4B6ZA

Crystal structure of metallo-carboxypeptidase from burkholderia cenocepacia
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
382
structure length
380
Chain Sequence
TLSITSNFDAGAIDVVSCDSPDAIRLRVRGDNRSEFAQWFYYRLTGARGERCVMTFENAAECAYPSGWRNYSAVASYDRVDWFRVPTTFDGKTMTIDHTPEFDSIYYAYFEPYSEERHAAFLGAVQQLPQASVVELGRTVEGRPMSLLTLGTPETAPKKKVWIIARQHPGESMAEWFVEGLVKRLAGWGDWAGDPVARKLYDRVTFHIVPNMNPDGSVHGNLRTNAAGANLNREWMAPDAERSPEVLAVRDAIHAIGCDMFFDIHGDEDLPYVFVAGSEMLPSFTEQQGKEQTAFIEAFKVASPDFQTEHGYAASKYKEDALKLASKYIGHQFGCLSLTLEMPFKDNANLPDERVGWNGERSAALGAAMLAAILVHVDTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FAMILY M14 UNASSIGNED PEPTIDASE
publication title High-Resolution Structure of the M14-Type Cytosolic Carboxypeptidase from Burkholderia Cenocepacia Refined Exploiting Pdb_Redo Strategies.
pubmed doi rcsb
source organism Burkholderia cenocepacia
molecule tags Hydrolase
total genus 140
structure length 380
sequence length 382
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
A PF18027 Pepdidase_M14_N Cytosolic carboxypeptidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3120 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4b6zA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4b6zA02
4ZY1A 1M4LA 1ZLHA 1TKJA 3BHXA 4NGMA 3SI0A 4TWEA 2PJ9A 2QJ8A 2FVGA 4UF4A 2C6GA 3MN8A 1R3NA 4P4DA 2ZOGA 2ZEDA 4UIAA 5LRGA 4MXUA 3D7HA 3PFEA 5K8MA 2WZNA 4UIBA 1Z5RA 5K8PA 4P10A 4LQGA 1ZLIA 4FUUA 3H8FA 3VARA 4MCSA 5JH9A 2GU2A 3DGVA 2IMOA 4PXEA 4UEZA 1TKFA 3GB0A 2XEFA 1BPMA 3B3TA 3N5FA 5K8OA 4MMOA 2BCOA 3LMSA 2C6PA 1DE4C 2HB6A 3IEHA 4A39A 2RFHA 3H8EA 4OMEA 3D66A 1CPSA 4ZX8A 3IO1A 3FECA 3BI1A 5I4MA 3PRTA 4EMEA 3GUXA 1FT7A 4NJQA 4YU9A 2GLFA 3WC5A 4ONWA 4PQAA 2ZEGA 2OR4A 1XMBA 1IY7A 1XFOA 3D68A 5JM6A 2NYQA 2PJBA 3SJGA 2POKA 1CBXA 2AFWA 4MHZA 2EK8A 1QQ9A 2ZEMA 3IWWA 4MHPA 4RUHA 3WC6A 4EWTA 5ELYA 2CIJA 1Y7EA 2QYVA 1OBRA 4R76A 2AFXA 1ELLP 3CPXA 3FEDA 1PCAA 1Z2LA 2ANPA 4CPAA 3PB7X 2JBKA 3ISXA 1Z8LA 2AFZA 3FEEA 4IK2A 4PXCA 3NFZA 3SJFA 3TX8A 4ZI6A 3MRUA 3NH5A 2XEGA 3FJUA 4MCPA 1ZG9A 2ZEPA 2Q4ZA 2PJ8A 4P45A 3KR5A 3KQZA 3V38A 3LWUA 5J1QA 2ZEEA 3SJXA 1F2PA 4ZY0A 2AFMA 4F9VA 3TC8A 4IHMA 3WABA 4NGQA 4P4EA 1TXRA 3DLJA 2AFUA 2IQ6A 1Y0RA 3QNVA 2VL1A 4IAVA 4X8IA 4EFDA 4OC4A 1NSAA 1XJOA 1EE3P 4FWUA 3S9LA 2IJZA 2PE3A 5D29A 1BPNA 2PJCA 3PB6X 3WC7A 4X2TA 4H2KA 3PB8X 3B3WA 1CP6A 2RB7A 2NSMA 5JGFA 1DTDA 3IIBA 1KWMA 3IJ3A 1AYEA 2WYRA 4F8ZA 4WJBA 2AFSA 4NGSA 1FNOA 2GLJA 3SI1A 6CPAA 1IGBA 4ZYQA 4P44A 1LAPA 3V7ZA 2JEWA 3PEIA 2ZENA 1PYTB 3SI2A 2EK9A 1LFWA 3NH4A 4OP4A 4JYWA 4R7MA 2AFOA 1HEEA 1Q7LA 2OOTA 2F8HA 4YWYA 2I3CA 2V8HA 4WWVA 2BO9A 2PJ0A 1LCPA 5LYLA 5LRKA 4MRIA 3NA6A 1VIXA 1XBUA 3KL9A 4ZX9A 3B3SA 1UWYA 4P4IA 5D8NA 3CPAA 4P6YA 4R6TA 2PJ1A 3HUVA 4DYOA 3D67A 3WT4A 3KGQA 3D7DA 1R43A 4MCQA 2PIYA 1CG2A 3S9MA 4KSIA 3NH8A 4OKOA 1ARLA 4PXDA 5IB9A 2PJ7A 3CT9A 1Y0YA 1LANA 2PJ3A 5F09A 4MCRA 2V77A 2F7VA 2J9AA 4X3RA 3B2YA 3SJEA 1YSJA 2XEJA 3GLJA 1VHOA 3JRUA 4OIWA 4UEEA 5LYFA 2PCUA 5LYDA 2Q43A 2ABZA 1ZG8A 4BD9A 1YW4A 4ZY2A 3L2NA 4B6ZA 5HVFA 2PVWA 2ZOFA 4OC5A 3VATA 4FBEA 2V8GA 3IFEA 3PFOA 4OC3A 1TF9A 1JQGA 1HDUA 3K2KA 4K3NA 3RZAA 3CDXA 5HVHA 1VGYA 3ISZA 5LRJA 5CBMA 1YMEA 5HVGA 1LOKA 1CX8A 1VHEA 5DS0A 8CPAA 2GREA 5LYIA 1CPXA 4GM5A 1H8LA 3KHXA 2BOAA 1F57A 4G1PA 3I1UA 4OC1A 4NFRA 2G9DA 1YLOA 3BXMA 4JZ0A 4MHNA 4A38A 3FF3A 2PVVA 4TNUA 1QMUA 2Q51A 1AMPA 5CPAA 3RBUA 4F9UA 4PXBA 3BI0A 3PB9X 3S9NA 3KR4A 5K8NA 3FMCA 3B35A 4P4FA 2C6CA 2O4HA 2QVPA 2PIZA 3D4UA 1LAMA 3PBBA 2ZELA 2PJ2A 2O53A 2PRQA 1TKHA 3B3CA 4A94A 7CPAA 1YW6A 4R8FA 4NGPA 3FVLA 3H8GA 4P4BA 4MHYA 4OIDA 1ELMP 3HLPA 4AXVA 3KZWA 2ZEFA 3B7IA 4A37A 4UEFA 3IC1A 1BLLE 3B3VA 5THWA 2PJAA 1ZG7A 4O23A 3PBEA 2CTCA 2DEAA 4DJLA 4NJRA 1BAVA 1ARMA 2JBJA 2V8VA 3D7FA 2CTBA 2V8DA 2PJ5A 3D7GA 4OC2A 3KHZA 5HXDA 1F2OA 3T8WA 2HC9A 1CP7A 4W9YA 2ZEHA 4P4JA 1RTQA 2CF4A 1GYTA 3KASA 2PJ6A 2EWBA 3KQXA 3FH4A 4OC0A 3PB4X 4NGNA 1XRYA 4Q7AA 2PJ4A 4NGTA 4PPZA 2C1CA 4DUKA 3VH9A 1TF8A 4NGRA 4FAIA 2XEIA 3RAMA 3FX6A 4Z65A 3KI9A 2ZEOA 3K9TA 1HDQA
chains in the Genus database with same CATH superfamily
1YNTB 2L7UA 4OF8A 5C09A 3QDJB 5HPMB 5I30L 4F27A 4W1TA 5B8CB 1OTUD 2VNCA 3CDFA 4TSAL 4Y19D 5JXED 3HC0A 4OFKA 2BXYA 4BFIA 1F6AB 4Y9BA 1SLVA 1FNGB 3ZX1A 3N1PC 4NFCA 2Y5TB 3LX9A 2OSLB 3B9VA 3UZEA 1QVOB 4ZMOA 4XI5C 3VQMA 1CD9B 2AK1H 3LZNA 3AQDA 4NQCB 5DVMA 4X99B 3TFKD 2YNCA 4TWEA 5HGBB 3LZFH 5T5FH 4N0YL 2PTTB 1BOGA 1JRHL 5KBNC 2HJLB 3L45A 3P0YL 4MDJB 3GI8H 4JRYB 1XO8A 3RU8H 2PO6B 3G04B 4XB7A 3LOWA 1CWVA 1XCWA 2WINB 5K39A 4KI1A 1IL1B 4MASA 4BA8A 3A4EA 2ITCB 3CCHB 5BO1H 1A9BA 4PJEB 2CKBA 4Y5XC 2JKLA 2MWCA 2CM5A 4GEIA 1W16A 2XZCH 3AS2A 4UF7C 3SPVB 2WZNA 1E7UA 1MOEA 3SGDI 2QLYA 5T3XE 2J72A 2FLBT 1E4HA 4KKCD 4F1ZA 2DWTA 3CVHH 2ZXQA 1F11B 3QS3A 3US9A 1OWWA 2OYLA 3QUXD 3K8KA 5FGBC 2EC8A 4ELMB 3P73A 5C0IA 5CZXD 4EJ1C 2GB2A 3AREC 2FSRA 3NP4A 1AXSA 1OCZB 1DVFB 3CK0H 4RAHA 3L3HA 3MLSL 5D7SH 3A6CH 4F7TA 4YMPA 4PJ7B 3COOA 1MHEB 5EBLA 1KY6A 3P9MB 5C07D 5KYYB 1FV1A 5KWYC 2PXYB 3EYFB 5D96C 1AG6A 4B14A 4P23D 2TRHA 1CG9B 1K4DB 1NCTA 4XN8A 4DFIA 1RZJH 3PL6B 1PS3A 1G0DA 3TOPA 1GY2A 2OX5A 2R1XB 5E8DL 5JO5B 4LUAA 2OW6A 3DUSB 1DVUA 1FN4B 2AEPH 2EXWD 1B9KA 3HMWH 2B5IC 2NY5H 2GSIA 1BX2B 3QNYB 4J2QA 3SY0A 1DQDH 2COQA 3FT3A 4G3YL 2ZUYA 2JB6A 3GSNB 1SDYA 1UM6H 3HG1B 1MIMH 3ATDA 1ZPUA 4P2QB 3TWCL 5L9DH 3CC1A 1A6WH 1MFBH 3TZVB 5I76A 2BMKB 4FYTA 4ONHA 3IDXH 4MRBA 3SYOA 2ESVA 5B7EA 2BSTA 1N71A 1XR8B 2K9UA 3HNVL 1IGFH 1FDLL 1U8IA 1FGNH 4F7EB 3D0LB 1ZHKA 3LS4L 4XVTH 5DMYA 5I6OA 2QVMA 4HIIB 3F05A 2A77H 2OMXA 3BVVA 1ZLSL 2DQUH 1PMYA 2VDKB 4YFLF 4R5XA 2WO4A 2LU7A 1Y9WA 3HI1A 5DD5H 1YNTF 2NR6A 2ZXCA 4ZNEE 1B9ZA 2VO8A 1SHMA 1S7QB 4ZOEA 5B1JA 3T6VA 1YYML 4L9LA 1G7LA 3DO7B 4QHKI 4NKMB 4XI5D 2AFWA 5AVTB 5EULV 1QQ9A 4EN3B 3EDJA 5A7EA 2OZ4L 2QHLA 5TF0A 5D2NA 4FD5A 3GKWH 2EACA 2DWEA 4PYGA 4X6CE 2R29L 3DYPA 5B3JE 2YR3A 1CBJA 3TCXA 4F9PA 4EWTA 5BW7A 3F7VB 3LV3A 3BUYB 4I48A 1VA9A 1IUZA 4I77H 4LCCA 5D55A 3VMPA 5B38A 1YEDA 4PY8I 4XVJH 3MPCA 4P2CG 1IIDA 3MRHA 3U1SL 3PGFH 3VFRB 4J3XA 1WVZA 2CLVB 1TTFA 3J27A 4Z3JA 4YHLL 2VZUA 2BY1A 5FYKH 1QTPA 1A3ZA 1WFNA 3L5WB 4OJAA 4PJEF 4AY0A 1DANT 3QB7C 3RZCA 1O6SB 4IM8A 4BSJA 5JHAA 2NSXA 1KBWA 5GGVH 2IWFA 1BXAA 5BUPA 3ARED 4IKNA 4PJDA 1KGIA 4XX1E 4OCXL 4XWGL 5DEZA 2Q04A 2YPLA 4Z95L 3FFCD 3NSJA 2Y0SA 4M5SA 4H5SA 4UU9B 4WGKA 4ELMF 5IFHL 1VZIA 1IEHA 4RFOL 1B0RA 1NGWA 5I5JA 3AB0B 1UCBH 4ZZFA 1VENA 5JOPE 3ECQA 5I18L 4JO1L 3TNMA 1S7VA 3DVGA 4CU6A 4PHZA 1I8AA 4BELD 3BSZL 3DTDA 2X05A 4JY5H 4N0CC 2PR1A 1GZPA 4X5RA 3PDOA 2QPSA 3ESPA 2CSPA 5E5LA 1BQLL 1VFMA 3PGCA 4JFFB 2ZOWA 4N2MA 1SHSA 2QFRA 1J5CA 1R4XA 2R27A 3AVEA 2B1AH 5CCJA 2YK1L 5IBLC 3QQXA 2VDRB 4HA1A 2A6KA 1CFNA 3MLTA 2E9BA 3WS3A 3GIUA 2GIVA 1JK8B 2QVFB 1FNSL 4O9HL 4U2ZA 4Y19B 2OQJA 1D5RA 1YVOA 1JG9A 4DPCX 1KENL 1U8NA 4MQ7B 2DTMH 3VH8A 3ETTA 4GXHA 4E41D 1S7XB 2RB7A 2XYBA 2NMSA 4CDGC 1AGDA 1KWMA 4UM9D 4DP1X 3SGKC 2XKNA 5TJWK 3U4EA 2AABL 4OI8A 1XGRB 5DRNA 4L1DA 2HFEA 1VGKA 4NQQA 4R96B 3SI1A 4AJVA 1XF5B 3G6AA 2IV9A 4WW1B 3UAJC 4WO4A 5A2IH 2E9JA 4PRAB 3KLDA 5BOPA 4BK4A 1S7FA 5SWQB 4MHHG 1J1PH 3V8CA 5AVVB 1RHHA 4XCFL 1JF1B 4PREB 5AUMA 5I17B 3AS0A 3WEOA 1S7TA 1Z66A 3V2AR 4EI5C 2F0CA 1NUDA 3KZ8A 5AAMA 4WFGD 2DQJL 1P4IL 2GT9B 3L3DB 2CDGB 1AVAA 5DJ2B 3VFMA 5C07B 1F5WA 3L6FB 3Q2LA 5GISL 2VLJE 4N8PA 2BO9A 4DGYH 3IU2A 3OAZK 4TL5A 5LRKA 2DWXA 5G5DA 4GEJA 5IJKA 3EFAA 4XC3L 3CPLA 3B3SA 2CXGA 2JLMA 3F7YA 1DJSA 1LE9B 2ZPAA 3GSUA 1DDHB 1H19A 4P6YA 4JZOB 3UMNA 5CWSB 3WIAA 4F2ME 4I85A 2NY1C 2APWA 4ZX6A 5B22A 1G1YA 3ETBF 3P9LB 1PKQA 3Q7JA 4P2YA 1UWGH 3HS0A 4Q38A 4L1LA 5F6IB 1JZHA 5EHFA 1NAKH 3S6KA 4YX2H 1IAOB 1JAEA 2WQRA 2C3XA 2DDQH 4N0CD 1TZHB 5DQ9B 3QEHB 4ETQB 4PJAB 5SWSB 1PLGH 1H6UA 3WKPA 5KYXB 5D5MB 5J1AA 1ZHBA 4UQBA 5DWMA 2WUCL 4PGZA 4WWPA 1G7IA 3GHPA 4X3RA 3SE8H 1MQKH 1TQSA 1TLKA 2O4EA 2WLYA 1RXLA 4H4NA 4XCCH 5IBLD 5DHEA 3C2SA 4YUEL 3ASWA 1MJ9A 3SGEH 3EGXA 5GGRA 1LO2L 1TCRB 3W9DB 3C08H 4PRBB 2HUEA 3DETC 4ZNEA 4U49A 5GQBA 2DMBA 2WWNA 4QRPD 3HRZB 4KUAA 5D1XC 3SN6N 2MOVA 4XXDB 3EH2A 2O30A 2Y7SA 2XXCB 4X6CA 4BE5A 5DUBB 3O45A 4LVNB 4NXSA 1AAJA 3OZ9L 3WEMA 3WN5A 1IC4L 3WMQA 3OLGA 2XFXB 3PFOA 1FL6A 4GP8B 5BZDB 2XTLA 4Y5XB 4Y5VB 5ACLA 4UB0L 1UOKA 4CKQA 4ZS7H 1LE5A 3UAJD 4ISVB 3PFQA 3V0JA 2RH0A 2VLKE 5C0GB 1J5DA 2YPKA 5E70A 5C0JA 1M7DB 1NSLA 2EUVA 3M7FB 4J3BA 4U6YA 4OIIH 4PJ8C 4EI5D 4F92B 1QW8A 3TH4T 2GFQA 2QFPA 3IDNA 3B34A 4D2NA 3ZMEA 1CLCA 4ODTL 4OCWL 1B0WA 5EZJA 1BFOA 1P7KB 1TETH 4WGVB 3AXIA 4Q9BA 5GSVA 2P5EA 1CX8A 5LKNA 1WWZA 2MOQA 1RUML 5D96B 4KZTA 2H2PC 4FQQA 4JO5A 5LYIA 4JPKH 4OUOA 2O5ZH 3DA0A 4GM5A 1SOXA 3CFCL 3PWNB 4FNLL 1TUPA 3KHXA 1F42A 3UZEC 3PP3K 4ERSH 2F74B 5ADPH 1R3IH 2YNCC 2IQAA 2HX8A 2NY1D 2B5IB 3HCVB 1NBZA 1FZKB 4NFRA 2W94A 5CFAA 2EJ1A 5LAPA 1DL7L 2NX5E 4RFNC 1TNNA 5I8KH 5IB2B 1P6WA 2A4ZA 2MOGA 4KAQL 1BEYH 3KW8A 3B2VL 4TNUA 3WUWG 4ZUUB 3BAJA 1DFBH 1A7RH 2CWRA 3PHSA 3PIQA 5D1ZA 4LMQE 5TDOB 1HILB 3ULVE 2Q51A 4B7LA 1WFJA 1X9QA 4E41B 1FORH 2Z4QA 4PJAF 2K6ZA 2VAJA 3NZUA 5D5MF 1A4BA 3GSWB 3R7QA 4Y1SA 2QR0B 3DKHA 1N67A 3FQXA 1L3WA 3TYGL 25C8L 4DP7X 3B35A 2X1OA 5H86A 3DETD 2XPZA 1U9KA 5FB8A 4PGEA 5F3FA 5H37H 3TOBA 5DWPA 4OV5B 2DMCA 2ZELA 3KXFD 5D1XD 1RZFH 4W9CC 5K9QI 4HWZA 1AGEB 3RY5A 1GA2A 3B3CA 1QFWI 1BQSA 1LO3H 4M7LL 1I7ZA 3UTTD 3ARXA 4RS2A 1PSKH 2D7MA 1M2VA 3E2HB 2QHRL 3H3BC 4MA8H 5CJQL 3ZDXE 1IU8A 1CF1A 3U9PL 4NRZA 4D9RE 1GYAA 3UC0L 4OIDA 4H7VA 2CGYA 4TVPL 2I9TB 3S6HA 1C5DA 2DPKA 3MZTA 7FABH 1HEZB 3BJ91 3MV11 5C0AA 1G1KA 5F7YC 5THWA 4OCNC 4CC4A 5C08E 3VI3B 3P9WB 3BSGA 1ZG7A 4R2GB 3CC5B 4AGQA 3CXFA 5DS1A 4ZTOH 4Z76A 2CTCA 4Q58C 3EJPA 1HQ4A 4MKMA 1LWHA 2FYVA 1MFAL 1OAUL 4AITA 5JHDB 1XOVA 5FDWB 4PJ8D 5C6WH 1QEXA 4NKOA 2CGRL 2D4DA 3AG3B 3KPRD 5C09D 3DHPA 3V4PA 2KZBA 3HZKA 5DJYA 3D3VB 2F7OA 4TTGA 1NLDL 4WI5A 5E94B 2H2PD 5EEVA 3IK2A 4HCGA 2NR6C 3ULUL 4ELDA 1RTQA 1KBGH 3ZDZE 3LKPA 3KASA 3ATBA 3BKYH 1KC5L 1ZSDA 5TTRA 1CLYL 4L9LC 2GSGB 2DLIA 3ZZ1A 3ARGC 3PB4X 3GMRB 2C4XA 2R4SH 1CU4L 1MLBA 5ANME 1SXZA 1RY7B 2OMYA 3K8LA 4LDCA 3EF7A 4WQOA 5D2NC 2B1HL 1KIQA 5FKAA 1T0MB 1XGPA 3KYOA 5AOKA 5LBSA 3S5ZA 5BW7C 2XEIA 4LCCC 4NPYA 5J5EA 2X3CA 3FQTB 1INQB 3OAYH 4QHMB 1QKZH 3UTOA 3WFDH 2DQMA 3ESUF 4P3WA 2X4RA 4R6UA 1SQHA 1OCOB 4FQIH 4WTXA 4O5LL 2HH0L 4PRDA 4LXFA 3GXFA 1VLXA 2FLMA 3RZCC 4MGXA 1K2DB 4JPVL 1NGYA 3UBXI 1TQCC 2PW2B 4Y9CA 1KCWA 4U6HB 1Y6NR 3S3PA 1OEZW 2OXGB 2BZDA 4QT5B 3ATAA 1MFDH 4XP6L 2CO7B 3FB8A 4H8QA 1ROCA 1BGXL 3FOMA 1T1ZA 5HGAA 2XPYA 5T3ZD 4Q9QH 1LM8V 2W9EH 3FQRA 3MOQA 4UT7H 1DSFL 3IWGA 3IF1A 4UCNA 1NIEA 2JQZA 1C5BL 2VUOA 4ZX5A 4IBSA 1THCA 1Y1UA 2UYLB 4BKLA 4XBEL 2XVGA 3L1GA 2BDNH 4B9ZA 5DLMH 4YWGL 1S9KC 4PVLA 3LHAA 3I75A 3DR8A 3GSNL 4OFIA 3QRFM 2XETA 3OBAA 3NK3A 5JPMC 3NSCA 4EI5B 3FQWA 5FUOH 5MEOB 3BXNB 4E0RA 1CFQA 2W60B 3DPBA 5AB1A 4LQGA 2FYYB 4JO4H 2E74C 2YAMA 2JSFA 4RWYH 2IMOA 2VC2B 3MLXL 4FQ1H 4OCYH 5F1IB 2BSCA 4MMYA 2GABA 3TWYA 1BFVH 5GJSH 4CAFA 3FXTA 3VI3F 4W9KC 2ESVD 2PETA 1GMEA 8FABA 5I1GL 5KSAA 1CDYA 1XGUB 5DZLA 5EN2B 5JA8B 3KL5A 1KACB 1E5BA 4AKOA 2VDKL 4AIZB 3VXTA 2DY2A 2QSQA 3A4AA 2NY1B 3PNWA 4M9PA 5F3BA 3IPFA 4GKSB 1Q1JH 1H3PL 4IDLA 2NX5A 4M6OL 2NR6D 3RX7A 2LOEA 1I1AA 4Z7NE 1UB5A 1FNFA 1UYWL 5BMFH 5KYUB 2Q10A 4U6VH 4K94C 5HHNA 3TESA 5I6LA 4WSKA 5JPNB 1X7TA 3ARGD 1N3NA 4WO4C 4LARH 3LRSB 3ET9F 4HALA 4B60A 4RFEA 2VXUL 3QJZA 1OP3K 2H32H 5D2LB 1ETA1 3B9DA 3GNMH 3MRLB 3FMGH 2ZXWB 3FRPA 3AFLA 3IN0A 2VH5H 2ZAHA 5AOMA 3X14B 4E5XA 2QZ5A 5AKRA 5ID0B 2WP3O 1JNHA 3LN9A 3WFHB 4OZFB 5IQ7L 4WHCA 1G7JA 3GJFK 2XWCA 3RVTC 2QQLL 1J1OL 2WWKT 5CGMA 1MZZA 2Y1VA 4BHUI 2OMWA 1PIGA 3NIGB 4HIHB 4JHZA 3ZZLA 5L2KD 5IJKC 3RZCD 4ZMQA 5IMMA 3OC5A 3ABGA 5LGYA 3ZL4L 5IQ9B 2EBJA 5E4AA 3WFZA 1W0WB 5E51A 1WA1X 3CZUB 2YPLD 3M8OL 1IM9A 2JJTA 1DBBL 4GPVA 4LLQA 4XNQA 4AKPA 4B5OA 1J9CT 3RL2B 3BVNA 5KS9F 3L95B 4K9JA 3OX8B 3B5TA 3HS0C 5HHOA 5L2JA 4MHPA 5HVFB 1ES0A 2XZQH 3Q8EA 4BXVA 5C08A 3P0GB 4WJ5A 5AG6A 2WO2B 4LEOA 3NGBC 1TZIB 3MRJA 1JP5A 3V4LA 1OCWL 5HP5A 2ZXBA 3FQ4A 1JV2B 4C47A 3C9NB 3V7AE 1T04B 1A9EA 2VDRL 3OMIB 4BK8A 2ANPA 4LCWE 1URZA 2JLPA 3THML 1NFAA 1P5VB 2Q86A 2CJUH 1T4KB 2VBQA 3QHZH 4LNVA 5I5MA 1ZIAA 1L9RA 3GIVB 2ALWA 4XN2A 4MXWL 1FG2B 3POCA 2VE6A 5A2KH 3D05A 2B4CC 3U4AA 4BFIB 2COVD 2V2XA 4MFQA 1BOBA 5ELIA 4A31A 1TVBA 3FJUA 2YFNA 1MCPL 4CAEA 1T7VA 4XMLL 2FEEL 4OFQA 4LGSB 3U46A 1RP9A 1Y7VA 1NA8A 2ZEEA 4DVRH 3OGCB 2ZYHA 1E3XA 3WN5C 4AYSA 3WABA 3L7FA 5K39B 2ICES 2OM5A 3HKFA 5HVWA 3H9SE 3IMWA 3IMSA 3MRDA 4WO4D 1HHIB 2J3SA 2ZOKB 5E6UB 4ODXB 3N40P 1QWUA 3OZKA 4MJ4A 2EKSB 4YO0A 4GG8A 5HHXH 5M94B 3U6XS 2ATKB 1QEWA 1W15A 2YUWA 4XMUA 3UZVA 5C0IB 3WD5L 4BZ2A 4X2TA 1L7TH 3WC7A 1S2EA 5D2LF 5CMAB 4LNRA 2J8HA 3QFDA 4H8VA 4L3EE 3ULAB 3V0WL 2NSMA 1SHWA 3NUKA 4F7TB 5JW3H 3RVTD 4JPWL 1DTDA 1JZ4A 2I9LB 2X44D 4UA3A 1GCYA 1U8LB 1IBDA 2H3KA 3BKML 4QHUA 5TFSH 4CA4A 3AU1B 4WJBA 1GC1L 5IVZA 3FUMA 1UB6A 3PLYA 2Y25A 2K6WA 3ERXA 3MRCA 1G6RH 3NIGF 2BJMH 2OR9H 2OX5B 1TSHA 3U6XA 3ULSB 4PJCA 2R7EA 4BEIA 4PEEA 3OAWA 3BIAX 4E2AA 1ESOA 5TE7L 4AL8L 1AE6H 1Q9OA 2GSIB 5J06A 3ZTNL 3FT3B 1KZYA 2BHFA 1BFSA 4M6IA 3C5ZC 4FKEA 5BRZB 1N0LB 1KTJA 3ARBB 3SDCA 5HYIA 4X6FB 2OOTA 4LOUC 5CJXC 5CP3H 4DW2H 5JTWA 4DESA 5I76B 4ALAL 3LKQA 3T65B 4N3UA 2WTRA 3O2WH 3BAKA 5DMIL 3FBUA 3VD9A 4JRLA 2ESVB 4JG9A 5D1ZC 3W39A 3BEVA 3M17A 1LCPA 5LYLA 5DHVH 1ZOXA 5PCYA 5T5NF 2BVPA 4D3CH 2WVUA 3CX5K 4M5ZL 2DWSA 2R8SH 1FLRH 4WF7A 4NDMA 3WN6A 5F6HJ 4DYOA 1O5DT 4K15A 4PTUA 5FK9A 5GJTL 2G60H 1FF5A 1DQTA 3F64A 3N04A 4NKIH 5HDOA 2CM6A 3ARGB 5AW6B 4PSPA 5J11C 2I32A 3VD2A 3SKUD 1UENA 3ZIYA 5D2NB 1YG9A 2BVQB 3REWA 2DWEB 4NC1E 5KUKA 2KPWA 1X9LA 1JGVH 3VU1A 3V6OE 4YSCA 4I48B 1KGJA 5B38B 3RTQB 5E1GA 5AZUA 1EZSA 3MRQA 3WTWA 4K3JH 3SJEA 1UUNA 3QZWA 5AYQA 1ANUA 2ITFA 4CC4C 3VRJA 4XNHC 1ZPLA 5L2KB 2X4NA 4JFOB 4GAJL 5T1KA 1BF8A 1CE1H 4HUKB 3OWEA 4X4XB 1U6MA 5H35B 4OGYH 1VHPA 3C5JA 2IQ9L 1XF2A 2C1OA 1LEGA 1HH6B 1QI4A 2KL6A 1CK0H 2A9ML 2WW8A 4X0KA 1VHSA 2P5ED 4FQCL 3ZZIA 2PVWA 5HGDA 3FT1A 4D0CB 4OC5A 4FG2A 3T4YA 3DVGB 1A1NA 4OZIE 1GY1A 3WY3A 1FG9C 5BXFA 1JDCA 1H5BB 1R3HB 2WLMA 3L1OH 1TF9A 2WWMC 1EO7A 3D7PA 2IAMA 3LSOA 2XZZA 3QULA 4I18A 1YEHL 1B3JA 4J8RB 4LCWA 5A1AA 5JPMB 3D50A 4EUPA 2OMTB 1QNZH 4FQJH 5CD3A 5CUSL 3CDXA 5FVJA 5E08H 3K6FA 5L4IA 4Z78B 3C5ZD 4XMWA 1N5YH 1ZGLA 4KKAC 4CYNA 1CFNB 5HVHA 5ICXA 1ZEAL 4YHYC 1SY6A 3IBEA 4LOUD 3UG4A 4LBEB 3WS3B 2DQDH 2X6UA 4MSWB 3OAUL 4YH6A 4RA0C 4Q97A 5JHMA 2O6PA 4Q6KA 4X80H 2Q1EA 5KYWA 4AQAB 4XNXL 4UBRA 4NO5A 4DKEL 2OSXA 4WI0A 1U8NB 1XB6A 3KH3A 3P1VA 4GSDH 2BNRB 5D1ZD 4CJ1A 4N2FA 5F0LB 3OLDA 2PWFA 1KYFA 4XNUL 4EAEA 3VWJC 4HF5L 3J07A 4ZO9A 3U4EB 1ID5I 4NWUH 4NJ9L 1D2PA 3RJQB 4J3OH 2ITEA 4Y4FA 2OAAA 3ALWA 4CRPA 3SY6A 4WY7H 1N12A 3L9RA 3ABMB 3EFOB 2HKHL 4IU2A 1YYLL 2W1NA 2EILB 3CPUA 4IKJA 1XF8A 2J1WA 3VGFA 4WO4B 5EB9A 2P42B 4N2NA 4DEUA 1LEKA 1NCNA 5G4MA 2ADJA 1CGVA 4PI0A 4MHNA 4R3KA 2C3WA 4JFUA 3ZE1E 3P4NA 3EO1A 3QJUB 2Z6FA 4JPIB 4KRLB 3QQDA 4I2XE 3G8WA 4XO5A 3DNSA 4J4PA 3MOAH 3NAAH 1AMPA 3STZA 2XC8A 1HSBA 4LCVA 4Y89A 4Z7QB 1BO4A 4L3EA 1TQTA 2B08A 3QJHA 4PXBA 3Q8FA 4RISL 2F8IA 2F5IA 1PQZA 2VZVA 3VFMB 5C0AD 4FLQA 3VWKA 2J2ZA 3P11H 3LTVA 1X3DA 5DJDB 4UANA 4Y5YA 3GSRA 4GUPA 1JWMB 5AYUL 1EUUA 1C12A 2ZSVA 4CDHA 5B4MC 1K85A 1F00I 2ATRA 2WQ8A 3BWZA 3H9YA 3I6KA 1FHNA 5KSAC 1J9RA 3LXUX 1XIWB 4R0LA 3GSUB 1DQLL 3QARA 2Q76A 4CILA 2OU2A 1BLNA 2NXZC 4LOVA 4XO8A 3DJRA 4AXWB 5ABZA 2VXVH 4R4FH 5CFHA 3AJ7A 3WFCH 2CNSA 2VR8A 3QUMH 1PKQB 1VSCA 4HK0A 3WEXA 1R3KA 3OPZL 1Y1DA 4XP4H 2O5YH 4JM0A 1FH5H 1ZE3H 5ID1A 1I1AC 1E4WH 4UQ3B 3UTPE 3LH8A 3JWDL 1A4JA 2ED6A 3HVDA 4LSPL 2ZEFA 2OLDA 4LMQI 2B4BA 3B7IA 3DX6A 3L9BA 3TPKA 2WWMD 3RIAF 5J1AB 4YQXH 4CVUA 1MHCA 4O23A 3U7WH 1KEMH 2QMKA 2X70A 3FU7A 3G5XA 4XO4A 5GRWA 4P9HL 5FYJE 2FH8A 1MCWM 1EEYA 3P4LA 3CQQA 4KKAD 4ACTA 4MDRA 1COBA 4KHTL 2ED7A 3KEHA 3QUYB 1CGWA 1SLXA 5EOTA 4DUXA 4XPDC 5GGRB 5I30H 2CTBA 1FI8C 4IRJA 3D7GA 5L0QB 2OCCB 4NQSA 2D7TL 3VGBA 1FFOA 3UTQA 4DGWC 3RIKA 2R2EA 3VVWA 4AG9A 4BXSV 4Q74A 2YWYA 3H4QA 3GMNB 1J10A 3EH3B 3CU1A 3PQYA 3VWJD 5ICZB 2EWBA 1EBPA 5C7ZA 2ICWJ 4QF1A 3MYJA 5KYNA 2JJTC 2NQCA 2YQ2A 4N0YH 4L8CB 5KTCA 1ZANL 2DLEA 3P0YH 4PPZA 4DUKA 4RMUA 1NICA 1LE5B 3IWEA 3Q2WA 5J89A 1F4XH 4KLWA 3RAMA 2R2HA 4PJBB 1G9EA 2NYYC 2J8NA 1I8IB 4YDVB 3GHEL 1P7HL 4OY9A 2HT4C 1F3JA 1HAWA 4W6WB 4U6YB 4TVUA 3AXHA 1XH3B 1NM4A 1T1YB 3E6HB 2R23B 3EJZC 2R0WL 2E7HA 2VC2L 5EO9A 3IDNB 2I60L 1AYOA 5EZJB 1RIVL 5ENWB 5LXVA 1BFOB 1VFUA 5GSVB 3MV7E 2P5EB 5CIPH 4Z7QF 3LACA 3QRGL 2WBJA 2WCGA 2FCBA 3MJGX 1AZNA 2F8OA 3VX0A 3LAFA 2DBLL 3CDZA 5B4MD 4P05A 1JHKL 3PXLA 4IYKA 2FJHA 4GRWH 4GP5B 4NGMA 5KSAD 1QHPA 2PJ9A 3WMSA 2E4FA 4H26B 2RQEA 2E9IA 2NXZD 2R51A 5E8DH 5FA3B 5CBAA 5DJAA 3FB7B 3BW9A 1YEJL 4AIXA 4AGOA 1AFVL 1MCWW 1S9XB 3F7LA 2NX5D 1E8ZA 1I8UA 5TF1H 5CHNA 1DUZA 3C5ZB 5HGHA 3TFYA 3BIKA 1GS7A 2JJWA 4OZGE 1I1AD 3QHTC 4FHBD 2XIBA 1YPZB 4ONFL 3CH1A 5E5RB 5FKPB 4HGWB 4NBXB 1MFEL 3MBWB 3TWCH 2DW5A 5E0QA 1CTMA 3Q9PA 4N5EC 2JDCA 3PIQB 5D1ZB 5BV7B 3D0VA 3NJHA 4KO9A 3DGVA 2OZUA 3MYZA 4DP5X 3HAEH 4NWTL 3EG9B 2PCFA 2QSTA 4KI5F 3SO3B 1FDLH 4WTQA 3TEZA 3ISYA 5HJBA 1FRGL 4IEFA 3LS4H 4HWUA 4K8RC 4PJ9C 4AENA 2ICEC 4CKVX 1FIGL 5LWYL 4Z77B 5FB8B 1KUXA 5AL0A 3IDIA 1E6JH 3L4XA 1FO0B 3SB3A 4GW4B 3UEZA 1D7CA 3WE6B 1NCUA 5HYJB 4ZX3A 4YOKA 4HWZB 5J11B 2HB6A 3MTXA 5KSVB 2CY2A 5ECGA 4U3CA 1UT2A 4X6DE 2AEIT 3GDBA 3H8EA 3TO7A 4LF3A 4OADA 4JX0A 2HFFA 4DGIL 2OZ4H 4CGNA 5HBBA 2JI3A 1IM9D 1PG7L 1RUPL 1M2VB 3EZJB 4I2XA 4M48L 4OT1L 2Y5QA 4ZOAA 4FQ2L 4CNIB 1HC1A 5IW1A 1Z32X 2IOOA 3K6NA 1MEXL 3F84A 3LQMA 4P3CL 5ALCL 5HHOD 2XTJE 2WKOA 4YHPA 1V3MA 1F1DA 2EO1A 3WXWH 5IQMA 2NY7L 5E7FA 1EVTC 2XQYA 2BOCB 5C0AB 5C08D 3SDCC 3SPHA 1FT7A 3GFUA 4XNHB 4KJQC 1IICA 3RTLA 1H8SA 5C0FA 3QCTH 5TDNA 2NYYD 3FUHA 3GLAA 1HQ4B 3C8DA 3IU4H 4GLRI 5F1SA 2HT4D 4PJBF 2PR4L 5KAQG 1B0GA 4IQHA 1Q9LA 3EJZD 3MJ9A 4HS3A 1GGIL 2P47B 3MBXL 4G7QB 4AYDC 3PWPA 4YGVB 4ZPTA 4AGLA 4OCXH 4XWGH 2VUKA 4J3UA 5C71A 2ZZUT 5IFHH 5CP7A 5DJYB 3OKEB 1XX9C 4OKVB 4F91B 2JI1A 2OI9C 1AQKH 4FKKA 5CNHA 4MHZA 3C8KA 2AKRB 3LKPB 5HDBE 3HHMA 2ILLA 4P59L 2EC9T 3IU3B 4U1GC 3PHOA 4HP5A 1MLBB 4XP5H 4WI9A 4DP2X 2XLLA 2XYCA 1RJZB 2Y7MA 1ZVHA 3CH8A 4UAHA 1CD1A 1T21A 3F00A 1ASOA 1KJMB 2Y72A 3HLKA 4YHYB 4E36A 3VXRA 1DVTA 5DK3A 5K9OA 2YK1H 2UZXB 2VZSA 1U2YA 4UYPA 3T0XA 4UOQA 2IPKB 3BWUC 3OR7A 4ACPA 4N5ED 4A30A 3QEQE 5HJ3A 1S3KL 5E6IA 4WUUE 1V7NH 3BEWA 4ZG1A 2EDYA 4JKPL 3UGXA 5GXBB 1QACA 2OW7A 3DHJA 4JW3A 4LLYB 3VWJB 4FAAB 1S9WA 1L9MA 3GZOA 3OZLA 5JUEH 4K8RD 4PJ9D 5IT2L 1BAWA 1Q72H 4HJEA 1S9VB 1T7WA 4QHLA 2ORBL 2PJ8A 2CLRA 1IC0A 1CTOA 2ZW6A 4R97C 5IESL 2OYPA 1M1DA 1JPFB 1ITCA 3Q2CA 4LLVA 1IEAA 1OO2A 3ZGHA 2CIIB 3UZQA 4AG4H 4P4EA 3WIFA 3JV0A 4KUBA 2P7TA 1T2QL 2X38A 4QHPA 3DIDA 3MSPA 1KFGA 3X3GL 3OJMB 2IAMC 3DLQR 4I18C 4PP1C 3PY9A 4MJ8A 4JY6B 4AVHA 4XCFH 4HCRA 3X2QB 4HIJA 1CFQB 1YMHA 3DPBB 3QJQB 4E0RB 1N8ZB 3AG4B 4ORZC 5JW4N 5HVHC 3KE0A 3SDCD 4LKCB 4JMXA 1I1RA 4MMYB 3T3PB 2DQIL 1KGCE 3BUQA 3JTTA 3VFUB 1QRNE 1B6BA 1XSKA 5CKAA 8FABB 3GMOB 1U3HB 2OH1A 4XC3H 4A68A 3TJPA 3GWJA 2NCEA 1XL4A 5ERWB 2XKSA 2NXZB 3GF8A 3GPEA 2VDMH 3PNWB 1JFQL 5DHMC 3ZT6A 4NGSA 3IRPX 5F3BB 2H3NB 2O5XL 1U41A 1UA6L 2VJXA 1FNOA 2GLJA 1MUJA 5EN3A 3X1FA 3BX7C 1P6AB 3W5NA 4Y4FC 4OZGA 3VG9C 1F4YL 1I1AB 3AABA 4WU5A 1XF3A 2G5RA 1S3ZA 3U0PA 3GSXA 5HHNB 1YC8A 5HJGA 1LFWA 3VGDA 2E27L 3NH4A 3NYKA 5IJBC 4L48A 3EYOB 1OL0A 2OJZH 3C6LA 2QPEB 1XZWA 2R0LH 3PV7A 5DZOA 5SX4I 3TIDA 1T0NA 2VR5A 2WUCH 1QRKA 3X1GA 4J4PC 4MYWB 4YBQC 4XPDB 4PCKA 1XB8A 3SDDB 2P5PA 4OF7A 4F7CA 4L5FL 3T71A 1S6NA 4WEEA 1CGTA 3O3BB 5ALBL 1XBUA 1G7JB 3VWKC 3B56A 3HG0A 5L4JA 2OMWB 2WLJA 1GSMA 1MAKA 4Y5YC 3G08B 3I02B 4KGLA 1EZLA 2Q8AL 3VFTA 4JNXA 1CB4A 5CJOH 5IMMB 1RZIB 5T1KD 3KLQA 2K8MA 3MMEA 3WHXA 3MJ8B 3B5GA 1QD0A 4M6NL 5E8EB 5C6PB 1MF2H 1J5OL 3ECWA 2AQQA 2D2OA 5DC9B 3SQOH 4OQTL 3UTSE 3IJ8A 3S9MA 1IM9B 4MZRA 1PX4A 2OZHA 3F62A 4RRPA 1CL7L 3H8NA 5LDUA 4YDKL 3GRGA 4PXDA 2G75B 1N26A 5HYQA 1HIMH 3CE1A 2WY3B 3IAQA 1IQWL 4FFZL 4M00A 1FJ1A 2D0GA 5FV2A 4DWHA 5DVNA 4A04A 5C0RL 3L4ZA 5F47A 4UILL 4WJ5B 4UB0H 5JNYB 4LPVA 4JFSA 4LEOB 1KT2A 2B7DT 2GFBB 4XNBA 3WDHA 2Q6WB 1PYWA 2ZWKA 4AW4A 2Z3MA 2IAMD 4Q9CA 4PP1D 4NJAH 1LTXA 3O6KL 4LCWD 3M88A 3PAZA 1VHOA 1LVEA 5T5FA 1M05A 1DBKL 2Q86B 2C7FA 1F6LL 2BSRA 1UZ6F 4Q52A 2WPGA 4A7VA 2Y36L 1NCAL 5FECB 4YXHH 2BSWA 4IRJC 4E42A 1WFMA 3CMOL 2R1WB 1UA3A 3GI9H 2QTEA 5FOBB 4B95C 2LVEA 1QW9A 5D6CA 3HZMA 5GHWL 4M5TA 3KPOB 1XH1A 3CFCH 5AB0A 5E1IA 3CVHA 1RULL 4FNLH 2H6OA 2J8UA 4HFUL 1OCRB 1L3NA 4OLEA 1KLUA 1IEBB 2W88A 1P7QA 1UXWA 4QKTA 5I5IA 3WDIA 4Y1AE 3SKOB 2AJ6A 4NUJB 5DYOA 4Y4FD 4OJFH 4ETYA 5KJ7E 3QCVL 1YNLL 4Z7VE 1PZAA 4KJPC 5D8JL 5HHME 1XVSA 2ICWA 3MV9A 1U92A 4X6EA 1OSPH 4R7LA 3QEQA 3F5BA 1JPSH 4PUBL 1HHKB 4PPTA 2OTUA 3DJTA 4JG0L 4YO0B 3CQPA 3T2LA 5D7JB 3UZVB 5GRZA 4J4PD 1HJCA 4FNQA 5DS0A 3FSOA 4YBQD 2F1BA 4MZ2A 4PJ9B 4UNVA 2NTFB 2ICEB 4JQVA 4X98B 4R9HA 3EDDA 1G7MA 3VWKD 5GRJH 4E2OA 1OW0A 4UM8B 2WBJC 2QV4A 2A6DB 3QO1A 5IVZB 1F57A 2WQXA 5F7WC 1RSYA 3NCJL 4ZJ9A 1SM3H 4BFEA 1KULA 4PJCB 3QEUA 3V9FA 1NGQH 4M7LH 3FZUC 1R47A 4JDEA 1Q9OB 3VUAA 4PRPB 3B9AA 4NB7A 1UM4H 4GMTL 3DDFA 1YLEA 4G5ZH 2PVVA 3VA2C 1WQVT 3SDCB 1GGCH 1FYTB 4HS8H 4C56A 1RZQA 3QISA 3KWTA 4AW7A 1Z4EA 3BC9A 2B0SH 2WC7A 3H3PL 4HC1H 2XVLA 4OFYA 3TA3A 2NY4C 1JYXA 3CFJA 3P2TA 2V2WA 4ODWB 1QI3A 3BEVB 3D8MA 4NM4H 3LPGA 3JXAA 3OKNB 1MFAH 4K9EL 3VXUE 4F0XA 3JVNA 1S5IL 4OM0L 1YREA 2B4CL 2CGRH 2PP9A 2NUTB 4YPGB 3N2JA 3QQ9C 2A1WL 3HI6H 4IRJD 2OI9B 3DROA 4LASH 4NZJA 4ANVA 4PTUB 4N22A 1TKHA 2DM3A 1OE2A 3CBRA 3O9WB 4KFMA 1AIFA 3ABZA 3ULUH 4X8GA 4KLVA 5DSCA 3D39B 1KC5H 3ZDZF 1YW6A 1CLYH 2EH8H 3MGAA 3PQYD 4U2YA 5CXPA 5CJ5A 1ZO0A 3REWB 1A7PH 1ADQL 2IGLA 1J0JA 1CU4H 5B39G 1CE6A 1FHGA 3GINA 3CBKB 1LEIA 2IH1B 4M7ZB 2WUBH 4M4PA 1Q0YH 3V0EA 3MRQB 2EDOA 2YGOA 4KJPD 1SMOA 3QZWB 4AVIA 4ZW7A 2C4FT 3VRJB 5I23A 1BG9A 1OK8A 4HSCX 2PC1A 3FT9A 2V8VA 2GTWB 5D7IB 3T0EE 3O11B 2X4SA 4O5LH 4WWID 1WZ1H 2JTDA 4XZUA 5T1KB 3QUGA 1OGAA 2FR4B 1T3FB 3RO0A 3OXSB 2LAGB 4L4TB 4NSKB 3U2IA 1XF2B 3C5JB 4Y49C 2C1OB 1LO4H 4W9YA 1LP9B 4HAFA 4FQLH 2V3FA 1ZV9A 1OOWA 3KYMB 2IH8A 4GSXA 5KVDE 2A73A 3RDJA 1H3WM 4XP6H 2WBJD 1M6UA 2ZUXA 3ZL2A 3OKYA 3CZXA 2BVOA 2FQEA 3A67L 3FTGA 2VDOB 4YHOH 4E9YA 2WLLA 1C5BH 3FZUD 4OZ4B 1NFKA 1XMWA 4XBEH 2XY1A 5LCVA 2FBOJ 4YSSA 4PJCF 1A0QH 4QXGH 3IXTB 2R7HA 4Q6IA 4PLOB 4U1KB 3KI9A 5K59F 3UO1L 5E2UH 4DQOL 5ICXB 2QBWA 2VDPB 2C9QA 4NKDA 4XP9L 1MJ8H 4RAUA 5BV7L 1G9NL 5DK2B 4NUMA 3DBXA 5KYWB 4MBUA 1WAAF 4ANWA 4NO5B 4WI0B 2CA3A 2NY4D 1NMCC 1SFHA 3VFOA 1NCBL 2CUMA 2NY2C 2H0EA 4WEBH 5E6IC 5I1KL 5J8FA 4BDVB 3AGWA 4F8TA 1JZ6A 1CLZL 4O58L 2ZONA 2X4UB 1N8OE 2ZW5A 2B5GA 1RFDH 4Y1AA 5F48A 4NXYA 3QQ9D 4KFZC 1FO0L 2PRBA 1H3PH 3MXWL 4P4DA 3K72A 1JWUB 4GXUN 4KMTH 4MXUA 2VN3A 4GQ9L 3FW6A 4UUJA 1B0IA 2EIMB 5KAQF 3VSUA 1QLEB 5A7BA 4XOAA 4FJ6A 1NL0H 3BAWA 2AK4A 2ADJB 3LYRA 2VL4A 2X6AA 1B2WL 1EMTL 2WK2A 3K4ZA 1MJBA 3EO1B 2VXUH 3CSPA 5J3HC 4HU8A 1NINA 3FYNA 4GKNB 1HOCA 3QDME 4HUCA 5DFTA 4HXBH 1CVSC 5EF0A 3MROA 2CLZA 1TKFA 1NTDA 5IQ7H 2VR9A 3LN5B 3FSWA 3X11B 1OV8A 1WIOA 4Y5YB 2QQLH 3RBGA 4GUPB 2ZSVB 3EYQC 4U6XA 4D3CL 3HR6A 3B3TA 3BWUF 4WKXA 4U7MA 1N2RA 1KWKA 3TVMB 5D7IF 1MH5B 3BLKA 4F24A 2F6AA 2Q76B 1IBGH 2P80A 4S0SD 3S37X 1ORSB 4KITB 2Z7WA 3PWPD 3HW7A 3T08A 2W07B 1IBYA 2GC4C 2WLIB 2RFHA 1IVLA 3WEXB 2W91A 4B3VA 1R3KB 1IJNA 2YD1A 1BBJA 4JGJA 1HXYB 3O4OC 1G4MA 5ID1B 5KJRL 5LQBL 2OFQA 3UTPD 3LY6A 1TITA 4QRAA 1A4JB 1ECYA 4Z5RB 3H9HA 4R8WH 1DQQA 1U8MB 2VZYA 1D5BB 1GPOH 4PWIA 3C6LC 2ADFL 3BGMA 3VXME 1SOQA 4PV8B 4TULL 5CEZH 1OCWH 4GFTB 4RAVA 2DMHA 3JZ7A 3VXUA 4H0GA 4A6YB 3I9AA 2X70B 3EIFA 2VDRH 5L6YL 2W65B 4HCIA 2FX9H 4P4KA 2XOTA 3CBJB 5AVZB 3VXRD 3W2DL 3HR5A 4ZFOA 4IRJB 4OB5L 2ZWNA 1DQML 2J8MA 4MXWH 1J88A 2WHVA 1FFOB 2NY2D 5E6ID 2R2EB 2WXIA 4M43H 1QTSA 2ZWYA 5D6DA 1MCPH 2DQFB 2GK0B 3BDYH 3PQYB 5DDHA 2CNZA 1NSNL 4GNKB 4XMLH 3FQUB 3MYJB 4TYUA 1FY7A 1R3LB 2C1PA 3BZFA 4JZJB 3L5IA 3OQ3B 4EZJA 2PCPA 3DDGA 3M1BA 1OANA 4D8OA 4GMSL 1YCSA 3BFQG 5K9KA 3A6BL 4TNWK 2EDJA 3NPSB 3BVXA 2VUYA 1O9VA 4PU2A 3KKWA 2R2HB 2JIXB 3SBRA 2C9UA 5KANI 1EJFA 4ENZA 4XXCA 1KIUA 5J3HD 4F9LA 2V9QA 3MA7A 2N7BA 2GQHA 3VGAC 1NWOA 2Z31A 4Y2DA 1ZTMA 4HKBA 4GS4A 1BD2A 2X2YA 3GBDA 4OSUL 3T2PA 5MEQB 2PSWA 1HKFA 5CCGE 3GS0A 5JDSB 4NQTA 4W9FC 3EYSL 3WTVA 3NH5A 4O02H 2RB8A 1WBYA 4LCYB 4PRHB 3IGRA 3FQNB 3CDZB 2E8ZA 5DLLA 2FJHB 1E0OB 3HG5A 4AQOA 4ADGA 4C83B 3RIFF 2EAEA 5KVFL 1CS6A 2ZG3A 3D4CA 1SJMA 1AQ8A 3SPCA 5CBAB 1SQ2N 4UZGA 5DJAB 3BW9B 1XDTT 4GI9A 2IQ6A 3QNVA 3SZKC 2P8LA 1J0ZA 3ZTNH 4OC4A 4HJTA 4XP1L 1W72H 2J6WA 1IYLA 3O2DL 4B5EA 4E9TA 3UBGA 4TSBL 2CDFA 5H37A 4BWTA 4WZ9A 3QZNA 2BINA 1J12A 1CT8B 3PAUA 2NY4B 1U8PB 1RZJC 3LPOA 4FXGA 2YXWA 3VI4B 5IJVB 3C6LD 2AGJL 3A3YB 3JWOH 5DMIH 5E0FA 4MFKA 1I9EA 1NIFA 3S48A 3I6LD 3NE8A 2D8KA 3QG7H 2NY5C 2Q7BA 4XPBL 4TRPH 5GS1B 3RPBA 4JQVC 2IDQA 4Z23A 5DHYA 3RI5F 4KBPA 2MJWA 3TPUA 1DE4A 1MW2A 1E90A 1OW0C 1P2CB 3GPSA 1NQBA 4FNRA 4ZSOA 2DV6A 4AYFA 4AMWA 3GM0A 5IB5A 5JW4M 4J3GA 4KY1L 4S1QH 2CHNA 2WKLA 2R1IA 1S5HA 2AMUA 1YJDC 3NJGA 5K9QG 3IAGC 1I8KA 3QG6B 5IHHA 4MMXB 3KBFA 4AGMA 1KFAL 1MWAB 2H1PL 2ZENA 4HEPA 3VFGL 3BFWA 1OAKH 2APBA 2H1XA 2KDGA 5IMKB 5IW1B 1WZLA 3MRFB 3QDMA 5F3HB 3N55A 4MWFB 2XG4A 3U4KA 1VACA 4AV5A 3BIBX 3TTYA 4WV1A 3EOYG 5B39B 1X5MA 5C0FB 2JKNA 2X4QA 3LZPA 4KVNL 4NQVA 4YSPA 5DVPA 2VABB 3TA3C 1SJEA 4TQHA 1MHPH 3TTHA 2HLFD 1S78C 2WLKA 3KVQA 1RJLB 4Z1PA 1KUMA 3OKKA 5T33L 1B0GB 1Q9LB 1UWYA 2K3HA 4NENB 3SKJL 1DANU 4HUXA 3GSVA 4PBVC 4YSQA 1KN2L 3PWPB 4ZYKA 1I8MA 2G4EA 3DSNB 3QYNA 1CD0A 4QMEA 5CP7B 3LKRA 1A7QL 4U3SA 1XAUA 4NKQB 3D06A 2QADC 4KQ4L 1IGTB 4JVPA 4UINL 3HPLB 3UIZA 1Y18A 5CEYA 4JFEB 4EI0A 4ABVA 1R24A 4PW3A 2F1EA 1LANA 4N2CA 3IFPA 3FPYA 3EFFB 3TT1L 1DBMH 1P7QD 4G42B 4QCIB 1S7LA 1T21B 4YAQA 3S88L 4ODUA 3BPLC 4J3SA 4M7LT 1YEKH 2JE8A 4WENB 4FCAA 5EZPA 2QDVA 3VXRB 4P57A 5K9OB 4X7FC 2ICCA 3MV9D 5FGCE 2CE6A 2CUIA 4CJ0A 3ZE0B 3OAUH 2A7BA 4K7PX 3QEQD 3DIFB 2BIHA 4BZ2L 4XNXH 3ZBMA 5IUSA 1WFUA 2O6EA 1S8DB 1ZHNB 1IM3B 2NY2B 2BH0A 4HH9A 4B0MB 4CGTA 4HUVA 4DKFL 4K8RL 3UBXG 3FTVA 3MU3A 3N6YA 4BD9A 3QXTA 5AW7B 3VI4F 5E8PA 1MI5E 2WV3A 3PNRB 4FTVE 4B6ZA 3V9CA 1PX8A 2I26N 4HF5H 3ZW3A 1AHKA 3VATA 1A14L 1H9VA 4IK7A 2CLRB 4NJ9H 1Y0LA 2RA1A 3RI5K 1EV2E 2ZP0T 4OCLC 5SX5K 1ROWA 4CU8A 5AW4B 1X7QA 4LLVB 4S10A 1IEAB 1WA0X 1AANA 2HKHH 5KW9L 1HDUA 1G84A 3WIFB 2J5LC 1URIA 1XMEB 3K1KC 1DTUA 1E28B 3T9WA 1A6ZA 2NY3C 5IVXB 1EPFA 3T09A 1WCQA 4FFVC 4Q6IC 5T1DH 2IPUG 4WJKB 2V5RA 4OQ1A 4X4YA 4WHTB 5I6MA 2Z8VC 4WK2B 3SBPA 3NCFB 1RH8A 1TQUA 4Y9FA 2DQGL 2VR3A 2SODB 4C56D 4RISH 3G6JE 2WKOF 4QXUL 2VXSL 8CPAA 4LSVH 1KGCD 2FT0A 1LXMA 3TA3D 1FAIL 4NLHA 4OFYD 3VW3L 1S78D 2ZJSH 5AYUH 1W8OA 4FI8A 3VSVA 2QPUA 3GRWA 2IIJA 3VXOA 1D5XB 1XGYL 2W59A 2P0WA 4JUSA 1TSRA 4RWHA 2DBJA 2QADD 3M46A 1KCUH 3TA4D 3VB8A 2DL2A 1EO8L 2JCCB 1Z8TA 1FP5A 3DV4A 3OPZH 4KTEL 4WU5B 2J88L 4A38A 6FABH 4H6UA 5E56A 5FYKD 5I1IL 1BVOA 1YRKA 2CJSA 1OAZL 2A3TA 3JWDH 1HHJA 1UVQA 3MV01 3PPEA 3BZEB 5AG4A 5FYJU 4BD4A 3MLUL 3FS9A 3TIDB 2P6FA 3R95A 2BOBA 5EU7E 2QPFA 3CZSA 2OR7A 4P9HH 5K8NA 1MCFA 4AYMC 5J57B 4N9GB 1I7RA 5LXGL 1WO2A 3NJMA 3DX7A 4P06A 4KHTH 4UTBL 5B1BB 5FO8A 5MERA 1EX0A 2E7MA 1JXKA 2XFGB 2Q44A 3QW9A 4F57L 2AJUL 4B27A 3E6FB 5IQLA 2HG5A 3WHXB 3ZE0F 1OGAD 1CI3M 1ET8A 3T8XA 4RGMC 4CSSA 4RGOL 5F93C 3GKRA 3IJHA 5FFLA 4BWWA 2EDEA 1A7NL 1ACCA 1KLFA 1U3NA 1U93A 5F96H 1F1AA 1VFAA 3KWWB 2VDOL 4LU5H 1T2JA 4MHYA 4AH2B 2GITA 3H42H 4Z0BL 4EKJA 1KCBA 5KG9A 3MA9H 3QXDA 4UQDA 4R7NA 3EOBA 4XPTL 1YECH 2MTAA 4HCFA 4MJIB 3N85L 1I3GL 4BH7A 4Z8FH 4WAFA 2EEFA 3CZKA 3N3EA 3FTSA 2O61B 4HG4J 1PYWB 2NY3D 5MHSE 2WNXA 4HWNA 4ZT1A 4NJRA 4YDMA 3GHEH 5F88A 4BK5A 2XX1A 2KHAA 1QLFB 1Z9SB 1K8IA 2VDPL 1M05B 5EU5A 1CR9L 5IVXF 3TBTB 3OXRB 4O2FB 2VC2H 2AJYL 3D48R 4K23L 3LNIA 3L9YA 1SJVA 4P4KC 2I60H 4JUTA 1N6QH 1RIVH 1UGKA 4RETB 4E42B 2FQGA 4U6TA 3S3CB 1FLTX 1G4RA 2QSCH 2XWXA 3MOBH 3VRIA 2DBLH 2XQYK 3GMMB 5C0CB 1Z8WA 4KC3B 3IPBA 4ZFGH 3FRUA 2XICA 5D6DC 3CVHB 2J8UB 1F45A 1KLUB 2XZAH 5E1AB 1P7QB 4ZMAT 3DGGA 5EF2A 2JJUA 3TU6A 1YEJH 3OKMA 4MFJA 1AFVH 1U91B 2K8QA 2YGVA 1TR7A 2YD0A 2ZX7A 1D9KA 4G6JH 1QLEL 1ZWIA 2C9VA 4OGQC 3ZDYB 3MLPA 3B2XA 3LS5L 4F7MA 4GG6B 3BQVA 3DJ9A 5HHMD 3CHXA 1KB5H 2QKIA 3L5HA 2JCCF 4BRVA 1NC2B 4OZGF 3MV9B 1U92B 3PAVA 1MFEH 3V55A 4J3VA 3K9TA 2AK4D 3RWDA 2Z92A 1G6RA 2P6GA 4XXCC 4XX1G 1SEBA 1Z9OA 4F9LC 2BP8A 4AM0A 1OIOA 2BWIA 4NN7C 5F9OL 3TBBA 4PV6A 4NWTH 2Z31C 4FD4A 1T20B 3K2IA 1QSEB 3EJCA 2ITDA 2GJRA 1PG7W 2OMZA 1FZJB 3V9EA 3BHXA 2ZX6A 4J3TA 4YC2C 1OAQL 1KGUA 1PZUB 1FIGH 1RUAL 2AMGA 3SI0A 3BPNB 5CP3A 3WKML 2IBZY 4JRFA 1JZ2A 4FL4C 5DD0L 5ILTH 4G9DB 5FCUH 3GM8A 2P80D 3D7HA 1BYPA 3QIUB 4NRXB 2FTAA 5DHVA 2DEXX 4DTGL 4TPRL 4XMXA 1PG7H 1RUPH 5JYLA 3RWEA 4N26A 1G5AA 4W6XB 1JTPA 1MEXH 3PDGA 4P3CH 5DEGA 2VMJA 4TUKH 5ALCH 2JDDA 3MHZA 4PFEA 4C56B 2YJLA 2A5UA 1PTZA 5JORB 4HKFA 2NY7H 2A6IB 3SPGA 3OWRA 3TA3B 5IFAH 4A6YL 4FXGC 3CFJB 4O2CA 3DRQA 1P0SE 1TTBA 2VXTL 3VXUD 2WYTA 3W5MA 2Z91A 3H56A 4DO4A 2OMBA 3IYLW 5CZVH 1ZVNA 1GGIH 4PWHA 4P4KD 4MMOA 4P04A 1Q2YA 3HS8A 2YC1A 3LMSA 3U6RA 3B3IA 1LYQA 1MN4A 35C8L 1VAHA 3P0VH 5FA4A 3ZVVA 3I6GB 1O0VA 5IB3A 5LLIC 1DE4C 2AW2A 3KPLB 1AIFB 3MBEB 5DA0B 5DSCB 4QXTA 4TUJA 1K4CA 4NEXA 3EUDA 3KGTA 4JREC 4F8LA 1CPSA 4XVUC 2RCSL 4ADJA 4XNDA 3FTWA 3IJEB 3OMAB 3IGFA 1CE6B 2J8UF 1EEQA 2YBGA 4KOCA 1OKEA 3ROOB 4TQEH 4YJZL 5I1JH 4AVBA 4HJGB 3GQFA 3QRLA 3GD1C 3WC5A 2DKMA 3SOTA 1LK2B 3IETA 3ZDYF 3FTYA 2ZIDA 1AR2A 4WV1C 3K6OA 1E4JA 1QLRA 2XWJA 3NA9H 3OR6A 2UXFA 3V8OA 1T0OA 4XZUB 3T2OA 2EH7H 1C08A 1OGAB 3QUZB 4X6BB 4A7TA 1JGLH 3GIZH 5A43C 1U4FA 2YRPA 4PVNA 2HAZA 2Z31D 1BQHA 5E5MA 1WK4A 4JKPH 1BD2D 4S1SH 1DSWA 4AYBA 1BVLB 2BOLA 2G3XA 4Y1TA 1EXGA 1OF2B 4LLMA 4WKZB 3VXQA 2CRZA 1GZQA 2PYFB 2A73B 4IMKA 3PJSA 2GHWB 5L4MA 4RBPH 2YGPA 4P3DA 5F9DC 3UAEA 3ELAT 5FF6B 1MG3C 3CFIC 1S5KA 3BE1H 3V0GA 1SLUA 4DP4X 5DMGC 2CUAA 2J5LB 4ZODA 2WN2A 5ELYA 2NY3B 2VZZA 2QGCA 3VXNA 3FCGA 5JHLA 1FNAA 2R4RL 1V0CA 4KOUA 4GYBA 4NCC2 1G5GA 4K71B 5IBTL 1IU1A 4GO8A 1KTDA 4J27A 1V55B 4AC4A 3CV5A 1ZLUH 3GMPA 1KG0B 4MDIB 1KSRA 3RDTB 3C5SA 4MJ5B 1WAEA 3ZKQD 1PCXA 5AOZA 2DQTL 2E0PA 3DBXB 3IFLL 1KPVB 2ZT9C 1UWXH 5D72L 3GTTA 1M53A 1VESA 1PY4A 1EJ8A 1XGTB 3QO0B 1UT9A 4NN5C 5H8DA 4XPHL 1NBCA 2DYRB 4NNXB 4A2DA 3M86A 5LB1A 5LHDA 1QUNA 4PV1C 2B5GB 1ACXA 4AQ8A 4FHJA 2AE6A 1WZMA 2UXGA 1F97A 4M6HA 1UA6H 1JFHA 3TNNA 3TC8A 4HVBA 4MA3A 1NMBL 3RA7H 2NYKA 1NDGB 3K72B 1MWAL 1F4YH 4UUJB 2VSKB 4XNYL 3UACA 1QWNA 5D7LE 4BSWB 3F2LA 1TO5A 5FHAL 1Z4RA 4EKXA 4TOYH 1MIEL 2AK4B 4FC3E 4UTAA 4XVUD 4NUGH 4DK5A 4NSQA 1AJ7L 1U8CB 2R1YA 2HVKB 3V6FB 3F58L 3NH7H 4G8GE 4JEGB 5AWNL 1QSFE 4YHMH 4JHBA 5IB4A 4NN6C 4S0TD 2P46B 1QYGL 2NNRA 4M3SA 2HTKC 1OWRM 3MROB 1MQ8A 3IMUA 4ZUTB 1T4WA 1IBZA 3FYEB 5KVEL 2DD8L 4U6XB 2XWBB 1T83A 1SUHA 3B37A 4JFDB 1OT4A 4NZDA 5DZVA 2Q8AH 1N2RB 2VLRE 4RGMB 5G2NA 4KRPC 4M6NH 1TTAA 2FATL 2Q4YA 4OQTH 1ZLWH 4BA0A 4HOZA 4YSAA 5IHWA 3OM3B 1IGIH 3JTSA 2WQAA 2WANA 3OHXB 3EKCA 5H94A 3GT6A 4YDKH 1BBJB 1I1FB 2YIHA 4YHNA 4WUKH 2SEBA 4XVOA 5DJ8B 3QI9D 4WHYH 1ZDQA 5DMGD 2RC4A 2OS7A 4JFHD 4M85A 3D18A 1JD9A 3MJ7A 1DQQB 1GYUA 4PHXA 4HJIA 5TDPA 5EIIA 1KTBA 1IBHA 1GH7A 2IC2A 1SMAA 5B1CA 1PZCA 2Q9OA 4LVEA 3TONA 1PD0A 1HZLA 4P4RB 1AP2B 4OUUB 4JJXA 5ACMA 1WZKA 3L3KB 3TBCA 1VIXA 4F0YA 4MAYA 3W9EA 1LO0H 3P77A 3TS8A 1ZT4A 1PFCA 1IOFA 5EBWB 3HR5B 4ZFOB 1WYJA 3MV8B 1D6EB 3ECUA 2C7UA 3T1FA 1JZ8A 5J13C 2VDQB 4N6RB 3KGQA 1NEZA 3CMOH 4P9ML 4QJ3B 1K8DA 1IGYA 3BKCL 5GHWH 3RNKB 2J7LA 1KDIA 5CLTA 1KEGH 2BRRL 2V5SA 2BP5M 4E9LA 3GUTA 5DFAA 4DEWA 1TU2B 1N59A 4HFWB 4EOWH 3OVUB 3BZFB 4H2AA 2X7LB 5DS2A 1EXUA 4LKXB 1HX0A 1KXTA 2PCPB 1A2YA 3M1BB 2VDNB 1CFTB 5CINH 5EFIB 4MCRA 2EUIA 4HZLB 1KJ3L 4GW5A 4HU2A 1Q0XH 3LRHA 4OLWL 5CIPA 4BGDA 5ISZE 1YNLH 4Q6YA 1VERA 1YSJA 2CK2A 5D8JH 5G55A 3D5OF 5FUZL 4C57C 1L6PA 4XN4A 3ARYA 1R5IA 1TJIH 1BXVA 4PUBH 3VNZA 4B13A 4NN7B 1EEZA 3MNDA 4BK5C 4NX0A 2O1AA 1BD2B 2HTKD 4FP8L 2VKXA 4N86A 5DC0A 2Z0UA 1L7IH 1ZG8A 4P2RE 3FQ1A 4YC2B 5DZ9A 1ET7A 2X88A 1WC7A 2IALB 5C0NC 2V37A 4GQRA 4U5YA 2M83A 3FBKA 5AZEL 5D4IA 3RUGE 4MFPA 4LEXL 2ZPKL 2P6EA 4KRPD 4HZAA 2MQ3A 4RNRB 3FSAA 4IKLA 5DUMH 4LEBA 1AQDA 1JNNL 2XN9A 3CVIH 4K5MA 1IKNA 2F1AA 3MCLL 1E4XH 1L9SA 4HIXL 4XAWH 5DD3H 4L1TA 2YN5A 1D9KC 4N2IA 4G8AC 4Q0XL 3UYRL 1RZ7L 2CDFB 1ED3B 4XO3A 2ZKXA 2QKIC 2A0LC 2G5BA 3HS9A 1R0AL 1F2XK 1YQVL 5D9SA 1ZS2A 3ROLB 5CBMA 1PZ5A 4RMSA 1GGUA 4QRRD 1BMWA 2ED9A 3ESMA 1Z0MA 4PJFE 4J39A 3A4DA 2ADIB 3ZZSA 1YR0A 2OZ4A 4Z7OE 1G7PB 2ZG1A 1DDTA 3BP7B 2Z7YA 2HRGA 5I0DA 4LSUL 1NEPA 1CPXA 3K9UA 1MCSA 4OFDA 5E2WH 1MELA 2HWZL 1J0KA 2BOAA 3TPUB 4JKNA 1DE4B 2HTLC 3CLEL 3RPIA 4AYFB 5KVMC 5IB5B 1IKOP 2F8VA 2Y07L 5D7LA 1JGUH 5GCNA 5CD5C 1NLBL 2VXQH 1EERB 4JFPA 4LB8A 4DIXA 1I8KB 1KPRA 5FCSH 2V2TB 3MLZH 5JZ7C 3LHPH 3QWRA 2AV7B 3H85A 4QXVA 3FF7A 3ARDA 1ADQH 2DM7A 1N4XH 1WUZA 4YDIH 4H44C 2APVA 1K5WA 2EDMA 1CZ8H 4DEPC 4UOZA 4M3JA 4KKNA 2X6CA 3QQ3A 4GJTB 4IBUA 3I50L 3KS0J 1AYRA 4QRSB 1SZNA 4WV1B 3I6SA 3UJIH 1BXUA 1SF3A 3F04A 2GAZA 2X4QB 4CL7A 1XL6A 2X87A 5T5FL 3IFOA 2WXGA 1AKJB 1DUYB 2VLJB 3BSZA 4UAOC 3Q3GA 3GI8L 3FYIB 2YGNA 3RU8L 2OR8A 1F8TL 3GSVB 2WYZA 3QGVA 1SJHA 4ZYKB 5BO1L 4AVJA 4F15B 3PBBA 1I8MB 1KY7A 4JFQB 2Y7QB 3IEAA 1AC6A 2HN7A 2H5MA 3FXIC 3LKRB 5AKSA 1NM9A 5ICYB 5BRQA 4CU7A 4PVMA 7CPAA 1FFNA 3KYKH 4JJ5A 5GZOA 4MS6A 3F5WA 5C0ND 3SE4A 2LHAA 4X9YA 3CVHL 3S36H 2VJ0A 3QI9B 2FJFA 3A67H 4JRXE 1JERA 3U1QA 1FSKC 4NI6A 4PY7A 4POYA 2EVGA 3C60A 4IK6A 3IFPB 1ZLVK 5AD0A 5D7SL 3A6CL 2C9SA 3NCCB 3BRFA 3VDAA 2BNQB 4YAQB 3O0LA 3DYMA 5I71C 1D9KD 2O6CA 4JO3H 3VD3A 5HHVH 1NKRA 3UO1H 1ARMA 1FNLA 2B20A 2MH4A 1IFHH 2A0LD 3MRMA 5I2IB 4APXA 4Y0GA 1CDBA 1ICTA 4BFFA 5BV7H 4OLLA 3WO3B 3C75A 3KDMA 1M2OA 3KHZA 4ONGL 2BIIA 3HN8A 1DQDL 1NCBH 5JOEA 1GOHA 3BP6A 4D8PB 2AP2A 1UM6L 4AV0A 1CLZH 4I3GA 4O58H 1ORQB 4M8VA 4HHWA 2AC0A 3FUNA 1G7QB 3STLB 1R6VA 2HJFB 1A6WL 3MRIA 2H6PB 4JZNA 2HTLD 1DN2A 3KGUA 1IT9L 4IMKC 1Y0LB 4GW1A 1AGCA 2EYSA 4TVPE 3TO4B 3ETBJ 5AGEA 3UPRA 1NUNB 2Z93B 3IDXL 5C2UB 2EDFA 1WGVA 3II3A 1SDDB 1MXGA 4N85A 5CD5D 3AQYA 5IK3A 1EUTA 2P52A 4LT7A 5JZ7D 5DD1L 4K5LA 1RD6A 1SHXA 2A77L 1S9YA 2YD8A 3IDUA 4FZ8H 4N3TA 2DQUL 4K73A 1QFWL 2E6JA 2VISA 4NN6B 1OLZA 2EDRA 2ZKHL 4KO6A 4UNUA 3T5WA 2W95A 4CGUB 1HDQA 3QDJE 4LL1A 1O7DE 2OZNA 5DD5L 2GKIA 4OW6A 3AT9A 3S35H 2ETWA 4P2RA 3X17A 2B59A 4J3OC 3EUUA 1FE8H 1UADC 3E3QC 4I0CC 2CNTA 3B83A 3C09B 4L8DB 4ODSH 3ULUE 3GKWL 1BQ5A 3RUGA 4NQCE 2AITA 1UQSA 5F7DA 2XWZA 3CZJA 4KRPB 3VFVA 1ULVA 4XVJL 4YHKL 2H32B 3VXOB 5FO2A 4JRYE 2FVGA 2R69L 4AQ8C 2VAAA 5DQJB 2Z9TA 1P4UA 2VT0A 2W0FB 1GYVA 3D2UA 5FYKL 1J4JA 3LN4B 4PJEE 1QBLH 1NANH 5DMJB 3ZSTA 1BJ1J 1SXCA 3BVDB 4ZFZA 5GGVL 3V8IA 3PP4H 5D1QA 1LNUA 1HHJB 2YQ3A 5E8NB 4LP5A 4ELME 4QRRB 2DEWX 4PJFA 5F9JB 5JH9A 2XG5B 2MPAL 2ADFH 2BOBB 2VMFA 4P46A 3UJJL 3EDEA 4PJ7E 1I7RB 2PMZA 1CIDA 1U95B 2VL5B 4CRZB 4O4YH 5MERB 5FO8B 3W2DH 3N5FA 3T6ZA 5AG7A 3O3DA 2BIQA 4OB5H 1ZE3C 1DQMH 3RURA 5DUPL 1XD1A 4N28A 2HG5B 1T83C 2OCFD 2D7PA 1UTDA 2FSEA 2ZOLA 3QPKA 2FO8A 3S36X 4IIZA 3TBSB 3IJHB 4KQ0A 1AGFB 3D30A 3RRQA 4B9JA 5E6YA 1IAMA 1KLFB 1NSNH 1U93B 3HG1E 1OGTA 1VFAB 1AGBA 2ARJA 4P2QE 3Q9QA 1NC4A 3BHBA 5KG9B 1HH9B 3QEGL 3QXDB 4ZMXA 2Z65C 3HMXH 4EMEA 1RPUA 3EOBB 4GMSH 2YRZA 3A6BH 4TMPA 1FZOA 2Z35B 4Y88A 5SV3A 3WL9B 3B6SB 5B7MA 1MCBA 2OPCA 3IPEA 3EOAB 5EEZA 2AQRA 4OI7A 1LO5A 4LEEA 4JDZA 4K7FB 3VD5A 1O9ZA 1JRHI 1OALA 5DXWA 1TCMA 1UFUA 1F56A 3K4DA 4MAYC 4EQ2A 1JK9B 1OD7A 4J3OD 2GJZA 3D68A 5JM6A 2EYTA 3CU7A 3NACH 3VM5A 3SJGA 4ABWA 4C7HA 2NSQA 3VAEA 5M7QA 4WCYL 1TYRA 4JRXA 4JN1H 4OV6F 1ZA3A 1PZBA 5KVFH 1NIAA 4BFGA 4YIQB 4KKQA 4KXCA 3V5HA 1AACA 3NFPA 3QWOB 3DGGB 4U0QB 3OKMB 1Y7EA 2DTSA 2AXGA 4DGYL 3UAAA 3QAZB 1JE6A 3BT2H 3RVUC 2ZG2A 2WNGA 4NBYB 5I82A 3D25A 3FQ2A 5LNDA 4G83A 1JS4A 2BSDA 2J1ZA 2QKIB 3OAYK 1Z2LA 3ISXA 1VEOA 4NZRL 4AEHH 1NGZB 1Z9NA 3RL1A 2BWQA 4PXCA 2YAPA 3RWDB 2Z92B 2Z3LA 1G6RB 4JAMB 3NFZA 3AXLA 3GO1H 1YEEH 2EYRA 3H0TA 1SEBB 1A6UH 4AM0B 3QH3A 4OAWB 3BUDA 4AQ1A 2XEGA 2WLZA 1M3JA 1NAKL 1QG3A 4AZ8A 4YX2L 1UGNA 4Y4HA 4MY3A 2ITDB 3MRKB 4HD9A 2DDQL 4DJMA 4HKZB 2P49B 4DH2A 3HAEG 2OL3B 1PLGL 1E43A 2RBLA 4HMDA 4YSUA 4KY1H 4HC1A 4TTDC 1MQKL 2FUQA 3RGHA 2FIWA 3CFEA 3IKKA 1TXRA 4XCCL 2YMOA 1JTOA 2VL1A 1KFAH 4IBZA 4JFFE 4HNYB 1P53A 1MNUL 3QIBA 3VFGH 4F37K 1YNTA 2B2XL 2ZOTA 3C08L 4JHUA 1IKNC 3RWEB 5B8CA 3K71A 4DEPB 1CF8H 2CH8A 2Y3NA 4NEHB 1MCDA 4Y19E 1JWQA 2YUXA 4QBJA 2REEA 3DSBA 4BMHA 1QTYT 1F6AA 1FNGA 3PB6X 4NUQA 3RFRA 1ETZA 1IC7L 2FD6L 3FTZA 4QGYA 4B9KC 2DI8A 2OSLA 3W37A 1QVOA 1DQVA 3FL7A 4H2KA 4U7SA 3IJ9A 4YDLC 2ZW7A 4NQCA 1CP6A 5A2FA 5HGBA 1DVYA 1R5WA 2PTTA 3FU9A 2HJLA 2WYRA 1XH0A 4MDJA 3BPCA 4E9VA 2Z91B 5B21A 4ZFOL 4CVZB 5T33H 4N2BA 1PAZA 4JRYA 4MAYD 4NC0B 3G04A 2J25A 2WINA 3BDBA 2VDQL 4JDVB 3CCHA 4ZS7L 5AOIA 5F7UA 4DFHA 3DNKA 5DS8B 2H3XC 2ZKMX 1X5YA 4KQ4H 4UMSA 4W68A 3S6FA 5DURD 4UINH 1FSKB 2ZP9A 3R4RA 5JXAH 4OIIL 1WK0A 5E00B 1U8KA 2V6HA 2ZUTA 1MFVA 2V5MA 3OB8A 1DVFA 4XNZC 2N01B 5IB1B 1TETL 4N2DA 4B9FA 2EC9U 3ARDC 4WGWB 2Y4SA 4PJ7A 1MHEA 3TT1H 4YWYA 3P9MA 1RZGB 4YDZA 3RVUD 5KYYA 2V8HA 5C07E 1M42A 4WWVA 1WH0A 4JPKL 3S88H 3EYFA 2YGQA 1CG9A 1ID2A 2QQQA 4AOFA 3PL6A 2AXJA 5LGJA 4NFBA 4PB9H 4TQ8A 5BUGA 1EAQA 1OB1A 3OR6B 4LSTL 4D7BA 1O6TA 5ADPL 2EIEA 5JIKA 3ZJ0A 3DUSA 2Z8WC 1C08B 2NNFA 2CA4A 2LR4A 1G9HA 1E65A 4MLSA 5DHXB 3QNYA 1MFUA 1BX2A 4DKFH 3ZJAA 1T22A 5E5MB 1E5AA 2VOTA 4YGAB 3WTUA 2IO5A 1BEYL 3FTXA 3VXQB 1F3RB 2CO1A 1GZQB 1IAIM 4P2QA 3MCYA 4G6ML 1ZSHA 3VFNA 4ZUSA 3PJSB 4ZMZA 5GZOC 3TZVA 3SE4C 4XNMB 2BMKA 4KNTA 2JJSA 4KH9A 3R8QA 1PJWA 1Y0YA 4PJAE 4Z7WB 5SWSE 1FORL 4TTDD 5D5ME 1YNKH 1XR8A 2Q2EB 3RY4A 5KW9H 4F7EA 5FYLH 3D0LA 3C60C 1NIDA 1C8PA 5AL8A 3BFOA 2ZXGA 4HIIA 1PBYA 4N2LA 1BAGA 2XN9D 2CCWA 5LJYH 2BLFA 3HNTH 4FI6A 1X4YA 5HYSG 3EO9H 1IKFH 5D4JA 4ZUWA 3LXCA 2E8YA 1WDAA 4PGCB 4B50A 4MZ3A 1WCBB 2WMPB 1LO3L 2DQGH 5IQOA 4NKMA 1T1XB 2VXSH 4JM4H 3KYNB 4KXZH 4A55A 1FAIH 1I7UA 4MA8L 1TQBC 5E9DB 3ES6A 1AXTL 4GIAA 3F7VA 5GRUL 2WBXA 3BUYA 1SFDA 1WD8A 5EBVA 3AG1B 1K72A 1A7OH 4XAKD 7FABL 1X6NA 3QDGB 5J6GB 2X7BA 4NQEB 3IFEA 2VKWA 4QTHB 1XGYH 2HKFL 2GCYB 2GIYA 2CLVA 4OC3A 5KOMC 5EMIA 2G30A 3KJ6H 4YEEA 2G3AA 1UWFA 4A33A 1Q38A 2H5UA 3TXAA 5FXCH 2ZKYA 5D7LD 1JGIA 4CGMA 2WO3B 2Z10A 5I1IH 4B97A 1BWMA 1PU9A 5AB9A 3AROA 1OAZH 3QWRD 3E80A 2Y1AA 3QXUA 4PJHB 5DA4A 2BSSB 3SD2A 5IB4B 2X6VA 3ARDD 3P3SA 4ZOBA 1BIIB 4EE2A 3ZHFA 3QUMB 4MMZA 3RFZB 1KBGL 1JZEA 3SE3A 2PPAA 3BKYL 3DX4A 8PAZA 5LXGH 2YAEA 4H20H 1PFOA 1RV6X 4UTBH 3POHA 3ZE2B 1OF0A 1X5FA 4B9IA 1Y9KA 1EDYA 4M3HA 3L08A 1MCQA 1OARH 1PZ3A 1SGKA 2M26A 5E4EC 3V52H 1LGVA 3NG5A 4LQFL 3NN8B 2FQDA 2PP7A 1G9MH 3WFDL 1KIRB 1MZYA 4RGOH 2IBZX 3BJ8A 4XRCB 4JKMA 2Q87A 1A7NH 3ZMNA 1W0VA 3JTSB 2HX9A 3CZFA 4FQIL 1JK8A 4UT9H 4XCEB 4FABH 5GZOD 2VDOH 3D33A 2FHCA 3MNZB 1FNHA 4LQ6A 2FGWL 2MCPL 4YHNB 2C3VB 1CXFA 1JZ5A 1GS8A 4XPTH 3VMNA 1ZTXH 4ZBJA 1WHPA 3D18B 2XV6B 4UFVA 3MJ7B 1MVUB 1S7XA 3NFNB 5D1QC 3ATEA 3C60D 4E41E 4Z7WF 4IW4C 4IS6A 5EIIB 3H3KA 4ZO7A 5EOQH 1OPOA 4B5ZA 2WTPA 2OJEA 3IM1A 4X8JB 3HLAA 1AMXA 4KOBA 4BSVB 4Q9QL 1AD0A 4P46C 3W9EB 1YAZA 5DYFA 1XGRA 2UZYB 2VDPH 3P77B 1CR9H 3F6LA 4K23H 1TJMA 1VCAA 2VW6A 4WW1A 1SPDA 4J3OF 3OG4B 3PG2A 2BDNL 2CQVA 2PJ2A 4YXLL 5F89B 3LZQA 5SWQA 4FA7B 1NEZB 1USQA 4NZUH 3WTYA 4I1PA 3WEBA 2FIKB 3GTVA 3AS1A 5HDQH 3SGJA 3U36A 4GAGL 4KRNA 1JF1A 5FUOL 2FECL 4OIAA 3GUTB 1DJWA 3HLPA 2BP0A 1N59B 3GEFA 2DKSA 2X89A 3QDHA 2GT9A 1AZRA 3L3DA 2XN2A 3OKLB 4OCYL 1UOVA 3LNHA 5DJ2A 5C07A 2GUOA 3L6FA 5KUMA 1XIXA 3VG0H 1BFVL 1N5AA 1M7UA 3MRGB 3VI3E 4O02A 5FR3A 1OQXA 5CIPB 4BQCA 1BIHA 3LS5H 1VEMA 3QXAB 4EQ3A 1MW0A 4XC1H 5EEYA 4N2EA 4DNLA 1NE9A 3PWVB 4ZTPL 1WSST 2DM4A 4GRWB 5JHDE 5KANG 1DDHA 1R5IB 3LEXB 2R0KH 4TVSa 1MXDA 4WEUD 3QFJB 4Y2LA 2F8XC 1Q1JL 4R7XA 3QJFA 4OC2A 3P9LA 4N68A 1AIZA 4PJHF 4LK4A 5EH1A 3D3VE 5F9OH 2VLMD 2QZQA 5IQNA 4R3SB 5IG7A 3PV6A 4QGTA 1W72A 4KOYA 5KJ4A 2NOYA 4HX1B 4LARL 1J8HA 1WC7B 4OD2B 5DQ9A 3KQXA 3QEHA 1RUAH 4ETQA 1SVZA 4PJAA 5SWSA 4LP4A 5KYXA 5D5MA 3GNML 4LLDB 3WKMH 1X4XA 3MZGB 3ZE2F 2PN5A 4Q7AA 2VM4A 1J5HA 1KCLA 1EHKB 3EH5B 2OZGA 3CSBA 3HAEB 1XCQB 2XN9B 1R17A 4ICWA 3GKZA 1VRSA 4E9QA 3ZQ9A 4LHUG 3D2UD 3EGDB 5I75B 4PRBA 1V3KA 2Y2YA 3U83A 4PG2A 3F7KA 4LPWA 3ALPA 2YA1A 1W0YT 2XSKA 3O4LA 1DJYA 4ZY1A 4HXAH 3HRZA 4LIQH 3MRNB 5D9SB 5D1QD 4YDLB 4XXDA 4X9BA 1LQBC 2L8AA 4C54A 4X5LA 2J1YA 5AW3B 5I66B 4FYQA 4MCNA 4P46D 2VXTH 3NABH 3L5XL 3ALXA 4KOVA 5BRPA 2XFXA 4Y4HC 3QJVB 5BZDA 4Y5VA 1P4BH 3C5XA 5I24A 4ISVA 1F6FB 3S97C 4KMLB 5C0GA 4XMTA 1R5VB 4Y2NA 3SKNB 4F20A 3MKGA 2VO5A 1R75A 4ZMTA 1WTGT 3MNVA 2ZEDA 1X5XA 4LFHD 4EDWL 4J7RA 5F7MC 4UV7H 3V4VB 4NT6B 4LGPB 4YFLI 3GZPA 3TH2T 2CUHA 1L0PA 2IOIA 4KROB 2ZYSA 3QHZL 3ZL1A 1A6AB 3QIBC 3ARDB 1KBKA 4Z3IA 1P7KA 4EIGB 2CR6A 1O7DC 4N24A 1LL1A 2YLKA 5B8CC 3ESNA 1HJBC 1V7ML 2FL4A 1X9UA 3QQ3B 3KNBA 4R4BB 3W0WD 3HC2A 3VFPA 4ZMNA 4JJOA 2A9BA 1CJYA 4G8IA 4Z7UB 2ATAA 3BH9B 2OYMA 3PWNA 2G9HA 3ULUC 3IFOB 4LCIL 3BP4B 3AG2B 1IGCL 4I9XA 4XHJC 4DVRL 3HCVA 2C4FU 4GRWF 2XDHA 1FZKA 3WIIH 3SGDH 1J5IA 3UDWA 3NEEA 2P5WB 3UL4A 2HB0A 1QFOA 3I2CL 1FBIH 5IB2A 1H8OA 3MNMA 2EE6A 2ZE0A 4TXVB 4A39A 3VU2A 1FFNB 1K6QL 2EVHA 5DR5L 1S7KA 3F5WB 3I3BA 4ZUUA 2BSBA 5HHXL 3S3JA 5TDOA 4JRXD 1QABA 1U8QB 3AMLA 5FM5O 3CNKA 1SUJA 5D2LE 2OXHA 2VGLM 3F83A 4WHDA 1OP3H 3ZIMA 2CPCA 1MWOA 2DN7A 4TS6A 4FA8A 4YBHA