4B6ZA

Crystal structure of metallo-carboxypeptidase from burkholderia cenocepacia
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
382
structure length
380
Chain Sequence
TLSITSNFDAGAIDVVSCDSPDAIRLRVRGDNRSEFAQWFYYRLTGARGERCVMTFENAAECAYPSGWRNYSAVASYDRVDWFRVPTTFDGKTMTIDHTPEFDSIYYAYFEPYSEERHAAFLGAVQQLPQASVVELGRTVEGRPMSLLTLGTPETAPKKKVWIIARQHPGESMAEWFVEGLVKRLAGWGDWAGDPVARKLYDRVTFHIVPNMNPDGSVHGNLRTNAAGANLNREWMAPDAERSPEVLAVRDAIHAIGCDMFFDIHGDEDLPYVFVAGSEMLPSFTEQQGKEQTAFIEAFKVASPDFQTEHGYAASKYKEDALKLASKYIGHQFGCLSLTLEMPFKDNANLPDERVGWNGERSAALGAAMLAAILVHVDTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title High-Resolution Structure of the M14-Type Cytosolic Carboxypeptidase from Burkholderia Cenocepacia Refined Exploiting Pdb_Redo Strategies.
pubmed doi rcsb
source organism Burkholderia cenocepacia
molecule tags Hydrolase
molecule keywords FAMILY M14 UNASSIGNED PEPTIDASE
total genus 140
structure length 380
sequence length 382
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
A PF18027 Pepdidase_M14_N Cytosolic carboxypeptidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3120 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4b6zA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4b6zA02
4PXDA 3DLJA 7CPAA 1BPMA 1R3NA 4F9UA 4A39A 1TXRA 1XMBA 2CTBA 3B3VA 1Y0YA 3B2YA 2ZEFA 2NYQA 3D4UA 1Y0RA 2PJ2A 2CTCA 1OBRA 5D29A 1LAMA 4NGRA 2PRQA 2ZEEA 3PBEA 4MRIA 3RAMA 5THWA 1KWMA 2BO9A 1Y7EA 3NFZA 2AFOA 4NGNA 3KR4A 3LWUA 2ZELA 2I3CA 2BCOA 4FUUA 4MCPA 4OMEA 2GREA 4ZY1A 2BOAA 3NA6A 3FJUA 4P4DA 3PBBA 4NGSA 3LMSA 4P4EA 3FVLA 2IMOA 3PB9X 3PFOA 3B3TA 5DS0A 3KQZA 1XRYA 4WJBA 1BPNA 3N5FA 3D7GA 4WWVA 4O23A 2PJ9A 4YWYA 3TX8A 2PJ1A 3SJGA 4YU9A 2AFXA 4F9VA 3PRTA 4IK2A 1JQGA 4P4FA 4ZYQA 2PJ8A 3SJFA 1TF9A 4TWEA 4A38A 1TKJA 3FEDA 2AFWA 4UIAA 3B7IA 4OIWA 2C6PA 3JRUA 4FWUA 1XBUA 2PJ5A 1TKFA 4NGQA 4OC5A 3IWWA 1VHEA 5JGFA 5HVFA 1DE4C 5CBMA 3FH4A 2AFUA 1LCPA 1CX8A 2PJ4A 1Q7LA 1ZLHA 4IHMA 2PIYA 1GYTA 2POKA 4H2KA 5LRJA 3SJEA 2F8HA 2ZEHA 3IEHA 4ZI6A 2V8HA 2C6CA 2PJCA 1TF8A 4Q7AA 4A37A 1ZG9A 4R6TA 1Z8LA 3S9LA 3RZAA 4MHYA 1XJOA 4FBEA 2Q43A 3SI1A 4P6YA 2XEFA 2CF4A 3FEEA 4P4IA 4ZY0A 4OP4A 1CP6A 1IGBA 3FX6A 3B35A 1RTQA 2PCUA 3VARA 3I1UA 2Q4ZA 3ISZA 1ARLA 5JM6A 3CDXA 3MN8A 3WT4A 2V8GA 3FMCA 2QYVA 2ABZA 4PXCA 2ZEGA 2QVPA 4MMOA 1F2OA 4FAIA 2EK8A 1ZG7A 1AMPA 4NGTA 3CPXA 4A94A 1F2PA 5F09A 4MHNA 1HDQA 4MHPA 2V8VA 5CPAA 4MXUA 3BI0A 2PIZA 1YW6A 4JYWA 3KR5A 4R76A 3D66A 3CT9A 1VGYA 3D7DA 3PB7X 5LYIA 2ZENA 3RBUA 1H8LA 4X2TA 2ZEMA 3KGQA 3WABA 4RUHA 2EWBA 3PFEA 2GLJA 4NGPA 2Q51A 5HVHA 2PJ6A 3NH8A 4DJLA 1F57A 3H8FA 1ARMA 4PXEA 4K3NA 5LRKA 3D67A 2XEJA 4EMEA 4UEFA 4B6ZA 2ZOFA 1LFWA 4OKOA 4ZX9A 2JBJA 1LOKA 2PJAA 4PXBA 5JH9A 3B3WA 3WC6A 1ZG8A 3CPAA 4OC1A 4OC4A 2JEWA 1FNOA 4NGMA 4JZ0A 4DYOA 5LRGA 1NSAA 2WZNA 4PQAA 4ZY2A 1UWYA 3IJ3A 3BI1A 4X8IA 2PE3A 3HUVA 3K9TA 2PJ0A 4ONWA 1VHOA 1HDUA 2AFZA 2V77A 1FT7A 5ELYA 1ZLIA 3ISXA 5LYDA 2GLFA 1CPXA 3PEIA 3GB0A 2J9AA 3QNVA 3BHXA 4UIBA 4UEZA 4MHZA 1EE3P 3NH5A 8CPAA 1CBXA 3V38A 1YSJA 1YLOA 1VIXA 3BXMA 1QMUA 4GM5A 2HC9A 1PYTB 3FF3A 3KASA 1LANA 4P10A 1CP7A 3T8WA 1YMEA 2ZEPA 5HVGA 1BLLE 2NSMA 1BAVA 3WC7A 2ZEOA 2ZEDA 3IC1A 3D7HA 3KQXA 3KHZA 4NJRA 3WC5A 4EFDA 4LQGA 4CPAA 3S9MA 4PPZA 2JBKA 2EK9A 3KHXA 4P45A 1TKHA 3KZWA 2XEGA 2O4HA 2AFMA 4EWTA 3D7FA 2VL1A 4MCQA 1PCAA 5K8NA 5D8NA 2ZOGA 1HEEA 3SI2A 1DTDA 4UEEA 3VH9A 3GUXA 4G1PA 4NFRA 3TC8A 2PJ3A 4R8FA 3V7ZA 4UF4A 4OIDA 4F8ZA 1LAPA 2IQ6A 1CG2A 3D68A 4TNUA 2GU2A 3H8GA 4P44A 1ELMP 2CIJA 2V8DA 5HXDA 2IJZA 2C6GA 4P4JA 1Z2LA 3B3CA 4KSIA 3SI0A 4R7MA 3PB6X 2O53A 4W9YA 2DEAA 1CPSA 4BD9A 3K2KA 5I4MA 5LYFA 4X3RA 3IFEA 5LYLA 3SJXA 5K8PA 2PVVA 2PVWA 2ANPA 2OOTA 1ELLP 3IIBA 2QJ8A 5J1QA 2HB6A 4MCRA 1Z5RA 3KL9A 4IAVA 2PJBA 4ZX8A 4AXVA 3MRUA 1IY7A 2RFHA 2RB7A 3NH4A 5K8MA 3VATA 3L2NA 1XFOA 3H8EA 2XEIA 4P4BA 1YW4A 3DGVA 3PB8X 1QQ9A 2G9DA 1R43A 5K8OA 3GLJA 3FECA 4NJQA 3IO1A 2PJ7A 4MCSA 1M4LA 4DUKA 2FVGA 6CPAA 1AYEA 4OC0A 2AFSA 4Z65A 3B3SA 2WYRA 4OC3A 3S9NA 3KI9A 3PB4X 2C1CA 2OR4A 3HLPA 4OC2A 5IB9A 2F7VA
chains in the Genus database with same CATH superfamily
1XH1A 2J8HA 5GRVL 2VDOB 3HRZA 1SY6H 3PL6C 4PXDA 1IC1A 3HC3L 1UZ6F 3RVWD 1A21A 3VFVA 4K73A 4LARH 3AWEA 4Y5VC 3RX7A 3T65A 1OF2A 5LGKA 4U5YA 5DQDL 2I25N 3GF8A 3BO8B 4H8WL 5LO7A 2CO6A 5C0FA 5KTAA 1AOZA 1Y0YA 3T2NH 3FUDA 2FO4A 2W94A 1G84A 3VRJB 4K71B 3QFJE 3GSNA 3OV6A 3M8OL 3GMQB 2K4WA 4Y2DB 5A27A 4G8GE 1XE4A 1FFQA 5F96L 1WAPA 3SJVD 1DANT 1MJAA 1NC2B 3CZFA 5FYJE 4KKBD 2NUTA 1A1OA 1VFBA 2N7BA 3OG6B 2IF7A 2JTDA 3SDDB 3SDAA 4G9FE 1TYEB 4O4YL 2HQYA 5KJRL 4ANXA 3KE0A 3DGCR 4PTUB 4QY8B 2ZG1A 3VE0B 4FN0A 3V6OC 3HMXL 3K8KA 4ODUB 4OLXL 3QZWB 4FNQA 4BSWA 4BZ2A 2AEPL 2GT9A 1ERNA 3ULUE 1YYLH 1KPRB 4NDMA 3ATAA 4H8PA 4NNXB 4L8SB 5DJ2A 3IDIA 2Z0ZA 1QFWM 3OMAB 5LNEA 1OAQL 4GXUN 4M7JH 5EOCL 3DUSA 2EXSA 4XPTL 4FKKA 2G5BB 2P5EB 1D7FA 5CGYC 1BA9A 2OMUA 5D1ZI 4Y2OA 5JHAA 2A9NH 2FJUB 2VN4A 3PB9X 2P45B 3S97C 1EEZB 5FUZH 2WMPA 4Z3GA 3ARGA 4ZFZB 4ZJ9A 3NT0A 4PJCB 1A3RH 4ETYA 1U4EA 3UBXB 1YECL 2QR0A 5E5UB 5E9NA 1OSZA 3MUZ1 1HOCB 4JKMA 3S88L 1IILE 2EDJA 4PJBF 4W9KC 2AEPH 1LMIA 4O23A 2I60H 2Q2LA 3LKNA 2ZUTA 4XPAH 3NSXA 4OZIB 5EUOE 1JIBA 1TZGL 4OB5H 2JIXB 1BGXL 4GRLA 4JDVB 3MCLL 5C08A 2AFXA 1ZDSA 1TMCB 3LNGA 5KJRH 3RNKA 2GK0A 4IK2A 1RURH 3WIFB 1IEHA 3GS4A 5TE6L 4Y9FA 3ZRFC 3T0DA 4QOKA 3HE7A 3QXAB 5FR3A 4JL2A 5IM7A 5FPIA 3FQTB 5IB1B 2CIKA 2D7MA 3U4KA 1MCCA 4Y4HD 3O6KH 1XD0A 4OCLC 4J3UA 4YO0A 5I5MA 1U3HC 4HS8L 3RWEB 2NY3C 3SGEH 5CIPB 3MLVL 4M1DH 1S5HB 4NJAL 2C6PA 2XWJB 1TLMA 5D6DC 4AEIL 1X9LA 3F2LA 5LBGA 3GEFA 1FFTB 4FWUA 1LO2L 1J9RA 4ZUTB 1YMME 1ON0A 1B6UA 1YYCA 1NEZG 1XCQA 3NDYE 4M7KL 4M3SA 4NEXA 1NGXA 4S1QH 2B0SH 2ZP9A 3VFMA 2V5SA 5DLML 1XCWA 4HEPA 4HJUA 4JO2H 1VADA 3MRMA 5CF3A 2F1EA 3FH4A 4GIAA 4GQ9L 2AFUA 1KIUA 1TTFA 4OFYD 1IKNC 1WHOA 5CP3H 1QSEE 2B15A 3Q01A 5FOBB 3AQYA 1L0CA 1EX0A 4JDEA 3T1FB 2OXHA 5F0JB 1YJDH 2JH2A 3PV6B 4H26B 9PCYA 1CI5A 5IB0A 4HD9A 5E96A 5HDLA 4NO5A 3IEHA 2F58H 2O5XL 2V8HA 4WY7L 1ES0A 1TQCC 4Z7UF 1YVLA 5BO0D 3ULVF 4G1MA 1G7MA 8FABA 3C5JB 2HWZH 4MD0A 3TNMB 1KXQA 4UYQA 5DHYB 2BC4B 2Z3LA 1QSEA 2BCKB 3WE1A 3KCPA 1QLFB 2BVQB 1TPXB 3QI9C 5KBMA 1XSOA 5MERB 4ZY0A 1CLYL 2IH8A 4FL4B 2HJFA 1M4IA 2BP0A 2X6MA 3JWNC 4XNBA 1E9PB 1LQBC 5D1XC 5IVXE 5TK4A 1CYWA 1GAFL 2YZ8A 1IGTB 4JN1H 3VFOB 4XOBA 4JFTA 4WUUE 4YOKA 1L6ZA 5HDRA 1MCDA 1X5YA 4QHLB 4AGNA 5FUOL 3NP3A 4LF3A 4MXWL 4P23B 3U7WL 1HXYB 2HJLB 1R3KA 3CXHK 4LP5A 2MCG1 1LEKB 3UBXG 3JVGC 1S78C 2W1NA 4NN7B 1WT5A 3LACA 1JF6A 1T7VA 4ZNEE 5CLYA 1U95B 1BXAA 1JN6B 4BSVB 4EXPX 5I6OA 2EE6A 3C60D 3RL1B 3WSQH 3TA3D 3BUDA 3Q8EA 3U30B 4HJSA 1ZTMA 3B7SA 3FTYA 1D5ZB 4PJ5E 1ZHBB 3D2UD 4Z7NB 4ODXB 4LEOA 1NCCH 5AAWA 1A4KA 1LO0H 4XCCL 5JXED 5DSCB 1MDTA 4KI5D 4LRIA 2JKXA 5D2NE 4ES9A 1Q9WB 4A30A 1WH0A 2B7DT 3TJEL 3CN3A 1Q9KB 3GDCA 5I30H 3QCTH 5IMMA 1A7OL 4QCIA 1MEXL 3QXDA 4MWFA 5KYUA 2PR1A 5L4IA 4ORFA 4A95A 3FUEA 2G0LA 4XP5H 5FECA 2R1IA 4ZX4A 2YD7A 2VDMH 3WJLC 1HYRC 2AJZB 1N7ML 1TZAA 4QEGA 3MCYA 2Q4YA 2DQIL 1SFDA 5DEFA 2O6CA 3LQMA 5B7FA 2Z65C 5IQMA 1NC4B 3E38A 3IJEB 4KKBC 4PLNC 4NQVA 2K3TA 2WZ0A 5LUMA 2I26N 3DWTA 3TYFB 3MRIB 3OKKA 3IPEA 4ATTA 4B96A 1BBDH 4IKKA 4WSJA 1NM9A 1NCOA 3R1GH 4UI2A 3F8KA 1HDMA 5BS0B 1KTLA 4R97B 2YWYA 5K1JA 4OCMC 5IB2A 3O2DA 1Q8MA 1YEIH 5DD0H 3VXPA 2QSCL 5IJVA 2DQTH 4XPTH 1U91B 1DHKA 1R0AH 1RY7B 3NJIA 4H5SB 3P02A 4LKXB 4CC4A 3FXIC 1MHEA 4FC3E 2RIKA 5HPMA 4QNPF 2C9UA 3VGBA 2OJEB 3L4UA 4JG9A 4ZO7A 5LRGA 1X7SA 4JG5A 4JN2A 1I1YB 2CO2A 2PYEE 4JKLA 4MNQD 3QUXA 3MRGA 5FDWA 3SQBA 4I9XA 2YQGA 3QH3A 2KHAA 4IRZH 1BFSA 3GBLA 3ARPA 3U4AA 3DX8B 3ULSA 1VHOA 1T2JA 3T8XB 4DN3L 2WXGA 1CIDA 4Y2LA 3FTZA 5DA4A 4BIKA 5C7XL 1AE6H 4PUBL 4NENA 3GDBA 5HVFB 3LMJL 1EV2E 4TVPH 4LSTL 3UADA 3UTTE 2ZP8A 4KKLD 2O6PA 1OZPA 4B9YA 3QNVA 1LP9B 1QI4A 5C0CE 1B0GA 1OAZH 3NH5A 4JPIB 1KB9J 5KS9A 4LCWD 4X4YA 3BXNA 3T8XA 1WJ3A 2DW5A 3C5ZA 4JFEA 1H6UA 2Z91B 2VE6B 4M03A 2X6AA 1JZIA 3VXPB 4LUAA 1UOLA 4GM5A 1J8RA 3ZUNC 3ZO9A 4X8JA 1I85A 3L48A 1ZT1B 1KCVH 2WWOA 1CD1A 1YMEA 4XNUL 5AOMA 4XC3L 4XMLL 3F05A 4IBYA 4U3SA 4Z7WB 1JZ2A 4ZTEA 2CKBH 4JRYB 1L9QA 4Y8AA 1AQHA 2NT0A 3IMBA 4HX1B 1S3KL 2MHAA 2WQWA 4G8EB 4EVNB 4GW1B 1YLEA 3JTTB 3RQ3A 5T1MA 5KVFL 4NQSA 4XPHL 1JDAA 3KL0A 4LOFA 4NKOB 1NCIA 5CHNB 1G0XA 1HS6A 4CJ1A 5BQDA 3ZE0F 1I4FB 3S9MA 4O2CA 1K72A 2YRPA 4K5OA 2ITCA 2EK9A 3PFQA 3CV5A 5FFOA 5FGCB 3VJ6A 2RJMA 1KBPA 3EH4B 3QW9A 1ILSA 4P5KB 4LVNB 5B3JE 2OSYA 4I3SH 4W9LC 3ZHFA 4FAAB 1G87A 4ZBJA 1J1XL 5TTRA 2V5RA 5KBLA 1HXMA 4LLAA 4RDBA 3WKQA 3SZKC 4QRAA 2F08A 2OZ4H 4NXSA 1WD8A 3ULUH 1I1YA 2OCJA 4L0ZA 2PTTA 2PWDA 3EXLA 1BVLB 5ID1A 1INQB 1AD0B 3VU2A 2V33A 2HLAB 1Q9WA 2FBJL 5AG5A 1VGEH 1LO5B 3NIGF 3PG2A 4UYPA 1HEJC 2DQCL 4IBLT 2I69A 3GZPA 1RZ8A 5D4QA 1S46A 4NZUH 3TEYA 3KKWA 2FECL 3MNVB 2QADC 3MRLB 5DJZB 3WLWC 4EBQL 2GEEA 3KBEA 4FQ2H 5DJXB 3BKJL 1Z2LA 2H2SD 1G5GA 5DJ8B 2Q1EA 4I77L 3KPPB 4CNIA 4XMPL 1WWAX 5C07A 1WLHA 3GJFK 3VRIB 4PJEF 1D9KA 3C2AH 1AO7B 4DFHA 2NZIA 4CN1A 4CN6A 3RPIA 2G5RA 3LXCA 2BP0B 3S36X 2I07A 1ZMYA 2W0FB 3IETB 4N6RA 4F15C 2Q7SA 3QAHA 4CRZB 4I0PB 2E9JA 2EUXA 3B8YA 1JFQH 4D0CB 4JLYA 2AZUA 2XIIA 1UOKA 3WD5H 4I2XA 1IO4C 2V2TB 1ELLP 2N1TE 4X9YA 5KYUB 5C9JB 5J1QA 2B3IA 1C5DA 3MGAA 1ND0B 1U8KB 2IAMA 1J4JA 4M43H 3W9DA 3FTWA 3ALPA 5B39B 2OL3B 4M5ZL 4KMTL 3W2DL 3KL9A 5JYMA 4DP9X 3BKYH 4IAVA 3P0YH 3UZVB 3CU7A 3ATFA 1E6JH 4PJXB 4WNJA 4HUMB 1YC7A 4KKPA 1U8QA 2NX5D 3VATA 4MXVE 5HH1A 2VLRE 1MJUH 2AEQL 4XMZA 1K6QH 5LGHL 3PS6A 1J10A 2ZUWA 3NJVA 5JQ6L 3ILQD 3MFFA 4P4KD 5T3XD 1LK3L 1EH9A 5IVNA 4EI6B 3MUUA 4PGZA 1H3GA 1BVKA 3WNKA 1AC6A 3IO1A 3QR1A 1X5ZA 2WVUA 2LU3A 2A9BA 1FVCA 2ENJA 2FBRA 3GRWH 1U30A 3IJSB 4PWHA 1DVUA 2XT1B 2I00A 3JWOL 3I9SA 2OTUA 4UCNA 1QQDA 3QZBA 5EBWB 2CMRL 2OSWA 2APWA 3G6DH 3DBSA 4JKWA 3US9A 4OC3A 3HBGA 3CC1A 5FAAA 1PDKB 5MP6H 1V7MH 3HLPA 3HMXA 4OJAA 3K1DA 3KPTA 4BK5A 3BD5A 2DQTL 2E7LC 2VJXA 3TBBA 1U6MA 5AAPA 1XIWD 5F72S 4QAMB 3HEIB 3GI9L 5MEOB 5DJDB 3K8LA 4EZMA 3ARFC 3H3BC 4UUJA 3FSOA 4R4BB 2WBJA 1OTUD 1G0DA 2XQBL 3MLZL 5C3IA 2X4PB 4MX7B 5EUOF 3NH7H 4AMKH 2QQKH 3BDXA 3NCXA 1UFUA 1U8IA 4ZTPL 1DFXA 1ZWIB 4K2UH 2VC2B 3VFRB 4ANUA 4F7PA 1DVSA 1FZMA 3L4YA 4PJBB 4HULB 2UXTA 1KXTA 4G8AC 3VYNA 4G80A 5I76A 4QTHA 5PAZA 3CFBA 4EUPH 4ANWA 2X40A 1OW0A 3IFOB 4LSRH 5I6PA 3A22A 4AKOA 5HDOA 3DVGA 4KK5D 5EOCJ 2EEAA 1DJZA 1M9SA 3DV4B 3NOIA 1A6UL 3QDJE 3FCBA 1H0DB 4JHAH 1KCWA 3VXME 2ZELA 4XWOC 2WC7A 4Y5XC 3QEGH 5D70L 5BRZB 2H0PA 5AVXB 1D5IL 1M7IB 2AI0L 4R26H 3VRLE 3TZVC 4EVNA 4N0YH 2VC2L 4XMTA 4HSQA 1P0HA 3RTLA 1M57B 2YHGA 3ISRA 3N50A 3PDDA 1ZLSL 4ZZFA 1FVDB 2ENYA 2BOAA 5FYLL 4U3SB 4C59B 4NQEB 3JWNE 1KPVB 43CAA 4NGSA 4DVRL 1R4XA 1YN7B 1KTBA 1UD5A 4WW2F 4DJMA 1RK1B 4TNVF 4WFHE 4PY8I 1E27A 2F7PA 5A7BA 5I18H 4JWPA 2DQ6A 1PFOA 4Q2ZA 1XL6A 4NNXA 1MCWW 1NAKL 1XAUA 3W39A 4N3TA 4A7QA 3RZCB 2EVJA 3QZWA 1MCFA 2R4SH 1V0CA 4RMTA 3IS1X 5F7FA 4J1UB 5F9JB 3I3EA 2LOEA 5E8OB 3L4WA 3DIDA 3FCTA 4FFTA 4FLOA 4P46D 2HUEA 1W0VA 1UYWH 1E27B 2B2XH 4L1SA 3UOAB 5CJOL 2FTAA 2FJSA 4Q38A 1CU4L 4YDJA 3EOTL 2X4NA 2OMVB 1EVUA 1YEGH 4WI4A 3TEWA 4I5BB 2CSPA 1CYXA 1L0XA 1PLBA 5CEZH 4YS4A 4NHCL 4PJCA 5I5JA 4BJLA 2W88A 3NZ8A 3MLSL 2XQYA 3MBWA 5DK0A 3G6AA 1JCVA 4A2HA 4OLYL 1P7HL 1K6QL 5HPMB 2BRRH 1XCXA 2DAVA 3GJFA 4F1SA 2P8PA 4TQ8A 3A5VA 3WEAA 2W60A 2XPYA 3WKMH 1ID5I 1D9KD 2JJVA 2CO3A 4QRQA 4MAYD 4WNQA 3BVWA 3JRUA 4L4TA 4NZTL 4PRIE 3TBSB 1ORSA 3PWVB 5I19H 1TKFA 3RRQA 2PQ8A 3UZVA 3LXBA 5I1LA 3BH9B 5ECGA 5TPWL 3MRKB 2H2PC 4YFDB 4E8OA 4G11A 1YUKB 3QJUB 4PRBB 2R15A 5E6ZA 2AK1L 3IRZA 4MVBD 3U30C 1Q0XH 3SDXA 3TYFA 3QC6X 4R3KA 4AH2B 3IFPA 2RHEA 3D87B 1OOWA 3GRGA 4H0LC 5TK2A 5C2BL 2PJ4A 5C07E 4I2XB 3CPLA 2XN9D 1ZJAA 2CDEA 1FIGH 3B2VL 1SDDB 1Q4NX 3JV6B 4WZ9A 1RK7A 1MW0A 1E4JA 3KPRD 4Q9QH 3KS0H 3I9PA 3EDKA 1VIWA 1BQSA 4QXTB 5F9WB 5CEZD 4LGSB 2WTOA 5A2IH 5KSBA 3ZJAA 4BWWA 4LFHG 5M7QA 2G60L 4FOMA 5JHLH 1V5JA 2H1PH 3J8F7 1K3IA 3ZT6A 3ISWA 4PRID 2A9AA 5F8QC 1NUNB 2BWQA 3BIKB 5EORH 4XRCA 5HHQB 1NFAA 3FZUC 2Z31B 1G9MC 2AJUH 3KPPA 5EA0H 4CNIB 3CDZA 5D2LF 1OAUL 2WUCH 3BQUD 3Q8BA 4HIHA 5T1DH 2LQRA 3Q9PA 3KPNB 1ACYL 4LLUB 2QPFA 4X4ME 4HK3J 1GZQA 4YK4C 5IQ7H 1R3IH 1Y1DA 3KPSD 2VITB 1WBZB 3D52A 3VWKA 3HRZC 3QQ9C 4B53A 2NR6C 2EO8A 5KAQF 1RTQA 2VEZA 1U6AL 5INDB 1FAIL 1P5VA 1GHFH 3AC0A 3SDAD 1UM4L 3R06B 1OOAA 3PWJA 3RTQB 1RPUA 2PO6C 5JM6A 5JDJA 2ZQKA 3SE8H 3ILQC 1WISA 1N59B 5MHSD 4HKFA 4B5PA 2A99A 3MV01 3S3PA 1DN0B 3GSXA 2PLTA 4HZLB 5GGUB 4MFKA 5T3XL 2WIIB 2NY4C 1F97A 4PB9H 3FMGL 2ZKYA 4PJIB 4PJ5D 4FAIA 1X7QA 4RFOH 4G72B 1T03L 3WKML 3K72B 3QDGE 4YC2C 4YLBA 3PABA 1Q94B 5F3HB 5GRZA 3ZX1A 1T3FB 2KPWA 5E0FA 1MQKL 2E27L 2YA1A 1HSBA 3P9LA 4NM8L 4ELMB 5E8EB 1RJCA 4EIBA 3QEHB 2J88H 5KSBB 1D7BA 3I6LD 1RJZB 2OQJA 2AQ3A 1X7QB 3CVHH 3U1SH 4NCC2 3QUML 1PPIA 2BXYA 2ICEC 3TO7A 2Z3OA 5H4ZA 2PXYA 3BP5B 3AAZA 1JF1A 4OR1A 2EIMB 4AH2A 4DZ8B 1FN4A 5HVHC 1CB4A 1WFIA 4Z3JA 2ZEMA 5J8CA 2X70A 2LE9A 1NSLA 1UTDA 3FTXA 2YMTA 3VMPA 2DICA 3L3IA 2C9SA 4NJ9H 1T20A 2Q7NA 4FJZA 5H35A 3MLTA 1XF4B 1IGJA 4NCC1 2Z3NA 1MIML 4PG9A 1DL7L 5DLMH 1E5YA 3V0HA 1DFBL 1SN5A 2I5YL 2XY1A 3P3RA 3B7RL 1ARMA 4K3NA 1VERA 1VADB 2NSXA 4J4PA 4P46B 2XTJB 1KF9B 3ES6A 4DK6A 3UP1A 4HT1L 5E4OA 4AV5A 4GIOA 5E2WL 2DWDB 4DN4L 5EDXA 2OYLA 4KOBA 4NJAH 5IQNA 3APFA 4B6ZA 1A0QH 2ICCA 4JBSA 4ZX9A 2CUIA 4X83A 3C5ZD 4JFED 1Q0YL 1PTZA 4OLVL 3O3BB 4D0BB 1N64H 1Z5HA 4NIKB 3VSVA 5I73B 3DX8A 3HUJF 4LOEA 3EGXB 1MIEH 1ZK9A 4FG2A 4KDTA 1BF5A 4ZMNA 1UACL 4X80L 1KB3A 3EGSA 3FNKA 4FX5A 4PWEA 1OCRB 1XEDA 3VD5A 2YJLA 3KYOB 1PW3A 3L7FB 1KGWA 4Y5VA 1WWBX 4NYLB 1OQOA 4FABL 1IL1A 5EMYA 5J6HB 4EXKA 4PRHD 1ZA3B 1YEIL 3MLXL 1BD2A 2VDRL 1U91A 2W80C 3MO1A 3LH9A 3UPAA 4JCMA 3VVVA 4AMKL 1R1CA 3R1GL 3UAJA 2HFEB 3G04A 5C70A 5LYDA 1N5AA 1XGPB 2E3VA 2VYRE 3NESA 4TLKA 4U6YB 1OGTA 4ISVB 5BZXA 4UNUA 43CAB 4Z77A 5L8KB 2BLFA 1NAMH 1KTCA 1SM3L 3PWPE 2AK4E 4R90L 2X38A 4ZD3L 4ZMWA 3MRIA 5HHXL 1EZLA 3LKOA 1QBAA 2QSVA 4CYNA 1XB6A 1I8IB 4AG4L 3L81A 3ZE2E 4FD0A 2D7TH 1PUAA 4F33B 1UQSB 5GS2H 3OB0H 2ROXA 4MJJA 4GRMB 4N2FA 4PRHE 2H45A 5B3SB 1AQKH 3BOVA 2ZXGA 1LANA 1DBJL 1DLFH 15C8H 4OVUA 3WJJA 1M3JA 3HI6H 3QEQA 4IOIA 2OZHA 3K71A 3HMXH 4LVHB 4OLXH 2NW3B 4IIQC 3N44F 1CGVA 4MAYC 5BV7C 4GSXA 1N3NB 4H8HA 2NY6D 3RFZB 4FG6D 1MFUA 2ZONA 5FWRA 43C9A 3OX8B 1I21A 2Q9OA 5I28A 1PX4A 2KZWA 3EBIA 1R3IL 3KXFA 3B9KD 3BLPX 4MVBC 4FQXA 4KVME 1QRND 1BXUA 5C8JA 1OAUH 2FAUA 2WUCL 3QPXL 4Z3IA 4LZKA 1W2KT 3TFYA 3QGVA 5CGYD 4NNPL 2X89A 3ULUD 1OE2A 3QJHB 3FTVA 3BAWA 1K4CB 4JO4L 5EZIH 2PTVA 5ESAB 4HGWA 4GAYB 4JKPH 1JPEA 3F6LA 3NE7A 1SOKA 2LLLA 2V2XA 5EO9B 1OPGH 2J3SA 3CSBA 3LKRA 4X5LA 1KJ2H 4UEEA 4JDZA 3EOBB 5E4EC 2FIKB 2FEDD 4WHYH 4AGLA 1CYGA 4KOTA 4K7PH 2VDKH 2VZ1A 3NRQA 4M8VA 3AXIA 1SLXA 1P53A 3IFOA 4CVZA 3F00A 4TUKL 1HWHB 2GJ6E 2P52A 4JR9H 4LDEB 3V7ZA 3HRZB 3V6FA 2BCMA 4RQQB 1WGVA 1ZHKA 4TPRL 2FX7L 5BJTA 1UXWA 4JGMA 2X4SA 4N68A 3N91A 5A7EA 1FHNA 3KPSE 2ZNWA 1A5FL 1NMCB 4Y4HC 1CXHA 2IJZA 2C6GA 3B3CA 4XOCA 3DROB 4OY9A 4R7MA 4FQ2L 1ED3B 3L54A 3ZDYB 5E08L 2CXKA 12E8L 1NOFA 2NRDA 1LP9E 5I6NA 4QHMB 5KS9E 1HH6B 4IGBA 1BX2A 3CCHA 3EOAA 2W81C 4LAQH 1OGPA 5C0ND 2YBRB 2B3UA 1TSRA 1U8IB 4RFNC 2G9KA 1DEDA 5JO5A 4X3RA 5E23A 5HHVH 1E0OB 3PV6A 2BVEA 2MCMA 4HWEH 3W5NA 4XPBL 3N1MC 4S1DC 4XNZB 4DGIH 1BLLE 1QTYT 1ZPLA 1F58H 4WI6A 3F01A 5I1GH 1AR1D 1N26A 4PY7B 3S4SG 4OD3L 1W91A 5A2FA 5C9KA 3L45A 5EDSA 2QJ8A 5I1DB 1XF5A 1LXMA 2JJUA 3GO1H 4G9FB 4RX4A 4UQ3B 4F2MA 2HB6A 5G22A 2ZOWA 2O5YH 4X9BA 3QI9B 1QA9B 5MEND 3QZWG 1FRGH 4Z7AA 3U36B 2HFGH 5HVWA 4Y5XB 2X9WA 3WN6A 4APQA 4PJIF 3BKML 8CGTA 4KVXA 3OKEA 2OAAA 4NZ8A 4UTBH 1QQDB 1E67A 4XVOA 5K8MA 5DEGB 2PDOA 5DYOA 4H2CA 3B83A 4X7TB 3JWDH 2CGRH 4QHLA 1HT6A 3QQ4A 4C56E 5IHZB 2NY1D 2E6JA 2XKSA 3MRBB 4QTFA 5E6RB 2H5UA 4A7GF 1UJ3A 4AZ8B 3ZTNH 4ZOBA 1VESA 3EKCA 1E9PA 1JYVA 3PFUA 2EUIA 4ZS6C 2GANA 4E9RA 4R2GB 4PV8B 2Z7YA 4PV9B 2DKSA 5DA0B 3PCYA 1JPGA 3K0WA 5D2NB 4P5SA 2VW7A 4K3DL 4NHUA 5F0MB 3GMMB 1LTXA 2I60L 2UX6A 2AITA 1Z4EA 4OC0A 1JMZA 1U33A 4XCYA 2EYTA 2F1BA 2JQZA 5L7XL 3K3QA 2OH1A 2AABL 4TUOB 5HY9B 4PS4H 1RZJH 2R0WL 5H8DA 1XGQA 1FL3A 2RBLA 4K23L 3RZCC 3OR6B 4JM0A 5B4MC 2GY7B 1DJIA 4OJFL 5GSVB 5TDPB 1OLLA 4P5RA 4Z23A 2XWBA 1B6DA 5AD0A 1Y9WA 1JWUB 5DU7A 5DD5L 4D8PB 1OAZL 3PGDB 2WZAA 4ERSL 1HILA 3RVUC 4Z3EA 5BVJA 4Z5RB 2WB1A 4YSUA 1YY8A 3C60C 3JVNA 2DOCA 2ISDA 4XTRD 3LN4B 3B3VA 5J12C 4M3JA 5CEZE 4PM1A 5IP4A 1QNZL 2HVKA 2MJWA 5EOCH 2FK9A 2ZCLH 4PR5B 4IRJA 1FVEB 4OCYH 2JKLA 3FBQA 3RPIB 2Q86B 4NQCE 3MACH 2AEWA 3JTTA 1MY7A 3L3OB 3TOPA 3GMOA 1RXTA 3HG1B 4BGLA 1F3JB 2GG1A 2YEVB 1E8XA 3A67H 3P4LA 2GT9B 4I1RA 4ODWB 3LPFA 3QQXA 1R5VB 1Y0LA 1JPSL 3RAMA 5TFSH 4TRPL 1JV5B 1Z0NA 4GIPD 3VXOA 4P2OA 3SGDH 2F6AA 4QXUL 1RIVH 3PWPA 4DK5A 5K9KB 1CD9B 4KI5E 4Y5VB 3FPYA 4HK0A 5AVTB 3NP4A 2XFGB 4Y2DD 3LRKA 3OKDA 2BCOA 2WQUA 3WDJA 5CD5D 5I1AA 3NCBB 3V5DA 3V9CA 2HTLD 4B5PB 2B4CL 3NJMA 3NYKA 3CZFB 5FYKH 3U46B 1N6QL 5AKRA 3MZTA 1IBYA 4D0DB 3EJTA 4WJG3 2ARJB 4B5ZA 5JR1H 3GNMH 1ADQA 4BZ1H 4OGQC 4TL4A 1EXGA 1BZ8A 2ADGB 3ZU8A 1N68A 1BBDL 3EF7A 1DJWA 1KELL 1DQTA 1J0ZA 1RUQH 2YOCA 1RIUL 3PBBA 1NGPL 3LKSA 4GJTB 4U6TA 4RIRA 4POUB 2X87A 5D1QB 3SDCD 3K9UA 4X6DA 3QWOB 1Q9LA 4AQ8C 5JW5B 3FOMA 3EYOA 3E6FB 3EDJA 4C54A 3CNKA 2G4EA 2NY6C 4P05A 3RVVC 4Q9BA 5L8JB 4GSDL 2VDOL 1MWOA 3ZHLA 1OF2B 4OJFH 2YUZA 5FO2A 5IEHA 1JGDA 4UQAA 3QH3B 2ZAIA 3UEZA 5EIQA 1XF4A 2IH9A 4I9WD 4MSWA 2EH8H 1BZ9B 1CFBA 4WFFE 5E5RB 4G8GA 2DWSA 5EIIG 2Y3AA 1HAUA 1SFHA 2VERA 1P2CA 3VXMD 1B0IA 2OJEA 3KVDD 3DX0A 4ODVH 5DO2C 2Y7QA 3WGVB 2PJ9A 2GSGA 3LV3B 3WD5L 4LQFH 5ESVB 3L7EA 3VFUB 4BFIB 3E2HB 1K4DB 2GITA 1JQGA 1BAWA 3IKCB 4R57A 2PPDA 3VCLB 1UWGL 4L8SA 3VXNA 3ZL4L 4YIQB 2VE6A 4PJDA 3ZE0B 3UC0H 5E6IB 2WN2A 1NM4A 4QHUB 3DJZA 1I1FA 2UWEA 4WU5B 3LV3A 4ABUA 2B1AH 4Q74A 4MFPA 4PTUA 1FSKB 2WKGA 2NUPB 3DUUB 5F7DA 1ZT1A 5D1QA 3MACL 1OP4A 4NFDA 4V1DA 4K7PY 3BKJH 4ADIA 4OZIF 2TAAA 2WXNA 4BKLB 5EC2B 2DF5A 1X4XA 1DN2A 2DF3A 5F88A 2J8UA 2VLME 5AENA 2Z10A 3C8KB 3NZUA 4G9DB 5DVKA 4XMKH 5SV4A 3SPVB 2B3RA 3ULSB 3ZQ9A 2K78A 3GO1L 1P4IH 5M95B 4NO0B 1BQHG 3FS9A 2XWEA 3PHOB 1N6UA 4JRYD 3MBWB 3GSVA 2ZUQC 5KVDL 25C8L 3HKZA 4UQ2A 4KH2A 5LVEA 3SPGA 3PGPA 3GXFA 1XOVA 2P5WB 2OZ4L 2PN5A 3CXFA 4JPVL 5J8FA 3FRPB 5CSGA 4DOHE 4DKTA 5D1QC 4YBQC 1NFDE 4MJID 4L23A 2BEIA 5DYFA 1XB8A 1Q9OA 1JPTH 3CN2A 1F1GA 1ZSDA 4X7CC 5DQJB 5E95B 1SQHA 2ZD0A 3W9EA 4FGMA 4FEMA 3NIFF 2PWEA 3IMSA 4I85A 4XNMA 5E0QA 4KORA 4U1IB 1OM3H 1VPOH 1H19A 2ZSWB 2P6GA 3RZAA 3T0EB 1VFOA 2WQSA 1N18A 3OXRB 2OI9C 3GLDA 4M8RA 1TKWB 2P47B 1PZBA 4DGYH 4OP4A 1QSFE 4F91B 4AI7A 1WD9A 1R3KB 1GMIA 2B77A 2UWEE 1SXSA 2YGVA 5C6TL 2XXCB 4FHJA 1ROCA 1JHLH 2AK4D 4LESA 1BOBA 5EU3A 5DFVD 2VN6A 1BLIA 1SLUA 4MB3A 2DQEH 5HYQB 4RGMB 3ARFA 4YHNA 1HL5A 4NUJA 4MCZB 3GEWB 4HIJB 3SDDC 3RO0A 3L8QA 4ZTOL 4X6BA 4Z95L 3HZMA 1QFHA 4S1QL 2C3HA 5DI8B 2FS5A 4R3SB 5D7IA 2A4CA 3QYNA 4IMKA 2Q3ZA 3HE6D 4I3RL 3ABZA 3WE6A 5E2VL 3VNYA 4DW2H 1UZGA 1OB0A 3ARDC 2Z34A 1UJTA 3DVFA 4AVHA 1ODAA 5JIDA 2PPCA 5CO1A 1PKQB 4QWWD 4BV1A 3IFNL 3KVQA 5SX5H 4KUAA 4MHNA 5DYOB 4E2AA 2DMGA 2V8VA 3FK3A 2YOAA 1AKPA 2WYTA 1UH3A 2XTJE 4O5LH 2PYEA 1E9QB 2YSSA 4NOFA 2P1YA 2A2QT 3BPNC 1N19A 2YD3A 4YE4H 4CGPA 4YSDA 3ULUF 3CT9A 4JFOB 2YRZA 3EGDA 4XMUA 2VITA 5E99H 3D8PA 4KUCF 2CGZA 4KKNA 5CEXB 4GQRA 1NCDH 3CAFA 3MV8E 3FQWA 3V5KA 4BZ2H 4CVWA 2X3BA 2JI3A 3ZZSA 1UADC 3ZDYF 1GGBH 3NFNB 3L3OC 3EFDH 3PAVA 4LLYA 3I9AA 4XXCC 2BSBA 5JHDE 2L3BA 5JOPD 2D7PA 2PJ6A 1ZT4A 2CA4A 4CW1A 3NJFA 1UA3A 4XGZA 2QDVA 5KVMC 3A23A 5CEXA 1IGML 3KYNA 3O9WB 4QF1B 2AERT 4G6JL 1FLRL 1YQ2A 2UUDK 2FVNA 5C0CD 3ZMEA 3FONA 2K7PA 4LCUA 2F54B 1DO6A 3VFTB 3UAFA 1TZOA 4OU3A 4QD2E 5I6MA 5EZIL 5DHYA 3FU0A 1G94A 3AQDA 1L0QA 2KDYA 3HPLA 4P2QE 4GEJA 1Z5LA 5E8DH 2IQ9L 3M07A 3IU4L 3HE7B 5F7AA 2OR7A 4N9OB 3EOAB 2P48B 3IU1A 1PKQA 1XR8A 4AV0A 1A6AA 1J12A 3DXAE 1E5UI 3LPOA 5HD8C 2C3GA 4UMSA 3ZTDC 2VW6A 1YO4A 3ATEA 1AJ7H 1OARL 3Q05A 3P4OA 3WIHH 2J5LC 5AWNL 4U49A 2W9EL 4KO7A 2WKOF 3RDJA 4RISL 1UXLA 2J4WH 3WFCL 1IE4A 5JIMA 1TETL 3P69A 1A4AA 1GOHA 2K5TA 1S7RB 3KPRA 1KJ3L 3BI1A 3VD3A 3HUVA 2OSLA 2WSPA 2PJ0A 4HLJA 1P9MC 4HQQL 4IRZA 1FT7A 1MAJA 3QO0B 1R5IB 4JHUA 4L8CA 1S7QB 2JCCE 5FO7A 5K69A 3DO4A 4UZSA 1P7QD 2XX1A 2KLSA 3T4AC 1NFDB 3AG1B 4HEMA 5D5MA 3CZSA 3DO7B 2OR9L 1GYAA 2QPSA 1KEGH 3LB6C 3HHSA 5C08E 2C3WA 3KVPA 5E8DL 3ZK0A 1WFUA 3GM8A 3AREA 1G6RB 4L05A 2WBKA 4FFZA 4S1RH 1J7VR 3SDYH 3V8CA 5JPMC 1NJ9A 1INDH 1F41A 1I7ZB 2W92A 4YK4B 1PLGL 3WU1A 4XBEL 1QRKA 1WZLA 1WIUA 3CQPA 1GC1L 5KSBE 1RZ8B 1C9SA 3VWEA 2ZW4A 5C8JB 1EXHA 2R23B 4AIOA 1UKSA 3S8FB 2JK5B 3GXIA 4LASL 1OP3K 4JANB 5MEPA 1KGCE 2JFCA 1Q72L 2ZEOA 1CVRA 4HPYL 1ZSHA 3WNIA 4HJEA 3EF4A 3GHPA 4NQXB 3IC1A 4TXVB 5CBEB 5DS8B 5C0RL 4NBZB 3B6SA 3O8XD 4ZYKA 2A0LD 3EO1A 5IOPA 2OULB 3DPBA 5E99L 3HPJA 4P46A 5D5MB 5FO9A 2PO6A 3RKPA 1XGUB 3DOIA 3RDTC 4BYHA 1NMCC 4Y4HB 5AVZB 1B9ZA 2NQDA 3UTTB 4HPSA 1RIHH 3DURB 4UV7H 1TTCA 3IVKA 4YBQD 3TWYA 1IFHH 4KUCD 3PGCB 1AXSA 1IZJA 2UZPA 1YJDL 1GJIA 3OJMB 4HJ0C 4KJYB 4Y1AB 4JO3L 1PNCA 2OL3A 2DLFL 4BKTC 3WEXB 3WLWD 4B9KC 1ILUA 3O3UN 1YMMA 2VDLL 4DW2L 4FQLL 1BVZA 4NS0A 3H9SD 2VQ1A 1QYGL 3APCA 3OJVC 3VGDA 1KENH 5F6IB 5K9QG 4NFRA 3UP6A 2VLRA 3MRFB 1T4WA 3L6FB 4UBDD 5IWLA 5KW9L 2P5EE 3K6IA 2D7QA 3FUFA 3O3BA 4D0BA 1TPXC 2VH5H 2DDQL 2NY5C 1M7UA 2WK2A 4GPVA 3LTVA 1EANA 3S37X 3GSQA 2DWDA 2FD6H 2KZ1B 4HBQA 1ESOA 4E0RB 1CR9H 4ZI8A 5B38B 4C2ZA 1WFJA 3C5ZB 4JFEB 3OMNB 1VRSA 1NC4D 1SUJA 1KYAA 3RIFK 3QIUC 5ISZA 4DGWC 2ZOUA 3H3PL 3MLTB 4PY8J 4DUWA 4U9ZA 4HFWB 4FYSA 2D0GA 2H2PD 3DRTB 3IJYB 4FMKA 4WFHD 3VQ2C 1QPKA 1WBXB 2JXMA 1BF2A 3BAEL 5FC9A 3V79C 1A7PH 3J27A 1GMEA 4N90D 5F9DC 1KGCD 3RTQA 4NQCB 1CD8A 1A14L 3E80A 5JZ7D 5IW3A 4Y9GA 4BFGA 2N56A 4NQUA 3FT3B 4AQ1A 3RA7L 3WXVL 4EQ3A 1HINH 1A6TB 2EIKB 4X5KA 2ZOOA 4P2AA 2YXFA 1RUAL 3P0GB 2DLGA 4KX9A 2V5TA 4OCSL 2ZOTA 4Y4KB 1NLDL 1PLGH 3SD2A 1YECH 1MG2C 3CLEH 4P23D 5LCVH 4C55A 1N0LA 3SOTA 1X5AA 1GHFL 4PJHE 1AS6A 4IHOB 1ZV2A 4XMVA 5KYYA 3HZKB 4X6FA 1NCTA 1JCKA 3OKOA 4N3UA 5JIQA 3ARBC 2FL5A 3SGDI 3T6ZA 4DF9A 5SWZD 3OGOE 1HTYA 1P1ZB 5HYEA 5LLIC 5LQBL 5C0GB 2XKUA 3A6CL 3EYQC 1MNUL 4MXVF 4NWUH 4FD6A 1ACYH 3TP4A 1DVFA 4PJGF 3HZYA 4ZXBC 3WIIL 1WG3A 1Y7VA 1EZUA 2DYPB 4GUCA 4NHCH 5TE4H 2MCAA 3UTSD 1K5NA 5HI3C 4DP2X 5ID0B 3B8GA 5CN3A 5M94B 3FN9A 4WJ5A 3LQAC 3C6SB 2W07A 4YWGH 5DZLA 7CGTA 1IB1E 5FB8A 4L5FH 4FMFA 5LWYH 1QASA 3K4AA 1H6TA 5C0GA 2DD8L 2EKJA 3JWOC 5GSRA 5DJCB 2YKLH 1G9NH 4RSYA 1SYVA 1F4XH 3MJ7B 4ORZC 4GINA 1I8KB 3SO3B 4XVJL 3N7ZA 1ZTXE 5ID0A 2C1CA 2OV0A 4ZFGH 4JRXD 2WXJA 1AKJA 3OAZK 2QHRH 1E42A 5DDHB 2WIIA 5C82A 1QYGH 3KGUA 3QCVH 5CAYB 1JXFA 4XBPA 1QLEL 2DQJH 5JIKA 4R87A 4MAZA 1LO5A 3MROA 5HD8D 3QB8A 3GMMA 4U31A 1NBVL 2D3NA 5T33H 3VMNA 2YPVL 2XWCA 3OKOB 3ECWA 4MJ6A 4NGHH 4IBTA 3RP1A 1IGCL 3R06A 3LDBB 4Q56A 5C0BA 2HN7B 4Z7QB 4W70A 3QFJA 1EVTC 2ZEFA 3MOAL 4PJGA 4B10A 2B5IB 1IFRA 1DEEB 1LAMA 2AQTA 4X7TA 1YRKA 5D9SA 4K3JH 1HKLH 1N5YH 2ERJB 2OMVA 4HWUA 4YSOA 3UY5A 2WLHA 5HGAB 3SPVA 3TBYA 1UGNA 1XGTB 1QFWH 2P8MB 3EFDL 4H89A 1CGSL 3WS6C 1LDPL 1YEKH 2R59A 1MVFA 2YR3A 3L4XA 1IOFA 1WBXA 4HUVB 5THWA 4A2GA 1T21A 3FFCD 2J1XA 1XL4A 2YO3A 3IDYB 3TC9A 1VCBC 1NMAH 3N9GL 5IEKB 2J1ZA 3DJTA 4JQXA 2Q8BH 2I3CA 2YWZA 5HJ3B 4QI3A 1T7XA 4KNUA 2PW2B 4XE0A 5IUSA 3CFKA 4RVBA 5E56A 2YRLA 1WCBB 1E40A 4E5XA 3IAPA 4G8FA 4NQSB 3VXUB 3TBTA 2QQKL 1V7NL 4L4TB 4FF9A 1QSZA 5FKPA 2O1AA 5IX3A 1OWWA 5JHDB 2A6IB 4V1DE 1R24A 4K7FA 5JORB 5DRNA 5IFJA 4J39A 1WHPA 5ALBL 3DVNB 4L89A 3UFIA 1RZFH 2Y7MA 1YEFL 4JFQB 4LL1A 1DBMH 1CICB 4Z7QF 5CWSA 2BVQA 4WI7A 5G5DB 1IAIM 4UAHA 4WJBA 2XVBA 4FFZH 3LEXB 2H6PA 1MI5D 2W38A 4KXZI 5K59E 4ERSH 2PO6B 3WEXA 2NYZA 4GOSA 3K1KC 5F6HJ 3WXWH 1NUDA 3QULB 3LKSB 2Y36H 5I8EA 4JM2A 3Q2LA 1LO3H 4P5MA 1BFOA 3QXWA 3LIZH 5E8PA 1CDIA 3KR3H 4CMMB 1EJ6A 4AGQA 4RZCB 3CIAA 3SKOB 4HWBA 1E28B 3WFDH 4Z7UE 4K3DH 5ITBL 1S5KA 1EAOA 2BP8B 4JFPA 2I32A 1TKJA 1NGXB 1KTDA 3TU6A 4EOWH 1YN7A 1NUGA 1BEXA 1MREL 1G7IB 3RAJH 4JN2B 1KUXA 4Z7NE 1N8ZB 3T3PB 4FFYA 4JVUA 1FL6B 1K4CA 4YFJA 3MCG1 1MJ9A 1W0YT 4LRNL 1CFTB 4ZXBB 3W39B 1UOWA 4N6QA 1MXDA 4RGND 4YZWA 5DHMC 2VISB 2ZX6A 1ZLUH 4LL4A 1BVNP 3UAEA 5IB2B 5JQIB 3CVIH 2CZNA 2VR7A 2YAHA 4XPLA 1J86A 4P3DB 1YEEH 3DV4A 1CF1A 3KL5A 2FYYB 3K6SA 1E5CA 4WTZG 5F93C 5KVDH 2Z93B 3L5IA 4GH7B 2UYLB 1N3NA 5SWSB 2EJ1A 3G6DL 4Y5YA 5DZJA 1QPPA 4F3FB 5LXVA 2VZ3A 2PIYA 1ADWA 1F56A 1B4TA 2AKRB 4WIQA 3V4UL 1E9OA 3INUL 3BZ5A 3N6YA 3GRWL 1QFWI 3DX9A 4YXLL 5IBTH 2C6CA 4OSUH 5DD3H 4GRMA 1HHKA 2XACC 2CJUH 3P4OB 3TBWA 1KLFB 5T1LD 5BRZE 2IOMA 2F5BH 4M8QA 4N0FA 5JUEL 2YXMA 4XO3A 1CFVH 3F58L 5CD3B 5CGMA 3QUKA 4UDTA 1S7RA 2B4CC 4JFZL 1RV6X 3ZDYE 2CF4A 1M6UA 1L6PA 1O7SA 1ID2A 3BUYB 1A9EB 4FFVC 1GZPB 1QSVA 4ODHH 4ZPTA 1VZGA 3HA0A 2FEDC 5EO1B 3QWRD 2ZAGA 3NPSB 1KSRA 2A9MH 1MZYA 2E8YA 5E6YA 3ZE1B 3ISZA 5ICYA 4KY1H 1W72H 2Z64C 1ZGLA 3FQUB 5HGDA 3RNQA 5C6WH 2DV6A 1KB5B 4HP5A 2CLVA 2ZCZA 3WT4A 4G7YH 3MRMB 1S3RA 2Z3PA 1DVFD 5L2KB 2QPUA 4AE0A 4P2RD 5DVLA 5F3BA 2YRBA 3QDME 5BUGA 2VDOH 1LK2A 3VFTA 1F02I 1IEBA 1P4BL 4HA1A 4OIBA 5DZNA 2ZG3A 1KFAH 3SB3A 1RZJC 4PJ5A 1F2PA 4P23A 1ZV5A 3D69A 2D9CA 4PJ9D 4F7CB 4UIMB 3S9DB 4FTVD 4DNCA 2VLJB 3BIAX 3C08L 2EUVA 5E94B 1KJ2A 2X1PA 3HBZA 4UTAH 3SPCA 4XPHH 4H8QA 5BV7L 2VKWA 1N2RB 1J1PH 3OG4B 1FL5A 3FQTA 5FVJA 1AS7A 5DTFB 3D7DA 3P30L 4MJ6B 5DEZA 3Q6FB 3QQ3B 4BK4A 2V2WA 3BPLC 4Q9RH 2ZENA 5ITBH 1P7KB 3HS0B 3DDFA 2B5GB 1P5UC 5CD3A 3HG0A 4XC3H 4XMLH 5KTCA 2Z1KA 3E0GA 3NCFB 3VQLA 1XVSA 2Z4QB 4F8PA 1ZXQA 3EYVA 1FFRA 2GJJA 3LIZL 4YC2B 4YAQB 4UZUA 5DHDA 3OL2A 4D7BA 3C5ZC 2GLJA 3DYPA 4NGPA 3QG7L 4IBZA 1FLTX 4NO5B 4GBXD 1INEH 3T1WA 3VH8A 3LZLA 5DI8A 1WA0X 3D4CA 1A9BA 2D03H 4MCYB 3MROB 2DH3A 3JZ7A 1FBIH 4PJIE 1AO7E 2CBPA 1M7DB 1SJVA 5ABAA 1DQQB 4F9LC 1CXEA 1HHKB 3M86A 3ESVF 5F7UA 3AW5A 2VO5A 4N86A 5DJXA 2ZOFA 5E4IA 1ZVSB 3IMUA 2QMLA 4IBSA 5EUKB 1A3ZA 1OE3A 3T04D 1R3HB 2BZ7A 3H9SA 1QUPA 1IGYA 1JZ6A 3NZHL 3MJ8B 1KN2H 2X3CA 4LNRA 3DARA 2XN9B 3WUWB 5C0RH 2O4EA 4WW1A 3ZKXC 4U1IA 2GUYA 3CVHB 1I9RH 1K2DB 3S3JA 1NSAA 2M83A 3MKKA 2XDHA 2F61A 3A4DA 4U1JB 3CSPA 3K4DA 2WNGA 5JNYA 4X8IA 4A6YL 4WGVB 2PE3A 4ONWA 1MLBA 43C9B 1JOIA 1QKZL 3CH8A 1X5GA 3G5YB 2P5PA 4PWGA 1MHPL 2EXTA 3SDYL 4WHTB 2GLFA 1A7RL 4PRPD 3S6HA 4EUPB 1YNTA 3K6FA 5DC9B 5KVFE 4JJHA 1Y07A 2PCFB 3O2VH 1ZRUA 5IHUH 2G30A 1G7PB 2PPEA 3FSVA 4JZJA 3HG1D 1NEPA 1OK0A 5D4IA 4NPJA 4NBYB 5E00B 4LCCC 5IJDC 2WSDA 5CHNA 5TF1H 3SYAA 4G59C 1YSJA 2CJ3A 4LDLB 4YXHL 3APNA 2G5UA 4O51A 4AYMC 3II2A 4AV4A 4LHJB 4HFWA 3EDDA 4G6ML 2ZEPA 3DK0A 3OGCA 1BDYA 3K80A 3T0ED 2FSDA 2F7QA 3DI2B 1QZNA 2NTSP 5CM1A 2P5EA 3QCTL 3QG6A 1UWEH 3Q2WA 4UQ9A 5EPMA 3IKCA 2QEJA 3F85A 4AQ8A 2C4FU 3LDBC 4N26A 5L2JA 1R0AL 3TN0D 4XP1H 2GHZA 2HCZX 2YEQA 4AYSA 1CTOA 3MJWA 5G55A 2NY0B 3N06B 1SYSA 4U1KB 2KCWA 1OGTB 2CRIA 4JLRB 5HI5C 2IPKB 4KZDH 3EG9B 4UZGA 2J8UF 5FGRA 3LZQA 3MRFA 2NTFA 5DJ6A 3DOHA 4JO8A 1MSPA 1NIBA 2FX9L 4XN2A 3GMRB 5I82A 1QSMA 3CSTA 2CBQA 5K8NA 5MI0B 1LMKA 5LQBH 2HH0H 2WLKA 4ELKB 1MFVA 4A2DA 1EGJA 1BMGA 1FNHA 3BSZH 4MAYB 4PRAA 5HYJE 4YSEA 1Z9SB 1XH2A 1BM7A 4ZYKB 2MH4A 3FTUA 3KCWA 5DO2D 4AQZA 2Q7AA 2FRGP 3EJCA 4QOKE 1IAKB 2IMNA 4B9CA 3LEYH 2YD5A 4R8FA 2VGLM 3LS5H 1VZHA 2AVFA 3E6FA 4E41D 5IG7B 1NCDL 4GO9A 5HTSA 4FP8H 1KB5L 1T1XB 3VFVB 3EJYD 5FM5M 3WBDA 1SY6A 5IESL 1Q1JL 3V4PH 1C1EH 1WFNA 2MCPH 1T66C 4LAJH 3VFNA 4DPCX 1URZA 1S7TB 2QZQA 2WXOA 1RCYA 1U6AH 1CR9L 4AYID 2EC8A 1ASPA 2F5AL 3SI0A 4QRFA 4K9EC 2YQ3A 4HKZB 2A6KA 4HWBH 3PB6X 1MJ7L 4U6HB 3O3EA 1IBBA 1TQTA 1IV8A 1G6RA 5H37H 4LIQH 2ICWJ 5F7YC 1FGNL 1SJEB 3ESPA 5JW4R 4Q6IC 3L3OA 4HLZH 2NZ9C 3NIDB 4EQ2A 4BA0A 4DP8X 1MJ8H 3MXWH 5DEFB 2AZAA 4W9CC 1VFAA 3VACA 1XD1A 1CPUA 3OF6D 2FUTA 3TIEB 1FNSH 1YY9D 4NXYA 1MH5A 5JOPE 2MQ3A 4PSXA 2BWIA 3GC3A 3FB7A 4PJ9C 4AYBA 1SOQA 3BFQG 1MCJA 4JO2L 1BWWA 1ASQA 3V6BR 1P1ZA 1F0LA 5DJ0A 2IGFH 1F4HA 1PS3A 1FIGL 3ROLB 2AK4A 4MS8C 1YN6A 5I9QB 2W07B 2H41A 1IFHL 4DEUA 3QJOA 3PXHA 2YS4A 2WUBL 3AGWA 1L5GA 4PGDB 2PETA 5JOFA 4HWEL 2H6OA 4IYKA 5FM4A 2R0ZL 1IY7A 2RFHA 2Y6TE 1I82A 1YMMD 3NH4A 5C09B 1WWCA 3QJQB 1GW6A 1OTUC 3DGVA 1EZVX 1MHPH 3ZHDA 4HETA 4MA7L 3T3ME 1XQ4A 2NY2B 4G6AC 1MJ7H 1LHZA 1Y18A 2Y07L 1N0LB 1TNNA 4E5XG 1J5OL 1G1KA 1S5IH 2WWKO 4TUOA 4X5PA 4XBGB 5B4MD 3VO0A 2REFA 2ATRA 4EN3B 1B6BA 3BWAA 4BK8A 3QJFB 3LD2A 2HV2A 1EUTA 2YKKA 4WDIB 1AYEA 4LF3B 2B14A 5GGRY 5IUCA 1SOSA 3FCSA 1QX1A 2IG2L 5ADOL 3S9NA 4HGMA 3T3MB 4A68A 3PB4X 2F19L 3EOTH 4OVVA 3QYMA 4X4XB 1QFWL 2ZPAA 4J6RL 3QI9A 1JK9B 3QRFM 1EDHA 4MMYA 2CNMA 5E5MA 3TH2T 1L9MA 3I02B 1EHAA 3SYPA 2L7QA 4A39A 3O0RH 1TXRA 1LNUA 1NCBH 4PLKD 5I1KH 3BEVB 1U92A 4RMUA 5GHWH 2Z8RA 4G43A 1HC1A 4HH8A 5C6PB 2J57A 5GGRB 3N40P 1LWHA 1IGCH 4AEIH 1MI5B 1RJLA 4ZOAA 4E42A 3BDYH 1E9QA 1MRCH 2OP4L 3VXTB 3ZDZF 5L2KA 1JK8A 3GD1C 5EZLB 4YX2L 2V0AA 4Y1AA 4PLJD 1NL0H 1ZHNB 1OP3H 3UGUA 3M1OA 4AWJC 4UFVA 5G20A 3SXOA 4CGTA 3KLHC 2DIEA 3MAWA 3O6KL 3D09A 3STZB 4JO1H 3QHTC 3VXUE 1J8KA 2J4WL 2N4IA 4G70B 4JVPA 3WFCH 1OAYL 5GGVY 4CU8A 4P46C 3WI9A 1UWGH 4QRTA 3ARBB 4B7LA 2BIMA 1U36A 1Y7EA 2X1XR 1OVZA 3BWSA 3FSZA 5KBPA 1BGXH 3SPIA 3ULVC 1YN6B 4J8RB 3QCUH 4QTIL 5BO1H 4H26A 4HKXB 1OP9A 5DJ0B 1BMZA 2BNUA 2EIEA 4AK1A 3E7JA 3T1FA 1G9NC 2IAND 3NEXA 1O5PA 4G6MH 2EC9T 1CLCA 1QLRA 3BDYL 2GJPA 5SWSE 1ZE3H 4QJ5B 3T0EC 4CKVX 2EICA 3RWHB 2ZCKL 3OSKA 3R9EA 5C3TA 1SXAA 3LMSA 1CO1A 3LSOB 4IJ3B 1TCRB 2IQ9H 1FNGA 3WV0A 1AHWC 4RQQA 2IMOA 4X9GA 5DJ2B 2CM5A 1FG9C 2FWOA 3ARYA 3QAZB 4HGWB 5CCHE 1NJ9B 4GT7A 2X9YA 5EU3B 3CLWA 2BSEA 2VMJA 1IM3A 2WOYA 1NLDH 4FQHA 4P3DA 3IJHA 3MNVA 3ZBMA 1Y6NR 3CZGA 1KWKA 1BPNA 1UUSA 4OCXH 4U1NB 4TNWF 2VDNH 1KULA 3ULVL 2NYYC 2ZUQB 3REVA 2AFNA 4XVUC 3TX4A 3DO7A 1J0YA 4LCWA 1IM9A 2GBVA 2W9LA 4FABH 4NI6A 3SYOA 4E9VA 4F9VA 4EIZC 2KKQA 1YNLL 5CLTA 1S5IL 1IGIL 4PRNA 3U9UA 2XBDA 1JPSH 1ZO0A 3C6LB 2FR4B 1XWVA 3NZSA 4RMRA 2J71A 4HS6B 5AW6B 4FQXB 3QULA 1BFVH 3SBWA 2YQ2A 5F96H 4AQAB 2UUDH 3O2DL 5TDNA 3X3GH 3QORD 1RZIA 4ZAKB 3IMRA 3U2IA 3VWJD 1GY2A 4CMMA 2CH8A 3T2NL 5I8OL 1XBUA 3MBXH 4G42B 5DQ9A 3R9GA 2ZOLB 3LZNA 5I76B 5HJDA 3S8GB 3H9SE 4LPWA 1L9NA 4HF5H 2Q7YB 2WTRB 2X4QB 4OFIA 1G9EA 2YNDA 5I71C 4D9LL 3HG3A 2VQYA 5IHHA 3ARBA 2OYPA 1G1YA 1N5AB 4U6YA 5CBMA 2PO6D 1YEEL 2WBJB 1MW2A 4R3LA 1S7VB 3MLUL 1M71A 1MCPH 5IVZB 3D3VA 3CFUA 4Q6IA 3UTSB 3D3VD 3BRDA 5L7XH 5CXPA 4WCYL 5LBSA 2IMMA 1SJHA 4GKZB 2X2UA 4IW4C 1HNGA 2CR3A 3FQ4A 4QC6A 4MD4B 2MQ0A 3SJEA 3DYMA 4S0TD 1DJSA 5I19L 3V0VB 3WUWG 3HLKA 5E6IA 1R24B 2A0LC 4K7FB 5HPOA 3FOLB 5MEQB 4X8JB 3D0AA 2OM5A 3N43B 1A3LH 1OIOA 4RGOL 4BFIA 5EBWA 1I3GL 4KV5F 3QA3A 4JRXB 4DGYL 4WHDA 3MRDB 3MODH 4NN6C 4KITB 1QR4A 2X41A 1FE8L 2PCFA 1G1CA 4NC1E 5JPNB 4PLOB 1D7CA 3EJUA 3NFNA 1AFVL 1D6EA 3FSAA 5TJWK 3TO6A 3LEYL 4LLQA 3MOQA 5C0FB 3FO1B 1DDTA 4NF1A 4WDIA 1ZANH 2WQRA 2B59B 3C09C 4B5OA 3LZFL 4JO5A 3S2AA 4UFXA 2F53D 1IGJB 2QV4A 1DEEA 4YHPA 2XLLA 2YD9A 4Z7IA 3VXUD 5GGSB 3KMDA 2OI9B 4PXCA 1OALA 3PUCA 3S4SA 3P2FA 1F2OA 1PG7X 2BSDA 4NKDB 4DGIL 1Y9KA 3HUJA 4WGWB 2IXQA 4B95C 2X1WL 5HHVL 2ZW6A 4G83A 1RQ5A 2G3XA 3EYSH 3HFMH 3M7FB 1SXZA 2ID5A 2FB4H 2N1KA 3N0AA 1DUYB 4AG7A 3QWQB 1E4XL 1GRWA 1T4KA 1CD0A 2VLKA 3BQUC 4YZFF 1S9VA 3M17B 2GABA 3UC0L 3VFSB 3RWIA 5GRJH 3P2DA 2ADFH 3MLRH 1NMBL 3G5XB 2YPLD 3HE7C 4X4KA 2YN5A 1MFMA 1OAXH 4JFHD 4UM9B 1YY8B 1F3JA 4KROB 1PIGA 5EH1A 2C9VA 5F7HA 1CFSA 2EIZA 1A7BA 3B56A 4QKTA 3UJTH 3T2PA 4A7UA 4HLEA 5F3HA 4MGXA 4PI2A 4IRJB 5KBNC 4WU7A 4ZDHB 2J25A 1XAKA 2E56A 3KYKH 3RWCB 2HFTA 3BYYA 2AHIA 2NMTA 4KK6D 3GBEA 4LLVA 2E7HA 3HZYB 4PLJC 2XZCH 5AG4A 5T1LA 2NY4D 3THML 4LQ6A 4H8VA 1R9FA 2Z8SA 1JI1A 1T83A 2F7RA 2DXQA 3RY6A 4UQDA 4XNQB 4UU9B 4FTVE 5HDBE 1RMFH 4PXEA 4R96B 3VFPB 2R1YB 2WVVA 1A7RH 1RIUH 4OGAD 4OD1H 2AXFB 1A6WL 1XMEB 1ITBB 4NXKA 4NNYA 1OK8A 3EOYG 1RK0A 2VERN 2DM2A 1S9VB 2Z4QA 4ZXBD 2VMEA 4RGNB 3DK2A 5C3LD 3SJVB 4GT0A 1XF3B 4PJ6A 4XO5A 3TGXA 3B3WA 4AVIA 2ZWSA 3KEHA 4MZ3A 2Q20A 1RL1A 3UACA 4CYOA 1BLNA 5DUBB 2E59A 4TVPE 4PWIA 1N2RA 3GNML 3QSKB 2IANE 2G3TA 4XN5A 1E5BA 1C8QA 1MWAL 4TSCL 5FA4A 2IV8A 3KPMA 3Q2VA 5HVGB 1FNOA 1CGWA 2YXVA 3QEUB 1VACB 2BVPB 3FULA 2J7LA 1EEYA 3OLDA 4M3HA 5KSUA 1WK4A 3VAEA 4N2MA 4HMEA 1I53A 2Y36L 4LLUA 4U7KA 5ICUA 5DMKA 3ECUA 3PAYA 3VSQA 1MF2L 4XAWH 1K8DA 3VCLA 4Z0XB 4M6IA 1HQ4B 2OZUA 4N2AA 2VR9A 3D18A 3GSQB 5JA9A 3P11L 4FNTA 4GRWB 1A25A 4RGNE 3U0PA 3A67L 3GB0A 2BRQA 3BX7C 4LBEB 3AJ7A 4YHIA 2B1HL 2BS9A 3HG2A 2HRHA 2QBWA 4X6CE 1FC2D 5B38G 5EOTA 1PY0A 1IE5A 1KZYA 5EEWA 4PYHA 2O28A 5ALBH 4YFLF 5K9JH 1J88A 3WTSA 3FAXA 3KHQA 4AGOA 3QJTB 5C0IA 4KKQA 2D31A 1RZJL 1CGTA 1PJ9A 3Q06A 1PX3A 1KUYA 4K3HA 4DP4X 2VBQA 3CFJA 2VDRH 3QRGL 2NSMA 5FGCE 4HMDA 4KX8A 1NLBL 2QDWA 4G42A 3FFCE 2WYHA 1CLOL 5DLLA 2OYKA 3FYIB 3LN9A 5F1NA 3UTTA 4LSRL 3SDXF 3KHZA 4AC4A 3UJTL 2H3NB 5A43C 2WINA 1A7OH 5CFHA 4XNYH 5ANMB 1OSPL 3EO4A 4HS6A 1HEZB 2FSEB 3DV6B 1NBQA 2WHVA 3WHXB 4WO4D 1S7NA 3E6HB 3PWPB 5K9KA 4Y89A 2AFMA 2WNKA 1KFAL 4HS3A 4Y0GA 1NCCL 3L4TA 3MRDA 2XYBA 3B7TA 1BG9A 3HCVB 3MLZH 3QJRB 2XRAH 4FQJL 4OZGE 5JXEA 3RZCA 5TGBB 2IDFA 4MCQA 4M61B 2WXPA 1S6NA 3D2UA 2FB4L 3RFZC 1VGEL 2VXSH 2QPDB 5D1XD 1IYLA 5KSAA 2DMKA 3QO1B 5B7MA 1AGDB 4JZNB 3TWCH 4FLQA 5LCVA 5GCNA 5I73C 4HIEB 2B3VA 4Y49C 4ZFGL 3FYEB 1AQMA 5E8PB 2CHZA 1ZGLM 3TTSA 4GG8B 4NIYE 1T2XA 3PJSA 3N3EA 1S78D 5CJXA 1QSRA 3KPRB 1MKFA 4JFFD 5DMGC 4XX1E 4TVUA 2H3NA 1QFUL 4FQCL 4QJ4B 5I8OH 3BQVA 3W57A 5JUEH 3H4HA 4LCWE 2BNRE 5DUML 1QO3B 1T5XA 3UTSE 1JRHI 1Z3GL 2C3XA 2EDYA 5FK9B 1NCJA 4OSUL 3ULUC 1A5FH 2ZSVA 2HAZA 3K2MC 5I8EB 4JFDB 3EJRA 3GSUA 3INUH 4KRPB 4L4VE 1JPGB 4KI5C 4KSAA 2F1AA 3HG1E 2ATKB 4ZS6D 3DJ9A 4R83A 2EBJA 1CDCA 4YHKH 4PTTA 4PGBB 4TUKH 1WP6A 3IWEA 2YD8A 5C0IB 1ET7A 4KROC 1DE4B 4EMZA 5EWIH 2W0KA 4F9LA 3BC9A 3KHOA 4PG2C 4K30A 1RPQA 4AX3A 4OCXL 5FYJU 2PW2A 4P9HH 3UTZB 1OPGL 2IVFC 3HW7A 4OTXH 5FYJH 4IOFC 5HI3D 4EDWH 3RZCD 4MCRA 4LCWB 5GZOD 1Z5RA 1XXFC 1L9TA 1AGDA 4E41B 1FA4A 2X89D 5AB2A 3LD8C 5AL0A 2EE9A 4ZX8A 3O4OB 4AY0A 1X9RA 1SUHA 4ONFH 2DRUA 3HN3A 5HGAA 5I66A 4KTEH 5GGSY 3OB0K 3QPXH 1GIGL 5F7EL 3IJSA 1NGPH 1JK8B 3DIVA 3PB8X 1T22B 1IBHA 4N2KA 4XMPH 3E6HA 2GJZA 3GIZL 5I24A 2V8LA 2WXIA 4BRJA 3C09B 2VXTH 4BE6A 5F47A 2YBRA 2XTSA 3CQFA 1NANI 4JFVA 4NZUL 5I1HL 3T9YA 3I02A 1T0OA 2VH5L 4J3OC 6CPAA 3ZR5A 1BXXA 4YSQA 5T5FA 5HHOA 5C0BE 4G71B 3EZJB 2VL5B 2O6DA 2OS7A 4L3EE 1Z66A 3H6AA 3O45A 1DZ0A 1DVFC 7FABH 3STLA 2O26U 5DS1A 2CKBA 1CDHA 3FB6B 2HJFB 4N8VG 5DD0L 4MJ8A 3RBSA 5TE7L 1KY6A 3LEVL 1SPDA 3NJJA 1AVAA 2NY0D 5TH2B 1DVTA 2XG5A 3WELA 3S88H 1XGYH 3STZA 1S7UB 2O93L 4PSPA 4LLMB 2B08A 3FU9A 1KZQA 4UT9A 1GY1A 1O6TA 2HVBA 4KOCA 1KG0A 2X70B 5AVYB 4C68A 1FLRH 2UY7B 4LVEA 5FDYA 5BJTB 2K8QA 4ALAH 3K7UA 4WK0B 5G2NA 4TVSa 3TH4T 1KJVB 3NCEB 2R0WH 5AGEA 1PCSA 1UH4A 1IBZA 5KVFH 3QRLA 2UZYA 1F8TH 1RU9L 3EJQA 3W0WE 2QGDA 3ROLA 4O02L 5AKVA 1MEXH 4LASH 5DJYA 1UA6L 5JIPA 3QDGA 1NBCA 2K0RA 4M61A 1F18A 2GREA 2NPLX 4ICXA 3ME0B 4MBRA 2HJKA 2RCSH 1ETZB 3VYOA 1JGEB 1WAAE 1A0QL 4OF7A 1UT2A 1H3WM 4ZY1A 2XN0A 1OAYH 3DR6A 1OSEA 3L5WB 1S3ZA 2ZX8A 3HOGA 5IMKA 4P4DA 2OMXB 1ZJBA 4M5TA 1N64L 3D85B 4DESA 1B3IA 1DQJA 4OLZH 4OZIA 1NL0L 1XZWA 4TF4A 4PJAB 4WFEE 4WWID 1FZKB 5HHNB 5JTWA 1QLEH 2BNRB 2DQJL 1UATA 4YDNA 4HLZG 3ZMNA 4H4NA 2ITDA 4N8PA 4DAGH 4PJDF 1MCEA 3BP4A 1JS4A 5T5FH 3ZKSD 5D71L 4JD6A 3H42H 2G9HA 3P73B 2GUOA 3QR0A 1L9SA 1SJMA 4WWVA 3DUUA 2K7QA 4X0KA 3CFJB 5DF0A 5BQ7A 3A47A 1PLAA 4YWYA 3RGHA 5D2NC 4ISVA 5I1GL 3QUYC 1WZMA 2JJTC 3VFWA 4WUUD 3UAAA 1EAPB 5AWNH 2ADYA 2WTPA 1DBAH 2VSDA 4OQTH 3B7UX 1N4XL 5MEQA 3WTVA 3B9AA 3BW9A 5I2IA 2NMSA 1F6AB 1DZBA 3V0JA 1GKEA 2J88L 1YMMB 4BSWB 1FGNH 2ZYIA 2BK8A 5L6YH 4JFSA 1P2CB 4LOUC 1B3JA 1C5CH 4OIWA 2NR6A 1XXDC 1MW1A 5IHLB 1XF8A 2P8LA 4WO0A 2X6BA 2XV6B 4G8FB 3VXUA 2DJ4A 4H1LB 1PZ5B 2APTA 1AIZA 4NI3A 5ANME 4IMKC 2VQ4A 3LPPA 4MCMA 2CLZB 1PF3A 2V9TA 5FYLD 1ULVA 1NSNH 4KJYA 5J1SC 4URKA 4ZPVB 3F0AA 3BESR 5KVEE 2XBTA 2DB8A 4UIKH 4A2ZA 1D2OA 1NCWL 4PP2A 5HVFA 4WV1A 4ACPA 1R75A 3BRGC 3E8UH 4P2RE 5JOEA 1CX8A 4URTB 2CNZA 1X5LA 1CUOA 2F15A 4X4YB 5GZOA 3LRSB 3BWZA 2HPTA 4H2KA 2MOGA 5LRJA 3MLYH 3FDWA 2R69H 1F4WH 3MREB 1M1XA 1XH3A 2CGYA 3CZLA 3ES6B 1XIWA 2DEWX 2Y24A 4MY3A 5HDQH 2R1YA 2WP3T 2YAOA 4QYAA 4H0GA 1QLEB 2W8CA 1KDJA 5PCYA 5T1KA 5KS9F 1Q2YA 2K3HA 3GMRA 2MNWA 4P6YA 4XN1A 3MRRA 2OLDA 3HHSB 4QIRA 2ETWA 1FV1B 4RAVB 4HWBL 1QP1A 5EN3A 1AQDB 1EHXA 4PGCA 2VMCA 4YVNA 4HKBB 4BEIA 1J11A 3VXOB 4AQOA 7TAAA 4FNLH 2AV7B 4Z7VE 2WLMA 1KCSH 3GJEB 3IRPX 2D4PA 2QVKA 4OB5L 3CXQA 3BKYL 4HUWB 4H40A 1ARLA 2PPAA 3RGVA 4EIUA 2ZNXA 1IC5H 1KZFA 2NX5E 1S9XA 3VU1A 3LSOA 3LX9A 4F8NA 5AVVB 1EJOL 2MKLC 1SHWA 1QI3A 3RILA 3ZHNA 1JZ3A 1A6PA 4YDMA 2IANB 1KGJA 2ARJQ 3QNZB 3WFHA 2CLRA 2YLKA 1JI2A 4X8GA 2CU9A 4H13C 4LGRB 3SO5A 1RIHL 2OK0L 5ICXA 2ATPB 3FT2B 4IRSA 2CBMA 1E30A 4MWFB 1AXIB 3CSYB 1NOLA 1P1VA 1K5WA 3QZLA 3L5HA 1LEIB 1H8SA 2YQBA 2ED8A 4W6XB 2Z0BA 2EYSA 4N0UE 2RGSA 4PJIA 4F93B 1YW6A 1UJ3B 4AZ8A 4N2BA 5CEZL 4PJXE 1C5CL 3AS1A 2PPFA 4JG1L 1DSFL 2DQDL 4KMLB 2ZOKA 4X9FA 4XPFH 3C6LA 2EDTA 2BOCA 1CCZA 4ZFOB 1JPTL 3KYNB 3O9WA 5C0DB 1H8LA 5FO8B 1OV8A 2Y72A 1S9KC 2B2XL 3BYTA 4Y2NA 3BJ8A 3B43A 3T4YA 5IK3A 1I9RL 4HIIA 1HX0A 1WITA 2YD2A 3HPLB 1LO4H 2Z35B 4XOAA 3ZZQA 4A7SA 4DGVH 3FH5A 5JNYB 5LNDA 2VXUL 3QDGB 2FT0A 3EC4A 1F1AA 25C8H 3IBOA 3NZHH 3TZVD 1WEJH 4HUUA 5ISZB 1BQHB 4OV6F 4ES8A 1W72A 2XV3A 1Q0YH 4NAJA 1JNHA 3QNXA 3HC0B 3IJHB 4NAQA 2M2DA 1E7UA 3DC0A 4WLCA 4HSAC 3AU0A 3LHAA 1RHHA 4TV3A 4DVRH 4QT5B 3R1KA 3O3AB 4H20H 3BIKA 4MJIA 4BE5A 1JYXA 2XEJA 3BPCA 4JRYE 2YPVA 3FQWB 3UJIL 1ZLSH 5IMOB 5FKAB 4RA0C 4FZEH 1LOKA 2JBJA 3HB3B 1SJHB 3HC3H 4GKZA 4Q4EA 1INEL 3QQNA 5B8CA 3QIWC 2C1OB 1OSPH 3QJFA 4K5NA 1ADQH 3DTXA 1ZV9A 4K23H 4NO3A 2OZNA 5FYLH 3GXNA 3L3JA 3KZ8A 2NXZB 4AYDC 5KVGL 4XH2B 1XO8A 4JGUA 5CLZA 5ENWA 4KRNA 3M45A 5MI0C 5G4MA 3KG5A 4AVJA 1K8IA 2OB0A 2ZWKA 4GS4A 2CLVB 1GOGA 4IKIA 1OM9A 1QATA 4AXWB 1Z8WA 2X7LB 2ZG2A 4LHUG 2ZOLA 4RNRB 3IU4H 4K3EH 1NIEA 3VXRA 1KGXA 1D5BB 1HHGA 2ATPA 2PP7A 1OD9A 3T0VA 4FYRA 5I6KA 1JHKH 4Y1TA 5AG9A 3I84A 1ONQA 4WI8A 4N2GA 1A3RL 4U05A 4GFXA 5DUPL 5CN2A 4OBRA 4MHZA 4X6BB 4FXTA 4IQHA 3ILPA 5FK9A 2D0FA 2YC1B 4AQEB 1XB3A 3LHPH 4OADA 3V38A 1TZIB 3MV7B 4V33A 2AQPA 1GGBL 4MYPA 3TN0C 5E24E 4EI5D 5JR1L 5DK2B 2I07B 2EO9A 4ZG1A 5SWQA 3R19A 1NFKA 1DJYA 3ABKB 2QLVB 3JWOH 4GG8A 1JGLH 4BFEA 1I1AA 4KNSA 2F53A 4UT6H 3HCVA 4WTQA 1CGUA 4QLWA 4XI5D 4HHWA 1B2WH 4Z7UB 3QJHA 4P4KA 3TV3H 3HR5A 1DQML 4PRPA 5DJZA 4C7IA 3I6KA 3K0YA 4LCCA 5DRXA 4Q52A 3FHAA 4A55A 1GW0A 3QO1A 3EO9H 5D4JA 5C0AD 5JQ6H 1F6FB 4TUJB 3F58H 4OZHA 1HXMB 1PG7W 1GGCL 3DUHA 5EA0L 1U8OB 1TKHA 3KZWA 4IHBA 4P45A 4HISA 3G6JB 3TN0A 4KZCA 3PAZA 5CKAA 3HRPA 4OLWH 5FCUL 3N1QC 2Z8WC 3P0YL 4BCZA 2PR8A 2AJXH 5GZNC 2AXGA 5DZVA 5J1AB 1KCUH 2VABB 5F7EH 3U0TA 3JYBA 3ILDA 2VQTA 4UB0H 1DTDA 2ITCB 1D6VH 4A2MA 5HHMB 5J5EA 4FKEA 4HPOH 3JQOB 4Q36A 4O2CB 1KXHA 3LIUA 4I18B 2XWDA 4MA8L 4M48L 4PVBA 5C2UB 5CU5A 3X14A 5I0CA 1EDQA 1TEGA 1ZLWK 3T2OA 2BSRA 1S9XB 5J06A 1RZGA 1OTSC 2WYZA 4OTXL 3OKNA 4V1DB 5FYJL 5SWSA 2DEXX 4Y7MA 4A7VA 1I3UA 3BHBB 3KLSA 1CG2A 1WK0A 4PJBA 1XMTA 2GU2A 4P23C 3J7HA 2ZXVA 3T4AB 2AV7A 1M2OA 1G7QA 3M6DA 4LSUH 4LQ1A 4PK2A 1U2CA 3ECBA 2Y1AA 1RUML 2GIXA 3RWFB 4OZHB 2D2CC 3T0AA 4W9HC 5GGRA 4LL9A 3U4BH 3D50A 1KLUA 4UAOB 4U6VL 4AEHH 5DJDA 1ETA1 2IQAA 2X88A 4PJEE 3BLNA 3AS0A 3FO9A 1NIAA 4BFOA 3SXNA 5CINH 2RACA 2X4RB 5I4MA 5ICZA 2PW1B 3CZJA 3MX0A 2AJYL 4BBWA 4PWJA 2AXJA 3IFEA 2L7JA 3SDAB 3N42B 1CDUA 2J56A 3DR8A 5F89A 1R3LB 1VFBB 1BPLB 3VMOA 3CUPA 5DK2A 5DGRA 4X6DE 2HYMA 2ANPA 1EQWA 2BJMH 3NCMA 2F7OA 3PV7A 5C97A 5EU5B 2FGZA 2A83B 4OAWB 2YA0A 35C8H 1BZDA 4G6AD 5F7KC 3MNZB 3S48A 2E9GA 2OCFD 1I9IH 5IW1A 4IIZA 4EI6A 2ZKWA 4LPTA 2LHAA 3DJRA 4JY4A 4GKSA 2R0LH 4L37A 1U8LA 5AZUA 1SF5A 4U2YA 2XWTA 4APXA 4BZ1A 1N10A 2HKFL 3SY0A 1MW3A 3LN5A 3U48A 2EILB 1CLYH 3C5SB 3QDMD 3MRGB 1CS6A 3OQRA 4AYGA 4EJ1C 1QQ9A 3NJKA 5DDHA 2VN7A 1FVEA 1ORQB 3S35X 1M7XA 3GLJA 4AZUA 4GG6E 1DQDH 1FFPB 2VC2H 3MRPB 3Q43A 1NDMA 1ZTXL 4ODWA 1AO7A 3UMTA 3CXSA 1CFSB 2EIZB 2NNRA 3GS7A 1SEBB 3MYJA 2IO5A 3NJHA 4LQFL 4XZ4A 3H56A 3ARFB 3TCTA 2Y7OA 1NMAL 4YHNB 3UBHA 3DOSB 3BPNB 3B3SA 1KG0B 2L7EA 3FO0H 1MG3C 1WFTA 5D2LB 5FOJA 4DP1X 2BSSB 1I75A 1K5NB 3VXSD 3OZKA 1YEWA 3R8QA 1ZOXA 3M17A 5JXEC 2JNZA 2JCCB 4NO2B 1VCAA 3QIWA 4HJGA 2VDKL 2K9UA 1AZUA 1HKLL 3KJ6L 2DLIA 3QIWD 4KKAD 4NPYB 3BKCH 3VG9C 1N5YL 1JAEA 3CFQA 2A6DA 4HJJH 4UB0L 2LU7A 4IEFA 4KFZC 3RU8L 2FJFB 4LSTH 1ZE3C 2CTBA 1X9UA 2R1WB 5JYLA 1BQLL 2ZUVA 3EYQD 3UYPA 1KYUA 3O45B 3SHPA 3ULVD 5E8NB 5B1JA 2GC4C 4DPBX 3DNSA 1DN0A 3GSXB 3KPSA 4DN3H 1AHWB 2IADB 3GSOB 2PYFB 2H26B 1ECZA 1GGCH 3HE7D 3O11B 3H7BB 5HI4C 4PJHF 3G5YA 4OKDA 2Z31D 2CNSA 3D0LB 3HN8A 3QRBA 2VXUH 2ZF9A 3X1BA 4WEEA 1YYML 5DVOA 1IU1A 2IAAC 4X7EC 3M88A 5C7XH 4PCYA 4A2EA 4Y9BA 2ZWZA 4K55A 4XVJH 4PJEB 4FD7A 4X6EA 1T83C 3MRBA 3QT2A 3O4LE 2IFGA 2NX5A 5A2BA 4P3CH 4F2MB 1FO0B 2F8OA 4LLVB 4Z7OE 2A83A 4OAWA 4D3CH 1UA6H 2KLTA 3PLYA 4OMEA 4KOUA 1DSFH 2DQDH 2ZCHH 4CSTA 1OL0A 1DSYA 3UGEA 5F88B 1BQRA 2JCCF 2MRYA 4UQBA 4F37F 2A4NA 5I1IH 1FJ1B 1U3ZA 2NYYD 1DANU 1SYSB 4M1CC 4U1KA 4XCEB 4YJZL 1JHTB 4UNIA 4BUGA 4HHGA 1UT1A 1YC8A 3I3DA 2AANA 1YVOA 1ORQA 3QA3B 4Y2DC 3BH9A 4U1HB 1T6WA 5FHAL 1A2ZA 5D7EA 2FIWA 4M00A 3KQZA 5CJXC 4X50A 4GSRA 3KPQA 3NEOA 2IWEA 4KMTH 3W2DH 3D34A 3AY4C 4IKNA 2K45A 1GZPA 3MRPA 3E8VA 3HZKA 5F1IB 1AZNA 2A74A 2H8PA 4GI6A 5DD1H 4G7RB 1C08A 1EHKB 3IF1A 3QAZC 4FQQA 3VWJC 1NA8A 3GLEA 3BFOA 1M71B 5FOBA 4KRPD 1X12A 3QPKA 5I1CH 4A7TA 1I3VA 1RP8A 3LQZA 4TVPD 4HV8A 4BMHA 3NA4A 1IM9D 1IC0A 4KY2A 3ZE0E 5HYSG 4KPH