2VL1A

Crystal structure of beta-alanine synthase from saccharomyces kluyveri in complex with a gly-gly peptide
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
433
structure length
433
Chain Sequence
PLSIASGRLNQTILETGSQFGGVARWGQESHEFGMRRLAGTALDGAMRDWFTNECESLGCKVKVDKIGNMFAVYPGKNGGKPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNYVPNYDVCVVVWFNEEGARFARSCTGSSVWSHDLSLEEAYGLMSVGEDKPESVYDSLKNIGYIGDTPASYKENEIDAHFELHIEQGPILEDENKAIGIVTGVQAYNWQKVTVHGVGAHAGTTPWRLRKDALLMSSKMIVAASEIAQRHNGLFTCGIIDAKPYSVNIIPGEVSFTLDFRHPSDDVLATMLKEAAAEFDRLIKINDGGALSYESETLQVSPAVNFHEVCIECVSRSAFAQFKKDQVRQIWSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPEEIENGFKVLLQAIINYDNYRVIRGHQFPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords BETA-ALANINE SYNTHASE
publication title A Recruited Protease is Involved in Catabolism of Pyrimidines.
pubmed doi rcsb
source organism Saccharomyces kluyveri
total genus 162
structure length 433
sequence length 433
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.6: Beta-ureidopropionase.
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vl1A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2vl1A01
3KL9A 4WWVA 1TF8A 1BPMA 5IB9A 3KQZA 3BHXA 4JYWA 4MHZA 4P4JA 1TKFA 4ZY2A 3WABA 3SI1A 4IAVA 3GB0A 3NH5A 2F8HA 3IJ3A 4DYOA 4NFRA 4NGPA 3RAMA 1R3NA 3B2YA 2CTCA 4RUHA 1GYTA 2PJ6A 3GUXA 2HC9A 3WC5A 3B3VA 4R6TA 3H8FA 3D67A 1YSJA 2BOAA 3PRTA 3TC8A 4LQGA 5K8NA 3KASA 2AFZA 1BPNA 5K8PA 2NYQA 2Q4ZA 3KHZA 4PXCA 1FT7A 1CPXA 4YU9A 4UIBA 3H8EA 3I1UA 2BO9A 4Z65A 3PBBA 2GREA 1H8LA 3DLJA 4NJQA 1LFWA 5LYDA 5LYLA 2PJBA 3KZWA 4NGTA 4O23A 2DEAA 2ABZA 4FAIA 3DGVA 3S9MA 4PQAA 1LANA 5DS0A 1ZLHA 3PB9X 2ZEGA 1YW6A 4X2TA 4ZI6A 1ZG9A 2CTBA 3LWUA 4ZX9A 2O4HA 3H8GA 3K2KA 2WZNA 2PJCA 3HUVA 1HDUA 1NSAA 4OKOA 4ZY1A 4NJRA 4MHPA 2JBKA 1ARMA 4X8IA 1ARLA 3PFOA 4K3NA 2XEFA 4YWYA 1Z5RA 3HLPA 5JGFA 3KGQA 1BAVA 3MRUA 2V8GA 1XMBA 2XEIA 1TF9A 4JZ0A 1VIXA 3FF3A 3CPXA 2IJZA 4OMEA 3RZAA 2FVGA 4EWTA 4DUKA 4G1PA 3SJGA 2PJ7A 3IFEA 3IIBA 1Z2LA 3PB8X 3L2NA 2JEWA 1DTDA 3B35A 4W9YA 3V7ZA 6CPAA 1JQGA 3JRUA 3PBEA 2OR4A 4OC1A 2CF4A 2PJ3A 1LCPA 2XEJA 2PJAA 1CP7A 3D4UA 3SI2A 4Q7AA 4PXDA 1VHEA 1CPSA 2ZELA 3CT9A 3PFEA 2ZOFA 2G9DA 1AYEA 4A38A 4NGQA 2I3CA 1VGYA 1LAMA 3FEEA 5THWA 1ZG7A 1YLOA 4NGSA 3NA6A 4NGNA 1ELMP 4P4EA 2Q51A 4EFDA 2C1CA 2F7VA 1Y0RA 2ZENA 5J1QA 3FECA 4OC0A 4ZYQA 5LRGA 8CPAA 3RBUA 1ZLIA 1EE3P 2PVVA 1Z8LA 4MHNA 2PCUA 1HDQA 2C6GA 4FWUA 2PJ2A 2VL1A 3IWWA 2OOTA 4FUUA 2ZEFA 4R7MA 1LOKA 5HXDA 2J9AA 3CDXA 4MRIA 3SI0A 5LYFA 5LRKA 3FJUA 2HB6A 1Y0YA 1Y7EA 1F57A 3D7HA 2GLFA 5K8OA 5I4MA 3SJFA 4TWEA 4OC2A 1KWMA 1R43A 3ISXA 1OBRA 3N5FA 4F8ZA 3QNVA 3S9LA 2IQ6A 4A39A 4H2KA 2GLJA 4TNUA 1FNOA 1CX8A 4OP4A 2ZEEA 2ZOGA 3IO1A 1PCAA 2PIZA 4KSIA 1Q7LA 3T8WA 2WYRA 3WC6A 3IC1A 1LAPA 4P6YA 4MCRA 4F9VA 4OIWA 1TXRA 2EWBA 1QMUA 3D66A 5JM6A 1F2OA 4BD9A 4P4DA 4DJLA 4A37A 4P4BA 5F09A 3WC7A 2ANPA 1PYTB 4MXUA 4AXVA 3KR4A 2AFOA 2EK8A 2QVPA 1IGBA 4IK2A 1CG2A 2NSMA 2IMOA 2ZEOA 2PJ5A 2O53A 2PJ9A 5JH9A 4MMOA 4OC5A 5HVHA 3K9TA 4NGMA 4A94A 3B3CA 3BI1A 2QYVA 4B6ZA 1RTQA 4EMEA 3NH8A 3BI0A 2AFMA 2ZEPA 4UEZA 4F9UA 2ZEHA 1CP6A 3B3SA 4OIDA 2CIJA 4UEEA 4IHMA 4MHYA 4ONWA 3NH4A 2POKA 1HEEA 5CPAA 1XFOA 1YMEA 1YW4A 5CBMA 4PXEA 3D68A 2C6CA 3S9NA 2BCOA 1VHOA 3GLJA 5D29A 2PRQA 3FVLA 3KI9A 2Q43A 2AFSA 5HVFA 1AMPA 1DE4C 3D7GA 2PIYA 5D8NA 3IEHA 1XJOA 4FBEA 2RB7A 2XEGA 4OC4A 2V8HA 1TKHA 2AFUA 2EK9A 4P44A 5K8MA 3PB7X 2V77A 3VATA 4CPAA 3SJXA 5LRJA 3NFZA 4PXBA 2AFXA 3VARA 3SJEA 3D7DA 7CPAA 3CPAA 3MN8A 2AFWA 3FH4A 1UWYA 4NGRA 4WJBA 1BLLE 1F2PA 3PEIA 4PPZA 1M4LA 2ZEMA 4R76A 3B7IA 5LYIA 3B3WA 2PJ4A 3WT4A 5ELYA 2RFHA 2JBJA 2QJ8A 3PB4X 4X3RA 4ZY0A 2PVWA 3FEDA 4MCQA 3BXMA 4R8FA 1ZG8A 3D7FA 2GU2A 2PJ0A 4P4FA 1ELLP 4P4IA 3FMCA 4MCPA 3KHXA 4GM5A 3V38A 3TX8A 4ZX8A 1XBUA 4UEFA 1QQ9A 4P10A 3LMSA 1IY7A 2V8VA 4UIAA 1CBXA 2PJ8A 4P45A 4OC3A 2PE3A 3KQXA 2V8DA 2PJ1A 3KR5A 3FX6A 3VH9A 3ISZA 3B3TA 1XRYA 4UF4A 4MCSA 5HVGA 1TKJA 3PB6X 2ZEDA 2C6PA
chains in the Genus database with same CATH superfamily
2VQFJ 1ZTTA 2VDHA 4ED5A 3RYOA 1UPMB 4ALZA 4LF7J 4AUKA 2UVUA 2FLLA 1UFKA 4I0WA 4ETZA 4B3MJ 1YJVA 1S6UA 4B11A 3OR1A 2AP6A 3FK4A 3H8FA 3M2RB 4O3SA 1FRJA 2WPWA 4H6ZA 4RR5A 1N5YA 5K8NA 4MK8A 3IRWP 5JPHA 4K0KF 4W98A 3LOUA 4ETXA 4HDGA 4DR2F 5T7LB 4WE1B 4KY3A 2UUTA 4P73A 1UETA 1KSPA 2M0GB 4MHDA 1KOHA 3MM6A 5KT6A 1CJTA 1NU4A 1NMTA 5ETRA 1JK9B 1T03A 3L95X 1SJ1A 5KG7A 5KFWA 4RBVA 5F9NA 1AFIA 1Y4ZB 2CQBA 4IFYB 3NE7A 2LA6A 4B14A 5GADU 3DDDA 1RTIA 4Q5VA 3GJSB 1UVLA 1NSAA 2V9KA 2VOPA 2V94A 2H4YB 2LXUA 2DEIA 1LKZA 1U1RA 3UE2A 2XEFA 1E6YA 3DXSX 3MEEB 4JI0J 4RW8B 2LXFA 2VPWB 4GO5X 3KDNA 1IKWB 1TTHB 3CNQP 2MKJA 1KNZA 4QBUA 1Y5NB 3QGHA 4KOYA 1APSA 2BYCA 4QW9A 1YJ9S 3IIBA 1Z2LA 2ZW5A 2XO6A 4DN9A 3OHBA 4DR4F 4P2XA 4JI1J 1S0NA 3H7HB 1SJFA 1S1UB 1SJQA 3Q8VA 3T5HA 1VC0A 4JOUA 1OO0B 4O44A 4ZPCA 2PJAA 1CP7A 1MW7A 2FB0A 4EEYA 1E6VB 3K59A 1JJ2R 1IOIA 1BQNB 2BM0A 5A8KB 4F2RA 3MXHP 4ZPVR 1WC5A 2MXYA 2FDNA 3QO9A 1MJBA 2IYIA 4RW4A 2EBGA 2OMOA 1RAHB 1MJAA 2DXQA 2OPPB 5KFEA 3P3DA 3FSXA 3FECA 2YWFA 2NR0A 3KOAA 2P9GA 3UY5A 2ZE2B 4ID5B 4PWWA 1VFJA 3LP0B 1TKTA 5HN0A 2HFNA 3HVRA 2Z11A 2AF6A 2X3DA 2BANA 4LBPA 4E2FB 1Z8WA 3IAS9 2HB6A 3HDSA 1IBCB 4CYQA 3CDUA 1P4NA 2HBRB 3CXSA 3T1YF 3HHLC 2GLJA 3BN7A 1C1BB 3LAMA 1FNOA 3BYRA 2E5HA 2PIZA 1VQ8S 4PRFA 2W01A 2B5GA 4WKRA 2JRSA 1Q8LA 2Y9HA 3D66A 3MMAB 1M44A 1Y9WA 3PO4A 1ICEB 3HO1A 5IV0A 2F8MA 5F3ZA 2CPHA 1TL7A 2DNKA 2EK1A 4Y28C 4JI0F 3RB3A 3ELHA 1ELOA 1NKEA 4IK2A 3UDCA 1BHNA 1HBUB 1WC4A 4MMOA 4A94A 4A2ZA 1PAUB 2RHQB 1OYEA 4JV0A 3BBBA 1R27B 5K9FA 2FT0A 2DRBA 2QMXA 1R0AA 2BUEA 4JYAJ 1GX6A 4PG8A 3FNNA 3MR5A 1C1CA 3TTHA 5IT9U 3S9NA 2G0IA 3L7PA 4JI2F 2QV6A 1UVNA 4GVLA 3TUZC 3H5SA 4NLXA 4C7QA 2VC1A 1U26A 2HBYB 3B78A 3NGDA 2GC8A 3P5BP 3A8JA 3DM2B 3UR3C 1SH3A 3MFIA 3EGVA 3OUYA 2JX2A 7CPAA 4LRAA 4UY85 1V0CA 2HVHA 3FH4A 4DR1J 4IQXA 4MAKA 1S1TA 2DXFA 4PPZA 2MQQA 3R95A 2FS5A 2RQKA 3ILIA 1FF2A 1WC0A 3MAQA 1M4LA 2B4OA 1EP4B 3P49B 4L76A 3L7OA 3BQ0A 2VOOA 2BJ9A 2CNMA 1XMQJ 1SH2A 3FXTA 4TQRA 1DHMA 2FSRA 1OPIA 3QJPA 3UD5A 1T9UA 1X8DA 4P4FA 2W7AA 4X4SA 3OJUA 3WX4A 3LGMA 2QL5B 1Y10A 2WRMA 1CBXA 2W9BA 5D3GA 1I21A 4USIA 3OFHA 2HNZB 4OI3A 3IGNA 2IRXA 2ZEDA 1VRQC 2GFFA 3TEHB 1Q86T 3GV5B 2MKHA 2ADCA 3BPSP 3MM9A 1XNQJ 2ZJRQ 5CA5A 2AW0A 1SC1B 3VAIA 4FYWB 2YNDA 4L72B 2CFXA 4DR3F 3RAMA 2DNHA 4Y3CA 4ZP6A 3JTOA 3EX7B 2W7OA 4A31A 1OMSA 3B3VA 1QLNA 1MU2B 2NCKL 3W8GA 1K0TA 2BR0A 1RTJB 3M8PA 1FJ7A 2LCWA 3DRPA 3KHHA 1X0FA 2RRBA 1Q95G 1MN7A 5GAGU 2P9CA 1QSYA 2B4VA 4M5LA 5KTQA 5C42B 1LW0A 3C6UA 3PV8A 2DHXA 2HQCA 1FEEA 5KFHA 1RAFB 3OPKA 5KFFA 3HX9A 9ATCB 1T3OA 4ES1A 1XF8A 5AXMA 2HVEA 2WVEA 4J9PA 2EXUA 2R3VA 2IL4A 4K30A 2W2PP 3KUHA 3RJMB 1KQGB 5HO4A 3PM9A 2VC0A 3P8BB 4CNZA 4ZI6A 3C2PA 2J8MA 1Q2YA 1Q5YA 3M4XA 3PNIA 3IR7B 4WPAA 4J9RA 1W25A 4NJRA 2FY1A 3I96A 4X8IA 4DV0F 3OL8A 4FKXA 2YWGA 3PX4A 1N34J 1M5VC 2K7JA 1BD6A 4R3LA 4NLGA 4UOCA 5CH7B 3M6VA 4CP5A 4UOFA 3M6UA 3M1VB 5ISVA 1KN6A 1VRUB 3I9ZA 2N4DA 3POTB 3BO4A 2ASYA 1GMWD 3EVWA 4F4AA 4P9SA 1S9FA 2IAJB 2JEWA 2CIMA 1UL3A 2DNMA 2BL1A 1KOOA 2GS8A 2XS2A 2D1CA 5KG6A 4AYBD 1WK4A 2C2OB 5FD1A 3SZ2A 2YNIA 4K59A 3TUPA 3H5UA 4OYZA 4U96A 4FBTA 2Z4PA 1Q4RA 3CT9A 5JJBA 1VJQA 2KO1A 1M4GA 2RF2B 4OI1A 2RSQA 1AYEA 1LNQA 5L1KA 1HNIA 2R8JA 5KG0A 2DCUB 5CZVA 4P72A 2NYHA 1NRKA 1RO5A 2KTQA 2DNGA 2X1BA 4AL5A 4UWJA 4ZYQA 4E0AA 8CPAA 3M8SA 3S6EA 3CMES 4ER8A 1RXTA 3QFWA 3DKDA 3CCES 2ROPA 3KXDA 4FXVA 4RLEA 3VVTA 4BINA 3ICLA 2PN6A 5DGBA 5HXDA 3SI0A 5LYFA 1WG1A 5LRKA 2GFQA 5JMNA 4USJC 4BWJA 3KK3A 3SQGB 3O6QA 3OVBA 4H4KA 1LWEA 1F57A 2JC0A 1ZH5A 3G4SS 2K1RA 5D0EA 4UBRA 2GMJA 4F0YA 5A6WA 2U1AA 2CDRB 3MPVA 3P2HA 4B3TJ 3T90A 3VV2B 4IDKB 5J2QA 4AQYF 4KSIA 3T9YA 2XWYA 3QRQA 2DGXA 3WC6A 4MYTA 4X4OA 1HWJA 1JJCB 1RTHB 2HMIB 5G22A 2IVMA 2IHR1 3B4DA 4DJLA 2E44A 3LQVA 3K5PA 4FD7A 5GADI 1B0PA 5J2MB 2MZ1A 4ZGYB 4LF8F 2ZEOA 4XPEA 5EWGA 1QD1A 4FF4A 4B6ZA 3QRRA 3HJVA 2XSJB 2RHSB 1FX2A 5GCNA 3PKMA 3AB2B 2ZH9A 1U25A 4IHMA 4MHYA 4KPCA 1HNZF 3FC9A 2G0JA 3T19A 2KFNA 1G1XA 4A30A 3I55S 3DFEA 2OPSB 2W2OP 1SJRA 1NCLA 2CZ4A 4NLVA 1HD0A 4LIWA 4FBEA 1NDCA 4UA3A 4WYWA 3UNGC 1LFPA 2R7WA 4CPAA 3SJXA 3HKWA 1QJHA 2FC8A 3HCXA 4DUTA 1QSSA 4C0BA 3KLEA 1RT6A 4DV2F 2R2UA 1RTDA 4A8OA 4OAEA 4J90A 4QWEA 4ANCA 4ED0A 2HFOA 2BEFA 3Q8RB 1RHKB 4IQMA 4BMHA 4YFUA 2YNGB 3RBXA 1XIQA 1JLEB 2CG4A 1S3ZA 2QJ8A 1N52B 4JJXA 2Z3MA 3QAHA 4X3RA 4NI2B 4MCQA 2RU9A 3M9NB 4P4IA 2R7OA 3VAHA 2J0SD 2W7PA 2G2ZA 4Q38A 3TAMA 2X1FA 2Z57B 3RB4A 3LMSA 2HRUA 1EIYB 2GHWA 4MKYA 1FXDA 2FJBB 4C8KA 1VHSA 2L9WA 4DLEA 4DEZA 2HV2A 3PTWA 2B56A 2NZCA 1XRYA 1BQMB 2MY7A 1NO8A 3G6YA 2VQYA 1I12A 2C6PA 1SJ3P 2BKPA 4C8ZA 4JYWA 2GO9A 1YITS 2F4VJ 2VF3A 3SI1A 2MZQA 4OLLA 4DYOA 1VCTA 2DF5A 3FYNA 3BH7B 5CYQB 4MFQA 3LWMA 4GVBA 2ZH4A 5A8RA 3IU2A 3H90A 2UXCF 1Z4UA 2BQUA 2C3PA 5DRKA 2OFGX 5A76A 4F3MA 3MM7A 3EVMA 3W62A 1CEZA 4MFKA 2J8RA 5KT2A 2EFOA 2IVFB 1WTFA 3HVTA 2I5JB 5KG5A 5B0CA 3IRXA 3NBPA 2E7WA 1SUQB 3I5CA 4W90B 3PZPA 3W9JA 1CM0A 4F4WA 1Y5IB 1K9MT 2G1HA 4YHHF 2J9DA 4X64J 4CLWA 1VK8A 2ZD1B 1RP5A 3TI0A 2V2VA 4DCPB 1CS4A 4YOEA 4LRDA 4ONUA 4ZS6A 4LF5F 1O6XA 3CJTA 3MM8B 3PRVA 2D41A 2GCFA 4W4MA 2OI2A 1O51A 4PEOA 4X2TA 3TJ9A 3PW0A 3CXQA 2IDLA 2CTBA 4DL6A 2FVRA 3D2WA 4YDXA 3R1HA 1HMVA 3WR7A 1WSRA 2ZOMA 3KLIA 5I0CA 1W26A 2YNHB 3JVNA 5FIIA 3M2UB 4PK3A 3D4JA 2AKWB 4WE1A 4FXDA 4WKYA 1BLUA 5EX0A 2HEKA 3HZGA 4NLRA 3NP5A 4NWBA 1N33F 1RCXB 4OMEA 4NCGB 4ZPDA 3ISND 4JXRA 2HFSA 2Y0SD 3O2IA 2ALZA 1O5JA 3TT2A 3TFYA 1PSDA 5D77A 3V6JA 3VHQA 2H5MA 3BGRB 3NNAA 2ACYA 4ZJLA 4W9YA 2ZZNA 4IFYA 3GJQB 3UCGA 2ZW7A 2AZ1A 1FK9B 3PJWA 2JDDA 3GMGA 1RDRA 1RT4B 1QAJA 4NYOA 4UCNA 5ETOA 2AD9A 3UN3A 4Q8EA 1RACB 1KLMA 4DG1B 3MEEA 4OYMA 1ZBTA 4RW8A 2HQDA 2WAQD 2HHWA 4OFZA 3NGRA 4U67Q 3H59A 4OI0A 3UD3P 2BSWA 5J8CA 3LALA 1FKPA 5J1QA 2H54B 1XOVA 1MNEA 5LRGA 5E3PA 4CI0B 1VBYA 3AJ2A 1Z8LA 2GHPA 4MHNA 2DGQA 3L3CA 2C6GA 1HHSA 4R25A 3NGKA 3OLBA 3R9EA 4QWAA 4E8UA 3E51A 2JFDA 3NG8A 3CDXA 5D4LA 4V19X 4X2BA 1RYRA 3CMQA 3J7YU 2M2BA 1BQNA 3PIOQ 4CO2A 1RT7B 3DU5A 2W9CA 4LVOP 1KWMA 3LPEA 3LANA 1VBXA 2IQ6A 3ITHA 2OPPA 1S5KA 3EPGA 1Z4EA 5AXLA 4OX9J 3KK1A 4H4MA 4LIRA 4UW2A 2ZE2A 2ZW4A 3PP9A 2DO0A 1HWUA 4NL5A 1IBLF 4AB7A 3DRRB 3HF5A 1Z8TA 3O5TB 5J8FA 3J81j 4AXVA 1S7NA 3FUYA 5D8HB 4Y6IA 2NSMA 2PJ9A 1DTQA 3QIPB 2RU3A 2VA2A 2GVZB 1RWNB 2PC6A 1A0OB 3BI1A 4KO0A 4RU9A 1RTQA 1T0TV 1FDDA 3EO4A 4DU8A 3OTCA 3M6XA 4GC7A 1I94J 3BI0A 4BDPA 5M2UA 4MIAA 1HQ2A 2HUZA 2YPZA 3GR1A 1KDNA 2WW4A 3MMAA 4DF8A 1V9OA 4DQIA 2HK2A 2JEGA 1TFYA 1IUJA 4WFNQ 2E1RA 2FJVA 4NOHA 2JOQA 2YKPA 4CAEA 4CO3A 4DN0A 4F4XA 3W5XA 1TKHA 3H8YA 3NRBA 3TO8A 2B6AB 4XPDC 2AX1A 2FGCA 3R8YA 1R7IA 4L6V3 3D6HB 3WDOA 4M95A 3SCJE 4IFVA 3TUIC 2DGUA 1QSOA 2Y0BB 1NDPA 2O5DA 3SSQA 3PVXA 1UJ6A 2MPUA 3TZWA 3W1YC 1S48A 2RE1A 4Y2KA 2UU9F 3J7AN 1P27B 2RFHA 2CZVC 3LO3A 3PB4X 2WBMA 4P2SA 2X7IA 4DL0C 1EKSA 3GIJA 1RA7A 3DM2A 3T3FA 3V38A 3ETMA 2UUBJ 3KTQA 3DRSA 1HNVB 4DPOA 2DEJA 1X10A 1VQPS 1B70B 3W9IA 1JXLA 4RKUC 2HQ3A 3FX6A 2MKYA 2QIFA 4HKFA 3VH9A 2PEHA 4XO0A 4I2PB 3G86A 4IH6A 1T9YA 5KFGA 2MLXA 2KT3A 4YR2A 4BHQA 2UUWA 3HFZB 2ZFHA 2GJIA 2JFKA 1OYDA 1UWBB 4NCZA 3WABA 4IAVA 2BRLA 2A1BA 2FD2A 1ZM3A 2KYZA 1NJZA 1PO6A 5E0OA 1DLOB 1N54B 1VQOS 3TOBA 1IU8A 5DG8A 2B4DA 5ETSA 1ZAWA 2IM0A 3KLGB 5J2NB 4RL1A 1R6VA 4LQGA 3KUGA 3BV8A 4X4NA 4CCHA 1N5SA 4TU7A 5K8PA 4X4TA 5HLFA 2YVSA 4KFBA 2KHCA 2VFSA 2BO9A 2GVDA 2YH0A 4QWBA 4DR5J 4MIWA 5IV3A 2AJ4A 4NGTA 1DURA 2YKMB 4O23A 4CNYA 1V5IB 2CKWA 3LWLA 1X4DA 5DS0A 4USUA 1HYSB 3UFCX 3GV7B 3V4IB 1IR1A 3GFZA 2FY8A 1ZG9A 3KWMA 3LWUA 4CYOA 4PPDA 2HNDA 4UZBA 1NE9A 3MAHA 3IU1A 4KHPJ 1LXNA 3PX0A 4ED2A 2CJAA 3HLPA 2DVIA 1X5TA 4Y0FA 1J5EF 1S9GB 1IBKJ 2UUAJ 3JAMY 2Z2YB 3FBBA 2YNCC 1L3VA 2XLJA 3CJ3A 2HVIA 2PJ7A 2VQEF 2Y8YA 1GAOA 5KFNA 2D3ZA 2VBWA 3L2NA 2VG6B 1ZM9A 4K4TA 2FIWA 1HR0J 3CJ8A 1Z1ZA 2MZSA 3CULA 1A6LA 3LPYA 4FS1A 2R9LA 3HK2A 1NH7A 2HHUA 4NCAA 3LF0A 2MQNA 4LRFA 1NSQA 1RT1B 3TX0A 2VXKA 3FBUA 4LFCJ 2Q6CA 2CPJA 2K06A 4IO9Q 4F0HA 3PXGa 2CXEA 3EYZA 5DGAA 4P74A 3MCMA 2ILZA 2A6MA 1YLOA 3KLHA 3GYGA 3CCRS 5C88A 4F67A 1FFSB 1FRIA 4OC0A 3T1HF 3R9GA 4I4BA 2IAJA 3AOAA 3M9MB 6AT1B 1EE3P 3M7VA 4LUBA 5FJ4A 3MEGB 5H9EK 1JJHA 3Q24A 3BB5A 3E8OA 5IM0B 1D0EA 2VL1A 2CG8A 2RAQA 3CJ2A 2KJVA 3A12A 4MRIA 2VONA 2OO4A 1B7FA 3BDPA 5EWEA 5H9FJ 3CCTA 1PAEX 3DN9A 4CTAB 3H4QA 1HW8A 2GAHC 2HFUA 2AGOA 4AL6A 3KJNB 4FYVB 5FLXY 2X7BA 4IUFA 3W8PA 2R2TA 4ILMA 4Q8FA 1K44A 3ZZOA 5CYMA 4OYIA 4OIWA 2VASA 2EWBA 1U1PA 5HANA 2J5AA 3IM8A 2J0XA 2PT0A 3FIXA 1S7KA 3W60A 4ZVEA 2WSAA 5DM6Q 2UVVA 2HZVA 1GXUA 1ZPWX 4CYUA 4NLDA 1H3DA 5K20B 1YX0A 3DNSA 2XEXA 1UKUA 4IKAA 1NK7A 3FNCA 3B3CA 3R96A 1PUAA 2B4PA 4F8RA 2OELA 5DDQC 4JI3F 1RU1A 2FGOA 5T14A 2ZEPA 2QA2A 1N88A 1VQ4S 1NK6A 1UFWA 1S99A 2M52A 2LMIA 5JXSA 2DITA 4DDFA 2C2EA 1RTHA 1UVJA 3THPA 2HMIA 2AFSA 4LQ9A 4FD4A 3UVJB 4B9VA 3QPIA 2V8HA 2ZVIA 3MTKA 3PW2A 1JJ4A 2PSWA 4DV1F 2H5IB 3PB7X 1VRTB 2GV1A 1M5PC 3MEKA 5D0RA 2IPOB 3RGIA 1KS2A 2HAFA 4RN7A 4MH8A 5IT0A 3CJRA 2OPSA 4IG3A 3KDOA 2IBOA 2CNNB 4F4ZA 3D5MA 2JVOA 4EO8A 5HROB 3AJ1A 3JYTB 2XCPA 3FRZA 1F2GA 5B0BA 2J9EA 3PHEA 4PKDB 3UDLA 1TKXB 3ZZTA 5HMWA 4NXYA 3B82A 4F2SA 3ILLA 2YXLA 2DKOB 2I9SA 1X5PA 2LQ5A 3J7YI 4CGPA 4PG4A 1W7WA 4UIAA 1VBKA 4HL9A 2DGWA 1T8EA 4ILRA 4DCOB 3A1YG 3Q86A 4UWIA 4MCSA 1R8BA 3CXPA 4B9NA 3F8KA 1TKJA 1M5SA 2IJNA 3DMJA 1JLEA 1F3VA 4M8LA 5ETVA 1JIHA 1TKFA 2DRAA 2V2KA 1UVMA 3OXFA 3FSYA 4JI5F 2G13A 2VZZA 4RUHA 2JLGA 1TKZB 2CY2A 2OD6A 3CDAA 1ZPVA 4WXWA 2HC9A 4R6TA 2AYGA 3AD8C 4U7CA 1VQLS 2XMMA 1S1VB 2OP5A 4RNHA 1NPPA 3KMSA 5F0WA 1BPNA 3QIDA 4I56A 2W25A 2MKCA 4YU9A 4QIWD 3ENWA 1TAQA 3MM5A 1C0UB 1JMTA 3EGZA 3OSNA 2NXCA 4M5KA 2KT2A 4ECWA 3FDSA 4J9QA 3ZO7A 3J81Y 1JNRB 1FESA 4OJ3A 3V81B 4FYXB 1YK3A 1VMBA 2LEAA 1JLBB 3JTNA 4AE5A 4EZ9A 3D9BA 4HKQA 5G21A 5BWAB 4ICLB 5HI7A 1IBMF 2C3UA 1TUWA 2ATCB 4OKOA 2I5JA 2DXDA 2E9RX 3N9UC 5IB0A 2P9EA 1UEKA 2DH8A 2REFA 1YK9A 3NLCA 4OADA 3AOCA 2LP4A 4Y2CA 2LQ8A 1RABB 1NSPA 3MM8A 3EC4A 3RW7A 4Q44A 2YKNB 4ED4A 4DS5A 4DFPA 3GG0A 3S6HA 3PYGA 4OC1A 5HJXA 2RC4A 1LCPA 5HBMB 1WELA 5GAEI 5DLFA 3EZ5A 5G0RA 1Z9UA 1FJEB 4A8XA 3PYEA 1S1XA 4FF2A 3M2UA 4N56A 4OI2A 2XWXA 2HLUA 1B99A 3IWNC 2K8GA 5I3UB 3S6FA 4JWPA 3AA8A 1Q82T 2V4JA 4NCGA 3NA6A 2ZBPA 4ZVTB 1BMQB 2BJ1A 2B0GA 4BC9A 1S7LA 4N8OA 3EUNA 1Y0RA 2UV8A 1S10A 3DDKA 3BGRA 3C14B 4USHA 5A0YA 2A4NA 4OZ5A 2GIQA 2OFHX 4RUAA 3H4BA 2ZEFA 1U7LA 4TY8A 1TK5A 1JNZB 2MTLA 3BKUA 1YI2S 1BWEA 4IO1A 2HG4A 4YR3A 2AJ0A 1HNWJ 4UT4A 2EKNA 2GMLA 4A4JA 1TP7A 2EFGA 2VBYA 3GZ7A 4TU8A 3VAMA 4P2FA 4KV8A 2EBJA 1FE0A 5LMNF 7AT1B 4HYKA 3I32A 3DLEA 4BD9A 4ZVFA 4NZ6A 4P4DA 4A37A 4KH0B 1NAQA 1J5OB 2RQCA 1IOFA 4KOSA 2G4BA 2HHPA 1RT7A 2WW8A 2KH9A 4OC5A 4W92B 4LF9J 1N71A 3R5BA 4JI7F 3FCHA 3I9V9 4B5PB 1DARA 2GW8A 4DFJA 3WHIA 4G1QB 3K8VA 2VPXB 2VD3A 4KT0C 3FGVA 1UP1A 2XMKA 4MFZA 1VOMA 1B6BA 1NK5A 2Q79A 3V5RA 3THVA 2UXDF 3IEHA 1Q7LB 4P44A 4A8YA 3FCVA 3DRXA 2CQGA 3MF5A 4XNHC 2IM2A 4ZLNA 3MR2A 2DNNA 4X62J 2B51A 2ACMA 1QTMA 1YBAA 2L3MA 4QPTA 1F6TA 1UWYA 3W64A 2AYMA 1FJGF 4LF4F 4JI6J 3Q89A 2Z3PA 3W65A 4HR2A 2KXNB 3HHLB 1N32F 1GX5A 4TN2A 1UVIA 5F8NA 4C3MA 3JAMU 5KTAA 3JUWA 4F6AA 2MY8A 4PABA 3TA0A 3TAPA 3V6DA 3FEDA 2GZOA 1XMTA 2B3TB 4BBYA 2YNEA 4EMDA 4HT5A 2LA4A 2PJ0A 4NXMF 4C7HA 3J80Y 1U0HB 4HVZA 3TX8A 1MSWD 4ZX8A 1FRLA 1LW2A 3MMCB 4HEA9 2M3DA 1HLWA 4F0XA 3T6BA 4F3QA 1FKOB 2PE3A 2R7HA 1FDAA 3ISZA 4FP9A 3GY9A 1UEUA 4HNXB 2ZZTA 2DPSA 2FVCA 3PGPA 2CVIA 4U8VA 3KQZA 4Y2MA 1KUVA 3SSRA 5LMUF 2DYAA 4P4JA 2COLA 5GAHU 2VG5B 3ZZIA 1NZ8A 4M5MA 2ASJA 2G3AA 3PYFA 1FVQA 4MTPA 4KIAA 1T3NA 4OYXA 4CLYA 3M8ZA 2Y1JA 1S9EB 3PRTA 4BBHA 2XNRA 3G82B 1XR5A 5DQHA 2VPZB 1KQFB 2EC0A 1SB6A 3PYDA 1WKLA 4KRWA 4I2PA 2D9OA 1EAYC 1WOOA 4KOWA 2VG7A 2KT5A 2ZC4A 2Y1IA 4B3OA 2CPEA 4GO7X 4WXOA 3R7NB 3R5DA 3ZTOA 4Q0BB 4OJHA 5CXTA 1UWBA 4ZLPA 4C48A 5JVHQ 2PMHA 2H4WB 3AOBA 5B0DA 4LFBF 4AD6A 2V5HG 1JLCB 1RHJB 5FLXU 2RUSA 3TA2A 2ZH7A 3I5AA 3ZC4A 2M4MA 1BE4A 5GMDA 3VZHA 5B0EA 3KLGA 1SPBP 5J2NA 3HFVA 2WOMB 4GKJJ 1TFWA 4X65J 4NRUA 1EETB 2XI3A 4FF3A 4MHPA 4RW9A 4K3NA 3BS9A 5GMKa 1XMBA 2CVEA 1NMEB 3BO3A 1VIXA 4F25A 1XWLA 4ECVA 2FVGA 2DRDA 3DCAA 2R7XA 1N56A 2HPUA 3JTPA 4ZCLA 4OI4A 2NZ4A 1X5SA 3MD3A 5IV4A 1XN9A 4B3RF 3BZQA 2P0WA 4R57A 4RS2A 3JTKA 4J3GA 2WHOA 4M85A 1HQUB 4YQWA 4WZMA 4CM0A 3ZZ0A 3LGNA 1HA1A 2PR8A 3AJDA 4PAAA 4JV2A 1D9DA 4QIFA 3W5YA 4N41A 5CABA 4QQBA 3B8HA 3NMAA 3OR2A 2C1CA 2F7VA 2VG6A 1HD1A 4ELUA 1RWOB 5B7WA 3D8PA 3U1NA 2W2NP 1K47A 1QAYA 5ITHA 3K9UA 2H5EA 3FRMA 3DR8A 1FWPA 4HNWB 4DS4A 2JWNA 3JSYA 1PKUA 2DD8S 3HHDA 3BKTA 3DHXA 5KFVA 4DV6J 1FFGB 2DGSA 2KVQE 5L1LA 4II9A 3G3SA 3NL0A 2H48B 2GLFA 3F5BA 5I4MA 2BUNA 5HQMA 5AXNA 1R43A 3S9LA 3ADAC 1LK7A 4H2KA 4XAKA 2J8NA 1O8BA 3MD1A 3CCVS 3BN4A 3QB8A 4KSEB 3BR8A 3DLGB 2WYRA 2ATRA 2H3EB 4QOTA 4I6AA 4X65F 3DOLB 1REVA 1R89A 2DT9A 3AA9A 3CUNA 3OD2A 3KNAA 4MCRA 3HVWA 1CJKB 4OMFG 2WSEC 3M30B 1CPZA 1B4SA 4ECUA 3DRYA 1LWCA 3CCMS 3DNCA 1XE4A 2ZM6F 3BPDA 2ANPA 3D0HE 3QT6A 1P1LA 1IJEB 4ZLJA 2O66A 1M90T 2EK8A 3BGOP 4Q43A 1CG2A 4XTTA 2P6FA 3VAFA 2ZC3A 4KVOE 3IWXA 4ZVUB 2JLMA 1WC1A 3R1KA 1MROB 1RWXB 1GQEA 3SEOA 5I3QA 4UEZA 3NH4A 4EVYA 1UA0A 4YR0A 1YW4A 4NLYA 3PACA 3IS9A 3JSMB 1G6BA 1HI1A 1U6ZA 1MMDA 5D8NA 3TRGA 5C5JA 5L1JA 3ZZZA 3J81U 3OL9A 3L09A 4J37A 4OHZA 4B02A 1SCJB 4J9NA 3VARA 1ZS6A 3DLKB 3CCLS 3TQ1A 2FHJD 4Y34A 3VQTA 3AD7C 1VBZA 3VCDA 1NEEA 4TLQA 1TL5A 1N6QB 1FTRA 4XDDA 1V3ZA 3R6GB 3IG1B 4IOCQ 4K50A 5AT1B 4MBUA 3MWBA 3EMTA 1QUPA 1BOBA 1KZFA 4Y49C 5ELYA 3US5A 4C68A 1UWAA 2E5JA 3C8YA 1IKVA 1U47A 4NPOA 3ET6A 2RRAA 1YGYA 2XM3A 5KFQA 4L73A 5LSLA 4DQPA 1D3WA 4UUWA 1ZG8A 1QY7A 1EJ7L 3FMCA 1XJWB 1VRTA 2FPHX 1WHWA 3HSGA 5BR8J 2FHJA 4DV4F 4P10A 2N7YA 2QECA 5B0FA 5J1EB 4ZPBA 2ZH1A 3T9NA 1X9WA 5FVJA 1ZETA 3AQOA 3VWDA 3V2UC 2BJDA 2KG0A 1B3TA 2DNRA 2PI5A 5HMZA 1ZA1B 3OXLA 3C16B 3PB6X 3C15B 2C3MA 1OSCA 4X66F 4M5GA 1XR6A 4CQ1A 5HMXA 4M5DB 1TL3A 3LP2A 3AH6A 3IJ3A 4DI6A 4G3IA 1CULA 3PIPQ 4YP3A 1R3NA 4DQRA 3QT8A 3R1LA 1VQYA 5DDOC 3FBCA 4ZVHA 3EM1A 3ZTRA 1S72S 3MECB 3MHYA 1YSJA 1OPZA 3M2VB 3ZXWA 1S6PA 2QX0A 3QAEA 5B0AA 2E5IA 1UZDA 2QIRA 1WF1A 4XIUA 2CNSA 4A95A 1Q8IA 2AMCB 3MUTP 4YB7A 3CDEA 4P7VA 4NLTA 1U4BA 3I1UA 3GYXB 3V8IA 2CPZA 3W9HA 1YDLA 2QA4S 1F5BA 2VHGA 2CQ2A 4DR7J 4NJQA 5LYLA 3FKBA 1F3FA 3OT9A 4M6IA 2L41A 1MK4A 4Y00A 2O3DA 1TV6A 4FXWA 4ITSA 3ZNJ1 3NMRA 1WTBA 3GONA 2QL9B 3GSDA 3ZTSA 1YZ7A 4R0EA 2LDIA 3TO9A 1QAIA 3D2PA 3KLFB 1HDUA 2LFVA 4B3SJ 4CM2A 2JEFA 1RAOA 4OYPA 3E3XA 1T9VA 2XB2D 4DL3A 2N3LA 4I68A 1LWFB 3CC7S 3EJMA 5HP1A 2HGMA 4UFWA 1RZMA 4JI8F 4IRKA 2KCWA 1GXLA 3SV3A 5ETKA 3KKWA 2UUCF 1C4CA 2VH7A 5E5NA 1H7WA 2CDQA 4A8FA 2QA1A 3D54A 1U2RA 4WCEQ 6CPAA 4ATNA 1JQGA 1DRZA 4LSZB 1P9QC 3PBEA 2CQIA 3CCZA 4ICLA 2PJ3A 4Y65A 2CZ9A 2VZYA 3ETOA 5D15A 1SJ4P 3ZZPA 3GIUA 2MLYA 3BH6B 4DU7A 3OQ2A 3SXLA 1VHFA 1MLAA 3V4MA 1RYSA 2LQ9A 2W4DA 5THWA 2IM1A 2RQ4A 4K0KJ 1RWKB 4CZCA 4DR2J 4RBTA 3K8WA 4LF2A 2ZENA 1S49A 2DHAA 3T5JA 3FZBA 1HWKA 1OY8A 5GAHI 1GEHA 4IG0A 5K14A 2B3UA 1NKCA 3SCIE 2ZBCA 5HBMA 1N36F 1LOKA 2J9AA 1S1WA 4DV5F 4RWXA 1N0VC 4NLSA 2HHXA 1Y7EA 2BQRA 1HBMB 1SC4B 2IDEA 5I3UA 3D7HA 3AB4B 3J80U 3G8QA 1OBRA 3IP0A 2Y3YA 2DPIA 1U24A 3B54A 4Q2MA 4Z7YA 5CCLA 3MCOA 4GRSA 5F41A 1NK9A 2HHQA 3AHPA 4ECQA 3C14A 2QZ8A 3CE8A 4KGZB 2NXUA 4B3SF 3SHPA 1RAGB 2D3O1 2E29A 5CD4H 1XMOF 2J6UA 4OZ3A 3N5BA 4WBFA 3MCNA 2DGVA 4A8KA 1H98A 3MMBA 1PYTB 3D2MA 1U6MA 1D1UA 4A8WA 3BLNA 1VQMS 1YVFA 5KFZA 1ROFA 1YKWA 2FJDB 4FZVA 2FLOA 4O3PA 3H5ZA 4X4QA 4IOAQ 4FKYA 2Y1LB 2XY5A 1H38A 2KDOA 4L75A 2ASDA 1GMVA 1YR0A 2N7CA 2YTCA 5DG9A 4EYIB 4K5SA 2QTWA 4HH1A 5CNPA 1DJ0A 2I2YA 1SQFA 2EW9A 5CPAA 4A8MP 1SQEA 4M6GA 1WWZA 1WD6A 3CF5Q 5LJ3Y 1S59A 4J7CA 3R7BB 2XTJP 4OQJA 2QE5A 3D7GA 2XNQA 4J9OA 1NJXA 1URRA 1Q53A 1WF0A 1H6KX 2AFUA 4ZKAA 3CJKA 4J9MA 5RUBA 5LSRA 4QBJA 4DWIA 5K8MA 4DJBA 3FEXB 1X5OA 4FS2A 4ZIVA 3RUBL 4CLLA 3D3SA 4L74A 4JXQA 4YB5A 4DMZA 3BQ2A 4LFAF 1YJWS 4OIXA 2C2KB 2HIQA 4NGRA 1N4LA 2FJEB 2FE7A 2V69A 4R76A 3T1YJ 1BO4A 5LSOA 3CXCR 2JBJA 2HURA 2QLJB 2HFZA 1RLDA 2HNYA 4R8FA 1WHVA 4DSJA 4A46A 1UFLA 1EZZB 5IQQA 1RWWB 4HT7A 3X1LB 1Q5VA 4MCPA 1U2FA 2FIUA 2Z2LA 1ZAXA 1ULRA 2KI2A 3DLLQ 1H72C 3T41A 4K4XA 4OV6A 2XHCA 5CCMA 4KBIA 2QMLA 4F36A 2V8DA 4B9SA 2E7XA 2CPFA 3MMJA 4HACB 1MWZA 1J4JA 2BE2B 1SVDA 2XYHB 5KFLA 2HRTA 2CIJA 4HH0A 3KL9A 1YRUA 1PBAA 3PR5B 3CO0P 2REEA 4ANEA 1BPMA 3VAKA 4C97A 4U7UK 4WTOB 1MMLA 3NWGA 2RDDA 3RAQA 2KJWA 3FZ2A 3Q83A 4R5PA 4UY8T 1G7CB 4P75A 3FFIB 4WFZA 3KJVB 4JI2J 1KFDA 3MMCA 2GGPB 2HZAA 4C9DA 4E0DA 3NCQA 5F8HA 5DWMA 1A7GE 2B8PA 1FKOA 1CJVB 1SL1A 4FN5A 3D7SB 2MQOA 3A3PB 4XPDB 1P9YA 2MEWA 1KR4A 2YQ0A 4ECXA 4HHJA 4PXCA 1SC3B 4QWDA 4NMXA 3EXCX 2GREA 3BDEA 2RILA 1LFWA 1NHKL 4EO6A 2V4RA 1D09B 4PUOB 2DTJA 1IKYB 3UN5A 2GNKA 3H2LA 2WK4A 4O4GA 1LANA 3U02A 1WDTA 8RUCA 1XTZA 4NASA 1O0PA 4OLOA 1M1KT 1ON0A 4TYAA 5KOXA 2LKZA 1M0SA 2HBQB 4KLWA 1TL4A 1S77D 3NS5A 2P6EA 5AE3A 3OR1B 4R9MA 2JBKA 2BMBA 1ZZNA 1T9TA 3PFOA 1NZAA 2Z3OA 1CQMA 5M2PA 1N5YB 2EFVA 2WVCA 2BACA 1HNXF 3D0IE 2C2RA 1WG4A 5KFBA 2FC9A 3DU6A 4C8OA 2EFNA 2JC1A 3SI8A 2W4PA 4PYDA 3I0RA 2EO8A 3DLHA 1YJUA 2Z58B 2OR4A 2OPQA 2WOMA 2OSRA 4USVA 4IR9A 4DR3J 1AUSL 4DHVA 2CQHA 1EETA 2C28A 2PD1A 4KLVA 1T03B 4LF1A 1VHEA 3DSBA 3KJFB 2LEBA 3OL7A 3PFEA 1S6OA 1N5TA 4UQGA 4PWDB 3FEEA 1RTIB 2D4PA 2OTJS 1Q7YT 2X3GA 1KUXA 4J9VA 2A2DA 4NX9A 3NY0A 2FZGB 1VDHA 3LP1B 1VQ5S 2CA9A 3WIUA 1E6YB 2VFVA 4G1IA 3RRKA 3M8QA 2BV3A 4CAXA 3K5MA 2DGOA 4DF4A 2CQ3A 2PFDA 2NUHA 2QN6B 1HQUA 3IMQJ 4K4YA 2M9KA 2A18A 2XGPA 3I9SA 1SV5B 5KFRA 3CCJS 1SBRA 4DQQA 3R9LA 2FZCB 1YX2A 2W2MP 5DZ6A 2C2DA 3CD5A 3N5FA 3JQMA 4K4SA 4O44B 1X9SA 2CAJA 5EGYA 2VJVA 4A39A 4LRBA 5AJ3F 4DV0J 3QZ8A 2FJWA 2RD5C 4RNNA 2Q6BA 3IXQA 1EQMA 3D1HA 1HBOA 5FDLB 5LXYA 4DCJB 4Y2IA 3DOKA 3KHRA 1WC6A 4X4PA 3QO9B 2G9OA 2E9ZA 1U8WA 1K4JA 1HPZA 3PY8A 1UPPA 4P4BA 3CJ5A 4I1TA 2HYIB 5F8IA 3CO9A 1UCNA 4C11A 4WK3A 3R5AA 4NE9C 4AG7A 2AJ2A 2V34A 4LVNP 1TKTB 3IA0A 3K9TA 2B7CB 1QSNA 3IBFB 4WFYA 3TO6A 4EMEA 2BANB 3CTRA 2Q66A 4AG9A 3LUYA 2VJUA 2F3JA 2QT7A 2POKA 2WVBA 3VAGA 3D68A 2C6CA 4CLZA 4DSFA 2K3KA 5C7PA 1L3UA 2PRQA 1CJKA 3M30A 4DSKA 3PDNA 3Q8SB 4RW6A 3EZOA 2PIYA 3FB3A 2ZXVA 4Z2XA 2OPRB 3R3TA 4V1Ak 2DR9A 2DY1A 2VBXA 3F41A 2OMLA 4PWUA 1TL7B 4F02A 2H65B 2ZBIA 2WB1D 3DR6A 1NJIT 1JXEA 1JXVA 5KOWA 2QLXA 2ASLA 2ZEMA 2QO3A 4FVMA 4QR0A 1FDNA 1I1GA 2ZBRA 1BUXA 2IIHA 4AQYJ 3G9CA 1R0AB 2XMJA 2GIFA 4ECTA 1C1CB 1FX4A 3P45B 2FTRA 4N77A 4QJVA 3WC2A 1LEOA 5F9LA 2O1PA 4KB7A 1XEBA 3CW2C 3I0SA 4IH7A 1RBOB 2AEFA 1H2VZ 2C42A 4I7FA 3KK2A 4R87A 4LF8J 1WACA 3GQCA 4RPFA 3MR6A 1N6QA 4QVTA 4DUYF 3LD2A 4OLPA 1NUEA 4DV7F 3AXKA 1SQHA 2CYYA 1XR7A 3W63A 3M8YA 2HAIA 4MHZA 2MKSA 5A8WA 2HK3A 1HNZJ 2F8HA 4USWA 4MFBB 1XK8A 5E41A 4USKA 4C8MA 3SDEA 3KG4A 1RKIA 3B2YA 5IZHA 1XERA 2CQPA 4O0NA 1RI7A 3UR0A 4YB1P 3GUXA 2B5JA 3VTIA 2YY3A 3MDFA 2JDJA 4DV3F 1F0XA 5J1EA 3WZ0A 1UFHA 4YUDA 2ZVSA 4KKOA 3F56A 4RNMA 3HXMA 3C16A 2PEBA 2MQPA 5C2GA 4GKKF 5L38A 4Z65A 3EXYA 2RIJA 4DV2J 2K5TA 2PJBA 5D3GB 1H7XA 4ZVSB 3KZWA 5C82A 2M8HA 5B08A 3OVAA 3OWCA 4HNYB 2DH7A 1CJUB 4CRYB 3D0GE 2GJ2A 4OZNA 1HIYA 1ZLHA 4QIVA 4BCAA 2BBEA 1OQ3A 3GWCA 1K8AT 4KHRA 2UXBF 4LF6F 2X51A 4ZX9A 5H9EJ 2A6OA 3H8GA 5AXKA 1CJWA 2PQ8A 4ZN3A 2WZNA 2MZJA 2EVZA 2OH1A 4YB6A 4R0JA 1U8SA 2PA8D 2YBVA 1ARMA 2E5LF 4EZ6A 3MCSA 3M8PB 1FWKA 2XEIA 2J8AA 2VUGA 1TF9A 4K4VA 3DRPB 1CC7A 3RZAA 2RKIA 5DO2A 2V6AA 2HS3A 2E1CA 4LSNB 3FJ2A 2ZITA 5JVGQ 3CGIA 3FEZA 2R98A 1LW0B 1S5ZA 3DXBA 3EY5A 1S4FA 2AJFE 2UV8G 1NHUA 1X31C 7FD1A 4U9ZA 3PG9A 3IR5B 1R0CB 1B87A 3N6MA 1KQSR 1WJ9A 3KLFA 3C3LA 2V2QA 3D4UA 3SI2A 5SZTA 1U2CA 1YREA 3R7SB 4QU6A 1GHEA 1X4GA 2DHHA 1LWFA 2G9DA 3HVAA 2UXCJ 2R4FA 4I49A 2MGZA 1B0TA 2BM1A 2G2YA 4P4EA 1BC6A 3F44A 1J2VA 3CIZA 4RBUA 1FRKA 1WEYA 1X4AA 5U47A 3OTOF 2F1FA 1N8RT 1R57A 2M7SA 2AYEA 4XPKA 3ZZRA 1RT5A 4YHHJ 4PV6A 4FWUA 1S76D 1S7IA 4LF5J 2HS4A 4TYBA 2V67A 2QL7B 4PZVA 2A3JA 3EXNA 3G71S 4LJMA 2OAUA 3PO5A 1YGHA 1HFEL 3M8RA 4B9TA 2AYBA 2ROEA 1GK8A 2VFTA 2YNIB 3HPOA 4DUZF 2EFPA 4S0MA 3DOMB 1KD1T 2DR6A 1JLGA 1PCAA 2CWXA 1IKXA 5KT4A 4OHWA 1RT2A 2NLWA 3UDVA 1HNIB 1N33J 3MEDA 5E3RA 3IN5A 1GNKA 2QFJA 1UEVA 1F2OA 1Y9OA 2JVRA 5AG4A 4DOZA 4DX8H 5F49A 2E5GA 2E1PA 4MXUA 2Z3LA 2M70A 4URSA 1S0VA 1HBMA 4NYZA 2OGUA 4MT1A 1GTEA 1HHQA 2Z0GA 4C3LA 2PJ5A 2DH9A 3QGPA 3W2VA 4YY3F 2VZ9A 4DBQA 1KTQA 1TKDA 2R7TA 4F9UA 3KK3B 2P6TA 4DSIA 2B8QA 1LWEB 4IF5A 1HEEA 4CLPA 1FD2A 2FJAB 2QSFA 5IQ6A 3D6FB 2K1RB 3OBIA 3QYYA 3NAHA 2CPYA 3HHNB 1M4DA 4QIEA 4B13A 4C2ZA 1F9EB 5B09A 4Q36A 1N5QA 2CWKA 1JWQA 3AXMA 5LRJA 2AX0A 3VR1A 3CCSS 4RNOA 1X60A 4PXBA 1QE1B 4IRDA 2YQ1A 5E3QA 4WFAQ 1R31A 2AFWA 4JBCA 1IM6A 5LT5A 3PEIA 2YNFB 3HI9A 2D9PA 4OYOA 1IQTA 4L3KA 1N5VA 5KFCA 1SIZA 5KG3A 1NDKA 3M2RA 1BWVA 3TVKA 1TUGB 2YWHA 3SMZA 3SXOA 4DR6F 4A33A 3GFXA 1QSRA 2CJBA 3MR7A 4UEFA 3RW6A 1IBLJ 4JV1A 5T7LA 2V8VA 2F9DA 1S57A 1CQNA 2OKQA 4CAFA 3KR5A 2GMHA 1M5OC 4M5JA 2PC1A 5HQ8A 4CT8A 5E3AA 3CDBA 4I2QB 4TU9A 4MFLA 1U1QA 3JS9A 3QATA 1RTDB 1H73A 2Y8WA 1RGVA 2ZPAA 2Z30B 2F40A 1FDBA 4OYBA 3T6JA 2PJ6A 2BJ7A 4ED8A 3FRYA 1DAXA 4EU0A 4HI1A 4ZBGA 3DYAB 3KASA 4DL2A 3ZZYA 1IKWA 1RWVB 5HQLA 1X9MA 1WSVA 4QYZK 3CCUS 3JQJA 4XNHB 4UIBA 2QYCA 2W1BA 2JJ4D 2NXJA 1AFJA 1S1UA 4OHXA 3D6TB 5KTCA 1J27A 1AUGA 1S7FA 2DEAA 3L7UA 2ABZA 3N6NA 4Q2LA 3DI6B 3G6XA 2B4UA 1I5OB 5IFMA 2IM3A 2XLKA 1E6VA 2UU9J 1OWXA 1S79A 2Q4VA 1VQ9S 2YQ3A 1HQEB 5GAGI 4NF1A 4OJGA 2O4HA 4NLWA 5L9NA 5A8KA 1RHQB 3VF0B 1SKUB 4LT6A 5DJBA 5M2RA 2QG9B 1XNRF 2PJCA 5ETPA 3R97A 1DQAA 5J2PB 5D4NA 1VQ7S 2B9WA 4LQ6A 4GVBB 4YWYA 5CZXA 2Z2ZA 3ZFVA 2H51B 4YS2A 4ID5A 4PUOA 3QQCD 4G65A 2V8PA 3MM7B 4WP8A 2IJZA 2VBQA 3I87A 3LP0A 1AW0A 1TQLA 1FCAA 5ETQA 1FXRA 3HZEA 4FYDA 1NB2A 2EKYA 2HHHF 1RAIB 2IVYA 4EBDA 3CCWA 2W2QP 1QM9A 3SQOP 5EHHA 4ZPTR 3GCXP 4M6HA 1ITPA 1CS4B 3I4PA 2M8DB 1C1BA 1YG0A 3N01A 4PXDA 5KFOA 2DGTA 2ZOFA 1L3TA 3UCZP 2DIVA 2B7BB 1SKRA 2HQFA 1H2TZ 4JLYA 4O3RA 2PE8A 1HMVB 4NGNA 3GFHA 2ZH3A 2C2ZB 3P4UB 3BBFA 3KLIB 5AG6A 1KVIA 4QUSA 1FFWB 3CD0A 5B0GA 2P6SA 4KH1B 4ZJOA 1HBUA 5LL6d 3HP6A 3R9FA 2F8EX 3QBCA 4KSFA 4N47A 3O3LA 3GR0A 2MYFA 4CGNA 3KUEA 1VQNS 2CPXA 2KZMA 4OZ2A 3A4TA 1PC5A 4PWDA 3SJFA 4OC2A 3J7ZT 4WIIA 2CQ4A 1PJ5A 1KFSA 4F8ZA 3H5XA 1FEHA 3GU0A 3LP1A 1NPRA 4DSLA 3TVZA 5G20A 2ZOGA 4DPUA 3H98A 1MG7A 3AY0A 4R8UB 3BBCA 1KLMB 2RS2A 1EQ0A 3IBCB 1J5EJ 1L5UA 2NPIA 4HDHA 4NXNF 1FKAF 1G3OA 3VGVA 3OVSA 2D4OA 2XY7A 5JM6A 2XSFA 2R8HA 2CQ1A 2VQEJ 1FKPB 4Q45A 2WVDA 1SV5A 1PC4A 2KFZA 3WC7A 4CO0A 5DS7A 3UQSA 2AFOA 3Q8YA 1I1DA 2C2MB 2OEKA 4C2MA 3T5KA 2EG1A 2RRNA 1IGBA 4URGA 4KHMA 2O53A 5JH9A 2MLZA 1U1OA 3QGIA 1TK0A 1EP4A 2VQFF 3FMWA 4QPXA 2DISA 2AFMA 2CNTA 2JLEA 4LF7F 3I6PA 5FDLA 5EDWA 4B3MF 2W9CB 3W7BA 4KAIA 2R7SA 1FY7A 5HL7Q 2YNCA 4AL7A 4NSQA 2DR7A 3TOAA 3V6HA 3HD2A 2HGLA 2MZTA 3ITHB 1OJ4A 3FVLA 3NGTA 2VICA 1AMPA 5BYQA 2MQ8A 3T1HJ 2ZH2A 2LEPA 3KK1B 4H4MB 2RB7A 4MFPA 1VISA 1FE4A 1JLQB 4DX5A 2WCXA 2HNZA 2V68A 3IAM9 4X5KA 3NFZA 3EVOA 2AFXA 3PKYA 3CPAA 1F60B 1S7HA 4FBUA 1PG5B 3GTYX 2PA3A 1ZO0A 4KGVB 3QAYA 3QRPA 5EWFA 1DTQB 1R8CA 4U8YA 1SQGA 2F63A 4B10A 3B7IA 3GFYA 2QRRA 3FQKA 2XGQA 4KO0B 3B3WA 2W24A 4LREA 1DFDA 1MU2A 3PW5A 3S8SA 2DR8A 3THTA 1RTJA 4K4WA 1WDDA 4ZY0A 2OPRA 1AT1B 5C42A 3VGUA 1VYAA 5DWNA 2RS8A 4RW7B 3HD1A 4QU7A 5F48A 4KC5A 4F4YA 4QIGA 2PJ1A 5D0HA 3NNCA 4C7IA 4CGOA 2VFUA 2V0NA 3HFKA 5J1NA 4JI3J 4JI1F 1TF8A 5IB9A 4MY0A 2CADA 5GMEA 4IFVB 2AJ1A 3HKZD 4KYZA 1VC5A 2BVZA 3GJRB 4XDCA 5CHCB 3W6SA 4M94A 3HSZA 2J6TA 1GYTA 3GG1A 1A2ZA 3A8KA 1C4AA 1U1KA 2FXFA 3P96A 3N4WA 2V50A 3EICA 4V19J 1JLAB 2YWKA 3M1VA 4ES2A 5KT7A 1KLNA 4PQUB 1RAJA 1VRUA 5E3CA 1FVSA 4DV1J 4DX6A 3POTA 1F9HA 3DRSB 4YDDB 2WTFA 2FVQA 1ZA2B 4MFJA 2EI5A 1CVJA 3VQSA 2MHNA 3GIRA 4QR2A 5DETA 2E66A 2YKQA 1L3KA 1EX8A 4FYYB 2VDIA 4MFBA 3A3NB 4B08A 2C3YA 2CXAA 4PQAA 1AROP 4Y49B 2IYGA 2RF2A 4O4RA 3G6VA 2IJFA 2XCAA 3SBMA 3M32B 4QW8A 4R3KA 4KTQA 2R7VA 3WIVA 3IR6B 1NBEB 2NS1B 3WQPA 5DZ7A 4KOUA 2P5VA 2R8IA 2LXIA 2B4DB 1TIQA 1YZ6A 4ZVRB 2DPJA 3BQ1A 2ZNZA 2AJQA 1BY9A 2L08A 2E9TA 1BXNA 3MAAB 4HI2A 5HLFB 1X4BA 2ZH5A 4KFBB 1CJUA 3PB8X 4M5HA 5L8RC 3S6KA 2GVDB 3SQGA 3V7ZA 1TR0A 3SYZA 4KZTA 1RK8A 5KT3A 4ZCIA 1C0TB 4ERDA 4JI5J 1Y7PA 3U27A 5KFPA 4IDKA 4C98A 4JYAF 3F73A 3IGRA 4GC6A 2HRYA 4DSEA 3K89A 1QAXA 3EGNA 2R8GA 4NGSA 2HNDB 2G2OA 2R8VA 3KJQB 2PDOA 2D7SA 3GV8B 3PJ9A 4ZJQA 3LTOA 3BEGB 3P6YC 4LSNA 5C24B 3MPUB 3IWGA 1EB0A 4KUAA 1S0OA 3RBUA 2RMLA 1VLYA 4OZ1A 1D9FA 5J2MA 1QVGR 2PCUA 2AIRB 4YMEA 2BE9B 2MMYA 1WWHA 2MHEA 4AXJA 4K8RA 2DNOA 4ZN1A 2XSJA 3A8IA 2LU2A 4DR1F 3Q23A 4DQSA 2J0QD 4WWSA 1S60A 3KG0A 2L9DA 3HULA 2XZWA 3ISXA 2UP1A 1UTAA 5HAOA 3OFEA 4UOHA 4F4KA 1DQ9A 1IBMJ 4NZ7A 2W8LA 3P2FA 4TNUA 4WU3A 1XMQF 2ADBA 3EE3A 1V6HA 2WSCC 4WU2A 2PO4A 3QWUA 3IC1A 3KLHB 4KOTA 1QVFR 3GIIA 2PSZA 2FQQB 5E33A 3PJXA 2BA9A 4ZVPB 1H2UX 4TY9A 1KKHA 2IMOA 4I69A 3QT5A 4U95A 2XS7A 2YNGA 2Y1RI 5L1IA 2IBKA 3DLBA 3NXZA 3DOMA 4ECZA 1Q78A 3DDNA 4ZP7A 1XNQF 1SKWA 4NI2A 1RCOB 1WEZA 1IICA 1XFOA 1SIWB 2HVZA 5CBMA 4O0IA 2B43A 1VS3A 2BCOA 3MPYA 1GMWA 3D28A 5D29A 4F3OA 4PCQA 4QB9A 3K5OA 2ZZMA 3EZUA 2H5JB 3NGUA 1K73T 1G2EA 5AE2A 1K1SA 5CYMB 4WF9Q 1BQMA 2V77A 2C22A 1FNXH 2Q7SA 5DQGA 3FVYA 3SJEA 4URQU 3D7DA 3MN8A 3NCRA 1OQ6A 2BQ3A 4UFVA 4BLGA 3M05A 2C1EB 3GYAA 1QUVA 4CH0S 1HW9A 2KYXA 4CYUB 1QSLA 5H86A 4M3SA 1R8HA 2DIUA 4GS4A 4I67A 1OIAA 3D3BJ 2WB4A 5CYQA 2KVIA 2ZEJA 4WFXA 3WT4A 3SSSA 4H6UA 1Q8BA 3W91A 4B9MA 1WUUA 3D3CJ 5LMNJ 2HW3A 2QLWA 3AAWB 3LW5C 3WX8A 2R8KA 2KM8C 1XBUA 2IC3B 3BGLA 5KT5A 3BSAA 1FHTA 3FBEA 1QE1A 1N34F 1SUQA 2AU0A 3PR4A 2G1DA 3RYLA 1FRXA 1T94A 2ZD1A 1YHQS 2YKOA 2YNFA 3CC2S 2KKHA 3BGFA 4GMKA 4N76A 4C0HA 4JI7J 3A3OB 2RUGA 4WWVA 3TR5A 3D1OA 4D3HA 1NJWA 1T95A 4ELTA 1Q16B 1VQSA 2SXLA 5BYSA 5IC4B 3HT3A 2DHSA 4YEAA 4IG3B 3HSJA 4CDIA 2V9WA 2YNHA 2AT1B 3EWGA 4E2AA 1M5KC 2X1GA 4WYLA 1IR2A 3D67A 1GMUA 2UXDJ 4H4KC 4F04B 2BOAA 3TC8A 4ZA1A 5IXUA 1KUYA 4NLPA 2ABYA 3V6KA 2C3OA 2GO8A 4EYHB 3HHEA 2ZNYA 5F8GA 1FT7A 1Y7RA 4I2QA 2GJFA 3PBBA 1XIXA 1X7VA 2QMWA 2DK2A 4FVCA 1ACMB 2I00A 4MI4A 1Y5LB 1FJGJ 1FK9A 4LF4J 2ZJPQ 1M1DA 2LLZA 4ZITA 1RT4A 3UI3A 4NZ0A 4H4OB 1SH0A 2A0FB 2LQJA 2B9EA 3DMJB 1N32J 3QAUA 2ZEGA 4NYPA 2DNYA 2QLBB 2X1AA 1VKCA 3SV4A 2E1MC 2YH1A 3R2CJ 4DG1A 3DYAA 1KQKA 3K2KA 2G0BA 2D69A 3CC4S 4HTIA 4NXMJ 5AE1A 2Z2MA 2ZHAA 4QR1A 4B3TF 2F5GA 1YBTA 4UCPA 2XBPA 3TANA 5D78A 1NNDA 1LRZA 4NLQA 4TNOA 2NYIA 3DI6A 4OX7A 1YWXA 4XPCA 2WUUA 2HFVA 1AZSB 3MM5B 2BJ8A 4TLRA 2KU7A 5HSPA 1DTDA 4J91A 3GPAA 5BYRA 2ZHBA 1HQEA 2Q04A 4AFFA 3JRUA 1IN0A 5LMUJ 3EFAA 4JV5J 3H20A 2CF4A 4XK8C 4EK2A 4KORA 3L4BC 4QCLA 5CQGA 3NEKA 4KSAA 5J2PA 3MZIA 2NXEA 4UOGA 2KRRA 5ETNA 3JQKA 2R42A 3RRHA 4DPXA 1IQZA 3OXGA 4NGQA 2I3CA 1VGYA 1LAMA 3CJSA 3L9ZA 2WBRA 1ZG7A 1W2BR 5IX3A 4DZ6A 1P8GA 2GANA 4LMZA 2DXEA 1TK8A 1XQIA 3A9LA 3K17A 3DRRA 5C25B 1SC6A 4ECSA 2IRUA 1F2HA 2BABA 3TA1A 4J9SA 2OJ3A 1L0CA 3QIPA 2PJ2A 4TVAB 4LFBJ 2GVZA 1G4CA 3W61A 3F0NA 1YLXA 1Y0YA 3H42A 3Q2SC 5K8OA 1RQ0A 4TWEA 2GHVC 2EFQA 3GSIA 1FJCA 2ALYB 2XYGB 5D4OA 3CB4A 3BO2A 3PRBA 1WOSA 5G0RB 1CX8A 3A8EA 1S1XB 2MKKA 6FDRA 1MWYA 3VGSA 1UMJA 3CPWR 1HWIA 2B6AA 5F8MA 4ZMMA 1PU9A 2V4JB 4RU2A 2PMZD 4CO4A 4FD6A 4HLBA 4ILLA 3SXNA 4B3RJ 1FA0A 5A0YB 2PFFB 2M88A 3WBZA 2PDAA 2V4QA 3RAXA 3H40A 3TZZA 6FD1A 2ZUGA 3K5LA 4IOBA 4TY8B 3P5TL 1Z8XA 5AG5A 2F4VF 3B3SA 4OIDA 4JV5F 4R8UA 1S4EA 2ZJQQ 4ORFA 1T9XA 2YKAA 4M63A 1HNVA 1FNMA 2O67A 1I51B 3ILJA 2IA6A 4F0KA 1TL1B 3UPFA 4J9KA 1XJOA 1DBDA 4OZ0A 2H9ZA 2KXHA 4KV8B 4OHVA 3C6TB 1TU0B 2ZBQA 5KAKA 4RJVA 2NSBA 3VATA 3DLEB 1Y3JA 3GP9A 2J6SA 2Q1LA 4FF1A 1PYOB 1QTNB 2QC3A 4J9LA 1LOUA 4X64F 3EDRB 3QWPA 5H1SV 3OTBA 4KGMA 2DO4A 3X3UA 1JKHB 1DLOA 4ZVOB 3ENQA 5KFXA 2C2NA 1RT3B 5L39A 4KVME 4CS0B 4CLFA 3W2WB 4L8AA 1BGXT 3TWZA 3BXMA 4G6VB 1JLQA 1Z2ZA 2B9XA 2GU2A 2CJQA 4HPSA 1NDLA 4UQTA 2XHWA 5IS2A 2HS0A 3I5BA 2ODFA 3G6ES 2W9AA 2DNZA 2JSXA 1QQ9A 2VPYB 3NE8A 4C2YA 3ISNC 5GVQA 2ZM6J 5A6PA 3EDQB 4Z37A 2MSSA 3D6MB 1RTZA 2BJ3A 2YKMA 4B5OA 1A9NB 3RBZA 2CPIA 1Q0NA 3LA0A 1ZM4A 1HYSA 3V4IA 4BS2A 3NOCA 2MQMA 3HSDA 4LSLB 4X4UA 2JEIA 2JEJA 4ZK7M 1Q2CA 4NFRA 1RE1B 2PI4A 4RUBA 4NCBA 3HHKA 1RA6A 1XC9A 4U9RA 1YTYA 4KJIA 1GH8A 1U1NA 2AE6A 4QWCA 2IRYA 1FT8A 2QEXS 4RW7A 4C6AA 5HMYA 2Z56B 3V6DB 1S9GA 2XLIA 1YVOA 1X4HA 4EBEA 1V3SA 3BF4A 1AUDA 1RKJA 2NYQA 5KG4A 3GIMA 3MUMP 3TP2A 2YWWA 1LW2B 4KQZA 3KHZA 1CPXA 3H8EA 2JDCA 1P1TA 1H8LA 3MOJB 2BW2A 3TZXA 4CGLA 1I3OB 5KG2A 2FVSA 2R7UA 2HHVA 3TEGA 4Y2AA 2VA3A 1RT1A 3U7JA 3HMJG 4AT1B 1Y11A 4KS9A 3GKRA 3DGVA 3S9MA 1HI8A 1KONA 4IRCA 3CJ0A 3PB9X 4ZDNA 2EG2A 2HWHA 1YW6A 1WHYA 3N28A 1R8AA 1YIJS 1VK3A 4ECRA 1JLAA 3BR9A 3NNHA 2OZGA 4PQUA 5ADZA 4RNFA 2ILYA 3BSNA 1EKRA 5MAOA 1M1HA 2AGQA 3W5ZA 3VZIA 4OX9F 4DV4J 1ARLA 1U09A 1RHUB 1VR6A 5GAEU 3KGQA 4K7QA 2Z8QA 1VQKS 4JZ0A 3MEGA 2W4CA 1U45A 4C8LA 2QJ3A 5IM0A 4OX6A 2DNLA 5H84A 4ZVGA 1JB0C 2VG7B 1NK0A 1M5HA 4B3OB 3KG1A 5CYJA 3U1MA 2OU2A 3MPWA 4X66J 1DQ8A 5T41A 1UVKA 4CTAA 2E1AA 2HQIA 4A48A 2GIRA 3M32A 2KN4A 4RZRA 4Q7AA 1CPSA 1I94F 2ZELA 3FBFA 2B9YA 2D74B 2OZHA 2ZWOA 1VIOA 3R5CA 2WVFA 5EMIA 5MLCV 1LXJA 2J9CA 4PK2A 2PGCA 2QGFB 5KTDA 3MTJA 3Q0AA 3MAAA 3BJYA 2Q51A 4FD5A 1FERA 3NWRA 5DDRC 1OSDA 4ZIWA 2ZKTA 4RW9B 4A47A 3UW1A 2I79A 1NM2A 4EFAC 1JLFB 2Y0MA 1RSCA 5BXIA 2H1YA 2U2FA 2AEJA 1KVJA 2HHTA 4QZVB 2OOTA 2E7VA 1C0TA 1WOPA 1IB1E 3FQLA 4U9YA 3PCOB 3K7RA 1T05B 2HLTA 2WZ1A 2XZTB 4ENOA 2J76E 2ZH6A 2GIVA 2NREA 4RWWA 2R7QA 2GQ2A 1WF2A 2Q0YA 5C24A 1Z4RA 3DHWC 4DXLA 4HHHA 3BKFA 3UVJA 3CWJA 3PW7A 4JI8J 1NXIA 2MB0B 1TXRA 2UUBF 1QMUA 1OY6A 2RDJA 3OR2B 4KGXB 1PBUA 2F5IA 2UUCJ 1HBNB 3BJ7A 4JUZA 2OSQA 2PIIA 5I42B 3J7Z5 3I56S 2FLNA 2WPXA 4MKBA 1U1MA 4OL8A 4K4ZA 3TZYA 4CRJA 3O44A 2HQYA 3W3SA 2KB2A 2G3TA 4FPRA 5F46A 5HROA 3JYTA 1BQXA 2B58A 1CP6A 4UEEA 2HGNA 1RU2A 3G8SA 1TKXA 5G4DA 4HHUA 3Q8QB 3G8TA 1RWUA 1YJRA 4ED1A 3GLJA 2PR1A 4P71A 1D8YA 2APOA 3GJTB 3QGGA 4AVCA 2MKIA 2CPDA 1ZAVA 1TVRB 1REVB 4IUSA 2OTLS 3QSIA 3CCQS 3KLVA 3NOGA 4MY3A 1N36J 1T9WA 1U48A 1FTCA 1R6YA 1LWCB 4PSWA 4DV5J 4DR5F 1DTTB 3LAKA 4ED7A 3MOZA 4EUVA 5HH1A 4N7TA 3MUVP 4H54A 1TKZA 5LYIA 5IT4A 5E2QA 4ZCKA 2VV5A 1S1VA 2OD4A 1SI9A 2RQMA 1KTVA 2IMWP 3D7FA 1P6TA 2XY6A 2OLWA 4KHPF 2XO7A 3IWLA 5HJYA 4ZVQB 3DC2A 3IS9B 2GAGC 2I8EA 1XMOJ 4ZHRB 1UW4A 1YLEA 3KFWX 1C0UA 5KFKA 2C27A 3RBDA 3NS6A 2PJ8A 3H5YA 3U1LA 4DFKA 4C2XA 3KQXA 1IBKF 2UUAF 3IWEA 3KHLA 4EGLA 4KUBA 2R7RA 1KP6A 5DQIA 3GILA 3V81A 3VVUA 3UDEA 1JLBA 2MSTA 1HR0F 4D3GA 2OHDA 3ENVA 2CQCA 1YRTA 4NGPA 4OYAA 3T9ZA 2BKOA 4LFCF 2WONB 2IC3A 4QYRA 2DJWA 1NSKL 5EN1A 2NXNA 3RNZA 5JUMA 3H2VE 1IKVB 3CSKA 3K2YA 3OJSA 3ET6B 2FLPA 2VB6A 2XMAA 3NAIA 1PILA 2FYXA 3LODA 5G1ZA 1KHWA 1XBWA 1DY3A 5E96A 2J7UA 2JNJA 2OIHA 5K5MA 2YKNA 4OV1A 5DDPC 3Q22A 1PGZA 1TAUA 4LFAJ 2MQLA 4DX7A 1NHVA 3PEHA 2DBBA 4AVAA 3CVKA 2J0WA 1EARA 2EBEA 2N82B 3RBEA 3OW2R 2CJXB 4EBCA 1U49A 3W66A 1F9FA 1PJ6A 3FEYB 4WP3A 2FUG9 4FDFA 1FWLA 1TL3B 2XI2A 3LP2B 3Q8UA 2DHGA 1CULB 2HBZB 2RNEA 3HUVA 1V5VA 2BRKA 4NLUA 2DY9A 3GIKA 1U6BA 4K4UA 4IYQA 1S97A 1CC8A 1YJ7A 4LQ3A 2QMUB 2Q3PA 1Z5RA 2XG8A 4KOVA 2V8GA 5F3TA 3MI7X 3ULHA 4FNIA 3FF3A 1S6PB 4LR7A 3CPXA 3I3GA 5AGEA 1RBAA 5KFAA 3O8WA 4EWTA 4DUKA 4PG7A 4G1PA 3ENAA 3E01B 4H4OA 2P6GA 3IFEA 1JWWA 4WK1A 4CH1A 1RXOB 2HQGA 3FMBA 5ETTA 3H0PA 5IWAJ 3OSPA 5LJ5Y 3PRDA 4I6YA 1AXQA 1TV6B 3O1LA 1IM4A 2CQDA 3ONQA 1MMNA 4OI6A 1IWAA 3VAJA 2GQQA 3MGJA 3DGPB 4PG5A 2CNKB 2AWZA 1VQ6S 5D0GA 2YX4A 1VLOA 2HVDA 2N4CA 2R2SA 1X0PA 3RB6A 1S0MA 2KFYA 1ELMP 3UN2A 3ZZUA 2HWIA 2VKRA 1GXTA 4WFBQ 1AZSA 1AB8A 2KZZA 1ZLIA 5HP1B 1J5OA 5A28A 1NJYA 4JI4J 3S6GA 1UA1A 2JEVA 4I64A 2Z10A 4ANDA 5EBVA 4R7MA 4B5PA 1REGX 1Y00A 4G1QA 3KKFA 2CJ9A 2V63A 5ETLA 3UNYA 1X4FA 4B9UA 1RB0A 3HT0A 5SUHA 1NKBA 2GX8A 3MURP 3SFUA 2FIAA 3H4DA 4WP9A 3CJQA 2B3VA 1LQ9A 1UZHA 3TYTA 3HHLD 5C25A 2K2PA 5LXRA 2ZUAA 3TOQA 1Q7LA 3T8WA 4ZCMA 3IBWA 2JHEA 5F0UA 1GTHA 1P0HA 1HNXJ 4CLTA 1JX4A 3RRGA 1RAAB 4NRTA 2XQCA 3C19A 2JZ5A 4J5OA 4O3QA 2HSEB 2FVPA 3KR4A 4ED6A 4IG0B 5K14B 3PZJA 1HKAA 1YBUA 2VU5A 2EPIA 5CD4A 2DB1A 4NGMA 3HHLA 2L9NA 2R1IA 3G96A 1URNA 2IY5B 5IWAF 4ZP8A 3CZXA 1S1WB 5D4PA 3OHAA 4CAWA 2ZEHA 4ECYA 1KC8T 3B8GA 4ZP9A 1YMEA 4AXIA 4DPYA 4PXEA 2FL4A 2Q44A 1ZYQA 1U0HA 4HTJA 1YRXA 4DL4A 3FCWA 2BEIA 3KI9A 3S7RA 5HVFA 1DE4C 2R2RA 1VI7A 1ZM2A 3F0AA 4C4WA 3QZ7A 1WEXA 4EI2A 1UW9A 5IOLA 4Z7CA 4E98A 1RAEB 7FDRA 2AQ4A 4U6PA 4MKVA 1NLKL 3Q8PB 2Q4YA 1MWQA 3CIMA 4CAVA 3NCPA 3R27A 4NEXA 2I38A 3NGSA 4OZLA 3MMBB 1S6QB 4JI4F 5F47A 1YVKA 2ZW6A 1XEZA 3QLHB 4WJBA 1F2PA 2A10A 2VG5A 2EUIA 3AQPA 2MJUA 3J7A1 4QYZJ 5LOQA 1N48A 2PJ4A 4ZOSA 5AJ3J 1S9EA 1TL1A 2RVJA 3BJ8A 3S01A 2BZ2A 3G82A 2OEMA 2PVWA 3BYPA 3HJFA 2MJNA 3PHTA 5L9XA 5DM7Q 3K0JA 3C6TA 4CLUA 1B0VA 3UO0A 3UCUP 2ZWPA 4CLKA 3H2UB 1IY7A 2RH3A 3RU0A 3AFGA 2P2CB 2HZCA 4KGKA 4Q0BA 3W6XA 2DCLA 1R8PA 3C66A 3CJKB 1CBKA 1B7YB 4F26A 3I82A 3RB0A 1SL0A 1RADB 5A2QY 3GCWP 1JLCA 2I6WA 5KFTA 5HATA 4CYPA 1JKHA 2CJYB 3DDIA 1Q2DA 2QYGA 2QA4G 1IR0A 1RT3A 2EEYA 2UVWA 2BKNA 3M6WA 3W2WA 1WI6A 3GB0A 3MM6B 1RJJA 1NPKA 3TJ8A 1CJTB 3NKYA 2XMTA 4O3OA 4B17A 2XMWA 2J9DE 1IVZA 4K2XA 1SL2A 3ZJ0A 3WC5A 4P6QA 1R0BG 2HNYB 4UZCA 1T11A 1LK5A 2Q4ZA 2ARHA 4GXHA 1RHRB 2UZAA 2IFXA 4CO1A 3KNGA 3DLJA 1QDUB 5LYDA 4LSLA 4CLSA 2J7WA 2XMVA 3MFHA 4X4VA 4M5IA 4YRHA 4LX9A 4CH7A 5F8LA 3KMQA 2VEZA 2CRLA 3VALA 3TO7A 1Y0HA 4ELVA 2YWEA 4I6WA 3G87A 4UFXA 3CDWA 1WNEA 4RI1A 1HNWF 4R5PB 3MR3A 1FRMA 4MIBA 4M5NA 4TQSA 5DLGA 1YQHA 4ZY1A 3B6BA 1TZ0A 5JGFA 3S1TA 3PW4A 2Z0ZA 2BX6A 3MRUA 3EGWB 2K3IA 2DNPA 4KVXA 2QFIA 4RW4B 4CT9A 3AT1B 3SJGA 4DUYJ 2EK6A 2LQBA 3TVYA 3SIPB 4DV7J 2NUUG 4NA2A 3B35A 3N79A 2N3OA 3T5LA 2VI7A 9RUBA 2NSCA 2Z3NA 5KFMA 2XEJA 2FCKA 1UJ4A 4LF9F 4UUXA 3T1AA 1ZTWA 4O4GB 4DL7A 3SCLE 2RDIA 3JSRA 2AEMA 2HKEA 5AG7A 3JB9k 4USMA 3GE9A 4FPIA 3DLGA 4DV3J 3I4HX 1M4IA 3DOLA 1WG5A 2CUYA 4RX6A 4EFDA 2D3OR 2AGPA 4GKKJ 4P2MA 4LR8A 3CEDA 3QJLA 2B5GB 3OTEA 4K5RA 1OY9A 3OTDA 1PIEA 5KFUA 4OYWA 3IWWA 1MROA 4FUUA 4LBIA 4X62F 1WHXA 3LGHA 4C8NA 1NK4A 1H74A 3FJUA 3I0RB 3C46A 2NQPA 4NEZA 3QFHA 2UXBJ 4LF6J 1X4EA 2OPQB 4JI6F 4AVBA 2YX1A 2DNQA 4ED3A 3KYLA 4DPWA 3JSMA 1YQEA 5LM7E 4UTGA 2ZEEA 2E5LJ 2PRBA 3IO1A 1JLFA 1RWMB 4B12A 4JB8B 1Y9KA 2QLFB 1WI8A 3I31A 4J9UE 3E2EA 4CIOA 1T7PA 2EVNA 4XPLA 4L3NA 1HI0P 3TJAA 3RG6A 4F9VA 1WKKA 3RR8A 3Q2TC 4A8QA 3DLKA 3N6LA 1T05A 3UWTA 3M8QB 4DL5A 1TMMA 2QVPA 3QJJA 2ZHOA 3QT7A 3M8WA 2V2ZA 2O01C 3OUYB 1F5CA 3IGVA 2QYVA 3IG1A 4MJKA 4F50A 3NH8A 1X12A 2AJ6A 4DPTA 4K2JA 2ZKUA 1S1TB 2UVRA 3WC0A 3ZNUA 1RWPB 8AT1B 2Q43A 1TMJA 1RBLA 1HBNA 3OTOJ 2XEGA 5I42A 4OC4A 3BM7A 5H9FK 1HBOB 3ZTPA 1RHMB 3G2XA 4DLGA 3DOKB 4O3NA 2VBZA 2KG1A 1HPZB 3C15A 1VHIA 2D3UA 4N8NA 3JSBA 5EUHA 2W9BB 3TW0A 4C11B 3N7ZA 1L3SA 5JQ4A 2YPYA 1Q8KA 1KRPA 4MKAA 4M5DA 1BLLE 4PR6A 2B4BA 4B9LA 4DUZJ 2BJEA 1HARA 3PX6A 2VFRA 1ZZFA 2YGWA 4KE5A 4DNCA 3RO0A 4DFMA 3MECA 4U5YA 2GQCA 1LWXA 4ZPAA 3MM9B 2OZUA 1PJ7A 1U6FA 3M2VA 2LVWA 4GKJF 3LACA 1UJ5A 1TVRA 1I6JA 1DZ5A 3BGUA 2CNLB 1FO1A 2A2CA 2CJKA 5D6GA 2AHOB 4RW6B 2J7KA 4P45A 4OC3A 1S12A 1DTTA 4WTYA 2ATLA 4LR9A 3OV7A 5DG7A 1Q81T 4UF4A 3K57A 5HVGA 1YJTA 2ZH8A 2AZ3A 4YY3J 3C6UB 4ES3A 2XZDB 2P8IA 3BSOA 2FHKA 3BHXA 1WKJA 2LECA 4ZY2A 3MGDA 3NH5A 1KVKA 4LBHA 2VODA 3SCKE 3TUJC 5C2CA 4H89A 4QC6A 2CTCA 4C8YA 2ERRA 2NPFA 4ZHRA 2OEJA 4LUAA 4X84A 3CJ4A 2EC2A 2XULA 4M1KA 1U1LA 1C2PA 5I3PA 3RR7A 2LU1A 1MJ9A 2MDAA 2AFZA 1Q1KA 3TQEA 3VGTA 2QSWA 5KFSA 5L46A 1HL6A 1U02A 5IT9Y 4NEYA 3I0SB 4TXSA 3R2DJ 4ZLLA 3GYNA 3HM9A 2KXFA 4I7FB 3KK2B 4NMLA 2G0CA 3TE4A 3TAQA 3QMQA 1NSLA 4FAIA 2WONA 4KR0B 4DV6F 1CLFA 3A13A 1NH8A 1D8ZA 4PYAA 5J1PA 2BXJA 5CAAA 1WORA 3KHGA 2HIYA 4F7VA 5A8WB 5IC6B 4DZDA 4OJ1A 4DR6J 3SDEB 3OL6A 1K1QA 2JLFA 1IYLA 2KM8B 4PSXA 2B5JB 1NB7A 2RJZA 2WSFC 4KPYA 2NMTA 4WIQA 4USTA 1BAVA 4CGMA 4BC7A 1IYKA 1LV5A 2IA0A 3JXOA 3MPDA 4CO5A 4KKOB 2J8SA 4A8SA 1Q79A 4MJ8A 1RUSA 1AA1B 1IXKA 1HWLA 1KHVA 2HWTA 3M9OB 1FI4A 1TUVA 2BE7D 2ZDPA 2KRBA 4YGOA 4P7TA 3VWSA 4N5SA 3B4MA 3CMAS 2DPTA 5KG1A 3ILOA 2GE3A 4LRCA 3R6LB 4A38A 2RT3A 1VC6A 1HHTP 5F8JA 4YFJA 3QSYB 5KFDA 3E0KA 1RLCL 3H25A 3E01A 3OFFA 2OH2A 5J2QB 3AODA 1PYTA 2PVVA 2FJXA 4X4RA 1HDQA 3VWEA 2BW7A 1SXLA 4CRZB 2RKIB 5HK4A 2DR5A 4ZPWR 4OX8A 1F1BB 4TKTA 3DGPA 4MK9A 3UD4P 3CD6S 5HMNA 4IH5A 1KBRA 3ZTQA 1Y3KA 2F65A 3PEJA 2FHMA 8ATCB 2LYVA 3QNWB 1M1GA 3G8WA 3QNVA 3NS7B 1XNRJ 3C26A 2YX7A 3N0VA 1IIDA 2ZDOA 1N0UA 4OP4A 1D9AA 3D1QA 1QSTA 1YJNS 1RISA 3SFGA 4BWMA 1MN9A 2MGZB 4L89A 5A2QU 4CYNA 1LAPA 4KOXA 3IM9A 3OFGA 4IR1A 2BDPA 2IJRA 4UCMA 4P6YA 2XMUA 1ZOTA 3LH2S 1V3RA 5KFIA 5KFYA 5BR8F 5EC4A 2HHHJ 4U7UD 5F09A 2M5YA 1UAWA 2K7KA 3EPIA 2F4FA 1QSMA 4A32A 2Z3KA 2OUGA 1RT5B 1B64A 1VJWA 5ETMA 3AD9C 5HVHA 2XC9A 3RTVA 4F0MA 5KFJA 3TCVA 2CQ0A 5A27A 3KLEB 1RT6B 1W2IA 4C0OC 4ONWA 4FNHA 1CSJA 3BSCA 1VHOA 4YN3B 2FHOB 1OS5A 1OZPA 5EX3A 1KEKA 5BJRA 1JLGB 3FSIA 1TELA 4WZQA 1X4CA 2EK9A 1IKXB 3TARA 1RT2B 1GFWB 3MEDB 4HACA 2JL9A 4MYUA 2BE2A 2XS5A 4JD6A 2LDYA 4P52A 3TAMB 3R5JB 4NLOA 1IJFB 1IWGA 2ROGA 4OZJA 4NA3A 4DR7F 2KHDA 1FXLA 4RO0A 4JP8A 2VIHA 1F5AA 2BOPA 1SKSA 2HHSA 2PMWA 2JH3A 3FFIA 4PG6A 2AV5A 1H0HB 3K5NA 3KJVA 3OLAA 3W2VB 1FD8A 2O28A 2GGPA 1K0VA 2OB0A 2W8KA 2FZKB 1U0SA 1CJVA 2VKZG 4OHYA 2F9JA 2KL8A 2L48A 4C3KA 1NK8A 3CD7A 1ELLP 4NXNJ 1FRHA 3KHXA 4GM5A 1WC3A 1EHWA 2MZRA 4MK7A 3R5GA 2GA7A 2CNOB 3K58A 4ID8A 5A8RB 1S6QA 1PYSB 4DR4J 5E7OB 4CWBA 4E8OA 4NA1A 1IKYA 3QLHA 3HLUA 1T02A 3B3TA 2I0XA 2EWHA 2XYPB 3HVTB