17A 5ALBH 3CVHB 3MRCB 3RBSA 5FAAA 4PXEA 5J1QA 4BKLA 4AYMC 1W72H 2YAHA 3WFCH 2B4DB 4JY6A 1FO0H 3QB8A 1ZTXH 2C9QA 1E42A 1LE5B 4P2AA 3MRJA 5JDSA 3CFCL 3WFEL 1L7TH 4DAGL 2QSCL 1WK0A 2IPKA 1RZGB 1IKFL 1XHHA 2OAAA 3WTXA 2D7NA 3MV7E 5C9JA 3CZEA 4H26A 4AT6A 2X4QA 4CDHA 4PIBA 3FT3A 3R8BB 4EI6B 4B9GA 4RSVA 1Z8WA 4KV5F 4R7DA 3LEYH 3B35A 2AJZB 2DQUL 4APXB 2IO5A 5D9SB 3TURA 4LVNB 3S96A 3SDXF 1YEHL 2OMVB 4OH2A 3BVTA 3AT8A 4XOCA 3GXPA 3FQWB 1EFQA 4ISVA 3VTMA 2QKIB 1SJXA 3N1QC 1F11A 2KLSA 3NFPB 2FHCA 1G9HA 1Y1UA 4OQTH 1VKXA 3A0OA 2XN0A 1ZHKB 1WCQA 4NO2A 4L8CB 1MFEH 5CSGA 1IYLA 3MV8E 4UU9B 1GW6A 2FWLB 2AFMA 5I26A 4YGVA 5D1ZB 5E94B 3PE9A 1S7WA 1KGWA 2WQRA 1TJGL 3N9GH 3L1GA 1SQMA 2EEXA 3IETA 4GXUN 3ZDZF 5BQ7B 1HHJA 2H8PA 4PBVC 5E6SB 4LL4A 4KKLC 4M6OL 3NT0A 4I48B 1MW0A 1E2ZA 2Q3ZA 3WBDA 2Z35B 5DQDL 3II2A 4IJTA 2XG5B 2VMDA 3QUZC 5E4OA 5E70A 1S7TB 3CDYA 1CL7L 1M57B 1JV2A 5EIIG 1NGZA 4I4WA 4P5TD 2EVNA 1N64H 3S98A 1F45A 3TA3D 3S4SB 2N1TE 4TS6A 1FDLH 4L23A 1U3ZA 2NR6D 1FPTH 1OSEA 4DW2H 5L6YH 1QNIA 2W8CA 2P5EA 1KXVA 2BOCB 1UWEL 3M8OH 4QOKB 1NBZA 5ID1B 4U31A 3ULVH 1A6PA 5LB1A 5ILTH 2XPYA 1NCBH 3MRFB 4NKDB 4C47A 4IGBC 3B3BA 5TH2A 4QVTA 3T0EC 1IL1A 1QO3B 2P9RA 5GGUB 5JOPE 1J5OH 1EHAA 1TEGA 3LB6D 1H3VA 3F7VA 2MCMA 2WO2B 3D85A 3PLYA 4GRMB 1FFTB 4K71C 1G1CA 1GSMA 4M7ZC 3RNKA 3RVTD 4UIKL 3SJVA 1ZA3A 3UL4A 5I16B 3VFWA 2V7NA 2X89D 3QZWA 5D7JC 2Q7YA 3ZTCC 1WTLA 2W07A 1JFHA 4XN2A 4OGAC 4R84A 3QZNA 5GHWH 1MFCL 3MLXH 2K45A 3IJ8A 2ZYSA 5DHXB 4IBZA 2FE0A 1ZHBA 4JZOB 3ESVF 3TBWB 5FVJA 1EWHA 3U4BH 3VI3F 1UG9A 5KVFL 4WENB 2HJKB 4B7LA 5EORL 1DTDA 5G4OA 4Z0BL 3EYQC 5C0DA 3HPJB 4YDKL 5GXBB 3TO6A 4DUXA 1QBAA 2KL6A 2C5DC 1BQHB 2X6MA 1SDDA 3GZPA 3IDIB 3QYCA 5BS0E 4M85A 4PB0H 4D7BA 1WDAA 4KDTC 2WQWA 2ZCLH 4NQDA 2P5WD 2YKKA 3WS6A 1A7RL 1E4JA 4ZUSB 5T1KB 5L4MA 1QD0A 4MCNA 2BSSB 3RX9A 3T4AA 5KSBB 2F7QA 4B0MB 3VWDA 2H2SC 3AY4C 5JO5B 4E41A 3CZUB 3VG0L 3E6FA 5ICYA 1HOEA 4A33A 4IW4C 1MXDA 3F64A 3MRNB 2EXSA 2IMMA 2PP9A 1JZHA 2OCFD 2YAQA 4FXLA 4PS7A 4ZMLA 2RB8A 1MHHA 1CFTA 2CM5A 4MQTB 2EYRB 3KEDA 3MZTA 1RK1B 3VTTA 3I2CL 1W6WA 3KYNB 3THML 4J3UA 3M1OA 2Z0ZA 4JMNA 4KK5D 1MCSA 2OR9H 2BP8B 1HXMB 2XEJA 4Q6YA 3BWSA 3GTVA 1KJ3H 3RGBA 4JXRA 4RSYA 3W11D 1XJOA 1J1XH 5DK2B 4XPAH 1XSJA 3BO8B 1U2HA 5BPPA 3F5BA 4JYWA 2QADC 4BUHA 5CPAA 1SQHA 5LYIA 3PGFL 1TCMA 5GGSA 3KPSE 1GY2A 1NCJA 5TE4L 4J3OC 1JVLA 1MRFH 3P9LB 5JW4M 5ANMA 1FCCA 3WU1A 4TQEL 3HR6A 3DJ9A 3MBEC 2PR4L 2E56A 1YNKL 4DGVL 4K07A 2IDQA 4GI9A 1XF8A 2V33A 2VDMH 1U8NA 1JN6B 2NY6D 1J9QA 3NABL 3LXBA 4OCXH 1ZG9A 5AOJA 4OZFH 5KW9H 1TZGH 4PJHB 3KYMA 4F7TB 5I9QC 4WW2F 5JHMA 3RPKA 2SEBB 3VH8A 2KERA 4HJJH 4YXKH 2Z7WA 4KOYA 1A6UH 3TA3C 2Q6WA 3PJSB 3WXWH 4LEXL 2O6FA 2FD6L 2XTSA 3BJLA 5IFJB 2DYPB 3Q6GL 5IQNA 4WVRA 1C16B 3ROOA 1WWAX 3ZDYB 4AOFA 4Q9QH 4OFVA 1OB0A 2AEPL 2PTTB 4MCSA 3B8SA 1CICA 3F65A 3TBSB 2R9HC 4MJJA 3QCUH 4JG9A 4RNRA 5AGEA 2W5PA 3T77A 4HT1H 2Y7SA 5I74C 4XBGB 4MFZA 3STLA 1OKEA 2JH2A 3CDFA 3UTQA 4MNQE 2Z0BA 1NMBL 4XNBA 5I24A 3O3EB 2ATRA 4GFXA 5KS9F 5E8DL 1ID5I 1G9EA 1UXLA 2O5YL 1OZUA 4JM2F 2V2TA 2LU7A 5FLUA 3PDDA 1I53A 2YD9A 4F1SA 4X9BA 2Y6SD 5AKTA 1VHOA 1DSFL 2GAZA 4L5FL 2DKUA 4P2RD 2HFTA 1G1KA 2JBJA 4RGOL 4N0YL 4XTRC 3HN8A 4E36A 2MTAA 4Y16B 4OT1L 1NC2D 4MYWB 1G9NH 2WHVA 4AE1A 3WMQA 4PGBB 1G7IA 3FULA 3JQOB 3SZ6A 3FUFA 5HD8D 2R51A 4PRDB 4HXBH 2AGJH 1NICA 2P8LB 1ZPLA 2R29L 4L3CB 1PX4A 3RNQA 3CJJA 1OM3H 4JM2C 3FQUA 1MHCB 2ZWLT 4DEUA 3K74B 2J2ZB 4R3SA 3V9CA 2BSEA 4Z7NE 3ESMA 4E0AA 2AV1B 4BE6A 1AHWC 3QXVA 2V8DA 1FORH 3I9PA 1UKTA 3C75A 1WFMA 4V2BA 1USQA 3PABA 1OD9A 2MJWA 4BM7A 4ELMB 4ZXBA 3F6LA 3EJRA 3PHAA 4Z7WE 4X4YB 1XXFC 4IRZA 5DI8A 4Z7QE 2DWSA 4LLQA 4XPBH 4BSWB 2YN5A 1JJUA 3E8UL 2XV6B 5HVHB 3SE9L 1M9SA 3VI4F 2B5GA 3MGDA 5F2FA 4B9ZA 4FP8L 5MHSD 4OCNC 5LCVL 3C26A 1Y6NR 4IOIB 1LJMA 2YD6A 3O0LA 1NGQL 4GS7C 1ZWIB 4NSQA 3GSXB 3BE1H 5E9AA 3VXSD 1IQDA 1LMKA 3HZVA 1DQDH 3QG6B 5KSUA 3LQAC 4JHAH 5DJYB 5HP5A 1T66C 4JRXE 5IB5A 3MYJB 1PW3A 3D07A 4MB4A 4WI0B 4B5PA 2WBXA 2DWDA 4TUOB 4PVBA 4OGYL 5CJQH 3SO5A 2W88A 2GJ6B 3FXIC 2BUEA 4KZEH 2KH2B 4P2OB 5DJXB 4D9LL 3TV3L 3J2PA 3QDGB 2O6PA 2EIMB 1QZNA 1X7SA 1J18A 4I0PA 1U8LA 2JEWA 4HPSA 2NTSP 4G6AC 1QI4A 5AG9A 4GKSB 2OZ4A 3FUNA 3WSQL 1VFUA 1QSED 4BDVA 4EAEA 5KYUB 2YFNA 3HG5A 3L7FB 4P5RA 5FO9B 2BSCA 4OZHE 3GK8H 4JJHA 5C0BD 1ET8A 4OB5L 4WV1C 5FECA 5D4IA 2W92A 2EDWA 2CLZB 1N64L 3C12A 3TVMA 2WKOA 3O6ML 3BDBA 1QPKA 2E7CA 5HHNB 5KBDA 5FB8A 4AKQA 4FD5A 3S4SG 1ZV2A 2VUOA 5JORB 2FSEB 4XXDB 1NJ9A 2EDYA 1AP2B 2XZAH 5AZ2L 5E56A 2BRRL 2XN9D 3U6RA 1QG3A 4MCQA 4UAHA 2FLRT 3UTSE 4ZBGA 3BMVA 4S11A 1PJWA 1BWMA 2CRMA 2EEBA 4GAYA 3M6DA 4UT9L 4ENZA 3W2DL 4DTGL 2HG5B 1PBYA 6FABH 4YHNA 5CP3H 5AB2A 2XZCH 5CAYB 2ICWJ 4L1LA 4HWEL 1T7ZA 3VXNA 5T1LD 3HE6A 3KZ8A 1MJBA 4B5OA 5JM6A 4JANA 4ZSOE 1CD0A 4GKZA 4PJFA 2EZ0D 3KPSD 4B96A 4KQ0A 4OGYH 1QLRB 2EILB 2F53A 4O5LL 4YDZA 2VLKA 2HUHA 1PVHA 3QDAA 2Z4QB 4EZKA 2GCYB 2ZW7A 4LCCB 4C68A 4LSVH 1GZHC 2BIMA 1UURA 2WBWB 4JFHE 4HD9A 1S78D 1FZJB 2J1KA 2VDLL 2CIIB 4GRLB 3D34A 1A6VH 1OAYH 2C9XA 1HNGA 4F57L 3NCYP 2EDOA 1EUUA 1WVZA 1KEML 3P54A 2X4UB 2IALA 4FXKA 2PXYD 2ARJA 1RUMH 4GIPD 3SJVE 2IANE 2CNSA 1GGIL 3NEXA 4G7VH 2GC4C 4QRSB 2ZW6A 3T4YA 4P4KA 3ULUL 2R1IA 2OQJB 4WLCA 1MAML 2FIAA 3VXUA 2BOLA 3WEMA 1SEBB 1XZ0B 1U8PA 4OJYA 3S8FB 3UPRB 2D03H 3I6KA 2ZWSA 1U58A 4NRXA 4FFWD 4OLZH 4R7DB 3IRZA 1BXAA 4X6CB 5DUMH 2IGLA 5DJCA 1XEBA 4L37B 3LRLA 2NX5A 4X6DB 2ZG3A 2HRLA 1ZTMA 1JPSL 4MB1A 3X1FA 4M03A 5BMFL 2ODFA 1NCOA 3L9RA 3G8WA 4P5KB 5IK3A 2ADFL 4YX2L 2CD0A 1W6LA 3TX8A 4M3SA 2IDSA 3K9UA 4XVUC 3Q3GA 3B2UC 4UBDD 5E4AA 2UY7B 5HGDB 5D4JA 5I0VA 2ZW4A 1WO2A 4GM5A 1F58L 1EJ6A 2J21A 5DMKB 2AJXL 3EJZC 4E9VA 1CM0A 4ZTEA 3WIIL 2VDQL 1KJ2H 3TX4A 1S9WA 5CIPA 2Q4ZA 1HC1A 3QNVA 4Z7VE 4UDUA 4N2BA 4WK4B 3SPVB 4I48A 2FO1A 4OCYH 4PRIB 4R96A 1C7TA 1T89C 5IHWA 3I9GH 4PJCB 3DBSA 1S2EA 4W9FC 2KZ1B 4LLVA 3MRRA 4YOKA 5K39A 3TO2A 1HIML 3CSPA 5D93B 1WAAF 3WKPA 2ZKXA 1I3GL 4I3SL 2OYPA 5GZOA 1I9EA 1U41A 3KPOA 2XWRA 3DMMB 1DUYA 3P2HA 3VGFA 2X05A 4JQVA 3I75A 4YDNA 2C6GA 1CD9B 1XWVA 4P10A 5HI5C 4QRPA 1S5IL 5IB4A 3QUXA 1KXVC 1NIFA 1PZ5B 5AZUA 3QIBA 1S5KA 2VZZA 5EO1B 5GIRB 2PCPB 4K73A 4N6RB 2BM3A 1A6ZA 2HVBA 2VZOA 5K1NA 1MW3A 1QO3A 3RVVD 1X7TA 2PW1B 1YR0A 1E5AA 1G4RA 3BT2L 2PO6A 4PBDA 1JPSH 4FG2A 5BMFH 5C0GB 1BXXA 4H0LC 4DHLA 4F7MB 4HDIB 1D2PA 2VBQA 3JTTA 2VRQA 5HXDA 1YY9C 2W07B 2I9TB 2GK0B 4HV8A 5DJ0B 1Z9UA 3RWJA 3KH4A 2CGRL 4KO7A 3ZRFC 2Q4YA 5D1QD 1JD9A 3X12A 1J1XL 4KI5F 3OB0H 4FA6A 3TT3H 4G9DB 4BK8A 3D7HA 3NACH 3I9IA 1G9MC 4AVCA 2BW5A 4R9HA 2Q76A 5EFIB 4LSUH 1DN0B 4UCMA 2EUWA 1T22A 1RMFH 1MJAA 4UM9A 3FO2A 5E6YA 1M71A 2YD7A 4DAGH 2AQ3A 4DK5A 1GGBH 3ZBMA 1D5IH 3UBGA 3KPRE 5DS2A 1SLWA 1F0LA 2Q86B 3W11C 1JZ4A 3ARGB 2DXQA 1LHZA 4C83A 2NQDA 1CYXA 1XB6A 4LOFA 3L4UA 4LASL 3NSJA 1KYOK 1S8DA 5AL8A 3BN9C 5JHLH 3FYEB 3FEEA 3RFZB 1YUHA 3QCVL 2ZOLA 5D8JH 2A6IB 3GJEB 5CSBA 2WXQA 1TF8A 1ETZB 4ZMOA 4MA3A 1JNNH 2PJ5A 1MFBH 4HPOH 1XGPA 4P48A 1YEDB 4PGCB 2X4TB 4FNLH 4YLQT 4K55A 4FFWC 5JOFA 4P2QB 2VRKA 4UT6A 4G8AC 3ALXA 2OBGA 5TF1L 5AVSB 1OT4A 4JCMA 1S9YA 1PPIA 3RIFK 4MDRA 1BQSA 3BKCH 2NX5E 1KGUA 5GS2H 3B7RL 4GAGL 3MODH 5I18L 2Z1PA 4UM8B 4PREB 1E5YA 1E43A 1S3KH 1CD1B 3BO8A 2ZUXA 5I6KA 1JXJA 3S6GA 1U36A 1J5IA 4NO0D 3DSBA 2X28A 4OZFG 3P02A 1X7QA 2FH6A 4IRSD 4Y16D 4ZFZA 1HZHH 4XP4H 2Z93B 5I66B 4OFYD 1L9QA 1FZMA 2EDXA 1SOXA 2P47B 1ZTXL 3ZU8A 5CNPA 5JIDA 4M4RB 1RZKH 4PG9A 4EZMA 5BV7L 2YARA 3VXOA 3WDIA 5A1AA 1P6FA 2YR3A 2IJ0C 5HVGA 1XIWC 2DQFA 5C2UB 1NEUA 5K8MA 3KYMB 4F7TA 1HNYA 3F8UB 5FDWB 5C86A 4N2FA 3IFPA 2BOBB 2XQYA 1W0VB 4PJ7B 1WZLA 4K7FA 3TNMA 3VH8B 4KPHH 1AQHA 4UNIA 1E28B 4RWYL 1JXGA 3FONB 3MU3A 4YFLI 3L5HA 4NUJA 5B3SB 2NT0A 1MJUL 3MRKB 4RFEA 3UIZA 4DO5A 4NIKB 4FYTA 2X6BA 1EX0A 1MFBL 2JCCB 2BWQA 3FTGA 2AI0L 2J88H 4QHLA 5EC4A 1FPTL 5AEAA 4XR8C 1GYVA 4DW2L 5K1VA 3IJSA 3HG4A 3MRIA 1FG2B 5F0PB 4WJ5A 3S6HA 2X9YA 1JQGA 5ESQB 4O4YH 4QIRA 5D7LB 3L5WA 2BHZA 1ANUA 3W56A 4PJ5A 5DWMA 2VE6B 4ODHH 2VZUA 2IH3B 4WWKB 3DDDA 1DVYA 2H5MA 1MFDL 1AGBA 1N7ML 4TVSa 2VAJA 3G08A 3CN1A 5J0BA 2RFXB 4JPWL 1N59B 4F91B 2FIRT 3V4VL 4TTGA 4KZTA 3AU1A 3MO1A 1BBJA 5EWIL 5KUKA 1N0XH 3CFBB 3L3OB 2VIRB 5DRZA 2XI9A 2JCCF 1UB5B 2H2PC 1NKGA 2CCWA 3O6FC 2L4OA 1ZGLP 4WW2A 4KX9A 4J2XA 1J9SA 1KB3A 4WW1B 3WMPA 4D9LH 4UDTA 1QFPA 2R0LH 3A67H 3DK0A 2K5TA 2DWYA 4QXTB 4NENB 1N5YH 2X9WA 4OJAA 1KB5A 1OHZA 1T66D 2DEAA 1FDLL 1K4CA 3GINA 2IDCA 1IGTB 3TIEA 3CN4A 4R97C 1Z66A 4UQCA 3GSRA 1T03H 5SV4A 3U0WL 1B6BA 1JGIA 3LVTA 3ARTA 4AGLA 5F88B 1CZ8H 1AZZC 3FIXA 1MAMH 4YC2C 1WIOA 5M95B 4XN1A 4NYLB 2Y1AA 2PPAA 2G3TA 3C5JA 5AOMA 4XGZA 1N5AA 5JUEL 4BSWA 4EI5B 2NMTA 4P2QE 5HYSB 1Z8XA 3HNSL 4LOUD 2ZSWA 3OMAB 4Y9FA 2OSLA 4QDGA 1KLFA 2YFOA 1OCCB 2RACA 3S3DB 1UT1A 2JLPA 1LE9B 1L4IA 1QFHA 2F6AA 4RFOL 1E4WL 1BAWA 3BPCA 4ZPTA 4JFPA 3WNLA 4IF5A 5T5FL 4N2AA 1J0ZA 4XMXA 2EDMA 3WIFA 2UWEE 1N4XH 3DXAE 4NQXB 3NP4A 3VFTA 2BOAA 3H9HA 2OYLA 4HWBA 4BA8A 3D4YA 3ZT7A 1E0OB 5A16A 4L8BA 1HSAA 1SYSA 4KVNH 5ID0A 3CFJB 2YA0A 4JS7A 4JHBA 3STZA 4BQ6A 5DRXB 3C60D 3H56A 1IM3D 3JTSB 2NXZB 2HB6A 3QRGH 4K7PX 4QEGA 4QJ3B 3AXLB 2B5IB 1I7ZA 1SZNA 5EBVA 2EO8A 4AQAA 4PJIE 4PGZA 3CPLB 4NQSA 4GI8A 3ZN6A 1UZ6E 3DX7B 3SB3A 3ETBJ 1VENA 3TWCL 3LNEA 2IBGA 2ITDA 2V5YA 4FQIL 4H8UA 3H1ZA 4M3KB 4PJAE 1WIPA 4CAEA 3OKLA 5I0ZA 3S2AA 1MPAH 2CA4A 3WAJA 3PY9A 4E9XA 1FZKA 3AS2A 1KMGA 4JFOB 2EEAA 3CX2A 4KJPD 1AHMA 5B38B 3KM1A 3TASA 3CDXA 1XB8A 2CG9X 5E03A 4MY3A 4YSDA 2CMRH 2H0FA 3HC3L 3PWPB 4NXKA 1UA6H 5C0AA 1KZQA 3GIVB 3KGSA 2WK2A 3P3SA 3PQYD 4AVKA 5CLWA 4HZAA 5IW6B 4QY8A 1E8ZA 1RK0B 3EDJA 3ZL1A 2FZ3A 1S9VB 2E4FA 1CI3M 4QRBA 4OM1L 3TVMC 3MFFA 5DC0A 1IGFL 3RB5A 5ABDE 4N90D 1UZGA 3BVWA 4LOUC 1TSHA 2R1WA 5KBMA 4CGTA 3FTXA 1SNRA 4LF3A 4ZO6A 4R87A 1KCWA 4Z8FH 1OCWL 1E6OL 2VW6A 4O02B 4FG4A 2OSXA 3K71B 1HXKA 1FH2A 3D7DA 1BFTA 4I0PC 4G8IA 1CLVA 1HEZA 1KPRA 1P4UA 2RMNA 4NBYB 4RESB 1ZLVK 5JQ6L 3CHSA 3F85A 1WBXB 3SODB 5AG5A 5CEZL 1TZGL 2DLIA 3IRCA 1TTCA 3JYCA 5AW4B 2YUWA 4WUUA 1R57A 1CU4H 1IC4H 1IE5A 4HEMA 3EO9H 4ONFL 5F9OH 2GUOB 2NW2B 2YQGA 5IG7B 4L4VA 3VMOA 4JE4B 1QQ9A 4FBEA 3BKJL 1NCWL 1DQMH 3DHMA 5ECJE 2R1XA 4HHGA 4MA7L 3JVNA 3FJTA 5ENWB 5HHQB 4QB9A 3GJFA 3C9NB 5G5DA 2K8MA 2YNCA 3JV5A 2KUTA 3QYMA 1WFOA 3E8UH 5C08E 4QJ5B 1AGDA 1TTRA 3NBNA 2KQNA 4GH7B 2NTFB 1PG7W 4PTTB 3FQTB 5C0BA 1UENA 2X3CA 1YEWA 2P26A 3BW9B 4YWGH 3S8GB 5FKPA 4XPFL 1XX9C 4ONHB 2HJLB 3VGBA 3CZXA 3IDXH 2R83A 1PS3A 3TTYA 4BFFA 1V7ML 4P57B 3TBYB 1PNCA 2YNCC 5TE7H 1E8WA 5DC2A 4CVWA 4QTIH 5CP7B 5TFSH 2APTA 4XMUA 1XL6A 3TVMD 4BJLA 2C34A 1CFVL 4QO1B 1LO4L 25C8L 4D0DB 1LEIB 1K2DA 4QYOA 2GW5A 4QTHB 5FX3A 5A2FA 4Z8FL 3N0AA 3BYYA 3CFDA 4KY1H 3V4UH 2N7SA 1DVXA 1KCLA 3CHPA 5EU3A 4JGNA 4YHZH 3BCFA 3O2WL 3SYAA 4U6XB 1A7PL 4LCIH 1RP8A 3TJEL 3W6XA 2EYTB 4KNQA 2AXFA 1GA2A 2HJFA 1M7DA 4NN7B 4G9FA 2YPVH 2OJEA 1T0PB 4PRHD 5BVJB 2YC1B 4W4NA 3T1WA 4IBSA 3BKJH 3VWKC 4CU8A 1WLHA 1ZMYA 3KPPA 4S1QL 3VFMB 4JPIA 4NFBA 1H8LA 1KIRA 3ARGD 3FHEA 4HAFA 2MOGA 3LKSB 5I6XB 1KYOJ 1MCJA 1DQQB 5C9KA 1FFPA 3SI2A 1KENL 5C82A 3ARSA 2LVEA 4QAWA 1B0RA 1U8KA 2VLKD 3W9DA 5IJVB 4X99A 1AZRA 1RZQA 2NY0C 1DDTA 3KHOA 5I8KH 1TF9A 2DEYX 1J1OL 3OF6A 1ACYL 1JRHH 4Y4HD 3L95A 5C88A 4E2OA 2VERA 4HC1L 3ZOAA 1KFAH 3QI9B 5IVXB 2Z11A 2WUBH 3ARFC 5D29A 4G5ZL 4X7TB 2PJ3A 1BVKB 1TQBB 1A3QA 2F5AL 4W9IC 2PR9A 4JFEE 4DETA 3S6CA 1MFAL 3KLHD 1VFBA 4P9HH 4LP5A 2CHXA 3HC2A 5DC9B 1CMOA 3BRGC 5SWSB 3SBQA 3I6LD 4PIRF 1MWAA 4K9EC 3F6IA 3ARUA 3QUXC 4Z76A 5E9DE 3EFAA 3O3DB 3K4DA 3IMTA 3LZRA 3NIFF 4NQEE 4YHML 3VDAA 3M07A 4J3OD 3ULUH 5ESAB 3ZQXA 2R23B 3EDFA 4RQQA 4TVPH 3IF1B 4WI3A 5HHOA 2ZOKA 2CIKA 2VDPB 1K3IA 5I5RA 1HINL 3C2AL 1GRWA 1HILA 3MV7B 5J13B 5IX3A 3QEGL 3DOIA 4AKPA 4RETB 1IGJB 4I0CC 5D2NA 2YUZA 1EZVX 4JBSA 2HZHA 1XH1A 5DDHB 1HJCA 2X4OA 3GMQA 1T89A 2XA3A 2N4IA 1D9KB 1I1FB 3DX3A 4MA3B 3UERA 1KWKA 3V5HB 2DQMA 2QVFB 2YEZB 3ES6A 4FG6C 3W0WD 4MD5B 4PW4A 5KVEE 3K2UL 3PQYE 3QEUA 4JQIL 3VSTA 3SGJC 4Y2DB 4MJ6A 2IWEA 3CXFA 3JXAA 2CUIA 4Y4FD 5KS9B 1NMCB 1WC7A 2FVGA 1KBBA 1T03L 2BRRH 1QUPA 4WO4A 4O2CA 3RY4A 1P7HL 4M9PA 3O8XA 2P45B 3A4FA 2XJKA 4YZFF 3WS6C 4EN3D 3VYPA 2CR6A 3GSNL 2EO9A 3KLAA 4P3WA 4UIAA 3TZVA 1P4IH 4L48A 2A6KB 3SDCA 5DRNB 1IFRA 5C2BH 4B9YA 1S9KC 4PJBA 1KCSH 2ZUTA 5F9AC 1CO1A 1NBQA 3ZZSA 1J12A 5I8EA 3WC5A 5I2IA 3FRUB 1D5MA 5K1JA 1WEJH 3QXAA 2VDQH 1IGIH 1S4IA 3Q2NA 2ZG1A 5D7IB 3ILPB 3P77A 4PG9B 2QGCA 4B6ZA 4GY4A 4TUUA 4WKXA 4Q8BA 3W91A 4KMLB 1R3LB 2UZXA 2X9XA 3AABA 3MNVB 1A9BB 1PZBA 4JLRA 4OLEA 5K9JH 1NOFA 2BSBA 2ZX5A 1PZAA 2H1PL 2QELA 2OCJA 3TNMB 3Q6GH 1OAQL 4ZX5A 1IGCH 1FF5A 5FK9A 4A04A 4DZ8B 3LQZB 5C08D 3CUPA 4ZFFB 2AXGB 1ERNA 3GRWA 3C6SA 1K6QL 3T0EA 5ADOL 3FFCE 2KT6A 5K9KB 2HUEA 1XAUA 1IC7L 1XEDA 2XN2A 2Y06H 5L2KD 4XCFL 1YVLA 3T2LA 3EC4A 4WHTA 5I1AA 1NAKH 1QRKA 1J0IA 4FOMA 4MQ7A 4MNQD 5FYLE 4OLZL 1NGXB 3S9NA 1XO8A 4N87A 1R3JB 4HGWA 2C27A 4KFZC 2GJZB 2JSFA 4WKZB 3ECBA 3L8QA 1BHGA 2ZICA 4CMMB 2DLGA 2VKXA 3IFOA 4MVBD 1Z2LA 2EE3A 3L4YA 3MUZ1 4NUQA 2DWEB 2R4SH 5CJXC 1ZLWK 1SJMA 3HS0A 1Y6KR 5F3HA 2AJVH 7FABL 5C2BL 2JELH 5SWSE 4I49A 3KJ4C 4M8QB 1OZTG 5CLTA 2EYSA 1MW2A 4NC2B 3VD0A 4MCPA 5IR1B 4A68A 4HIEA 3SPGA 5E1QA 1MRCH 1K8IB 3DECA 1TVHA 4D7PA 1MJJB 4I3RL 4IKJA 3W9EA 2BNUB 1EXUB 1XEUA 3WE6B 4N2LA 4NENA 3J27A 1T5KA 3QRLA 4P9MH 5EU6A 1LWRA 1KB5B 4KROB 2NXYD 5GISL 2GITB 4Y9EA 1VHPA 3NH8A 2F1EA 4LCWB 1BOYA 4PVMA 2EDEA 1X10A 5IVXF 1T3FB 2P28B 4KKZA 1K5NB 4ECNA 4FFYH 2L7QA 2VUYA 1U30A 4ZYKB 1A9VA 1OT2A 1T0NB 4RWHA 4DP8X 3GHBL 3AZUA 4KI1A 1ZHLB 4YSQA 5TGBB 2MRYA 1CFQB 4JRYE 4F58H 1HWWA 4DGIL 1BBDL 5JLZA 1SM3L 3KPRB 1OARH 3QH3B 4XMLL 5KVDL 2CBTA 2CDGB 2AFNA 2IQAB 1B4LA 2ZUUA 5ANHA 1J4JA 1UD3A 4N0RA 4IK6A 1NGQH 4UQAA 1XVSA 4HISA 4J4PA 4N2NA 4YQXH 2GREA 2OSLB 1PCSA 2DF3A 4P46B 4P6YA 3L6FA 4JJOA 1L9MA 2CGRH 3BSZH 1LE9A 2DI9A 3RGHA 3WXVH 2NNRA 2PJ4A 1JV5A 4X5PA 1YREA 3NACL 5FOBA 4BRJA 1YW4A 4R57A 3RZCB 2HPTA 1NUDA 4PJXE 2A74A 3P0VH 2X10A 1IC1A 3D25B 3HB3D 4RDBA 2NY2D 4Y5VC 2BEIA 3W37A 4HMDA 2MH4A 2IGFL 3CDZA 5CU9A 5LXVA 1UZ8B 3QRBA 2X12A 1CR9H 5DS8A 1QLEB 1G0DA 3P1VA 2DI8A 1WCBB 2DN7A 2AGJL 4K23H 3FZUD 5IUSA 3GI8L 2NW3B 3Q8EA 43CAB 3AREC 3HBZA 1B88A 4P5MB 4P9ML 1N8ZB 4ANXA 3LHPH 4ZW5A 1ZG8A 3DSNA 2I9LB 3PGDA 1KF9B 1LM8V 3FN0H 5F1KC 4ABVA 5E2UL 1BVNP 2NQ3A 4LSSH 1TQCB 3KDMB 5EZJB 3X2QB 2F61A 2ITDB 3CFQA 3HS8A 1XSOA 4PVLA 1LNUB 3N1MC 3VFRB 3ZDYE 4JO5A 3O3AA 1QASA 5I73B 3FO1B 1L9SA 3T3MF 4BH7B 3EXLA 1OW0A 2VSCA 4BWUA 4OP4A 3HJ0A 3BZEB 3K1KC 3PWPA 4P3DB 3ZR6A 5JPMB 4OD3H 1WRFA 3VW3H 3AGVA 1YECL 3UABA 3FRPB 3AXHA 1VACA 3QQ4A 2WSKA 3ARRA 4FLSA 2WLKA 2FZ3B 3DUHA 4HKJA 3OAUL 2NY7H 1IJNA 1RUKH 4X8IA 1KLGB 3DIFA 5AW6B 3WFHB 1JNLH 1YLEA 1O7SA 1MFEL 3FUMA 3NJJA 2R1WB 8PAZA 1KPUB 1NLDL 1JZ2A 1H0DA 4Y9BA 5ISZA 5TE7L 2CIJA 1YMHA 1JZFA 1H6UA 2NYYD 4XAKE 4AJWA 1L6ZA 1LO4H 1JGUL 25C8H 5CN3A 1WFUA 1JGLL 2F15A 1EO5A 3J7HA 4H20L 4XNZC 2J3SA 1KPRB 1A4KB 1KTBA 3HB3C 2QJ8A 3HG1B 2WWKO 4U1SB 2ISDA 4PJEB 1WBXA 1JXFA 2CXAA 4PJGA 2XKNA 1JHKL 5T1MB 3VXMA 3ZL2A 2H3NA 2WINA 2YAOA 3K0YA 4X9IA 3RWDB 5I19L 3ARDD 3NZ8A 3F12A 5F6IB 1MZZA 3LHAA 4PUBH 2R1XB 4GW4B 1B9ZA 1XF3A 1GGUA 2EINB 1VCAA 4JO4H 5KSAB 3EYVA 2WLNA 3BPNC 1OP3K 3PUUA 3FCTB 3V8CA 3BSGA 4ELME 2QMKA 1OP9A 5C08B 4O2FA 1Q0XH 1BEYL 3GO1H 3W82A 1AGDB 3EAKA 3DRTB 1IKNC 4XHQA 4QRTB 1VHSA 3DURA 4GEJA 5BS0B 1A7NH 4OR1A 5L4IA 3VWJD 4KBPA 3PFEA 2EACA 5MHSE 4MJHA 3G9VA 4G6FB 4K30A 1RIUH 2ADFH 2ZKHL 5ICZB 4MRBA 4CN4A 4FG6D 1IVLA 3LOWA 4Y7OC 1BX2B 3NZHL 4FZ8H 5IEKB 1I3RB 2FK9A 2TAAA 3BXNA 4MJIB 2H32H 3ABLB 2CUAA 3ZKNC 4F2EA 1RZ7H 2AJXH 4EIBA 3DO7B 1HAUA 3G5YA 3LJ3A 3QT2A 2B9BA 3UTTE 4PR5A 4OIAA 3P3TA 4O2EB 2WQ8A 3IAQA 4EDWH 5I1EL 1XF2B 1BVOA 1EZLA 1SXAA 4UTCA 4XNZB 5D6DC 5J8CA 3QIUD 1JGLH 4ZMVA 1UOWA 4NBXB 1LEGB 2R0LL 3BUYA 1TZIA 2MQ0A 1TTFA 2KDGA 5I17B 4LNVA 2ORBL 4POZC 1AD0B 3PQYA 4LHQB 2AJZA 2HJFB 4APXA 2E7HA 3S96B 3A6OA 1RTQA 1PLGH 2EAEA 2EH7L 4HUWA 4JJ5B 2Z92B 4YAQB 3REVB 2GIMA 4LSTH 5MI0B 3LKOA 3CDCA 3HI5H 3AT0A 1FL6B 2C8NA 2EIZA 4CW1B 4ZFOL 2EE9A 5GJTL 1D9KD 3KWXA 5GSRA 5TE6L 2V5MA 1QTYT 1FVDB 2XZQL 3B7SA 4Z5RA 5JUEH 3V6OA 1KYAA 4QCIB 1F6AB 4HBCL 5J6SA 2JKNA 2QPUA 3U4AA 3B3TA 3BIKB 3IETB 2OMXB 1NIDA 3K3QA 3QJOA 4KI5D 2EDTA 3SY0B 4PRHB 1J8HE 1R5VB 4KKLD 1RZJC 4RA0C 2CPUA 2DL2A 3L4TA 3GLZA 2YAMA 1JK8B 1I1AA 4JHUA 4NZTH 4Y1AB 5E4IA 4QNPE 3VNZA 4OAWB 1H3GA 1GZQA 1KTRL 3X13B 1RZ7L 3SKNB 2XX0A 3N85H 4EF3A 4OCMC 5IVZB 4YFJA 2YK1L 1ACCA 3CFKA 1ZV5A 1HXYA 2QDWA 2DD8L 2CO7B 2WBJC 1GOFA 2C9SA 1QWUA 4OBRA 5CU5A 1TVBA 3F6JA 2H7WA 3VB9A 3CXHJ 1BAGA 2IOOA 1CG9A 2V7HB 4OGXL 4PJEE 3D7FA 2ITEA 1EPFA 3CG8A 1HIMH 5TH2B 3N50A 4EN3C 1DVTA 1FNSH 5GGUA 1A6WH 3FAXA 3MLVL 5F89B 1JF5A 3H9ZA 4N4YB 1FV1A 4GPVA 4RMBA 5T33H 3D85B 3IDYC 4P46C 4AT6B 4IEFB 1Z2KA 1MELA 5F9OL 3GS4A 3X3FL 3FT3B 2GSMB 3VFWB 4EI6A 1B3JA 2F7OA 2M2DA 4U6HB 4KLVA 1S7UB 3QPXH 3SE6A 5D4QA 1LO3H 3EGXB 3KLSA 4NO5A 1UJ3B 1BDYA 5DVOA 1GCFA 3TO4D 4JD6A 5K93A 4M7JL 3SCMD 3FPXA 2WCPA 6TAAA 3QZOA 3T8XB 2BW4A 2AJYH 3QXDA 1OAZH 4NWUH 3KBFA 4GT7A 1R5WA 5DQ9A 2HVKB 1U21A 2WYZA 3QIUA 4LSRL 2ED6A 4YN3A 3VUAA 4YWGL 4I18A 4XVOA 5IM7B 5TQ0H 2XBTA 5EOCJ 2AQTA 1ML0A 4TLSA 2IMNA 4WO4B 5D7HA 5J7CC 3PYCA 3CLFL 3GDCA 2IAMB 4K0OA 5EBLB 4HJ0D 5J9PB 1GYCA 5JPHA 3UBXA 4U0RC 1NGWA 1DQKA 1DJHA 1JG9A 1I1DA 3CN0A 5E6IB 5EU7C 1JS4A 3BP6B 1BD2B 3O0RH 4C4BA 4Z7AA 4YHPA 2OXHB 3TIDA 1S9XA 4FD6A 2HVJA 1P4BH 2WLLA 2ZYIA 3EGDA 3OF6D 5DLLA 1YMEA 4OGXH 5E24E 3G5XA 5AG8A 3A23A 1R3LA 2UZXB 4TLKA 4XN5A 4PRPB 4RVBA 1NCHA 3S4SA 4A7GF 4MHZA 2BX5A 1IEAB 2YPVL 3MRLA 1YYML 2H41A 5GGRY 3R7QA 1K3ZA 4WNSA 2Z3PA 5L7XH 2R4RL 4QOKA 4HA1A 1R0AH 2ITFA 3HAEG 1UD8A 4NC1E 3GPSA 4YDLC 4ZFFA 3KWTA 3LWUA 1KUXA 1NEPA 1NGPH 2E75C 2IOMA 3NJHA 3RA7L 4PJXA 5D5ME 2WZ5A 1KFAL 1HHHB 4AC2A 1P5UA 2HV2A 4U3HA 1E4XH 3P0YL 5BVPH 4IOFD 3MKGA 4M43L 2YOAA 1AHWA 1I1YA 2FYYB 2X3AA 4M7LT 4CN1A 2AXHA 2Q7YB 2ZEMA 3I9SA 3MOQA 1YECH 2VM4A 3CE1A 5IMMB 1AAJA 2O6EA 1T1YB 2JKLA 1XCXA 5TPWH 3IWGA 1NC2B 4F7KA 4NQCD 4YIQB 3MBXL 2OX5A 5CD3B 4RI1A 4PJHA 1C12B 3QJUB 4M1GL 3BGAA 2A1WH 3NIGB 2OMNA 3T0AA 3B7UX 3NCEB 1T5WB 5DD5L 2C6PA 3RWGB 2EECA 2J55A 1Q9KA 2Q6WB 3WGUB 3H4HA 4LSDA 2HG0A 4OKOA 1FO0L 1AQDA 1HFUA 1URLA 2G0BA 3LEXA 3D0LA 1VKCA 1C16A 3ROOB 3W81A 1BQHA 3ZL4H 1SDDB 4PJ9D 4FI8A 1B9KA 3BD3A 3RB7A 4MCZA 4M5YH 4KOSA 2ATPB 4CAXA 4JR9L 1E9PA 5DJ2A 1FE8H 2FX7H 3LEVL 4M9OA 2BNUA 5BS0D 1YGHA 1A7BA 3WSQH 4FNRA 4XE0A 1X6LA 4HXBL 2B9AA 4HIJB 3T4AB 4XMTA 3WKMH 5F8RC 1A1MB 3PXJA 2WP3O 3NFNB 4X5XA 1BZ9B 5H35A 5IQ7L 1NMCC 4K5OA 3DIVA 3K5RA 5IOPA 5IESH 1QNZL 2XA8L 1I4FA 2Y2WA 4HCFA 4NFCA 1PTZA 3RILA 4F7EA 1CICC 1BMZA 2UUDH 2KS0A 2BRQA 1UH2A 3X1EA 3GJFH 1IIDA 1FA4A 1S7NA 2DMCA 4HMEA 1UWGL 4J3GA 1LK3L 5GZND 2FWSA 3SE9H 3LEYL 5D71H 2WZPA 5JXAL 2VLRE 5IHLB 4L8SA 3PV6B 5F6HI 4RLDA 1D5XA 1ZT7A 3TO4C 4WY7H 4WIQA 1X5JA 3CZGA 2AQ1A 3HG1D 4ODHL 4WHYH 3VFOA 2WIMA 3MLRH 2QQKH 1AGEB 1OGAA 3EOAA 3EUDA 5HY9A 1HH9B 3QWRD 1QBLH 3LN5B 3KCPB 3DXAA 2Z31B 5D72L 5DYOA 4NOFA 3ZE1B 3ETBF 3L4XA 3O2VH 3PWVB 4IBTA 4M48L 2AV1A 4MNGA 2OSWA 3QDGD 4ZUUB 2DYSB 1CT8B 3FOMA 1IM9A 2Z7UA 1SY6A 5B3JF 5E00B 4EMZA 5MEND 3B7TA 3P40A 4IRZH 43C9A 4L4TD 2VISB 3GD1C 3MXVL 1S7KA 2R2HB 4AUJA 1F18A 2HRGA 5CJ8A 4BELD 4EFDA 3MQIA 4R26L 5HGAA 5AWNL 4ERSH 3IAPA 3MUUA 1P7KA 3VJ6A 1NM9A 1QR1A 3BKYH 2FEEI 2R0WH 1T1ZB 3GT6A 4PWEA 5LNGA 1NQBA 5IFJA 2GY5A 3QQNA 1OEZW 3QI9C 4H2KA 4U1IA 3DSNB 1GS8A 1PZCA 3FSWA 2E86A 4RGND 5AVUB 3WNPA 3PNWA 4AIZB 4XCEB 5FGCB 5BZWB 4Z7VB 5SX4I 1P0HA 3KVQA 2NY0B 5F49A 3H9SA 4H26B 4V1DE 2QBWA 4A2LA 4AK1A 3UJJL 4P2CG 1JIBA 2BDNH 2XN9A 3H7LA 1Q0XL 4F8PA 1G5AA 4JVWA 1HCFX 3N0PB 4MB3A 5I6XC 1GSKA 2CJUL 4P3DA 3W38A 4FQ2H 3SDCD 3VRLF 4JKWA 3QQ4B 4U0RB 4F3FB 5K8NA 4CN6A 1A5FH 5T1LB 1PG7H 3WIHH 4UF7C 1BMGA 1I8IA 1EAOA 1SJVA 4P4RB 3LKPA 2WVTA 3W3BA 3DIFB 1HZLA 5DVLA 4F8LA 1NGYB 3CZLA 3WHE0 1A7QH 4L8CA 4JX0A 4X2TA 2DPKA 4FTVD 4R6UA 2NY2B 2H6OA 1B6UA 2QVPA 1DFBL 2LT9A 5ISZB 2HT4D 1VADA 5HYSG 1MN4A 2QSQA 4AI7A 3SGJA 3WIIH 5A6MA 1EHXA 3GXUB 1HDMB 2DQHH 4ZMWA 5I28A 4H25A 5SWZD 2A3TA 2R69L 1F6LL 4M7KH 3OR7A 4ZUVB 4KUZH 3WNIA 5C7XH 4S1DD 4KVME 2XRAH 1KCVH 1Y0RA 1TR7A 5C0AE 5FPIA 1UB6B 1T2QH 3V4PH 3C6LA 2Y3NA 5HYJD 4G1MA 1Z9MA 4LIQL 3EO4A 4NNYA 5IV0A 4R3SB 1KB5H 2VMEA 3B8YA 3RWDA 2Q43A 3F12B 1EJOL 2WKLA 1S7TA 4O23A 4NP9A 1VGKA 3FUJA 4GW4A 5KSAA 1KLUA 2HLEB 5AW5B 1MOEA 1VDGA 4N2KA 3ZDWA 1P9MC 2PWDA 1Q0YL 4PS4L 3ILQC 4WJBA 2DLTA 2XNAA 4E5XA 1MIMH 2B5GB 1AY1H 3IU3B 2IBBA 4HEPG 1E6JL 3PIQB 4QRTA 4YSUA 4G83A 5I30L 2PYEA 1QSNA 3IDNB 3SGDI 1BJ1H 3NSXA 2JJVA 1IOFA 1WBYA 2WBJB 5LBSH 2ID5A 2RD0A 1F4XL 4XHJD 5JW4Q 3SKOB 2DI7A 5GPRA 4FI7A 1OPGH 1UM5L 3WN6A 5KVDH 3HHSB 3NH4A 1G87A 1SXZA 2OTPA 5CR1A 1EERB 1AGFB 1O75A 2Y36H 1JPTL 3QZWB 3FSAA 2DWDB 2PXYC 4YSOA 3SYPA 1HQRA 2NR6A 4RS2A 1CR9L 1JPGA 1QPPA 1F58H 3K72B 5I6PA 3N85L 2BNQA 4K3HA 4I0PB 3K2KA 3VI4A 2DQHL 4DZBA 2A6JA 2DW5A 2NNXA 6CGTA 4Z1PA 1E67A 4PH8A 5KVEH 1BPNA 4M7KL 2WTRA 3DROA 3ZQ9A 5EU5B 2MQ3A 1S7XB 4OLYH 1F1DA 1GGBL 1PY0A 5AVQB 4BSJA 3KPQA 1MNNA 1BIIA 2X4NB 5EZLB 2FX8L 2V5RA 4JJ5A 4JN1H 3TPKA 5MI0C 3HBPA 3V0AC 3X14A 4H4NA 4YBHA 3RKPA 3NH7H 4ZUSA 4YNYB 3TNNA 1RZJH 1ICTA 4GUPA 5JORA 4DP4X 2FSEA 4XXDA 4PY7B 1KCRL 4ZQKA 4OD3L 4QCIA 4KOTA 1UOVA 1XD0A 1Z5YD 3ZSTA 2PJAA 5D1QA 2A2QT 4X8GA 4HUXA 4WFED 3TO9A 2DBLH 4PRHE 2V77A 1BAVA 1VPOH 2Y7QB 3VI3E 5D6CB 3T6QC 3U9WA 2GIYA 2QQLH 4M1CC 5LAXA 1AZNA 3ARDA 2EC9T 1I1AB 4Y1AA 5CEZD 2P5WB 1BJ8A 1U3HB 3U2SA 2CCLA 3NQKA 2XEGA 1KCUL 3NK3A 4L4TB 1P6AB 2B5IC 4NQDD 2HP4A 2GABA 4HEME 2EVJA 3QNYA 5A27A 4G6KH 2Y36L 1YEJH 4KRPC 3T2PA 5DK2A 1D5BA 5BW7A 3WY4A 3OTTA 3BLPX 1E8YA 3KPOB 1AYOA 4LCCA 3IPFA 4PWKA 1X5AA 1CPUA 3CMOL 4AEIH 1WH0A 3PWJB 3L4VA 1JZIA 3FL7A 2V8GA 5DQDH 3HHRB 4XNXL 4JHWL 5KBNC 1HE8A 1DN2A 1UFGA 3P73A 4CNIA 1XMBA 1RO5A 2XBZA 3N43F 3VYOA 2EVGA 1WPCA 2QSCH 4JB9L 1EMTL 4N6RA 2BIIA 1T5XB 2LABA 2WQXA 2BVOA 2APWA 1OWRM 5T3XD 4LAJH 5EBWA 3EDDA 5SX5K 3QXTA 3U7WH 4XRCB 4IIQA 4JN1L 2BNRD 3FSVA 3KL3A 1T83A 2KDYA 3GS7A 3BYTA 5C0GA 1XH3B 1TKJA 4NCZA 3GK8L 2D7QA 5DURB 5E8EB 1D7CA 1RZFL 3PJSA 1IY7A 3WE1A 3OWEA 2A5UA 4NO5B 3WD5H 1UJ3A 1NDMB 3S36H 1T7XA 4RX4D 3ET9F 3CVDA 1JDCA 3RWFB 4Q0XH 2QPEB 4MVBC 4ZO9A 5CGYC 3T3MB 2J8UF 1TQSA 4ZW8A 4GLRH 1VA9A 2QFRA 2WB1A 2V2XA 3UP1A 5DD0L 3BHBB 4BD9A 1MCNA 2BVTA 3EGSA 2R8VA 2RFHA 1E4XI 3MROA 4R97B 1CDUA 4UCNA 2UX6A 5B7MA 4NUMA 5DFVD 4NQED 4MMZA 2R69A 1GL4B 3O4OC 4JRXB 4WNQB 4G82A 2CRIA 2W80C 4G7SB 4Q2ZA 1OQOA 2HC9A 2W9DL 5D72H 1HHGB 4HKZB 5LGHL 1LK2B 1ADWA 3O6FB 2GJ6E 2OMUA 4F2MB 5IQOA 2X0WA 5JPMC 3KGTA 2WC7A 3CD4A 4ILDA 1J5HA 2OYKA 4MLSA 3BP6A 3P4MB 4W9YA 5I73C 1XGPB 5KEZA 3CH1B 5JDJA 4Z7OB 3FHAA 2WLLB 2YOCA 3EGDB 3QE5A 4JMXA 4Z6AT 5JOFB 3U4EA 2A9MH 1SMDA 5EORH 4JO4L 1HQ4B 2FBOJ 3DVNA 4HUVA 1QACA 3CBKB 3ZYJA 3RYOA 4L3CA 3ZK0A 3I75B 3S8WA 4U9YA 5G20A 1X6NA 2JQMA 2APFA 4PJ8A 2VLME 2VL1A 4DK6A 1A3LL 3H7BB 1YN6B 1FLRL 3EF4A 3PRTA 3AREB 1E2VA 2YBRB 5C09B 3RZWA 4FQ1H 5ADPH 3IGAA 3KW7A 5AW3B 3SEPA 1HOCA 2FE7A 3IS0X 5FO7A 2X3BA 3LS5L 1ND0B 1XF1A 5T1JA 1AKJD 4HQQH 3QO1B 4UMSA 4H6UA 4LLQB 1X7QB 4B9CA 3FT2B 4N0UA 5D70H 3L1EA 5CM1A 4JFXA 2XPGA 3BN3B 4PJHE 4TUKL 5MP6L 4TMPA 4CYOA 1PF3A 3OKOA 4F7MA 1C8QA 1NIEA 3T8VA 4IOIA 2OFQA 5MEQA 4RGNE 3SJFA 3WYRA 5FV2A 2WYRA 4JRYA 1B0GA 1XIWB 4RDQF 3D6GA 4FZEL 4OF5A 3IE9A 2A38A 2PQ8A 1KWGA 2IXQA 3QG6A 5KSUB 3CIQA 1N7MH 1FRGH 4M1CD 4GJTB 1W0VA 2Y07L 2I60L 1EGJL 2J6EH 4H0HB 4Z7NF 2FIWA 4U1KB 4QPEA 1TETH 4ZTPH 2KI6A 3WC7A 5M94B 2UZPA 4NERA 4NZ8A 4AGMA 1VCBC 4XOAA 4CKQA 1YX0A 1IGIL 4HBQA 1KEMH 4KORA 2I24N 4U2YA 3OHXC 2DQIL 3D0LB 3KXFA 2R0KH 3PCYA 4OIBA 3FFCD 1M42A 2WLYA 3C5ZD 5INCA 4WFFE 4MS8D 4NJAH 1FG2A 4GKSA 3QRGL 1HKLL 4JG1L 2V9TA 3CSBA 5HPOA 4W9HC 4FAIA 5BOPA 4LEXH 1BQUA 1DDHB 1K4DB 3MHZA 3V52H 2FJGB 3B8GA 5I1IL 4PJ5B 1F2QA 2QVKA 2F0CA 3HAEB 4EIUA 2VE6A 4C58B 4PQAA 3ESPA 1A22B 1IGMH 1BLIA 5GZNC 5ADPL 2EWBA 3H6AA 1WE5A 3FO9A 3HC4H 2LV4A 4YXKL 5E1HB 1IRAY 1UCTA 1QFWM 3B6SA 2MQCA 4KXZH 4BGDA 1Q7LA 2VL5B 3EJYC 32C2B 5DRZB 1GPOH 4I0PD 1UWYA 1CURA 1QW8A 3NFZA 3UTPD 2FCKA 1S7SB 2WO3B 2Z1KA 1RZKC 1P84J 2I07B 4HHAA 4UZSA 4MMXA 3FB3A 5KBLA 3HKZA 3QUYD 5KVGL 1DVFB 2ENPA 5KANI 4UDTB 4OM1H 1L9NA 3QQDA 4QLWA 1DBBL 4U1JA 4U5YA 4ZI6A 1OGAB 3EOAB 4MMZC 3QC5X 4YH6A 2HG5A 2GJJA 1HH9A 3QORD 1NOAA 3SQOH 1Q8MA 4BFOA 4ZFZB 2XEIA 1GYAA 1QMUA 3FT4A 5TDNA 2DIAA 5DWPA 5C8JB 4GBXC 3G6JE 3AQXA 1OP4A 4RRPG 3H8EA 2ILLA 4I9WE 1ID2A 2JE8A 3FOMB 2R2EB 2P24A 1Q2YA 3GMNB 5CFAA 3HI6H 1QLEH 4G7RB 2XWJB 3PZJA 3POHA 1PFOA 1A4BA 5I1LB 3WEXB 2ZP8A 1U2YA 1ARMA 1FZJA 1H8SA 3ABGA 4NN5B 4WFGD 4UT7L 1FIEA 2WMPA 4P3CH 4IBWA 3WV0A 5GISH 4BXSV 3FBQA 4HP5A 4B50A 1A6UL 2EVFA 2ARJB 3IN0A 5C0EA 1GR7A 4ZJ9A 1MHEB 3SE8H 5CD5C 2QLYA 3H2QA 2GSIB 5DK3A 3T8MA 3FNCA 4HSAC 1OALA 4KQ3H 4N85A 2G5BB 3WI9A 3V95A 3IJEB 4Z7VA 2CK0L 3FTGB 2DLFH 1DJYA 3DO4A 3ZHNA 3K6NA 4U6YB 3CN2A 2OL3L 2QT6A 2WUCH 3KLDA 4HIHB 4NX0A 1ASQA 2MKWA 3GKWL 4FXGA 4M3HA 3U36B 1IKOP 4FJ6A 1R0AL 1VEMA 5IFHL 4U33A 1RFDH 1JWUA 3QR1A 4YSSA 5ACZA 3HMXH 5D7LA 1ESOA 4X5QA 4UQ2B 1I75A 4G8GB 4ODSL 2B3VA 1E9OB 5EOCH 2X70B 5FUZH 3LV3A 5AAWC 5TDPA 2Q4VA 2FECI 5D93C 1QBML 3H42L 1M4DA 1CF8L 4XT1C 1D2OA 5J1SC 3Q3GB 1JGEA 2P48B 1EVTC 2UY7A 5TQ0L 2VZSA 1RJCA 1TCRA 5DHEA 4Y2DC 1U93A 1HDMA 2XFGB 5F1OB 4B11A 3EJSA 3TFKC 1YYLL 5DHVB 3IFEA 1JCKA 1MF2L 3SOTA 4JFOA 2UWEA 1HYSD 1U8HB 2OJZH 4OJEH 4PRIA 5I19H 5KVEL 4ACTA 5JHDB 4OJFH 3D3VD 3S9DB 4DJMA 4UT7H 1YMME 5IESL 1FNOA 2QPDB 4XO9A 4M5YL 5E7FA 3RL1B 2BO0A 5J13C 5AD0A 4AQ1A 1U8CB 2XU9A 3G04A 4ZSOB 4H8WC 1HH6A 1N67A 2BWDA 1T1WA 3F7PC 2Q7AA 3QUYA 4NKMB 3O9WA 2BXYA 3HW7A 4YDIH 5F7BA 3UX9B 5H4ZA 2UZYB 3KASA 3BVVA 1SDYA 4JZJA 4KK9D 4QRPB 3FTYA 5HYSA 3QUXB 2AK4D 2FRGP 4GAJL 4ODXB 4FS0A 4JZNB 3AG1B 4EQ2A 3L1FA 2HXAA 1Q0EA 1E3XA 3SIKA 5IJDC 3DGDA 5TPWL 4YHYC 1SUHA 3SDAD 5I1HL 1TO4A 3QZPA 4G42B 4MTMA 1P4LB 2PW1A 2QEJA 4N0FA 4E9LA 2YMTA 4OTXL 2PCYA 4KGJA 4M1GH 2GI7A 3WIFB 5C3LD 1P84K 2WLHA 4UQEA 3UAAA 4PP2B 5BVPL 4PRPD 2EDQA 4EKXA 4EBQL 4OV5B 1LDPL 3ZMNA 4M61A 4PJ9A 3ARFB 4YHOL 3B3CA 4XC3L 2R2BA 2C7UA 1B4TA 1MFAH 3Q01A 1I8AA 1TJGH 4ZTOH 4C4UA 2BK8A 5CWSB 5ENWA 5HHQA 1RJLA 1YY8A 2WSPA 3NIDE 4G11A 3JTSA 1NFDA 3E38A 3QHTC 4W9KC 3CZNA 2YQ2A 1JI1A 3QIBD 2R15A 4GO9A 4B53A 2ARHA 3BIBX 3AXLA 5C92A 3LDBB 1FGNL 4IRZL 1MJ8H 2R59A 1B2WH 4TNWF 1F8TH 4A2HA 3PHSA 3ETTA 2VWEE 2CJTA 3T0DA 3ARGA 4TVPL 5DMJB 2HTKD 3BESR 3HPLB 5T1DH 4DVRL 2I5YL 1G7LB 2CALA 4AYBA 3ARXA 4LCYB 3N91A 3OKKB 4UA3A 1YPZE 3HCVB 4HS3A 5C3TA 3ZYIA 4FFYA 4MAZA 1V5JA 4LLDA 4L4VE 1VZGA 1HI6B 1YDPA 4YHIA 2POKA 5FXCH 2NYQA 2AEIT 2C1OB 4KSIA 2B1AH 4K94L 4D0DA 3RVTC 1T4WA 3K6IA 2FLMA 3MRMB 4KI5E 5IVOA 1NBCA 3FQXB 3HUJB 2ZELA 1RJZA 4F6AA 1UXSB 1ASOA 2BDNL 1BLNB 4PW3A 5M7QA 4YLCA 2J5WA 1YYCA 3GRWH 1ZO0A 3B2PA 3DETC 4LF3B 4GOSA 3OSKA 5B39A 4NBZB 4L4TA 4MBRA 1FFOB 4UM8A 2DMBA 4KMTH 2VR9A 2DOCA 1SBSL 3FTUA 3FFCB 5FM5O 5IB2B 4I9WD 2XWDA 4PJGE 3QUKB 2AERT 3OHXA 3KVPA 1NFIB 3ATBA 1QSEA 5BZZA 5DHMC 1A6AB 1N5YL 2Z93A 3APFA 4DT2A 2BSRB 4IAVA 1R6VA 5ESVB 2AAVA 3P73B 4MQSB 1ZVYA 4ZS7L 3OR6B 4G6MH 5GGTA 4JY4B 3UTTD 1CJWA 5EBMB 3U9UA 2D8KA 3UCRA 3U1SL 2XQ0A 1FBIL 3MLZL 3DJSA 2DQFB 4BGLA 2APXA 4GS7B 2FT8A 2RA1A 2Y1ZA 4PXBA 3SGKC 4LB8A 3LIUA 4PXDA 1BQHG 3EJYD 3SBWA 3FF8A 3MLSL 3NMEA 1G6VK 1HSBA 3GS0A 1RJYA 3US0A 3SKJL 1VFBB 5K59F 3UY5A 3VXRD 2EO1A 4A95A 4LHUA 2OL3A 4W4OC 3OKNA 3TYFB 3MV9A 4UV7H 4ZDHB 3T6WA 2DMGA 2VJ8A 3CVHA 1Q0YH 3MRCA 3VA2C 1MWAB 2BFGA 1QA9B 2K6WA 1OHQA 4KZDL 2Y9RT 1GPOL 3PB7X 2BJMH 2NY5L 5GSVA 5EA0L 5DRWB 3PP9A 1HYRC 5ANME 8FABB 4ZW6A 2O61A 4H8PA 2ROXA 1TU2A 1WP6A 4CGUB 2PJ6A 4R8WH 2QYVA 2F53D 4JDTL 1BAFH 1CDGA 2V6HA 4AQZA 3QJVB 5D7LE 5IIEA 5AVWB 3CFEB 2W9EL 1PL3A 3FPYA 4J3BA 5BQDA 1KJ2A 1W72B 2QADD 4O00A 1ZGLM 1SBSH 2XUWA 4DP2X 3PGFH 4KUZL 3LPOA 5C7XL 2P4AB 4PJIA 1ZIBA 3MREB 5LJYH 3KL5A 2EYTA 2AXFB 5DEJA 3D48R 1MIEL 3UC2A 2DTML 3V6BR 2EUZA 3TH2T 1ORQB 3ULVC 4Y2DD 2NSQA 2Z64C 1DBAH 4K2UH 4N24A 1NPUA 4I3SH 3MTXA 3P3RA 4HZLA 4JPIB 4IM8A 3ZE2B 1SJEB 4AUUA 5SX4H 5GS2D 1M4LA 1MPAL 2GBTA 3WT4A 3KWUA 3M7OA 3TIEB 1EEYA 3JV4B 4E41E 5KYYA 4MD0B 1R3HB 1JGVH 2FX8H 1VEPA 2D73A 5JMOC 3VM7A 2E7LC 5LLIC 1T04B 2VDKB 3KBPA 3KLAB 3OG6B 3RA7H 4C56D 3G6JA 5IY5B 1KN4H 1GKEA 3HLAB 4FFZA 2AEPH 1WWCA 3M46A 2VZTA 3L95B 3QO1A 1DLFH 2BC4A 3DOSA 4LVHC 3T9YA 5IVXA 4EI5A 3VXUE 3ZMEA 3HZMB 2BP0A 3EBIA 4QWWC 3FAWA 1ZG7A 1CJYA 2W0PA 5I6LA 1TPXC 4CYNA 2IG2L 3NA9L 1ES0B 5IMLB 1KLFB 1FNHA 1KXHA 4XPFH 3UZVB 3MI6A 3DPDA 2J6EA 3X1NA 2D4PA 1RP9A 1N6QL 3IDXL 3LN4B 5HJ3A 4MS6A 2WYTA 4F9UA 4A2GA 2G9HA 5KJ7E 3OXRA 4K9JA 1QHQA 4WTZG 3MJ9A 3MBEB 4H8QA 4O9HL 4XP4L 5DJ6A 3FU8A 1WA1X 3H9HB 4ZMAT 4AG7A 1QAWA 1HSAB 2JELL 1FIGH 3VQ1C 3MRFA 3OMZA 4HWBL 3JWNE 4L0PB 2J20A 3C6SB 3NE7A 4JQXC 1CGWA 3O9WC 5HJBA 4RQQB 3F7VB 3G3LA 1ZA3B 2IOIA 1UATA 3NIFB 4PV9B 1XXDC 4DUWA 4J6RL 1G6RH 1O7DE 2FB4L 3NEOA 4OCWL 3LQMA 5BOZG 3ECBB 4Q56A 1D3CA 4L1HA 1L0PA 2WLIA 4Z7UF 4PTUA 3BP5A 1BMWA 1N2RB 4BFRA 2VERN 1JTTA 2G9DA 3SGDH 2FATH 3TBVA 1MCRA 1CUOA 4Y4KB 5JMRA 2JXMA 5DR5L 1XH0A 2HJKA 2UWEF 3QZLA 4J3VA 3C5XA 5D1QC 4CAGA 4JFYA 4M4PA 4OVVA 1QBBA 3C60A 2ZKYA 3ESOA 2NCEA 1J87A 2PVVA 1UHVA 1S7RA 1DJZA 2YWYA 3HA0A 1PFCA 3JWOL 1VF5C 3ML9A 3QG7H 3SSGA 4BINA 2CA3A 1AXSB 2KYIA 5L2JB 5EO0A 2A4ZA 1AKJA 3NZUA 4IDJL 1NCAH 3AG3B 3KYKL 2Y5TA 3MOBH 1CTNA 1Q4NX 5GQBA 3LXCA 4ZD3L 3W5NA 4OI8A 2H5UA 3A22A 3BAEH 3D18A 4LT7A 3VFGL 5ICXB 1AIFA 1OP5K 1JWSA 3D69A 3FH8A 4B14A 2JJSC 3BP4A 5IEHB 4UYPA 1MQKH 1QEWA 2CLVB 4RMTA 5E99H 4UQ3B 3T3PE 3BDXA 2VC2L 4PJIF 4HK0A 4O02A 4HNYB 1UZ6F 4K3GA 1XCWA 4NM4L 4QOKE 3SHSA 3AS0A 2X6VA 1WIUA 1FIGL 2F8VA 3IGKA 3K71A 1QSFD 1YQEA 3WFZA 2YLKA 1NSNL 3IC1A 4IKLA 5E1IA 3WUWA 4IUSA 4YHZL 3KYNA 3Q8CA 3WEXA 4S1RH 4KU1A 3AUWB 1F4YH 4G80A 3BKYL 3IMUA 5E08L 4MY0A 3S0PA 5D7JB 4HIQA 2V17L 4NNXB 3S3CB 3O3BB 3ZE0E 3PJLA 4RX4A 3QW9A 5HHXH 1I12A 4PSWA 2WTOA 1XCTB 5E6ZA 3EO0A 4W6WB 4CVZB 2WO4A 5DZOA 2MCAA 2FUTA 3A67L 4B9KC 4IK2A 3P11L 1CBXA 3LRKA 2XIIA 1RI8A 3HZKA 4XPGL 1M2VA 2X38A 1QZ1A 4KKBC 3IMVA 5F71A 2EXYD 5C6PB 4ANVA 4OF7A 4PJFF 1LGVA 3B1TA 4FAAB 5JA8B 2WBKA 2YRBA 3FQTA 5C0BB 1T80A 3PS6A 3KXFD 3PF2A 1RVFH 4RFOH 5KJ4A 4U49A 3G5ZB 4QHMB 5CUSH 4QF1A 4J39A 3EXNA 4FABH 5BXFA 4B5ZA 1EZUA 3IFOB 2HJLA 4L4VD 2WXRA 2XWTA 5EEUA 1L9TA 2QVTA 2Y4SA 3KG5A 2V9UA 1L5GA 5HHMB 1A7QL 5H2BB 2H32A 2CK2A 1HCYA 5EN3A 2WQAA 3BAEL 3VFGH 4H88L 2GFBB 2XKUA 4OFIA 1A2ZA 4B10A 2ICCA 3NCWA 1AXIB 1TJHH 2ICEB 2BVQB 3L17A 3BWAA 1EA9C 3DHUA 4DQOH 2OKMA 3V8OA 3TFYA 3IMRA 2A73B 5E9DA 4OCYL 2VXQH 1KXQE 1MJJA 2N01B 3JUYA 4FQHB 3W9EB 3VXSB 2OW7A 9CGTA 2APVA 3EFFA 4WGWB 3VXRB 3DGGB 3FBKA 2OMTA 3ZGIA 4KI5C 2UYLB 4LL9A 1CBVL 4OC3A 3HEIB 2OMVA 4NQTA 1VACB 2GYSA 2HT3D 2B1OA 5CCKL 4NCDA 2QKIC 4YUEH 3IJ9A 3ISRA 5K9JL 1HH6B 3KYAA 5FYJE 1X5LA 2GTWB 3RKDC 3D66A 3IDMA 1OLZA 3EH4B 2VQYA 3QK0A 4KK6C 2CDGA 2IQAA 4ZMNA 3E9TA 3L4WA 3O4LE 1P2CA 4PYHA 1MG2C 2JDCA 5CJOL 1WA2X 3QARA 3W9DB 1AXTH 3KNBA 4KUBA 4NZUH 3GIZH 1JZGA 4MA1B 2IV8A 5I0DA 3THMH 5HPMB 3HFFA 1Z9PA 4Q38A 1NAKL 1CIUA 3LCYA 1Z9SA 1PU9A 2J2ZA 1GS6X 4ETQB 1TDQA 3WABA 5EF2A 1J10A 3D25A 4Z7WB 5JIMA 1F2OA 5HMNA 5T3ZH 3M88A 3K8KA 4ACPA 2BZCA 1HDQA 1BG9A 1I31A 3OAYK 4ZXBB 2QQNL 3ULVF 2LU4A 3EYVB 3PAVA 1IQWL 4JKMA 1ONQB 3R8QA 5FS5A 1FNLA 5SWSA 4DNLA 5C6TL 4ZT1A 2HMID 4Z7OF 2AQPA 4TNVK 4B12A 1IBDA 3E8VA 4HPHA 3GMMA 3AS3A 4RCAA 1RPUA 2FECL 4ZPVB 3B9DA 3TEUA 4LQFH 2VI7A 3DK2A 1OTSC 2XYBA 4MRIA 1ZLSL 2PR4H 3HHMA 5DUJA 3U46A 1GMEA 4W9EC 4F8NA 5FYLH 4FHKA 2IWGA 3DMMC 2H4EA 3KPNA 5FCUL 5EMYA 3BD4A 5ESAA 4Q97A 3VGEA 2V3DA 3T0XA 2NYKA 2PIZA 2JTDA 3QCVH 1EVUA 2CLRB 1MLBB 3DNSA 2DYPD 2I7SA 4B5PB 1IGJA 4LGSB 3UIYA 4LLDB 2CF4A 4K3EH 4EQ3A 1HI6A 1YDPB 4MA7H 5D9SA 4V1DD 2QL1A 3H6JA 3WS3B 4ABWA 1T6WA 1A4JB 3L1OH 1UH4A 1T2JA 4ZS6C 3TBWA 1GGCL 1F57A 2Q04A 5CJOH 1KJVB 2F58L 3H3PL 4NKIH 1D5ZB 2FWOB 1DBBH 4E68A 1H3WM 2OXGA 3DUUB 4GW5A 5LRJA 5I1JL 3HPJA 4D94A 4UU9A 2HTLD 5AOZA 3S35X 4W9LC 1J88A 3HLPA 2C9PA 4FL4B 3Q2LA 3MYZA 3FB8B 3O8XB 4J27A 1FFOA 4NPKA 1MWAL 4KOVA 4C56E 1N6QH 1OM9A 4DKAA 4POZD 1ECZA 4NAJA 5T1KA 3SDCB 2VDNH 4N5ED 5I5MA 1Q38A 2DAVA 1QFWL 5E0FA 4TVUA 4BH8A 1AP2A 4I8DA 2CR3A 5ICYB 2E7DA 1XMTA 3L5IA 2EXWC 5I2IB 1ZE3H 2Z35A 2H3NB 4NI6A 5HVWA 3B5GA 5DD3H 1HK6A 5DYFA 4OIWA 2NY0D 2QDVA 4I4WB 4IMKA 3N40P 3KHQA 2C3HA 3DJZA 1SXBA 2IADB 4JKLA 3NH7L 1U91B 3PHOB 1VZHA 3VXNB 4UTBH 2XKSA 1RL1A 1M4KA 5KYXB 1KN2H 4X6BB 4XMLH 2D3JA 1ZJAA 4IMLA 4YVUA 4DP5X 1R1CA 5A2IH 4A2MA 5KSBF 2GEQA 4NKDA 3P9WB 4NUPA 2VLKB 3VXPA 4MXVE 4LHUB 1A9EA 2Y5EA 3MV9B 1INQB 4ZDHA 4YK4C 5MENB 5KVMC 2ZPAA 5GGSB 4GW1A 2I25N 5F7WC 5HVFB 3ASOB 3SJVB 4KXAA 5IEKA 4G72B 2A74C 1GYWA 5FYJL 4JZ0A 4J3OH 1HHIA 1KCUH 2F5AH 4LPUA 5T5FA 4G6KL 2YGPA 2WSDA 3IDUA 4UILL 2WQUA 1N6UA 2ZSVA 4XMZA 4YEEA 4IMKC 1HNFA 5AKSA 4YHLL 4IHOA 4KHXL 3VCLA 3EJZD 2ZW5A 1QVOB 4MFKA 1NLDH 3UPRA 1UM4L 1UA7A 2MPAL 3TONA 3T0ED 2DYPA 1X5ZA 2NX5D 2VDOB 4YHMH 5IR1A 4HSCX 4R4FL 4HUWB 5E0QA 4XCCH 2FQGA 3KGUA 1R5WB 3C5SA 5ITBL 4Y7MA 2HVKA 2CKNA 3L9RB 5IHBA 3LSOA 3B2VL 2WWMC 3ZE1E 3CH8A 4FCHA 3JVGA 4QOKD 1DBKH 5GSRB 4HJEA 4O58H 4RMQA 5T3ZE 1RERA 1ITBB 2B1AL 2CKBB 4K94H 3UBHA 1AQMA 1L9PA 2JKWA 3IXTA 3AAZB 1KTLB 4AXVA 4QHNA 4D9QE 3SY0A 4MDIA 3T04D 3RUGB 1NDGA 1MHHB 4H13C 3BRFA 5D70L 2H3XC 5EZOL 2HX7A 5T3XE 4N8PA 3BJ91 4P2OC 1UD5A 4X6CF 4HCRH 1TIQA 1NANH 1E4XL 3BX7C 2VN5A 4HUUA 3OJ2C 3LD2A 4MCRA 4HMCA 3BD5A 2FAUA 3OJDB 4XOBA 2Y6SC 4JO3H 4FQLH 2F8OA 4ZTOL 4Y1SA 4HPYH 4AVHA 5IVNA 1N3NA 1DVFD 3PRZA 3P2FA 3R19A 2X1XR 3RWCA 2VNCA 1ILUA 4LLYB 4FYSA 2D7TH 3CLEH 1MW1A 3B3IA 3QISA 3QFDB 1UXWA 3DBXA 4BUGA 5DD6A 3HUJE 1NFKA 4KSAA 2DQIH 5E99L 4YHOH 3VSUA 4HEPA 5IQ9A 1ZAGA 2RC4A 2FIKA 5DLML 2IFFL 1OD7A 2XG4B 1BCIA 3MCLL 2DRUA 4NM4H 5DMGD 2HKHH 1I7RB 5DD1H 5ALCH 2MIZA 4Z0BH 4N0UE 4WEUD 3F2LA 5FHBL 2C6CA 5IHUH 1BREA 4PV9A 1AHWB 2FYYA 4WI2A 4HDIA 1JHKH 4DP6X 5ISZE 4P44A 5AKRA 4YMPA 1U9KA 2DEXX 4ZFGH 5GS1C 3F01A 3U1SH 1QWNA 1NCBL 4G9DA 2F74A 3W5MA 2DQGH 1ZJBA 4MKTA 5EN2A 4OZ4B 4XPTL 4Y4KA 4OFKA 3F58L 1OAQH 3DXAD 3LQAH 3P4OA 4NFRA 4HNXB 3VI3A 4U0QB 1UOKA 3ARBD 2V9QA 3HI1A 4Y5YB 4A2ZA 2A9BA 3KXFE 1BQLL 1JPST 1KZYA 3BZEA 3FF3A 4JDTH 4E0RB 3SDCC 3ISZA 4V11A 3RAJH 5JOEA 3TF4A 4L5FE 1YEIL 5EO0B 2BJML 2NY5H 3IGFA 3O8XC 4WFHE 4FL4C 7FABH 3ULAB 3KD4A 1A66A 1V55B 5EUOE 5FO9A 3T1FA 1KCSL 1KPUA 1DFBH 2VQTA 1GW0A 1UACH 5FECB 1SMOA 1S6NA 35C8H 5FCSH 5L8JB 2HN7A 4AGQA 1NWPA 2HFFA 4PSRA 2X4TA 3Q5YA 4JAMB 1N10A 5HHOD 2HT2D 4IDLA 4DKTA 3AWEA 1P1ZA 2J5LB 4MXQD 2REEA 5FGRA 4Q4IA 4LP4A 1QQDB 3BAJA 3LXUX 4U1SA 4QXGH 1H6FA 4HS6A 3FCBA 4N1EA 3RHWK 4NQUA 4DGYH 3RVUC 4YFEA 3WXWL 3VXMB 1OAYL 4MNHB 2B1HH 1NAMH 5TDOA 3MJ9L 4ALAL 2LE9A 4LHUD 4UTAH 5HDWA 1J8HD 4NNXA 4JXQA 1G7MB 2GT9A 4TULL 4UQDA 5H37G 3NIGF 4ZS7H 3H9SD 1N6VA 4ABUA 3VFOB 5KW9L 4X5LA 5D7JD 4X83A 2WUCL 3NRFA 3MUHL 4AV4A 1MCOH 3LN5A 5FM8A 3BI1