2BL1A

Crystal structure of a putative phosphinothricin acetyltransferase (pa4866) from pseudomonas aeruginosa pac1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
170
structure length
170
Chain Sequence
ASIRDAGVADLPGILAIYNDAVGNTTAIWNETPVDLANRQAWFDARARQGYPILVASDAAGEVLGYASYGDWRPFEGFRGTVEHSVYVRDDQRGKGLGVQLLQALIERARAQGLHVMVAAIESGNAASIGLHRRLGFEISGQMPQVGQKFGRWLDLTFMQLNLDPTRSAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PUTATIVE PHOSPHINOTHRICIN N-ACETYLTRANSFERASE PA4866
publication title Crystal Structure of a Putative Phosphinothricin Acetyltransferase (Pa4866) from Pseudomonas Aeruginosa Pac1
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 47
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2005-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2bl1A00
3S6KA 3LD2A 3ZJ0A 5EC4A 2Q44A 4KOUA 2IL4A 4FD6A 2NMTA 1Z9UA 2VQYA 2J8MA 1XEBA 2CNTA 4F6AA 4UBRA 1XIXA 4H6UA 4AVBA 4B5PA 2I79A 1YVOA 2VBQA 1P4NA 3D2MA 4KVOE 3EXNA 4J3GA 5F46A 5KTDA 2R7HA 1QSRA 1VHSA 1RXTA 1KUVA 4PV6A 2EUIA 3GKRA 4JLYA 1KUYA 1IICA 4KLVA 1YR0A 2X7BA 5IV0A 4KUAA 2VXKA 2Y0MA 2OH1A 4U5YA 4FD7A 2Q0YA 3EC4A 4GS4A 1Z4RA 3KKWA 2Z0ZA 1PUAA 2BL1A 4AVCA 3P2HA 5IB0A 2OU2A 2ATRA 2DXQA 5F47A 3W91A 3NE7A 4KORA 4XPLA 2REEA 1CJWA 2REFA 5KTAA 4RS2A 4EVYA 2VZYA 2OZUA 4E0AA 4MHDA 3TOAA 3F0AA 3SHPA 5DWNA 4KOVA 4XPDB 4UWJA 2JDDA 1QSTA 3FNCA 5HH1A 3DNSA 4U9YA 2GE3A 1YREA 1YK3A 1R57A 2Z11A 3FXTA 4DNCA 4E8OA 5F49A 4M85A 2A4NA 4BMHA 5H86A 1K4JA 1QSOA 4NEXA 4NXYA 3N7ZA 1YLEA 2QECA 4HNYB 4KVME 4ORFA 4B5PB 3JUWA 2GIVA 2Q4YA 2BSWA 4RI1A 4XNHB 3TCVA 2AE6A 3GY9A 4M3SA 1S7LA 4QBJA 2PR8A 3F8KA 3PZJA 4HNXB 4PSXA 4OLLA 1CM0A 2EVNA 4CS0B 2C27A 5CNPA 3S6FA 4KOWA 2D4OA 3TO7A 3D8PA 4XNHC 3BLNA 4UWIA 2HUZA 4CRZB 2FS5A 2WPWA 3K9UA 2B5GA 2FL4A 1ON0A 2CY2A 1WK4A 3OWCA 3G3SA 3I9SA 2PR1A 3BJ8A 4NCZA 1XE4A 1QSMA 1MJBA 1FY7A 1LRZA 4PK2A 4ONUA 1XF8A 4B5OA 1N71A 1S7KA 1U6MA 4L8AA 1S3ZA 2B3VA 5F48A 2OZGA 3FB3A 1BOBA 2J8NA 2VZZA 1S5KA 2G0BA 4R87A 4KLWA 1M4GA 2J8RA 5GCNA 4KOSA 2QIRA 2P6FA 2OZHA 3FRMA 1XMTA 2G3AA 5C82A 4ZBGA 2BUEA 4CAXA 4KVXA 3FIXA 3V8IA 4IUSA 3P2FA 1S7NA 1RO5A 4UA3A 2FXFA 2HV2A 2Q7BA 1S60A 3R9FA 2QMLA 2JLMA 2B58A 5EBVA 2H5MA 2ARHA 2Q4VA 2ZXVA 1KUXA 1TIQA 4AB7A 2JEVA 4JJXA 5I0CA 2WPXA 2PQ8A 4Y49C 3JVNA 1UFHA 3MGDA 4U9ZA 1Q2DA 3CXPA 1I1DA 4KZTA 4MJ8A 4JWPA 2Q04A 3DDDA 2ZW4A 1MJ9A 1MK4A 2B5GB 4E2AA 5IX3A 3FBUA 2FSRA 4IF5A 3E0KA 2R1IA 1M1DA 2PDOA 1PU9A 1MJAA 3TOBA 4FD4A 1YGHA 3UY5A 4HNWB 5FVJA 3C26A 1NMTA 1S7FA 4PK3A 1P0HA 4CAWA 2FIAA 4H6ZA 4CAVA 4AG7A 2B4DA 3BJ7A 3PGPA 2K5TA 5KTCA 3EY5A 3D2PA 4R57A 1M44A 2PC1A 1YX0A 3VWDA 4II9A 4KOYA 1J4JA 2JDCA 3GYAA 2AJ6A 2PRBA 3WR7A 3DR6A 3PP9A 1GHEA 5JQ4A 3EFAA 4X5KA 1Y7RA 3DR8A 2PSWA 3G8WA 1M4DA 2RC4A 2CNSA 2I00A 4HKFA 3RYOA 4I49A 4LUAA 2CNMA 3F5BA 4FD5A 3S6HA 1I21A 1I12A 3W6XA 3IGRA 2OB0A 4KOTA 1Z4EA 4QB9A 3H4QA 2FE7A 1YVKA 4R9MA 1OZPA 3TO6A 4LX9A 5ISVA 4R3KA 2Z10A 4YFJA 1NSLA 3R1KA 3R9GA 3QB8A 2P6EA 2O28A 2KCWA 4Y49B 2ZW6A 1WWZA 5E96A 3ZZIA 3TFYA 3SXOA 3W6SA 1KZFA 4MY3A 1NE9A 3T90A 2ZPAA 4YGOA 5J8CA 2B3UA 1Q2YA 2F5IA 3EO4A 3IWGA 1IB1E 3B8GA 4K30A 4YRHA 4JD6A 4MI4A 2B4DB 1Y9WA 3CXQA 5J8FA 4OAEA 2ZW5A 4NSQA 1VKCA 2FIWA 3I3GA 2G3TA 2GANA 5C88A 2FCKA 2B4BA 1IYKA 5DWMA 3R96A 2P6GA 3LODA 4OADA 2R98A 2R8VA 2P0WA 3TTHA 1B87A 3TT2A 4JXRA 2D4PA 1V0CA 3CXSA 1IYLA 3TE4A 1IIDA 3DSBA 2FT0A 4KUBA 5HMNA 4PSWA 1B6BA 3VWEA 3R9EA 4H89A 1BO4A 2VI7A 4L89A 4XPDC 4QVTA 4JXQA 2BEIA 3SXNA 5H84A 1M4IA 4MBUA 1QSNA 2HQYA 4NF1A 5JPHA 1L0CA 3D3SA 3QAHA 4QUSA 4XPKA 1Q2CA 3T9YA 1SQHA 1Y9KA 4R3LA 4AVAA 3S6GA 3FYNA 2VEZA 4F0YA 4QC6A 4KOXA 4CRYB 4MY0A 3TO9A 3R95A 4AG9A 2ZW7A
chains in the Genus database with same CATH superfamily
3KGQA 4NGQA 3H8EA 3S6KA 3LD2A 3ZJ0A 2HC9A 4MRIA 1XMBA 4CPAA 5HVFA 5THWA 5EC4A 2Q44A 3B3WA 2QJ8A 5K8NA 3ISXA 1VHOA 4CYQA 3B3TA 3S9NA 2CTBA 5LRGA 4KOUA 4MCRA 5K8PA 2CXAA 2PJ4A 2IL4A 4FD6A 1Z8LA 1Z9UA 2NMTA 4UCMA 2ZOGA 2VQYA 2J9AA 3FMCA 2J8MA 4R6TA 5LRJA 1XEBA 2CNTA 4F6AA 4F0XA 4OP4A 2GLJA 2OR4A 5G21A 5HXDA 4B10A 4UBRA 1XIXA 4H6UA 4PXCA 4AVBA 4EMEA 4OIDA 4B5PA 2I79A 3BI0A 1YVOA 4OC1A 4OC0A 2VBQA 1P4NA 3D2MA 3KQZA 2PCUA 4KVOE 3EXNA 4PPZA 3V38A 3FECA 4J3GA 5A28A 2I3CA 2POKA 2XEJA 4CYPA 3S9LA 5F46A 5G1ZA 4RUHA 1EE3P 5KTDA 1IGBA 4GM5A 2R7HA 2EBJA 3B3VA 1QSRA 1VHSA 1RXTA 1KUVA 4LQGA 1VHEA 3PFOA 2EUIA 1CBXA 1PCAA 4PV6A 3GKRA 4JLYA 1AMPA 1R3NA 1KUYA 1IICA 4YU9A 4KLVA 4A94A 4MCSA 1YR0A 5AG4A 4A33A 2X7BA 5IV0A 4KUAA 2VXKA 1Z5RA 3S9MA 2PJ0A 2Y0MA 4MFPA 2OH1A 1TF9A 3QAYA 4FD7A 4U5YA 4F9UA 3WC5A 4OKOA 2Q0YA 5K8MA 3GB0A 3EC4A 3VATA 4GS4A 1Z4RA 1CPSA 1ZLHA 2Z0ZA 1PUAA 2BL1A 3KKWA 3P2HA 2PE3A 1LAPA 2OU2A 2ATRA 4A30A 4AVCA 5IB0A 2DXQA 5F47A 1QMUA 3GUXA 3W91A 3NE7A 5I4MA 4KORA 4XPLA 2REEA 1Y0YA 1CJWA 2REFA 2JBKA 1YMEA 3PB4X 5LRKA 3FEDA 5KTAA 4RS2A 4EVYA 2GU2A 2VZYA 2OZUA 3FVLA 4WJBA 5EMIA 2JEWA 4UFVA 4MCPA 3D7FA 1R43A 4E0AA 3H8FA 4MHDA 4C68A 3TOAA 3F0AA 3SHPA 4EWTA 2WUUA 4P4IA 3CT9A 5LYFA 2HB6A 5DWNA 3DGVA 3LMSA 4KOVA 4XPDB 4BINA 4MMOA 2WSAA 4UWJA 4P45A 5BWAB 2C6CA 2WYRA 3KI9A 4ZY2A 4CGLA 2JDDA 1QSTA 5LYDA 3FNCA 5HH1A 3WC6A 3DNSA 1YW4A 4U9YA 1TKFA 4A31A 3NE8A 2GE3A 1YREA 2CIJA 1HEEA 1PYTB 1YK3A 1R57A 2Z11A 3FXTA 4DNCA 4E8OA 5F49A 3LWUA 1JWQA 1NSAA 3KHXA 4M85A 2A4NA 1Z8WA 4KSFA 4BMHA 4ZI6A 5H86A 1K4JA 1QSOA 4FAIA 3LACA 4NEXA 1CX8A 4NXYA 2PJCA 1Q7LA 2CTCA 5CPAA 3N7ZA 1YLEA 2QECA 4HNYB 2ZEHA 4KVME 1TF8A 4ORFA 4UFWA 3IO1A 4B5PB 5JM6A 3JUWA 2GIVA 2PJ8A 2Q4YA 2ANPA 2BSWA 4RI1A 4XNHB 2AE6A 3GY9A 3RNZA 3TCVA 4P6YA 3DLJA 4M3SA 6CPAA 3KR4A 3PBEA 1S7LA 2ZEEA 1LFWA 4B12A 4QBJA 2RB7A 4ZX9A 1XBUA 2PR8A 1H8LA 3F8KA 3PZJA 4HNXB 4PSXA 4OLLA 1ZG7A 3GLJA 4UEFA 1CM0A 1KWMA 2PVWA 2EVNA 3NH8A 4CS0B 4MXUA 2C27A 2IMOA 3V7ZA 5CNPA 4IHMA 2YNCC 2BCOA 2ZOFA 3S6FA 4KOWA 2D4OA 2DF5A 3TO7A 3D8PA 2V8DA 4OC3A 3PRTA 2ZEDA 4NGSA 4XNHC 2O53A 3BLNA 4UWIA 1YSJA 4CGOA 3B35A 3KHZA 2PIYA 2PJ3A 4IAVA 2HUZA 3NH4A 1HDQA 2ZEGA 3IFEA 4UIBA 3WT4A 4G1PA 3MRUA 4CRZB 1LCPA 2FS5A 3D66A 4BD9A 4F9VA 1IY7A 2WPWA 3K9UA 4DUKA 2B5GA 3T8WA 2FL4A 4FWUA 1ON0A 1VIXA 1WK4A 2CY2A 4CAFA 3IEHA 5K8OA 3OWCA 3G3SA 1DTDA 4NGMA 3I9SA 2PR1A 3PEIA 2PJBA 3BJ8A 4NCZA 1XE4A 1QSMA 1MJBA 8CPAA 2YNCA 1ELMP 4X8IA 1QQ9A 1FY7A 2AFOA 1LRZA 2ODFA 4B14A 3D68A 4PK2A 5D8NA 4ONUA 1XF8A 4B5OA 1N71A 1S7KA 3RO0A 1U6MA 4L8AA 4P4JA 1S3ZA 2B3VA 5F48A 4H2KA 1IOFA 2OZGA 3D4UA 3FB3A 1BOBA 4PXDA 2J8NA 2VZZA 1OBRA 1S5KA 2PJ2A 4OIWA 2Q7SA 4YWYA 4UEZA 1Z2LA 1YW6A 2AFZA 2G0BA 4R87A 4KLWA 1M4GA 4CGMA 2J8RA 5GCNA 2FVGA 4KOSA 2C1CA 2P6FA 2QIRA 4MHYA 2OZHA 4C2XA 3FRMA 4Q38A 2V8GA 1A2ZA 4C7HA 1XMTA 3SI1A 3PB8X 2G3AA 4HPSA 4W9YA 5AG7A 5C82A 4ZBGA 2BUEA 1X12A 4NGTA 4C2YA 5CBMA 2YGWA 3H8GA 4CAXA 3PBBA 4KVXA 5JH9A 3FIXA 3FX6A 3V8IA 3SJXA 4F8ZA 4IUSA 1LOKA 3D67A 3P2FA 4A38A 2PJ9A 5DS0A 1S7NA 1RO5A 3FEEA 4OC5A 4UCNA 4UA3A 2FXFA 2HV2A 2Q43A 3IC1A 2Q7BA 4BBHA 1S60A 4KSIA 3R9FA 4ONWA 2QMLA 2JLMA 2B58A 5EBVA 2H5MA 2ARHA 1CP7A 2Q4VA 2ZXVA 4ZYQA 1XOVA 4CYNA 4Z65A 5LYLA 2V77A 2NSMA 1KUXA 2XEFA 1TIQA 4AB7A 4UF4A 2JEVA 4M6IA 3PB9X 1FNOA 2YNEA 1TKJA 4JJXA 4B13A 5I0CA 2WPXA 2PQ8A 4Y49C 4RN7A 3JVNA 3WC7A 4CGPA 4ZY1A 1X10A 2F8HA 1UFHA 2Z3NA 3MGDA 3I1UA 4U9ZA 1Q2DA 3CXPA 1BPMA 2ZEMA 5LYIA 1I1DA 4KZTA 4B6ZA 1AUGA 4JWPA 2Q04A 3DDDA 4MJ8A 2XEIA 2Z3MA 2ZW4A 4UIAA 5G20A 5G22A 4P44A 4X3RA 1MJ9A 1MK4A 4MCQA 3K2KA 4MHPA 2QYVA 2B5GB 4E2AA 5IX3A 1DE4C 3FBUA 3HLPA 2QVPA 1ZO0A 2FSRA 4IF5A 2GLFA 4NFRA 3L2NA 3E0KA 2R1IA 1M1DA 2PDOA 5JGFA 2G9DA 2DEAA 1PU9A 1MJAA 4MHZA 3TOBA 4FD4A 1BPNA 1YGHA 4ZGYB 1YLOA 4O23A 2V8HA 4WWVA 4HNWB 5FVJA 3UY5A 3C26A 3VARA 2OOTA 4R8FA 1NMTA 1S7FA 4PK3A 1P0HA 2JBJA 3HUVA 3FJUA 5AGEA 4CAWA 4JZ0A 2FIAA 1Y7EA 3RAMA 4H6ZA 4CAVA 2AFWA 1BLLE 2AFSA 3RBUA 4M6HA 4AG7A 2B4DA 3B3SA 1XFOA 4KSAA 4MFKA 4TNUA 3BJ7A 2RFHA 2IQ6A 2K5TA 3PGPA 4FUUA 4X2TA 3EY5A 5KTCA 4ZY0A 3D2PA 4R57A 1M44A 1TXRA 2ABZA 2PC1A 1YX0A 2PJ5A 3VWDA 4II9A 4KOYA 1J4JA 3B2YA 4A2ZA 2PIZA 1CG2A 2JDCA 2NYQA 3GYAA 2AJ6A 2EK8A 4OC4A 3KQXA 2PRBA 3PB6X 3WR7A 2AFMA 3DR6A 4P4BA 4DJLA 3CZXA 3PP9A 4LQ6A 1GHEA 2PVVA 3GIUA 7CPAA 5JQ4A 3EFAA 1GYTA 3H5ZA 3A9LA 4X5KA 1Y7RA 4IK2A 4A95A 3VH9A 1ARMA 1JQGA 2V8VA 2PJAA 3DR8A 2PSWA 2YNDA 3G8WA 1ARLA 1AYEA 3MN8A 3NFZA 1M4DA 1LANA 2CNSA 2RC4A 2I00A 4HKFA 1ELLP 3RYOA 3PB7X 4I49A 4LUAA 2Q4ZA 2CNMA 3CPXA 2PJ1A 3F5BA 3IWWA 4FD5A 3RZAA 2DPTA 1I21A 3S6HA 3SJEA 4DYOA 1I12A 4P4DA 3W6XA 3IGRA 4CGNA 2OB0A 2EWBA 4KOTA 1Z4EA 1Z8XA 2EO8A 4QB9A 4A37A 5HVHA 3H4QA 2FE7A 1YVKA 4R9MA 1OZPA 4R76A 2F7VA 3TO6A 1F2OA 4PXEA 1HDUA 3IJ3A 4LX9A 4UCPA 4UFXA 2BOAA 5ISVA 4NGNA 4MFLA 2Z3PA 2ZENA 1Z8TA 5AG6A 1IOIA 4R3KA 3KASA 2Z10A 4EFDA 1F57A 1NSLA 4YFJA 2PJ7A 2Z3KA 5HVGA 3R1KA 3R9GA 3D7GA 3QB8A 4Q36A 2P6EA 1UWYA 4KS9A 2O28A 2KCWA 3KZWA 3N5FA 4Y49B 3SI2A 2ZW6A 1WWZA 4CYOA 5E96A 3SI0A 3ZZIA 1ZG8A 3TFYA 4MFZA 3SXOA 1YQEA 4C7IA 3W6SA 1KZFA 2PRQA 4MY3A 2PJ6A 1M4LA 2ZELA 1NE9A 2BO9A 4AXVA 3T90A 4R7MA 2ZPAA 4YGOA 5J8CA 2B3UA 1Q2YA 2F5IA 1RTQA 3EO4A 3IWGA 3JRUA 1IB1E 2Z3LA 3B8GA 1LAMA 4K30A 4NJRA 1ZLIA 4JD6A 4MI4A 4YRHA 4ZX8A 2B4DB 4PXBA 1TKHA 1XRYA 1Y9WA 3CXQA 5A27A 5J8FA 3NH5A 3D7HA 4OAEA 2ZEPA 2ZW5A 4NSQA 2O4HA 4MHNA 1VKCA 2FIWA 3BI1A 3I3GA 3IIBA 4CAEA 2G3TA 2WZNA 2GANA 5C88A 4GXHA 2FCKA 2B4BA 1IYKA 2IJZA 5DWMA 1XJOA 3R96A 5F09A 2AFUA 2P6GA 4M6GA 3LODA 1IU8A 4OADA 2C6GA 2R98A 2R8VA 4FBEA 4NGRA 2P0WA 3TTHA 1B87A 3SJGA 3IU2A 1ZG9A 3TT2A 3FF3A 2EK9A 3K9TA 4P10A 4JXRA 4TWEA 2D4PA 1V0CA 4A32A 3CXSA 1IYLA 3TE4A 2GFQA 3CDXA 3QNVA 4C2ZA 5J1QA 2ZEFA 1IIDA 3DSBA 4PQAA 3SJFA 3PFEA 5IB9A 3FH4A 2GREA 1VGYA 2FT0A 4KUBA 2ZEOA 3NA6A 5HMNA 4Q7AA 4PSWA 1B6BA 3ISZA 3IWEA 3D7DA 3VWEA 3R9EA 2VL1A 4H89A 1BO4A 2VI7A 3BXMA 4L89A 1CPXA 4XPDC 4QVTA 4K3NA 4JXQA 2BEIA 5D29A 3BHXA 3CPAA 3KR5A 1BAVA 4MFJA 3SXNA 4OMEA 5H84A 4OC2A 3B7IA 1M4IA 2CF4A 4MBUA 2C6PA 2Q51A 1QSNA 2HQYA 4NF1A 5JPHA 1L0CA 3D3SA 4NJQA 3QAHA 4MFQA 4JYWA 4QUSA 4A39A 4XPKA 3IU1A 1FT7A 1Q2CA 4NGPA 5AG5A 4P4EA 3T9YA 1F2PA 1SQHA 1Y9KA 3KL9A 4R3LA 3WABA 3TC8A 4AVAA 2AFXA 3S6GA 3B3CA 1Y0RA 4UEEA 2DPSA 4B11A 3FYNA 2XEGA 1CP6A 2VEZA 4F0YA 4P4FA 4QC6A 4KOXA 4CRYB 5ELYA 2Z3OA 4MY0A 3TO9A 3JTKA 3TX8A 3R95A 4AG9A 2ZW7A
chains in the Genus database with same CATH topology
3S6KA 3LD2A 3ZJ0A 5EC4A 2Q44A 4CYQA 4KOUA 2CXAA 2IL4A 4FD6A 2NMTA 1Z9UA 4UCMA 2VQYA 2J8MA 1XEBA 2CNTA 4F6AA 4F0XA 5G21A 4B10A 4UBRA 1XIXA 4H6UA 4AVBA 4B5PA 2I79A 1YVOA 2VBQA 1P4NA 3D2MA 4KVOE 3EXNA 4J3GA 5A28A 4CYPA 5F46A 5G1ZA 5KTDA 2R7HA 1QSRA 1VHSA 1RXTA 1KUVA 4PV6A 2EUIA 3GKRA 4JLYA 1KUYA 1IICA 4KLVA 1YR0A 5AG4A 4A33A 2X7BA 5IV0A 4KUAA 2VXKA 2Y0MA 4MFPA 2OH1A 4U5YA 4FD7A 2Q0YA 3EC4A 4GS4A 1Z4RA 3KKWA 2Z0ZA 1PUAA 2BL1A 4A30A 3P2HA 4AVCA 5IB0A 2OU2A 2ATRA 2DXQA 5F47A 3W91A 3NE7A 4KORA 4XPLA 2REEA 1CJWA 2REFA 5KTAA 4RS2A 4EVYA 2VZYA 2OZUA 4UFVA 4E0AA 4MHDA 4C68A 3TOAA 3F0AA 3SHPA 2WUUA 5DWNA 4KOVA 4XPDB 2WSAA 4UWJA 5BWAB 4CGLA 2JDDA 1QSTA 3FNCA 5HH1A 3DNSA 4U9YA 4A31A 2GE3A 1YREA 1YK3A 1R57A 2Z11A 3FXTA 4DNCA 4E8OA 5F49A 4M85A 2A4NA 4KSFA 4BMHA 5H86A 1K4JA 1QSOA 4NEXA 4NXYA 3N7ZA 1YLEA 2QECA 4HNYB 4KVME 4ORFA 4UFWA 4B5PB 3JUWA 2GIVA 2Q4YA 2BSWA 4RI1A 4XNHB 3TCVA 2AE6A 3GY9A 4M3SA 1S7LA 4B12A 4QBJA 2PR8A 3F8KA 3PZJA 4HNXB 4PSXA 4OLLA 1CM0A 2EVNA 4CS0B 2C27A 5CNPA 2YNCC 3S6FA 4KOWA 2D4OA 3TO7A 3D8PA 4XNHC 3BLNA 4UWIA 4CGOA 2HUZA 4CRZB 2FS5A 2WPWA 3K9UA 2B5GA 2FL4A 1ON0A 2CY2A 1WK4A 4CAFA 3OWCA 3G3SA 3I9SA 2PR1A 3BJ8A 4NCZA 1XE4A 1QSMA 1MJBA 2YNCA 1FY7A 4B14A 1LRZA 4PK2A 4ONUA 1XF8A 4B5OA 1N71A 1S7KA 1U6MA 4L8AA 1S3ZA 2B3VA 5F48A 2OZGA 3FB3A 1BOBA 2J8NA 2VZZA 1S5KA 2G0BA 4R87A 4KLWA 1M4GA 4CGMA 2J8RA 5GCNA 4KOSA 2QIRA 2P6FA 2OZHA 4C2XA 3FRMA 4Q38A 4C7HA 1XMTA 2G3AA 5AG7A 5C82A 4ZBGA 2BUEA 4C2YA 2YGWA 4CAXA 4KVXA 3FIXA 3V8IA 4IUSA 3P2FA 1S7NA 1RO5A 4UCNA 4UA3A 2FXFA 2HV2A 2Q7BA 4BBHA 1S60A 3R9FA 2QMLA 2JLMA 2B58A 5EBVA 2H5MA 2ARHA 2Q4VA 2ZXVA 4CYNA 1KUXA 1TIQA 4AB7A 2JEVA 2YNEA 4JJXA 4B13A 5I0CA 2WPXA 2PQ8A 4Y49C 3JVNA 4CGPA 1UFHA 2Z3NA 3MGDA 4U9ZA 1Q2DA 3CXPA 1I1DA 4KZTA 4MJ8A 4JWPA 2Q04A 3DDDA 5G20A 2Z3MA 2ZW4A 5G22A 1MJ9A 1MK4A 2B5GB 4E2AA 5IX3A 3FBUA 1ZO0A 2FSRA 4IF5A 3E0KA 2R1IA 1M1DA 2PDOA 1PU9A 1MJAA 3TOBA 4FD4A 1YGHA 4ZGYB 3UY5A 4HNWB 5FVJA 3C26A 1NMTA 1S7FA 4PK3A 1P0HA 5AGEA 4CAWA 2FIAA 4H6ZA 4CAVA 4AG7A 2B4DA 4MFKA 4KSAA 3BJ7A 3PGPA 2K5TA 5KTCA 3EY5A 3D2PA 4R57A 1M44A 2PC1A 1YX0A 3VWDA 4II9A 4KOYA 1J4JA 4A2ZA 2JDCA 3GYAA 2AJ6A 2PRBA 3WR7A 3DR6A 3PP9A 1GHEA 5JQ4A 3EFAA 3H5ZA 4X5KA 3A9LA 1Y7RA 4A95A 3DR8A 2PSWA 2YNDA 3G8WA 1M4DA 2RC4A 2CNSA 2I00A 4HKFA 3RYOA 4I49A 4LUAA 2CNMA 3F5BA 4FD5A 3S6HA 2DPTA 1I21A 1I12A 3W6XA 3IGRA 4CGNA 2OB0A 4KOTA 1Z4EA 4QB9A 3H4QA 2FE7A 1YVKA 4R9MA 1OZPA 3TO6A 4LX9A 4UCPA 4UFXA 5ISVA 4MFLA 2Z3PA 5AG6A 4R3KA 2Z10A 4YFJA 1NSLA 2Z3KA 3R1KA 3R9GA 3QB8A 4Q36A 2P6EA 4KS9A 2O28A 2KCWA 4Y49B 2ZW6A 1WWZA 4CYOA 5E96A 3ZZIA 3TFYA 4MFZA 3SXOA 4C7IA 3W6SA 1KZFA 4MY3A 1NE9A 3T90A 2ZPAA 4YGOA 5J8CA 2B3UA 1Q2YA 2F5IA 3EO4A 3IWGA 1IB1E 2Z3LA 3B8GA 4K30A 4YRHA 4JD6A 4MI4A 2B4DB 1Y9WA 3CXQA 5A27A 5J8FA 4OAEA 2ZW5A 4NSQA 1VKCA 2FIWA 3I3GA 4CAEA 2G3TA 2GANA 5C88A 2FCKA 2B4BA 1IYKA 5DWMA 3R96A 2P6GA 3LODA 4OADA 2R98A 2R8VA 2P0WA 3TTHA 1B87A 3IU2A 3TT2A 4JXRA 2D4PA 1V0CA 4A32A 3CXSA 1IYLA 3TE4A 4C2ZA 1IIDA 3DSBA 2FT0A 4KUBA 5HMNA 4PSWA 1B6BA 3IWEA 3VWEA 3R9EA 4H89A 1BO4A 2VI7A 4L89A 4XPDC 4QVTA 4JXQA 2BEIA 4MFJA 3SXNA 5H84A 1M4IA 4MBUA 1QSNA 2HQYA 4NF1A 5JPHA 1L0CA 3D3SA 3QAHA 4MFQA 4QUSA 4XPKA 3IU1A 1Q2CA 5AG5A 3T9YA 1SQHA 1Y9KA 4R3LA 4AVAA 4B11A 3S6GA 2DPSA 3FYNA 2VEZA 4F0YA 4QC6A 4KOXA 4CRYB 2Z3OA 4MY0A 3TO9A 3JTKA 3R95A 4AG9A 2ZW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S6K A;  3LD2 A;  3ZJ0 A;  5EC4 A;  2Q44 A;  4KOU A;  2IL4 A;  4FD6 A;  2NMT A;  1Z9U A;  2VQY A;  2J8M A;  1XEB A;  2CNT A;  4F6A A;  4UBR A;  1XIX A;  4H6U A;  4AVB A;  4B5P A;  2I79 A;  1YVO A;  2VBQ A;  1P4N A;  3D2M A;  4KVO E;  3EXN A;  4J3G A;  5F46 A;  5KTD A;  2R7H A;  1QSR A;  1VHS A;  1RXT A;  1KUV A;  4PV6 A;  2EUI A;  3GKR A;  4JLY A;  1KUY A;  1IIC A;  4KLV A;  1YR0 A;  2X7B A;  5IV0 A;  4KUA A;  2VXK A;  2Y0M A;  2OH1 A;  4U5Y A;  4FD7 A;  2Q0Y A;  3EC4 A;  4GS4 A;  1Z4R A;  3KKW A;  2Z0Z A;  1PUA A;  2BL1 A;  4AVC A;  3P2H A;  5IB0 A;  2OU2 A;  2ATR A;  2DXQ A;  5F47 A;  3W91 A;  3NE7 A;  4KOR A;  4XPL A;  2REE A;  1CJW A;  2REF A;  5KTA A;  4RS2 A;  4EVY A;  2VZY A;  2OZU A;  4E0A A;  4MHD A;  3TOA A;  3F0A A;  3SHP A;  5DWN A;  4KOV A;  4XPD B;  4UWJ A;  2JDD A;  1QST A;  3FNC A;  5HH1 A;  3DNS A;  4U9Y A;  2GE3 A;  1YRE A;  1YK3 A;  1R57 A;  2Z11 A;  3FXT A;  4DNC A;  4E8O A;  5F49 A;  4M85 A;  2A4N A;  4BMH A;  5H86 A;  1K4J A;  1QSO A;  4NEX A;  4NXY A;  3N7Z A;  1YLE A;  2QEC A;  4HNY B;  4KVM E;  4ORF A;  4B5P B;  3JUW A;  2GIV A;  2Q4Y A;  2BSW A;  4RI1 A;  4XNH B;  3TCV A;  2AE6 A;  3GY9 A;  4M3S A;  1S7L A;  4QBJ A;  2PR8 A;  3F8K A;  3PZJ A;  4HNX B;  4PSX A;  4OLL A;  1CM0 A;  2EVN A;  4CS0 B;  2C27 A;  5CNP A;  3S6F A;  4KOW A;  2D4O A;  3TO7 A;  3D8P A;  4XNH C;  3BLN A;  4UWI A;  2HUZ A;  4CRZ B;  2FS5 A;  2WPW A;  3K9U A;  2B5G A;  2FL4 A;  1ON0 A;  2CY2 A;  1WK4 A;  3OWC A;  3G3S A;  3I9S A;  2PR1 A;  3BJ8 A;  4NCZ A;  1XE4 A;  1QSM A;  1MJB A;  1FY7 A;  1LRZ A;  4PK2 A;  4ONU A;  1XF8 A;  4B5O A;  1N71 A;  1S7K A;  1U6M A;  4L8A A;  1S3Z A;  2B3V A;  5F48 A;  2OZG A;  3FB3 A;  1BOB A;  2J8N A;  2VZZ A;  1S5K A;  2G0B A;  4R87 A;  4KLW A;  1M4G A;  2J8R A;  5GCN A;  4KOS A;  2QIR A;  2P6F A;  2OZH A;  3FRM A;  1XMT A;  2G3A A;  5C82 A;  4ZBG A;  2BUE A;  4CAX A;  4KVX A;  3FIX A;  3V8I A;  4IUS A;  3P2F A;  1S7N A;  1RO5 A;  4UA3 A;  2FXF A;  2HV2 A;  2Q7B A;  1S60 A;  3R9F A;  2QML A;  2JLM A;  2B58 A;  5EBV A;  2H5M A;  2ARH A;  2Q4V A;  2ZXV A;  1KUX A;  1TIQ A;  4AB7 A;  2JEV A;  4JJX A;  5I0C A;  2WPX A;  2PQ8 A;  4Y49 C;  3JVN A;  1UFH A;  3MGD A;  4U9Z A;  1Q2D A;  3CXP A;  1I1D A;  4KZT A;  4MJ8 A;  4JWP A;  2Q04 A;  3DDD A;  2ZW4 A;  1MJ9 A;  1MK4 A;  2B5G B;  4E2A A;  5IX3 A;  3FBU A;  2FSR A;  4IF5 A;  3E0K A;  2R1I A;  1M1D A;  2PDO A;  1PU9 A;  1MJA A;  3TOB A;  4FD4 A;  1YGH A;  3UY5 A;  4HNW B;  5FVJ A;  3C26 A;  1NMT A;  1S7F A;  4PK3 A;  1P0H A;  4CAW A;  2FIA A;  4H6Z A;  4CAV A;  4AG7 A;  2B4D A;  3BJ7 A;  3PGP A;  2K5T A;  5KTC A;  3EY5 A;  3D2P A;  4R57 A;  1M44 A;  2PC1 A;  1YX0 A;  3VWD A;  4II9 A;  4KOY A;  1J4J A;  2JDC A;  3GYA A;  2AJ6 A;  2PRB A;  3WR7 A;  3DR6 A;  3PP9 A;  1GHE A;  5JQ4 A;  3EFA A;  4X5K A;  1Y7R A;  3DR8 A;  2PSW A;  3G8W A;  1M4D A;  2RC4 A;  2CNS A;  2I00 A;  4HKF A;  3RYO A;  4I49 A;  4LUA A;  2CNM A;  3F5B A;  4FD5 A;  3S6H A;  1I21 A;  1I12 A;  3W6X A;  3IGR A;  2OB0 A;  4KOT A;  1Z4E A;  4QB9 A;  3H4Q A;  2FE7 A;  1YVK A;  4R9M A;  1OZP A;  3TO6 A;  4LX9 A;  5ISV A;  4R3K A;  2Z10 A;  4YFJ A;  1NSL A;  3R1K A;  3R9G A;  3QB8 A;  2P6E A;  2O28 A;  2KCW A;  4Y49 B;  2ZW6 A;  1WWZ A;  5E96 A;  3ZZI A;  3TFY A;  3SXO A;  3W6S A;  1KZF A;  4MY3 A;  1NE9 A;  3T90 A;  2ZPA A;  4YGO A;  5J8C A;  2B3U A;  1Q2Y A;  2F5I A;  3EO4 A;  3IWG A;  1IB1 E;  3B8G A;  4K30 A;  4YRH A;  4JD6 A;  4MI4 A;  2B4D B;  1Y9W A;  3CXQ A;  5J8F A;  4OAE A;  2ZW5 A;  4NSQ A;  1VKC A;  2FIW A;  3I3G A;  2G3T A;  2GAN A;  5C88 A;  2FCK A;  2B4B A;  1IYK A;  5DWM A;  3R96 A;  2P6G A;  3LOD A;  4OAD A;  2R98 A;  2R8V A;  2P0W A;  3TTH A;  1B87 A;  3TT2 A;  4JXR A;  2D4P A;  1V0C A;  3CXS A;  1IYL A;  3TE4 A;  1IID A;  3DSB A;  2FT0 A;  4KUB A;  5HMN A;  4PSW A;  1B6B A;  3VWE A;  3R9E A;  4H89 A;  1BO4 A;  2VI7 A;  4L89 A;  4XPD C;  4QVT A;  4JXQ A;  2BEI A;  3SXN A;  5H84 A;  1M4I A;  4MBU A;  1QSN A;  2HQY A;  4NF1 A;  5JPH A;  1L0C A;  3D3S A;  3QAH A;  4QUS A;  4XPK A;  1Q2C A;  3T9Y A;  1SQH A;  1Y9K A;  4R3L A;  4AVA A;  3S6G A;  3FYN A;  2VEZ A;  4F0Y A;  4QC6 A;  4KOX A;  4CRY B;  4MY0 A;  3TO9 A;  3R95 A;  4AG9 A;  2ZW7 A; 
#chains in the Genus database with same CATH topology
 3KGQ A;  4NGQ A;  3H8E A;  3S6K A;  3LD2 A;  3ZJ0 A;  2HC9 A;  4MRI A;  1XMB A;  4CPA A;  5HVF A;  5THW A;  5EC4 A;  2Q44 A;  3B3W A;  2QJ8 A;  5K8N A;  3ISX A;  1VHO A;  4CYQ A;  3B3T A;  3S9N A;  2CTB A;  5LRG A;  4KOU A;  4MCR A;  5K8P A;  2CXA A;  2PJ4 A;  2IL4 A;  4FD6 A;  1Z8L A;  1Z9U A;  2NMT A;  4UCM A;  2ZOG A;  2VQY A;  2J9A A;  3FMC A;  2J8M A;  4R6T A;  5LRJ A;  1XEB A;  2CNT A;  4F6A A;  4F0X A;  4OP4 A;  2GLJ A;  2OR4 A;  5G21 A;  5HXD A;  4B10 A;  4UBR A;  1XIX A;  4H6U A;  4PXC A;  4AVB A;  4EME A;  4OID A;  4B5P A;  2I79 A;  3BI0 A;  1YVO A;  4OC1 A;  4OC0 A;  2VBQ A;  1P4N A;  3D2M A;  3KQZ A;  2PCU A;  4KVO E;  3EXN A;  4PPZ A;  3V38 A;  3FEC A;  4J3G A;  5A28 A;  2I3C A;  2POK A;  2XEJ A;  4CYP A;  3S9L A;  5F46 A;  5G1Z A;  4RUH A;  1EE3 P;  5KTD A;  1IGB A;  4GM5 A;  2R7H A;  2EBJ A;  3B3V A;  1QSR A;  1VHS A;  1RXT A;  1KUV A;  4LQG A;  1VHE A;  3PFO A;  2EUI A;  1CBX A;  1PCA A;  4PV6 A;  3GKR A;  4JLY A;  1AMP A;  1R3N A;  1KUY A;  1IIC A;  4YU9 A;  4KLV A;  4A94 A;  4MCS A;  1YR0 A;  5AG4 A;  4A33 A;  2X7B A;  5IV0 A;  4KUA A;  2VXK A;  1Z5R A;  3S9M A;  2PJ0 A;  2Y0M A;  4MFP A;  2OH1 A;  1TF9 A;  3QAY A;  4FD7 A;  4U5Y A;  4F9U A;  3WC5 A;  4OKO A;  2Q0Y A;  5K8M A;  3GB0 A;  3EC4 A;  3VAT A;  4GS4 A;  1Z4R A;  1CPS A;  1ZLH A;  2Z0Z A;  1PUA A;  2BL1 A;  3KKW A;  3P2H A;  2PE3 A;  1LAP A;  2OU2 A;  2ATR A;  4A30 A;  4AVC A;  5IB0 A;  2DXQ A;  5F47 A;  1QMU A;  3GUX A;  3W91 A;  3NE7 A;  5I4M A;  4KOR A;  4XPL A;  2REE A;  1Y0Y A;  1CJW A;  2REF A;  2JBK A;  1YME A;  3PB4 X;  5LRK A;  3FED A;  5KTA A;  4RS2 A;  4EVY A;  2GU2 A;  2VZY A;  2OZU A;  3FVL A;  4WJB A;  5EMI A;  2JEW A;  4UFV A;  4MCP A;  3D7F A;  1R43 A;  4E0A A;  3H8F A;  4MHD A;  4C68 A;  3TOA A;  3F0A A;  3SHP A;  4EWT A;  2WUU A;  4P4I A;  3CT9 A;  5LYF A;  2HB6 A;  5DWN A;  3DGV A;  3LMS A;  4KOV A;  4XPD B;  4BIN A;  4MMO A;  2WSA A;  4UWJ A;  4P45 A;  5BWA B;  2C6C A;  2WYR A;  3KI9 A;  4ZY2 A;  4CGL A;  2JDD A;  1QST A;  5LYD A;  3FNC A;  5HH1 A;  3WC6 A;  3DNS A;  1YW4 A;  4U9Y A;  1TKF A;  4A31 A;  3NE8 A;  2GE3 A;  1YRE A;  2CIJ A;  1HEE A;  1PYT B;  1YK3 A;  1R57 A;  2Z11 A;  3FXT A;  4DNC A;  4E8O A;  5F49 A;  3LWU A;  1JWQ A;  1NSA A;  3KHX A;  4M85 A;  2A4N A;  1Z8W A;  4KSF A;  4BMH A;  4ZI6 A;  5H86 A;  1K4J A;  1QSO A;  4FAI A;  3LAC A;  4NEX A;  1CX8 A;  4NXY A;  2PJC A;  1Q7L A;  2CTC A;  5CPA A;  3N7Z A;  1YLE A;  2QEC A;  4HNY B;  2ZEH A;  4KVM E;  1TF8 A;  4ORF A;  4UFW A;  3IO1 A;  4B5P B;  5JM6 A;  3JUW A;  2GIV A;  2PJ8 A;  2Q4Y A;  2ANP A;  2BSW A;  4RI1 A;  4XNH B;  2AE6 A;  3GY9 A;  3RNZ A;  3TCV A;  4P6Y A;  3DLJ A;  4M3S A;  6CPA A;  3KR4 A;  3PBE A;  1S7L A;  2ZEE A;  1LFW A;  4B12 A;  4QBJ A;  2RB7 A;  4ZX9 A;  1XBU A;  2PR8 A;  1H8L A;  3F8K A;  3PZJ A;  4HNX B;  4PSX A;  4OLL A;  1ZG7 A;  3GLJ A;  4UEF A;  1CM0 A;  1KWM A;  2PVW A;  2EVN A;  3NH8 A;  4CS0 B;  4MXU A;  2C27 A;  2IMO A;  3V7Z A;  5CNP A;  4IHM A;  2YNC C;  2BCO A;  2ZOF A;  3S6F A;  4KOW A;  2D4O A;  2DF5 A;  3TO7 A;  3D8P A;  2V8D A;  4OC3 A;  3PRT A;  2ZED A;  4NGS A;  4XNH C;  2O53 A;  3BLN A;  4UWI A;  1YSJ A;  4CGO A;  3B35 A;  3KHZ A;  2PIY A;  2PJ3 A;  4IAV A;  2HUZ A;  3NH4 A;  1HDQ A;  2ZEG A;  3IFE A;  4UIB A;  3WT4 A;  4G1P A;  3MRU A;  4CRZ B;  1LCP A;  2FS5 A;  3D66 A;  4BD9 A;  4F9V A;  1IY7 A;  2WPW A;  3K9U A;  4DUK A;  2B5G A;  3T8W A;  2FL4 A;  4FWU A;  1ON0 A;  1VIX A;  1WK4 A;  2CY2 A;  4CAF A;  3IEH A;  5K8O A;  3OWC A;  3G3S A;  1DTD A;  4NGM A;  3I9S A;  2PR1 A;  3PEI A;  2PJB A;  3BJ8 A;  4NCZ A;  1XE4 A;  1QSM A;  1MJB A;  8CPA A;  2YNC A;  1ELM P;  4X8I A;  1QQ9 A;  1FY7 A;  2AFO A;  1LRZ A;  2ODF A;  4B14 A;  3D68 A;  4PK2 A;  5D8N A;  4ONU A;  1XF8 A;  4B5O A;  1N71 A;  1S7K A;  3RO0 A;  1U6M A;  4L8A A;  4P4J A;  1S3Z A;  2B3V A;  5F48 A;  4H2K A;  1IOF A;  2OZG A;  3D4U A;  3FB3 A;  1BOB A;  4PXD A;  2J8N A;  2VZZ A;  1OBR A;  1S5K A;  2PJ2 A;  4OIW A;  2Q7S A;  4YWY A;  4UEZ A;  1Z2L A;  1YW6 A;  2AFZ A;  2G0B A;  4R87 A;  4KLW A;  1M4G A;  4CGM A;  2J8R A;  5GCN A;  2FVG A;  4KOS A;  2C1C A;  2P6F A;  2QIR A;  4MHY A;  2OZH A;  4C2X A;  3FRM A;  4Q38 A;  2V8G A;  1A2Z A;  4C7H A;  1XMT A;  3SI1 A;  3PB8 X;  2G3A A;  4HPS A;  4W9Y A;  5AG7 A;  5C82 A;  4ZBG A;  2BUE A;  1X12 A;  4NGT A;  4C2Y A;  5CBM A;  2YGW A;  3H8G A;  4CAX A;  3PBB A;  4KVX A;  5JH9 A;  3FIX A;  3FX6 A;  3V8I A;  3SJX A;  4F8Z A;  4IUS A;  1LOK A;  3D67 A;  3P2F A;  4A38 A;  2PJ9 A;  5DS0 A;  1S7N A;  1RO5 A;  3FEE A;  4OC5 A;  4UCN A;  4UA3 A;  2FXF A;  2HV2 A;  2Q43 A;  3IC1 A;  2Q7B A;  4BBH A;  1S60 A;  4KSI A;  3R9F A;  4ONW A;  2QML A;  2JLM A;  2B58 A;  5EBV A;  2H5M A;  2ARH A;  1CP7 A;  2Q4V A;  2ZXV A;  4ZYQ A;  1XOV A;  4CYN A;  4Z65 A;  5LYL A;  2V77 A;  2NSM A;  1KUX A;  2XEF A;  1TIQ A;  4AB7 A;  4UF4 A;  2JEV A;  4M6I A;  3PB9 X;  1FNO A;  2YNE A;  1TKJ A;  4JJX A;  4B13 A;  5I0C A;  2WPX A;  2PQ8 A;  4Y49 C;  4RN7 A;  3JVN A;  3WC7 A;  4CGP A;  4ZY1 A;  1X10 A;  2F8H A;  1UFH A;  2Z3N A;  3MGD A;  3I1U A;  4U9Z A;  1Q2D A;  3CXP A;  1BPM A;  2ZEM A;  5LYI A;  1I1D A;  4KZT A;  4B6Z A;  1AUG A;  4JWP A;  2Q04 A;  3DDD A;  4MJ8 A;  2XEI A;  2Z3M A;  2ZW4 A;  4UIA A;  5G20 A;  5G22 A;  4P44 A;  4X3R A;  1MJ9 A;  1MK4 A;  4MCQ A;  3K2K A;  4MHP A;  2QYV A;  2B5G B;  4E2A A;  5IX3 A;  1DE4 C;  3FBU A;  3HLP A;  2QVP A;  1ZO0 A;  2FSR A;  4IF5 A;  2GLF A;  4NFR A;  3L2N A;  3E0K A;  2R1I A;  1M1D A;  2PDO A;  5JGF A;  2G9D A;  2DEA A;  1PU9 A;  1MJA A;  4MHZ A;  3TOB A;  4FD4 A;  1BPN A;  1YGH A;  4ZGY B;  1YLO A;  4O23 A;  2V8H A;  4WWV A;  4HNW B;  5FVJ A;  3UY5 A;  3C26 A;  3VAR A;  2OOT A;  4R8F A;  1NMT A;  1S7F A;  4PK3 A;  1P0H A;  2JBJ A;  3HUV A;  3FJU A;  5AGE A;  4CAW A;  4JZ0 A;  2FIA A;  1Y7E A;  3RAM A;  4H6Z A;  4CAV A;  2AFW A;  1BLL E;  2AFS A;  3RBU A;  4M6H A;  4AG7 A;  2B4D A;  3B3S A;  1XFO A;  4KSA A;  4MFK A;  4TNU A;  3BJ7 A;  2RFH A;  2IQ6 A;  2K5T A;  3PGP A;  4FUU A;  4X2T A;  3EY5 A;  5KTC A;  4ZY0 A;  3D2P A;  4R57 A;  1M44 A;  1TXR A;  2ABZ A;  2PC1 A;  1YX0 A;  2PJ5 A;  3VWD A;  4II9 A;  4KOY A;  1J4J A;  3B2Y A;  4A2Z A;  2PIZ A;  1CG2 A;  2JDC A;  2NYQ A;  3GYA A;  2AJ6 A;  2EK8 A;  4OC4 A;  3KQX A;  2PRB A;  3PB6 X;  3WR7 A;  2AFM A;  3DR6 A;  4P4B A;  4DJL A;  3CZX A;  3PP9 A;  4LQ6 A;  1GHE A;  2PVV A;  3GIU A;  7CPA A;  5JQ4 A;  3EFA A;  1GYT A;  3H5Z A;  3A9L A;  4X5K A;  1Y7R A;  4IK2 A;  4A95 A;  3VH9 A;  1ARM A;  1JQG A;  2V8V A;  2PJA A;  3DR8 A;  2PSW A;  2YND A;  3G8W A;  1ARL A;  1AYE A;  3MN8 A;  3NFZ A;  1M4D A;  1LAN A;  2CNS A;  2RC4 A;  2I00 A;  4HKF A;  1ELL P;  3RYO A;  3PB7 X;  4I49 A;  4LUA A;  2Q4Z A;  2CNM A;  3CPX A;  2PJ1 A;  3F5B A;  3IWW A;  4FD5 A;  3RZA A;  2DPT A;  1I21 A;  3S6H A;  3SJE A;  4DYO A;  1I12 A;  4P4D A;  3W6X A;  3IGR A;  4CGN A;  2OB0 A;  2EWB A;  4KOT A;  1Z4E A;  1Z8X A;  2EO8 A;  4QB9 A;  4A37 A;  5HVH A;  3H4Q A;  2FE7 A;  1YVK A;  4R9M A;  1OZP A;  4R76 A;  2F7V A;  3TO6 A;  1F2O A;  4PXE A;  1HDU A;  3IJ3 A;  4LX9 A;  4UCP A;  4UFX A;  2BOA A;  5ISV A;  4NGN A;  4MFL A;  2Z3P A;  2ZEN A;  1Z8T A;  5AG6 A;  1IOI A;  4R3K A;  3KAS A;  2Z10 A;  4EFD A;  1F57 A;  1NSL A;  4YFJ A;  2PJ7 A;  2Z3K A;  5HVG A;  3R1K A;  3R9G A;  3D7G A;  3QB8 A;  4Q36 A;  2P6E A;  1UWY A;  4KS9 A;  2O28 A;  2KCW A;  3KZW A;  3N5F A;  4Y49 B;  3SI2 A;  2ZW6 A;  1WWZ A;  4CYO A;  5E96 A;  3SI0 A;  3ZZI A;  1ZG8 A;  3TFY A;  4MFZ A;  3SXO A;  1YQE A;  4C7I A;  3W6S A;  1KZF A;  2PRQ A;  4MY3 A;  2PJ6 A;  1M4L A;  2ZEL A;  1NE9 A;  2BO9 A;  4AXV A;  3T90 A;  4R7M A;  2ZPA A;  4YGO A;  5J8C A;  2B3U A;  1Q2Y A;  2F5I A;  1RTQ A;  3EO4 A;  3IWG A;  3JRU A;  1IB1 E;  2Z3L A;  3B8G A;  1LAM A;  4K30 A;  4NJR A;  1ZLI A;  4JD6 A;  4MI4 A;  4YRH A;  4ZX8 A;  2B4D B;  4PXB A;  1TKH A;  1XRY A;  1Y9W A;  3CXQ A;  5A27 A;  5J8F A;  3NH5 A;  3D7H A;  4OAE A;  2ZEP A;  2ZW5 A;  4NSQ A;  2O4H A;  4MHN A;  1VKC A;  2FIW A;  3BI1 A;  3I3G A;  3IIB A;  4CAE A;  2G3T A;  2WZN A;  2GAN A;  5C88 A;  4GXH A;  2FCK A;  2B4B A;  1IYK A;  2IJZ A;  5DWM A;  1XJO A;  3R96 A;  5F09 A;  2AFU A;  2P6G A;  4M6G A;  3LOD A;  1IU8 A;  4OAD A;  2C6G A;  2R98 A;  2R8V A;  4FBE A;  4NGR A;  2P0W A;  3TTH A;  1B87 A;  3SJG A;  3IU2 A;  1ZG9 A;  3TT2 A;  3FF3 A;  2EK9 A;  3K9T A;  4P10 A;  4JXR A;  4TWE A;  2D4P A;  1V0C A;  4A32 A;  3CXS A;  1IYL A;  3TE4 A;  2GFQ A;  3CDX A;  3QNV A;  4C2Z A;  5J1Q A;  2ZEF A;  1IID A;  3DSB A;  4PQA A;  3SJF A;  3PFE A;  5IB9 A;  3FH4 A;  2GRE A;  1VGY A;  2FT0 A;  4KUB A;  2ZEO A;  3NA6 A;  5HMN A;  4Q7A A;  4PSW A;  1B6B A;  3ISZ A;  3IWE A;  3D7D A;  3VWE A;  3R9E A;  2VL1 A;  4H89 A;  1BO4 A;  2VI7 A;  3BXM A;  4L89 A;  1CPX A;  4XPD C;  4QVT A;  4K3N A;  4JXQ A;  2BEI A;  5D29 A;  3BHX A;  3CPA A;  3KR5 A;  1BAV A;  4MFJ A;  3SXN A;  4OME A;  5H84 A;  4OC2 A;  3B7I A;  1M4I A;  2CF4 A;  4MBU A;  2C6P A;  2Q51 A;  1QSN A;  2HQY A;  4NF1 A;  5JPH A;  1L0C A;  3D3S A;  4NJQ A;  3QAH A;  4MFQ A;  4JYW A;  4QUS A;  4A39 A;  4XPK A;  3IU1 A;  1FT7 A;  1Q2C A;  4NGP A;  5AG5 A;  4P4E A;  3T9Y A;  1F2P A;  1SQH A;  1Y9K A;  3KL9 A;  4R3L A;  3WAB A;  3TC8 A;  4AVA A;  2AFX A;  3S6G A;  3B3C A;  1Y0R A;  4UEE A;  2DPS A;  4B11 A;  3FYN A;  2XEG A;  1CP6 A;  2VEZ A;  4F0Y A;  4P4F A;  4QC6 A;  4KOX A;  4CRY B;  5ELY A;  2Z3O A;  4MY0 A;  3TO9 A;  3JTK A;  3TX8 A;  3R95 A;  4AG9 A;  2ZW7 A; 
#chains in the Genus database with same CATH homology
 3S6K A;  3LD2 A;  3ZJ0 A;  5EC4 A;  2Q44 A;  4CYQ A;  4KOU A;  2CXA A;  2IL4 A;  4FD6 A;  2NMT A;  1Z9U A;  4UCM A;  2VQY A;  2J8M A;  1XEB A;  2CNT A;  4F6A A;  4F0X A;  5G21 A;  4B10 A;  4UBR A;  1XIX A;  4H6U A;  4AVB A;  4B5P A;  2I79 A;  1YVO A;  2VBQ A;  1P4N A;  3D2M A;  4KVO E;  3EXN A;  4J3G A;  5A28 A;  4CYP A;  5F46 A;  5G1Z A;  5KTD A;  2R7H A;  1QSR A;  1VHS A;  1RXT A;  1KUV A;  4PV6 A;  2EUI A;  3GKR A;  4JLY A;  1KUY A;  1IIC A;  4KLV A;  1YR0 A;  5AG4 A;  4A33 A;  2X7B A;  5IV0 A;  4KUA A;  2VXK A;  2Y0M A;  4MFP A;  2OH1 A;  4U5Y A;  4FD7 A;  2Q0Y A;  3EC4 A;  4GS4 A;  1Z4R A;  3KKW A;  2Z0Z A;  1PUA A;  2BL1 A;  4A30 A;  3P2H A;  4AVC A;  5IB0 A;  2OU2 A;  2ATR A;  2DXQ A;  5F47 A;  3W91 A;  3NE7 A;  4KOR A;  4XPL A;  2REE A;  1CJW A;  2REF A;  5KTA A;  4RS2 A;  4EVY A;  2VZY A;  2OZU A;  4UFV A;  4E0A A;  4MHD A;  4C68 A;  3TOA A;  3F0A A;  3SHP A;  2WUU A;  5DWN A;  4KOV A;  4XPD B;  2WSA A;  4UWJ A;  5BWA B;  4CGL A;  2JDD A;  1QST A;  3FNC A;  5HH1 A;  3DNS A;  4U9Y A;  4A31 A;  2GE3 A;  1YRE A;  1YK3 A;  1R57 A;  2Z11 A;  3FXT A;  4DNC A;  4E8O A;  5F49 A;  4M85 A;  2A4N A;  4KSF A;  4BMH A;  5H86 A;  1K4J A;  1QSO A;  4NEX A;  4NXY A;  3N7Z A;  1YLE A;  2QEC A;  4HNY B;  4KVM E;  4ORF A;  4UFW A;  4B5P B;  3JUW A;  2GIV A;  2Q4Y A;  2BSW A;  4RI1 A;  4XNH B;  3TCV A;  2AE6 A;  3GY9 A;  4M3S A;  1S7L A;  4B12 A;  4QBJ A;  2PR8 A;  3F8K A;  3PZJ A;  4HNX B;  4PSX A;  4OLL A;  1CM0 A;  2EVN A;  4CS0 B;  2C27 A;  5CNP A;  2YNC C;  3S6F A;  4KOW A;  2D4O A;  3TO7 A;  3D8P A;  4XNH C;  3BLN A;  4UWI A;  4CGO A;  2HUZ A;  4CRZ B;  2FS5 A;  2WPW A;  3K9U A;  2B5G A;  2FL4 A;  1ON0 A;  2CY2 A;  1WK4 A;  4CAF A;  3OWC A;  3G3S A;  3I9S A;  2PR1 A;  3BJ8 A;  4NCZ A;  1XE4 A;  1QSM A;  1MJB A;  2YNC A;  1FY7 A;  4B14 A;  1LRZ A;  4PK2 A;  4ONU A;  1XF8 A;  4B5O A;  1N71 A;  1S7K A;  1U6M A;  4L8A A;  1S3Z A;  2B3V A;  5F48 A;  2OZG A;  3FB3 A;  1BOB A;  2J8N A;  2VZZ A;  1S5K A;  2G0B A;  4R87 A;  4KLW A;  1M4G A;  4CGM A;  2J8R A;  5GCN A;  4KOS A;  2QIR A;  2P6F A;  2OZH A;  4C2X A;  3FRM A;  4Q38 A;  4C7H A;  1XMT A;  2G3A A;  5AG7 A;  5C82 A;  4ZBG A;  2BUE A;  4C2Y A;  2YGW A;  4CAX A;  4KVX A;  3FIX A;  3V8I A;  4IUS A;  3P2F A;  1S7N A;  1RO5 A;  4UCN A;  4UA3 A;  2FXF A;  2HV2 A;  2Q7B A;  4BBH A;  1S60 A;  3R9F A;  2QML A;  2JLM A;  2B58 A;  5EBV A;  2H5M A;  2ARH A;  2Q4V A;  2ZXV A;  4CYN A;  1KUX A;  1TIQ A;  4AB7 A;  2JEV A;  2YNE A;  4JJX A;  4B13 A;  5I0C A;  2WPX A;  2PQ8 A;  4Y49 C;  3JVN A;  4CGP A;  1UFH A;  2Z3N A;  3MGD A;  4U9Z A;  1Q2D A;  3CXP A;  1I1D A;  4KZT A;  4MJ8 A;  4JWP A;  2Q04 A;  3DDD A;  5G20 A;  2Z3M A;  2ZW4 A;  5G22 A;  1MJ9 A;  1MK4 A;  2B5G B;  4E2A A;  5IX3 A;  3FBU A;  1ZO0 A;  2FSR A;  4IF5 A;  3E0K A;  2R1I A;  1M1D A;  2PDO A;  1PU9 A;  1MJA A;  3TOB A;  4FD4 A;  1YGH A;  4ZGY B;  3UY5 A;  4HNW B;  5FVJ A;  3C26 A;  1NMT A;  1S7F A;  4PK3 A;  1P0H A;  5AGE A;  4CAW A;  2FIA A;  4H6Z A;  4CAV A;  4AG7 A;  2B4D A;  4MFK A;  4KSA A;  3BJ7 A;  3PGP A;  2K5T A;  5KTC A;  3EY5 A;  3D2P A;  4R57 A;  1M44 A;  2PC1 A;  1YX0 A;  3VWD A;  4II9 A;  4KOY A;  1J4J A;  4A2Z A;  2JDC A;  3GYA A;  2AJ6 A;  2PRB A;  3WR7 A;  3DR6 A;  3PP9 A;  1GHE A;  5JQ4 A;  3EFA A;  3H5Z A;  4X5K A;  3A9L A;  1Y7R A;  4A95 A;  3DR8 A;  2PSW A;  2YND A;  3G8W A;  1M4D A;  2RC4 A;  2CNS A;  2I00 A;  4HKF A;  3RYO A;  4I49 A;  4LUA A;  2CNM A;  3F5B A;  4FD5 A;  3S6H A;  2DPT A;  1I21 A;  1I12 A;  3W6X A;  3IGR A;  4CGN A;  2OB0 A;  4KOT A;  1Z4E A;  4QB9 A;  3H4Q A;  2FE7 A;  1YVK A;  4R9M A;  1OZP A;  3TO6 A;  4LX9 A;  4UCP A;  4UFX A;  5ISV A;  4MFL A;  2Z3P A;  5AG6 A;  4R3K A;  2Z10 A;  4YFJ A;  1NSL A;  2Z3K A;  3R1K A;  3R9G A;  3QB8 A;  4Q36 A;  2P6E A;  4KS9 A;  2O28 A;  2KCW A;  4Y49 B;  2ZW6 A;  1WWZ A;  4CYO A;  5E96 A;  3ZZI A;  3TFY A;  4MFZ A;  3SXO A;  4C7I A;  3W6S A;  1KZF A;  4MY3 A;  1NE9 A;  3T90 A;  2ZPA A;  4YGO A;  5J8C A;  2B3U A;  1Q2Y A;  2F5I A;  3EO4 A;  3IWG A;  1IB1 E;  2Z3L A;  3B8G A;  4K30 A;  4YRH A;  4JD6 A;  4MI4 A;  2B4D B;  1Y9W A;  3CXQ A;  5A27 A;  5J8F A;  4OAE A;  2ZW5 A;  4NSQ A;  1VKC A;  2FIW A;  3I3G A;  4CAE A;  2G3T A;  2GAN A;  5C88 A;  2FCK A;  2B4B A;  1IYK A;  5DWM A;  3R96 A;  2P6G A;  3LOD A;  4OAD A;  2R98 A;  2R8V A;  2P0W A;  3TTH A;  1B87 A;  3IU2 A;  3TT2 A;  4JXR A;  2D4P A;  1V0C A;  4A32 A;  3CXS A;  1IYL A;  3TE4 A;  4C2Z A;  1IID A;  3DSB A;  2FT0 A;  4KUB A;  5HMN A;  4PSW A;  1B6B A;  3IWE A;  3VWE A;  3R9E A;  4H89 A;  1BO4 A;  2VI7 A;  4L89 A;  4XPD C;  4QVT A;  4JXQ A;  2BEI A;  4MFJ A;  3SXN A;  5H84 A;  1M4I A;  4MBU A;  1QSN A;  2HQY A;  4NF1 A;  5JPH A;  1L0C A;  3D3S A;  3QAH A;  4MFQ A;  4QUS A;  4XPK A;  3IU1 A;  1Q2C A;  5AG5 A;  3T9Y A;  1SQH A;  1Y9K A;  4R3L A;  4AVA A;  4B11 A;  3S6G A;  2DPS A;  3FYN A;  2VEZ A;  4F0Y A;  4QC6 A;  4KOX A;  4CRY B;  2Z3O A;  4MY0 A;  3TO9 A;  3JTK A;  3R95 A;  4AG9 A;  2ZW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...