4B6ZA

Crystal structure of metallo-carboxypeptidase from burkholderia cenocepacia
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
382
structure length
380
Chain Sequence
TLSITSNFDAGAIDVVSCDSPDAIRLRVRGDNRSEFAQWFYYRLTGARGERCVMTFENAAECAYPSGWRNYSAVASYDRVDWFRVPTTFDGKTMTIDHTPEFDSIYYAYFEPYSEERHAAFLGAVQQLPQASVVELGRTVEGRPMSLLTLGTPETAPKKKVWIIARQHPGESMAEWFVEGLVKRLAGWGDWAGDPVARKLYDRVTFHIVPNMNPDGSVHGNLRTNAAGANLNREWMAPDAERSPEVLAVRDAIHAIGCDMFFDIHGDEDLPYVFVAGSEMLPSFTEQQGKEQTAFIEAFKVASPDFQTEHGYAASKYKEDALKLASKYIGHQFGCLSLTLEMPFKDNANLPDERVGWNGERSAALGAAMLAAILVHVDTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FAMILY M14 UNASSIGNED PEPTIDASE
publication title High-Resolution Structure of the M14-Type Cytosolic Carboxypeptidase from Burkholderia Cenocepacia Refined Exploiting Pdb_Redo Strategies.
pubmed doi rcsb
source organism Burkholderia cenocepacia
molecule tags Hydrolase
total genus 140
structure length 380
sequence length 382
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
A PF18027 Pepdidase_M14_N Cytosolic carboxypeptidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3120 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4b6zA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4b6zA02
2PJAA 2V8HA 3DGVA 4TNUA 4R76A 3KASA 4P4EA 3KGQA 3V38A 4FUUA 2PIYA 3PFOA 1NSAA 2V8VA 6CPAA 3B3WA 1F57A 3D67A 5K8PA 4ZX9A 2PJBA 4OKOA 1DTDA 5LRGA 1M4LA 1FT7A 3CPAA 1VHOA 1CP6A 3KL9A 4OP4A 3H8EA 3NH5A 2DEAA 4X2TA 1R43A 3MN8A 1CPXA 4ZY0A 3VARA 3KR4A 3CDXA 4YWYA 3TX8A 3VATA 1JQGA 3DLJA 2CTBA 3LWUA 4ZX8A 5LYDA 2EK9A 3SJEA 1KWMA 4KSIA 1CX8A 3IIBA 1BAVA 3CPXA 3PB9X 3KQXA 4PQAA 1LANA 3T8WA 5K8OA 4NGNA 2ZOFA 5IB9A 3NH4A 1XBUA 8CPAA 4UIAA 4R6TA 4ZI6A 4P4BA 1BLLE 3PB6X 1LAPA 2PJ2A 3BI0A 2XEJA 2Q4ZA 2AFSA 3GB0A 3S9LA 4OIWA 3SJGA 1XJOA 5K8MA 1ZLHA 4LQGA 3RZAA 3NA6A 3B7IA 3D4UA 4TWEA 5JM6A 3WC7A 4A39A 2RFHA 3GLJA 2AFWA 4ZYQA 4DYOA 1YMEA 3BHXA 4MRIA 3QNVA 2PJ6A 3FF3A 4ONWA 4P44A 4DJLA 1ZG7A 3CT9A 4PXCA 3B3SA 3SI1A 2POKA 2ZEOA 4ZY2A 4P6YA 5K8NA 4PPZA 4X3RA 5THWA 1Y0RA 1DE4C 1LOKA 3WT4A 2PVWA 3SJXA 3S9NA 3D7HA 1VGYA 5J1QA 4EWTA 5LRJA 2PJ4A 4PXBA 2PJ7A 4MCPA 4NGSA 2PJ0A 5ELYA 4JZ0A 4F9VA 4R8FA 4BD9A 1Q7LA 1RTQA 2GLJA 1TKHA 2XEGA 2GLFA 1GYTA 2AFMA 5CPAA 4ZY1A 4DUKA 2PJ8A 4F8ZA 3L2NA 1YSJA 3IO1A 2QYVA 1YW4A 3D66A 3IEHA 2PJ1A 4A94A 1IGBA 4OC2A 4FWUA 3FMCA 3FECA 1Z5RA 1XFOA 3B3CA 5HXDA 4JYWA 4FAIA 4IAVA 3PBEA 2XEIA 1CBXA 1ZG9A 4PXDA 2ZEHA 2EK8A 2PCUA 4FBEA 2IJZA 2RB7A 2ZELA 2J9AA 1PCAA 3IWWA 3D7FA 3PFEA 2ZOGA 5HVFA 1CG2A 2F7VA 3TC8A 1ARMA 1LCPA 1ARLA 1F2OA 2AFXA 5HVHA 3WC6A 4GM5A 2VL1A 4OC4A 4OC5A 3I1UA 4F9UA 1ZLIA 1ELLP 4YU9A 3B35A 3D7GA 2ZEDA 2OOTA 3PRTA 4MHYA 4P4DA 2F8HA 3KI9A 2PJCA 4EMEA 4MCRA 3LMSA 4NGQA 5F09A 1AMPA 4NGRA 2AFZA 2NSMA 5LYLA 1YLOA 1UWYA 2AFOA 3RAMA 3SI2A 2ANPA 2JEWA 2C6GA 3WABA 3ISZA 1TF8A 1TKJA 4UEFA 4MHNA 1TXRA 3PBBA 4Z65A 3KQZA 2C6PA 3D68A 3BI1A 4P10A 4OC3A 1ELMP 1CPSA 3B2YA 4UF4A 3SI0A 2C1CA 2ZENA 2HB6A 2JBKA 2ZEGA 3HUVA 5D29A 4AXVA 4NGTA 5JH9A 1TF9A 1F2PA 2PE3A 5I4MA 2CTCA 3FVLA 3PB8X 2O53A 2ZEEA 3B3VA 3ISXA 2WZNA 2V77A 5LYFA 4H2KA 2V8GA 5LRKA 4Q7AA 3GUXA 2O4HA 3RBUA 4P45A 4RUHA 1Y7EA 2CF4A 4X8IA 4R7MA 1XRYA 3B3TA 1HEEA 2QJ8A 4MHPA 4WJBA 2PJ9A 4MXUA 3FX6A 3KHZA 1HDQA 3KZWA 2CIJA 2PJ3A 2ZEFA 4MCSA 1Y0YA 4NJQA 2PVVA 4EFDA 5JGFA 2IQ6A 2G9DA 1QMUA 3K9TA 3FEDA 2JBJA 4O23A 3SJFA 3PB7X 3HLPA 3MRUA 4MCQA 1Z8LA 1HDUA 1LFWA 4UEEA 2GREA 1VHEA 3JRUA 5LYIA 1FNOA 3H8GA 3S9MA 4NGMA 4NFRA 2C6CA 1Z2LA 3VH9A 1VIXA 4NGPA 2PRQA 5HVGA 1R3NA 2WYRA 4IHMA 4WWVA 1YW6A 2EWBA 4A37A 3FJUA 2ZEPA 2I3CA 4MHZA 4PXEA 2BCOA 4UIBA 3IC1A 1BPMA 4OC0A 4OIDA 1TKFA 5DS0A 2ABZA 4P4IA 4W9YA 1EE3P 4OC1A 2ZEMA 2FVGA 5D8NA 2BO9A 4G1PA 3PEIA 3KR5A 2BOAA 2QVPA 1H8LA 2PIZA 4P4FA 4A38A 2XEFA 2AFUA 2Q43A 1AYEA 1BPNA 1XMBA 3PB4X 1ZG8A 3FH4A 4OMEA 3NH8A 4P4JA 2HC9A 4B6ZA 3FEEA 3V7ZA 1LAMA 2NYQA 2Q51A 4MMOA 1CP7A 4K3NA 1PYTB 4UEZA 1IY7A 3K2KA 4IK2A 3WC5A 3IJ3A 3NFZA 3N5FA 2GU2A 2V8DA 3KHXA 2OR4A 3H8FA 4NJRA 1QQ9A 3BXMA 2PJ5A 5CBMA 3IFEA 1OBRA 7CPAA 4CPAA 3D7DA 2IMOA
chains in the Genus database with same CATH superfamily
1XL4A 4X6EA 1WFMA 2L0DA 3HRZC 2DI8A 1DQMH 4M6IA 2SODB 2C1PA 1SM3L 4Y4KB 3ARPA 1BZQK 2DMCA 2EDNA 4GS7B 4P5TC 1KWGA 4A31A 1J0HA 3ARXA 4ZPVA 4KKLC 9CGTA 3BKYL 1IC5L 1CVRA 2DKUA 1F4XH 3JV0A 4MB3A 4OZFA 4LBEB 3TT2A 4K3JL 1N2RA 3QQ4A 4IMKA 4BQ8A 2FT0A 4MBOA 5DJYB 5E96A 2GJ6B 1NEUA 1TKWA 1UVQA 3EYSL 3AB0B 4OLWH 2AJSH 4LP4A 5I15L 4HUNB 3GIUA 4XBPA 3VFUA 1NSAA 4A7UA 2GSIB 4YC2B 2EIJB 2F7QA 3UBXG 3CK0H 4M4PA 4UIKL 5BRPA 5IEKB 1BQRA 1F57A 2FEDC 5GGUB 4JXQA 1A7OL 4DETA 2X0WA 3BCFA 5E6ZA 5FM5M 1WK0A 3LQZA 1N71A 5LRGA 3WIHH 3WY4A 1AQMA 3D69B 1X9LA 2X3AA 5L0QC 5EUOB 5IMKA 1MZYA 4PGBB 3ENEA 5B7EA 1CL7H 3GT6A 4HKZB 4M7LT 4DKAA 3WMQA 1QW8A 4POZD 5J5EA 4UM9B 5CIPB 3DO7B 1KCWA 4KH2A 2EYSB 4R84A 5AB0A 2W9DL 4AQAA 2NY4D 3B6SA 4S2SB 3V0WL 5KJRL 2P8LA 2XPZA 1KELL 4K4KA 4FADA 3SCMC 3G5XA 4N8UA 1SF3A 4G8EB 5CM1A 3CDXA 3C5ZA 4BXSV 4FKEA 5ERWB 4DNCA 1ZA3A 2AQ1A 4BFOA 3HNTL 3L8QA 2X6BA 4ODXB 5ABZA 2FLBT 4N3TA 4ZX8A 3RTLA 4PS4H 4P23A 4CAWA 2LFEA 4JLRA 4JFZL 1TEFA 2YMOA 3VTAA 1JFHA 2BVUA 4NP9A 3BXNB 4ZD3H 2V2XA 2N7BA 3NCYS 4QHKJ 2IMNA 4F3FB 2YAMA 1MK4A 4IBZA 5D55A 4NHUA 1ND0B 3FTVA 2X4NB 3OQ3B 4IW4C 3TBBA 3U9PH 2WQUA 5I0CA 1PAMA 5CBEB 3F64A 2CD0A 3TEWA 3OX8A 1E4KA 1A4JB 2UZIH 1IOIA 4HLZH 1Z5HA 1X6NA 3OSKA 5FA3A 1CLCA 5K9JH 4KMQA 3V55A 3ARZA 5BXFB 1W6LA 5I1EL 2BNRD 2IVFC 4BINA 2JV6A 1IGMH 4OZGB 1P69B 5CP7A 3E8VA 4WY7H 5FHBL 1U8MB 3UTOA 4ESKA 4AYFA 1MFMA 2Q3ZA 1DVZA 4H13C 1JGEA 1X9UA 2OTWB 4RMQA 3L5IA 3QFDB 3LD8B 4KI1A 4OFKA 1FO0B 1Q94B 3G6AA 3SSGA 1WFOA 1BOGA 1X5KA 1G7PA 1NMCC 3V4VL 4N9OB 4A7VA 3DX1A 3STBA 3UC0L 3DV4B 5KG9B 3MRIB 2P44B 2E9IA 3DI3B 4XAWL 2QKSA 3DVNB 4AC4A 2PJ6A 3NJVA 3DJRA 4I89A 3TVMA 3IE9A 1WS8A 2WXGA 4MTMA 3HRZB 3L5JA 4P6YA 5FM8A 5K69A 5C09B 1B6UA 3QEGH 3UIZA 3QDGD 3LNHA 4FI8A 2NY1B 4M7LL 4P07A 5CZXD 4R2GD 4WU7B 1ADQA 1DBBH 2A9DA 1S7XA 4HW6A 3FOMA 3HE7D 4WSGA 3AU0A 1P6WA 5HHVH 4FNPA 4UZUA 5C0CA 4XNHC 1YYLH 1IGIL 2CNYA 3OKLB 1UYWL 2VAJA 3JVGC 3VXUE 4ELKB 4H6UA 2EIZB 2XWTB 4GEIA 3FBKA 5LDSA 4ZAKB 3Q6GL 1E9OA 3N85L 1KY7A 3UC2A 5D7IB 5JIPA 1QR1B 3PHOB 2GCYB 2Z3KA 4JRXB 4BH8B 3VM7A 5IB2A 2XLLA 3DIFB 3VGHA 1QBBA 1IB1E 4GO8A 4KMLB 2Q4VA 2FO1A 1BBJA 3KLLA 5I74B 2GLJA 2QQKH 1DBKL 1UATA 3PV6A 3WEOA 4DJMA 3C2AH 1VA9A 4W4NA 1C16B 1F90L 1I3RB 2IH3B 3QZNA 2O5YL 1CXLA 2DBJA 3KGTA 5DRWB 1KXQA 1JZHA 1YJDL 3HJ0A 3H3PH 2XQBL 5THWA 3K6SA 3BAEH 3WU1A 1IM9D 1XB3A 1MJ8H 3N44B 5GGSA 2D3LA 1FVEB 2COQA 2P5EE 1XGRB 3T0XA 2FGZA 5LBGA 4AG7A 3FMCA 3STZB 2C9SA 2ADGA 1TOXA 4XMZA 1AQDB 3BWUC 3KHOA 1HL4A 1YMMA 3MRKA 4UT6L 4XO8A 3MCLH 1IAIM 2WXJA 4POUB 5CZVH 2I9LA 3OB0H 4LSVH 5F70A 4BBWA 2BOCA 1X6LA 3BP5A 4N87A 5AB9A 3ALXA 3GUTB 1HKLH 4HHGA 1TENA 3IF1A 4HQQH 5D1QD 1OSZA 2IJZA 2RB7A 1P9MC 1CD9B 4OGYL 5AW2B 4NQCB 1THAA 3QQ3A 4OCWL 1XB6A 4X9YA 2A9AA 1FVCB 4XTRD 4BCYA 3GHBH 4N6RB 2BOLA 5INCA 4Z7OB 3BGFC 1Q0XL 4G80A 2NY3D 5C2UB 4ABQA 3IDGB 3MOQA 3ARYA 2J73A 4PAZA 4GUOA 1T1WA 1ARLA 2Z3LA 5HDBB 4RFNC 4FG0A 4ZUTB 3HN3A 4PJ5E 3MTXA 2P52A 4MDRA 1BCIA 1E4WH 3WUWG 2N1KA 3APFA 4N0YH 3MREA 4YQXH 4ORZC 5DHEA 1Y07A 1L0PA 2V5MA 4NKIL 4PBVC 4NQDB 1TT6A 2E86A 2ZJSH 3X1FA 4JFQB 2F18A 3WGUB 3F58L 2ZOKB 1LO3H 3IXTA 4LVOC 1H8SA 3VXMA 3D0LB 5ENWA 4EVNA 2AI0L 2VLRA 2DAVA 3KAAA 3QSKB 1I8MA 5JHDA 1TNNA 4G9DA 1YEEL 2G5BB 1XF4B 3KYKL 4MD4B 4FQHA 3T2OA 1BFVL 5DK2A 3WAKA 5KSAA 1N8ZB 4NI3A 5F46A 3NJGA 2A9BA 4KJQC 2X2HA 1JPGB 4U1JB 3VWKA 3FOLA 1T21B 6CGTA 4XWGL 3WFCH 1KCLA 4R7NA 3U0PA 2AEQH 3JTSB 2VL5B 5TQ0L 3V5DA 2ESVA 1MI5E 3SI2A 5I1CL 2APVA 1KGIA 4XPFL 4OGAC 2HPTA 4MXWH 3RZCA 2R29A 3SKJH 1FL5A 1NFKA 2KDGA 1S5KA 2GFBB 5HDQL 3CD4A 3QRBA 3MSPA 2WUUA 4U1LB 2CUHA 4Z65A 2MNJB 1MCQA 3MLVH 5D1ZD 3SPVB 3QCVL 4N9GB 4WO4A 4WIQA 3D07A 3LN4A 4UF4A 3EAKA 4L3CB 1IFRA 1DANU 2J72A 5BS0B 1A4AA 4N8VA 4KTDL 3S3JA 3UJTH 1NFDF 4CSPA 1CFSA 4X4YB 3VQ2C 1C5CL 3MLZL 1QSVA 1ZLWK 5D2LA 1FY7A 1MOEA 2SEBB 3ASNB 4OTXH 3CXFA 2V7NB 1A8JH 3CDGA 3MNVB 3UABA 1J0IA 4KTYA 4B11A 4LSDA 4XNDA 4F7EA 2WINA 5JZ7D 4HT1L 1G7MA 1TCMA 4JQIA 4JCWA 2AAAA 5D7LB 3HBQA 4E42A 5HYSG 1LEGA 1W72A 4LE8A 4XVJH 4MHDA 1IGFH 1U6AH 1S7LA 2DQHL 4IOSD 4YUEL 1JXFA 4NN6C 1I85A 4F15C 3TP4A 1PZUB 2FWUA 4PLKC 4KITB 3AXLA 5HJBA 1B9ZA 3P11L 4E5XG 2F8IA 5IG7A 5DJDA 2IPKA 3NJMA 3D6GA 3PWVA 1NBVH 4N8PA 3T3MB 1AXIB 3IU3B 5EC4A 3ZY7A 4BDVB 5J3HD 1FNEB 3E3QE 2B3UA 2PLTA 3EZJB 2CIJA 4I8DA 4W1TA 4NBYB 2LV4A 1TZIA 1LK3L 1AKJB 5AVTB 5DYOA 3MBXL 3UO1L 2J8UB 5DQDL 1A1OB 1NOLA 2Y24A 2OL3L 4N5UA 4P2OA 3MV01 4KDTA 4NQSB 5K33A 2K6WA 4DZBB 3KKWA 1DCEA 1IAOA 4UM8A 1RZ7L 4O23A 1KTJA 1ORSB 4OZGF 1FLTX 3DVFA 3I6LE 1MUJB 2BLFA 2G3MA 4FXGA 2OMYB 2E6JA 3QNYB 3CC5A 4I87A 4LVOB 4Q4IA 5DWPA 4F27A 1N9PA 4BZ2L 4CA4A 4NEXA 3B2UC 4G6JH 3THML 3F84A 5BPPA 2ATRA 1MAJA 4Q4EA 1ZY9A 1FFPB 1JNHA 1G6RA 3QNZA 2D7OA 2G60H 5EIIG 4QHMB 4XPBL 4D0CB 3SDAC 2GT9B 3WTYA 2GEEA 4AE1A 1UXSA 3MV8B 4PXEA 4UIBA 4NSKA 4Z0BH 5I6MA 4ZSOB 2R15A 3MZGB 3ALPA 3JTBA 2C9PA 1UCBH 3IJEA 4QRPB 1YEDA 4J4PC 3D8PA 5FOBB 2VXVL 3VH8G 1WFTA 1XBDA 3QIUB 3CUPB 4F33B 4FNLH 1IILE 2X1QA 1OAZL 4DVBA 1J8HE 4LSUH 4PWIA 2XN9A 4MVBC 3NSDA 5CJOH 3MOAH 1P4NA 2C5DC 4UTCA 1OGSA 2OR8A 4LQFL 1NWOA 4WV1C 4RGOH 3AREB 1KLGB 2HKFL 2R4RH 3KWWB 3L9RB 3QHZH 4GT0A 5D7IF 5J7CC 3WJLC 4PLJC 3QORD 5ILTH 1CF8H 3SN6N 2F68X 3EYQC 4BUGA 3PG2A 5HGHB 1FHGA 3UGXA 5HSFA 1SBSL 3TL5A 3VWJD 3TYGH 1MVUB 3EYOB 3TA3B 1HT6A 1A47A 1AZRA 1RK0B 2WXRA 3JWNG 1FZOB 1ULVA 3CHXA 2B9AA 4WTZG 3F7RA 4LSRH 2GUYA 3BFOA 2ZKHH 3SGDH 3N44F 4G7YL 4Z7UF 3EIFA 3RJOA 3UMNA 3RKDC 4JHBA 2FO4B 2FE0A 4H8VA 4B9PA 1QQ9A 1U3NA 2WNGA 2PJ5A 4NJ9H 2OKMA 4F6AA 4HCGA 5F3BB 4GKZB 4MDJB 4A2EA 1BOBA 4K2UH 3M1CA 1MHCA 1BYNA 4CJ0A 4DP2X 2RCSL 4UBDD 2YEZA 4LBEA 3VD2A 4N68A 5DJYA 3ISRA 1QATA 4R76A 3MR9B 2JKSA 2FIWA 3L4XA 3O2DL 2H2SD 4X7DC 1MFBL 3NABH 4QY8A 4FCAA 4G8IA 3D05A 3ULUC 4GKNB 2VDQL 3RFZB 5FO2A 4CYOA 4Q6IB 1NFDA 1B2YA 1OOWA 1OO2A 4Z7OF 5JW4M 1P7KB 4JM0A 2ARJA 4E9VA 3RGBA 3SYAA 1QD0A 4MKTA 4JFHE 4K8RL 4L0PB 4PGBA 5HDBF 1CICA 4KDWA 3UROR 1PEWA 1XF3A 3DO7A 3GFUA 1SJHB 4GOSA 4MJ8A 4FQ2L 1SDYA 2J6EL 3ABMB 4S2SA 2PTUA 4XMLL 3NDZE 3H8EA 5KVGE 3C6LA 1MY7A 2BHFA 5F1NB 2F19H 3HC4L 3QEQE 4NNPL 3KW8A 5IHWA 4XPDC 5SX4I 4G8EA 3MGTB 3B2DC 2Y6SD 4FZ8L 1OTTC 2OMXB 5E2TL 5E6ID 4Z6AT 4OJCA 1TYRA 5DFWH 3WKMH 2QPSA 3SDAB 3C6SA 1V0CA 1E2WA 2IXQA 5FYKL 1J86A 2AQRA 1JVLA 3U79A 2I9TA 5AKRA 3T2PA 3VWDA 2F53B 4IRZL 3K4ZA 2GHZA 5FEBA 2JXMB 1S7QB 1A6AA 4YFJA 3ZE1B 3HI5L 3B9KC 4F3FA 4YXHH 1WWZA 2BVYA 2PXYA 4YHZH 2IQ9H 5GJTH 3C5XA 2X4NA 5JHLH 2R9HD 3F3HA 4W9ZA 5ICYA 2G3TA 5CBEA 2ZXCA 3BUDA 1IMHC 5DZAA 4HHAB 4JO4H 5C6TH 5LN8A 4C4BA 5IJCC 5IUCA 3WFDH 1UUNA 2IDSA 3Q5OA 5HGDB 1L5GB 3AS2A 5C7XH 1A0QL 2VDLB 3A22A 2OZUA 4TSBL 2DQTH 2R2EB 3NCXA 1I7ZA 4H6ZA 2QELA 2R1YA 4C56D 4OZGA 3H54A 4HFWB 3EDJA 1TZGH 1U8MA 1A6UH 5HH1A 3HC0B 1TVDA 2B3IA 2DIEA 1BJ8A 5IWLC 2YD1A 3GSNL 4AJYV 5I1KH 1Q94A 5BRQA 1U91B 4RWHA 4OIWA 2BINA 4JXRA 2Y2WA 1TU2B 2OMVB 4LEOB 4X5RA 1LDPH 2AE6A 1T4KB 3L1OH 3MA9L 2P0WA 1PD0A 3DV4A 3O6FA 4UTAA 4K7PX 4LCIL 5AOJA 5SWZB 1QSFE 3DPBA 3ULSA 1S7FA 3DVNA 3ZBMA 2DH2A 3T08A 4F8QA 3ASOB 4NKDB 2NX5E 3DJZA 3NFSL 2YAFA 3SKOA 1CGTA 4GAJH 4GP4B 2OLDA 4LQ6A 2IGFH 4UINH 3TURA 1AXSB 2NYYC 3H9YA 3QXDB 4JFSA 4XP4L 5IB4A 5C09A 1I21A 4DJLA 1IC7H 4WI4A 4UCNA 5AENA 1R57A 2IIJA 1A9EB 4Q36A 2H32H 4KX8A 1ILSA 4YLQT 3TXAA 4UQBA 2QGBA 3GI8L 3OF6A 4AEHH 3RBSA 3E8UH 2QVFB 4JFED 3OKLA 4ZQTA 4C7IA 4EN3B 3HA0A 5I0XA 3LB6D 1BG9A 4ZAKA 1QUPA 3B1TA 3W37A 4XO5A 1QR1A 5I76B 3MA7B 2DM2A 3AVEA 3P9MB 5D6DA 3FRMA 1FGNL 4MASA 3T3MF 2IPUG 3AQZA 4KRMB 3DIFA 4MCZB 4G6MH 2XUWA 3IWEA 1L7TH 3CZUB 3PWPD 2PPCA 5EMYA 3U1SH 4YDIH 1T5WB 4P0DA 1C16A 1L0YA 1Q2CA 4AYSA 3I9SA 2J8UF 5E1IA 1E30A 4P9HC 5AALA 4KOUA 3B34A 4D0DB 5JOFA 1NMAL 3GSVB 4P4KD 2DW5A 3QDAA 3TZVD 4NOFA 5EUKA 5G55A 1N7MH 4Z7UA 2LTQB 5CMAA 4GBXC 4PJ5D 4ICWA 4TLTA 3MXVL 3OKDB 2FATH 4TYUA 4L8DB 3STZA 5I30H 2EICA 5DHVA 2CKBA 3Q7JA 4K9EH 3NACL 1OD9A 4GNKB 4PJXB 3ZE2E 4NKMB 2RAMA 3P30L 3BPNC 4B60A 5HJGA 3FECA 4ONHA 5GIRB 3R4RA 1ACXA 2WYTA 1KDIA 3MLSH 3B9KB 5FB8A 3GUTA 3D85B 3H9SD 5GRJL 1T89A 5I1HL 1LWRA 4NJAH 4B97A 5IW6A 4HS8L 5IUSA 1NEZA 2X88A 2XY1A 5ESQB 1NMTA 4HALA 4RQQB 1QFUH 5KVGH 4FBEA 4QD2E 1WJ3A 5LN4A 1T6BX 2CAKA 4HPSA 1FVCA 3QIWC 2WZPD 4ZMPA 4M6NH 4N6RA 5E1QA 4H88H 4FJZA 3IAGC 1QLFA 2ZCHL 1AIZA 1H3PL 5B38B 3Q06A 3UADA 4URKA 3CG8A 3JUWA 3IGUA 4YSTA 1V10A 3SYQA 2Z8SA 1K4JA 4NCC2 4OQTA 3UTSD 1QHOA 4ZUTA 1YSOA 3L3OC 3V6ZB 4PGDA 1WT5C 2COVD 5IQ7L 1A3RH 3CH8A 3T4AA 5HPMB 3FQTB 3IWUA 4JKPL 2X2IA 1R5IB 3OR7B 4PJHE 4JJ5A 1HCVA 1NGQH 3C5ZC 1W91A 2VL1A 5I6NA 1O7VA 4OC4A 1NPNA 2AK1L 5G4OA 1I8IB 2IH1B 2L4OA 1OIOA 2TRYA 3C6EA 2GIMA 4FLSA 4HK0B 4E8OA 4K5NA 4HWUA 4A6YL 3D0LA 3GXUB 3H3BC 4O02L 1A14H 4P23C 5KYXA 4UUJA 2JCCE 3P0VL 4M85A 2G5BA 4LLYA 4YDMA 3ZYOA 4MD4A 3BJ7A 1Q1JL 3FCSB 1YY8B 3O6KL 2BL1A 4PGCB 4XN2A 3RTQA 4AZ8A 5EO1B 2ZUVA 3LEVH 2J56A 4L4JA 1XB8A 2Y1YA 3H7LA 3NRQA 3E7JA 4UTBL 3FSZA 3H4HA 4D7BA 3IFLH 2EDKA 4NGRA 5AZ2H 4LUAA 4MMZA 4CVUA 2OSLA 2VL5A 4ZUUB 3WDHA 2NSMA 4NENB 3D39A 5TFSL 1L9MA 4JZNA 3LIZL 4DQOL 3BCDA 1I7UA 2VLKA 4HS6B 4XNMB 2ZOWA 4LCWD 1E6JL 1MCKA 4MNQB 2XWDA 3FU8A 4U1LA 4U1SB 5TE4L 5CLYA 5J0BA 3PF2A 5EC1A 2YUXA 4M29A 4OBRA 4PG9B 2ITFA 5E2WH 2QECA 4MHNA 1H8OA 4G1EA 3WHE0 2H26A 3VXPB 4L3CA 3P0YH 3B2VH 3V0GA 2F6AA 3CGTA 1R3LB 4RZKA 3RX5A 4X4YA 2B4CH 1QZ1A 3QJVB 4G7QB 4FAAB 4OLVH 1FLRL 3UPRA 1U3HD 1MCWM 5KAQG 2V7NA 4M62L 1XH3B 4GBXB 4HGWA 4NI6A 3TVMC 2FNWA 1DQQB 5D29A 4ZW5A 3GS7A 4FNUA 4UIMB 5ISZB 3QG6A 3OAUH 2CO7B 4GPVA 4OCSL 3PIQB 1BQLL 1AP2B 3BPNB 2MMXA 5I4MA 4M7KH 5AYUL 4HJJH 1YAIA 2CTCA 2X4RB 5BMFL 3D9AL 4M6HA 3PWNB 4GRLA 2ZEEA 2C9UA 4OZHE 5T3XL 5AVWB 4OZIA 4N5EC 2B2XH 1U42A 1IM9B 3CDCA 4HWEH 5L2KE 3K1DA 3O2WL 4KY2A 3RI5F 2PO6C 3VQMA 4S10A 12E8H 1HHHA 1YPZF 5E6SB 5I0ZA 3QFJD 1DQKA 3NQIA 2V8GA 3QIWB 2P5WB 4F20A 4PI0A 4M03A 1HWHB 3R9FA 1FDLH 1EXGA 4OFYA 5KEZA 3BKCL 2VTFA 5GZNA 3V4PB 2FQEA 1CQYA 5IF0B 4FLQA 4MAYA 4JG9A 4BDVA 3B3TA 2HLAA 1VFUA 4PRNA 4ODHH 4BQ9A 1W2KT 2ZT9C 4BE5A 4CU8A 2BHZA 4DPCX 3L3OB 4QB9A 3NZHL 3QDMA 5FX3A 4DPBX 5D1QB 3ZDYE 1AKJA 2AXFB 3GEWB 1KBGL 1CTOA 4RRPG 5E2UL 5C9JB 3KHZA 5C0AE 2AKRA 1A1OA 4P46D 2R8SH 2O61B 2G4EA 3TJEL 5I5JA 3UJJL 2ZEFA 2YGNA 4PV1C 2EDLA 3H8NA 5LG6A 4IF5A 2BZ7A 3R96A 1J8HD 3FQNB 4NJQA 2O5ZH 4AV0A 1AGEA 1ORSA 3GO1H 1Z9OA 2F5AH 5DZLA 2H8PB 4YHYC 3T2LA 1KXTA 3GM0A 3HHSB 3REWA 5G4NA 3EKCA 3VRIB 3NOIA 3PJLA 1E9PA 4FLRA 4FQCL 4JDTL 2RQ8A 3MRUA 5JIQA 3CNKA 4GUPA 4KI5F 3BC9A 3VU1A 4B96A 3UIYA 1COBA 2MCPL 3ZTEA 4W6YB 2WUBH 4QHMA 1YQVL 2AFNA 4Y19A 3UTTB 4GW4B 1A6PA 2AK4E 1U58B 3MV8A 4XP1L 1I12A 4O51A 4HCRA 1R34A 4ZSOA 1S7SB 4WWVA 3SDDD 3LKQB 2Z92B 4QRPA 4LDEB 2VDPB 5E8NB 1KIRA 3GB7A 1J88A 3FFDB 5A2LH 4YDKL 4NGHL 2OJZL 5AVVB 2BW4A 2LU7A 3MCYA 3OXRB 1DSFL 3VQLA 1AO7B 1WZLA 3IETB 1XXFC 3GIVA 5DZPA 3SD2A 3FMGL 3LTVA 3OR6B 4II9A 1FBIH 5EU6E 3PPSA 1XD1A 4EZJA 3BAIA 4IUSA 4G1PA 5DJXB 3FKUS 1E65A 1T22B 1OPGL 3WGVB 2I79A 1YYMH 2V8LA 3AREA 2QVPA 1UACH 4ODSH 2WZ6A 4MFPA 1T2QH 3ARRA 4U1NA 2VXKA 3GMRA 4PS7A 2P6EA 1FNLA 5HGHA 5A3ID 4CS0B 4I9WE 5GHWH 5IJVA 2AHIA 3GF8A 3GQFA 2Y1AA 2DXQA 2NY0C 2VM4A 2J4WH 2A99A 5CP3A 3HAEG 4YMPA 3EYOA 1KC5L 1XMBA 4R9MA 4PYHA 1RK0A 3CFBA 5HI4D 3ULAB 4YPJA 1L9NA 5DRNA 2Q51A 4QKXB 1NFIA 2WNKA 3ZJAA 2W0FB 1I7RA 3AY4C 3N06B 1HNGA 2P7TB 2HTKD 1JZFA 2A9MH 2VDML 2DQCL 3H7BA 3KS0J 4P5RA 5L8JB 4KTEH 4HUKB 2BZCA 3QEHB 1UXWB 3RY6A 4NNYA 1W0WA 1NUDA 1RXLA 2ZUUA 2C9AA 1N5YH 3QUMA 5D4QA 3TTHA 4MDIB 4PJXF 4RFEB 3RZCC 4HKFA 5BZWB 2IFFL 5JHBA 4OJYA 2WCPA 1XR8A 3Q0HA 2Y0MA 3LRKA 4PGEA 3OJDA 3HG1B 5AAMC 3VVWA 5LQBL 1LO0H 1QWUA 1SXCA 4WO4C 1OE1A 2DQIH 3MBWA 3TBTB 4PRPD 1BF8A 1MVFA 1T0MB 2P4AB 3O45B 4GKNA 1KIPB 1Q9LA 4A7GF 4PVNA 4N20A 3AAZB 3QUYA 4Q6IA 2REFA 5C07D 3DX6B 4O4YH 4QMEA 3PRZA 4CVXB 3KGQA 3V52H 1BECA 2NNRA 4OF5A 1R24B 3PAYA 3BO8A 3IXAB 1MFNA 4IRSA 2ZENA 5GS2D 2BNQE 3S37H 2F61A 1V3MA 2DICA 3PFOA 2R1WA 4QJ3B 3X14B 5CN1A 4QPEA 1E6OH 1WAAE 3IJYB 1SJHA 4F0YA 4H26A 2EXYC 4LARL 4DTGH 2I25N 1S4IA 3WD5L 1JP5A 1BFSA 1QSEA 1WUNT 2P8MA 5LCVA 5A27A 5HHQB 1RUMH 1OP5H 2QPDB 3COOA 3MGTA 3B5GA 3QO1B 5E1HB 3AJ7A 2D3VA 5E0FA 5C6WH 3VGGA 5A16B 4KX7A 4ZFZB 4QRTB 3I6GB 1GOGA 3CDYA 2E0PA 2H47C 5EPMB 1SLXA 3FB5A 2MHAB 3S48A 3UZVA 1YPZA 3B2XA 1RIUH 2XZAL 1XHHA 4M48L 4LASL 1BM3H 5EIVA 4DUVA 1IBGL 3ARVA 1WFUA 3K5RA 1UM6H 4RIRB 5T5NG 1XEDA 2IOMA 4N2AA 3VATA 2R83A 2ZOLA 43C9B 2WLYA 5HP5A 4HEMA 5KJ4A 3V5KA 4JRWA 3CZLA 3FO9A 4HHAA 1CGXA 2YD9A 4R4FL 4K3DL 3D2PA 2FIKB 2HG5A 4FHKA 4NDMB 3UYOD 3AWEA 2G9KA 5C0BD 1KYDA 1L5GA 2FJFA 1EUTA 5IQOA 2R2EA 4FMKA 3WIFA 4KOCA 1BWWA 5K8OA 1ODUA 4G8GD 2IWEA 4Q9RH 2OYLA 2EYRB 5JOPE 4HIXH 2X6MA 4FXGC 4GRMB 2VXQH 1JTTA 4FS0A 5F8QC 3R8BB 8CPAA 2NY0B 4FTVB 1SEQL 2OX5B 3AT0A 5JQ6L 1RJLB 5AD0A 1YN6B 1FNGA 5JHMA 3K8LA 1TU2A 2G30A 4FQ1H 3FW6A 2NXZC 1XCQB 1PUAA 1D5IH 4F7PA 2VXTL 3DI2B 5SWZA 4XN9A 2XIDA 5K8MA 4R96B 4M5SA 1ACYH 3DETC 3ZKNC 2XBDA 3QORB 4ONGH 4NKDA 1TZHB 3GKRA 4A39A 4L4VE 1NE9A 3K0YA 3HG0A 4IDJL 3I75B 3QXDA 3TTYA 3RL1B 3VWJB 2IADA 3VYPA 4Y8DC 3GINA 2H41A 1J1PH 4MXQD 3N3EA 1JPFA 5EORH 5GGVH 4ZYQA 1Q72L 1BD2E 3AITA 3EO0B 4IOIA 3F7YB 3GBNL 4ONWA 3WLWD 4P44A 4MJIE 4K8RD 4PCYA 3L95B 3WOVA 4NFDA 4BSVA 2ZKYA 1PLGL 3S34H 2BS9A 2DYPD 1H6UA 2CDEB 2H1XA 1JS4A 5C0DA 1JTPA 4WRLA 5IMOB 2BVQB 3HR6A 2FHCA 1YEIH 4PREB 4RVBA 4K3EH 4DIXA 1Y18A 3FTSA 3N40P 4LLDA 2A2QT 4MCZA 4U6YB 2ZWKA 3RDTC 4I48B 2AEWA 3BWAB 4QJ4B 3DVIA 5FYKD 4GG8B 2NXYB 3B9VA 1T5WA 5IHBA 4YDLC 2ADJB 3VXRE 5F89B 1PF3A 4NGSA 2XPYA 4ZTPH 3HPLB 3BZEB 3BP7B 4XMTA 5GJSH 5IFAH 1KLUB 4FGMA 5FV1L 1C1EH 1QUNB 1S3KH 3L4TA 4HJ0D 4JN1L 1Q7LA 5J6GB 4W9FC 4WNSA 5C3IA 4H89A 4PFEA 4DO4A 3F7QA 2V33A 1S5IL 5E8DH 1U2YA 4L9LC 2J20A 3S4SG 2BWIA 4ZY1A 1UHVA 3NP4A 4NKMA 2EDOA 4WFGD 1Y6NR 4ZTOH 4J5VA 1ZK9A 2XWZA 2VR5A 4J3BA 5F9JB 4HV8B 2KLSA 1BF5A 3BJ91 4QF1B 1R3JA 3Q13A 2DKMA 1F56A 2OI9C 5TF1H 3MAWA 3MBEB 1MJUH 2MKWA 3KHQA 1RJZA 3D52A 1PMYA 2KPNA 4XWOC 2XEIA 2JI1A 5FYJE 1U8JA 1MJ7H 2DS4A 4JKWA 4A7GA 4F58L 3QYNA 5IESH 3APNA 3QXAB 2K9FB 3M1BA 1KUMA 3VFMA 3OXSB 1MQKL 4RZCB 4OKVB 4K9JA 2EYTB 1CICC 1A6WH 4DNLA 4H20H 4I3GA 4EF3A 1NCTA 1V7NH 4YX2L 1QA9A 1SMOA 4TNGA 1GL4B 1X9RA 2X6AA 4I77H 5C71A 4X7SH 2NXZB 3WIIH 5M95B 2ZAHA 3EC4A 4UQDA 2E9JA 2ZUXA 3HMWL 3O3DB 3V4UH 1J9QA 3HR5A 1RLWA 2UXTA 1HIML 1VEOA 5JO5B 3CHRA 3ZDXE 2BNRA 3IKKA 3QPQC 2EVHA 2HH0L 4X8JA 2UY7B 3FQXA 5K59E 5IVOA 1AR2A 1ELLP 1IBHA 2BP0B 3E6HB 4QOKE 3VXUB 1EANA 4EI6A 4XBEL 1T7XA 5EEYA 4CGOA 5DJCA 4PY8J 1A4KA 4LHQB 4WDIB 3HS0A 1GH7A 1RAMA 3QPXH 3FPYA 5HYJE 4TRPH 4AIZB 3T0DA 3JZ7A 2IV8A 4I3SL 4JQXC 4ZUUA 1P4LA 3ZKMD 1MCOH 4GXHA 4KJPC 4APXB 1OCOB 1ZJBA 4WUKL 3DOSA 4WTXA 2ZOOA 1LM8V 1MFCH 2CNZA 5E99H 4IU3B 4Z5RA 2B0SL 3HBGA 3IDNB 4XNMA 5B3SB 1EZLA 3ZUCA 1XT5A 2RR3A 2CDGA 1E5BA 2GB2A 1CZ8H 8CGTA 1H5BB 3VXQA 2BVPA 5AW7B 2FBJH 3QDGA 4WJG3 3ZVVA 4YSQA 4PG9A 2ANPA 2P5EB 1OTSC 1X5YA 4P3WA 4PN6A 4ZOBA 3A4FA 1UEYA 3AQYA 3HE7A 2Z4QA 4AQ8C 1IEBA 1QVOB 4C4UA 1BGXH 5HYQA 3L2MA 4U4IA 1NGWB 4QI3A 1RUKL 1OALA 2MOGA 3FB8B 1R3LA 3KWVA 2QADD 1TXRA 3G7TA 2GIVA 4N0UE 1P0SE 4XX1E 4YGVB 2E6PA 3O6FC 1CDCA 2IAMD 5EC2A 5FM4A 5FS5A 5AVZB 1OANA 3W38A 4RI1A 4J2QA 3ZMEA 1WZ1L 2NT0A 5FW6A 4G1MB 2XZCL 1LO5B 3UBXA 1CFTB 4UIMA 4ZDHA 1JPTL 3LZOA 4L9LB 2CO7A 5IQLA 3I85A 8FABA 2N0MA 4I1NB 5BUAA 4NO5A 3JYCA 1AJ7H 3T1WA 4YPGB 1DLHB 3FULA 4YL9A 5GRVK 4XCFH 5KS9A 1IM9A 5EZJB 5E08H 2A6DB 3FVLA 2G3NA 3RWGA 3CVHH 3TASA 4WWKD 1RU9H 3N9GH 1IO4C 1CXFA 1BYPA 4PJ5B 4XC1L 3K2UL 1ECZA 5JIIA 5KYUB 2V77A 2NUPB 4PD4K 2DB8A 4BK5A 1KGYE 2JB5H 4HH9A 1CT8B 5IF0A 1TTBA 3ROOB 2ORBH 3TOBA 2YBRB 3WXVL 1M2VB 3A5VA 4UQCA 2ARHA 5F49A 4FD7A 3WELA 5D1QA 3RVWC 4JHWL 4Z95H 5TDOB 1J1XH 3U0TB 2QZQA 3WTTA 4KJYA 3CQPA 2BDNH 1HHGA 4BSWB 5F9WC 1U95A 3EO9L 5TK2A 3GJFH 5JTWA 3OGOE 1TTGA 3FO1A 3ZR5A 4KLWA 2GJPA 4AI7A 2Z0UA 1BDYA 5CZRA 5FYJH 4DOHE 3OZ9H 1MHHA 1CL7I 2MJWA 3CBRA 1RURH 1N6UA 1Y0YA 1HNYA 3CVIH 1GHEA 5IROC 1R3IL 5IGXH 2JKRM 4U6VH 2V17L 3LRHA 4G3YH 3WO4B 1UZGA 4QHPA 1GIGL 3P4OB 5KSBF 3C09C 2I00A 5A43C 5FYLE 5HGAA 1MI5B 5HVWA 4M3SA 4JGUA 4FQQA 1S2EA 4Z3IA 3PB7X 1E2ZA 2AGJL 4GAYB 4FMVA 3FDWA 3VD3A 3CH1B 3KCWA 1IC0A 4GW4A 3Q8AA 5CS7A 2HSIA 2VC2L 3HHRB 5IQ9B 2NT1A 3DURA 2CBQA 5IV2A 1H8NA 2R2HA 2WBKA 1MFDL 1X44A 5EA0L 3OKNB 5E9AA 4HIIA 1GVIA 3LKQA 3VH9A 4N2OA 1NAML 2WD0A 3EHBC 3N42F 3TN0D 4WU5B 2PRQA 3KGSA 1NZRA 1DL7L 4RAUB 4ODWB 1OE2A 1UM5H 3HB3C 3PFQA 3F12B 4A37A 2XRAH 3H5ZA 4TUKL 5FGSA 2I3CA 5FA4B 1S7NA 4KVOE 1N26A 3L3HB 2Z11A 3OR6A 1B9KA 5J06A 4Q0XH 4EI5C 3QPKA 1YC7A 3VM5A 3IE4A 1S8DB 3NA9L 5DJXA 1HXYA 3C5SB 3CFTA 3NG5A 3S96B 1LEIA 4OLEA 3RX8A 2DDQL 3TLRA 1H6FA 1K4DB 4O2CB 2ZEMA 2FECL 4HVBA 4CVZB 1EUUA 3GUFA 3DIDA 3STLB 1GMIA 2ZOTA 1DQDH 4LPCA 4BZ1H 1SXAA 1QLEL 3LZNA 2XZQH 3PABA 1NAKL 1QYGL 4RMSA 1RUAH 4RSVA 4AMKL 1C5BH 2WXQA 5D1ZA 3WIHA 4JFVA 3RTQC 5L8LB 1O7SA 5F7YC 5GGTL 1BPNA 1TFPA 2X5PA 4KROD 4P9ML 4IGBC 2W0FA 4OCNC 1KFAL 1J05A 2P7TA 2G2RB 2VDRL 2VKWA 5A2JH 1NCCL 3RVXC 3SKMA 2VLME 1ZSDB 4MSWA 5HI5C 4EVYA 1G9EA 2ATPB 2HKHL 3D3VD 4A7TA 4O9HL 1UWXK 2L7QA 5DJAB 4B3VA 3EYFB 4X6FB 2H5UA 5D4IA 3APCA 4K9EC 4YGAB 3KHXA 1ERNA 3C08L 1DR9A 1XTMA 2ZWZA 2XV2A 4NJRA 2CG9X 4YSAA 5KTCA 1OBRA 2ZYSA 4NPKA 5GZOD 7CPAA 5AWNH 3GPSA 1KEGL 2CXGA 1TJHH 3DKHA 1W9XA 3RYMA 3TV3H 1J9CT 4IOSA 5I18L 4HKJA 2NRDA 3DX6A 5AOLA 3V4LA 4CVXA 2EBJA 1XSOA 3MV9E 4Y16C 1R24A 1JFQH 5B22A 2PABA 4GSDL 4I0PC 3IXAA 1JIBA 1NM4A 3QCUH 5I2IB 3G08B 5KYYB 4P5KB 1RULL 3BDYH 4F5CE 2HQYA 1A7NH 3EJPA 2Z0ZA 3EJTA 3KASA 3MRQB 3SY0A 1P1ZA 3ROLB 3IJYA 3CPLA 4HUXA 1D6VH 4AVBA 3VFGH 1IL1B 4YDZA 1N8OE 5KVFE 4KVCL 2C3VB 3NT0A 3ZTJG 1N6QH 1DFXA 4LESA 3RI5K 2IANE 3NFPB 4OM0L 3VFPA 2BSRB 4UV4H 1XIWC 4GRLC 4PRID 2BP8B 1NGZB 4YAQA 3WUWA 1GKEA 2I5YL 5A16A 4V1DE 1J8HB 3VFTB 3VFOB 3VX0A 1K8IB 2Z31C 1ZWIB 2BSSB 5C0RH 2B5GB 1CP6A 4ADJA 4O2FB 5F7UA 4L8SA 3SDCD 4C2YA 1RZJL 3JV6B 3RU8L 4BXVA 3EHBB 4V2CB 3OAYH 1UWGH 4BUHA 3HB3B 5A2BA 1A1NB 2DQMA 4KQ4L 1UZ6E 4MAYC 4QNPE 1XGQB 1KCVL 1KN4H 1QFOA 2A73B 5MI0C 3MJ8B 1B6BA 3RRQA 1ET5A 5FYLH 2A83A 2BZDA 5IW3A 4FFWC 1PIGA 5DO8A 2BHUA 1YDPA 1JQGA 2AEOA 4X6BB 1X7TA 3O4OC 4EI5B 4QTHB 1IC4L 4L4TD 4J6RH 1HYSD 4MCYB 1VFAB 3NN8A 4TQHA 3WMSA 4CGLA 3LHPL 4QXTB 5JLZA 5JPMA 2H32B 4Y2DB 2CIKB 1G1YA 4ZPTB 1JHKL 2XHNA 1BAVA 3SDDB 1YEKH 3QUZB 4JM2C 5KBPA 1EDHA 5DMKB 5EMIA 2W88A 3OD3A 3TOPA 2OQJB 1NBYA 4GRMA 2R7EA 5DJ0A 2FUQA 3ZDZE 4NO3A 5E5RB 2J8RA 3PHAA 5F97E 2ARWA 5F7KC 1D5ZB 2K3TA 3CFQA 5C88A 2VM3A 4Q8BA 3U2SA 5ITFA 1B90A 3QDJE 4A2HA 5KSBA 2BSTA 3MLRL 4ZYKA 4UFXA 1WA2X 2ZCKL 3MV7D 5BV7H 5I1GL 1KB5A 1GA2A 4JDEA 3ZO0A 4ZX3A 4LKXB 4S1DD 1J9TA 5AG9A 4ABVA 3IFOB 4KPHH 2VDOL 4U7KA 2VABB 3QORA 4XCCH 1MH5B 2B4CC 2Q10A 1TSHA 4AIXA 2Z0BA 1T7VA 5EBWB 3U36A 3LXCA 3MYJA 3RZAA 4JFDE 1Z9NA 3VWJA 3RL1A 2DMBA 3U82B 2NZ1A 4FRWA 4HZAA 1NCDL 3A47A 1T0OA 4L1HA 1JD7A 4C68A 1XL6A 3L7EA 3SE8L 5FXCH 3OMIB 1TQVA 5I19H 1YMEA 1NFAA 5DQ9A 3OKMA 5JIDA 3PP3K 3FF3A 5CCHE 3OPZL 3B83A 3QQ9D 1F2XK 1HVXA 4PJCA 4PSPA 1VENA 5K1JA 5HYSA 5CF3A 1P7QD 3LZPA 5IB1A 2PYFA 3QC6X 1EJOH 3MTRA 4JDZB 5C2BH 2XWJB 4Y16B 4PREA 4APQB 3OWRA 1IIIA 2UZXA 3QEQB 1PD6A 2FX7H 3IT8D 1DE4C 4TNWF 4DP6X 1D2OA 5C0IA 1LOKA 4E5XA 4GXUM 4QXGL 5B21A 4GG8A 5T3ZL 2X6VA 4G6AC 2G0BA 3W0WE 4I5BB 2VDKL 2VW7A 4EZMA 6PAZA 4DUXA 1IC5H 4HXBH 3TO4B 5J1QA 3JWNH 3BZEA 3NTCL 4K3JH 3FRPB 1A5FH 1PG7L 2X4OA 5AOZA 4E0RA 4TPRH 4GKSA 5A7EA 1XIWB 4MJHA 4P2AA 5I15H 1KULA 3T5WA 5IOPA 4ZODA 2DWDB 4J1UB 3RY6C 2QR0B 5F7HA 4Z9KB 2A6KA 2AS5M 2XG5A 1U3JA 3CBJB 4I2XE 4UIKH 4LDLB 4JPQA 3A0OA 2Z31B 2HJKA 2WQWA 1A7OH 4OF7A 5IR1B 3ZX1A 4NRZB 1FJ1A 4GLRH 3FN0H 4OCLC 3SBRA 1GYTA 3JSSA 2R69L 3A23A 4ILDA 1QBLL 5DLMH 4PMEA 2ZSVA 2VERA 3QI9B 1DCLA 2F54E 4N22A 5MI0B 1N3NB 1OAXL 2IG2L 2D0FA 5A2AA 3MBEA 3ZSTA 1KF9B 1U8QB 6TAAA 5KVFH 2VBQA 4M7JL 2W9DH 3QXWA 3RIAF 1O6SA 3V0WH 5KJRH 4R90L 3PWLB 2W0LA 4G6KL 4PJDE 3LXBA 3DO3A 1L6PA 3QXAA 2NCEA 5EIIA 4GFTB 3QEUB 1QABA 2OS7A 1VFBB 4XO3A 5EF0A 4IRSC 2P3YA 5FGBA 5K9QI 3HNTH 3OXSA 5FFOA 4JM2B 2IO5A 4RZCA 5K39B 4KJWD 4ONOA 4IK7A 2EK8A 1CLYL 4Z3TA 3AG4B 4PS8A 4F2MA 1QSFB 5BJTB 3C26A 3JT0A 1RD6A 4IRJB 4XMPL 1OT1A 3B7UX 2NX5B 3LQAL 4NHCH 5FUOL 5LGYA 1U36A 5DD6B 3T0BA 3WTWA 1PZSA 4QRQB 5EFIA 1AGBB 5C8JB 3LCYA 1BHGA 4FN0A 4GG6F 1VIWA 2ALAA 5IFJA 3GLZA 3IRZA 4RISL 3M6DA 1PZ5B 1KY6A 5SX5K 3SO3B 1OSPH 4C56A 1XF2A 3GMQB 5EO9A 5ADPL 3SYOA 2W5PA 2BP0A 5I1EH 4C2XA 3WC6A 2GC4C 4QRFA 2CK0H 3VD4A 2BSBA 1WISA 4R5VA 1WBZB 2Z65C 3GM8A 1JJUA 4YHIA 4F9UA 4OIIL 1CVSC 2V7HB 3TNMB 3CSGA 2FYYB 1QO3A 4L2LA 3AQXA 4MS6A 1BFTA 5DHYA 2F8HA 5I8CA 3PE9A 4JRYD 4NRYB 4APXA 2JI2A 1WLHA 2OR7A 1JK8B 3V4VH 5IB5B 3KPMA 3CJJA 1M7IA 5EN3A 3QC5X 2V2TB 2OMTB 2Q4YA 3VFSA 1NJ9A 3BVWA 2J71A 3IDNA 2V9UA 4XAWH 5F09A 5B8CB 1A6ZB 5F96L 3QAYA 4MGXA 4NZTH 1XGYH 1ZKAA 1H5BA 2A6IA 3VB8A 1HHJA 4YSEA 2Z10A 5HHXH 1DE4B 3D09A 3SKUD 1QBML 2X4TB 1KPUB 1YLOA 2F2HA 2HLFD 2RTTA 3C12A 4L3EE 3DUUA 1UJ3B 3QJOA 5E2JA 4Z7WE 1CGSL 2O28A 2YPKA 1R19A 3HS8A 3IB4A 4BV1A 2Q86A 3FB8A 1OTUD 3ZE2B 5GSVB 4XGZA 2C27A 1B0WA 3O11B 4YGVA 4QRUA 2B15A 1FFOB 2EDRA 3FHEA 4OCYL 2IDUA 4UEFA 1KG0B 2VN5A 5AGEA 4G1MA 5JPHA 1P4BH 5IY5B 2LLNA 4HNWB 3ZTNL 3Q6GH 2XKSA 3O3BB 5DO2D 4OU3A 4KNTA 1CPSA 1RIVL 4WEMB 5KBMA 3PWPA 5CJBA 3MRDA 1MW0A 5TE6H 3SGDI 4AEEA 1DFBH 4ZZFA 2O5NA 1A3LH 2GTQA 3TNNA 2EACA 2VMEA 1BIIB 5CCKL 2DQDH 1ZK5A 2CXAA 4P4KA 2JH2A 4NGTA 3OJMB 2GABA 3BT2L 1FIGH 3KGUA 1MJ9A 4Z3EA 1BMGA 3TZVA 4QHUA 2O5YH 5I66A 1BMWA 1WTLA 1SYSB 1DVSA 2YFOA 5DMJB 4Z76A 3S8WA 5DC4B 4CAXA 4PJ5A 5GGQH 2XQBH 1Z66A 4F2FA 2C9RA 1ZHLA 4PRHD 1T3FB 3FFCE 2JB6A 1BAWA 5DRXA 4GSRA 2NUPA 2JJVA 5KYUA 3HE6B 3ZT7A 2VR4A 3U48A 4MQXD 3OGCB 3RVTD 4LHUG 2DWYA 1F6LL 4PJHB 4UQIM 5DF0A 4XPKA 1MCSA 3M8OL 4P05A 4POYA 3IDXL 3P3UA 4LEXH 3RY4A 3LEXB 3ISWA 3S35X 3VSQA 3H9SA 5LYFA 2PNDA 5LRKA 5TDOA 1LNUA 2C9VA 4P45A 1EDYA 4RUHA 3P73A 3MO1B 2JCCB 2BW5A 2OMZB 1ZV5A 2R0KL 5KZCB 1VFOA 4LHJB 4PQXA 3NZUA 2Z93B 2WZPA 1Z9UA 1J5OH 4M93C 4OCWH 3D34A 3ML8A 2MFNA 2ATKB 3WEBA 4JPIB 2RBLA 3ILDA 1SY6H 1ZT4A 4Z3HA 3WEAA 3IWVA 1T04B 5KVDL 3UTSA 4PVBA 2LLLA 3KXFD 4C58B 1N67A 1K6QL 1OM3H 3FUKA 3K1KC 3IFPA 2WMPB 1FYTD 4DKEH 2NY4C 4HJGA 3CH1A 2R29L 5I8EB 1U8OB 3FO0H 2X12A 4O5LL 2ETWA 5GGRY 4C54A 4UCPA 2WKOF 3D4CA 2E7DA 2E75C 2VKXA 2CA4A 5G5DA 1WIOA 2H3NB 4CGMA 3KPSE 3CMGA 2GBVA 1P2CB 5J11B 1LMIA 1IT9H 4G42A 1D9KC 4U4BA 1V27A 1TVBB 3LVTA 4WU5A 2Y07H 3LV3B 3BQVA 3G6JE 4RAUA 3GPEA 1S3RA 4C83A 3F58H 4CSTA 5KAQF 4UU9A 3KD4A 5DHXB 3F12A 2KMWA 2NCMA 4ANXA 5FA4A 3AMLA 1ORQB 5GXBB 4CADA 5HVGA 3OVUB 1NPUA 2VR7A 4ZK8A 1YEEH 4GQQA 1J0YA 2EWBA 2EDDA 3KYKH 1BFVH 4XCNB 4KV5E 1S7WB 4PJBA 1S8DA 2Q7SA 25C8L 2YKLH 3C5SA 4H8WH 3S96A 4CC1A 5AB2A 5KSUA 4AKQA 1TKFA 1D2PA 4XP9H 3CIQA 4PI2A 3STLA 4JQIL 4YE4L 1XV8A 1PQZA 4GG6A 5TQ0H 3WE6B 5C0FB 5I17B 3BH8B 4E41E 4LCWA 1D5MB 4J3OG 4OZHB 1ZVNA 3TO7A 4AUYA 5L2KB 1EPFA 4HF5L 1T0NB 3UCQA 1MWOA 3BQUD 3LRLA 5HDQH 2Y5EA 4PVMA 3HS0C 1MRCH 5IB3B 2BX5A 1I1AD 1VKCA 4KK6D 4UT6A 4G7RB 3CSBA 3RGVC 1DLFH 2XEFA 1PJWA 4TQIA 4H5SA 3DMMB 5D6CA 3F05A 3RP1A 1HH6A 5MHSE 2IAMB 2XOTA 1ZSDA 4KTDH 1EHNA 4J3SA 1U3HA 2ATPA 1KTBA 3HG3A 1L3NA 1BMZA 3WKQA 1QASA 1C5CH 1G0DA 4OQ1A 3ZDYB 4OJFL 3LKRB 4K94L 1LAMA 5C0AB 1EHAA 4XHJC 3VD7A 2OH1A 4BHUA 5F72S 1NDMB 5AKVA 5GISH 2C3WA 5F9AC 3WNIA 1LTXA 1Z4RA 2RB8A 3CSFA 4Q9QH 2WSDA 3GHEH 15C8L 1OGTB 2O6CA 1C8QA 5CZXC 1F4AA 4HT1H 2J25A 2VZ1A 5CJXC 5KUMA 4YXLH 3VA2C 1HWWA 3LH2L 4LHUD 3NFZA 3HE7C 1XMEB 3U6RA 4MNGE 4YHKL 2WLHA 1OZTG 4G9FD 1JHTA 2HT4D 2YAOA 2IWKA 4XOAA 4LP8A 4QUSA 4P3CL 5B1KA 1OAQH 1V3JA 1XR9B 4K7FB 4XXDB 1ZLSL 3D7DA 4CPAA 2XA3A 3QFJA 2DQHH 4M43L 4YUEH 2V0AA 4XXCA 1NC4D 1B3JA 2V5TA 3ATDA 1CS6A 1NGPH 3BKML 4LGPB 1U8CA 3MRQA 3WFEL 4M93B 2AXJA 3ROLA 5DZOA 1ES0B 1TTUA 4LAJH 3GXIA 2VWEC 2AK4B 2OXHA 2G5RA 2XN2A 4P4EA 1L9QA 2C3VA 1JZGA 3VXSD 4B9KC 3WLBB 1FE8H 2CIIA 4ONFL 4PJIF 1EXUB 4P46A 3VFNA 2F74A 5HGGS 3FT9A 3MKGA 4X5QA 4Z1PA 5EBLB 4ONUA 2R27A 6CPAA 1NLDL 1QI4A 1FRGH 3AUVA 1J8HA 3MRFB 2EXTA 3UO1H 1VCAA 5DQDH 3G04B 2X41A 1FNAA 4O2FA 3O6LH 5EU6B 3QRLA 3ZR6A 4XVUD 5A28A 1RZ7H 2MPVA 1D9KB 2YBGA 4HBCL 4BK5C 4CN1A 3DRQB 3CFNA 3SPCA 3T1FA 3EFAA 5IB0A 3I50H 1I82A 3GNML 1A1NA 5MEOA 4B5EA 3LZFL 4U6XA 1H0DB 1SMAA 2IBZY 4PHXA 3C5JA 5I1LB 1KXHA 2QQNL 2X40A 1QOKA 4A7SA 3OMNB 4ZY0A 2X70B 5KYNA 2W91A 4KKBD 3BEVA 5AVSB 4MCYA 1VFAA 3VE0A 1FFNB 4RAVA 1FAKT 3APDA 4QXTA 2JMRA 4KORA 4X0KB 4Y2DA 3D18B 2VEZA 2XN0A 2GHWB 4ALAL 4TLUA 3BN9D 4XPBH 3SDDA 4AITA 1UURA 2HJFA 5DMKA 4OZFG 2OQJA 2NY3C 4B9FA 5T1KD 4XCYB 1FFRA 3D2UD 5JIMA 3ESOA 5I73B 2QV2A 4AJWA 4PWHA 4JFFE 5D2NE 2QLYA 4PQAA 2WWKO 4LIQL 1X5XA 5C7ZA 4J3OD 1UGKA 2AABH 3FUMA 2XQ0A 1PLBA 3VTMA 2FEEL 3UZEA 1JMZA 1RFDL 5IFHL 1AHWA 5FAAA 4I3RH 4S1QL 5CGYC 3T9WA 1ADWA 1S7UB 1BA9A 3HI6L 2VABA 2D8KA 4MJ5A 1BLLE 4LQFH 3V6OE 5F3HB 4ADGA 4XN5A 5D9SB 4AOFA 4OD3H 4ZNEE 2PJ2A 1GSMA 1EXHA 3WEMA 1OGAD 2VR3A 3QUKB 3VRJB 4PP1D 3HNSL 3FO2A 3OB0K 4KVNL 5BO1L 3CTTA 2RACA 3DGCR 3QO0B 1SBSH 5CNHA 3S2CA 1WRFA 1KT2A 1OEZW 4UAHA 3H9HB 3QZMA 4I18A 5D71L 3MFGB 3B7IA 4OGZA 3VU2A 4QHKI 2BNQB 3WC7A 3E38A 1ZLUH 4NQUA 2ENQA 1S9KC 3G5VB 3NA4A 3H0TB 4UQ9A 2DTML 4L8CB 2KKQA 4L23A 3IDMB 1GTFA 2XWJA 3HZMB 4MZ2A 2UWEA 2HCZX 3ZYIA 1VGKB 4PJHF 4U3HA 3BZ5A 5CEXA 4HNXB 2Z3FA 4QYOA 4D8OA 1VCBC 3VSVA 2QSQA 2Q3AA 3RWFB 3PS6A 3WS6C 2FH8A 5D1ZC 3AG2B 4HCFA 1AGDB 3PGDA 4HSCX 2VSCA 2JCCF 2XDHA 4FF9A 3V6FB 4HG4K 5MP6L 4B5OA 1TJGL 3M1OA 1MCPL 4LSSL 3UG3A 4BZ2A 3FT0A 3X11B 4XMWA 1PX4A 1P7BA 4OF6A 2B20A 1ZGLB 3ETBJ 5DD5H 5C07A 1CD1B 1B0GA 5ETUB 1MFBH 1ZRUA 3CVBA 3IRPX 3L3IB 4RRPA 5EBMA 2VDQH 5LXVA 3OQRA 2WN3A 3ABLB 3CVCA 5BVJB 1LMKA 1MZZA 3ZRFC 4NUQA 4WEBL 1B3IA 4MCPA 1UT2A 4LVNC 4NRZA 4ZO9A 3Q43A 4FLHA 5EEZA 2BRRL 3ATFA 3PP9A 4R8FA 1T83A 2G0KA 7FABL 3D48R 1RTQA 1L4IA 1NMBH 1M6OA 1N3NA 2A1WL 5MEPB 4JN2B 4OLXL 2J6EH 1SOQA 3FH8A 4K5OA 2JKNA 4XMLH 3U7AA 3L17A 4GAGL 2EEAA 3EUUA 2WP3O 4J3UA 1R17A 4YJZL 5JXED 2PJ1A 2DQEL 1L9TA 4NPJA 3CXPA 4K23H 2CGYA 5E2TH 4FFTA 5FLVA 5I24A 1FO0L 4XX5A 3NE7A 3B3CA 3FPXA 2OP4L 5HXDA 3KH4A 1Q9OB 2AJUH 4KS9A 5DGRA 4ZUVB 3J27A 1KJMB 3ECQA 2CLZB 3K2IA 1RK1B 1NGXB 3P4NB 1HINL 1E42A 4OT1H 5IT2L 4IRZH 4UTAL 1QNIA 5J3HC 3D08A 4IRJA 4X0NA 1JGVL 4QRRE 3IU4L 3HI5H 2WZ5A 5T1DL 2PWGA 3S9DB 2BHYA 2FWOB 3T0WA 4L4VB 2WXPA 1JZEA 3AC0A 4PJIA 3QBTB 5C0BA 4M5YH 5C8JA 4PSRA 1NH6A 4Z18A 2PTTB 2WB7A 1BD2B 5HBBA 2A0LD 3LKOB 4A55A 1O6TA 2XX1A 2AQTA 4MJIB 4OZHF 1A0QH 3GMQA 3HC2A 4G8GA 4X6CE 3LZRA 1WFNA 4TSBH 4QRSA 5HJ3A 3X12A 3ULVD 1QX1A 5F7LB 3GKWL 2AAVA 2AJXH 2F1EA 2ZXGA 2VH5H 3EFFA 1RPQA 4PY7B 4U1MA 4BK8A 5JUEL 3BVXA 3HAEA 4OM1L 2ZKXA 5BQ7B 3V2AR 3I1UA 3GSNH 2DYRB 4PK2A 2O72A 1CCZA 2FB4L 4AMWA 4HJIA 5T3ZD 1FVDA 4YFEA 4YU9A 3SJVD 3CXDL 3D7GA 4HYTB 4E9LA 2OMTA 3O2DA 2PW2A 3I9GL 3BEWA 4KOTA 2H0JA 3BSHA 5B8CA 3VXRB 4JO3L 1YLBB 2G4GA 4HOWA 3CVHB 1I3GL 4AG4L 3PAUA 3L4VA 4WW1A 3WJJC 1W8NA 4CGPA 5F7MC 2FRGP 5T1JA 3F7KA 4WEEA 3GRWH 2YC1B 3QQXA 1BXUA 4XPHH 3B2PA 1UKTA 5TJWK 1BVZA 2DYPA 3MV11 1EWHA 1TCRA 4YZFE 2JKIS 5AW9B 5GSVA 2ALWA 4GQZA 3O11A 4Q6YA 3C9NB 1R3KA 1ZS8B 3GI8H 5T1LB 1GHFH 3U46B 4FEMA 1KJ2H 4JDVB 1KEML 4OD1L 5J13B 3TS8A 1EGJH 2WO3B 3UAJD 4HKBA 1F13A 3TT1H 4HUVA 1E5CA 1RHHA 3GJFB 4KK5D 4R7XA 4FNTA 4MKMA 2MEJB 1HHIA 2JJSA 3O3BA 3T77B 1XGUB 4LVNB 1ZCRA 4JZJB 3J07A 1NBQA 3F6IA 4RH4A 4OJAA 4JPWH 1AZUA 4P10A 1BIIA 4DCQA 3SI0A 2DEYX 2L3BA 1KXVC 1JGDA 2NY6B 4W9IC 1IAKB 3MUHL 4AY0A 3QWOA 3ET9F 3HCVB 5T3XE 2VT0A 1EZVX 1N0LA 1SYSA 1X5HA 1QRNE 1NMAH 1PLAA 2C1OA 3NFNB 4O2EB 4CL7A 1AHMA 3O9WB 2EDWA 1JGLL 5FYKU 3Q8EA 3HE6A 4W6XB 4LLUB 5DWMA 2K1MA 3ARWA 3CZEA 2AXGB 2J1YA 3MXVH 3OGCA 4PW3A 3VGFA 4IHBA 1CD8A 2RH0A 3H6AA 2PCPA 1DUYA 5BUGA 3NACH 2WANA 3KYNA 3LMJH 4PJGE 4YHOL 4LL9A 3DX7B 2W59A 2Y7QA 4UOW0 1ZE3H 3VG0L 3ZDXB 4MFHA 3ISXA 1TYJA 4GH7B 2PP9A 1HYRC 1YUHA 3FB7B 5C0CD 3MO1A 2H2SC 2OMZA 3KYMA 4Q9CA 4PV6A 1U92B 4QOKB 4TOYH 2EJ1A 4NBZB 2BIOA 1FL6B 4YHLL 2EO9A 3AZUA 4NWUH 1E27A 3QG7L 5CWSB 2D4PA 1Q2DA 5ID1A 1G0YR 1Z0NA 1Q8MA 5HYJB 1SQMA 1ZHKB 2ATKA 4CC0A 3NJKA 3GI9L 3GS0A 3JUYA 4JPIA 3CE1A 3ZYZA 5G1ZA 2G3AA 1T04A 3DRTA 2ZCHH 4MXUA 4WHDA 1NDGB 1UXLA 4GRWE 2XQYA 3ASWA 2FJHB 3RIAK 4N1HB 5JNYA 4JHUA 1ZV2A 1A64A 4RETB 4QHNA 5I8EA 3ZE0F 3GZPA 4QXVA 1MFAH 1CBJA 5E9DD 2Y6SC 5BV7C 4N90E 4Y4FD 2RA1A 2WYHA 5E6IC 3TF7C 2H3NA 2M83A 3D87B 2JBJA 1OCCB 3REVA 3BE1H 2PPEA 4X4MA 1GPOH 5ESVB 2AK1H 2DF3A 1P5UA 1FV1A 4LXFA 1LDSA 2O6PA 4LU5L 4B0MB 4EE2A 4I7ZC 1LFWA 4UEEA 1BX2B 3FQWA 3KLQA 3DGDA 4O02H 4N0UB 3CHSA 2X2UA 3KYOB 3W11D 2X7LA 3P0VH 2ZP9A 4LLVB 2E7BA 5DZ9A 3WSQH 1Q1JH 1TQWA 1S7TA 2VJXA 3K8KA 3O6KH 4P2RD 1GYWA 1VIXA 3JBG7 3MLUH 1ZANL 1VACB 5EOCJ 1WAAF 2O6EA 3KEDA 4YDNA 4AEFA 2CGZA 1N68A 4UTBH 3RO0A 3FJUA 5LDUA 2Z34A 4BH7B 3TJPA 4XODA 4RS2A 3RURA 3EXJA 1INEH 2R0ZL 5EF2A 1YG9A 3MGOB 5JORA 3IC1A 5IBTL 4OIDA 4KZTA 1J8RA 1CQKA 4G72B 4WFEE 4ISVB 1D5MA 3LIZH 4DQOH 4FQPA 2WBWB 3P3SA 3UX9B 1EAOA 3TBVB 4B5PB 3CC1A 2P24B 1ZLVH 2Q8AL 3DROB 1E6JH 4CNIB 4UCMA 5IB3A 2IDFA 3QARA 3BHBA 4NZUH 1T5XB 4BGLA 2D7QA 2YQGA 3TX4A 3RWHB 3ARFD 3DXAD 3PP4L 5D1XC 1ZXKA 3MRPA 4X7EC 4N25A 3PWUB 2ZYHA 3JWNC 4BYHA 2IAMA 4XPLA 1AZBA 4G5AA 3MOBH 1BBDL 1OHZA 5BCAA 1KJVB 3PQYE 4BSJA 3G5ZB 3Q48A 4LCCB 5E4AA 5C3TA 2Q5BA 4R3SA 5JHDD 1B2WL 3A6CL 3T0ED 3FQRB 1HILA 4FXLA 4Y5YB 3NJJA 3BSGA 4R7VA 4D0BA 1DBML 1TQUA 4PV8A 2HUZA 3S4SA 2XWEA 4DOHB 1MNUH 1PYTB 4UEZA 1IY7A 1CWVA 1ETB1 4HCIA 2CRYA 2NW2A 4NUMA 1OQXA 2XXCB 1RZIA 2DIBA 5BMFH 3D9AH 3E6FB 1GOHA 4FFYL 2B8OT 3CDZA 5I0DA 3DR8A 4WWKA 3QUXD 5J56B 4R5XA 1QACA 5T3XH 4RRPM 1CK0H 4UOJA 3IDIB 3WJMB 5C1MB 3EYUL 1XGTB 4Q58C 4NUGL 3MJ6A 3L7FB 3ZMNA 1XQ4A 3WEXB 4HJEA 1FZMB 4FQJL 4NUJB 4ZFFB 2ZE0A 2KQNA 3D2MA 3BKCH 2GTWA 4A6YA 4G43B 4YWGL 4XP6H 2E7MA 2QSCH 5SWSE 1KYAA 3WLBA 4J3GA 4MFJA 3OKOB 3DJTA 2BRQA 2VAAA 4JGMA 4P4KC 3WFHB 4Z3JA 2FCBA 4H1LG 1QFWH 5FV2A 1TJMA 5I5IA 3TZVC 4N2EA 5E2UH 3S2AA 1SF5A 2IQAB 1Z1WA 3C60C 3GMMB 3UJJH 1CGWA 1NGYB 3F0AA 1B6DA 4UMGA 5EU6A 5KBLA 3RA7H 3I6KA 3RPIB 5KTDA 4AM0B 1AZNA 5DHDA 1A9BB 2CJ3A 1Z3RA 4H0GA 5DR5L 1FSKC 1ZPUA 3HMXL 3DJ9A 4IBWA 1H0DA 2W94A 3WYRA 3EOTH 1Y0LA 1UD4A 5E03A 4OLZL 4DQAA 1Y1DA 3MODL 4JDTH 3FB6A 5JW4N 5DVLA 3OM3B 4GRWH 1TSRA 1RCYA 1LE9B 1M3JA 4KRPD 5D7JC 5EO0B 3SOBL 2QDWA 1YGHA 2K78A 5FOJA 2FDBP 3S5ZA 3OJ2C 1FFNA 2Q0ZX 4MAUL 5DUML 2MCPH 3QCTH 4JO5A 2YRLA 3J8F7 5HYEA 1GGYA 4NM8L 3D3SA 3GIZH 4AQEB 1KN2L 2APFA 5AVRB 4MJJA 1XE4A 1HEZA 1E8XA 2X10A 3QT2A 3LRSB 3TN0A 4Y9BA 4XCYA 1U8PB 1G7JB 5IVZB 3TYFA 3UZQB 4L18A 1J9SA 3HN5A 3TJHC 4QCIA 4JR9L 4G6FB 1BZ8A 1P4IL 2OJZH 4NGHH 4R4NC 4OV5A 4OVUA 1HDMA 1TPXC 3HKZA 4UF7C 3SPJA 1P7HL 1U8LA 3MFFA 1GJUA 1ZVSB 4WENB 1K72A 3BIBX 3TT3L 4IKJA 4FA6A 1FF5A 2E76C 5INDA 4YIQB 1C9SA 3DK0A 1CDIA 3WDJA 5C92A 2BSWA 5IB9A 4KUZH 5F3HA 2Y7OA 1UD5A 4ZOEA 3HZKA 2VIRB 3FH7A 3DV6B 1SEBA 1YN7B 2GK0B 2V9RA 5KYWB 3S8FB 4ZI6A 4WTQA 1H6EA 1CLZL 1XFPA 2VR8A 1ONQB 2W0PA 4ES8A 4MD0B 4PTTB 5I75C 4TQPA 3CVDA 3BPCA 1HL5A 5DJ2A 2W92A 1ZOXA 3DSFL 1FH2A 1BAGA 3W57A 1XSJA 5CEYB 1RK7A 4PJ8B 2XIIA 4W70A 2RFXB 5EU4B 4AM0Q 2PYEE 4F0XA 1UG9A 2XBZA 3LZQA 4Z7VE 4H25B 1N19A 2VDMH 2DQCH 3PREA 3LY6A 4JAMB 1VGKA 4TKWA 2MSPA 1AG0A 1YJDC 3D3VA 2IANB 3QNVA 4PV9A 2ZPAA 1PCXA 3GRBA 3RVVD 1ZG7A 4HDIA 3H4FA 2JKTM 3EGXA 3ZDXF 4PXCA 3RWFA 4MQ7B 4V1DB 4S1SL 2ZYIA 4N0FA 2XN9D 1IYKA 5K59F 5GZOA 5LQBH 4HWBA 4H44C 5D7SH 1F11B 5GS0D 1CD1A 5DT1L 5DK3A 5ETUA 1OHQA 3RZWA 3L3IA 4M9PA 3KZ8A 3DR6A 4PJFA 5E8PA 2LU4A 3I3BA 2JK5B 3C60B 1XF5B 4JHVA 4JANA 4DO5A 2G3XA 5L4JA 3QA3A 4FQLH 1A9VA 2IALB 4L5FE 4XXWC 4XB8A 3IJ9A 1MQ8A 1YLEA 1PY4A 1Z5LA 4TNEA 1SXZA 3ARDC 5T1MB 1FSKB 1Q9WB 2AQSA 1X5LA 1PYWA 4U1HA 5GS1C 2VDLL 5AL0A 3RKPA 5MEPA 1RVFL 3BSZA 3R06B 4LARH 4HUWA 3WD5H 3ZDZB 1OAJA 1R0AH 4AVAA 3BZFB 3MRCB 1WBXA 3OHXC 1WH0A 4YHML 3QDJB 4AL8L 2DLFH 4W9JC 1A4BA 5K1VA 1KTDB 5HHOE 3SDCA 5LBSL 1VZHA 5ITBH 4Y4KD 1HOCA 4L8BA 1AQKH 4ZUVA 1NCBL 3V4VB 1CFMA 1CU4H 2NTSP 1IFHL 1G9HA 4XMXA 5E95B 4YSUA 2YGVA 1KLFB 3NRFA 3TFKC 2EVJA 4M48H 2GPZA 3UTPE 1U8NB 1IBGH 3N5AA 2I07B 2GJ6D 2V2WA 5DXWA 4CAGA 2VW6A 1ZG9A 4OAWB 5FCSH 4KK9D 1MWAB 3O4LE 4JFDB 4B9GA 5DWNA 1Q4NX 2ZXWB 3DX9A 4L4TA 3GZQA 5CR8A 1E5ZA 3WHE1 1WDAA 2PTTA 4LB8A 1BD2A 4KXZH 2EDJA 4ZQKA 3PGFH 1CTNA 3Q2WA 4I88A 3FBUA 3K6IA 2DL9A 5CFAA 3OKYA 2J9AA 2VLJE 3K81A 4Y5VC 3PL6D 2C9QA 4CMHB 1MAML 3EADA 2X4UA 3KVPA 4N28A 3KBPA 4OLYH 4UM9D 4EDWH 4M1GH 2OMWA 4PRBA 4TUJB 1XMTA 4OCRL 2HFFB 1I1CA 4HIHA 3ZMRA 1YECL 2YEVB 4RSYA 3MV7A 5JQ6H 1A6VL 2W1NA 1LCPA 1JXJA 3S36H 4KVME 1TVHA 4P3DB 3A4EA 4PR5A 1OARL 1RJYB 2CWRA 1KENH 1GGBL 3EGSB 4ERSL 1Z8TA 1IGTA 4TN9A 3B8GA 1MRFL 1MF2L 3W0WB 2C7UA 2VXTH 1CE6B 4XVTL 2J2ZA 1S7RB 3KLHD 1OVZA 3CHQA 4MHYA 1KIQB 4PGZA 2Q8BL 3W9DA 4NN5B 3TPKA 4CU6A 3KPNB 2V3EA 2W07B 3X3FL 3NZSA 2WWMD 2HFEB 1CFVH 4IDJH 2PQ8A 1F45A 4ZMXA 4MI4A 1H3GA 1W6WA 3O3EB 4N24A 3LMSA 1JYWA 4NGQA 4NBXB 3GBNH 5EOQH 1UB5B 2ICWI 5HHME 1HQRA 5CHNA 5DYFA 3VFRB 1KSRA 4R87A 2VXUL 2IH8A 5T1LA 4V11A 1PLGH 2AJZA 3DTXB 1GZPA 3V7MA 4PWEA 4NC1C 5ICZB 4U3SB 3ZZQA 1J0KA 1FZJB 1UWYA 2D2CC 2F54B 3QB8A 4F7TB 1CGVA 1U0QA 3BGAA 5EB9A 2C6GA 4YLBA 4R26H 5EF1A 1DJWA 5D7HA 1I9IL 4JZJA 4PJDB 4F7CB 5D7KE 1BO4A 4XMKH 2Q1EA 3ARDB 5HI4C 4LF3B 3PAVA 1K2DB 5GS1B 3EUDA 2F5BL 3JWDL 5BW7A 4KZDL 4NQXB 4HXAL 2W80C 4OBSA 2YPLE 3HCVA 3EZ8A 4OC3A 2ITDA 3V5HA 1ELMP 4L05A 3B2YA 2HTKC 3P3RA 1I8KB 2XYBA 4O2EA 3MMEA 4KO6A 4PJAE 3MNZB 2BERA 3O9WA 3H85A 2HJLB 3E9TA 2E9BA 4LLUA 2X4QB 1H15B 4PTUA 5C09D 5TTRA 3HZYA 4ZFOB 2ICES 2QHLA 2NY1D 4EN2A 4P5TD 3ECBB 3EH4B 4L5FH 3FT1A 4KKLD 2B5IB 3DX7A 2XTJC 5CGMA 3FSVA 2C4FT 3N1GC 4M4RA 2O53A 5DUPL 4H0HB 3T2QA 2CR6A 3G5YB 3KDPB 3SXOA 4CC4C 3RUGE 1CB4A 1PKQE 4JPVL 2CCWA 2FEDD 3Q2VA 2E7LA 4JRXD 1ZHKA 1XX9C 2WBXA 2BVTA 2XQYK 3CFEB 4TQEL 3SIKA 3ZN6A 4JPSA 2DQUH 4QLRA 4Y5VB 5CCGE 4KY1H 1BAFL 3F7VA 1AR1C 2OMUA 1LGVA 4LOFA 4WNQB 1ECYA 1DZBA 1NDGA 1T83C 2DIJA 3RWCB 3IGRA 5IMMB 5DJZA 4BFIB 4QRAA 3SE9L 1NBCA 2VMFA 4TL4A 1KIUA 2VN7A 3T6VA 3BAXA 4MQTB 4JPKH 5HDLA 1MY5A 5GCNA 1HDQA 4MA3A 5ESAA 2Y4SA 1DJSA 3A21A 3S37X 2CM6A 2DL2A 3IBOA 3QNXB 3LN5A 4XH2B 3FT4B 4L3EB 4DEWA 4HUCA 4HG4J 1C08B 1HIMH 1CYWA 3HZVB 4H0LC 1IBYA 4GMSH 2XWCA 3C75A 1MNNA 2N7AA 4MHHI 3ULUE 1HAWA 3WS3A 3E2HC 4FQXB 4BELD 1HDUA 1PTZA 4GIOA 3Q2NA 4HISA 3AWGA 2HB0A 3PQYD 4JREC 2ZICA 3ELQA 3RWJB 1FG9C 3GWJA 4PP2B 4ANUA 4NQCD 4NFRA 3ECUA 5LWYH 4JRYA 1LE5B 4LK4A 5F2FA 1P5VB 4S1RL 4LNRB 3EXLA 3NE8A 1L9PA 2WHVA 4J12A 4WCYH 4CW1B 5KSVB 3NCYP 3VGAB 1WC7A 3RL2B 1SOXA 4MHZA 5DK0A 3TBVA 3OKKB 4Y7MA 4ZJ9A 4W9YA 5IK3B 2X53A 1UD8A 1T0PB 5IEHA 3R95A 3FFCB 3TFYA 2O5XH 2CO3A 4Y5XC 2Z1PA 2OXGB 3DX4A 2NNXA 5DLLA 1OP5K 3VSTA 3X1EA 4NQDD 3EF4A 3O3AA 3Q6FB 4K73A 4B5ZA 1UZ6F 3L4UA 4GKOA 1T1YB 3V4PL 2IDCA 3X1NA 2KCWA 2WKLA 1MCHA 5DI8B 3SEPA 2VQ1B 4J6IA 4NZ8A 2V5SA 1I31A 1KJVA 4P4FA 2AJ3A 4LCUB 2ZXBA 4UNIA 5J6HB 2Q7AA 1AGCB 4LCCA 1I1YB 2TSBA 3MNMA 5DS1A 2XZCH 2HYMA 3KPQB 4IIQA 1GGIH 4WFFE 4Y5YA 3T4YA 1TETL 4YHPA 2J5LC 1JPTH 4E9SA 9PCYA 3FH4A 3TBYB 2F08A 2X09A 3ZDZF 2A9NL 2OAAA 4RMTA 4X8GA 2ZUTA 3U6XA 3FTZA 4W68A 2EH8L 3NSCA 3VSUA 1ILUA 3BPLC 4Q52A 2ZUQC 5ALBL 4PG2A 3DUSB 3FT3B 2B39A 4BKLA 3LEYL 4X9BA 5FDWA 3FZUC 4PRHA 3IJ3A 5AW1B 3VFVA 3WCYA 4N86A 3IDIA 3UJIL 3WJMA 5J1AB 4H8HA 3CX5J 4XN4A 4ETYA 2GSGA 5LO7A 3K2UH 2I32A 3EJZC 3WEXA 1LO4L 3GXNA 1IIKA 1YEGH 3LKPB 1KCKA 1GXEA 4ZFFA 3BXMA 4H8UA 5CINH 3ME0B 1AZCA 1AR1B 4MA8L 3S3SA 3KPSB 1VSCA 4G43A 2WGNB 5DEGA 5KBKA 2HG0A 2Z6FA 2Y7SA 4P04A 1OW0C 4N2MA 3WXVH 5BS0D 3G6JB 3T6ZA 4DGUA 3DDGA 4FXKA 3L3GB 1E28A 4OW6A 3UDWA 4JHWH 2J3SA 4E9XA 2V3DA 7PAZA 1UZ8B 2IQAA 1UOVA 5A2FA 1ZVHA 2FQFA 5HYIA 3Q5TA 5D93C 2Q76A 2ATAA 1DQML 4GLRI 1V05A 2PIYA 2B77A 3MLXL 3P3TA 43CAB 3IJHB 3GLDA 5A2IH 3WXWL 1RZQA 3EJYC 3FRUB 4DW2H 1F4XL 3B3WA 1KZFA 4DVRH 3I3GA 4QRBA 3IMSA 5D7LD 1U8HB 1GIGH 1ETZA 1TQTA 3KH3A 2AJSL 1BFOB 4OLWL 4P2QE 3T65B 5CEZE 5J57B 1GJWA 1N70A 4LLMB 3I9IA 4Y2OA 4LDCA 4YSSA 1LE9A 3QZLA 2PPAA 4E41B 2DJ4A 2ITEA 5HTSA 3JV4B 1AQ8A 3PJNA 3KL9A 4CMMB 2WJ5A 4Y4FB 4AQEA 1I9RH 4NSQA 3WIHL 1R43A 1TR7A 3MN8A 1U3ZA 2VC2H 1MJJA 3LRSA 1OAYH 2FJGB 3ARBC 4X98A 1U8PA 2VNCA 1CL7L 3TBWA 3S3DB 5DQJA 5GZND 3UZQA 1W80A 1LQBC 3I3EA 5FGCE 5AW8B 1IVLA 3RJDA 4XOEA 3UYRL 1OCWL 4RFOH 2LHAA 3VDBA 2X6UA 2IWGA 5EZLB 3MUGA 2QKIA 1VZGA 3ULUH 2XZZA 1AKJD 2YD7A 4MWFA 4ZXBC 4Y5XB 2UXGA 4JFOA 4TLKA 1RKRA 3L1GA 3ELAT 2OZGA 2KHAA 5JHAA 2EXSA 3NA9H 4LEEA 1RO5A 2BP5M 4PS4L 5D96C 3MJ7A 1ZHNA 5L6YH 3N6YA 3GMLB 3S88H 4N2HA 3DV6A 2GK0A 4XOBA 4ZD3L 4TSAH 5KANG 2Q2EB 4MNGB 1Z9SB 2J55A 4PJDF 1QLEH 3KPOB 4JMNA 4MD0A 2Y5QA 2Z64C 3BQUA 1AD0B 5DFVC 1NAKH 1QYGH 3BPOC 3GXTA 3SPHA 1I1AA 4D9QD 2EDMA 1MIMH 3KDMA 4QEGA 3ZW3A 4KJQD 4DUWA 3L2LA 4F5CA 3N04A 2UZIL 3L3KA 1H9VA 5GGTH 4A1RA 3BP4B 4P9MH 3ZKMC 3MV8D 1KFAH 2W0KA 4M8RA 3OJVC 5B1AB 1QEWB 4ZUWB 2JLPA 2ZUQB 3OLDA 4JZOA 3R8QA 1IAIH 2H2PD 3NA6A 1IGML 2LFGA 2VDRH 4QRPD 2ROXA 4AYDC 3N1MC 4JD6A 2Q2LA 4WY7L 3QIUD 2GJZB 1OXYA 3FTYA 4Z0XB 3OMAB 5J1TC 4CBZA 3TO2B 1BP3B 1UENA 5H37G 2K7PA 1E3FA 4N0CD 5CJ5A 6PCYA 4JBSA 4ELMA 3IVKB 3OWCA 5F0LB 3C08H 2R51A 2MCG1 2POKA 4G9FA 3FSAA 1ZE3C 2B1HH 1F11A 1SUHA 2IEPA 3ILPA 3G8WA 3ARED 2X4PB 1CBVL 1Y0RA 3IMUA 2J88H 1XF5A 1J5CA 2WNXA 5D93B 5I18H 3WT4A 1NC4A 2IALA 3F6LA 3PHQB 2LVEA 4GSDH 3DK2A 3IMWA 3O8XC 3VMOA 1RULH 3TA3D 4G2AA 2FXFA 1DBBL 1KDJA 1VGYA 2BNUB 1B0RB 1NAMA 4WUUE 5IMLB 1NKGA 1ZTXE 3CZJA 1S9XA 4PXBA 4NXKA 1JGIA 3RB5A 3OLGA 1YYLL