4B6ZA

Crystal structure of metallo-carboxypeptidase from burkholderia cenocepacia
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
382
structure length
380
Chain Sequence
TLSITSNFDAGAIDVVSCDSPDAIRLRVRGDNRSEFAQWFYYRLTGARGERCVMTFENAAECAYPSGWRNYSAVASYDRVDWFRVPTTFDGKTMTIDHTPEFDSIYYAYFEPYSEERHAAFLGAVQQLPQASVVELGRTVEGRPMSLLTLGTPETAPKKKVWIIARQHPGESMAEWFVEGLVKRLAGWGDWAGDPVARKLYDRVTFHIVPNMNPDGSVHGNLRTNAAGANLNREWMAPDAERSPEVLAVRDAIHAIGCDMFFDIHGDEDLPYVFVAGSEMLPSFTEQQGKEQTAFIEAFKVASPDFQTEHGYAASKYKEDALKLASKYIGHQFGCLSLTLEMPFKDNANLPDERVGWNGERSAALGAAMLAAILVHVDTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords FAMILY M14 UNASSIGNED PEPTIDASE
publication title High-Resolution Structure of the M14-Type Cytosolic Carboxypeptidase from Burkholderia Cenocepacia Refined Exploiting Pdb_Redo Strategies.
pubmed doi rcsb
source organism Burkholderia cenocepacia
total genus 140
structure length 380
sequence length 382
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
A PF18027 Pepdidase_M14_N Cytosolic carboxypeptidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3120 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4b6zA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4b6zA02
1Z5RA 3ISXA 5K8MA 3D7HA 3H8EA 4JYWA 4EMEA 3KHZA 5K8PA 1XFOA 2ZENA 4IK2A 1VIXA 4PQAA 1VGYA 2OR4A 2AFSA 3PFOA 2PE3A 2ZOGA 1ELLP 4TNUA 4OC0A 3B3TA 3FMCA 2C6CA 2PIZA 2Q51A 4LQGA 3IFEA 3CDXA 1XMBA 2CIJA 1BPMA 1UWYA 2ABZA 4R8FA 4ZI6A 3NH5A 4UEEA 1GYTA 3IWWA 5D29A 4A37A 5DS0A 3K9TA 4ZY0A 1TKJA 1CPSA 3PFEA 3KQZA 4TWEA 1IY7A 3N5FA 1RTQA 1LFWA 4MRIA 3FVLA 2PJ6A 3WC5A 2C6GA 2XEIA 5HVGA 2AFZA 2AFMA 3WC7A 3PB4X 2NSMA 2C1CA 4P45A 4PXDA 3KZWA 2ZEDA 4FBEA 3CPAA 6CPAA 2Q4ZA 3PB6X 4NGQA 2XEJA 1YW6A 2PJ0A 2CTBA 4ZY2A 2O53A 2F7VA 1TF9A 4MCSA 2QJ8A 2EWBA 3B2YA 3SI2A 4F9VA 3RZAA 3BXMA 3LMSA 3SJEA 3V7ZA 5JM6A 2CF4A 1YMEA 4FAIA 2V8DA 1KWMA 3PBEA 3D7DA 1ZG7A 2JBKA 2ZEPA 4NGRA 2PJAA 3H8FA 1YSJA 1BLLE 5D8NA 2V8HA 1XBUA 5LRKA 3KR5A 1TKHA 2AFXA 3PB8X 3B3CA 5K8NA 5F09A 4NFRA 5IB9A 3WT4A 4NGSA 1OBRA 2HC9A 2V8VA 1F2OA 2EK8A 2PJ8A 3KGQA 4A94A 4NGNA 3B3SA 3DLJA 3NH8A 1YW4A 4NGPA 2XEGA 2WZNA 3IC1A 3IIBA 2AFOA 3GLJA 2PJCA 1LANA 3NFZA 1PYTB 3KASA 3S9LA 2BO9A 2ZELA 3D7GA 5LYLA 4P4EA 1LCPA 4MCPA 1ZG8A 2AFUA 3D4UA 3L2NA 3IO1A 2ZOFA 4ONWA 3B35A 2PJ4A 1QQ9A 3PB7X 1AMPA 2JBJA 4UEFA 1FNOA 3D67A 2PJ1A 3WC6A 1LAMA 4K3NA 3B3WA 3KL9A 1ARMA 3CT9A 4GM5A 4AXVA 4RUHA 5JGFA 4PXEA 1H8LA 1ZLIA 2ANPA 2PCUA 2V8GA 4NGMA 2HB6A 4OKOA 4P4FA 3IEHA 4X8IA 1DTDA 1Y0YA 2JEWA 1CPXA 1Y0RA 2Q43A 3BHXA 3S9MA 2IQ6A 3D7FA 5J1QA 3VATA 3V38A 1XRYA 4OC5A 2IMOA 2VL1A 1VHEA 2F8HA 4CPAA 3FJUA 4ZX8A 4YWYA 4ZY1A 3TX8A 3NH4A 1CX8A 2EK9A 4NJRA 3D66A 4MMOA 3NA6A 5LYFA 4MHNA 3TC8A 3FF3A 4G1PA 4H2KA 2AFWA 2J9AA 1Q7LA 3PBBA 2IJZA 5HVFA 4BD9A 5LRJA 1EE3P 1F2PA 1ARLA 1JQGA 4OIDA 3SI1A 2DEAA 4R6TA 3MRUA 4EWTA 2PIYA 4ZX9A 2O4HA 1BAVA 1Z2LA 4X2TA 4MXUA 5LRGA 2QVPA 1LAPA 4NGTA 1TKFA 2BCOA 2OOTA 5LYDA 3KI9A 4FUUA 4A39A 4Z65A 5JH9A 3PB9X 4W9YA 5HVHA 2BOAA 1IGBA 2I3CA 7CPAA 2PJ7A 2ZEOA 3CPXA 3HLPA 5CPAA 3I1UA 4UEZA 4R7MA 1BPNA 4OMEA 1R3NA 4NJQA 5I4MA 1CBXA 4MCRA 2POKA 3RAMA 3GB0A 2NYQA 2RB7A 4OC2A 2G9DA 2ZEGA 1M4LA 2WYRA 3HUVA 4UIBA 5ELYA 1CP6A 1CG2A 3ISZA 4PPZA 3B3VA 4Q7AA 1VHOA 1NSAA 3LWUA 4MHYA 2ZEHA 2ZEMA 4WJBA 3S9NA 2ZEEA 4DYOA 4A38A 2XEFA 2PRQA 2PJ3A 1Z8LA 1XJOA 3PEIA 2FVGA 2V77A 3WABA 1YLOA 4P4IA 4FWUA 4OC3A 4O23A 3SJFA 4DJLA 3T8WA 4R76A 4ZYQA 4P44A 3D68A 4P4BA 3FEEA 5HXDA 5K8OA 4X3RA 1HEEA 4IAVA 3PRTA 3FEDA 2PJ5A 4P6YA 2PJ9A 2PJ2A 3RBUA 3KHXA 4B6ZA 3MN8A 1HDUA 5CBMA 3FECA 4KSIA 4OC1A 4OC4A 4UIAA 3IJ3A 4F8ZA 4DUKA 1AYEA 3FX6A 4P10A 2PVVA 2GLFA 4PXCA 1TXRA 4JZ0A 2GREA 5THWA 4P4JA 1ZG9A 3H8GA 3VARA 4EFDA 1R43A 3BI1A 2PVWA 4MCQA 3FH4A 1QMUA 4OP4A 3GUXA 3K2KA 1LOKA 2GU2A 5LYIA 3KQXA 3SJGA 4WWVA 4MHPA 3QNVA 3SJXA 3JRUA 1F57A 1TF8A 2CTCA 2GLJA 1HDQA 4MHZA 4OIWA 1DE4C 8CPAA 4YU9A 4P4DA 1PCAA 4PXBA 1ZLHA 3KR4A 3B7IA 2ZEFA 2C6PA 3DGVA 2PJBA 1CP7A 3BI0A 1ELMP 4UF4A 2RFHA 3VH9A 3SI0A 4F9UA 1FT7A 4IHMA 2QYVA 1Y7EA
chains in the Genus database with same CATH superfamily
3V9EA 5CEYB 1MI5D 2XN0A 4WNSA 1MWAH 2FO4A 4K3GA 4NNYB 4F33B 1SFHA 4PV8A 5CP3H 4Q9CA 2IDTA 1NIEA 3VRIB 4AGNA 2E0PA 2JK5A 1RI8A 4TSBH 5I30H 3WIAA 5K8PA 2EDTA 3BO8A 4JZNB 4H13C 4CBPA 1ZGLA 2CNZA 3QNXA 4I3SH 3WY4A 1VGYA 4WFHD 5IR1B 1NPUA 4DKEL 2XPGB 5JPMA 3G08B 2AJSL 2ARJB 1E6JH 1TVBA 4CRZB 1MCJA 3RVWD 3O0RH 4WV1A 1UC6A 3HE6C 3JYBA 5TFSL 2WXKA 2JNZA 4IBYA 5GRUH 2CHDA 5E8DH 1FO0H 5AW3B 2IXQA 4H6UA 4OGQC 4FTVD 4KSFA 4YSRA 3CVHA 5HHPB 5BRZD 5C6TH 3JT0A 4H8HA 2I9TB 4Y4HD 3NH5A 2JJSA 2NMSA 4HPHA 1ZVSA 2C9RA 4ORGA 5GS2H 1Z5LB 5G4OA 2R0WH 1OW0C 4OZGF 5E4OA 2CRZA 4WFGE 1M05B 1HNGA 4PRPE 1A6WH 3V4PB 1AYRA 3II3A 4X6CE 1XXDC 5FO7B 2XWDA 3AS1A 1EFXD 2YPLD 1JF5A 4PGZA 3BRFA 4LHUB 2NTFA 5IV2A 2R0ZH 2VSCA 2NY2C 4GLRH 2OL3L 3AUVA 5HYSB 2OS7A 4G6MH 3FAWA 5D93B 4RBPH 2C6GA 5C0RL 3FCTA 4RDQF 4KHTL 4JCWA 1NAKL 3MLWL 4R90L 1I3RA 2QTVA 3KEHA 3ULUC 3QNZB 4KPHL 1VZIA 3L1FA 2NY0D 3DI2B 4MD5B 3SCMB 4I0CC 4B10A 1I3GL 4IRJA 2Q4ZA 4ZAKB 1RUML 2QQKL 2F7OA 4RDBA 1S60A 1OM9A 4YE4H 1X10A 1A6VH 4ODVL 3GI9L 1OWRM 4KI5C 1T2XA 3FOMA 3V0VA 3ZTCC 4E5XB 5MI0B 5F7EH 4BA0A 2IF7A 5EWIL 3FB7A 2A1WL 4ZJ9A 5L8JB 5IEHB 1AQKH 3PQYA 3IKCA 3N50A 3U0PB 5F47A 5AAMA 1IC0A 1B0RB 4NUGH 2OR7A 5B8CB 3VMPA 4Y49C 3FU7A 3PJSB 4LSTH 5ANME 5C0CA 4OD2A 4CMHB 1VKXB 2PO6A 5K39B 1XBRA 3OKYA 3IJ7A 3FTUA 2BO0A 1PYWA 1A4KB 3WXWL 5D2NC 1MVUA 4JJXA 3V95A 1J5OL 4FERA 1OL0A 5EUOF 1BBJA 4LRNL 1ZLSL 2MTPA 2DQJL 3MHZA 4CJ1A 3FQRA 3VXQB 5L9DH 1N71A 1RERA 4MX7A 4W9HC 5IHZA 4U1JB 3DGDA 3JTBA 3QIWD 3N6YA 4XPGH 3VXMA 4DJMA 4APQC 2R2HA 4ADGA 5DUML 3QUZC 3O2VL 4PJFF 1N64H 2L7JA 1I85A 3SDCC 2J5WA 3D3SA 2QSTA 3F04A 1KJVA 4J6RL 3DUHA 3KR5A 2LT9A 4LOUC 5AZ2H 3KVQA 1FGNL 3AWFA 1SNRA 4MY0A 1E67A 2Y1AA 2YRZA 4ZX6A 4M6GA 3SDXB 2CKNA 1KJ2A 5IM7A 2HH0H 1TJMA 4GKOA 5DK0B 4WHTB 5K1VA 2RFXB 3AJ7A 3PIQB 3VDCA 1NWOA 3IFOA 2P5EA 5DJ6A 1UWFA 5IHLB 3UTTB 3MLYH 1YREA 3F3HA 3X14A 3STZA 4OW6A 3ILPA 1OGSA 4JRYA 2I60H 1K8IA 4QRQB 4XP1H 1ZTXH 3BGMB 2J2ZB 2HFGH 2D31B 1S2EA 3OPUA 1U91A 3MRLB 3FNCA 3EFDH 2NY1B 3L7FB 1HKLH 1DQJB 2E5EA 2R1WB 2BO9A 1FVCA 5LYLA 1D5IH 3NJLA 4Y19E 1H5BB 3QR2A 3HZVB 3JYCA 5IVXB 5INCB 1NAMA 5F6HI 2YPVL 4DP5X 4M6HA 2NX5A 3O2WH 3MOAH 3KPPB 4U9YA 4ONWA 3W2DL 1ZAGA 3GIVB 5F7FA 1UD4A 5AB2A 4PJCE 3CLWA 3H7LA 3LRGA 1ZLWK 1KCKA 4BD4A 4Y5VB 3FT3B 4PS4H 5MERB 3HZKA 3CLFH 4RN7A 1NCCH 4WWKD 2BCKB 2QR0B 1KCRH 4UNVA 2X0VA 1KYOJ 2HTKD 4XN1A 2Y0SA 3TN0C 2WUCH 4M62H 5E94B 2JBJA 2JJUA 2DI7A 3MNVB 1E9PA 1YEHH 4Z0BH 5FDWA 5ERWA 3GBNH 3P4NA 4TRPH 2PP7A 3W9DB 2AI0H 5DEZA 2XTJD 2F08A 4MHDA 3FNKA 2EDQA 1KPVB 3NABH 1MCRA 1MQKL 3DO7A 3MV7D 1ZLIA 2FIAA 3QO1B 2IGTA 1ODUA 1KTDA 5D93C 3V52H 3VI4B 3ZTDC 2P80D 1ACYL 2Y6TE 3MJWA 4N8VB 1MFMA 3RGVA 2W94A 3KPOB 1CFSB 1DTDA 2VZTA 2DJMA 3HAEA 2B3VA 3LXCA 2H5MA 4MNQD 1RZGA 3SCMC 3ZE2E 1LO4L 5IK3B 5ADPL 1TR7A 3VATA 1VIWA 2Q8AH 4X5PA 1QASA 5JHDD 1I1YA 2BSCA 3B56A 3SDAB 1X3DA 5MEQB 1V7ML 3F6IA 2JLMA 2VL1A 4KOXA 3ZLQC 1T1ZB 1A2YA 3EJTA 4Z7UB 5DD1H 4ZX8A 2J7LA 4M43H 3LN9A 4KXZH 4FYSA 2JJTA 3E6FB 4AVAA 3U7YH 5BZDB 3ARUA 2G0BA 2QGCA 4Y16B 3OL2A 3QG7H 2PYEA 4LP5A 5DJYA 1RK0A 4X7CC 1SJEA 1N8ZA 3K71A 5M94B 4CMHC 5E2WH 4XCCH 5AL0A 3SDDD 3PBBA 4Q4IA 1LQSR 1D6VL 4G1EA 4HMDA 5D1ZD 3QPQD 1E4XI 1G6RL 2APTA 3OAYK 4YJZL 4Q58C 3HMXH 4ZFGH 1FNEB 4JDZB 3JV0A 2TRHA 1RAMA 1M3IA 1YECH 3Q5TA 4MAZA 2VLRD 4KPHH 2EXYD 5I8EA 3KWXA 1T2QL 4LSQL 3SI1A 1LO0H 4TVPE 2ZX7A 4X99B 3T6VA 1M7IA 2AQRA 2ENPA 1U4EA 5HHVL 4PMEA 1UM6H 3BSZH 4X4ZA 5E4AA 2P7TA 4Y0GA 5LGHH 2NY6B 5IG7A 3EO1B 1H8OA 1L7IH 2W60B 3MLPA 1H6FA 2EUWA 1I9JL 1OSZB 1GKEA 2QZ5A 1E4XL 4EE2A 5F72S 4D9RE 3VFUA 5E8EB 3CXQA 2CUAA 1MVFA 5C0IA 5F6HJ 4LCUB 1H0DB 3A6BH 4AM0B 1S3ZA 2VXTH 3F85A 2CR6A 4A66A 5GZNC 4JZJA 3JWDH 2I25N 1Y6NR 3INUH 5T1KA 1ZRUA 4QHUB 2VZVA 4P9HL 3IU2A 3RWJB 2UZIH 2XHNA 4M5YH 1E5UI 4YXKL 3F8KA 1GIGL 1P6FA 5I74B 3MOBL 3L8QA 5E6IB 4HV8B 1XT5A 2G60H 4HF5L 4R0LB 5JHAA 4XP9H 2ITDA 4PTTB 3BXNB 1XCQB 1CBXA 2NY1C 4JFFA 1GA2A 1XR9B 1VFAA 4QOKA 4JHUA 2CA4A 3CC5B 5B38A 4KVNH 1XF5A 1CDHA 3QFJE 2WLHA 4G6AD 5T33H 1IC1A 1XBDA 1UZ8B 5AAWA 1JGUL 2ICES 1CCZA 1WHPA 4I77H 4YHOH 5LXVA 3UJTH 1NCDL 4MQSB 5JXAL 2B8OT 2O6DA 4FF9A 3FRMA 2R2EA 3LRKA 3RVXC 4J4PA 1TZGH 2XZCL 4OD3L 4XWOC 1IRAY 3ZUNC 3QS2A 1VHOA 3QT2A 2P44B 2JDCA 2QDVA 1NFIA 3N41B 5FA4B 1JSYA 3TTHA 1NBVH 5K9OA 2DWYA 3PE9A 5IMMB 1GGIL 5IQLA 2AEPL 4FEMA 5GHWH 1QEXA 4CAXA 3TBBA 5FVJA 2AGJL 4KKCD 4LKCA 3TFYA 4CC4A 2WLNA 3WKYA 4MFKA 2JLPA 4FMKA 5FYLH 3RZCC 3V4VH 3GI8L 2I24N 2Z64C 1XH1A 3SPVA 2BNQA 2W88A 1HIML 4MCMA 1CG9A 2VDNH 3BP4B 2AJVH 4NT6B 1HEJC 3AABA 4HCRH 4Z78A 2A9AA 2YMTA 4XP5L 2PJ5A 2BOLA 1SUJA 4CN6A 5F7UA 2PJ9A 4JXQA 5BMFH 5GGTA 3SDAC 2ZWNA 3ZQ9A 3CG8A 4B9IA 5SX5K 1DTUA 4RA3A 3H3BC 1FIEA 4YDVB 3MRMA 5CJQH 5EZOL 3QEQB 4GAFB 4UU9A 5FA3B 3U9PL 4UQAA 4OC4A 2CSPA 2CUIA 4EIGB 3PWVB 2GAZA 4Y16C 5AKRA 3OKEA 1OPGL 1Q94B 2QADB 3TYFB 1B3JA 3MODH 1YEFL 5H35B 1JGIA 2B08A 1HTYA 2JB5L 4KQ4L 3A23A 4H8WL 4HG4J 3HMWH 3W38A 1EFQA 1KBBA 3DUSB 3O3UN 1I82A 2VDML 5EOCH 2I9LA 1EXUB 2F74A 5ID1A 2DBJA 3EGSB 1CLYH 5TE4H 3GGWB 3WE6B 1M7DB 2WWKT 1OKEA 1S7XA 3VWDA 5L88L 4WI8A 5C08B 4BK5A 3QJOA 4KTGA 2PDOA 2VM9A 4JY4B 1PZAA 3MYJB 3VSTA 1NTDA 3TP4A 3FL7A 4PLKC 4P3WA 2F8XC 5I0WA 4UFWA 3SKJL 1JZDC 1MEXH 4JHVA 1RUKL 4LFHG 5AW0B 2HQYA 4GRWB 4KK5C 3ZR5A 2XWJA 3CSPA 1S9WA 5B3JF 2FL5A 3BYTA 5B39G 4E5XA 3TBTB 1QWHA 1SMDA 4GIOA 5AOIA 4OGAD 3ZKSD 2AXHA 2WYIA 3ULUH 3CDZA 3BLNA 2LVEA 3C6SB 5B8CA 1A4JA 1K5NB 1H6EA 3PJSA 1MFBL 4OQ1A 2XQBH 2IMMA 3ABMB 5K39A 5BZZA 3S0PA 1A7QL 2EH8H 3IJHB 4Y4KB 4YEEA 2EIDA 4L3EB 3HE7B 4MTMA 4P4DA 1PCAA 1FUNA 3GSVA 4HIXL 1XF3B 5K1JA 3BWAB 2X7LA 2XZAL 2PXYC 2GBTA 1HH9A 4R0LC 1MW1A 1YRKA 4MJ5B 2E3VA 2XXFA 4MJIA 4ZS7H 4B5PA 4KRLB 5DMJB 3GRWL 4HVBA 5IWLA 5D7LB 4IHMA 1BXVA 3KPNB 4M3KB 4X42A 5AOLA 4BZ1H 2I79A 1I9JH 4HA1A 1PAMA 5DQJB 3NEOA 1N4XL 5EN2A 2IPKA 3K0YA 3QFGA 1Y7EA 3LKPB 4K94L 1Q4NX 2QVKA 5CUSH 1K6QL 5F3HA 2CO2A 4BXSV 3X1BA 1K9TA 4PRHE 5F71A 5I1CH 2JFCA 2KLRA 3D07A 4QRRE 1X5ZA 2FBJL 1IEHA 4KJYB 3O4LD 4YSQA 5DK3A 2EC9U 2WO3B 4KHXL 4XAKD 3F6LA 2P5WD 4C4BA 3ULVC 2MWCA 1SLVA 2RGSA 5KVGL 3TJEL 4FQ2H 1SEQH 1Q90A 1TETL 2Y3NA 1YN6B 2WZPD 4YDZA 2GC4C 5IF0A 4NSQA 4UNUA 3GSQB 1XGUA 2K4WA 2XZZA 4NWTH 3QP3A 3VX0A 2Z3PA 1NUFA 2Y5QA 1UM5L 2VMDA 4JKPL 1FL3B 3P30L 1SY6H 4LSSH 4L9LB 1VFBA 3PAUA 4MA1B 1P2CB 4YPGA 3ZBMA 5AB9A 4XRCA 3KPPA 1BZOA 4LPUA 3GIVA 1M2OA 1KZYA 5C0BE 4UFVA 1NIFA 3FB6A 4YHIA 4JWPA 3DX2A 2Y24A 4N28A 3LNGA 1IX2A 1HINL 4AQ8A 3O45B 4Q38A 4J8QA 4BFBD 1X6LA 5E94A 3D18B 2Z9TA 3H2QA 4KDTC 4X6DA 1IY7A 1KBPA 2CCWA 2QADC 1DVYA 2WQRA 3CFJB 3T0EB 1BVLB 4X6BB 3RVTD 1MJ8H 1RUQL 1U92B 4NWUH 1GKOA 5EO1A 2X4QA 4CUCA 2YC1B 3O41A 1PAZA 5JHLL 4YK4C 3ATBA 1T80A 4HCFA 4HQQH 3BE1H 4KZEL 4YUEH 4WWPA 2VZYA 5DMIH 1AZBA 3QIUB 1IAIH 3T0BA 3NCEB 3OPZL 1FNSL 3V4PH 3VNZA 3TBWB 4TL4A 3PYCA 1F4XH 1FYTA 3ARFD 3GC3A 4PGJA 4NGQA 3WS6A 1YW6A 4RWYH 3VMNA 4LO9A 4N2IA 4OFKA 1OB0A 4NO5B 3S9DB 3BPCA 4KITB 2O53A 2AJ6A 1P4IH 2IVFC 2V37A 4IMKA 5MEQA 2ZXAA 1F41A 2AJZA 3KJ4B 3NH7L 3BGFB 4FNTA 1H6TA 4PJ7B 5JQ6L 2XIIA 4Z7UA 5EUKB 1R1CA 3GXDA 3TU6A 3S8WA 2Y1ZA 3ZDXB 3D34A 1IC7L 4C4KT 3E6FA 4GUOA 1DL7L 5EF3A 1AGBB 1QFUL 2EVGA 1BA9A 4FXGB 4WCYL 4PK3A 3MGTB 1YEKH 1C5BH 1NGWB 3FQWA 3BXMA 4MHHG 4GSUA 1OE1A 5JM6A 4FAIA 3MLZH 4WEBL 2CXKA 4MA3B 4E41B 3DO3A 3GSUA 3WFBL 2UX7A 5IJBC 3WLBA 4ISVA 1S5IL 2VLJB 4JDZA 4LVOC 5AB1A 1JPST 3II1A 4UQBA 4A31A 2WLLB 4TOYL 1JZ2A 3POCA 5D8NA 4X99A 3ETTA 4KORA 3P69A 4POYA 3VFRA 5CEXB 3O3BA 2VWEC 1MJBA 4OCYL 4EJ1C 4P57A 2W60A 1YDPB 2EO1A 4FNRA 1OSZA 3WTUA 5I8KL 1BZ9B 5HHMD 3WT4A 4K71B 5C9KA 1T7WA 4S1DC 5E8EA 1F2OA 5TJWK 5EC4A 4M1DL 4H25B 4DPCX 2DKUA 1OQOA 4M1GL 2YKLL 3JTSA 4AM0A 2FEJA 5HYJB 3NH8A 3FT9A 2MQ0A 4OLXL 2ZUTA 2Q7NA 4S1SH 4W9LC 1G4MA 5CN2A 4UZGA 4N2OA 4QHUA 4JFOA 1X44A 2ATRA 1V55B 4WO4D 4EUPB 2PJCA 4ZMNA 5ADOH 3KASA 2CPUA 8FABB 2LLGA 2OH1A 1J9TA 2HT2C 2X1OA 4OCMC 4X7SH 5E6IA 2FIKB 1PSKL 4HV8A 2FSRA 4OM1L 2J6WA 1RMFL 1XCQA 2VDQB 2P9RA 1XR9A 3KW7A 2VXQL 4L9LC 4LGSB 4MA1C 2WPXA 5CKGA 3QRGH 2XKUA 4I85A 5HHXH 1ZXQA 4TNGA 2Q8BH 3PB7X 3ZHDA 3II2A 1AACA 3VXRB 2FWLB 3WJJC 3FRPA 3K4ZA 4XCFL 4MQTB 4XC3L 3EAKA 2X9XA 4KTYA 4D7PA 3KL9A 1OIOA 2HJFA 3ME0B 1LO3L 3QWQB 4MMZA 4QXUH 4QHMB 5IMMA 5E2UH 4A2LA 3KPSD 1WA0X 2HLEB 1S7WB 2D3JA 2IQAB 2B5IB 4FC3E 2VMJA 3BP7A 3QWRD 2V8GA 3DDDA 2Y9RT 4NGMA 4JO3H 1OAKH 2F58L 1KEGH 2K7QA 1G9NH 4KGJA 2YBGA 1CU4H 1HJBC 1VJSA 4GI9A 1SN0A 4P8QA 3GDCA 3QG6A 1PY9A 3EGXA 4QXGL 2DL9A 3QIUC 4GXVL 3RWDA 4Z6AT 5JW3H 1L3WA 1TQBC 2VE6B 2C5DC 4JKPH 1F3JA 3D7FA 5K69A 2FNWA 4IRSA 5B1CA 3L7EB 4M3SA 4NT6A 1J1XL 2WCSA 1U8OA 2ZWSA 2EDFA 2F8HA 1WIPA 2HPTA 1R24B 5I1LB 3ZL2A 5TK2A 5BJTB 1KCUL 2DIJA 3QPXH 3BGFC 3PGDB 5HVFB 5C09A 3E3QE 4KX8A 2Y5EA 5LBVA 3QEQA 5ACMA 5FA3A 3QUKB 1RP8A 4I9WE 1RJCA 3WIIL 1DBAH 1MHEB 2ZWKA 3IJEB 1T03H 4KH2A 4ODUA 15C8L 4FXGC 2YUZA 3N06B 2FCKA 4RFEB 3JV4B 3ZTEA 2AVGA 3VA2C 2CIKB 2Y06H 5H35A 2W07B 3MACH 2HT3D 4HCIA 1QQDA 1JQGA 4ZW6A 1Z9LA 4L2YA 4X9IA 2PWFA 1OTSC 4Y1AD 2VL5B 1A8JH 3G3LA 1ACXA 4PRAB 2J1ZA 4NBZB 1KLUA 4NQQA 5SWSB 1Z4EA 3CH8A 2FXFA 3FFCB 3Q0HA 5C0CE 1DVUA 3CPLA 3FTXA 1FPTH 3GGWA 1M7DA 2D0GA 3IVKA 2QHRL 1WC7A 2IANB 3EF4A 1FG2A 1MY5A 3K6NA 4GXUN 4ZX9A 5EU6E 4KAQH 5C07B 4PJBF 5C08A 5BW7C 1U3HC 3EO0B 4JGJA 5E0FA 3ARDA 1KV3A 2E74C 1EHXA 1WK4A 4GRLB 5GRWA 4PCYA 3W5NA 4HJJH 1HZHH 5KVDE 4Z7QF 1VCBC 3S4SG 4W68A 3CX2A 3IN0A 2JQMA 4OCWH 4KMQA 5TF0A 3TBTA 2VQYA 3LEYL 4TVUA 4QJ3B 5C88A 1NDMA 3PB9X 1VSCA 4JK0D 4YC2C 3HI5L 3WFEL 3L5XH 1FBIL 3C6SA 1F90L 3K74B 4I0PD 4POZD 2RB8A 5DLMH 2PJ7A 2DY2A 2V2XB 4E2OA 4N25A 1W0WA 3QDMB 43C9A 3LD2A 3JTTB 2OK0H 1JCVA 4EN3D 1B4TA 9CGTA 2P5EE 4L3EA 2R69L 4B13A 1MJ7L 2AQTA 1JYVA 5DJZB 4GT7A 3GB0A 1YYML 3QUXB 4LLVA 4PJGE 4JRYE 4OC2A 2RQ8A 1JFQH 1H3TA 4OJDH 3BRGC 4MA7L 3QYNA 2VSDA 2DIEA 3ZO9A 4JO4H 2ADIB 4WI6A 4PIRF 5F7NC 4QKXB 3MRRB 4MZIA 4P5MB 3H42H 1IGYA 2LTQB 2AV1B 3HG1A 3RKDD 1DZ0A 2YGVA 3BKYL 5LCVL 1NSLA 1WZAA 2AQ1A 3EJCA 3HFMH 4QXWA 3ZHKA 1DSWA 3GINA 2KPNA 2NX5E 3VTAA 1JZ5A 2YWYA 4KJYA 1XGYH 4S2SB 4PJIE 5I8CB 4N0YL 5GGUB 2PPDA 1Y0LA 3BP6A 4XBEH 3LZRA 3L3KB 4IBQA 4GAGL 1OGAD 1XSKA 3VW3L 4JJOA 2IH3B 1T04A 2PR8A 4ZUSB 4WTWA 5E9DA 2VMFA 3D85A 2O5YH 1FV1B 2BSWA 3PS6A 3MMEB 2N7AA 4KTEH 3QO0B 3PRTA 4PRIA 4LCIL 4LLWB 1FL3A 4ZOAA 4YLQT 5DVMA 3ULVH 4P6YA 3KLQA 4KUZH 1I7RA 1MXDA 4JGUA 4MS8C 4NQDD 4Z7VE 4ZTPH 3L3DB 2VI7A 3WJMA 4ZQKA 5IQOA 3DSFL 4XPLA 3HKFA 1ILUA 3DOIA 3CH1A 2C3VA 3DRTB 3EYFB 3VWJA 2ZW7A 1WZ1L 2BL1A 2D7OA 4PH8A 1OAUH 3Q8CA 3MUY1 4YIQA 4A55A 4ZTOL 4UIAA 1NCIA 3JQOB 4DGYL 3V5DA 3MXWH 2Z92A 1YUHA 2XNAB 4NOBA 1L0QA 1LO3H 1WA1X 3QAZB 3D18A 2Q3AA 4OZFA 2HLAB 2D7QA 2VJ8A 2X6AA 1GOFA 2Z31D 4P4JA 3DPBA 5B7FA 4MVBD 1EK3A 3IB4A 4UCMA 5I1HL 5D70H 1F11A 3JWOC 4XCYA 1M57B 3DX0A 1BBDL 5LXGH 4HKFA 3NACH 3CV5A 5D2LA 3V7MA 4R7LA 2PYEE 4AQOA 4QGTA 1VEPA 5ESAB 3VFTA 4XNHB 5BRZB 1ZIAA 3QJHA 2VR9A 2ZUUA 3BWUC 2DQTH 2OJEB 4A6YB 3MCLH 2R59A 4OT1H 4EO5A 5KSAC 1GGUA 3V0HA 1TJHH 2ZCZA 1TYJA 3ATFA 1TQUA 3GZKA 3DVGB 1E9OB 2V2TB 4LDOB 5D7KE 4GRLC 4JFHD 2Q86B 4DP6X 2F5IA 1LMIA 1EFXB 3OKDA 1SXZA 2JKTM 3SJXA 4GAJH 3WGVB 1F97A 4HK0A 4ATWA 4OZFG 5EUKA 4YHLH 1CMOA 5I19L 3UC0H 5IW6B 2BSSA 3NPSC 2DLTA 4JQIH 3GMQB 2VCOA 3TNNA 3MGTA 1ND0B 2YGWA 5BWAB 1A9BB 4AYFA 5I71B 5EIIG 3QORA 4UM8A 1EGJL 1DE4B 2NY0B 1NDGA 2A4EA 5E8NB 1IQDA 5AKVA 3CSBA 3LMJL 4GRWH 2IPTH 4S11A 5LQBL 1IOFA 2X4TA 4II9A 3MRNB 2IL4A 1G9ML 5LN8A 1IAIM 4N9GB 2C6PA 3QWOB 3K6SB 2NUPB 1NSNH 2F6AA 1UM4L 2Z93A 3HUJA 3AU1A 4L5FL 1DJZA 2CBMA 3GXUB 3REWA 4L29B 3H6JA 2PUQT 4KNQA 2AS5M 3MRKA 4JZOB 1DQQA 1GHFH 2ZG3A 4LOFA 5K8MA 5DC0A 4QC6A 5T5NF 3RILA 1WBZA 1OSPH 2XWXA 3V7AG 2F19H 2BVEA 4PRBA 3BN9D 2EUXA 2AJYL 2Q1EA 2LTQC 3MJ9L 5EEZA 3IE9A 4JFFE 2WBJA 4GKSB 3TXAA 3W0WB 5AG6A 4QOKE 1USZA 3EJQA 3CNKA 3I9PA 1FORH 2DS4A 3B7SA 3KYAA 5GRXG 1C8QA 3C8KB 5F93C 5BUGA 3KG5A 3P11L 4NQED 2Y36L 1QRND 1CPUA 1ZHLB 1LK3H 4U6XA 2ZPKH 5IMKB 3MA9H 3GSNA 1BAFH 3QEGH 5AVWB 1DQMH 2BMKB 5HGBA 1P4NA 5E6ZA 5G5DB 1IUZA 2PIZA 2D4PA 3LCYA 5GZOC 4GMTH 2GSMB 1S9YB 2FIKA 4HZLA 3W11D 5I6XB 4LSPH 3RY4A 5KEZA 5LGJB 4PG9A 2IOIA 2NSXA 1EAPB 4X98B 1CS6A 1UURA 3LH2H 2DWDB 2DRUA 4KOUA 4ZPVA 4AOFA 3IEAA 3MLSH 1I53A 3GJEB 1RFDL 1S7SB 3RO0A 3I1UA 5DS0A 1ZV9A 2O5NA 3O9WA 1PQZB 1UH2A 4XXWA 2BNQE 5I18H 5EBVA 5LHDA 4LQ6A 5FHAL 1EMTH 4PJEB 3QGVA 2B20A 2GHZA 3DXAA 3GRBA 3HEIB 3GUTB 2CDGA 1I9IH 4Z3HA 1P7QB 3FC8A 2V17H 3RVWC 3RPIB 2XN9A 5J1AB 3IDIA 5CP7A 4KOSA 1V3KA 1U8JA 3HC4H 3EUDA 3MV11 1L3NA 5ICXB 3UCRA 1INQB 5I82A 2MRYA 5L7XL 4L8CB 2IQAA 4KKNA 4HG4K 3PB4X 1ADQH 3OF6D 5ES4B 2C9SA 3M7FB 3GT6A 1I8MA 1MCQA 3SYQA 1Y1UA 3PB6X 3C5SA 3B34A 4JO5A 4LPYA 3DNKA 4XNHC 4HGKC 1MOEA 4Y4HC 4WWKB 5EZLB 4MFLA 1AQMA 1DQLH 6FABH 2H6PB 4LOVA 3JBG7 1BOGA 5GS1C 1E28A 2Q87A 3EFAA 3RWGB 3WD5L 4F2FA 5I1LA 3GMPA 1SVZA 1PL3A 1URLA 2XTJB 5BJTA 4P5TB 4WKXA 2BP8A 3OKKA 4KFZC 2WK2A 1ZEAL 2ZD0A 3WS3A 5T1LD 3HZMA 4JCLA 5CLTA 1FFQA 5DYFA 3N42B 3V5HA 1MHEA 3IJEA 2Z1KA 3HS0C 5HYIA 2H3NB 2UXFA 1PW3A 1TF4A 3QCTL 1I8KA 4UINL 5FLVA 5I71C 2OFQA 3PHQB 4PJ8D 4TULL 5AOZA 5ESQA 4TLSA 5J06A 5JQ4A 1VHSA 1JXJA 2K8QA 4MNQB 1H9VA 1T4WA 2NY0C 3BVXA 4LF3B 4J5VA 3E38A 4GBXD 3R7RA 1CFVL 4O58H 1FVEB 4DP7X 5LN4A 2ZEPA 4BIKA 1VPOL 3H8FA 1HVXA 3PAZA 3MRJA 3S36L 3GZQA 1CDJA 3LZOA 4N85A 1YSJA 2CNTA 1MCEA 1PUAA 2YOAA 1NMCB 1MWAA 1NJ9A 1BJ8A 2CG9X 4K7FB 4MRCA 4PY7A 3K8LA 2IANA 3WR7A 5I1IL 5C07A 1J0HA 3AROA 3D69A 3PB8X 4HHAB 2LFEA 3B3CA 4ZMPA 3QZWB 2K70A 3BISA 3U4AA 3NFSH 3IPEA 2V8VA 4D9QD 2GIVA 4PB9L 4MJIE 5CFAA 3ZRCC 3SDDB 1F42A 5F9OH 2ARJQ 1R6VA 1RV6X 3AUWB 3F7RA 2WVSA 4HD9A 35C8L 3G5ZB 3C60A 5E2VL 1S5HB 3HNSH 5AZUA 3OKOA 3VI3B 5DEFB 2YK1L 3QZPA 3V10A 4O9HH 1QLFB 3A24A 2GY5A 1S7RB 3QIWC 4TNFA 5FUOL 2FX8L 5FK9B 5FYKE 1FO0A 2V2XA 5H37H 2DWEA 5D71L 3FUDA 5IW1B 5CGMA 1H9DA 1HL9A 4ZFOB 4RI1A 4Y2LA 1PZUB 3PGCB 3D7PA 3NIDB 2LQRA 3KYNB 2Q2LA 1AY1H 1PJ9A 2C26A 5DJZA 3IU1A 3QUXA 3BPLB 3PV6B 1KIPA 3BAXA 2ZAHA 3K5RA 4JKLA 4IOFD 3RDTB 2VERN 1GZHA 3S35H 3K8MA 5CZVL 3X3GL 5B1JC 2OZUA 1ZD6A 2GJPA 1JPTH 4TNEA 1CFTB 2DKMA 2WLIA 1E42A 1S6NA 2F7RA 2AV7B 2FJGA 3A67L 4OLEA 1XGZA 3TZVA 5HHNA 1D9KB 4XVTH 3S5ZA 5HGAA 2DYPA 3IBEA 3WYRA 3B3IA 2UX6A 2XVLA 2DKSA 3L1EA 4KLVA 1ZANH 3VFOB 1R5VB 4OGYH 1AS6A 1CTOA 1J8KA 4ALAL 3WXVH 2VZZA 5IVXE 2FT8A 1EHNA 1J1OH 3FUJA 1RUPL 3FCBA 4I0KA 3ESUF 1PPIA 4HWUA 5GGUA 3BUYB 3NFPA 4C2ZA 3EFOA 1QBBA 4FLSA 1F86A 2H1XA 4V1DD 1ASPA 1MCWW 2E7LC 3BCDA 4MRBA 2WNGA 4ZPTA 1ECYA 1KIUA 4I4WB 2WQWA 1SQ2N 4D0BA 3P40A 1C16B 1U8HB 4JY5H 1F4YL 2R2BA 5GRJL 3ESVF 3DOSB 4G6KH 3BH9A 3QO0A 4U2YA 1A14L 1TG8A 1KCBA 2Y7SA 4WWKC 5HD8D 1UWEH 4F9PA 3KKWA 2HTKC 1RPUA 3TX8A 4LNRB 4XVSH 3SBQA 3SGEI 3ZL4L 3F5WB 1IGMH 3KS0J 1TZIA 3LEVL 3UPRA 3EYFA 4RZCB 3EYOA 1JUFB 2Z3KA 3EJRA 2XTJC 3SBPA 2AEQL 2QVIA 2VT0A 4EVYA 1QTSA 4RCAA 1G6RB 2GC7C 5LYFA 3TC8A 5AG8A 4JFEA 4DVRL 2AXJA 4H1LB 1W2KT 4PBDA 3BQUA 5HI3D 3TO9A 3JV5A 3CCHA 3HNVL 3QEUA 2JE8A 2XICA 2FQEA 1QLEB 3RWFB 3F12A 4NO3A 4Z7UE 4PLJD 4OIDA 3WSQL 1FCCA 1REIA 1KGCD 4AQAB 2BNUB 1RUAL 3WBDA 1WWZA 1IC5L 4LGPB 3MUZ1 1U2YA 4WWID 3TX4A 3PABA 5C9JA 2X4RB 4UIMB 1L7TH 3AW5A 2HVJB 2Z35B 3H3PH 5AKTA 4JB9H 4B9GA 3N9GH 1NMCC 3DJRA 1EVUA 1FZOB 2PW2B 2GPZA 1BXUA 2MKWA 5J12B 5LRGA 1LEIA 3SQBA 5KAQG 3B7UX 5IIEB 2FUQA 4KO7A 4J3XA 1FF5A 1MXGA 2YMXH 5KVFE 2V2TA 1UCBH 4LLUB 4N2BA 3FN3A 4PEEA 25C8H 1MHPL 3KR3H 2V7NA 1OAYH 3OR7B 3VCLB 3SDDC 2UVEA 3EH5B 2CRMA 4JPVH 2J6EL 4G80A 4PU2A 3QPQC 5D7IF 5DLLA 5HDQH 5IW6A 4OLYH 1J0YA 4HIIB 1AQHA 4YNYA 2CLRA 3SKMA 2OXGB 3AWGA 4IRZA 4ZW7A 3GSRB 4PJXF 4HJIA 5CPAA 4R26H 1ZA6A 4P49A 5DWUH 2EXYC 5EMYA 3VRJB 1JK9B 3FO2A 5KBLA 4OIIH 5DGRA 2QQLH 4PV9B 1BOBA 2E7DA 4Z7NF 1HYRC 1FFPA 5BUPA 2YEZA 1QBLH 3EOBB 4RFNC 6TAAA 3BRDA 1WLHA 1F6FB 4RQQB 1N0XH 3MRNA 5JQHC 4P4EA 4W6XB 4DT2A 1MPAH 1KUVA 1TENA 2FNBA 4PJHB 4LARL 3OKNA 5EZIL 1T20A 1E27A 5ELYA 3ARRA 1UT9A 4NN7B 5INDB 3M1BA 2YUXA 32C2B 5CZRA 5CJOH 1NE9A 2FT6A 3GBLA 4N2EA 4JFXA 1WAPA 4U0QB 1QSOA 4UILH 1BGXL 3KS0H 1SVCP 2HV2A 3FT2A 5JIHA 4NFCA 4KUCD 2JIXD 3UH8A 3LDBB 3FIXA 1YMHB 2VN6A 2DICA 4JO2H 2R56H 5CJ8A 3W57A 3MCKB 4IS6A 1F8TL 2EIZA 4N6RA 3S8GB 2CUHA 3C8KA 4RAVA 1OZTG 2CGRL 2OSLA 2F1EA 3HPJB 3ENEA 2NNRA 3L45A 3R0NA 4LKXB 2K4AA 3UTPD 1CI5A 4G5ZL 1KT2B 4ZW5A 4MQ7B 3NMEA 4G6AC 5HDBB 3C2AL 3FEEA 3RE0A 3LJ3A 3MNMA 1R3IH 5G5DA 5JQIB 5ENWB 2Q0ZX 4GPVA 2CHXA 1WD8A 4JHAH 4WNJA 1Z9SA 3GM0A 3MJ8B 4HS8H 2EABA 1FFNA 1FLTX 4F3FB 3NOIA 4LGRB 5E6RB 4M7KL 3MJGX 4EI6A 1PU0A 4J3OG 4UQ2B 3LN4A 1A1NA 2H6OA 1IT9L 3EDKA 4C4KO 3IJ3A 1J8HD 2OL3A 2OR9H 2VDMB 3S6GA 2KMWA 4KKCC 4B41A 2GLFA 2CO7A 4DH2A 4LLDA 4ODXB 4JFVA 5CU5A 2WN2A 4MDIA 2YXWA 3LHAA 1ZG9A 4IEFA 1NC2D 2E9WA 5D5MB 1ZO0A 2KUTA 2O6CA 3D3VB 1UYWH 3L5JA 5J1AA 1G1YA 3V8OA 5K59F 4KQ0A 3FT0A 3BSZA 4JM2B 3LPWA 4NN6B 5LAXB 4EFDA 4A33A 4NRYB 5C09E 1INQA 3BCFA 1YEIL 3QEQE 4QRTB 5C0AA 5TE6H 2CHWA 4Y9FA 2B5GA 4AV4A 3KWVA 3BLKA 3UJIL 2EJ1A 5C6PB 2VJ0A 1A4BA 2GT9B 4P46D 1WFTA 4HU2A 2A83B 2MMXA 2BP0A 4XN4A 3UZEA 5EZLA 3WY1A 4M61A 3JVNA 2H6PA 3VNYA 1LP9F 4H5SB 3HC0B 3D8PA 4IGBB 5GGVY 3FHAA 4OI7A 2DPTA 1UFHA 2G3NA 3X3FH 2QGDA 2CJUL 2VSKB 1JNLH 4DO6A 3BP5B 4FKHA 1I1RA 4P5TA 4Z7OB 5JOEA 2GLJA 1HDQA 1KTJA 1YMMA 1QUNB 2PYFB 5EEVA 5C08E 3LNIA 5KYUB 2BCMA 3D39A 4JN1H 5F6IC 4JMNA 5D1ZI 1AMYA 3U4KA 4UQ9A 3UADA 3QRLA 2ADGB 4OKVB 2B3RA 4RMWA 2Q6WA 4WFGD 1MNNA 4PRPD 1XGRA 3AG1B 4BXVA 1Z66A 3MRIB 1KBGL 3PHQA 1CL7I 1BQHA 5C0GB 1DVFB 3WNLA 3BEVA 4F7TA 2V8MA 2BNRA 3B9VA 3FK3A 1P5UC 3NSFA 5FF6A 4PGEA 4AVBA 3DV6A 4UCPA 1OAZL 1Y18B 3GDBA 1OP5H 1KOAA 1AXIB 4PJCF 5E08H 2R7EA 4U2ZA 1GHEA 1U3ZA 1JWQA 1YQVL 4PHXA 4HALA 4KMLB 5FIEA 4R4FH 1YEWA 4OGAC 3DYMA 3FRUA 2GTZB 2HXAA 4HHAA 4L3EE 1EDQA 3TLRA 5TE7H 3QUYA 3S36X 2BVQB 3S3BB 2X2UA 2ZWZA 3HR5B 4CNIB 4MNHA 3STLB 1MHPH 3TO4D 1RXTA 5I5MA 1Z3RA 4L18A 1G9EA 3EC4A 4PQAA 3LDBC 2FJUB 3V4VA 4GFTB 5LJYH 3LH8A 5F89B 4NO2B 3U36A 1BQHG 1GY2A 1QBAA 3T1FB 2Y25A 4H8QA 1G7JA 1ZSHA 2VDRL 4Y5YB 1FH5L 1S5HA 4TPRH 1ONQA 3VI3A 2XC8A 5JR1H 4XPKA 2W38A 3HG1E 1R33A 3FF8A 2R8VA 1YPZA 1WGOA 1P9MC 2Z7ZA 4HCRA 4FQIL 4PSRA 5FK9A 1EEQA 5I6PA 5CEZL 4EI5D 4DKFH 1FHNA 3DBXA 1UD8A 1WZLA 4K5OA 5CMAA 4WKZB 3VXOB 4DP8X 1F4HA 4YGVB 1NLDH 1GSMA 2N1TE 4PJDA 5IGXL 1UJ3A 4CBZA 5BOJA 4U1HA 3TVMB 5HHMB 2PCPB 3HE6A 4OJFL 5SX4I 1XMEB 1HEZB 1IKFL 4FP8H 4HS3B 4GSDH 1AXSB 5LWYL 1MZYA 3PHSA 8PAZA 4AEEA 3IWWA 3FAXA 2OSWA 3LIZH 1JE6A 2A74C 3DX7A 5E9DE 2K78A 1JN6B 2YGPA 3GF8A 4NAJA 5AFAA 4OQTL 1IBZA 5I0ZA 3WNOA 5IB3B 1S9XA 1T66D 1LLAA 4D3CL 1CFTA 4Z7WA 3EBAA 3OSKA 2AV7A 2WGXA 3WN5A 1S46A 1FDLH 4LCWB 4PRIE 1FZMA 5EOTB 1RTQA 3IWUA 1IAKA 2ENQA 4H44C 4HAKA 4YHNB 2V5TA 1RJZB 3HI6L 4LASH 4NYLB 2ZSWA 1R34A 4GO8A 2VNCA 2PR9A 1SN2A 2EEBA 2W0LA 2Y1YA 4MAYA 2VSMB 4S10A 4QCIB 5JHMA 1Z3GH 2FH6A 5I26A 4DGVH 1QFHA 5DZJA 4Z7IA 4I5BA 5I0VA 4FFWD 2WKGA 2ARWA 6CPAA 2O5XL 4LOEA 4JQVC 2EC8A 3CD4A 4K9EL 2GSGA 4QDGA 1VADB 3WLWD 3WAKA 5E8OB 3U4BL 2O61A 2IBGA 3HTLX 4KK9D 2NR6A 1AGDB 3T0EE 4JFDA 1BP3B 5DT1H 1OAXL 4ZK8A 4OJYA 4KDVA 1AJ7H 3A6CL 5DMKA 1E5CA 3B7RL 4Y19D 3DRQA 4L48A 4YXLL 3T65B 3GQFA 5DFWH 3NZHL 2FZ3A 3F5WA 4Q2ZA 5D2LE 4GO6B 1RP9A 3GWJA 3KPSB 4TLTA 3NYKA 1JUFA 2VZOA 5FOBB 2DMBA 3RVTC 5J13C 3SE8L 1JXFA 4X9HA 1G6RA 3EFFA 2FJHA 3K6DA 4AXWB 1OGTB 2DJSA 2R29L 1CR9L 1T7VA 3O6LL 4U1SB 1YMEA 3U6XA 3LZLA 1H19A 3B3TA 4Q6KA 2E27L 4YWGL 2B4CL 4F9LA 5TDPA 3F58L 3D7DA 4KJQD 1ULVA 2R8SL 4G6JH 3CZXA 4HLZG 3PJLA 4BZ1A 1MCNA 3SKNB 3NJVA 3ARFC 3BUQA 1SYSB 3ZDXE 4GS4A 4K94C 3V7AE 2WIIB 2H6UA 3RNQB 2G3MA 3BW9B 1CFQB 1J9SA 1F4WH 4RZKA 3AY4C 4Y4FD 4M8QB 1JF1A 1U42A 1QNZH 4X8JA 3H9SA 4AJ0A 1DJHA 4L3AA 5EO0B 1WD9A 1XGQB 4RGOH 1FZOA 1AD0A 4ZD3L 1MJUH 2F54A 3QQ4B 2V5YA 5F09A 4K15A 2BIOA 5JA8B 4FFYH 2A73B 1WGVA 4DK5A 3AREB 3MRCB 4M5ZL 5IHUL 4A94A 2NY3B 3OB0H 2JKXA 4HUVB 1P0HA 1AXTH 5FC9A 3HUJE 3MREB 3UBFA 4BEIA 1QFWI 3FQUA 4HKBA 4TQEH 2F61A 2XRAL 4NGPA 3GNML 1MCKA 3UP6A 5C3IA 2FE7A 4AQEB 3I2CL 1XH0A 2AXGA 1TT6A 5T3XL 3S96A 5JW4M 4TNWF 4G8FB 3VH8B 1T1WA 3ARBD 4HIIA 3NIFB 1H6UA 2HJKA 1LANA 3VFWB 2IWEA 2WNWA 1P4BH 5L8LB 3VRJA 1JK9A 5M95B 2EINB 3P4MA 3QI9B 2WSDA 1QFWL 3JZ7A 1HHGB 3N43F 1CZ8H 5A2IH 1NFDA 1ZHBB 4DOHE 4M4RA 5ABZA 3PWUB 4I1RA 5F3BA 5HYJE 2X4PB 2NZ1A 2VDOL 4PJHA 4DW2L 3IDXL 1OP9A 5C0FA 4F91B 1YX0A 3D52A 1Q72H 1WCBB 4M03A 4FG2A 3B1TA 32C2A 1CL7H 4TVPD 3F7VA 1A6UH 1CGXA 2VRKA 3MV9B 3NCFB 5FW8A 2IWGA 2H2SD 1B0WA 3ROLA 1J18A 1FNOA 2P6GA 2PJ1A 3D67A 3CBRA 3LRLA 3DSBA 3AQYA 5KSVA 1V3MA 1VCAA 5IB0A 3UTZB 5IJDC 3FJTA 3KMDA 4O5LH 2DTMH 4ZX3A 1YJDL 4D9RD 3OMZA 4WO4C 5JORA 2ANPA 1KF9B 3TN0A 5DF0A 1MAML 4Y7OC 3KPRA 2HA1A 3L08A 4LESA 1KJ3H 1TZHB 3HPJA 1Y0YA 4LKXA 3E6HA 4AZUA 4GW4B 3FUHA 2ZJSH 5IJVB 4X7DC 1I7UA 3L5HA 4IDJL 3T09A 2RJMA 3M7OA 4NPJA 1Q0YL 4WSGA 3KLHD 1NUDA 4KRPD 5DUPL 5DJDA 3CVBA 4KC3B 4ZX4A 1QSRA 3LKSA 5H4YA 2XN9E 3VG0L 5GS0D 1RK7A 1WTGT 1S78D 2ITCA 4QIRA 5DD3L 1NPNA 3MJ8A 4JD6A 4YO0B 5CCKL 1D2OA 3BIKB 2A7BA 5TPWH 3WFHB 1I75A 2Z7WA 1O6TA 2MCAA 1AKPA 3NA6A 3QFJD 3KW8A 4LSVL 1L0XA 4ZFFA 1R3LB 4JDEA 2ZYIA 1TEYA 4JX0A 3FQTA 5IBTL 4XB7A 1LE5B 2BHYA 3FF3A 5AW9B 1BV8A 2C3GA 5J3HD 2Z0BA 5F88A 2HT4D 1OGAB 1KCSL 1L9PA 4S1RH 2HTLD 3HNTH 1KLFA 1EE3P 4YDJB 2OCFD 5FO9B 1LNUB 5SX4H 4AEIH 4ODXA 4LHUG 3IMVA 1HI6B 1BZEA 1RZ8A 1YEEL 2WPWA 3GMRA 4N2CA 1MY7A 4UA3A 3DUUA 3G3SA 2CKBL 1BVOA 4F2MA 5HYSG 1AKJD 3G6AA 3EH2A 5ALBL 3V0GA 4M29A 2PPAA 2HCZX 4XO8A 5TGBB 4EWTA 4C7IA 4ILDA 4NQDB 5H84A 3BVUA 1FC1A 1D5BB 1NDTA 4QUOA 3RUGB 4U5YA 3MRFA 4H8UA 4H1LH 5EBLB 1X5GA 2VQUA 1ZLUH 1QI4A 4NPYB 2BFGA 3FUKA 2JXMB 4HOWA 4RMUA 5KG9B 2EACA 2YAFA 1Z9UA 2GFBA 2WM0A 3OLIA 1A7NL 1FNAA 5BV7C 1QLEH 1A25A 5G1ZA 5AG7A 3AREC 1X7SA 5SWSE 2VLKA 1EDYA 3H7BA 1R75A 2Z31B 3REVB 3D2UB 3FFDB 2LOEA 5FM5M 1NKRA 1JG9A 3BAWA 4W9YA 1FE8H 1IGJB 4LLMA 1N6QL 2HT3C 2KERA 2IANE 4PWJA 2PYFA 5C07E 4U6YA 5E1QA 4P2OD 2OMUB 2YD2A 3RFZC 5DVPA 2B39A 4C55A 1VGKA 2QQNH 3TBVA 2W0KA 1GJUA 1EZVY 3P0YL 4OIAA 1CWVA 1A1MB 2IH8A 2Y6SD 4R7VA 3WEAA 4H40A 1X5LA 2AKRB 3ES6A 3GKWL 2NYQA 3WKNA 1L9OA 4U49A 1CF8L 2GW5A 1E4KA 1QRKA 2AVFA 2JJWA 4HK3N 4A7QA 2QBWA 1JZEA 4AL8L 1CP6A 1UG9A 2SODB 4I9XA 3NJMA 4FS0A 4OVVA 4YDKL 5F70A 4WU5A 3QJFB 5FDYA 2A0LD 4OB5L 2GABA 4YBLC 3H0TB 5C92A 2ZEMA 1UA7A 2DV6A 2WAQA 1MHHA 4I0PC 4POZC 2HWZL 3FSVA 2MSPA 4PVMA 5HP5A 5KSBF 1CK0H 2F5BH 3VXUA 5KUKA 4E42A 1JHLL 1DJYA 2R4SL 2OBGA 4EN3C 2FBOJ 4RNRA 5F89A 4WTZA 1HT6A 1T1YB 4ONUA 1CFNA 5E1AB 5C7ZA 5JW4Q 4I48B 4KY1H 2EC9T 3U9UA 2ATAA 3D5OF 3V8CA 4DVBB 3U46B 4QNPE 2A38A 3MR9B 1N0LA 3QUMB 5FYJL 4B7LA 1GGCH 1NCTA 3KPQB 3OX8B 4XC1L 4JFQA 4WZ9A 3TBYA 2DB8A 4BELD 2VM4A 3V9FA 1U4FA 3L4ZA 4JEGB 3RKDC 4AKOA 3BZEB 4IK6A 2MQCA 5F1NB 2OYPA 3D25A 5F44A 2IAMB 2WXGA 4HS3A 4DGIL 1AXSA 3JWNC 1BECA 4RMTA 3ISWA 4KTDL 3ABGA 2HG5A 4W9KC 2MFNA 1O9ZA 4DUKA 1LJMA 2J1WA 5GJSL 2WYTA 1A3RL 1PD6A 4P5KB 4WWOA 5LDUA 1TCMA 4I8DA 3ZKMD 1I7ZB 1FY7A 2Y7QB 4X5RA 5JHLA 5ETUA 5I1JH 5EEUA 2PW1B 4LCWA 5KAQF 5F48A 2DQUH 3P73A 4CVZB 2YLKA 4PRHD 4XMZA 2R23B 3SGDI 4QHPA 4BHUI 1FZJA 4QRRD 5IB2A 4XGZA 2D8KA 3UBXG 4LBEB 2ORBH 1Q9WB 4FL4B 3MBXH 2BZDA 2AP2A 3N85H 4FFVD 4QCIA 1AP2B 3CJJA 3N7ZA 4ONGH 1NLBH 4P3DB 4JFEE 2YNCA 5C0EA 5GRZA 4N8VG 5ABAA 1YLBB 2QVTA 1VZGA 3JVGA 1FRGL 2DI8A 2GUOB 2X09A 3T0AA 4BH7A 5AVSB 2WWOA 1G0XA 2BY2A 4QTHB 3C5ZD 2GU2A 2QSVA 2YFNA 2G3XA 4ODSH 3FONA 5HJGA 3RIAK 3GJFH 4I18B 4R9MA 3QNVA 1M1XB 2XV6B 5FFGA 4DP2X 2IDQA 1S7KA 2FH8A 3PHAA 2Y2WA 1ZJBA 3V6OC 5IFAL 4PBVC 1OCOB 2NLJB 2AQQA 4DGWC 1NGPL 2Z31C 4XMXA 2X6UA 2R83A 4OIWA 2V6HA 3HC2A 1CLVA 4MVBC 5C0BD 1M7XA 5DJ8B 1L9MA 4NRXB 5DQ9B 1QTYT 1NCGA 4FNLL 4ONFH 5IBUB 3BEWB 3TWYA 1YLEA 3K2UH 4PD4J 4FXKA 1UWXH 4X7TB 4YX2H 4EKXA 4UT6H 4DERA 1TMCB 1IGTB 4TNVK 2W80C 3E9UA 5IOKA 1RHHB 4ES9A 3VH9A 4WTXA 1MCOH 1ZHNA 3DPDA 4GAYB 5I6NA 1CDUA 3FB5B 1BQSA 4WRLA 4MJHA 2P6FA 2R98A 3T3PE 4OJEH 2QYVA 2W0FB 2PN5A 2AEOA 1C12B 2YUVA 4ZXBD 2WIIA 3B9KB 2AC0A 3GYAA 3LACA 1T1XA 3V0AC 2IOMA 2PXYA 3CC1A 2B4DA 2PWDA 2EE3A 2C9PA 3ZVVA 4OAWA 1XGQA 3R1KA 5H94B 2FT0A 3SSGA 1VGEL 4HT1L 2FLRT 3WEXB 2O93L 3DX4A 3OKLB 1TU2A 2OQJB 3I50L 1Y07A 4ODHH 1KLGB 3AXLB 4ANVA 3H54A 3ZJ0A 4B5ZA 5A16A 4QRPB 2IGLA 4A68A 4GBXB 3G04B 3CFEB 4H88H 1HSAB 3KM1A 3ESPA 2BS71 3BGAA 2HLFD 3VH8A 3L3JB 3X13B 5I76A 1QBMH 3GXTA 3SPIA 4F7MA 2GG1A 4R96B 4X8CA 3WNKA 4AQ1B 1CFBA 2X0UA 4GQZA 1B2YA 4N0FA 3BKMH 2B1HH 1FL6A 2G3AA 2COVD 2IAAC 3CZFA 3W0WE 5IFHL 1T5XB 3QI9A 3CDXA 4KNUA 4OF5A 3S37X 2ILLA 4R8FA 4BRVA 3CVHL 2I07B 3BN9C 1A65A 4XPBL 4NAQA 4YHML 2X4PA 2VMEA 4DQOL 1FA4A 3NIGB 4N3UA 3UX9B 2IAMC 2WBXA 2HG0A 4WJ5A 3GHEL 3ZIMA 4QLWA 4HGMA 4K3EL 3RY5A 2FS5A 4FABH 3MV9A 1PJWA 1BLNA 5E99L 2GHWB 4WO0A 4J23A 3PFEA 1N19A 3L54A 3NJIA 3ZKXB 2CY2A 2PTTB 3UAEA 1N5YH 1S3KH 3KDMA 3LQZB 3UIZA 3QH3B 1QABA 3U6XS 2PSWA 3QEHB 3UTZA 4DSYA 1DQDL 3PDOB 1JHLH 3QAHA 1AAJA 1WG3A 3TCLB 4RFOH 3WTYA 5DDHB 3DK0A 4HWBH 3IDYC 2CUMA 2W5PA 4XN8A 3BOVA 3PGPA 1KUMA 1QA9A 4FL4C 2EYRA 4FBEA 4MNGB 1IFHL 4L4TB 1HHHA 2EDRA 1H15A 2CK2A 4AIZB 4UB0L 4GW4A 3LRSB 5BQDA 2EDWA 1CLCA 1VERA 2APWA 4G8AC 4WFFE 3TJHD 3DTXB 4CU7A 4PJEE 4EPSA 3IAGC 4R7DB 1JD7A 1NGQH 2F7VA 3GY9A 1JWMA 4ZRGA 3MUUA 3KHOA 3RP1A 2B4BA 4JQIA 4C2XA 1VENA 5LVEA 1KG0B 5H86A 4RMVA 4YO0A 3ZTNL 1O9WA 3GSXB 2AQ2A 4DETA 4K7PH 2UZXB 1KY7A 4BYHA 3CFQA 1R3LA 1M2VB 1YYLL 2N1KA 1DO6A 5EOQH 5FHBL 1SHWA 1WVZA 2YSSB 3B2MA 3MNZB 2NY5C 5MENA 4KZDH 4GI8A 4HIPA 3Q6GL 3WIHH 3P3RA 5FO9A 4JFYB 4Q9QH 2L8AA 5ACZA 1XX9C 3DJ9A 3ATDA 3PBEA 4FQXD 5IESL 4E8OA 2FO8A 1QPKA 2D4DA 5T5FL 3LIUA 3HBGA 1SGKA 1OTTD 4IKKA 3T3MB 3E8UL 1YMME 1NCAL 1CGSH 4O51A 1YEDB 1N67A 4MMXA 2BSEA 1BMGA 4E9WA 2BVTA 2CXGA 3EDDA 4M48L 2WXLA 1MFEL 1KJ2L 5EBLA 5C8JA 1L9RA 4CL7A 1JPFA 4NPYA 3NK3A 3NJXA 4JLRA 1KXHA 2HC9A 4GG6B 1JP5A 1S3RA 3CZKA 1IAOB 1PKQA 2BNRE 2C9XA 2XXMB 3ARQA 4GNKB 3FQXB 3QUHA 2AJXL 3MRQB 4UOW1 4R8WH 1OCWH 1D2PA 1VLXA 3D2UA 3K72A 1OD9A 4IHOA 4PJ8C 1PX8A 4L1DA 3IC1A 4FQ1L 1EO5A 2LU5A 2R69A 3GSOA 3KLLA 1TNNA 3OZ9H 4GBXC 3QNYB 1O5PA 4JRXA 4HEPA 1L4IA 4I9WD 4YGAB 3SE3A 3AM8A 2B0SL 4IRJD 4AUUA 1BZ7A 4PGBB 1F1DA 4JDVA 5BV7H 3QVAA 4Y5XB 3BVWA 1TXKA 3GRGA 1YPZF 4OCLC 2ITFA 5ICYB 1YUKB 4PJAF 5JDJA 3V79C 1ZT4A 12E8H 3L2NA 1WWAX 5ISVA 2Q76B 4Z7VF 5A2AA 5LCVA 5KS9A 4CA4A 3CLEH 4FA8A 4ORZC 2M1KA 4U7SA 2MHAB 5B22A 3VI3E 1W80A 2ZXQA 5FKPA 4K0OA 3TF7C 4A7GF 5C0CD 4ZMLA 2PO6D 4IOSA 5E5LA 4WUKL 4CGTA 5EU6D 1SBSL 2B2XL 1M6UA 3QJSB 5F2FA 3GIUA 4ZFZB 1B6UA 2O5ZH 3NIDE 3C5XA 3PY9A 4MD0B 4GKLA 1AHKA 1LE9B 2VUOA 4X6FB 3ZDYF 2OMYB 3MYZA 4HEPG 4NDMB 3ZKXC 4Z7WF 1SYVB 4FG4A 2DWXA 3PWJB 2NRDA 3R06A 2KC0A 4A7TA 1NUGA 2PCUA 4KJWD 5JOFA 3Q01A 2HB6A 4G7YH 4MCYA 2BH0A 3LHPH 2JEWA 4MSWA 1HKFA 5ESVB 1XDTT 3AS0A 4XH2A 4J8RB 4I48A 4JPIB 2VTFA 4F7EA 2PWGA 3LQAC 4CW1A 2J8NA 3S9MA 4OCNC 1N7ML 4WW1B 4IOFC 5DUBA 5DHYA 3R7QA 1AGCB 1KN4L 2YA1A 1I1CA 1JPSH 1ACCA 2GVYA 4PRDB 4XNZC 4L1TA 3ULSA 3TA3B 4M85A 2EK9A 1HCFX 4B0MB 3UO8B 5KBPA 2BXYA 5EDSA 1C08B 4HISA 5D7SL 3ULUF 3ATAA 1V54B 4JRYD 2ZAGA 2AAVA 4TSCL 3LN5A 1AO7B 3ZE1B 4XHQA 3VFGH 2BW4A 4YHYC 1DSFH 3NCYS 1UVQB 3DMMA 5MP6H 1AZRA 1KYUA 4KZ0A 1QR1B 4LMQI 1I7ZA 4K3HA 4KI5F 4YSDA 1F2PA 1VZHA 4JFDE 1ARLA 5AVZB 1G9HA 2XI9A 3S34L 3RIKA 3MLVH 1FZKB 4ZFQA 3MA7B 4NQVB 3T6ZA 2NX5D 2EDNA 4XN2A 1AMXA 3JWNH 4X6EA 5AZEH 4YDLB 3M1CA 2CLVA 2FJSA 3CMGA 4B96A 1L6ZA 1FN4A 5HD8C 3VX1A 1XMTA 4PREB 1A3ZA 3LB6D 4WUUB 5T1JA 2HKFH 2XQYK 4LDLB 4QTHA 1L5GB 1J8HB 1JZJA 5B1KA 3HB3B 5T3ZL 1KN2L 2VL4A 5HI3C 3KI9A 2AQ3A 1RQ5A 1JZ6A 3BKJH 3HG3A 5PCYA 1EGJA 1NC2B 3A9LA 1JIBA 1KDJA 3O6FD 2BIQA 1OT1A 2NLJA 3QW9A 5H37A 3CWGA 1UKQA 3H9SE 1DQIA 3RGVD 2Y7OA 2XIBA 5I1GH 1IM9B 4HKJB 5AW8B 4N2AA 3ZQXA 2C34A 4YLCA 2F54E 5DJ8A 1D7BA 3FYNA 4ACTA 4NLHA 1R3NA 5IMOB 3U0TA 4HLEA 1Q9OA 1T5KA 5HGDA 1ZHKA 1D6EB 2NNXA 3E0KA 2FIRT 4W9IC 4P46B 4E9TA 4LAQH 2KT6A 4WU7A 4HKZA 1FQ9C 1XF4A 4Z3TA 2YUWA 1Q9KA 5DHVB 1Y7VA 4R7XA 2H8PA 1BQUA 2G9DA 2Y69B 2N56A 2N4IA 3SZKC 2W0FA 1C12A 3JUZA 3V6FB 5DJ0B 1AVAA 2LW3A 4FZ8H 4PP2B 2ZCLH 3QDJA 2C3WA 5DO2D 2PYED 1SLUA 5H37G 1G87A 4B9KC 4ETQA 2DQCL 5C71A 1S7TA 1ZWIB 4YQXH 4G9FB 2RBLA 4CVUA 1L6XA 4IMLB 2YAHA 1LK2B 1NFDE 1U8IA 1Z5YD 2DLEA 3G6JA 4L05A 4X6CB 5CNPA 5D7KD 1MF2H 4PJHE 5J56B 2J3SA 4G7VL 4NC1E 1YGHA 3VD9A 1E3ZA 2DYRB 3IU4L 5I28A 1CQYA 4O23A 3T8WA 2VDPL 3CFEA 4G9DB 5AG5A 3AC0A 3MUGB 5ALCL 4L0PB 4OZGB 5GGQL 4ABQA 1KWKA 4ES8A 3LS4H 1U8PA 1B87A 4ODWA 2OMVA 3MBEB 3C08L 1MFNA 3GSWA 4R96A 4G8GA 4M1CD 4G3YH 4UNTA 3QJQB 4HXBH 5FUZH 1XF8A 1PLBA 4KI5D 3PG2A 2PJ2A 3EYVB 1A0QL 2X4UA 1YR0A 5GGTL 3SPGA 4CVWA 2CIIB 1PLGL 4I87A 3WKML 3G5YA 3UO1L 3LKNA 3WFDL 2WHVA 3T8XB 1WZMA 3TA3C 1X5XA 3K2IA 4HS6B 4JL2A 3EHBD 4NZUH 1DQKA 3FCSB 4H20L 4H4NA 3MLUH 4UDTB 5FCUL 5GIRA 5T1KD 1BFOB 1CTMA 1J0KA 5DD0H 1M4DA 2J1KA 3F7LA 5DMGD 4OF7A 1R5WB 4DP9X 3QUMH 1N3NA 2EE0A 2RCSL 2NNFA 2PTTA 1WYJA 4BZ2H 3TOAA 2WD0A 3QCVH 2BINA 3QEHA 1MREL 2JQZA 3IMUA 4JFFD 4Y88A 3PDOA 1HH6A 4J3VA 4HWEL 1HHIA 1P84J 5CILH 1A5FL 1QAWA 1T0NB 3TCLA 4APQD 3VRLE 2YXFA 4UFXA 2QKIB 4YHZH 3SDCD 2J8HA 3UDWA 4YDLC 3X1NA 2EH7L 3HG4A 4L4TA 3PAVA 4UOW0 3W39B 5DEJA 2C1PB 4QRUB 4RRPM 3LRSA 4ZBGA 2MKLC 4L3FA 5EUOB 1SM3H 3HVDA 4Y9GA 1ZVHA 3I75B 4LSRL 5ISZB 4GXFA 1OV8A 4K8RL 5DD6A 3D3VE 2CDEA 2DIAA 5GRVL 4YAQA 4GW1A 1HN1A 1MH5A 3AMKA 4AYMC 1FL5B 3GSXA 1QO3A 1I8IB 2C4XA 4DFIA 2UYLB 4HJUA 3RNZA 2OYMA 1Q0EA 1NMBH 5CZXC 3SGJC 1R3JA 5AVYB 2Q04A 3HCVA 2BNQD 2W9DH 3SDXF 1I7TB 1LDSA 1K72A 1ZE3C 2OCJA 1XOVA 4B95C 4IUSA 1E40A 1JGEB 2JELH 2LAGB 3ALXA 3ASNB 4Q6IA 2A6JA 4HJSA 2VLKE 5HDRA 3C09C 5L6YH 1KTLA 1KWGA 4JUSA 4P46C 4BFIB 4DESA 4MFHA 4Z7OE 1MJ9A 3TNMA 1KB5H 2IJ0C 5DRNA 2XVKA 3D0LA 4Y19B 4ELMA 4AEHL 4LIQL 3QB8A 4MDJB 3UYOD 4CJ0A 2P26A 4JKWA 2Y23A 4N0UB 1I4FA 2NY5H 1GC1C 1T22A 3QULB 4XMPL 1D5XA 3GBEA 5SV3A 5FB8B 2VDRB 1OALA 3ZE0F 1U58A 2V5SA 5EO9A 1JHTA 5IVZB 2AJUL 3HS8A 5D7HA 1XAUA 4UF4A 1PNDA 5IVXF 4PJ9B 3FQXA 4LP8A 3SEPA 3APMA 4HIHB 4HX1B 4LPWA 2WP3T 4LCCB 4MJ6B 5IQ9B 4IJ3C 2EDXA 1RURL 3NG5A 1JI1A 4ENED 3T90A 1A7RL 1NBYA 1O7SA 4GXHA 5F1IB 3O6ML 5KVGE 3U1SH 3DIDA 2BSRA 3AMLA 4AYGA 1A3LH 1A7PL 3RRQA 4CGLA 2NYZA 3ROOA 4PGBA 4ZAKD 2ZUQB 4B9JA 2JKLA 1MW0A 2FX7H 3FO1B 4ONHA 1NC4A 3TPKA 3KM2A 3VXNB 2AK4B 2WXPA 4OCSH 3TASA 5ICYA 1IU1A 3RX8A 3VXUE 1T0MB 4M93B 2OJZH 4HUKB 3EYUL 1M9WA 4JRFA 4P9MH 2QVFB 2IDCA 1DVQA 1AIFB 2BVOA 3RWEA 3VI4F 3L4CA 1T7ZA 4HHWA 4IKIA 3TO4C 5D72L 1GW6A 1JXKA 3VWKA 3B2VH 2HKAA 4NKOA 1XSJA 1MI5A 4LQFH 4TXVB 3Q44A 3N5FA 3JSSA 4TVSa 1LFWA 1G43A 1KELL 5A40E 4NENB 1A4AA 2OU2A 1OAJA 2Y7NA 1DUYA 1LE9A 2FDBP 1WAAA 2MPAH 2ZOUA 2Q7YB 4BSJA 2EADA 5KN5A 4U6VH 3DYOA 3MROB 3U2SA 4EI5C 2EYTB 3LS5L 4FQJL 4F8NA 1HE7A 4FZEL 2VDLH 4NZRH 4RSYA 4HJTA 2KZWA 7CGTA 2J4WL 2NCMA 2H41A 3AQDA 3WFCH 2EVIA 2OTUB 1G1KA 3I9GH 4I3RH 2EUVA 4J8RA 5KJRL 2YGQA 3EXJA 2E9IA 1IILE 5JDSB 5J89A 4LUAA 4A7UA 4LCWE 5FYKD 2L0DA 3FTGA 4WI7A 1AGCA 4J1UA 3T71A 1K8DA 2PLTA 3CVCA 3WEMA 1T66C 4FTVA 3NAAL 4MZRA 4MZ2A 5GZND 1NEZA 4O2FB 4X9YA 4QHLB 4AKQA 3MRHB 4DAGL 4Y4HA 3C6LB 4G43A 1U2HA 3HFFA 4XO5A 3RWHA 3CN0A 2AERT 5KBKA 3LQAH 4A04A 4HUUB 1HAUA 1U33A 4P3CH 4XMTA 5GS1A 4LQ1A 2OZNA 4Z18A 2RTTA 1UVQA 1KBVA 3VFSB 2DLGA 4D2NA 1AHWB 4M7LL 3D9AH 1KBWA 2ENSA 2H32B 1JCKA 3EOTH 4LRIC 5HJ3A 4GMSH 3QCUL 1J9CT 1RIVL 3L1OH 3VD1A 3DIFB 1S7VA 4ZMYA 5BVPL 1BG1A 4N2NA 3P9LA 1KWMA 4OZ4A 4FFWC 3GKZA 1VFUA 1UT1A 5F96H 5FWQA 3SOBH 2W9EH 1FZKA 1TVHA 2RALA 1YEGL 4EKJA 5IT2L 3HS0A 3RFRA 3WLWC 3HHSA 4PD4K 4GSXA 5KW9L 4KK9C 3CZSA 3D05A 5IB4A 3MUHL 1QEWB 1WFIA 5B7EA 4PTUA 1NEZG 5IB5A 4HBCL 1A6ZA 3U82B 5HHOB 1Q0XL 1MELA 4RMSA 4TLUA 1Z2KA 4ZUUB 4MAUL 2B1OA 1ORSA 2J6EA 3EGDA 1TJGL 3J7HA 2ADJA 2VGLM 3D33A 4WNQB 2BY3A 4HETA 5TDNB 5JPNB 3FSWA 2VAAA 4PIBA 2UWEA 4FRWA 4AENB 4X7EC 2WGNB 3LD8C 3PNWB 5EIQA 2VQ1A 3GBDA 1CGVA 4JFZL 2CM6A 2G75B 2JCCA 5T1DH 3UYPB 3ZIYA 3WTSA 3O3DB 4KJQC 4PCSA 5EA0H 2NW3A 4HIEA 1ZPUA 3ZDZE 1U8NB 3S9LA 1CDIA 1E9QA 2VB5A 2VDOB 4HKJA 4FFZH 5AYUL 1VFMA 1SEBA 1P6AB 3H9HA 4NRZB 1UOWA 2XJLA 4MCPA 5IMOA 4XMKL 4MB5A 3N41F 3Q1SH 1KNOB 2HAZA 4Y4FC 3ULVF 1Q2DA 4DPRA 4KNTA 3HG0A 3SDAD 2BDNL 4JDTL 4QPEA 1MG3C 5ILTH 1MFAL 2MNWA 2H9GB 4M93C 4OKDA 1A3QA 1MUJB 2XJKA 3KXFB 3QQ9D 1MIEL 1RIHL 2FQGA 3IDMB 5DJ0A 5GSRA 3NIFE 4YMPA 2X70B 1C7SA 1FLRH 4ZUVB 5EG6C 2IGFH 3MLTA 3CHXA 3F2LA 1JYWA 1CD0A 3IFLL 2Q7SA 4P2OB 1U0QA 2LVCA 3CXDL 1NIBA 2OMWB 3T2PA 1ZWIA 2NXYD 3W9EA 3ARBC 4F15C 3K8KA 4FD0A 4P23B 1SJVA 9PCYA 1OWWA 2IO5A 4N90E 2BRRL 2FQDA 4L23A 5A7BA 4OBRA 4XN9A 1P53A 3MO1B 3OAZK 4OKOA 2LU3A 5BZWB 1HDMB 3VUAA 4XP4L 1WFOA 4DNLA 2ADFH 2V3EA 3DJTA 3GK8H 3RHWF 2DQMA 3MV9E 3HN8A 4JANB 1WH0A 3CN1A 2G9KA 3LRHA 1AI1L 2NY6D 1XRYA 5KSUB 2XVGA 2YR3A 4NGHL 1S8DB 4W9DC 2EDJA 3FB8A 2E7LA 1F1GA 2F7PA 2ZOOA 4RISH 3C87A 2H2SC 1QZNA 3O2DH 4O02B 1CQKA 2DQEL 2HFFA 1FNFA 4PS7A 3SO5A 3O81A 1UXSA 1W72H 2E6QA 3UG5A 2FRGP 1NCOA 1XZ0A 1GCFA 1KXVC 5E2TL 3UCQA 4CC1A 4AB7A 3FCSA 2UUDH 3G5XB 5KVEL 2CKBB 4U1LB 3UAJA 1RZJL 2X4SA 4GW5A 2NT1A 2P5PA 4XI5D 1TSRA 3U4EB 3MLXL 2EDHA 1UACH 2K7PA 2NUTB 4DO4A 1R5WA 1GZQA 4RMQA 2F5AL 1AHWC 3LNHA 5E6ID 1GYWA 2PCXA 4GRWF 3FO0L 1WS8A 1OSYA 2WVVB 3TV3H 3CDGB 4IIQB 3EYSL 2QLYA 1ZSDA 2ICWI 4FHJA 3LXUX 3KLHC 3B2DC 4KRPC 2YSTA 1E5ZA 3O3AB 4HWZA 1TIUA 2FR4A 4AG4L 4K3JL 2ZCKL 4XX5A 4GQ9L 2HX7A 5GS0C 1S78C 4JPSA 4R4BA 4NP4H 3RPKA 3GEWB 5MENE 3DSNA 4CKVX 3TE4A 4LDCA 2ZOLB 3W39A 4UV7H 4PY8I 1S7UA 5DU7A 2DH2A 4LAJH 5EUOA 5I0XA 2R2CA 1V7NL 5JHDA 2FB4H 3QIBA 4LL1A 5ISZA 5J3HC 3DECA 1RIUH 2FVNA 2HT4C 1FGVH 4Z65A 2UXGA 1XH3B 1A7OH 1ET7A 1HESA 1B2WH 2HTLC 4BQ9A 1ZVNA 5JPNC 2VISA 2R1XB 2C9AA 1BQRA 1IFGA 2VN4A 1YY9D 3L9RA 4PJFA 3EO9L 1I8IA 3V6ZA 5C0DA 2NXZD 4YDIH 4FHKA 1EHLH 5EBMB 4EZKA 5B3NA 4OJCA 1CE6B 3FSOA 1IU8A 2POKA 1JHKH 3L4VA 5D1ZA 4JM4L 1I7TA 1DDHB 4IRSD 4X5XB 5PAZA 4BFNA 5EU7E 2DLFL 1NCHA 4CAGA 3O8XB 3CUPB 2P0WA 4ICXA 2OTWB 2ZF9A 1EAJA 4KOVA 5KZCB 3KBPA 5C09D 4UQ3A 5ICUA 2OMXA 4PSPA 3QEQD 3QZBA 4JRXE 2GJZB 4OCRL 2RQEA 4N0UA 2AMGA 4WAFA 4AY0A 4DF9A 1A7BA 3S6KA 5DSCB 1F5WA 4WDIA 4IIZA 5C0BB 4U7MA 1P4LA 4NQUA 1A9EA 2PJ3A 5EF2A 4WEUD 4JPWH 4P2OC 3S5LB 7FABH 3WAJA 2FVGA 3PEIA 5KS9E 1UB5A 3ARSA 5FOJA 4E0RA 1W0VB 3SYPA 2ZW5A 2Y6SC 1T21B 1FAIL 1IM3A 2VN7A 2WINB 4HX1A 4JKNA 3T2NL 4XPFL 1KULA 2NY7H 2XQYA 3D12B 5IQ9A 4ZI8A 2QDWA 1GC1H 2ICEB 4OFDA 2X4OB 3IPFA 5I2IA 2CZNA 3B8YA 1R5IA 1MCHA 1IGFH 4ZXBB 1BM3H 4HXAL 4PWEA 5C08D 5C1MB 5FECB 4AZ8A 1ZVYA 1FIGH 3KYMB 5DEGA 2YQ3A 3DR8A 3K7UA 2K3TA 3NCXA 2CDFB 4GKZA 3V6BR 4ECNA 3D1MC 1CF1A 2ODFA 1G1CA 3WTTA 5AKSA 3VXNA 1JZ8A 1MCDA 3MN8A 1NBQA 2A0LC 1KGWA 5FEBA 1T0MA 1F58L 1K4DB 4P5SA 2HZHA 2ICWJ 3THMH 4WF7A 4KSIA 1UB6A 4K23H 1F18A 4TMPA 1CFMA 4CYPA 3APFA 2A9ML 4R4ND 1SXSA 3FX6A 1AE6L 3EG9B 2YNEA 4UT9H 1AD9B 4JG0L 4N87A 2KH2B 2XQYG 3FO9B 1J0ZA 3QJVB 1IARB 1JZGA 1B0GA 3UYRL 3R4RA 4PY8J 3LKRA 4P59L 4Y4KD 1QPPA 4L3ED 5DJXB 3HE7D 4ZYKA 5I8OL 3FOLB 4D94A 3I6GA 4UBRA 1RU9L 1FC2D 4PJ7F 1G5AA 1MFDL 1HQRB 4TUOA 4FADA 2ZX9A 3PWNA 5K9JL 5TF1H 4MCQA 2WUUA 2CU9A 2X9WA 3ZDXF 1IGCL 2AEIT 2YHGA 2D4FA 5GGRA 4AG9A 4YS4A 3RA7H 3HG5A 3OTTA 1NMTA 5AWNH 3P4OB 5JW4N 4BFOA 2EE9A 5FGBC 2I5YL 5JPHA 4NNPL 3HG1D 4IBSA 5F9WB 5GISL 1PEWA 1A22B 4H0HB 1U3NA 3VU2A 5LKNA 2CO6B 1IGIH 3IFNH 3Q2WA 1MN4A 2P8PA 4MLSA 3S3DB 5ITFB 2R29A 3ZKMC 3JRUA 4L8DA 4O2EB 4OLZH 4V2CB 4DN4L 4OR1A 2AF2A 1I8UA 2MJWA 5IJKC 5DWPA 3C6LA 2VR7A 3RYMA 3PDDA 5L0QB 4XNYH 4HWNA 4Z23A 4YU9A 4AMKH 4R2GB 4JM0A 5KYYB 5CINH 1QR1A 4H1LG 3D85D 1G4RA 4APXA 2DQGH 4WW2B 2WXMA 3DTDA 4FFVC 4ODTL 1MZZA 5FO2A 1KENH 3KR4A 3DIFA 4H8PA 5BO1L 2BJML 3QSKB 4PRID 2RFHA 2E76C 3ZRFC 5I9QC 1CM0A 1Q2CA 2NSQA 1YVKA 3C5ZC 1IEAB 3AU0A 3CXSA 1OXYA 2BIHA 2JK5B 3P77A 4LHJB 3O8XC 4WHCA 4XOBA 3EY5A 2RD0A 3BO8B 5A2LH 2ZUSA 1ZGLB 1L9QA 5IEKB 3TFBA 1MRCL 4L5FE 4EZLA 2UV3A 1BZ8A 3MVSA 5JPMB 5DJ2A 4WY7L 4QTIH 3CAFA 3BUIA 4C83A 1XFOA 2WWKO 4HC1H 3T0ED 4HULB 1YC8A 5EF0A 2ZKYA 3C2SA 5HBBA 2HP4A 4MJ8A 1ZLVH 2CMRH 4OM0L 2H1PL 3KJ6L 1KXTA 2IXQB 4DTGL 5A2JH 3K5SA 3G6JF 4Z7AA 4IOIA 5CKAA 1NUNB 4QRSA 3GSNL 4K3DH 3CVHB 3KH4A 4KO9A 3QIUD 4X80H 2D2OA 2ICEC 3G6DL 4ORGB 5C0ND 1RZKL 5AQ0A 1XCXA 1EO7A 1U8LA 3G5VA 4ZXBC 4IF5A 2BVYA 4KRNA 5AW5B 3IF1A 4ZOBA 1CDBA 5BRQA 5ANHA 4EVNA 5DC4B 1JK8A 2DQHL 4ZI6A 2BHFA 2FJFB 4FKKA 5CIPA 2G4EA 3ZHNA 1W8EA 3E1F1 3AQXA 3TCTA 1RPKA 3ZY7A 5IV2B 5D29A 2H9GA 3T6WA 1MUJA 2OMZA 3KXFA 3GTVA 4ZY0A 3O4OB 3KYKH 4LSUH 1CPSA 4K9JA 1O75A 5C70A 1YN7A 3FCTB 3WCYA 3VE0B 3ZKND 3GBML 4G8GE 4MB4A 1RJYA 4W4OA 4ZUVA 3SGKA 4JFSA 4QLRA 5A6MA 3QORD 5E6SB 2R4RH 3RX7A 4LU5L 2E4TA 2LR4A 2NTSP 1GPOH 4JO8A 4XOCA 1FNHA 2OMWA 1ITCA 1F56A 1FAKT 2HLFC 2Y07H 3O4LA 4IRJB 4FD6A 1OTSD 5F7KC 3ZJAA 4EDXA 2P5WA 3B9DA 5EC1A 5LBSH 1FAIH 1I3VA 5EBWA 4J3TA 1UA6H 1J1PH 1NL0H 3E2HC 4JKKA 2D9QB 4X0KA 3H53A 5BZWA 3NIGE 3B7YA 3FB7B 2OW6A 4HDIA 4OLVL 4XE5B 4C56A 3PQYB 3IKCB 1P84K 2O1AA 3U0WL 1YNLH 3LPFA 5GSVA 3CK0L 3FU7B 2J8MA 3QAYA 5C0CB 4OD2B 4PLOB 5KSUA 2HN7A 1EJ8A 1ICTA 4BGDA 1PYWB 1UFUA 3NCJH 1MVUB 4IKJA 3B2YA 4JR9L 5CM1A 3ARWA 4JQVA 1BBJB 1IICA 5I1KH 3F7KA 3Q6FB 3FQRB 3QS3A 4MX7B 2B1AL 5IHZB 4JREB 3SBWC 5HYJD 3BWUF 4MNGE 1HXKA 1LEKB 4L4TE 3VXMB 4IKLA 3WNJA 3PGFL 4FQLH 2R2HB 4DNCA 4PJBB 5CJXC 1BF2A 1QYGH 1QSVA 5D9SB 1A8ZA 3MZTA 4HFUL 4R2GC 1LEGB 2EDKA 1NFKA 3AACA 1IVTA 4K2UH 4KVME 2WVVA 2G30A 1KJ2B 3VM7A 4IIQA 2BFVH 5IM7B 3VXPA 3FH7A 3TJHC 5EEYA 1P0SE 4FQQA 1GJIA 1BLLE 3IFOB 2N3JA 3S3CB 3SE6A 1MWAL 2P5EB 5DJ6B 4A2MA 5CLYA 2CA3A 1JPGA 2OA9A 4ZMTA 1CICA 3K4DA 1RULH 3BAEH 3STZB 3ILPB 1TFPA