4B6ZA

Crystal structure of metallo-carboxypeptidase from burkholderia cenocepacia
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
382
structure length
380
Chain Sequence
b'TLSITSNFDAGAIDVVSCDSPDAIRLRVRGDNRSEFAQWFYYRLTGARGERCVMTFENAAECAYPSGWRNYSAVASYDRVDWFRVPTTFDGKTMTIDHTPEFDSIYYAYFEPYSEERHAAFLGAVQQLPQASVVELGRTVEGRPMSLLTLGTPETAPKKKVWIIARQHPGESMAEWFVEGLVKRLAGWGDWAGDPVARKLYDRVTFHIVPNMNPDGSVHGNLRTNAAGANLNREWMAPDAERSPEVLAVRDAIHAIGCDMFFDIHGDEDLPYVFVAGSEMLPSFTEQQGKEQTAFIEAFKVASPDFQTEHGYAASKYKEDALKLASKYIGHQFGCLSLTLEMPFKDNANLPDERVGWNGERSAALGAAMLAAILVHVDTF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FAMILY M14 UNASSIGNED PEPTIDASE
molecule tags Hydrolase
source organism Burkholderia cenocepacia
publication title High-Resolution Structure of the M14-Type Cytosolic Carboxypeptidase from Burkholderia Cenocepacia Refined Exploiting Pdb_Redo Strategies.
pubmed doi rcsb
total genus 140
structure length 380
sequence length 382
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
A PF18027 Pepdidase_M14_N Cytosolic carboxypeptidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3120 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4b6zA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4b6zA02
4TNUA 1GYTA 3H8EA 2Q43A 4R6TA 6CPAA 1BPNA 3H8GA 4F9UA 5JGFA 4O23A 3PEIA 4DJLA 1ELLP 3N5FA 2PJCA 1CPSA 2QVPA 4OMEA 1VIXA 3B3SA 2PJ2A 4EMEA 4KSIA 4MRIA 2CTCA 3HLPA 4Z65A 1HDQA 3PB4X 1QMUA 3MRUA 4ONWA 4BD9A 3V38A 4LQGA 3NA6A 1Q7LA 1ZG8A 2POKA 2PE3A 4K3NA 5F09A 2AFZA 1F57A 3B3CA 2EK9A 4P4EA 3B3WA 1CP7A 5LYIA 2ZEEA 3IFEA 2C6CA 2PJBA 4OKOA 4R76A 5THWA 3I1UA 4MCQA 4MXUA 4R8FA 4OC0A 4WWVA 4UEEA 3NH5A 4MCSA 1LAMA 3TC8A 2V8HA 4JZ0A 1CG2A 1M4LA 1YMEA 3D67A 2PJ1A 4P4IA 2ZOFA 1H8LA 3KHXA 3LWUA 4GM5A 3B7IA 4FBEA 1ZLHA 3IC1A 4YWYA 3ISZA 1VHEA 3KR4A 3NH8A 4MCRA 2I3CA 4MHYA 4NGRA 4MHNA 1XFOA 4UIAA 4TWEA 3BI0A 5CBMA 2PIZA 4P4DA 4IK2A 1TKFA 3D68A 5LYFA 4PXDA 1XBUA 3D4UA 4F8ZA 3CT9A 1LANA 3PFOA 4X3RA 5HVFA 1TKHA 1HDUA 4A38A 2HB6A 4P4JA 2XEJA 4PXEA 1KWMA 1LAPA 1AYEA 4CPAA 4UEZA 3B35A 2JBKA 3L2NA 2NSMA 1FNOA 2AFSA 1TF8A 4ZX9A 3KZWA 2F7VA 3K2KA 4OC3A 1TKJA 3HUVA 3SI2A 3VARA 1LFWA 4FWUA 1DE4C 3D7GA 5J1QA 2C6PA 4PQAA 4FUUA 1NSAA 4JYWA 2BOAA 2O4HA 1TXRA 4ZY2A 1F2PA 3KQZA 4A94A 3SI1A 2GLFA 3PFEA 2PIYA 8CPAA 2RFHA 2QYVA 2ZELA 2AFMA 3S9MA 3D66A 3CDXA 3VATA 1FT7A 2ANPA 2ZEMA 4H2KA 2OOTA 4OP4A 3DLJA 3QNVA 4EWTA 1YSJA 1R43A 3NH4A 4P4BA 2V77A 2AFOA 3BHXA 1XMBA 2IJZA 3BI1A 1ARMA 4MMOA 3KI9A 3KQXA 4WJBA 2PJ8A 5CPAA 2DEAA 3LMSA 1Y0RA 4OIDA 3RBUA 1Z2LA 1YLOA 1Z5RA 2PJ6A 1TF9A 2HC9A 3SJXA 3GUXA 2Q51A 3PB9X 1BAVA 4A37A 3MN8A 5IB9A 3JRUA 2ZEPA 4DYOA 1CPXA 1CX8A 3PB7X 2IMOA 2JBJA 2XEIA 5DS0A 4ZY1A 4PPZA 4OC4A 3FJUA 3B3VA 3FF3A 3PB6X 2OR4A 2QJ8A 2EWBA 5HXDA 2C6GA 2PJ4A 4G1PA 5JM6A 3CPXA 3DGVA 4ZY0A 2V8VA 4P45A 2GREA 3D7HA 1CP6A 4AXVA 3WABA 3WC7A 3RZAA 4EFDA 1ZG7A 5HVGA 3BXMA 1Z8LA 4NFRA 3PB8X 2EK8A 3SI0A 3RAMA 4UEFA 3FECA 1F2OA 1RTQA 2PJ5A 4NGSA 5D29A 4OIWA 4P44A 4F9VA 1ZLIA 2PJAA 2BCOA 1YW6A 4P10A 3FX6A 3B3TA 4NGQA 3SJFA 2NYQA 3B2YA 5LRJA 5K8PA 1ELMP 1PCAA 3KASA 4P4FA 4RUHA 2V8DA 1YW4A 2ZENA 5LYDA 3PBEA 2FVGA 4P6YA 3S9NA 3SJGA 1IY7A 4PXBA 2JEWA 1Y0YA 3D7DA 2Q4ZA 2PJ3A 2WYRA 5D8NA 4B6ZA 3ISXA 2ZEFA 1JQGA 1PYTB 4UF4A 2GLJA 2F8HA 3FMCA 1UWYA 4NGTA 5LRGA 3T8WA 3K9TA 2ZEHA 2V8GA 4W9YA 3V7ZA 4FAIA 3D7FA 5HVHA 2BO9A 5K8NA 2PCUA 7CPAA 3CPAA 5K8OA 2PJ0A 1Y7EA 1AMPA 1OBRA 5LYLA 3SJEA 3TX8A 5JH9A 3WT4A 4NJQA 4X2TA 1BLLE 2ABZA 3IJ3A 2PVWA 3FEEA 4OC2A 2WZNA 3KHZA 5LRKA 2GU2A 2AFXA 3KGQA 4DUKA 3H8FA 3FH4A 4UIBA 2G9DA 4MHZA 2AFWA 5I4MA 2PVVA 1HEEA 2AFUA 2CF4A 2ZEDA 3IIBA 3PBBA 2O53A 3GB0A 3S9LA 5ELYA 4MHPA 1BPMA 3KR5A 1XRYA 1VHOA 3GLJA 3IO1A 3IEHA 2VL1A 5K8MA 4NGNA 2ZEOA 4YU9A 4R7MA 2IQ6A 2RB7A 1ZG9A 4NGPA 3FEDA 2PJ9A 2CIJA 2XEGA 4OC1A 4MCPA 4NJRA 2J9AA 1IGBA 4ZI6A 1LCPA 4Q7AA 3KL9A 3NFZA 2PJ7A 1CBXA 3WC5A 4IHMA 1R3NA 4ZYQA 4ZX8A 4PXCA 1QQ9A 1XJOA 2XEFA 1DTDA 2CTBA 2ZEGA 1VGYA 4OC5A 3FVLA 3VH9A 2C1CA 4A39A 3WC6A 1EE3P 4NGMA 2ZOGA 4IAVA 4X8IA 2PRQA 1LOKA 1ARLA 3PRTA 3IWWA
chains in the Genus database with same CATH superfamily
5I6OA 4M8UA 1SJHB 3QNYA 3ARBA 4K3GA 2IPUG 3OAYK 4JDTL 5FW6A 2CO7A 5D7IF 3ZKND 3NAAL 5KSAD 4C4BA 3OKOB 5I1CH 2MPVA 2WNKA 4B5PB 2VLRB 2ITEA 4I87A 1JF1A 4YGVB 4E41D 2V3EA 1LK2A 2Y22A 4C4UA 2VM9A 1OCRB 2Z3PA 2JCWA 3TCLB 1NOFA 4YSEA 4O23A 1NDMB 2CJUL 2BC4B 1M7DB 1EHLL 3QE5A 1ELLP 1DVSA 3B43A 4YEEA 3HNSL 3L08A 2GT9B 3UP6A 1H3TA 4IGBB 3ZT6A 4KQ3L 2XXGA 4H5SA 3ZT7A 2BMKB 2X89D 4PRIA 3OZKA 3BW9B 3BDYH 1HK6A 1VIXA 2XX0A 3N85L 1A3LH 5HSFA 4QRSB 3UYPA 4ZG1A 2GJ6A 5KBDA 2H9GA 1ZS2A 3D39A 2CO6A 4XOBA 4KSIA 2AABH 2R2HB 4HJJL 3HG3A 5C0FA 2YWYA 5IHBA 1HHGA 1CD9B 3AW5A 3KYNA 4GIAA 1NC4A 5D72H 3T1FB 2PCXA 1SJMA 3FB6A 3ULUL 1DJHA 4JRXD 2XTJE 3SDDB 3DUHA 2OW6A 4G8EA 1ZMYA 3L5IA 3MZGB 2WQSA 5JW4N 3VG9C 1OSEA 2EDXA 3V4PH 4XO5A 1I7ZB 1MRDH 2JNZA 4HD5A 4F8NA 3D2UB 1LRZA 1YEIL 4NJ9L 3ULVC 2P24A 2HKFH 1UQSA 3TTHA 3I50L 5DJ6A 5DMKA 5KVGL 4MFJA 4PSWA 2ZOLA 2E8YA 4PJXB 2FX7L 4DO6A 3WMQA 1IARB 3CX5K 5IB5B 1T2QL 2MPAL 2PPFA 3B3WA 4I18C 1XOVA 3QIUA 3CFKB 4PYHA 1HDMA 1G4RA 1MKFA 2ZOTA 4X42A 3MLTA 5D1ZI 4KUCD 3PXHA 4RX4A 3VRLE 3UDWA 3MLZH 2Q86A 3VGGA 5L6YH 1AP2B 4GO6B 3FQNB 4NP4L 4OW6A 5FCSH 1QFWL 1UTDA 2OJZH 1TNNA 2FJHA 3IDYC 4WU7A 5EFIA 2ZWYA 2Z0BA 4NZRH 4G70B 3GJEB 1QA9B 1KT2A 3V7AE 4MBUA 4UCNA 2E56A 2CJSA 4AVKA 3LSOA 2K1MA 4OZHB 3QEUB 4R7LA 1KOAA 5C09A 3I6LD 4FHJA 4G6JH 4NGRA 4FOMA 1BJ8A 2FLBT 1KBKA 1CGSH 4CN1A 3WTVA 3KLHD 4ALAC 2VDPB 4ONFH 3L95A 3ASWA 3T09A 2K6YA 4NHCH 4Z8FH 3MJ8B 1UURA 1AH1A 2J8NA 3ZL4L 3PABA 3FRPG 3WLBA 3CLWA 2G60H 1WP6A 2JK5A 4BFIB 5I1CL 1QKZH 1D5MB 4QAWA 2CIIB 1QABA 2DM7A 4ZQTA 5DRNA 1Y7VA 3AITA 4PRHD 4BXSV 3G6JE 5ID1A 3GFUA 5FO8A 5EU6A 1DVUA 1KEMH 3MV11 3QJXA 4PJEA 4KOXA 4LFHG 2R9HC 1DQDL 2FSEA 5CZVH 2XWRA 2QVFB 4PXEA 1AO7E 2YJLA 2YK1L 3QIBC 15C8L 5AW7B 2ATPB 1W72L 4KMTL 1IZJA 3GSOA 1D7FA 3TZVB 2ZOUA 2EE9A 4MJIE 4U6VL 2I9LA 4ETQA 3IKKA 3SGDH 3ZDZF 1CDBA 1KV7A 1BOGB 1JGEB 2KKQA 1I9RH 1NBZB 1UFGA 4WVRA 2O6EA 1TF8A 1E40A 3TNNA 4CADA 1G5GA 5ACZB 3N43F 2J6WA 4XHJC 4CVZB 3IAPA 2V2XA 4BKSC 3LNEA 5D7LE 4BH8A 3CDCA 2DZEA 1D5XB 1HHJB 2CBOA 2K9UA 4KTDH 4L8CB 1KN4L 2GITB 4ZOAA 5INDA 1MVFA 2E46A 2XWJA 1OGAD 3M7OA 4QCIA 3MV01 2Z7UA 4S1DC 4X6BA 4AH2B 1CJWA 1W72B 2MOQA 4HIHB 3VXOA 1CFQB 3VXSD 3ZE2B 2XA8L 4HKXB 1GOFA 4YBLB 1ZDQA 3MOAH 4N90E 2OYKA 4HKBB 2R1YB 3SIKA 4HUUA 1DJWA 4M7ZC 1R3HB 3MUGA 5KS9F 1PW3A 1IGML 4U7KA 1SGKA 1I1FB 3IU4L 1I1CA 5MENE 4QYOA 1C5BL 3K2IA 4QJ5B 4W93A 4H26B 4FQXD 3MNWA 5E2TH 3CVHL 4RZKA 3C12A 3MI6A 4U3CA 3OJ2C 3PDDA 4AKQA 4AIEA 3C8KB 3RGVC 4G9FD 1TQBB 2B4BA 5E1AB 3HG1A 4GP5B 3BHXA 3DPBB 4QJ4B 4PRPA 4B5EA 4WJBA 3CFUA 5KSAA 1NMAL 3BIKA 1U9KA 2DEAA 4DIXA 2ODHA 2I07A 4UQEA 5C82A 1A6AB 3BAIA 2AMUA 1VADB 3KPSB 4LRNL 4ZD3L 5E00B 1YLOA 4D0DA 3G6DL 2BEIA 1JAEA 2UYLB 3W3BA 3T65A 4GUPA 2MQ3A 3BUDA 3WIIL 3FRPB 5IROD 1XR9A 5L4JA 3AFLA 3JRUA 5EUOA 4P3DA 1X10A 2GEEA 2ZEPA 2H6PA 4JN1L 1B90A 5KOVC 1OB1A 4LLMB 5IESH 1AKJB 1TCMA 2KQNA 1S9WA 1CGUA 4JY6B 2NR6A 4KJPD 4BFFA 4OCRH 3U0PB 4MCMA 3M7FB 3EG9A 4OC4A 5F9WB 5CJXA 5ANMB 2OR4A 3CH8A 32C2B 4MJ5B 4ZUWA 2UVEA 4G8GB 3V6FB 3DXAA 5I76B 3TV3L 3DO3A 5CJ5A 4I18A 2BUEA 4OZGF 2BHUA 1BAGA 1CLYH 1AFVL 3GIVB 3NZ8B 2ZX7A 4LL1A 5E9DA 2PPDA 3V7AG 3M86A 4FFYH 3WC7A 1JZGA 2C9QA 4G8GD 2YNDA 3NJLA 2OSLA 4WJKB 3STZA 3QQNA 4KBPA 1LM8V 2CK2A 4NQEB 3QJZA 4GSUA 4XPBH 3KDPB 3UTSD 3PB8X 5IVNA 4R83A 3QG6A 4RCAA 3QEQA 3SPGA 1WCQA 3PWNB 15C8H 3BAKA 4F0YA 5FA3A 3VQ2C 1TENA 4YC2B 5KYXB 5MEPA 4JB9L 4DTGL 1RD6A 1FV1A 1F4YH 2UX7A 1KG0A 2L8AA 3SD5A 1ZLIA 3DX0A 3PS6A 3ZDYF 3PNRB 5T1LA 5GRUH 3IRCA 1JWUB 4HCRA 3WELA 4YBQD 5DMJB 1IJNA 3GTTA 1GZHC 2Q2EB 4X8GA 3EH5B 3KWWA 4XNYL 2H32H 3KLQA 2NYQA 1XMWA 3MRKA 4NXSA 4XHQA 2H5UA 3O6KL 4N28A 4LBEB 1XGYL 3NCWA 4KK9D 3BP5B 2W07B 2YUZA 3ZRCC 4C8XA 2FCKA 5HH1A 5TE7H 3RPBA 4MWFA 4K7PH 4ZXBB 1IBGH 1U8MA 2AEQL 3DRTA 4DKFL 3DIDA 4U4IA 3ARUA 2QPFA 3FT3A 3SOTA 2JJTC 4FNLH 2H8PA 4ZUSB 3S98A 3X3FL 1G7HA 5LVEA 2V7HA 5ENWA 5ISVA 2LAAA 4KXDA 1PX3A 4JFOA 1QVOB 1SF3A 4PJCF 1BDYA 1JXKA 5IMOB 1EV2E 1SY6H 5FS5A 3OV6A 5AB2A 1A4KB 4LCWA 5C0AB 4Z9KB 5KYYA 4P2QB 4AUUA 4FEMA 1YN6B 4IIQC 3V9FA 2VW7A 2W65A 2E7HA 3VGDA 4ELMB 3VXNB 1ZIBA 2ZEFA 3L3JA 3C6LC 2O5ZH 2F7OA 2KLRA 1R47A 1N0XL 4WI9A 1ADQA 1INEH 2AK1H 2G0KA 5EV7A 4FFVC 1D5IL 3PL6A 1N7MH 2F1AA 4C56E 3TYFA 2HJKA 4X6DA 4XC1H 3RWGB 1NANH 1Z9PA 5HVHA 4FADA 2EXYD 35C8H 1KIRB 4PGDB 1QRNA 3PQYD 7CPAA 5E2JA 3F6JA 2AXGB 3L3OA 2BDNH 1ZHLB 5BCAA 3T2OA 3MR9B 4XPTH 1BM7A 1Y7EA 4FZ8H 5HI4D 3SZ6A 4DGYH 3NCXA 1R46A 1AKPA 2VLKA 3EH4B 3V2AR 3QRLA 5EOQL 3ZHLA 3GS0A 4GBXD 4HFWA 2EVFA 1KACB 1A2ZA 2ZCHH 4UM9B 4MQTB 1FGVL 1VIWA 1NICA 5KW9L 2CNYA 1QSFD 2V0AA 5AW4B 5HJ3A 1PQZA 1GW0A 2PW2A 1PFOA 2XN9B 4QTIH 5ISZE 3QFGA 3KHQA 4OI9A 1NDGA 4M3JA 4FCHA 2X4PB 4XNQA 4EKJA 1J1OL 1W0WA 4GBXB 5E8OA 5JDSB 4XMVA 1CGXA 1G7LA 2OMVB 2VL5B 5HYSB 3VXMD 2PVVA 5B1JA 5I6LA 5B3JF 5B7MA 2R83A 1NCTA 1ITCA 3MLVH 1A6UH 4NKIL 4D9RE 2G0LA 3PDOA 2BSSB 5LAXA 4B7IA 1KB5L 3FW6A 4P4KB 4XE5B 3WHXA 2I32A 3O3AA 1YX0A 2OI9C 4R4ND 1J8SA 4OBRA 4JHUA 3O9WC 3TBBA 3OGOE 4G6JL 2ZW6A 1R34A 3C5JB 4XNMB 2MNUA 1TQCC 1HIMH 1M9SA 1Y0LA 2Q3XA 3QXAB 2XWTB 4JDZA 2IQ6A 4R7MA 3CJJA 4PTUB 1SN2A 1T7WA 1DVFC 4V2CB 4JDEB 3TTSA 5DJ2A 5J5EA 1OW0A 4YO0B 5C86A 5IBLD 2MRYA 7FABH 4J4PA 3WY1A 2IG2L 2DIJA 1F90H 3BOVA 1IM9D 2CLRA 4M85A 1N8ZB 3C8DA 3GLEA 3HJ0A 5C08E 5FGCE 4XGZB 1GKEA 4HALA 4JPVH 3W9DB 5CAYB 4E9WA 5JOEA 2XEGA 1MCPH 2HKHL 2ZKWA 4MQ7A 4N2GA 3SGDI 5C0DA 7PCYA 3GXNA 4HF5L 1MRCL 1LCPA 3KWUA 3NMEA 2VL4A 5BVPH 3P9MA 3CPLA 3BPOC 3GXTA 4AGLA 1NAKH 3VI3E 4IHMA 9CGTA 5E6SB 2E9GA 4HS6B 3RWFA 1LO4L 4XBMA 2WY3B 5B39A 3KBFA 1HZKA 5HHXL 5HDLA 4NBZB 1M4KA 1OPGL 4YHOH 3VD1A 5ES4B 5HYJE 4WJG3 2G2RB 3BKMH 1SBBA 4KDTC 4NZDA 3GMPA 3V4PL 4NUGH 5D7LD 2Y2WA 1QSEA 4LSRL 1RKRA 1XCTB 1IJ9A 3MMEA 2CCVA 4N2NA 4E9VA 2ZOGA 4LSUH 2VLMD 3UTZA 5MENA 2PNDA 3HS9A 1VLXA 1KGYE 3DVNB 2CKBL 5FA4A 2EC9U 3PP4H 1DQIA 5DS8A 3I9SA 1GYTA 1W0VA 4CVXB 3O8XB 2HVBA 3QIWB 3RVUD 1MJBA 3VXMA 1MNUH 1UWEH 1JGUL 1VESA 4QTFA 3BAWA 3BKCL 1GH7A 3UAJA 2D9QB 2X5PA 1HKLL 1J1PH 2P7TB 2R23B 5IHLB 3UTSA 1HQ4A 3LV3A 5ICZB 2YAEA 3I75B 3U0WH 1A4BA 5IBTH 2FX7H 3L54A 1CDCA 4HGWB 2OR8A 4AIZA 4HFUH 2H41A 4WFHE 5ADOL 1U33A 1VFBA 1YEHL 3ZMNA 3F7QA 3LKNA 2A0LC 3KJ4C 1G7JA 4NRYA 3RZCC 4CAEA 1R3LA 5BRZD 1MHEB 1H3PH 1I8LC 4I3SH 3UJJL 3QCUL 1I7TB 4B41A 1FIGH 2QQLL 3US0A 3BUYB 3JTBA 3NABL 5IHZB 5F9DC 4BD9A 4MMXA 1FNLA 3K9UA 3Q8FA 1U8NB 5FYKD 4XN1A 1RIHL 4Z7WB 1VKXB 3ZZIA 5EU6E 1X7TA 1XIWA 4YXKH 1A2YA 2BXZA 2AJUL 2J6EH 2VDMH 3PWPE 4FS0A 5TDOB 2Q8BH 3OXRA 1G9NL 3FFCB 4FFTA 2Y5TA 5FHBL 2A6IB 4Z3FA 5D9SB 2Z3FA 3JWNE 3IGRA 1FO0H 5EUKA 3GMOB 1ICTA 2LLLA 3Q5TA 2GHWB 1CGSL 2OSYA 2VLRD 3GDCA 4W9HC 1KB5B 2WQVA 2HFGH 5DC4B 4B27A 4NHCL 4RDBA 2C1OA 5EOTB 4Z8FL 3P77B 4TRPH 3IWVA 3AXLA 3SPCA 4BFNA 4YXLH 4XWGL 2HUHA 3MXVL 3TX4A 4OZIE 3TFKD 2BW4A 2ZYHA 2WLZA 1TJHH 2NX5B 2V5YA 5I1DA 9PCYA 1FBIH 1HC1A 4RFEB 5JXAL 4KRLB 5IWLA 5D1QB 5DC0A 2L7JA 1H3PL 4WV1B 1F6FB 4QT5A 1U4EA 1JFQH 1IKNA 5FO9A 4FBEA 4Y9EA 4ORZC 3MRJB 4XCFL 5LBGA 1OTTD 3MRGB 3ARFC 3W39B 1F8TL 4IOIA 3RZCD 4I1RA 3T0EE 5HPMB 4DGYL 4L5FL 2N01B 1BZOA 3N1PC 3M1BB 1JNHB 1E2ZA 1M05A 3AZUA 5BO0D 5LNDA 4ETYA 1G7PB 1H8OA 1KB9J 4NQSB 4QRTB 2MFNA 4KPHL 3MACH 5HHQB 4EZLA 4JG0H 3QK0A 3A6CH 3F7YA 3I6LE 3KWVA 1ACXA 1FF5A 3IDMB 2VTFA 2ZP9A 2DIEA 4IK2A 3N40P 5GSRA 1YEKL 1ODAA 1BVNP 1QYGH 1WJ3A 2A6JA 2IQAB 3MCKA 3MCYA 2XG4B 2CD0A 5CIPB 5C0CA 1KV3A 3QXTA 4C57C 2O5XH 5KG9A 4QRPD 3D4UA 1QBMH 1WEJH 4RWHA 5B22A 2GKIA 5F44A 5BMFL 3L4WA 5FDWA 5FLVA 3LZNA 5HVFA 3QNZA 3A21A 2VEZA 3SY6A 2TSAA 1ORSB 2DLGA 3HE7A 1N2RA 3L5XH 2M26A 3DVIA 1AO7D 4RMSA 2AEPL 1S7XB 2EDLA 4P9HH 2NXZC 4HLZH 4UU9A 5AL8A 2EDKA 5HYEA 4OVVA 2QHLA 3WGVB 3ZE2F 2L0DA 2IWGA 2JFCA 2ZG2A 5D2LB 4F3FB 4EIBA 1FGNH 4LLUA 2CWRA 1U8OB 3G6AB 2G5UA 3B2DC 4PLOB 2QECA 2VABB 2ATRA 3RFZB 3NIDF 5D1ZD 4OGXL 1KCRL 2C4XA 3VI4B 4Z7QE 2FATH 3DJ9A 1Z8XA 1LFWA 4K8RC 3NZSA 1YEJL 2CG9X 4FXKC 2YEZB 4LPUA 2WYIA 4F33A 3DX3A 2BOBA 2F6AA 4WWKA 3RWHB 3ZRFC 4K5LA 4LPYA 3RGBA 4S1DD 3NSDA 4L4VB 1TXRA 3MA9H 4I85A 3VG9B 4BWWA 3I3BA 5IEKA 3MV7A 3PP3H 5F46A 3VXSA 4PJBB 3VYPA 3SPIA 4XH2A 5B8CC 2J21A 1QFWM 2GCYB 4LEXH 4P2OA 4NPJA 2GJZA 2OTWA 3VWJC 3F5BA 2NZIA 2FE7A 1Z9SB 2Z4QA 1JGIA 1OGSA 3EYOB 1RJZA 2GIYA 4FQLL 4Z3IA 2EYTA 2FT8A 2VQ1B 1A7BA 4ZAKD 5FKAA 2IO5A 1BZ7B 3PWLA 5HDWA 1U8CB 3D66A 2RH0A 1RLBA 3QFJE 2AZAA 2P28B 3BKYH 3C60B 4W9FC 4B9IA 4H2KA 4OP4A 4N8VA 2ADYA 3KLDA 1JHTB 4ELKA 4LSVL 3QAZB 1E4XL 2XPGB 5BZDB 4DPCX 3P69A 1XGRA 4UAOB 4EPSA 2J6EA 3OLDA 4WJ5A 4ANVA 2ZXGA 5C0IB 3SDCD 3OWEA 3THMH 4URTB 3KI9A 1CDHA 1N64H 3DIFA 2CQVA 4XNZB 4BUHA 2ZXCA 3CN3A 4CGMA 3U6XS 3CUPA 4AQOA 4CAWA 2JKWA 3NSYA 1KCKA 5KUKA 1FVEA 3FF8A 3PP4L 4K7FB 4OUUA 4J8QA 2IFFL 1NIDA 2XYCA 4GXVH 4IBSA 3EJSA 3SN6N 3IXTA 3MUZ1 2AV1B 1IAIM 2B5IC 5JHLL 1CXFA 4XH2B 3F8KA 4QGTA 3VXSB 5D6DA 5GRYA 2KUTA 3Q2VA 1MY7A 2WJ5A 2ZW5A 1Y6MR 43C9B 5JUEH 1CPXA 4ZUVA 3VFPB 3VU2A 1E2VA 4GLRH 2K8QA 5HHOB 2GTZA 2PR9A 2OTUB 2CHWA 4RDQF 3TCTA 1ZANH 3U2IA 3D52A 5ETUA 5J9PB 4LDLB 1LWJA 1Z9NA 3L17A 2KS0A 4EDWH 1LK3H 2Q9OA 3OSVA 2VABA 1U4FA 4UBRA 4RMWA 2Z3KA 4H0IA 1QBAA 2EWBA 1UZGA 2E4TA 5KSBB 4G1PA 2OXHA 3HHMA 5JM6A 3DC0A 2ZX8A 3LKOA 1MCPL 2HKHH 4G9FE 3RHWF 2ZSWB 3FCUB 5GRJH 5D70L 3D85D 2ADGB 5CILH 2CRZA 3MFGB 2UWEB 1KBBA 5I1AB 2R0LH 4L0PB 5EN3A 3RY6C 4PRHA 3TP4A 5HVGA 1H19A 1GVIA 2TAAA 1UB5B 4XO8A 4X9FA 4D8OA 2Q6WA 2WANA 1Q0XH 3KPSD 4M7KH 3FQXA 4IRZA 2O5NA 3B6SA 3G04A 2YA2A 3WE6A 4XN9A 3GRWL 4FQXB 1HEZB 1F4AA 4ZAKA 3WL9B 1D6EB 2QVMA 1G7IB 2RQ8A 4OZ4A 4CC0A 2QSCL 4A2GA 4ZMVA 2DQEL 1KULA 3BKML 2XG4A 1JCVA 4X5WB 4U3HA 5C2BL 3PCYA 3QDJB 4LLVA 4LSSH 3TOPA 1S7SA 5A2CA 3LN4A 4KZDL 4WKXA 4BE5A 2H7WA 1TKWA 4LLVB 4Z77B 5FYLE 2APSA 2AEWA 5BQ7B 5HMNA 1JNHA 2Q8BL 2AQ2A 4RIRA 3CDGA 2GPZA 1T6VN 1MCIA 4NQCA 3QEHB 4DESA 3QUZC 5C8JA 1TZHA 3FBQA 3O6FC 4TUUA 3VI4E 1UWXH 3BJLA 4AK2A 5DUML 4AIOA 4A30A 2BHZA 1AY1H 1UD4A 2I27N 3TH2T 3DX2A 4HUNB 4CNIB 3R06B 4Z0XA 2UWEA 4Q58C 4FZ8L 1NCOA 1T21A 2D3LA 4OLEA 2QV2A 4ZZFA 1HH6B 1I8MB 1TQBC 5D7EA 3P2FA 3BH9A 4G6KL 4Q36A 5C0JB 5IW6A 3AXLB 2DMGA 2CR6A 1HJCA 2N0MA 3MOBL 2C1OB 2JWYA 2LVEA 4RWYL 4AEIH 5GZNA 2JCCA 3GSXB 1QW9A 1QSNA 1EO7A 3GMRA 4KI5D 4TQEH 5CEZD 3KHOA 3P4NA 3RKDD 1EAJA 1B88A 1NAML 5MI0C 3GJFH 2X6UA 4QRPA 2RALA 1CGYA 3BUQA 4FNUA 1TYEB 4K71C 4NJ9H 1H9VA 2WSKA 3I85A 4PJBF 4RSYA 1KFGA 3VFMB 4C56D 3VFPA 2YIHA 43C9A 2VMEA 1ZA6B 3FFCA 1CTMA 3OXRB 5I75B 2VERA 2IV8A 5ALBL 3R19A 2YD9A 5K8OA 4KRNA 1FFNA 3TS8A 5E4IA 4NXKA 1V8HA 2IV9A 4YLCA 4MMXB 4LCCA 2HT2C 1IEBB 1JYNA 1TZIB 2WZAA 5AUMB 3NOIA 4JQIA 4L3ED 2B2XL 4YHYC 1FFPB 5E6ID 3FSWA 2WTOA 1UXMA 1UA7A 1V27A 5LGKA 1HNFA 3N55A 3V0AC 3KHZA 1ILSA 1WGOA 3TT1H 2ZF8A 4TVSa 1J5DA 3F5WA 3FHAA 2XY2A 1VFBB 2DQJH 5CJQL 5F7DA 3RWDB 1JZIA 1NGWB 2ZE0A 5D93C 3GSQB 5LAPA 1D9KB 5CHNB 5GSVA 2VDMB 4MHZA 1KJ2H 1MRFL 3BH8B 4PRDA 4R26L 2WYHA 5J7CC 4AEIL 3TASA 5ISZD 4JUTA 3GSNB 4HA1A 3BAXA 3D9AL 1XH0A 1Q1JL 4IJ3B 3ATAA 4ZXBD 1GTFA 1J5CA 3QORB 3GSRA 3MV7D 5DO2D 2MCG1 3FB3A 3OKDB 1BZ7A 3PWLB 5D1XC 4HS3A 3BUIA 3L13A 1NGPH 4U1JA 3VRJB 4Z7QB 2Z4QB 1Z9SA 1DJGA 2RTTA 4ZO6A 4ONHB 3SYCA 3QJTB 5D7JA 2YGWA 3BRDA 3MV7B 5GS0D 3DNKA 5IEKB 1A22B 1WS8A 1E0OB 1I7RB 3HS0B 3T5WA 5AB0A 4OTXH 1NCCL 3NK4A 5IJBC 1ZGLM 4NT6B 2DXQA 4PWEA 4IHBA 1JGLL 3P3SA 4RGNB 3MMEB 3BC9A 2BOBB 4WWKB 4GIOA 4B60A 4LSPH 3ZKSD 2EVGA 4C55A 1RJYA 3BP6A 4OD3L 2Y6SC 1IZKA 4FNPA 4MVBD 4HZ1A 5DGQA 1UWXK 3FEDA 3N85H 5KSBF 4X8JB 2G2RA 1C5DA 5FGCB 1VDGA 1B3JA 3RFZA 3P30L 3CIAA 2YMOA 3L3DA 3K74B 4ACPA 3L7EA 2E5EA 2F15A 4RGND 4Y4HD 4KZDH 4OC1A 4DGIH 3BGMB 1JS4A 1IYLA 2Q5BA 3MLRH 4MMZA 3ZE1F 2H2SC 2RCSL 2ZOOA 1BD2A 2FYVA 5DR5L 3UCQA 1E30A 3NIFB 3H2WA 4IRZL 4LFHD 4OGQC 4QWWC 3FONA 2IWFA 2QKIA 4ZOCA 2IGFL 4B10A 4NHUB 1IM3D 2NW3B 1GSMA 4HJIA 1J4JA 4X7FC 5C0CD 1YDPB 2YNEA 3B8GA 4NZUH 3S5LG 3FB7A 1YRKA 4M7JH 1SVZA 3OHXB 2JKNA 1PL3A 1F58H 3N50A 3QDGE 2ZX5A 3L9YA 3V6BR 3WE1A 2MNWA 3BLPX 3SO3C 2LABA 4YXHL 5LXGH 4XNAA 5KG9B 4KQ4H 2IBBA 3L9RB 5ESQA 3EDFA 1YEHH 3SJVE 5IMMB 1NCWL 3AS0A 2PYEE 3VD3A 1YREA 4XBPB 4PTUA 4OKVB 1JK8B 1KC5H 1XGTA 3RB5A 1D5IH 1FC1A 4L2LA 5G4MA 1JMZA 1KCUL 4NUJB 3V6OC 3DXAE 4UCPA 35C8L 3GKWH 1UT2A 2AJVH 3M1BA 5E99H 3V5HA 4HUWA 1ND0A 1X5YA 3QULA 1PS3A 1OQXA 3SODB 3VVVA 4DN3L 5DSCA 3SCMB 2EXWC 1J18A 3CC5A 4PJXF 2JQAA 1SOSA 3MRJA 5F3FA 5IY5B 4KLVA 3U82B 3H0TA 3W6SA 1S7NA 1RU9H 4AKOA 1ETJA 4PJDA 4Q9BA 4J2XA 4HAKA 1DVFD 2DI9A 2Y7OA 4OMEA 1F97A 2Y7MA 5LUMA 4EIUA 1PSKH 4BEIA 5K5YA 2X4PA 4XNQB 3VXME 3LQMA 3R1GL 5L8JB 4X9YA 3RE0A 2JDDA 1USZA 2HT4C 3B9EA 1KJ2A 3WNIA 2EJ1A 3HKFA 4PHXA 4CKQA 3GM0A 1XVSA 2A0LD 3RGHA 4ZX3A 3FUDA 5SWZA 4Z3JA 1TLMA 3AQYA 2E8ZA 3AXIA 1T4KB 3HA0A 4H8HA 2PO6D 3VFWA 3I74A 4NKDA 3MRUA 4UA3A 2F54D 4HP5A 4A7GF 5D2NE 5DJYB 3VG0L 2YUWA 3PIQA 2VLJB 4ZTPH 2YQ3A 5D9SA 4DP6X 2ESVB 3HG1E 4PGDA 4NN7B 2OS7A 1WT5A 1HXMB 4CMHB 3N1GC 4OD3H 2POKA 3S6FA 5SV4A 3HAEB 2OMYA 1X9UA 1IILE 2ZOWA 3DYPA 5CEXA 4EI5B 4POZD 1W72H 3HZMB 5J0BA 3G08A 1BOBA 2VLJD 2K70A 5IHZA 4U1LB 4R7DA 2AAVA 3HRZC 1MIEH 2NR6C 2Y2YA 2F7RA 2EINB 4WFGE 3UG3A 3VI3A 1DVYA 2I60L 3BPNC 3FO0H 1UWGL 1FVDB 4UIMB 4P2QA 3LKNB 5A2JH 3G5YB 4OC0A 2IGFH 2G4GA 2QDWA 1R5WA 5IBLC 4DN4H 1GYUA 1JZ8A 1AY1L 2HTKC 4KO6A 2F1EA 4AWJC 4X4XA 4NZUL 4HHAA 4AXWB 2XV0A 3EC4A 1JWSA 3BPOB 3KCPB 3MYJB 3ZZLA 1UJTA 4WSJA 4Y2LA 1UA6H 2Z0ZA 1I7UA 1NCAH 3KYAA 1ZLHA 4LZKA 2IVFC 5HYQB 1ACYL 2DAVA 2DKSA 2YXWA 3K91A 4IOSA 4K55A 3QHZL 2HT4D 5T3ZE 4F7KA 3KR4A 3LXAA 1JP5A 3R4DA 2AQ1A 4LVHC 4G9DA 1L9TA 1QUNA 4AGNA 5AZEL 3JUYA 4NO5A 5HDRA 1NLDL 3EF4A 5DVNA 2VUKA 3WEMA 2VR9A 5C71A 1KTJA 2JTYA 5DGRA 5BVJB 1D7BA 1LO0H 4FULA 2C9VA 4LOVA 5GGTH 2AV7A 4Q6YA 2VDOL 2DY2A 5DJ0B 3PFQA 2OCFD 4JE0A 5I1KL 1ESOA 3GY9A 3FN3A 1P6FA 2Z31D 2ZD0A 4Y4KD 1JDAA 1OGAE 2B5GA 1XCTA 1KLGA 2BCKB 3G6DH 3VJ6B 4P23C 2BIMA 2HCZX 5KYXA 1GJIA 1OZPA 3FU6A 2D7TL 2OCCB 1TOXA 4NB7A 3WDJA 3TCXA 3FU5A 1R3KB 2HMID 4L3EA 3VXRA 3QG6B 5KBNC 4NRZB 1I1YA 3A6CL 3IJEA 5DUPH 4A32A 3IN0A 3DETC 3RFRA 3I6KA 2AJSL 3HFMH 1AXSA 1T4WA 3ZPDA 4NSQA 2J55A 4K23H 5E9NA 1PZSA 1ZDSA 3CK0H 3V9CA 4NZFA 1XCWA 1J0KA 5L0QC 2JBKA 3V5KB 1BEYH 2X4NA 4GO8A 4KY2A 3GSVA 3WFEL 4F9PA 5C0DB 3V8IA 1Z0NA 1MRFH 1Z5HA 4G8GA 3V6FA 2G3ZA 5TDPB 4WI4A 4WI6A 2JJSC 4ZRGA 4E0RA 1TYRA 4IKIA 4EVNB 4QRRE 4MZ3A 3U0PA 4BCXA 3TFKC 1CBVH 4JY6A 1S9WB 4NRXB 5I16B 3WY3A 1QFUH 3LPFA 3G8WA 1WAEA 4PQAA 3TO7A 4AQ1B 1ZTMA 2H6PB 4JO2L 1NSAA 2DYPD 4GKOA 4JYWA 4L8SA 4HUCA 1Z5LA 3TBYA 4ZMOA 3FB8B 4XPHL 3FRPA 4OGYH 1X5ZA 2K7PA 3C5JA 4PJ9C 1P53A 3CSPA 4XNMA 3DVGB 3IMTA 3HI6H 2EIZB 4L9DA 3EAKA 2FWLB 4QKTA 3O3AB 5F96L 4PG2A 2NQCA 1CFMA 3RVVC 2H26B 5LAXB 4Y4KC 3S3SA 2XKNA 5A6IA 4WZ9A 2W9DH 2ZOKA 3HCVA 2YUVA 4RESB 5D5MF 4KQ3H 2VXSL 4DPAX 4JFDD 4DN4L 5GHWL 3SDAA 3VB8A 3CK0L 3UJTH 2W80C 1G7LB 4LKXB 4EBQL 4UFVA 4KV5E 1OQOA 3DPBA 1ZLVH 2ESVE 1JN6B 1GYCA 2VOTA 3OR6A 4XX1G 4XOCA 5E1AA 1NDGB 1KTKE 2NTSP 1H5BB 4KQ0A 1OXYA 1RVFL 4GQRA 3APMA 1PD1A 1Q72L 4JS7A 3RBUA 1OPOA 3C5ZB 4RRPG 2W81C 2MTPA 3ZDZB 2J5LC 5IQ9A 5C6TH 3C08H 1SHWA 2UXTA 5CXPA 4U1MA 1UGKA 2WXQA 2FX9L 4IRJC 4Y2OB 5FK9B 4O51A 4Q38A 1L0YA 1YQVH 3CSTA 1C5CL 1OD7A 4CRPA 1NKOA 1JHKH 2NY0C 5IR1B 2YD3A 3UPRB 4OSUL 1XGZA 4DYOA 4UUJA 4GAYA 3PL6B 4JO3H 4PP2B 1RQ5A 4PMFA 5DDHB 4M1DL 2WLKA 3UEZA 2PWDA 3EOBA 2JBJA 3ESUF 3O2VH 1HHHA 4JZJC 3ETBF 3ZY7A 1DQJB 2KBGA 3I9GH 5JQHC 3MGOA 3VXNA 4ELMA 5EIIG 1MFUA 4LSSL 1R75A 3B2VL 1YN6A 5HXMA 1U3HB 1ROCA 3FCSA 4G2AA 2PJ4A 1FORH 2ADFH 1U8QA 3HNVL 1F00I 4LSQL 1VEPA 1VB9A 2H32B 4LCWB 4KTEH 3OKMB 2YPLA 4POYA 4ETQB 4X2UA 1OE3A 5BW7C 4RAUA 5EOCJ 3GNML 1TPXB 5CGYC 3MNZA 1TVDA 3IDUA 4Z7VE 2BIPA 2O1AA 1RIVH 1ZK9A 5AW0B 3T3MB 4G8IA 4ECNA 4HV8B 4TQ8A 4DKAA 2BHYA 2V7HB 2ZF9A 2BFGA 3QR2A 4U6HA 2EO7A 2H8PB 2VSKB 4MMZC 2WPXA 3Q01A 4XPKA 3ABLB 3CFEB 4GIPD 1U3ZA 1DN2A 3GZKA 4FLRA 3SPVB 2GABA 1OSPL 2XBTA 2K7QA 3Q13A 2Q7AA 3Q5OA 1DBJL 4NGSA 2WB1A 2IWEA 4P44A 1CYWA 1KGWA 5JMOC 4X4YB 1YW6A 1OT4A 2WOYA 1I8IB 2APFA 3QZWB 1IB1E 3FB5B 1NPNA 3MJ8A 4YHLH 4I7ZC 4NGQA 4U5YA 2XZAH 4XWOD 2AGJL 2QL1A 4ODUB 5EU7C 1FV1B 2ZXWB 4DCQA 1F4HA 1MCOL 2CUIA 3E1F1 1MI5B 3B2VH 4P46B 5C09B 3CHQA 1SM3H 4PB9L 3PWNA 4Q7DA 3QEQB 4KOUA 3DI3B 1A6WH 3RIFK 1YC8A 2VO5A 4QRRB 4KTYA 1OWRM 4GG6F 1KSRA 5L88H 5LBSL 2VW6A 4ADGA 1RP9A 3VFUB 4OFYA 4KXCA 1FE8L 4XB3A 3UACA 2EVIA 2VDNH 3BSZL 3SJGA 4P57A 2J5WA 2I24N 5FXCH 4EN3B 1CVRA 1EVTC 4I18B 1I12A 4MFHA 4XZUA 1U3YA 2XVKA 2F7IA 3K72A 2BXYA 5I9QB 3S34L 1RHFA 1KBGL 5ANMA 4G6FD 4KI5E 5CEZE 2B77A 5I28A 3JWNG 1UA6L 3EG9B 3QIUB 1KTLA 1QWHA 4JDTH 2ZWSA 5AZ2H 5CLZA 1J87A 3T8WA 2Z8WC 1DQMH 4U49A 4TOYH 1T0NB 3IDYB 1JTPA 2V8GA 2XQ0A 1UQSB 2VB5A 4CRYB 3IDNB 5IK3B 5IMLA 4F2EA 3H4QA 4M93B 1MCOH 3DGGB 5AZUA 1O7VA 3KGTA 1J05B 3T65B 4L3EE 4QHKJ 1E7VA 4F7EA 4PLKD 1MDTA 1IT9H 3G9AB 2HRGA 5DJDA 4D0DB 4FABL 4BUQA 4XN5A 1N9PA 2VMDA 3FU9A 4Y9CA 4Z7NF 5GS0L 2OZ4A 3D2MA 4KX7A 1T1ZA 2APBA 2WXHA 3IFLL 4JY5L 3S36L 2NNFA 3HPJA 4EQ3A 2PVWA 2NDFA 3L5JA 3LQAH 3FEEA 3QWOB 4G6ML 2D7NA 2GJ6B 4KKRA 5AVQB 4H2AA 2NNCA 3VMPA 1NGXA 2LR4A 3Q5YA 3BEWA 2Z34A 4QVTA 3GXFA 4BRVA 1AHMA 4H25A 2YRBA 2GB2A 2EUIA 3B7TA 2GT9A 4ONFL 4YZFE 2IBZX 5CSGA 3GMQB 1G9NC 1M7DA 3QJFB 2N7AA 2ZUVA 1NC2A 2V8LA 4CW1B 1ZD6A 4PMEA 2WK2A 2VDPH 3RTQA 3PBBA 3TT1L 1KIPA 2V4LA 1MJJB 1BPMA 1DFBH 4JFQB 4ZBJA 4NX0A 3K80A 3CFCL 3T71A 4LUAA 4MNGB 4A7SA 1GZPA 1JVKA 1CBVL 4LVEA 4QOKB 4YDVB 1VHSA 2H47C 3MJWA 1YSOA 5MHSD 3RZCA 1QQDA 4P5SA 5AKVA 4X4ZA 4MB1A 1SY6A 1Z6JT 2A73B 1WEJL 2VW4A 5CGTA 3EJUA 1VACB 1CYXA 1VFMA 5F6HJ 4YFEA 2EUXA 5KANI 1BF8A 1A1NA 1TTRA 2GSGB 3F65A 1D5XA 3O3EB 4PJAA 4FNSA 3MFFB 5FW7A 4Z6AT 3GSUB 5B21A 2PXYA 5LNGA 2CKBB 5IJKA 1V55B 3AUVA 4FMKA 3MACL 2WLMA 2XXCB 1RMFH 3TNNB 4CADB 5AVSB 1KENH 3ZSTA 2EIJB 1JXFA 3L3HB 5EZLB 1ZGLA 1LO5A 5FVJA 3N41B 4Y4HC 3ELAT 2HPTA 5HYJA 3CSBA 1BO4A 3KXFE 4HF5H 1BAFH 4YSTA 1XMEB 2NXYC 5TPWL 1QQ9A 1U8IB 2XEFA 4K3JL 2FK9A 5ISZB 2VN4A 3OL2A 1U8KB 5LG1A 2W92A 1UATA 3EYVB 4N0UE 4RI1A 5H86A 3MOQA 2EEDA 4E9YA 2HFFA 3EBAA 1OGTA 1T89A 3BQUA 2X2IA 1TJXA 3CLEL 1QEWB 3D0VB 3IXAB 4KFMA 2RCSH 5EC2A 3ABGA 5FDYA 3WFBL 3O2WH 4YHNA 3FUJA 1G6RA 4WHTA 5HGAB 1D5BB 3KZ8A 2FHBA 1PKQA 1BMWA 4UILH 4CAXA 4XPDC 2PP9A 1S8DA 3VFOB 2WXOA 4AYID 1PZ3A 5EO1B 4IEFB 3VTMA 4MKTA 1ARLA 2NT0A 2FR4A 2H3NA 1A3RL 1PUAA 1UM4H 5F21B 1EA9C 4ZXBC 4WWKD 3SE4A 4LE8A 3SO5A 4KZEH 4JO1L 3QT2A 2GTWA 4XMXA 3U9PH 4M48L 5BS0E 3QDMB 4RFNC 2GQHA 1JG9A 3K4ZA 4CSSA 2VDQL 2CCWA 3RWIA 4A7VA 5CCGE 2VDOB 5LDSA 4CA4A 1GGYA 3T0EB 3GJEA 4AYGA 2J25A 4L8SC 3I3GA 2WJ7A 5TPWH 1QYGL 2PJCA 1ADQL 3FL7A 4ANWA 5A27A 2QVPA 5L8LB 1RULH 1KIUA 1FO0A 1ZHNB 3DX9B 3MJ7A 4GQPH 3CSFA 4OLXH 4FG0A 4EMEA 1OZTG 5DRXB 1T1YB 4G7SB 6FABL 2J8UB 1M6OB 5CINL 1QR1B 3VXRD 5IV2A 3ETSA 2YJQA 1ZS8A 4PJ5E 1T7YA 3PB4X 5I1GL 3WKPA 2O26U 4QHNA 4FJZA 5F1KC 1OV8A 5FUCE 1KN2L 1JNJA 5IB5A 2BSBA 4U3SA 4UWQB 3NA6A 3UTQB 1ZAGA 3R1GH 3EFFA 4M6OL 1PG7X 3CVHH 1NIAA 3D2UA 4LSTL 4P2OC 1HWHB 3II1A 2AFZA 1UB6B 4TUJA 1ZV9A 1PY4A 3APCA 4C54A 1GS7A 4G8EB 4K8RL 5DS2A 5B4MD 5JW3H 2FD6H 2R2CA 1R3JB 5I82A 3UROR 1G1OA 4WWKC 3T1FA 3ZIYA 1AI1L 3UAEA 1Z4EA 3KJ6H 2F53B 3MV8B 4B9CA 3TM6A 1N5YL 3K6FA 2DLTA 3IFEA 1AXIB 4FE9A 3TFBA 5L6YL 3MRDB 3K2MC 4TM9A 5B7FA 5CILL 4K7PX 4PGCB 4GB9A 3K6SA 1A3LL 3HIZA 5EBLA 4WWVA 3ARVA 1K3IA 4RA3A 3TBVA 3ZTEA 4P5TC 4ZDHA 5MEOA 2BMKA 4PRIB 1RSFA 4Y49B 3TH3T 4JGJA 4JR9L 1T5WA 1UXSA 4BK4A 4DZBA 3IDJB 4P4IA 2ZOFA 4WW1B 4DVRL 3ARBD 1WWZA 1NZRA 5IQ7L 3B7IA 3JV4B 2QADB 4MD0A 3EFDL 3G9VA 4WDIA 1E28A 2FL5A 4GI8A 3F58L 2PSWA 3OKOA 3TTYA 2CBTA 3FUKA 1SXNA 1AQMA 1U2HA 1ETB1 2R0WH 3L81A 3ARBB 3QNYB 4J3TA 3X11A 4JFYA 1CXHA 4H1LA 3PY9A 1IQWL 4HJ0C 1QSED 1JBJA 4XRCB 4U1NA 3OF6D 2CBQA 1DQML 3BZ4B 1ZLWH 1G1KA 4UQ2B 3ULVH 5DJXB 4GRMB 4PHZA 1BFVL 4PGZA 2HLEB 2Y4SA 4GW5B 4XNXL 3VFNB 3X11B 1KLFB 2LVCA 2Z31C 4F37K 3E6FB 2VXTH 1C12A 3MBWB 1NLDH 1MCSA 4ZX4A 1ETA1 5K59F 1FFTB 4F9PC 1N7ML 2IPUK 4OBSA 1OY3B 2PYFA 4WFGD 2C4FT 1W16A 3KPRD 2YNCC 1DN0A 1U8PA 1W6WA 2IAND 3HZYA 3EBGA 4NZ8A 3CSYB 1IM3A 1VZGA 1LAPA 1WIPA 5IOKA 1BZQK 3S97C 3V55A 3JVNA 2DMKA 1XBDA 1EBAA 3APNA 3QCTL 1F18A 5FYKH 1NEZG 4M1CD 5MEOB 4MJID 1XWVA 2BP8A 2ZUTA 5EBWB 3ESOA 3PPEA 5EF0A 4E2AA 4M6NL 5LG6A 4IS6A 2O93L 2XN1A 3IAGC 5IHHA 2AKRB 5ESAA 2A6KA 2A9DA 3FQ2A 3WS6A 4A6YA 1CR9L 2DQ6A 4KMLB 4Z7UA 2E59A 2EC8A 2QQKH 2XQYA 3RILA 3UAJD 2F7VA 4KKAD 2BNRD 2IOOA 5E5RB 1A64A 1UOLA 3DGDA 3SXOA 1R3JA 4M6OH 1H0DA 4M3SA 2C6PA 1OP5K 1SHMA 5KAQF 1ZPUA 4ZSOA 1DR9A 1LK3L 4LOEA 2J4WL 1A25A 2J73A 5MEND 1OOAA 4WHYH 3QRGL 4XX5A 4CL7A 2R0ZH 3RP1A 3L4VA 4X5XA 1CURA 4AV4A 1BVZA 5JLZB 2RFHA 1MVYA 3HNTH 3K8KA 3GS7A 1OM3H 4O4YL 3WOVA 3IF1B 3OX8B 1ZS8B 3HN3A 2WIIA 4Y1AB 5JHDE 3SJVA 3BJ8A 2P6EA 3CV5A 4CN6A 2OOTA 1MCNA 3ETBJ 5CJQH 3UIYA 4Z95L 3D34A 3T6WA 4EWTA 1FL5B 3C75A 3SE8L 3U4KA 3LS4H 4E2OA 4H0HB 2IFFH 1M4DA 3N3EA 2X1PA 3U83A 2ZQKA 1FO0B 1ZHNA 4JREC 4OV6F 5H37H 1G9HA 1N5AA 4IBZA 3FTYA 1G0DA 2ZCLH 2EQDA 5I5RA 5JPNB 4M5TA 2NZ1A 5FYJL 1P0SE 3K4AA 3NT0A 4DOHE 2HX9A 3KJ6L 1SN5A 2AAAA 2EDYA 2JB5H 5F0PB 2J43A 5JNYA 4FEIA 4R0LB 2PCPB 5LWYL 5I6XC 4AM0Q 1F1GA 3NJNA 4KTEL 4ORGA 1TETH 2VO8A 3BIBX 2VLKE 3CFJB 4KJYB 1I1RA 1PLGL 3KNBA 2NT1A 1BQLH 1SDDA 3TONA 4YL4A 4XXDB 3UAJC 1FQ9C 4O02B 3PUCA 5F1IA 4M61B 4BWUA 2C3XA 3PP3K 3GUTB 2N1KA 2PWGA 2ZUQB 5I5IA 4AB7A 2AQNA 4D9LH 5F49A 3SE4C 5KSAC 4RWYH 1USQA 4MBRA 3FDWA 2IMMA 2GC4C 3JUZA 2PMZA 5F0MB 5A1AA 5KAQG 2IMOA 1MFBH 3PE9A 2WD0A 4MB3A 2ZSVA 1MUJB 1A9VA 2HFEA 3HI5H 3P9WB 4UNIA 4BHUA 3RWJA 5BS0B 4PVLA 4LVNC 5IM7A 4PRBB 1ET5A 2D4DA 2N7BA 4JGUA 3VA2C 3EHBD 1OF0A 4AW4A 1KGCD 4KXAA 3S3CB 1KWKA 3FT2A 4OF0A 1SEQL 4J3GA 4AJ0A 3IU1A 2NY1B 4FQ1H 2EYRB 4WUUE 4BE6A 2ICWI 2E3VA 1RK1A 1X7QA 2H2PC 4X9IA 5DI8B 1MCWW 1DZ0A 5F1NA 4EFDA 5HI3D 5DQJB 3FMGH 4HUVA 1DN0B 4J1UA 4CBPA 5AZ2L 3OMAB 1B9KA 3CHXA 3ARDD 2ZIDA 3LHPH 3HR5B 1OP3K 4X6CF 2R7HA 2AVGA 1BGXH 1FZJA 5HI5C 4KOBA 4ZFOB 2FO8A 3EGDB 5DHMC 2EKSB 4GXUM 3SGEI 2XOTA 4ODVH 3IS0X 3KD4A 2D2CC 1FFOB 2ZYSA 3C09B 3E6HB 3EOTH 3G6JA 3QXDA 4I4WB 4MXQD 5GGSB 3NFNA 1A8ZA 4XRCA 1KZFA 4JM2D 4XPGL 4YFDB 3F12A 4MNGA 2MJWA 3UYRL 5C0BB 2WO4A 3AG3B 1RUPH 2XWZA 2DI8A 4NQDE 2V8DA 3DOIA 5GXBB 2Z4TA 2HH0L 1TZGL 2NXZB 5D4QA 3WIIH 3ZLQC 2JKIS 2CXGA 1NC2B 2RHEA 1AOHA 4ZFFA 4P6YA 4KZCA 1ZGLP 1DVTA 1KYOK 1L3WA 4OZFH 3JTSB 1UXSB 5LQBH 4QKXB 4ORFA 3CZEA 4OB5L 1QEXA 3VQLA 3H9ZA 2XQBL 1Y0YA 2FNBA 4UAHA 5DFAA 1E3FA 3BEWB 1OM3L 4YPGB 3EJYC 5TF1H 1AQKL 3VH8A 5EBLB 4IGBC 1NAKL 2X9YA 3MRDA 5F6IB 4P2AA 4HJ1A 3HPJB 4LOFA 4U1GC 3VWDA 5FFLA 1YNTA 4Y16B 3BAEH 3AS3A 4NQVA 4L1LA 5KJ7E 5HI3C 1JPFB 2WQRA 4Y0GA 5DD5L 3KLAA 1WS7A 1LVEA 4MD4B 4X4KA 3PGFH 2B2XH 4I48A 5C92A 5CN3A 5EU3A 4B0MM 5IMLB 5E6IA 1WA1X 4DKEL 3CN0A 3IDNA 3F6LA 4R7XA 4WV1C 1F2QA 1UEYA 2F5BH 5CP7A 3TN0B 2J7LA 3O6FA 1S9VA 2X09A 5DZ9A 3U4BL 2JIXB 4XCCH 2PDOA 4M4PA 2PXYC 5DR5H 4NOFA 1CXKA 3CN4A 4APQA 5EZPA 1PVHA 4H0LC 3QI9B 5DHXB 4EUPH 3SKNB 1QR1A 4FFZH 4UAOC 2Z91B 5CCHE 3DX4A 3BWZA 3BCDA 3KGQA 2C9XA 2VN7A 4HWZB 1U6AH 3X1BA 4PLJD 3MJ7B 4YDLB 4NGHH 4XWOC 5JO5B 2XI9A 4BQ9A 1WH0A 1SJXA 3U9UB 1GYWA 4U1HA 1BQSA 5I4MA 1EJOL 2VDQB 3EJQA 4EZJA 2CRMA 3T0EA 3BWUC 3SE9H 4J6RH 2VMFA 3MRLB 3VWJD 2XLLA 4P46A 2G5BB 3NTCL 4NPYA 2OMTB 1K4DA 4NO0D 4P9HC 1I3UA 1K9TA 5K8MA 2ZEOA 1NFAA 5F3HA 2D31B 3ZSSA 3NZHH 4NKMA 5F9JB 2BK8A 4H0GA 5K39B 4YDMA 4YLBA 4WHTB 1OAQL 5D6CB 5HGAA 1FL6A 2ED8A 4YHNB 1UH4A 1ZVSB 2N7SA 4Y7MA 5H2BA 1INEL 3PJSB 5I1EL 5EC2B 2EABA 3EJRA 3CFEA 4WCYL 3O11A 5T33L 3G5VB 1Y6KR 4IM8A 1KTCA 5L2KD 3QWQB 4OFVA 4HV8A 4F7CA 4E0AA 4G8IB 1IGBA 1SEBA 1U8KA 5FWQA 4Q7AA 3KL9A 4UTAH 4WI2A 1U8IA 4NUPA 5F1SA 2QELA 1YVOA 4HEPA 5I8CA 1HWWA 4D9QE 5HYJB 3HMXA 2X44D 1L0XA 1QFPA 3EJZC 4JZOA 4GXFA 2YPLB 5CP3H 3Q8CA 1S9XA 3QUZA 5DCCA 5CKAA 4KPHH 5EZLA 1ZLUK 4N0UB 1FGVH 1SF5A 4FNQA 2VR4A 3FCSB 1Y1UA 2CHDA 3N0AA 4ZPTA 4RMTA 4BHUI 1F2XK 1OHQA 4X7CC 5HY9B 2CKBA 4Z78B 3GSUA 1DBKL 1E4XI 3GSWB 3AM8C 2YPLD 3O3EA 4K23L 5FGBA 4XAWH 1EUUA 5I73C 3EOBB 2CIJA 2DBLH 3PYCA 4E8OA 3LRSA 4A95A 4GAYB 1BEYL 1MAML 2M2DA 4HGMA 4HWNA 4UUJB 3LXBA 3ORJA 3V4PA 4HX1B 4NWTH 3BWAA 1LWRA 3E7JA 1F3DH 3DX8A 3U46B 2ETWA 2ROYA 1FP5A 4QUSA 2WXPA 2J4WH 3IDGB 1TQTA 4MRBA 5IQMA 1CGTA 3BMVA 3BFOA 1AS8A 2QFPA 3X13A 4CAGA 4Y2OA 1NL0L 3I02A 1FZKB 3GC3A 4U1MB 5JA8B 5KVFH 1MJJA 1K6QH 1ZHBA 3JYBA 3P0GB 4R57A 1GOHA 1YNLL 2AJ3B 4LLYA 1KIPB 4ERSL 1MRDL 4JWPA 4CW1A 2E0PA 4MS6A 3AWFA 1KWGA 2DQCH 2PCYA 5D1ZC 4IQHA 4NNYA 3RKDC 1MXDA 1NDTA 3OR6B 1SYSB 2FATL 4L4TB 4K8RD 4TNFA 2BZ7A 2WO2B 3A4AA 2D0GA 4FXKA 4M4RB 1KBPA 1EANA 1WBZB 3FKUS 4HNWB 4HJUA 5A2LH 1NMTA 4ADJA 1OP4A 1GMEA 3QRFM 1K5WA 2LT9A 5EU6D 2COQA 5AVUB 1WCBB 2ZOKB 4QHUB 5J6GB 2WQXA 4UV7H 5DJDB 2HT2D 3ARZA 3PWJB 3ASNB 1TCRB 1GL4B 2Y7SA 1Z3GH 3CFDB 1J05A 1V3LA 5A2AA 3DVGA 3LN5A 4AE1A 3C2AL 4H1LG 1DBBH 1CDGA 3DGGA 5DWUH 1IBHA 4QBJA 3MBEC 5TJWK 2EYSB 3FB8A 4KOWA 1H3GA 4N8VG 3DO4A 3FO0L 3ILPA 5ICYA 4EI6A 3ULUD 2FIRT 5I71B 1ZG8A 1CFVL 4R5TA 2BIOA 1BF5A 3H3PH 4AVJA 2YD6A 1OVZA 1N67A 4H89A 4MFQA 1EH9A 3FQRB 3GBEA 4ERSH 3OG6B 3RNQA 2I9TA 1OT1A 3CGTA 1L0CA 4YSRA 1IGFL 2X4SB 4HEMA 3QDMD 1R0AL 3WUWA 3QIBD 1GC1H 2IDSA 5C0EB 2OP4H 4R76A 4YSDA 2H5MA 5D93B 5KSBE 1LDSA 4HC1A 2XFXA 4R8FA 5I30H 3GI9H 4ODTH 3T6XA 4HJEA 1JZ5A 3UAAA 4HHGA 3H6AA 1ED3B 1HKFA 4WUUD 3MODH 3NBNA 1QSFE 4Y4HB 4AIXA 4GFTB 1MCQA 4X5QA 5KYUA 2PQ8A 4QRRA 1DBKH 3C6LD 1I1YB 2BHFA 1BAWA 2WZ6A 4YWYA 3VXRB 2BSRB 1E90A 1Y6NR 5EBVA 5GGVL 4MCRA 4JANB 5G4OA 4BRJA 4A2MA 2NLJA 3EYQC 2JI3A 4LRIA 5DLML 1AJ7H 4MMYB 1M7UA 4AYSA 3WUZA 4RGNC 3EUDA 4M9PA 3O6ML 4W9GC 4Y8AA 4YDIH 4J3OF 3JXAA 2FYYA 3LIUA 3ZTNH 3DRQA 2WTRA 5KS9E 3O0RL 3L4YA 1VF5C 2RJMA 4NO5B 1XBUA 2BFVH 4Y4KA 3CT9A 1E4WH 1I8KA 2VXUL 2WUCH 2X10A 1ZKAA 2IF7A 3HI1A 4HPSA 5E7FA 2XVBA 2V17H 5CEYB 4IBTA 4N8CH 4ISVB 3MRHB 5BO1L 3R1KA 4CJ1A 5CINH 3ALWA 3UBFA 5F7UA 4XMUA 1TSHA 4OFPA 4RFNB 4OLWL 1YNKH 2ZX6A 2ZXEB 1BQRA 3GMMA 1XAUA 1N6QL 3KM2A 3QG7L 2H32A 1C8QA 1U8QB 2Z6FA 2D3VA 4KAQL 4PVNA 3L6FA 4XVUC 4PB0L 4MNGE 5SWSB 3P11L 4YXLL 3PZJA 1YEJH 5GGVY 2BY2A 2J71A 2X0VA 3K6DA 4L4VE 2BVPB 1A02N 1PAMA 2KLSA 2ZKYA 3S3JA 1DE4C 2ERJC 3VDAA 1KJ2L 4HUXB 5BNXD 5FECA 1FCGA 1DDTA 2OMYB 3HAEA 4NAQA 1AD9A 1AZBA 3ERXA 4YHIA 1HKLH 2EXTA 3SY0B 8FABB 2EXSA 1MF2L 1M2VB 1Q0YH 2JXMB 5D7IB 5FUOH 5LN4A 1BJ1J 2I5YH 4XNUL 5E8PA 3IE4A 4U3XA 4A94A 3LKPB 1KJMB 1PZUB 4G7VL 1WFOA 1TETL 3NCJL 1YQEA 1GGBH 2DM4A 3EOAA 2QYVA 2VRAA 4WK2B 5J06A 3CQPA 5IG7A 3NESA 2I7OA 4N22A 3L5XL 4P2RA 2P8PA 2A2QT 3QWRD 1MJ7L 1I9RL 3TIDB 5HPOA 4JFTA 3NQIA 4FQ1L 4D8PA 5HDBE 2OLDA 3SKJH 1KJ2B 4I3SL 3PDGA 1H5BA 4BFOA 2CH8A 2WXLA 2WMPB 2D2OA 4J3BA 2OKMA 4YC2C 1JN6A 3BGAA 1NGPL 4JM2A 4PI0A 1E5UI 3W9EB 1UACL 5EZJB 2FO4A 3HTLX 2R0WL 3IMSA 1L3NA 2V3FA 1ARMA 1T7ZA 2JKLA 5I2IB 2ROXA 2YAHA 5CPAA 2NSXA 2VIRA 4NNPL 3RNKB 3SDYH 4HOWA 1Y0RA 4YHLL 4P07A 1TEGA 4JQXC 3CC5B 1AGEB 1HVXA 4F2MA 3T8XB 3VG0H 4MCYA 1ZXQA 1HH9B 2H26A 2X2HA 2VH5L 1V7NL 3IAQA 3QNXB 4H20H 4OZIB 5FYKE 1IIDA 3IDIB 1WFUA 1XAKA 3AY4A 1NPJA 5TFSL 1PZ2A 5A3ID 5IB9A 3FO9B 2NCMA 1Z5LB 5DD1L 5KSVB 4ONGH 4XBPA 1NCGA 1A6ZB 1A66A 1TQCB 5IFAL 3BSZH 5JPMC 5I0ZA 3IWUA 1HYSD 1OSZA 1RZFL 4KRPD 2Q7NA 4WNQB 1DBAH 2V37A 3CXDL 5JOFA 5JQIB 3QQDA 5C6PB 1QWNA 3OHXA 3KKWA 4ZMNA 3KE0A 5TDPA 4JFFD 5DD3L 2QJ8A 5CD3B 3WGUB 1Q2DA 4W68A 1G6VK 2FQEA 3GSVB 5AOKA 3DPDA 2NW3A 2V8VA 1I9IL 3O6KH 3PWVA 4A2HA 4ES9A 1RJLA 4JPKH 4K7PL 3TJPA 3AU0A 2N0KA 1Q9OA 4GKZA 2OB0A 1AXSB 1T7XA 3NSJA 3N91A 5F7BA 1NFKA 5KN5B 3LD2A 1S7WA 4X99A 4XCEA 3QRGH 4XVOA 1CFSB 3RVWD 1FYHB 4L3EB 2A77L 4OLYL 4X8JA 4MD5B 1XXDC 1QUPA 4BWTA 3UGEA 4D2NA 4KVNL 1PEWA 3NEEA 4GINA 4OCWH 1YEGH 5DZLA 2B5GB 1SZNA 3LKSA 4JFFA 1Z7JA 3NIDE 4JJ5B 3TU6A 1EXHA 1U93B 3ZZQA 3ZDWA 2BOCA 1ID5I 3ISWA 4P3CL 1AGDA 2DIBA 2WBJD 4TNVF 3VM5A 2ILLA 3P3UA 1WBXB 4GBXC 1PCAA 4KKAC 2IANE 4I0PC 4ONHA 4Q52A 2YPVH 4HPYH 3SBWA 5EHFA 5JYMA 3FQUB 3VXUA 4G9DB 4YDZA 5IMKB 2HN7A 3J2PA 5FV2A 2HKAA 5K9KA 1W8OA 3G5WA 3H9SE 2V9RA 1I8AA 1LP9F 3DIVA 3G5XA 3L2MA 4L1BA 2DEWX 1T5XA 2FVGA 1YN7B 5D1XA 4LKCA 1HINH 1XTMA 5LBVA 4LAQL 5ITFA 3KCPA 3MYJA 2VDLL 3BH8A 4X4XB 4AXWA 2R2EB 4Q9QH 4YOKA 2CDGA 5K93A 5CO1A 4DP7X 1R5WB 1OSYA 1RI8A 3ZDXF 4FI6A 1BVOA 1ONQA 1R19A 4DEPB 2DYRB 3M1OA 1R4XA 3IBEA 1LL1A 3N44F 4ZMZA 2G4EA 3MLSL 4HWBH 4K07A 4UB0L 5B7EA 3UTTA 3ZYOA 4DP8X 2YZ1A 4XN7A 3WR7A 3ES6A 3WDHA 3VI3B 2P5ED 1YYLL 2X4RB 2MSPA 1PYTB 1PNCA 1L7IH 2FE0A 2P8MB 4LRNH 5FB8A 1RAMA 1WE5A 2NY1D 2IFGA 4B9ZA 1NEPA 1RZJH 3TF7C 5IIEA 3VWKA 4NQUA 4OJYA 5HGDA 3QO0A 1TTBA 3NJGA 5JIKA 2Y6TE 1QG3A 2WAQA 4KK8C 1HXMA 2NCEA 3S96B 6PAZA 1R9FA 2ENQA 4GAAA 3RUGB 3WN6A 1IUZA 1ZA6A 4NN6C 3U0TA 4MRCA 3GBNL 1ASQA 5C0BD 2ZUQC 5CWSB 1BYPA 4ZFZA 1J11A 5CS7A 3AVEA 1YEWA 3QDHA 2DW5A 4NKOB 4FZEL 1R1CA 1S7VB 4QNPF 5CBAB 1YO4A 3REWB 5L8KB 2NYYD 1M7XA 5SWZB 3KH3A 4HKFA 1EJ8A 1CJYA 1AGCB 1EX0A 4RFOL 3LMJH 4WNJA 5IW6B 3R18A 1GZHA 1OALA 4LVNB 5KTAA 2QQNL 1HFUA 2QSQA 5J89A 2H1XA 4GG6A 1YEFH 1U8HA 4TQHA 7FABL 4GXVL 4D0CA 1KPRA 4GSQA 4PLJC 4PFEA 4PIRF 4UIBA 5AG7A 1UXWA 3BPLC 2NY7H 5CUSH 3K0YA 3W2DH 4B9GA 3FTWA 3O4LB 2ZEDA 1TZHB 5C8JB 3V9EA 1F6AA 5E6UB 1FZMA 3RIAK 4UOW0 3RQ3A 4IRJB 3HR6A 1F45A 3ARPA 4KFZC 4I3RL 4RAVB 5HDQH 4BDVA 4E41B 3CDGB 4DWHA 3V5HB 3L3GB 1HE7A 3WMPA 3DMMA 3ESVF 1QNIA 3LZQA 3NCCB 4NN5B 3LRKA 5FHBH 1EEZA 4NUJA 3X14B 1KY6A 2XIIA 1XGTB 1E9QB 2JF1A 2HG0A 2ZAIA 2GJPA 2AXFB 3DDGA 3K5SA 1EFQA 3BVDB 3QFJB 3U2SA 4J3OD 5IMMA 1DDHA 1NUNB 1BD2E 3EBHA 4TQEL 4BSWA 1BJMA 3QUXB 2DPSA 1BA9A 5FOBA 3MYZA 2YQ2A 3WL9A 1AACA 2X0WA 4AYEC 1DCEA 2CMRL 2R0LL 4PGBB 2QT6A 3B6SB 3G04B 1C9SA 1S7RA 2X4TB 2VR5A 2B4CC 4FQLH 4NYLB 4V33A 3ULSB 3UPCA 2Q6WB 1A6TB 1OAKL 3BAEL 2W0FB 5HVGB 3B7YA 1B4RA 2XCMC 3WIAA 4LARH 5CF3A 1NEUA 2QKIB 2P5WD 5HP5A 1NCHA 2ADGA 5B1CA 2YAMA 1MG3C 1HZHH 2LQRA 2J2ZA 2PXYD 5HD8D 3LKOB 4QRRD 1BBJA 4PXCA 5DZJA 4MMZB 3WTXA 1J7VR 5LGHL 4XMKH 2J1KA 3NIGE 4NJAH 5KSBA 3DSNB 3MRCB 3Q1EA 2ZEGA 1J1PL 5GZNC 3IMBA 3WEBA 3O3DB 5T3XE 2VXSH 5L4MA 2CY2A 2AXHA 1P4IL 2F5AH 3U7YL 3IDXH 2BS8A 2F74B 1FH5L 1S5IL 3ZU8A 2FEDC 2C1CA 1SYVA 2HTLD 2YGNA 4S10A 1VPOL 3MGAA 1DBAL 3CQQA 3O4LE 2GTZB 3O8XD 4JR9H 1EE3P 1QPKA 3GKRA 4NGMA 5J1SC 3LZFL 2CLVB 4RLDA 1IAIL 3FH8A 3M46A 4NT6A 3V8OA 4FA7B 1NFDA 2DM2A 4LCIL 5D7JC 2ITCB 4HDIB 4IAVA 4EF3A 3HS0A 3DETD 4Z7VF 1ZLUH 3HE6A 2F18A 2WTPA 4A7QA 1ZLDA 3VM7A 1T80A 4KX8A 1ILUA 2F5BL 2LHAA 2XJKA 4B9FA 1BPNA 3HB3C 1KGUA 2B1AH 3E2HB 3MCLL 5EF1A 3OSKA 4KOYA 3OKDA 4ZO8A 5BRPA 3QORA 2F8IA 5H37A 1GPOH 1CLZH 4BZ2H 3GSNA 2BO0A 2WW8A 1ZJAA 2Y1ZA 4IKJA 2QLYA 4ANXA 2XIBA 3WJLC 1WC7B 2O6DA 1J0YA 3BT2H 4IRSC 3OPUA 4XXWC 5CHNA 4Z7WE 5LB1A 2IALB 3R0NA 3EXNA 3RWCA 1A6PA 3RWCB 5C0IA 5GGRY 4Y2DA 1XGRB 1CDIA 3IPBA 2XTJB 4PBWD 1WC7A 3FFCE 2PJ2A 5AG9A 2MQCA 1Q94A 4M5SA 3VD4A 2B14A 3SGJC 2EILB 2V5SA 5IHWA 2VLME 1FFPA 2X4OB 4IHOA 3GD1C 1M2OA 1WISA 1IGIL 5FKAB 2CU9A 2OH1A 2VZ3A 4PV9B 1HILB 4OIFA 4HK0A 4WWID 2V2TB 3D33A 5GRVK 1BYNA 3V38A 2A99A 1Y1DA 1FDLL 3AT9A 3AWEA 3FXTA 2X70B 1H3UA 4TULL 3P0VH 1YMMD 3MX0A 1FORL 4L4VA 1HX0A 4EOWL 2X38A 1RUAH 2VM4A 2WXGA 1JGVH 1N0LA 4O9HH 3ZVVA 4Z1PA 1M71B 5JHBA 3GPEA 2NTFB 3P4NB 1SHXA 3UERA 4EUPG 3VI4A 4UT9A 2F74A 4F9LC 4HKZA 3CFBB 2ZCZA 1A8JH 2PJBA 1UXLA 4LQ6A 3D4GA 3GEWB 2EE3A 1XDTT 5ADPL 3BH9B 1V54B 2X7BA 1AHWB 4L4TD 1HH6A 5LRGA 1J86A 4UU9B 3TC8A 5KVFE 3UBHA 4YSAA 2HVJB 4Z0XB 4J8RB 1PIGA 2PJ1A 1KTDB 1M7IB 4PJCA 4Y5XA 1C1EH 5HHNB 3HE7B 3KAAA 1NCCH 1ORSA 1PG7H 2G2PA 4Z95H 5B8CB 3ZIMA 3QNZB 1D3CA 1ZSDA 3QUMB 3LKQA 5FOBB 4FQQA 1TVBB 2EDMA 3A4EA 3EFDH 1Y9WA 4GW1A 4N5UA 5IEHB 4R97C 4BSWB 1CZ8H 4UIAA 3EJZD 2DWEA 4D7PA 4M03A 1ZLWK 3E3QC 3P40A 1I21A 4RN7A 5I73B 3MNDA 3QUKA 3MTXA 3LN4B 4KORA 2JQMA 3PJLA 1E6JH 5HHQA 1TKFA 4G7YL 1UJ3C 4ZAKC 2JI1A 3DMMB 1BBDL 2Z1PA 3GO1L 4AMKH 5IEHA 1TVBA 4FQQB 2NXYD 2YOAA 4PR5A 1ZSDB 1HEZA 1YEEL 1HHIB 3W39A 5LNEA 2X1OA 4IRJA 4MAZA 1XF4B 4Z3HA 4OCLC 5B8CA 4LGSB 3FNKA 4JK0D 1IAII 2IMNA 3LNHA 3P4LA 3Q8BA 1FCCA 1C5BH 1XR8A 3AS2A 3PHQA 5E1GA 1GY2A 1KUVA 1HT6A 2IIJA 2R9HD 4J8RA 3VAEA 5I1AA 2HVJA 2F53E 3RO0A 4RFEA 3REVB 4UZUA 4J3XA 5F7KC 1R3IL 4S11A 5EIVA 2NX5A 5J56B 4YAQA 5J1AB 2ZP0T 1UUSA 3D39E 3VD2A 1AE6H 4XVSL 4NEHB 2R8SH 4KV5F 2GJJA 3H8NA 4D7BA 1KBVA 3MREA 1OHZA 3V0IA 4MXWH 1B4JL 1AGCA 4ZW7A 5EOTA 1MQKL 2FJGA 3FYEB 4JJOA 3CFBA 4HKZB 4TSAH 2JB6B 5CBAA 3WAJA 2NTFA 5J9PA 2YGQA 4WKZB 4G7RB 2JCCF 4CYPA 1F8TH 1IGFH 2ED9A 4M6AA 5DVLA 5CWSA 1PCXA 4FUUA 1PIFA 2BOAA 1RIUH 2D0FA 3V0EA 4HC1L 5EMIA 3QO0B 4FDWA 3MBEB 3TA4D 4YSQA 2P52A 1U8NA 5J6SA 4JCMA 3A5VA 4XTRC 1JOIA 4GT0A 3ZTJH 3PAYA 3N0PB 1BQHA 2NMSA 1EVUA 3QDJE 7CGTA 4XB8A 3B9KC 4BZ1L 1UFHA 2E7DA 2I85A 3NZUA 5DHDA 3QUGA 4FLSA 4CU6A 2C7UA 4NRYB 4JFEE 2HFGL 3F8UB 1IOIA 4JZNA 4CN4A 1EWHA 1ONQB 1ZTXE 2IGLA 2WNWA 2EDNA 4FQPA 4JO1H 1OOWA 4JZJA 4S0HA 2WWMC 2P5WA 1C08A 4H6ZA 4F7PA 2JKSA 3D30A 3EYUH 5DYFA 2D73A 4HUMB 2XPGA 3KPTA 4IK7A 1FZOA 4LKCB 1TO4A 3UTSB 4OIDA 2L7QA 2VDLB 3HE6D 4P46D 5EORL 4MJ2A 4FD7A 2YD8A 1IB5A 1RJZB 1YEDA 3MRMA 3QORC 1TF9A 4PLKC 2Q51A 5GRVL 4OLUH 2PWHA 4P2OB 3MDJA 5DRZA 1AGDB 3HE6B 2FSRA 4N2HA 4EE2A 1H3VA 3CFTA 5I1IH 3TNMB 3SSGA 2RGSA 3IU3B 3VGFA 1X5AA 4W1TA 2Z0UA 3HS0C 2D3JA 4F33B 3V0VB 3FRMA 2XEIA 4BZ1H 1QSEB 5HHPA 1YEGL 1TJIH 2XZCH 3LS5H 4M8VA 2OMUA 2X4QA 4M8QB 2AI0H 1OCCB 4NLHA 3WO4B 2ZNWA 3OPZH 5AW5B 3HI5L 1MWAL 2MOGA 2X12A 1XSOA 3SYAA 4JQVA 4JY4B 3D25A 4K3DL 3QXVA 4YHPA 5D4HA 5KN5A 1UD2A 1YR0A 4Y49C 5ITBH 1W91A 3MKGA 4PJ7E 2FGZA 1AR2A 1RJLB 4WLCA 3GHBL 3S37H 3S6CA 3V52H 5I6MA 5IW1A 4J3VA 3B3IA 1KXQA 2LU7A 5DMIH 4B50A 3PFUA 4HK3J 4ZBGA 3K6OA 4KI5C 1N2RB 2APTA 4MB5A 5I26A 4N25A 5LO7A 2FT0A 4HCRH 1WFNA 1L7IL 1S7UA 1S7RB 2X4TA 4FFWD 4XCCL 1NWOA 3FJTA 4PGBA 5EBGA 4UDTB 2EDJA 4F20A 3ZR6A 5KUMA 5D55A 2CNTA 2EO8A 2HRHA 3MRIB 4PJFA 3U9PL 4YHYB 5DJ2B 1AGBB 1A6ZA 1H6TA 1CFNB 5KSVA 1VPOH 3UL4A 4KXBA 2EDRA 4GG8A 4M3HA 3ARDA 4LDCA 4ODVL 2WINB 1EEZB 2K6WA 3K6IA 3MSPA 1E9OB 4QRTA 3X14A 3B2YA 3DBSA 3KASA 2R39A 3QZLA 1BZDA 4H8WL 1J8HB 3NVQA 3LPGA 5ABAA 1XQ4A 3WHXB 3IM1A 4K3DH 4FA8A 5LYDA 2V2WA 3T8XA 4OGAC 4X9BA 4DPRA 5AW6B 1RZGA 1F6AB 5FO9B 2Q8AL 3B1TA 4UTBA 2EE2A 2VJ0A 3BI9X 2M83A 4QT5B 4RGOL 3RI5F 4F8PA 3QRBA 5DVKA 3T2PA 2VL5A 2OMVA 5HYSA 1ZE3C 2PKDA 2ICCA 2EDHA 3BUPA 2B15A 4NPKA 3WN5A 2VQUA 4D0CB 2C9RA 2XKUA 1JFQL 1W0WB 3W9EA 2P1YA 3MRFB 3VSTA 3GRGA 4GRLD 1JMXA 3NJVA 5D1XD 1U2YA 1K72A 5SX4I 4PVMA 3EXJA 5JW4Q 3S3BB 3FZUD 3UTTD 3C2AH 5IG7B 2GLJA 4FTVB 3W91A 1BXUA 1OZUA 4AQ8C 3EOAB 4IKNA 3K7UA 4BKLA 3TBWA 5ILTL 5JDJA 4RZCA 1JYWA 1F4WH 1KJMA 1HNYA 2CLZA 1QRNB 3QZBA 1JK9B 3T4AC 4S0SD 4UFWA 3A23A 1ITBB 3B2MA 2HJKB 1KYOJ 4X6DB 4KVXA 3H2QA 4M1CC 4Z7WA 1P6AB 1VKXA 4IBUA 4UV4L 2XN9E 2GSMB 3I3DA 4ZSOE 2HMIC 3NCEB 5F7FA 4W70A 2F8VA 1I31A 2BVPA 1FVCA 4Q6KA 1I7TA 1A0QL 2GG1A 5DHVB 2DLFH 1TQSA 2W65B 3N06B 4P9HL 1MHEA 3HRZB 4P48A 4WEUD 2XUWA 5T1DH 3SQBA 1P7QD 3TYGH 4KRMB 3ELQA 5KYYB 3NPSC 1A4KA 4JN1H 3F2LA 2B8OT 5KJRL 1MK4A 3AG4B 1PG7W 5DMIL 2P43B 4QTIL 4L8DA 4FXGA 4BBHA 1LO3H 4MI4A 3ZL1A 1J5HA 1DUYA 4KK9C 4CYQA 4HCRL 4B9KC 4JPWL 1QVOA 5DQDL 3X17A 3QQ9C 3IDXL 5AOLA 1I4FA 1MW3A 4OQTA 2AS5M 3F64A 1A47A 1NANI 1QSEE 3FQWB 3O9WA 2FWSA 2WCGA 3H85A 2D03H 4GRLC 3U7WL 3L5WB 1V10A 4MWFB 2GUOB 2JKJA 3QZWG 4I2XA 4PWFA 5CMAA 4ZTPL 3VXUB 3FIXA 3AGVA 4QXGL 2VDRL 2YN5A 4GEIA 4LBEA 3NPZB 1JYXA 4YSSA 5AD0A 1EO8L 2OYMA 4Z7OE 5CCKH 2BOCB 3DVNA 1U93A 1MNNA 1N70A 2GTQA 1CDJA 3N04A 2AP2A 4JJ5A 3UTZB 1VSCA 2IPKB 1GGTA 4DP4X 3TJHC 1LEIA 1ZG9A 4P5TD 1A0QH 4HIEA 5TTRA 2CKBH 4KY1L 3LNDA 4XB7A 3GMPB 3HMXL 5KTEH 2IQ9H 3LZFH 3KDMB 3WJMA 4FHBD 1EEQA 3L3OC 1RJCA 2GK2A 5CZXD 4WFEE 2NDGA 3KEDA 4UT6H 1B9ZA 1N64L 3M07A 4I0PD 3B5GA 3H4HA 4LIQL 1CO1A 1PLCA 4XP4H 2W8CA 5D2LE 3C6LA 3HBQA 5AW8B 5AYQA 3ZDXE 3ULVE 4OKDA 3TCVA 1RXLA 1G9NH 4XBEL 3BLBA 3EYUL 5I8EA 4DEPC 2KLTA 3QEQE 5ENWB 4YUEL 2FHCA 2CLRB 4OLVH 1HN1A 1S9YA 5C97A 4WNQA 5FUCC 2Z11A 2FEEI 3FAWA 3FQRA 4PV8A 1VGEL 3A9LA 3GXDA 1OSZB 3ZUCA 4I9WE 5A2BA 1F56A 1OB1B 1UYWL 5JPNC 4Y16D 1XF8A 4JDEA 2CM5A 4LQ1A 4OD1L 4O58H 2R7EB 4XPBL 2XWTA 3LMJL 3QXAA 4EXKA 1MG2C 4R90H 2EYSA 2HV2A 1DEDA 5F71A 3FCBA 3B9KA 4EO5A 1PMYA 4S1SH 3IDIA 3H8EA 5DK0A 1NUGA 2AERT 3EJYD 2P6FA 3QAHA 4H44C 4BSVB 3IB4A 4XO3A 1HH9A 2BSSA 4BKTC 2ZT9C 1UM5L 3II2A 2UXFA 3QQ4A 3RVUC 4MJ8A 5E00A 4PG9A 5IKCA 2BSWA 1MNUL 1UWEL 5IVXF 3HC3H 1VADA 2OU2A 2I07B 3RAJH 3F83A 3T3ME 5LWYH 4RGMC 4L48A 3FSZA 2VN5A 5KSAB 4C47A 3FTVA 4PW9A 5F6IC 1QRNE 2XSKA 2DD8H 3S35X 3MLUH 2WGXA 2ADIB 2R15A 3RURA 3C8KA 1QSOA 3CFNA 3ZJ0A 1CLVA 4JM2C 3IPFA 4ZTEA 5HJ3B 3ULUH 3DV4B 4QD2E 4UNUA 4AJWA 3PRZA 1WITA 3ABZA 4P2RB 3WJJC 5TD4A 2EEBA 4QYOB 3UC2A 4PRAB 1JNLL 1GC1C 1I9EA 2ZKMX 4I0KA 3ETTA 4KHXH 5CNPA 1QLEL 3JWOC 2VBQA 4HLZG 2VE6B 5DQ9B 2UWEF 2CRYA 4BGLA 5IFAH 2H3XC 3KPOB 5AB9A 4M6HA 4HX1A 2ICEC 3V4PB 3MZTA 1GOGA 4NCC2 2C7FA 3B3CA 5I30L 4OFIA 5FECB 5I0CA 2PR4H 4X6BB 3D6GA 2IAMD 4BBWA 3GXUB 3CCHA 1KCUH 2EK9A 4OV5A 4TL4A 5FYLH 5LYIA 4CBZA 3QUXC 2HSIA 3RG1C 5T5FL 2VXQL 4NAJA 4RSVA 3MJGX 1ADQH 1U8JA 1X6NA 3KPNB 3L5HA 2AI0L 4N0UA 4YFLF 5IT2H 1XIXA 2I79A 4A6YH 2I9LB 4MA3A 5HHMD 1SBSH 3GMMB 4TRPL 2EDFA 5TE6L 4DTGH 4WTQA 1G5AA 1KFAL 4TSBH 4UT9L 4M48H 3ZZ1A 4L2YA 4OD2A 4ZNEA 1IAIH 2CGRH 4JFOB 4B7LA 3MBXL 1WTGT 1ASPA 1UD6A 5AVZB 4L4TE 1G7HB 3LRLA 1VHEA 1P1ZA 3NH8A 1E9PB 5D4IA 3BESR 3UJIH 5C7XL 4Y4KB 2W07A 3BP5A 3K8LA 1D5MA 4PJEF 3CLFL 5K39A 1ZTXH 2DQFA 4D94A 2JLPA 4NO3B 1XFOA 3X3FH 1XD0A 3GK8H 4DVBB 5CBMA 3WEAA 3UZVA 1BFVH 1NMBH 1T04A 2GIXA 1TLKA 2D31A 4OH2A 2XTJD 2CIKB 5F70A 2DQDH