2VL1A

Crystal structure of beta-alanine synthase from saccharomyces kluyveri in complex with a gly-gly peptide
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
433
structure length
433
Chain Sequence
PLSIASGRLNQTILETGSQFGGVARWGQESHEFGMRRLAGTALDGAMRDWFTNECESLGCKVKVDKIGNMFAVYPGKNGGKPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNYVPNYDVCVVVWFNEEGARFARSCTGSSVWSHDLSLEEAYGLMSVGEDKPESVYDSLKNIGYIGDTPASYKENEIDAHFELHIEQGPILEDENKAIGIVTGVQAYNWQKVTVHGVGAHAGTTPWRLRKDALLMSSKMIVAASEIAQRHNGLFTCGIIDAKPYSVNIIPGEVSFTLDFRHPSDDVLATMLKEAAAEFDRLIKINDGGALSYESETLQVSPAVNFHEVCIECVSRSAFAQFKKDQVRQIWSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPEEIENGFKVLLQAIINYDNYRVIRGHQFPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Recruited Protease is Involved in Catabolism of Pyrimidines.
pubmed doi rcsb
source organism Saccharomyces kluyveri
molecule tags Hydrolase
molecule keywords BETA-ALANINE SYNTHASE
total genus 162
structure length 433
sequence length 433
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.6: Beta-ureidopropionase.
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vl1A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2vl1A01
4A94A 3WC7A 2HC9A 3H8EA 1XJOA 1IGBA 2PIYA 3V7ZA 5D29A 2I3CA 2AFMA 1EE3P 2OR4A 1CPSA 1TKFA 2ZEOA 4ZYQA 1HDQA 4OC3A 4MMOA 1VGYA 4P4EA 1AMPA 1TKHA 1OBRA 4OC0A 1VHOA 2QJ8A 3SI2A 4OC5A 2XEIA 3B3SA 4TWEA 3FH4A 4MXUA 4EFDA 2NSMA 1ARLA 2PJAA 4PXCA 4WJBA 1QMUA 1LAMA 4FBEA 1Q7LA 1YLOA 2POKA 3PBEA 2EK8A 1R43A 2PJ9A 3PFEA 4G1PA 1JQGA 5HVGA 2VL1A 2PJCA 1CX8A 3V38A 1TXRA 4OC1A 3BHXA 1LANA 4R7MA 2PE3A 3H8GA 2ZEMA 1QQ9A 2CF4A 1ZG8A 4MCSA 1ZG7A 1FNOA 5LRJA 3KHXA 5LRGA 4UEZA 4FUUA 1H8LA 3IWWA 2BCOA 2NYQA 1BPMA 2EWBA 2PJ3A 2CTBA 4A39A 5HVFA 3B3CA 4IHMA 4P4DA 1ELLP 1KWMA 3L2NA 3K9TA 2O53A 1UWYA 4MCRA 5K8NA 3KHZA 3VARA 2V8VA 1XMBA 3B35A 3MN8A 2AFXA 2PJBA 3CDXA 3D7GA 1TF8A 1M4LA 3WABA 4MHNA 1YW6A 1Y0RA 4EWTA 1LCPA 3FEDA 3D68A 3SJGA 2ZOGA 1ZLHA 3IO1A 4ZY1A 2C6GA 3HLPA 4GM5A 3GLJA 2JBJA 3IC1A 3NH5A 3IIBA 4P4JA 2PVVA 3KI9A 5LYDA 1Z8LA 3CPAA 2Q51A 3I1UA 5HXDA 3KASA 5DS0A 4Z65A 4OC2A 2V8DA 4NGMA 3PB7X 1F2OA 4F9VA 1BPNA 4ZY0A 1YMEA 2PIZA 1XRYA 2C1CA 1CP7A 4BD9A 3CPXA 4H2KA 2CTCA 3GUXA 3B2YA 3RAMA 1PCAA 4ZX9A 4OIDA 2IMOA 2GREA 3PEIA 3TC8A 3WC5A 2G9DA 2PJ8A 3VH9A 3FF3A 3FVLA 1FT7A 3SJXA 2PJ2A 3H8FA 2IQ6A 3FEEA 2ZEGA 4F9UA 2ZEEA 3SI1A 5IB9A 2JEWA 2V8GA 3PFOA 1Z2LA 4RUHA 3MRUA 1Y7EA 3B3VA 2ZEDA 4OP4A 1F2PA 3KR4A 5LYLA 4TNUA 4A38A 3D7DA 4NGPA 5K8OA 4R76A 2ZENA 4NGTA 3BI1A 3K2KA 3GB0A 3WC6A 1HEEA 7CPAA 4PPZA 1YW4A 3D7HA 3S9LA 2AFUA 2Q43A 3QNVA 4DYOA 2PJ5A 1LOKA 2PRQA 3FJUA 3D7FA 3IEHA 5THWA 1Z5RA 3DGVA 1ARMA 4NGRA 2Q4ZA 1RTQA 2RB7A 3KQXA 3PB8X 4NJQA 2OOTA 4UEFA 3KQZA 5JM6A 2PVWA 4X3RA 5CBMA 1LAPA 1F57A 4UIBA 3LMSA 2GU2A 4MCPA 8CPAA 1DTDA 1LFWA 4KSIA 4NGQA 5J1QA 3N5FA 4MHYA 4P10A 3PB9X 3D4UA 2V77A 2J9AA 2IJZA 3PB6X 4B6ZA 3RZAA 2JBKA 2ZEFA 2BO9A 2PCUA 3FECA 3KGQA 4IAVA 3SJEA 5HVHA 1HDUA 1TKJA 3NH4A 3S9NA 3NA6A 4PQAA 3CT9A 2AFOA 4P4IA 4YWYA 4OC4A 4ONWA 4Q7AA 5JGFA 3IFEA 1CG2A 2V8HA 4O23A 4PXEA 2ABZA 3HUVA 5K8MA 2C6PA 2O4HA 2PJ7A 3WT4A 1NSAA 4CPAA 2ANPA 2PJ0A 4UF4A 4EMEA 3ISZA 2HB6A 3BXMA 1R3NA 2AFZA 3ISXA 3SJFA 4P6YA 2XEJA 4P45A 3KL9A 2AFWA 2XEGA 4R8FA 1CPXA 1XFOA 5D8NA 3JRUA 3D66A 4X8IA 4AXVA 4MCQA 3T8WA 2ZEPA 4UIAA 3PRTA 4F8ZA 1DE4C 2ZEHA 2BOAA 5LYFA 3IJ3A 2F7VA 1ZLIA 2FVGA 2GLFA 3B3WA 4IK2A 4MHZA 3B7IA 4NGNA 1ZG9A 4UEEA 5K8PA 4ZY2A 2PJ1A 2ZOFA 4ZX8A 2EK9A 2ZELA 4FWUA 4P4FA 4LQGA 2XEFA 1TF9A 4FAIA 3FMCA 4NFRA 4OIWA 4PXDA 3NFZA 3PBBA 1IY7A 5LRKA 4NJRA 3TX8A 1CP6A 2WYRA 2DEAA 4W9YA 4OMEA 3PB4X 3KZWA 4A37A 1AYEA 4MHPA 2QYVA 3NH8A 4JZ0A 3D67A 4P4BA 5ELYA 2PJ6A 1BLLE 3FX6A 5F09A 3LWUA 1XBUA 4ZI6A 5I4MA 2CIJA 3VATA 1VIXA 2WZNA 1VHEA 4JYWA 3KR5A 1GYTA 4P44A 3DLJA 3B3TA 3SI0A 5CPAA 1PYTB 4WWVA 1CBXA 5LYIA 2QVPA 4NGSA 1YSJA 4K3NA 6CPAA 2PJ4A 4MRIA 2F8HA 4DUKA 4R6TA 1Y0YA 2RFHA 3RBUA 2C6CA 4X2TA 4PXBA 3BI0A 5JH9A 4OKOA 1BAVA 4YU9A 1ELMP 2GLJA 4DJLA 2AFSA 3S9MA
chains in the Genus database with same CATH superfamily
3CIMA 4ENOA 4AL6A 4N8NA 3GQCA 3CC7S 2E5LJ 2E1PA 4BMHA 1X4GA 4GMKA 3PW0A 4OZLA 1MLAA 1XNQF 4GKKF 2YQ3A 3KUHA 3KLGB 5HO4A 2COLA 2DHSA 3HVRA 3BQ2A 1UW9A 5CQGA 1R8AA 2HWTA 4USIA 1SJ3P 3T19A 3ZXWA 3B3SA 4U6PA 2RJZA 1WORA 1NDPA 1ZM2A 1P6TA 2BE7D 2XSJA 1EB0A 2LEBA 2E1AA 3EVMA 1RYSA 4FBEA 3H7HB 1J5OA 4ZPTR 4RZRA 3G6ES 3TI0A 2PJ9A 4LBHA 2C2RA 1YBUA 2GV1A 3UNYA 1EQMA 4ZIVA 4OC1A 3QJLA 4LSLA 4M95A 2YH0A 4M8LA 1N48A 3UR0A 3D0IE 1S97A 2KT2A 2VQEF 4FKYA 5KTAA 4UUWA 2EK1A 4LF9F 1UZDA 2OD6A 4KZTA 1UWYA 4QU6A 2YY3A 2AF6A 4V1Ak 4A95A 3OXLA 1Q86T 2RT3A 1M4LA 2ZBRA 3FEDA 1YITS 4LF4F 5IT9U 3OR2A 4FYYB 5HH1A 3OJUA 3JSMB 1LXJA 4BBHA 2RU9A 4WTYA 1ZLHA 1S1VB 4L74A 1IN0A 1Q5YA 3GLJA 4MFKA 3UD3P 4M5DA 2EXUA 2QTWA 3G86A 3NGRA 1S7IA 3CCJS 1FRKA 4JI0J 3RRGA 1TUVA 4X4UA 4KKOB 1XQIA 2F4VJ 5KOWA 3PW4A 2OTLS 2NXNA 4PWWA 4C98A 2FVPA 3RW7A 1BQMA 3PJWA 2HBQB 3MFHA 5EMIA 2ZZMA 1N52B 4KH1B 3SQGB 1RP5A 3B78A 2P5VA 4KIAA 3HO1A 3PZJA 2IMOA 1S6UA 1ZTTA 3AXKA 1B0VA 5A8KB 5HQLA 1C0TB 3QWPA 2LXIA 4NLYA 5D4NA 3PW5A 1T95A 1W2IA 2G0IA 2CRLA 4BWMA 1MK4A 2D4OA 4DFKA 4EBDA 2WVBA 3LANA 3H25A 4MYUA 3UNGC 2WBMA 2MZJA 3KJNB 1KBRA 5CCLA 3TZYA 2VFSA 2F4FA 4D3HA 4USMA 1SC1B 5C88A 2QSFA 1YW4A 2O66A 4ZKAA 4M1KA 1S3ZA 2VC1A 1E6YB 4M6HA 4I56A 4PWUA 1RHUB 4BC9A 1U2CA 4WZQA 2IL4A 2L41A 5ETQA 3OD2A 1HBMA 2O3DA 3G96A 1SPBP 3MR6A 4LF9J 5A8KA 2ZBPA 1ZM3A 1S4EA 3PO4A 2HIQA 2CJKA 2HFZA 4LBIA 4MCPA 2RQCA 4OZ5A 2JC1A 3KLEA 4AVAA 2X7IA 4RWWA 4CNZA 2UUBF 5EWFA 1OYEA 1WG4A 4URGA 1Z8TA 2KB2A 2Q7SA 3MECA 3PB6X 3KHLA 4B6ZA 8RUCA 3CO0P 3D5MA 1RT5B 1RT3B 3R9FA 2HPUA 4ZOSA 5DQIA 4YN3B 2ZBCA 5A8RA 3W65A 3SDEB 3R9LA 1FKOA 2R7SA 1CS4A 2FT0A 2Q6CA 4C4WA 2C3OA 4M5MA 4TKTA 2ACMA 3J81j 4HACA 1RWXB 2DNGA 2DB1A 5IWAJ 1Y10A 1YBTA 3DI6A 3WT4A 4MKBA 2KFNA 2ZOMA 5CD4H 2BACA 2R8HA 2P9EA 3KUEA 2C2EA 4E98A 1SB6A 1TL4A 1VDHA 3ISXA 3SJFA 4RW6B 2VDIA 4ER8A 4XDCA 3EXCX 1HQEA 3D66A 1XN9A 2AKWB 1TKZB 4NCGA 2ZEPA 4KOXA 2QLWA 4K5SA 2BOAA 2OKQA 1CJKA 2GLFA 3QSIA 3R95A 4ZY2A 3SBMA 2XBPA 1NUEA 3GKRA 2ZW6A 2ZOFA 4ZX8A 1WC5A 3MMJA 3MEEB 4X84A 4QJVA 1UL3A 1TL1A 4K59A 3VHQA 4U7UK 1OS5A 4ICLB 3LQVA 3EDRB 2DEAA 1NKEA 2ROPA 5JJBA 4MHPA 3D67A 2BKOA 4DWIA 4MT1A 3FMBA 4B9VA 1BLLE 5KFFA 1ULRA 2B4DA 3LWUA 3AAWB 3F0AA 2UXDF 4ILMA 2IA0A 4GKKJ 1U25A 3SI0A 2XMTA 4JJXA 2BMBA 5F9LA 2GX8A 1AROP 3UN5A 1MJAA 2F8HA 2YXLA 4JV2A 1VS3A 3RBUA 2HK3A 1OSDA 4C7QA 2IMWP 5JH9A 1F9HA 3HZGA 2XMAA 3BS9A 1BAVA 1HNWJ 1I21A 2XO7A 4DLGA 3H8EA 3MM6B 2HVZA 1XJOA 4MFQA 2XSFA 1CBKA 5KFXA 1BE4A 2XY7A 3QQCD 4O4GB 3OBIA 2B8QA 4ZP6A 3I6PA 2VFUA 4DDFA 1LOUA 4DF4A 2XC9A 1FD8A 1N32F 3FNCA 3ENQA 2FLNA 2R3VA 3KG0A 5KG1A 2BANB 1X4BA 3NAHA 1S0NA 1F2HA 1HNZJ 1X4CA 1YKWA 1FA0A 4G1QA 1HI1A 2Y8WA 3H0PA 1CJUA 1RTJB 4UUXA 3PBEA 3E01A 2EG1A 2Z0ZA 1B0PA 3AD9C 3C15A 1YJWS 3PFEA 1B70B 1AXQA 2M52A 4LVNP 3CEDA 1CX8A 1NDKA 3FEXB 2HBZB 1FDBA 1FNXH 2FJBB 4DEZA 1DJ0A 1FNOA 4A4JA 2W7AA 4X4RA 2KT5A 5LRGA 4QR1A 4UZBA 2BCOA 3FCVA 4OYAA 3UCZP 4IF5A 2Z58B 3M8PA 3R7BB 1ELLP 1BGXT 1U0HB 1YX2A 3T5LA 4RNHA 1FJ7A 3MN8A 5KTQA 2ATRA 4GS4A 3MM8B 1FJGF 3WABA 1FWPA 2F5GA 1LCPA 5B08A 3Q24A 4K5RA 3SMZA 3S8SA 4OL8A 2ZOGA 5CYQB 4IQXA 4GM5A 3TJAA 4URSA 5AG5A 1YTYA 2M9KA 3IC1A 3MD3A 1JXLA 1U47A 3IGNA 2C3PA 1Z8LA 4YFJA 5D77A 3I1UA 5JVHQ 3I31A 2KHDA 1S9EB 3F44A 1M5PC 1RT2A 3PR4A 1DHMA 3JVNA 1ICEB 5D0EA 3PVXA 3H42A 4H4MA 3IG1B 1VQ4S 4I4BA 4CP5A 5KFBA 4ZVPB 2HQYA 3JB9k 1RYRA 1F5BA 2UVRA 4ZPAA 3G8SA 4RW6A 1PCAA 2PEBA 5F3TA 2UUWA 1K1QA 2G9DA 3AQOA 1NK7A 4ZN1A 4KAIA 5KFEA 2ODFA 2ASYA 5GADU 4DN0A 2ZEEA 4CYPA 1KEKA 4CAWA 4I6YA 3B3VA 4WP8A 1NPPA 2YWKA 4Y00A 1WC6A 2LU1A 2C3YA 3H90A 1B6BA 1QTNB 4EEYA 4DV7F 2CQ4A 4Q45A 2OPQB 3GILA 3MAQA 2IVYA 2XS7A 5B0CA 1DQAA 3FJUA 2FD2A 5THWA 2HFUA 2BEIA 1KDNA 2JL9A 4YOEA 2I5JB 4EBEA 2OOTA 3TX0A 3IGRA 2PVWA 4K4YA 5EN1A 1F9EB 4F0YA 4A8KA 2W7PA 1F57A 2KG1A 8CPAA 3TANA 1TFYA 3D54A 3BBCA 1NE9A 2HFOA 4Q2LA 5D8HB 3IM8A 1RO5A 2K5TA 4DPWA 2CJQA 4ZVTB 1JMTA 4LRCA 4KO0A 5IC6B 4MIAA 2KM8B 2QV6A 3MUVP 1WF1A 4OI3A 3NH4A 3DFEA 3NEKA 4A47A 2BV3A 2RIJA 3IRXA 4DNCA 3FQLA 1FK9A 2RAQA 4ONWA 2XWXA 5HN0A 4IG3B 2OELA 4OJGA 4PXEA 2W9AA 4DL5A 3GY9A 3HUVA 2DR7A 2BL1A 3QO9B 2LA4A 4B3SF 1VC5A 4FYXB 3VAMA 1F9FA 2AWZA 1TKZA 4J9KA 2Z0GA 2VICA 2OPQA 2XEJA 3CIZA 1X4AA 2VB6A 2ZH7A 2GHPA 4R8FA 3QIPA 1YJNS 1SUQA 4GVBA 4M5JA 2XWYA 3CB4A 4HTJA 5GAHU 2CJYB 5HP1B 4WKRA 3TOAA 2OEMA 4MCQA 1JK9B 3M2VA 2BUEA 2W9CA 4MIWA 5I3UB 3IJ3A 1BY9A 4WP3A 4AG9A 3DI6B 1RKJA 3J7ZT 3OJSA 2VG5B 1Q1KA 4O4RA 4GVLA 2EK9A 3H8YA 3NCPA 1L3UA 3KLFA 4WF9Q 4O4GA 4B3OB 1NH8A 1NB2A 1TK0A 3CJ5A 4FDFA 3LOUA 1M1DA 5A8WB 3MMCB 4DV4J 3J7Z5 2IA6A 1RT5A 2B4OA 2VONA 3I32A 3JXOA 4ED0A 1VJWA 2B3TB 2RS2A 4JZ0A 3BZQA 3RBDA 4FZVA 3KLEB 4I64A 3DHWC 2XLKA 2AV5A 2C42A 4KJIA 2XGPA 4KVXA 1XBUA 5I4MA 3BGOP 2B3VA 4OX6A 4DR3J 4IYQA 1XMQF 4OI4A 5L1KA 4O3QA 1UP1A 1IBMJ 2DRDA 4P44A 1WOSA 3B3TA 4DS5A 4JI4J 2J0XA 4K0KJ 2QVPA 2CNMA 3V6DA 1S76D 2VQYA 2ALZA 4IUSA 4OZ0A 4W4MA 3UD4P 2PIIA 4GKJJ 1TVRA 3CXPA 3HSJA 1IBMF 4X2TA 1TL7A 3BI0A 3K59A 1I6JA 3NGSA 2FLLA 1NNDA 5ETNA 2GLJA 2P6EA 2AP6A 3W9HA 3S9MA 3I0RA 2DNPA 4KVME 1OMSA 1IYKA 2YQ0A 5CA5A 5HMWA 2Y8YA 2VZYA 1DBDA 1FVQA 3TO6A 3WIUA 4AT1B 3CCQS 1NO8A 1XIXA 2GS8A 4UA3A 3OL9A 2QJ8A 4P7VA 2ZE2B 2DGVA 3UDVA 4ZHRB 2LQJA 4Z2XA 4EZ9A 3LP1B 3CCMS 4HEA9 3WC0A 4LQ3A 1HWIA 2W2NP 2YKPA 3MI7X 5KFJA 3VGVA 1ZH5A 1G2EA 2EK8A 3CXQA 2VFRA 5F8GA 2WZ1A 5MAOA 4Y2KA 3DDNA 3M6UA 2M8DB 3LAMA 1TK8A 2VD3A 1XMOF 3KLHA 3X1LB 3TEGA 4AXIA 4HT5A 4A8YA 4X65F 3PW2A 5J1NA 1FO1A 2XZWA 4USTA 3IR5B 3ZNJ1 4PAAA 4MTPA 2JEVA 4UEZA 2VUGA 1M1HA 3VVUA 3GJRB 5B0DA 1U02A 3OVSA 4JXQA 4JI8F 3SCLE 4LIRA 4UCNA 1K47A 2AFXA 2JLEA 3FFIA 2EEYA 2FGCA 2YNHA 1ZPVA 2EFOA 4NRUA 1S9FA 1KTVA 1T03A 2CQ0A 2MJNA 4LSNA 3TWZA 1CVJA 5KFLA 1REVB 3AH6A 3W6SA 4CLZA 1SCJB 5KFCA 1RAEB 4ED4A 2ZZNA 4XO0A 3QT5A 4DSLA 2BVZA 1IKYB 1Y5IB 2Y1LB 3DOLB 4K8RA 1SKSA 4UOCA 1F6TA 4ATNA 4RUCA 1SL0A 1RTIB 2OP5A 4C2YA 4AQYJ 4Q8EA 4C9DA 2UV8A 5LJ5Y 3CUNA 4NEZA 4JV1A 2GW8A 3SSRA 4RW4B 3KK1A 1N34J 1WF0A 2F40A 4DL7A 1SV5A 2ABYA 2Q04A 2IQ6A 3FEEA 1QVGR 3DOMB 2GJIA 2MGZA 2EO8A 1N34F 1F2PA 3KR4A 2JJ4D 1NKBA 2EWHA 2G1HA 3NWGA 3EXYA 1JX4A 1G3OA 1IVZA 2BW7A 4RBTA 1P9YA 2NQPA 1ITPA 3SQGA 3DRRB 1YJUA 3S9LA 1UJ6A 2W2QP 4DYOA 3RO0A 1WJ9A 1XTZA 3VWEA 2KZMA 3EVWA 3QAEA 3UW1A 1CM0A 1EP4B 5JM6A 2FY1A 2KYXA 3MR7A 5IB0A 4DR1J 1AFJA 5HBMA 1LAPA 3ILJA 3P8BB 4J9SA 1LFWA 2VA2A 2RVJA 1FF2A 4P10A 2V67A 1GMWD 3D4UA 3Q86A 1RWKB 1KS2A 5DWNA 5A2QY 1D8YA 3PG9A 1GXLA 1S0MA 4PYDA 4C0BA 2WBRA 3W8PA 1FDNA 4EO8A 1VQKS 1RQ0A 2L48A 2O01C 4RBVA 1SIZA 3OQ2A 4Q7AA 1P4NA 3UPFA 2X1GA 4DL2A 1CG2A 4UFXA 4DG1A 4A8OA 4QR0A 2DRAA 1RGVA 5AG6A 4FD4A 1WELA 5L1LA 1L3KA 4B9MA 3CJ2A 4F0MA 2PI5A 3PHEA 1X0FA 3NG8A 4QWEA 4ED1A 4ID8A 4Y2AA 4C8KA 2OMLA 1TV6A 4KO0B 2VFTA 1ACMB 2GNKA 1C0UB 4DMZA 5ETSA 2Q0YA 3RR8A 1PILA 2LQ5A 2HNZB 1JXEA 4AL7A 4RUAA 3UO0A 3CJQA 2LEAA 2GMHA 1IYLA 1ZPWX 4B12A 3W2VA 2DIVA 4OZJA 3I56S 4G6VB 3VAJA 4MBUA 5IFMA 1YVFA 3V4MA 3TX8A 2R42A 5DETA 3D3SA 2EFGA 2E7VA 3D1OA 3CCES 4LF5F 2UU9J 3AT1B 2DO4A 1IU8A 3MM7B 2JH3A 2G3TA 3B82A 4DV6F 3VATA 2E29A 1GMWA 4LRFA 2UUTA 2ZM6F 4R87A 1SKWA 4WWVA 3GV7B 2ZXVA 2QO3A 2DGXA 2LXUA 5HMYA 1M1KT 2B58A 4OHYA 3FRMA 1DY3A 4KFBB 1W7WA 5DGBA 3KNAA 2ZVSA 2RKIB 2V4QA 3GYAA 3SZ2A 5E3RA 2DCUB 3S7RA 1TUWA 1HBUB 2WAQD 3W5XA 2J9DE 4ZPDA 1RT2B 2VF3A 4LF8J 1UMJA 2QSWA 2WB4A 3D2PA 1Y3KA 2Z3NA 4OC3A 3R3TA 5BXIA 2V34A 2R2RA 3CJ0A 1HQUB 2HVIA 1YR0A 4J9NA 3BKTA 1KTQA 2ZH6A 3M8ZA 2G1DA 3BO2A 1I12A 3BSAA 5AE1A 1MJ9A 4Y2IA 3NGTA 5DG8A 3AHPA 4H6ZA 3CW2C 3FBBA 3CD5A 5KFSA 4Y3CA 4QW9A 5KFNA 1P8GA 1GXUA 4IOCQ 3DDIA 3V38A 3QAHA 3JQKA 3J80U 5AJ3F 1H3DA 2G9OA 4OI0A 1JLAB 4A30A 1B3TA 3HJVA 2ZDPA 2WPWA 4JI5J 3RAQA 1LW2B 5E2QA 2DITA 2DRBA 2FHJA 3L2NA 4C2ZA 3EGZA 4ES2A 1XK8A 2BRKA 3RAXA 1QM9A 2RU3A 5L1JA 2FVQA 3K17A 8ATCB 2ZBQA 1IKYA 3DOLA 5ETPA 4CYQA 1R89A 3MWBA 1AA1B 2CQPA 4ECXA 3FUYA 1CJUB 1Y5LB 4MFJA 2G4BA 1N71A 3M7VA 3KK2A 5KG4A 2DHGA 2IAJB 1RWPB 2YNIA 3GCXP 4O3NA 1S0OA 4FYWB 1X4DA 3DMJA 2QL7B 2VJUA 2GMLA 3Q8VA 2XZTB 4L75A 1LWXA 3M2RA 3JAMU 2B5GA 1MNEA 4CAFA 2R8JA 4IH7A 3CJRA 1WHYA 2X51A 4ZY0A 4FKXA 1XF8A 1JLCA 4XNHB 4BD9A 5L39A 3THPA 1U2RA 2QRRA 2JZ5A 2VBXA 3G71S 1AUSL 2DHXA 3ILOA 1GEHA 1SKRA 4I67A 4GKJF 2E9TA 4CLWA 2FHMA 3SI1A 3F73A 1JKHA 4N47A 3CMQA 1K9MT 2R7TA 1QE1A 1TFWA 2ZD1B 4KSFA 4FNHA 4DX6A 1T05A 1FWKA 4IKAA 3DM2B 4PABA 2W9BB 3GB0A 2HS0A 5B0GA 5HROB 2CIMA 1N5YB 3OL6A 1Z9UA 3L7PA 3MEKA 2GJ2A 2H54B 2NCKL 1TU0B 5D0HA 5DO2A 3MURP 3OR1B 5KG6A 1M4DA 3GIUA 4PPDA 1QD1A 3GSIA 4N8OA 2WPXA 1HLWA 2VI7A 4WXWA 2XULA 5D3GA 1QSTA 4PZVA 5L9XA 3B6BA 1J5EF 3R2CJ 3MEGB 1NB7A 1U1OA 5DDRC 4TU9A 1NU4A 1Y0HA 1BOBA 3QFHA 4QVTA 2PQ8A 1CJKB 4GO7X 7FDRA 3DU6A 4EO6A 1HWJA 2YPYA 2CQ3A 5AXKA 2B43A 2MKCA 2HHXA 1X7VA 3HSZA 1OY9A 3NNAA 4ZPWR 2JSXA 1KQFB 4QB9A 1W26A 5B0BA 4DV1J 2EKYA 1HR0F 1T0TV 1UPMB 4OC4A 3P3DA 2OJ3A 4DQPA 2M0GB 2FJXA 3BPSP 1VK8A 1CC7A 2CNTA 2MQMA 1QVFR 2RF2A 2CNNB 3M2UB 2N7CA 3DGPA 2FHKA 2DO0A 1RAHB 1DAXA 2F9DA 4NI2B 5FIIA 1PBAA 5D4OA 3ITHA 1X9WA 1PYSB 2AFWA 2ZC4A 4I7FA 5L8RC 4AYBD 1T9YA 3TTHA 1Y00A 4KPYA 5FLXU 4HKQA 1S9GB 3B3WA 4ZHRA 3UFCX 4DHVA 3ZO7A 1QAJA 5KT5A 5K8PA 5LXRA 5BYRA 1TQLA 4C3MA 2ZELA 3LW5C 1IM4A 1HBMB 4NLSA 4C8OA 4JLYA 1OSCA 2KXHA 2DH8A 3FEYB 4Q0BB 5AE3A 3I5BA 5F8JA 3VQSA 2WYRA 4H4OA 4P72A 3IBWA 3V4IB 4UBRA 1QUPA 5D4PA 5F9NA 3QYYA 3T3FA 4DV7J 2LP4A 2GQCA 1BQNA 1LK7A 3DR8A 1TVRB 3PGPA 1U1QA 1WEZA 3IU2A 2ZJRQ 2WONB 3ZFVA 5GAEI 4ED3A 3VWDA 4ZA1A 3MCMA 1Q82T 3CNQP 4F26A 1S1TA 1IBLJ 2IBKA 3HSDA 1NJYA 6CPAA 4NLGA 1YZ7A 4CLSA 1Q0NA 1HYSB 2AYMA 3PKYA 4K4SA 2HUZA 1P1LA 3AB4B 4CO2A 4E2AA 3DOKB 4XPKA 4XAKA 1HHTP 2GHWA 4ZP8A 5C25A 1U1KA 2EUIA 2CPYA 4L6V3 3TT2A 2QLBB 3DC2A 3PX4A 5L38A 1TKFA 2ZEOA 1HPZB 2HNYB 3T5KA 2BSWA 4OFZA 4P4EA 3I0SA 4O3RA 4QBUA 1SH2A 5DM7Q 3OSPA 1TUGB 1Z4RA 1KP6A 2KM8C 3OXFA 1N5SA 5IT9Y 3MMBA 1F2GA 3Q2SC 1K8AT 1N5QA 3NBPB 4X4VA 3HULA 1Q7LA 1H73A 1R43A 1TL3B 3P2FA 4YY3J 4MKVA 1X9MA 1XERA 2EPIA 2JFDA 2PR8A 2MKKA 2OSQA 3RGIA 3NGKA 2V4RA 1S1XA 4NLTA 5HVFA 4MY0A 4ZP9A 2R7WA 3K9TA 3HX9A 1YZ6A 3OFHA 2O53A 4PRFA 2D4PA 3DRRA 1Q4RA 3V81B 1KQGB 4ZMMA 4K4UA 4B5OA 1FERA 1FWLA 5K20B 3IBFB 4LF2A 2BQRA 2QMXA 1WG5A 1FX2A 3MM9B 1JJCB 3HXMA 5HLFA 2F3JA 2M3DA 2RMLA 1MG7A 2Y1IA 1AUGA 3G6YA 4FF3A 1HQ2A 5KFPA 1HD0A 4DLEA 2BABA 2ARHA 2R1IA 1N88A 1TKTA 4CWBA 1HI8A 3R27A 4WWSA 4NZ0A 5F49A 2W4DA 2DPSA 4KH0B 3RYLA 1RAIB 4M5GA 3PB7X 4RJVA 1IQZA 4A46A 2XGQA 4KGXB 1Y9OA 3IU1A 4H2KA 2R7QA 3M6XA 3VWSA 1FY7A 2DPTA 5GAGI 1TR0A 2H51B 1MW7A 1JLCB 2PJ8A 1GAOA 3FVLA 3QLHA 1R8CA 3D3BJ 2AX0A 2IRYA 4NCZA 3HLUA 2ZEGA 2E1MC 4K2JA 5BJRA 1G4CA 2EI5A 2OAUA 5T14A 1PBUA 1RLDA 1U8WA 5F8HA 2R2TA 2YGWA 3NAIA 2I0XA 4FBUA 4RWXA 1JJ4A 2BJDA 3JSYA 5JQ4A 4ZDNA 5F3ZA 3WC6A 4C2MA 4ORFA 1N33J 5CZVA 2Q43A 2ZNZA 2DJWA 4FPIA 3D7SB 1VHFA 2FVRA 4EYHB 3T1YF 3SV3A 3PB8X 2AMCB 2Z3OA 2CADA 2DXEA 3CULA 1KLMB 4X65J 4P71A 5CYQA 2CPZA 4XTTA 2FCKA 1TAQA 3RRHA 2VBWA 4AE5A 5E96A 3MM5B 2V4JA 3CWJA 4NCAA 3I0RB 1VOMA 5B7WA 2BJEA 2JBKA 2X7BA 1ZBTA 1FKAF 4Y6IA 2G2ZA 2CKWA 4B9SA 3ULHA 1N54B 4F0XA 1FK9B 4I1TA 3W2VB 3LP0B 3CD0A 1R57A 4OZ1A 3RRKA 2B4DB 4ZLPA 1X5OA 4H6UA 4NSQA 2FS5A 3D4JA 2HBRB 2DTJA 1HNIA 2PJ7A 2MQQA 1JLGB 2OH1A 4OI6A 1VC0A 2BE2B 4NX9A 4CM2A 3RW6A 2CAJA 1KOHA 5SUHA 3G8TA 4X66J 5AXLA 4WFNQ 5E33A 2LVWA 1V3ZA 2RUSA 3ISND 1H7WA 2JLFA 3QZ8A 3NRBA 2A18A 2CXAA 1LK5A 1Q78A 1T9WA 5G20A 4F8ZA 1DE4C 2ZKTA 3JQMA 5JUMA 2CFXA 1U6FA 2IHR1 2J6UA 4MHZA 2HQCA 2Y1RI 3FIXA 3IS9B 3MDFA 4RW8B 1X4EA 2IRXA 3QMQA 1HQEB 4KBIA 2XEXA 4LT6A 3GG1A 4EGLA 1C4AA 4IRDA 3NFZA 1DRZA 4KPCA 1YLEA 3M8QA 1WDTA 1IWAA 2ROEA 3GYXB 3KZWA 3AFGA 4YFUA 4TXSA 1QAYA 4MFLA 1VQOS 1I51B 3BGRA 2QEXS 2D9PA 1KVJA 1S57A 3EGNA 4NXNJ 4C8ZA 2H48B 3AA9A 4W92B 4OX9J 3DLJA 3GTYX 1WTFA 1SVDA 1FRXA 5A8RB 3EZ5A 2JDCA 1NSQA 3J7A1 1IR2A 1C1BB 2J9DA 1YDLA 2VZ9A 1NKCA 5IXUA 1LW0A 2GANA 4Q38A 4F3QA 1S1WB 2I38A 1ELMP 2BE2A 2A3JA 4TVAB 3CCLS 3HKZD 3K8WA 5AXNA 1IGBA 2H5IB 1CJTB 4UW2A 1H0HB 3HKWA 1R0AA 3QO9A 1S72S 2DNOA 3LP0A 3GSDA 4DR7F 3H59A 3BGFA 3P96A 3C46A 3U1MA 2FZCB 1VHOA 1R27B 5IT0A 3TARA 2QGFB 4EYIB 4Z37A 2XMJA 1ELOA 1WKLA 3HFZB 4JI6J 1ARLA 5K5MA 4KHPF 4BS2A 2I00A 2MSSA 3VVTA 1UPPA 2Y0SD 2XI2A 4KV8B 4WFBQ 3TUIC 1RWUA 5E41A 2MKHA 2Z2YB 2IRUA 4LF7F 1TXRA 2YKNB 3B4DA 3O2IA 5H9EK 4MCSA 3I9V9 3E3XA 5LSOA 1MWZA 1MU2A 2APOA 3UD5A 2FLOA 4HACB 3KTQA 1WEYA 2EWBA 2CYYA 3UCGA 1BQMB 4HYKA 2BJ7A 3E51A 5DWMA 2ZH3A 2BW2A 2KKHA 3B35A 4YR3A 3LWMA 4ZS6A 2DHHA 2AGQA 3W2WB 4MHNA 1YW6A 1Y0RA 1NMEB 4NA3A 4V19J 3RJMB 1OIAA 2HFVA 2YNFB 5J2QA 3BV8A 1KRPA 2ZVIA 2VC0A 1FE0A 2NUHA 4P7TA 1S77D 1U1MA 2V2KA 2ZH9A 3KLHB 5DG7A 2PVVA 2BR0A 4ZPVR 4PV6A 5LYDA 5DDOC 1SL1A 3FCHA 3D1HA 2CJAA 2VG6A 2YVSA 4NGMA 4USUA 3UVJB 2PO4A 2VZZA 2ASDA 4DV0F 3QAUA 2BJ9A 1XRYA 2OIHA 4RR5A 2EFPA 1NRKA 2MZTA 2YWEA 1FI4A 2H5EA 3N0VA 1DZ5A 4CT8A 4OIDA 1SKUB 1PYTA 4C7IA 1WI6A 2OH2A 1N8RT 2YNCA 3U7JA 3FQKA 2E5LF 1KZFA 3KWMA 2C2DA 3CVKA 5ETKA 1ZM9A 1QDUB 2KCWA 4GO5X 2QFJA 3GYNA 3AOCA 1WG1A 1NK8A 2MKJA 3BJ8A 4WYLA 2OPRA 3OXGA 4LSNB 3OFGA 1Y7PA 4WXOA 4DFPA 1CPZA 1XE4A 2QC3A 2V9WA 2P0WA 1T3OA 4NGRA 4Y49C 5B0EA 4I6AA 3PX0A 5HANA 3CE8A 5DZ7A 1B87A 1SL2A 5IS2A 2F63A 2YNFA 2VJVA 2UU9F 3PDNA 3D6MB 4DUTA 1FXRA 1Q8KA 2IPOB 1AT1B 4HR2A 1GX6A 3KJFB 4NGQA 5E3AA 1KC8T 2GC8A 2VIHA 3O44A 4ZVQB 3PB9X 2YQ1A 3GCWP 3W2WA 2YKMA 4M6IA 3RZAA 3PIPQ 1H2VZ 3C16B 1X60A 4U96A 2PCUA 1S12A 3O6QA 1HW8A 5IV0A 1EETA 1JNZB 4IFVB 2QN6B 3CT9A 3BQ1A 2R7OA 2R8GA 3SXNA 4IH5A 4K4VA 2YNIB 1CS4B 4NXYA 1IIDA 3NCRA 1MN9A 5K8MA 2ZE2A 3EC4A 1HNXJ 2BX6A 2W9CB 3TVKA 4UF4A 1XBWA 2GZOA 4OHWA 1A2ZA 2AFZA 5J2MA 1Y11A 2HFNA 4GVBB 4DOZA 4LF6J 3MGJA 3UDLA 3AD7C 4KV8A 1PJ7A 2DNLA 2XEGA 4RW7A 2D9OA 4BDPA 4QU7A 2XSJB 2IBOA 3AJ1A 1CQNA 3E8OA 5F41A 1TTHB 4ITSA 2V94A 1S5ZA 1HNVA 4X64J 2R7VA 1WC4A 2IDLA 4ZP7A 1X9SA 2AZ1A 4LMZA 2XMUA 2CY2A 2BRLA 2DGTA 4PQUA 5LSLA 1F5AA 4FAIA 1QSNA 5F8LA 4OHXA 4UOFA 4KGMA 1CP6A 3W62A 4UY85 5HI7A 1UZHA 3SEOA 4OMFG 4YB5A 4ZVGA 3WZ0A 2PJ6A 3LPYA 1PJ6A 2KXNB 1S1XB 2M7SA 4Y49B 1YREA 4JYWA 2AJ6A 4A33A 4UY8T 3BYPA 4QZVB 1TAUA 3EWGA 4UQTA 4C3LA 1QSMA 2IVMA 2V2ZA 1YSJA 4CQ1A 2Z3MA 2VPZB 2W2PP 2Q4YA 3HF5A 1U1NA 2R98A 1VMBA 4JYAJ 3T1HJ 2BM1A 3CGIA 1M5SA 3R5JB 2BEFA 2K7KA 4BINA 4OYMA 2Y9HA 3T90A 4ECYA 1M4GA 3MM6A 3M8QB 4LR9A 3R8YA 4QPTA 2PGCA 2LU2A 3L7OA 1WWZA 1U6ZA 4C68A 3GG0A 2YNGA 1R7IA 1HDQA 5M2PA 1SC3B 1VGYA 1S99A 5A0YB 2MTLA 2QZ8A 3CZXA 2Q3PA 1OBRA 2OI2A 1K44A 1HPZA 2REEA 3U02A 3HFKA 3TQEA 2E1RA 1S10A 1RTDA 3P2HA 3T9YA 2NSMA 3BR9A 3CJSA 3DNCA 4YHHJ 3DOKA 1QMUA 1LAMA 2B4BA 3IR7B 4DUZJ 4NWBA 3DRPB 1JLFB 1X8DA 4I2PA 2HQFA 4ECZA 1VHIA 1YQEA 5HMXA 1TKTB 1URNA 3BEGB 5D0RA 2JC0A 2CF4A 3GMGA 3HVTB 3DU5A 3GV5B 1T9XA 4QIEA 3TEHB 1ZAVA 4WYWA 2JEIA 1S6OA 2OGUA 2CPEA 3IWWA 1QUVA 1EIYB 2D69A 1HBOB 2X3DA 3T5JA 1C0TA 1E6YA 5L9NA 1FTCA 4I68A 1FJCA 3IM9A 3VARA 1TIQA 5I42B 1GTHA 4WPAA 4Q43A 2PJBA 5LMNF 2ZD1A 1TMMA 3MM5A 1S7KA 2HYIB 5DDPC 2XLJA 2HAFA 4OI2A 5KG2A 4ZY1A 1LWCB 4PSXA 1TKXB 2A2CA 4KR0B 1DTTB 2R4FA 3NH5A 1EHWA 4LBPA 3PRVA 4A8WA 2WVDA 4WP9A 1DLOB 2BJ1A 1JNRB 4NXNF 4DPXA 2MY8A 4ECVA 4RLEA 2EVZA 1CP7A 1OJ4A 3VV2B 2LECA 4WE1A 3SV4A 4NI2A 3Q8PB 3CCRS 3FB3A 3N4WA 4USVA 4O44A 2YKQA 3DRYA 3P45B 5AGEA 1QJHA 3CDBA 4L8AA 2ZJPQ 2CZVC 2P9CA 2PJ2A 2KHCA 2ZHOA 4B10A 2MKYA 5IB9A 3DXBA 2JEWA 2GVZB 1Y7EA 4CYNA 2A2DA 1TL5A 4DSFA 4OJHA 2ZENA 4CRJA 4ED6A 4DR5J 4F4KA 4J9MA 4NGTA 1M5OC 1ZZFA 1RHQB 2ZH8A 1GQEA 3DLBA 3HPOA 3D7HA 4HT7A 2C3UA 4WFXA 3OTEA 4TLQA 2K1RA 1DQ8A 3V8IA 3Q8SB 2PD1A 2N3LA 4F4XA 3R7SB 1RTQA 4MI4A 4EVYA 3KNGA 1UWBA 3TP2A 2HHQA 2PT0A 4O3PA 2A1BA 3W7BA 3MR3A 1D8ZA 3L4BC 3MTKA 4B11A 4AVBA 2E7XA 2G3AA 2XS5A 4OIXA 4M63A 5KAKA 2Q4VA 2KJVA 2MQLA 3AJ2A 3MAAB 3L95X 4OYWA 5HSPA 2PMZD 1N0UA 3CJKB 4DSKA 3RYOA 3KGQA 3FECA 1TMJA 2JOQA 1SJ1A 1FKPB 4FXWA 1TKJA 4URQU 3LF0A 1GTEA 2W1BA 3OV7A 3TA0A 4EBCA 2CQIA 2B51A 2XYPB 2HW3A 4X62F 2NUUG 4IRKA 3ZZZA 4JB8B 3A3NB 1HNWF 2DEJA 2XLIA 3MCSA 4IQMA 4C11B 3BSNA 4P75A 2O4HA 2KVQE 4OJ1A 4OZ3A 2CQCA 1BLUA 5LOQA 1QLNA 4UFVA 2HWHA 4AXJA 2J7UA 3BSOA 2UZAA 5GMDA 2XQCA 1O5JA 2DR6A 4A48A 3H98A 5D78A 3M05A 4B3TJ 2GFQA 3NBPA 3GR0A 2MSTA 2KL8A 5CXTA 5EBVA 5LYFA 2HQGA 3SCKE 3VAKA 2ZFHA 4UOHA 4JUZA 4CO5A 2PEHA 4ECTA 2UUCJ 2OMOA 4DBQA 4P4FA 1GT8A 1DARA 4H4KC 4DR5F 1FESA 3PM9A 5FDLB 3UWTA 5IX3A 2HZAA 1Z1ZA 2Z4PA 4WIQA 2N7YA 2DIUA 3MR2A 2WSEC 1N32J 1WDDA 2RE1A 2U2FA 3Q8UA 2F65A 2EK6A 1S6QA 4QWCA 3A9LA 5D3GB 4NYPA 3CF5Q 5F8IA 1QSRA 3TNVA 4K3NA 1I1GA 2Q79A 4MRIA 3PYGA 4LR8A 1PC5A 1NK0A 3RTVA 3T9ZA 1B0TA 2K3IA 4OKOA 2NMTA 3IA0A 4Z7CA 5T7LB 3S1TA 4YB1P 4HDHA 2CVEA 1SQGA 2G2YA 2GE3A 2O5DA 4WBFA 3L3CA 4OV6A 1X5TA 4NLPA 2CQGA 4Y34A 4P2SA 5HMZA 2ZHAA 2JLGA 1VJQA 4CAVA 4N7TA 2QLXA 1R8HA 1X5SA 3KMSA 2NSBA 4Y2MA 3FGVA 3KDNA 5CYMA 3NNHA 4QIWD 3FBUA 3A8IA 4PXCA 1RAFB 5CHCB 3AOBA 1OQ6A 3BLNA 3HFVA 2ZH4A 3DGPB 3NS6A 2J5AA 3TO8A 4DR4F 5KT7A 3J80Y 1SJFA 4ZIWA 1QQ9A 2P9GA 3R1LA 4O44B 1ZG7A 1UETA 3QGGA 5A28A 5FJ4A 2MHNA 4RUBA 2LKZA 4B14A 4MK9A 1FJGJ 4NZ6A 3THTA 2HVDA 2CA9A 5J1EA 2PR1A 3ET6B 4B02A 4NLUA 1XNRJ 2HQDA 4USKA 1V5VA 4DV5J 1YGYA 2WSFC 5AXMA 5CH7B 5BYSA 2RILA 1U49A 3PJ9A 1IR0A 2HGNA 1TKXA 1URRA 1F0XA 1V3RA 1M1GA 4USWA 3GIJA 1SV5B 5KTCA 5HJYA 1SJQA 5IZHA 1M4IA 3KI9A 1UWBB 3W3SA 2MLXA 4ED8A 4Q2MA 2C2MB 1KN6A 4JI2F 3FVYA 5H1SV 2I79A 1F2OA 2ILYA 1BPNA 1YMEA 4LRDA 3KFWX 3N9UC 3DKDA 3RAMA 4IR1A 2QIFA 3HVTA 1UW4A 3X3UA 1HWKA 2VASA 1ROFA 2ZUGA 4ZLLA 4II9A 1XC9A 3FCWA 4ANEA 4F9UA 2GGPA 5C7PA 2VPXB 1JLFA 2JLMA 3QPIA 4JV5F 2MJUA 4ZCIA 2Y1JA 3SHPA 4USHA 2NXUA 4M5IA 1RACB 4UFWA 1FRIA 4HH0A 4BCAA 1WC1A 2M4MA 3CMES 3BI1A 3D6FB 4FNIA 3K2KA 4WE1B 5C42A 1VFJA 2IYIA 1G6BA 3ET6A 2JVRA 4B9NA 3DXSX 3D7FA 1T94A 4JI0F 2LXFA 3PIOQ 2W01A 4YRHA 3M2RB 4RPFA 4JI1J 2ASLA 2RB7A 4NJQA 4UEFA 1RKIA 4UCMA 2LMIA 1CEZA 2HNDA 4QWAA 4LIWA 3VZHA 2AX1A 5BR8F 2JDDA 4AD6A 3LMSA 2GU2A 4JI1F 2XNRA 1FDAA 4KSIA 3KLVA 3JTPA 4ZVHA 4RNMA 4RNFA 4NA1A 4K2XA 5M2UA 4O0IA 2BO9A 3SSQA 3T5HA 4FPRA 1MROB 1HWUA 3D1QA 2UP1A 3QBCA 5HAOA 2R2SA 3D28A 3H2VE 2DCLA 1NEEA 4QQBA 4FYDA 4PQAA 3OLBA 3GR1A 3W9JA 1Q7YT 3BGLA 3R1KA 2V8HA 1JLGA 3VGSA 2G0BA 2H4WB 3H5UA 2XS2A 4JP8A 2J7KA 2FZGB 4DU7A 3F5BA 1UJ4A 1NSAA 1WWHA 2HGMA 4ED2A 1FEHA 2RH3A 1WACA 1N6QB 3CJKA 4DI6A 4EU0A 4ES1A 3MAAA 3TO9A 1LKZA 5L46A 3CDAA 3KL9A 1RB0A 3R96A 4C48A 2IC3A 3M8PB 3KG1A 1XFOA 4W90B 3WDOA 3ENWA 3BQ0A 3R9EA 2MDAA 4OLLA 2XMWA 1JJ2R 1ZLIA 2CJBA 1QAIA 3I96A 2XHWA 5IOLA 3T6JA 4JV5J 4R5PA 4DG1B 5DGAA 3QT6A 3K5NA 5A6WA 1T11A 1H38A 2FJDB 2NZCA 5H9EJ 5LJ3Y 3OUYA 3OVBA 2AT1B 3ENVA 5BYQA 3W6XA 4E8OA 3MOZA 1JJHA 2Z2LA 3K7RA 1WOPA 5CNPA 1IY7A 5C24B 3N01A 3NOGA 1L3TA 1WEXA 2LQ8A 1IKVB 4NEYA 1J27A 3EPIA 4P6QA 3T9NA 3KHHA 2WB1D 1CJVB 1B64A 5ELYA 5IWAF 4G3IA 4I2QA 3FX6A 4X2BA 3ITHB 2LYVA 1YJ7A 3MPYA 2CIJA 2N4CA 3M2UA 4DCJB 3LA0A 2OPSB 4XIUA 4NGSA 4Z7YA 4UWJA 2F4VF 2J0QD 4ZLJA 4OJ3A 4KYZA 3MFIA 3POTA 2L9WA 2W2OP 1SXLA 3TJ8A 3LD2A 5DQHA 1KHVA 1NSPA 1I1DA 4J9QA 1KOOA 4IG0B 2IJFA 4X4OA 3DSBA 4NXMJ 2H3EB 2OHDA 2J7WA 3MGDA 4IG3A 4C11A 1RCXB 3HD1A 4IUFA 2J8MA 1RT1B 2Z2MA 4ECQA 1B4SA 1VRTA 3OTBA 3AQPA 2IFXA 5J2NB 2HNZA 3GE9A 5DDQC 4B9LA 1KUYA 2YNDA 4DJBA 3C14B 4XPDB 2R7HA 3NS5A 1UFWA 2E5JA 2O67A 1UFLA 2HURA 4WJBA 2YBVA 4AVCA 1IKWB 2QL5B 2POKA 4N76A 5KFUA 3PEJA 1S7HA 2W9BA 4MAKA 4E8UA 2V63A 4FN5A 2VQFF 2YKOA 2PE3A 2HSEB 1GXTA 5CD4A 2BXJA 5D15A 3TUPA 2HS3A 3PRDA 2K3KA 2BKNA 3BKFA 3G82A 4LF7J 3MAHA 3V6JA 2KU7A 2GO9A 2YX4A 2FUG9 2DD8S 3LACA 2ZKUA 4OYBA 5B09A 4K4TA 3G2XA 3V5RA 4KT0C 3CCTA 2YWWA 4YMEA 1GHEA 4MH8A 1AW0A 1VRQC 1DLOA 3US5A 4F4AA 4F4YA 1WK4A 1HNZF 3LPEA 4K0KF 3DNSA 1BO4A 3R5BA 6AT1B 4HNYB 4UT4A 4KY3A 1EKSA 1BQXA 4A32A 4DS4A 4KSAA 1LWCA 5AE2A 4IO1A 2DY1A 4ERDA 4ETXA 1RBOB 2UVVA 4OQJA 3IWEA 3EVOA 3N7ZA 1BUXA 5LMNJ 2W8LA 1HI0P 4GRSA 2PSZA 3NXZA 3A8EA 1ON0A 1XEBA 4ZX9A 2FJWA 1U1LA 5HATA 3NS7B 3TZXA 4JD6A 3RBXA 5H9FK 5GADI 3MPDA 2V0NA 4NASA 2BQUA 2MGZB 3DYAB 3TOQA 4YGOA 4L76A 4CRYB 5IQQA 4PUOB 1K0VA 4TNUA 4TYBA 2UUBJ 3TRGA 4PG8A 4NGPA 1XR7A 1C0UA 3CJ4A 2QA2A 1PJ5A 2FQQB 2HFSA 1FFWB 3KHGA 2XHCA 3NP5A 4EUVA 1IOFA 1FRMA 4PPZA 3W63A 1J2VA 3EDQB 2HZCA 3R6GB 4PQUB 1CSJA 2NSCA 5G22A 4M3SA 2JVOA 2ADCA 1GK8A 2CVIA 3EX7B 3KQXA 4KLWA 2P2CB 4F0KA 2Y0MA 3KQZA 1X31C 4DR6F 2O28A 4FVMA 4ZPCA 5J1EB 2IVFB 3EY5A 5ETMA 3C15B 5LL6d 1RISA 3GONA 1XIQA 3CJTA 1IKXA 1L0CA 2FLPA 1NH7A 1JLBB 1RT4B 4MHYA 4XK8C 3AJDA 3UI3A 3FRZA 2CQDA 3KLIA 4ZGYB 4WKYA 4CAXA 1YQHA 2RKIA 3CXCR 2DR5A 1Z4UA 2LDYA 2H5JB 1RCOB 4YWYA 2PA3A 3DLGA 5A0YA 1ZA2B 2C2ZB 3IFEA 4LRAA 3O1LA 2FE7A 2P6SA 2YNGB 3O8WA 1OZPA 4RS2A 1PIEA 5E7OB 2PN6A 4DX8H 4OX8A 2DYAA 1VQ9S 4K7QA 4JXRA 3MM7A 5KFKA 2RQMA 2UUAJ 4YB6A 1H72C 2YH1A 2RC4A 2CQHA 1HNXF 4ZPBA 3KG4A 4UIAA 2WVCA 3Q0AA 2F7VA 3CSKA 3QNWB 4HHHA 3HHLA 3KKFA 5HK4A 2Q7BA 4F7VA 3FYNA 4BLGA 1LV5A 4PWDB 1N33F 1UFHA 2Z3PA 2X1AA 3OFEA 3M30B 1PYOB 1R0AB 4I6WA 1IKWA 2IIHA 2DK2A 3K9UA 3KK1B 3Q22A 4B3TF 3DLHA 2MZ1A 2M88A 4ZVEA 4W9YA 3PB4X 5AJ3J 3C6TA 1NK4A 3NH8A 3L9ZA 3GZ7A 2VQEJ 2GVDB 3HD2A 1FDDA 2HVEA 1M5HA 1NMTA 1O8BA 2FB0A 3MPWA 4R57A 4U95A 2CNSA 3EJMA 3R97A 4JYAF 5HJXA 1H2UX 3SCJE 1RTDB 1RA6A 1PYTB 3M32B 2FSRA 1CBXA 2DNMA 2FIUA 2NREA 1DFDA 1NM2A 3LGMA 3I3GA 2FY8A 2MPUA 2ZWOA 4IG0A 5C5JA 2PC1A 2FYXA 3JAMY 3JTNA 3F0NA 4H89A 2C28A 4YP3A 3DN9A 2G2OA 4DJLA 4F8RA 4NLWA 4Y0FA 2AFSA 2YKMB 3MEDB 5CYJA 4KHPJ 3WC7A 4TQRA 3I87A 1VQ6S 4M5KA 2PIYA 2DEIA 3BBFA 3S6KA 4OYZA 4D3GA 3G8WA 5AG7A 1CPSA 4TN2A 1V3SA 1WKJA 3M9OB 3KUGA 3QIDA 1AMPA 4HTIA 2ZPAA 3IN5A 3DR6A 4MKAA 4M85A 2QA4S 2MQ8A 5IT4A 3O5TB 1LXNA 4I49A 4OC5A 2E9ZA 1F3VA 1NDLA 1UEUA 3NWRA 3T6BA 4FD6A 2ZW7A 2G0JA 4EFDA 5J8CA 4PG6A 3RG6A 2A10A 2CG4A 4QUSA 1VC6A 4ZVFA 3QSYB 3M8SA 4KHMA 1QTMA 2Z30B 4OLPA 4QWBA 1WHVA 2XY5A 2GIVA 4R9MA 2WCXA 1YBAA 5HVGA 2MMYA 1NZAA 2CNOB 3PKMA 2PRBA 2EBGA 1SC6A 3CDUA 5KFVA 4RX6A 2UXBF 2EKNA 1U6MA 1BPMA 4CLPA 3Q8YA 4HLBA 2PJ3A 4YEAA 4F25A 4AUKA 2C2KB 4CLTA 4OX9F 3BPDA 4C8LA 2VDHA 1XMBA 3WHIA 5F0UA 1T02A 3W5YA 5DG9A 1N5VA 1TF8A 1U0HA 3P6YC 4J5OA 2AEFA 5KFIA 2V8PA 3CCWA 4PG5A 1Y5NB 2FJVA 1R6VA 1LRZA 5LT5A 4KOUA 4A8MP 1VQ7S 4DL3A 3MEEA 3EZOA 4DL6A 2WK4A 5J2MB 4KUAA 1M0SA 2UXDJ 4ZK7M 2QMUB 2OSRA 3HJFA 3LALA 3EUNA 4ZBGA 1YG0A 1Q16B 4CGLA 4OC2A 1HR0J 2V8DA 3E01B 2HHUA 3OT9A 2PIZA 1RXOB 1AB8A 2C22A 3H2LA 4MYTA 1NAQA 5EC4A 2KTQA 1CLFA 4DU8A 3LGNA 3JYTB 2A6OA 2XM3A 4OX7A 3WC5A 4NMXA 4XDDA 4F67A 3J81U 3KHRA 4IOBA 2OZHA 5LMUF 1VLYA 1MU2B 3K5PA 2OU2A 3PRBA 3RB0A 4WU2A 2V8GA 3RR7A 1Z2LA 3R2DJ 4CYUA 4J37A 2DXDA 4OP4A 4KOYA 4M5LA 2CJ9A 1G1XA 3HHDA 5A76A 4R76A 2CZ9A 2XYGB 3QIPB 4NYOA 1S1UB 4MFPA 4PK2A 2M70A 1JXVA 3ILIA 3A4TA 3F56A 1XMQJ 4ILLA 4X4TA 5K14A 2HHWA 3TW0A 3S6EA 3H20A 4LFCJ 3PR5B 1ZTWA 2DGOA 2D3ZA 4WFZA 2DPJA 2FGOA 2OUGA 4NA2A 1FRHA 4XPEA 1CULA 4UIBA 3EGWB 4CM0A 1J5OB 1NJXA 1PAEX 2Z8QA 1S7LA 5J1QA 1R8BA 3W1YC 3P49B 2J9AA 2HRYA 3FSXA 2Y3YA 4LF6F 3BDEA 1UVNA 1S1TB 2JHEA 2HS4A 5DLGA 1LNQA 1AZSB 2HHPA 1C1BA 2AFOA 5KFTA 4P74A 1H74A 2CPIA 4B5PA 4E0AA 3I5CA 1S60A 3KKWA 4CNYA 1PSDA 4CYOA 3K5LA 4L3NA 4ECUA 1X4HA 1NK5A 1A9NB 3ISZA 2ZBIA 3JSRA 3CCVS 4Y65A 2B3UA 1YVOA 3TUJC 4X4PA 4NLVA 4NRTA 2JEJA 5KOXA 3POTB 4G1IA 1KUVA 1K0TA 5D8NA 2KN4A 3WBZA 4X8IA 5DZ6A 2HGLA 2BQ3A 2K7JA 5F48A 4X5KA 2E5IA 2WVFA 3BDPA 1Q53A 2FVGA 2V69A 2BANA 4TU7A 3IBCB 4UEEA 3TFYA 4UCPA 3KDOA 2R8VA 4HNXB 1LWFB 4KORA 1RBAA 1O6XA 1EETB 2I1RA 2XEFA 3H2UB 4B9TA 4PEOA 1Q8LA 2J8AA 2RQ4A 4ZITA 2J9CA 4A31A 4JI5F 4DR4J 4KOVA 2RDDA 2BKPA 5C25B 2VA3A 1N56A 4RNNA 2FL4A 1H7XA 5HP1A 4P4BA 2ATLA 2QYGA 3TQ1A 2KDOA 4GXHA 2OZGA 2DVIA 4EFAC 2LDIA 5ETVA 4K30A 3QLHB 2LQBA 2O1PA 3Q8QB 5B0FA 3KOAA 2W24A 3OHAA 1MMLA 1L5UA 1RT6B 2AYBA 1KVKA 2QG9B 2AJ1A 3OL7A 4YY3F 4N41A 3VAGA 2CNKB 1Y0YA 2OPPB 3PYDA 1U45A 1GFWB 4C2XA 4EMDA 2IDEA 4QCLA 4J9PA 1N36F 3V7ZA 4DQQA 3C14A 4J9RA 1BMQB 1RLCL 5LSRA 3NMRA 5H9FJ 3OFFA 4KSEB 3GPAA 2HHHJ 1VBYA 1LW0B 4MMOA 3EM1A 3TAMA 3WR7A 4N77A 2IM3A 4PWDA 4Y28C 2KFYA 1DQ9A 1YJVA 3D6TB 3HHLB 4ILRA 3N79A 5I3PA 2MLZA 1FTRA 4LREA 3NL0A 2ATCB 4IO9Q 3ETOA 1HA1A 4MJ8A 1NK9A 3GFXA 1RTZA 3C19A 2VKZG 1RAJA 4DUYJ 2HNDB 2RHQB 2AJFE 5EWGA 2DISA 4B3RJ 3QGPA 4F0HA 3HSGA 3B8HA 4E2FB 3SYZA 2ZEMA 2PC6A 3PJXA 1A6LA 2WTFA 3UE2A 2DHAA 3KHXA 4OHZA 2WOMA 2IYGA 3PCOB 4FUUA 4CLKA 4HH1A 1PU9A 2FJAB 2XG8A 2QFIA 4A39A 2ASJA 1TELA 4IHMA 4P4DA 2BDPA 3I9ZA 2DGSA 3T1YJ 2CNLB 5K8NA 5F8MA 2HKEA 2E5HA 1S5KA 3FNNA 3CDXA 2CPDA 1WKKA 3D7GA 4JI6F 3D6HB 4RKUC 2PDOA 1UJ5A 2BZ2A 1X0PA 2J0WA 4HI2A 1KHWA 3M1VB 3GIIA 4QYZJ 3H5ZA 4HHJA 3K2YA 2RDIA 1RZMA 2IAJA 3Q83A 3U1LA 3QWUA 3EICA 4R0JA 4ALZA 2YKNA 3D2WA 1HNIB 5KFAA 2Q51A 3BYRA 3HT3A 1T3NA 4JI4F 3W61A 5DS0A 4Z65A 1B99A 1RE1B 2AIRB 4AG7A 2HLTA 1LW2A 3LGHA 4ECWA 2VBYA 5IV3A 1NBEB 2DNZA 4WCEQ 4RU2A 2FIAA 1KUXA 2CWKA 3PEIA 4XPLA 1UA0A 4Q5VA 1U1PA 3SJXA 4X66F 2VG6B 1YJ9S 2ZW5A 3MR5A 2QA4G 3MRUA 2H4YB 1OPZA 2QT7A 2VODA 3K57A 1RWMB 2AGPA 1MROA 4NLXA 2VG7A 5ETRA 4Q8FA 2JEGA 3T41A 3F41A 3QNVA 4WFAQ 2DR9A 2W2MP 2MZQA 2QMLA 1JB0C 2B5GB 2Q4ZA 2AZ3A 2NS1B 2W4CA 4M5DB 4DV1F 4X3RA 3R1HA 2D1CA 3BSCA 2UXCJ 2D3O1 2XI3A 3ONQA 3FEZA 1RHJB 4KVOE 7AT1B 3JSMA 3ZZOA 4LX9A 3BGRB 4KHRA 1SQEA 2NPFA 2V77A 1P1TA 2HK2A 3KLIB 4M5NA 1X10A 3EPGA 4PG4A 4R25A 4IAVA 5EX0A 1Y9WA 1J4JA 2V68A 5HVHA 3BBBA 3MUMP 4CGMA 4JI3J 3BR8A 1DTTA 4CO4A 5ADZA 4F50A 5ITHA 3MMAA 2IY5B 4RW8A 4HVZA 4KGZB 1HMVA 2QMWA 1Y4ZB 2XYHB 4LSZB 4B5PB 4WFYA 3N5BA 3GV8B 2XZDB 5IV4A 2B5JA 1DURA 1T9UA 4QWDA 5D0GA 5T7LA 2PJ0A 4ANCA 2GQQA 1D09B 2CJXB 2J76E 1UEKA 3MEGA 2EG2A 4DUYF 1FFSB 4FYVB 1CPXA 3MM9A 2WSCC 1T9VA 3M8YA 3PO5A 3FRYA 1S1WA 3EMTA 3B7IA 4NGNA 5KFYA 1U09A 1HQUA 2MZSA 1YJRA 4M5HA 3W8GA 1XJWB 1NSKL 4LQGA 2QX0A 1TV6B 5HQ8A 3DRPA 2Q44A 1YHQS 1XR5A 4CGPA 4NJRA 1XMOJ 3MOJB 2A6MA 3HHLC 2GIRA 4DR2J 5MLCV 2VV5A 2PFFB 4I7FB 2B56A 2VH7A 3ZTSA 1AYEA 3QRPA 5D4LA 3FKBA 3M6VA 3A12A 4H4KA 1RAGB 3ILLA 3FXTA 5KFQA 3NKYA 3G4SS 3GP9A 3HZEA 2Z10A 3EO4A 1NHKL 1VHEA 1C1CA 4F3MA 1V5IB 5E3PA 4HI1A 2J0SD 3RB3A 1O0PA 3PX6A 2XCAA 2PE8A 2XMVA 2PJ4A 1M5VC 3FC9A 5AG4A 3JTOA 2RFHA 4TLRA 4DX5A 1Y9KA 3WIVA 1S49A 1UTAA 4ZCKA 4HHUA 4OLOA 4CRZB 3SFUA 1M90T 4NLQA 2Q1LA 5DLFA 1EP4A 3C66A 2AFMA 1EE3P 3M4XA 3QAYA 1RT7A 4NE9C 2DNNA 4FBTA 3TE4A 1WC0A 3LP2A 1DTQB 4DV0J 1Q81T 2QA1A 3M8RA 2HBYB 2DF5A 2F5IA 4TWEA 5BWAB 3R5CA 4KUBA 4QOTA 4UQGA 2WONA 2YX1A 2WSAA 3HT0A 1P9QC 4ZVSB 5KG3A 3D8PA 3QATA 5KT4A 2J8RA 4J9UE 1NLKL 1FJEB 1VBKA 1N6QA 3VF0B 3CC2S 5LM7E 4XPCA 2OO4A 1VK3A 3H8GA 1KLNA 1OO0B 1JKHB 1BWVA 3RU0A 1V9OA 3LO3A 2VEZA 2GA7A 3LTOA 1H8LA 3ISNC 1S6QB 5IM0B 2W7OA 4R0EA 4B3MF 1CC8A 1YI2S 1NHVA 1BXNA 5HROA 3KHZA 3GJQB 3IWLA 2DH7A 3V81A 5KFOA 4DPOA 3B54A 3WQPA 1RTHB 4OHVA 3D68A 1PGZA 4NPOA 3Q89A 3WX8A 4WTOB 3LP2B 4Y2CA 3UN3A 1HBNB 3SJGA 3W9IA 3CTRA 4OZ2A 4C97A 4O3SA 2N4DA 3SSSA 5HBMB 2OLWA 4CS0B 2ILZA 1F1BB 3IIBA 4P4JA 3U27A 4LRBA 1XOVA 3LODA 5HXDA 5KFWA 2FVCA 3KASA 1RHKB 3BH7B 3C6UA 4ZJQA 2F1FA 3I82A 4F9VA 1L3SA 1VBXA 2C1CA 4MFBB 5KFMA 1S0VA 2MQNA 2G0CA 2AGOA 5C24A 1KONA 3R5GA 1WF2A 1IUJA 1EZZB 4NL5A 3FF3A 1C1CB 1YWXA 5IM0A 4WIIA 2DT9A 3G82B 2V9KA 3DMJB 4PKDB 4J9LA 1NHUA 2XCPA 4GC7A 1X12A 2HNYA 2VXKA 2GGPB 3NNCA 2DNYA 1IICA 1R0CB 4TY8A 4LSLB 3N6NA 4Q44A 2HRUA 2OPRB 4ZVOB 3LP1A 1FKPA 1HARA 3FZBA 2HHTA 3CJ3A 2L08A 4MJKA 4J7CA 2PFDA 1HEEA 1HYSA 2PI4A 3FBCA 2ZITA 3FJ2A 3G8QA 3DGVA 4CH7A 4ZCMA 3BGUA 3GYGA 1YK3A 1S6PB 3DDDA 2DNKA 4LQ6A 4LVOP 3W91A 4FS1A 4CI0B 4CTAB 5CBMA 1REVA 3H4QA 3PY8A 1VQ8S 1XNQJ 3CDEA 3M1VA 4DX7A 2K1RB 1TL7B 1RHMB 2IJZA 3G9CA 3DRSB 5KT2A 1KQKA 2GFFA 4Q0BA 1TL3A 5G4DA 3DRXA 1YIJS 2KYZA 1Q5VA 1WD6A 1ZS6A 1F5CA 1ZYQA 4N5SA 3IGVA 3R6LB 5KFZA 4RN7A 4P2XA 1P27B 5JGFA 2HLUA 3RB6A 3S6GA 5K9FA 3A3PB 2C6PA 3HM9A 1S9GA 3AODA 2VPYB 4QPXA 3BXMA 3EGVA 1VQLS 4P45A 2OEKA 4N56A 5J8FA 3A13A 5CABA 4MY3A 1ZAWA 1RTHA 4AXVA 3DDKA 3N6LA 1C4CA 1C2PA 1YX0A 4RBUA 3PRTA 2J8SA 3V2UC 5JPHA 2IJRA 3IAM9 5JMNA 5KFGA 3KXDA 4MK8A 4K4ZA 1ZG9A 1JLBA 1SBRA 2M2BA 2ZDOA 5ETOA 2AJ4A 4YHHF 3LH2S 4H54A 2ZWPA 3V6KA 1LFPA 4U9RA 1JLAA 2Q6BA 1RXTA 2FXFA 1F3FA 4DFMA 1IJFB 3TYTA 1I5OB 2B8PA 3PTWA 2NXJA 4KGVB 2MQOA 3MZIA 2DGWA 3PNIA 2V2QA 4NLRA 3OTCA 3OHBA 1Z4EA 2B7BB 4F2RA 3CCUS 1IOIA 1KKHA 3HK2A 2EW9A 1U1RA 3TUZC 2HMIB 3V6DB 5C2CA 2YNCC 1Z8WA 1B7FA 2QLJB 3FSYA 4PUOA 3OTOF 2GAHC 1VI7A 2H1YA 1FRLA 1OWXA 2ERRA 4C6AA 3PEHA 2EVNA 5H84A 3MMAB 2EBJA 2FC8A 2CPJA 4TU8A 2R7RA 1SQHA 2NPIA 4HL9A 4XNHC 4LUAA 4KQZA 2AD9A 4LFBF 2IJNA 3KJVB 2AYGA 3TJ9A 5G1ZA 2CXEA 2HC9A 2UXCF 2RRBA 1I94J 5D29A 2LA6A 1UAWA 4TQSA 4CLFA 2I5JA 2OR4A 2HHVA 2B9XA 4PYAA 2A0FB 3CC4S 3PHTA 2HAIA 2HQIA 2VQFJ 4DSIA 5GAEU 3CD7A 3JQJA 4QC6A 4LF4J 1H98A 2E7WA 3CDWA 2U1AA 3M9NB 4YQWA 4UTGA 5A27A 1Y7RA 3ZZ0A 1YVKA 1B7YB 4F02A 3I5AA 3OR2B 5L1IA 1NCLA 1HW9A 5LMUJ 1VQ5S 1YLOA 3C6UB 1IB1E 2P6GA 4ONUA 3K8VA 4KOTA 3OPKA 1SIWB 2VL1A 3VAFA 3A1YG 3MXHP 1HFEL 1VBZA 3G3SA 4RO0A 2AU0A 1LQ9A 1ZG8A 2REFA 2Z3LA 4TNOA 2YTCA 5LRJA 4NLDA 4F6AA 3KK2B 4DV2F 5DQGA 2OFGX 3B3CA 2I6WA 3AOAA 1E6VA 3K89A 4DL4A 4MCRA 2AQ4A 2Q66A 4DZ6A 2NYHA 2WRMA 2KO1A 4B17A 4EWTA 1J5EJ 1S48A 2WVEA 1PO6A 3EYZA 3AY0A 2BE9B 2CPFA 2MHEA 2N3OA 2HG4A 3DM2A 1VQMS 1T05B 1U4BA 1M44A 3JTKA 2AYEA 3R5DA 5FLXY 1EQ0A 2PDAA 3MCNA 3U1NA 5KG0A 2M8HA 1OY6A 2N82B 2QE5A 4RW4A 3UR3C 3LAKA 2PA8D 4B08A 2CWXA 4R8UB 2V6AA 4DV3J 2CTCA 3GUXA 3IWGA 1FE4A 4EI2A 2Z3KA 1EJ7L 2KRBA 2VHGA 4CO0A 5IQ6A 3VH9A 3ZZTA 1FT7A 5J2QB 3GIRA 1UWAA 2BA9A 4BBYA 2JWNA 2GVZA 1ZAXA 2OFHX 1BC6A 4CO3A 3J81Y 3M8WA 2DPIA 2L9NA 2R2UA 1UKUA 3I4PA 5K8OA 5DJBA 1RI7A 2NZ4A 2PMWA 3QT8A 2VBZA 1PAUB 2AJ2A 1YJTA 3ADAC 1WNEA 2DR8A 3IG1A 3MHYA 5KT3A 2OB0A 2FDNA 1WOOA 3IEHA 3BREA 5ETTA 4JI8J 2B9WA 3PZPA 2AEJA 1ARMA 2B9YA 3H40A 4AB7A 2MEWA 3PP9A 4KGKA 4O3OA 3QGIA 5M2RA 3ZNUA 1S7NA 1MWYA 4LQ9A 3DOMA 3HCXA 3CMAS 3WX4A 4QW8A 3N5FA 1K4JA 1VRUB 4I0WA 3HHKA 2ZEFA 2V50A 4L3KA 4DN9A 2UUAF 4KOSA 3UCUP 2MYFA 1SH3A 4QYRA 1U48A 3NA6A 4B9UA 4L72B 3BM7A 4PSWA 1AZSA 4IDKB 1RTIA 2ABZA 4QR2A 3QGHA 3KJQB 4LF8F 5E3CA 3B8GA 3TR5A 2GAGC 4IFYB 4X4QA 2ANPA 4LF1A 4BC7A 2XMMA 4ICLA 4P6YA 1R0BG 1HHSA 4DFJA 1RT7B 3TAQA 1RTJA 3VR1A 4P2MA 2FVSA 4CLUA 4OV1A 5GCNA 8AT1B 3T8WA 3FFIB 2X1FA 3H4DA 2AW0A 2BOPA 2GHVC 2AJ0A 4B3OA 1U7LA 1Z8XA 3OVAA 3DLKB 4C8YA 1KSPA 3SCIE 4FWUA 4IFVA 1AUDA 1UVIA 1TF9A 3R5AA 1BWEA 3TVYA 3H4BA 2LFVA 2E44A 4PXDA 4IH6A 4TYAA 2NXCA 3PBBA 2HHHF 5LRKA 3M2VB 4U9ZA 3ZZPA 2OD4A 3C16A 3MMBB 1SUQB 3BKUA 3DCAA 2RHSB 2QYVA 1REGX 1QAXA 1VQPS 3JSBA 3MMCA 5IC4B 1Q8BA 3VAHA 2IM1A 4P2FA 1HD1A 3I0SB 3DLGB 1VQNS 1I94F 1YRUA 1Q79A 1SI9A 4W98A 3R7NB 2W4PA 5CZXA 4OI1A 2XB2D 5CPAA 5AT1B 3K0JA 4AFFA 4P52A 1NPKA 4A2ZA 3A8KA 4JWPA 1ZOTA 2HVHA 2JFKA 4H4MB 5T41A 1N5TA 4KTQA 4HPSA 2CPXA 3ZC4A 2C27A 3C6TB 4C8MA 4A94A 4CDIA 2DNHA 4CCHA 3TOBA 4DPUA 2I3CA 3IP0A 3BO4A 1PUAA 3Q23A 1TL1B 4DV5F 4CLYA 3BN4A 1IM6A 4ZYQA 3ZJ0A 3MPVA 2BYCA 2RRAA 1IR1A 4OC0A 3SI2A 2MKSA 3UDEA 2IM2A 3FH4A 3HHLD 9RUBA 1CJTA 2F8MA 1CJWA 2OTJS 1APSA 4U5YA 1XEZA 2PJAA 3W66A 3D9BA 4F36A 2WW4A 1KR4A 3T1AA 3Q8RB 4LUBA 1FT8A 1OPIA 1T7PA 1CULB 1UCNA 4G1PA 4MKYA 2QL9B 1LANA 3A8JA 3UN2A 4DR1F 3TAPA 3T1HF 1V0CA 1YRXA 2HIYA 4ES3A 5A8WA 2B4PA 2VU5A 1W2BR 4RW9A 1RBLA 5EX3A 4FP9A 1W25A 4FVCA 1MWQA 2Y0BB 4DXLA 3M6WA 2RUGA 2B7CB 1KWMA 4JI7J 3IXQA 3MPUB 2YNEA 2RD5C 1QY7A 2V8VA 4ZVUB 5I3UA 1SC4B 2CUYA 3GIKA 1QSYA 4C7HA 3FSIA 1RU1A 4PK3A 3RBEA 5EDWA 2BBEA 1G7CB 5HL7Q 3ZTQA 5KFHA 2I2YA 4G65A 2VKRA 4DV4F 2QLFB 1I3OB 2RS8A 4KS9A 2ACYA 5EUHA 1PG5B 4R8UA 1T8EA 4DR3F 2YWGA 3IRXB 1KQSR 2DGUA 4MK7A 3KK3A 4NF1A 5GVQA 4CGNA 1KFSA 3B2YA 4ED5A 4LR7A 2XTJP 2Z56B 1MJBA 5FD1A 1U8SA 3H8FA 4JOUA 1O51A 1XWLA 2D3OR 1FD2A 3FBFA 3PFOA 3MCOA 2ZEDA 2VBQA 2JNJA 2K06A 1VKCA 4J91A 1IQTA 4E0DA 4CH1A 2FZKB 2KJWA 2B9EA 4NCBA 3Q2TC 3MM8A 2DKOB 1OY8A 3G6XA 4RW7B 4KRWA 3IWNC 4I2PB 3TA1A 2EFVA 3HP6A 5K14B 5JVGQ 4AQYF 4B13A 2UXBJ 4PG7A 3S6FA 3QJJA 2UVWA 1TZ0A 3L09A 3UVJA 2PJ5A 4UWIA 4TY9A 3I55S 3TVZA 4G1QB 2PMHA 2HHSA 1WSVA 4FD7A 2BUNA 5E0OA 2VPWB 4QBJA 2GQ2A 4LFBJ 5FDLA 3JUWA 3O3LA 2B4VA 3KMQA 4QYZK 2WOMB 2YKAA 4RU9A 5KFRA 2J6TA 4KB7A 4EK2A 1Q7LB 3MTJA 2DXFA 1SQFA 2H9ZA 5F46A 3ZTOA 4YR2A 4NOHA 4L89A 3TZZA 1JLQB 1S79A 4R3LA 5DRKA 1RJJA 4F4ZA 4F04B 4CH0S 4DZDA 3JYTA 2LQ9A 2OEJA 2BJ3A 1HIYA 4U9YA 3KLFB 4CIOA 5DM6Q 2X1BA 3QZ7A 1ZETA 5JXSA 3IS9A 4U8VA 1RHRB 1SH0A 2RDJA 4GC6A 4ELUA 3EXNA 2PSWA 3G87A 4C0HA 4JI2J 4JI3F 2ROGA 2UUCF 4CPAA 2W25A 4C0OC 1VQYA 2CZ4A 4EMEA 2HB6A 4NYZA 1UA1A 4DUZF 3OSNA 2B0GA 2GVDA 4BHQA 1IKXB 3TZWA 3P5TL 3ZZIA 3CXSA 4DR7J 1R31A 3PXGa 2L9DA 1A7GE 2ZEHA 2JRSA 4YUDA 3E2EA 5KTDA 1RA7A 3HHEA 3HVAA 4NZ7A 3D3CJ 1FRJA 4IDKA 2UVUA 2PJ1A 1Q95G 1KFDA 3L7UA 5DS7A 3ZZYA 1NJIT 3K58A 4DV3F 3FMCA 2GMJA 2K8GA 4NFRA 3ZZUA 3D0GE 4ELTA 1RSCA 5F0WA 3K5OA 1VR6A 5HLFB 5ETLA 3BF4A 1HNVB 2KVIA 3AB2B 2JDJA 4A37A 1YK9A 4K4XA 2KT3A 4A8QA 1JWQA 4S0MA 1R8PA 4U7CA 3WC2A 3HDSA 1E6VB 3M30A 1RWWB 2FJEB 1N36J 4OYXA 1D9AA 1WC3A 3KR5A 4FD5A 4U67Q 5I0CA 1GYTA 5BR8J 3D2MA 4ELVA 1RWNB 5LYIA 1X4FA 1MMNA 2D74B 3EE3A 1VISA 3ETMA 3FZ2A 3UQSA 1UEVA 4DPTA 2ZNYA 2R7UA 2MKIA 1LWFA 4DUKA 2DNQA 1FFGB 4ID5B 1R6YA 1FKOB 4DCPB 3SDEA 4CGOA 1LEOA 3CCSS 1S1UA 4KFBA 1JIHA 2A4NA 2XMKA 3C26A 1S59A 4ZVRB 3MECB 1VHSA 2C1EB 5GAGU 4XPDC 2X3GA 1NSLA 1VQSA 2CDRB 1RABB 3BH6B 4HKFA 3OUYB 1VCTA 3N6MA 1BD6A 4B3RF 4DSEA 1GH8A 1NXIA 1LWEA 2B6AA 5C42B 3BO3A 3VTIA 3M32A 5EWEA 3DRSA 4CZCA 2ZH1A 2DNRA 2M5YA 5EGYA 2MZRA 5LXYA 4JI7F 2GJFA 2HZVA 2MLYA 3J7AN 1VLOA 2J9EA 2YPZA 4P9SA 1IBLF 1S9EA 2HEKA 4CTAA 1KNZA 3N28A 1JQGA 4Q36A 4NLOA 4WZMA 3E0KA 4R7MA 3I4HX 1HBOA 2J8NA 4X64F 2GO8A 4DF8A 1U2FA 2KG0A 2NYIA 1UVMA 2NYQA 1GMVA 4M6GA 2KH9A 1RAAB 2CTBA 4IR9A 2FIWA 2RQKA 5FVJA 2HQ3A 3HI9A 4QIFA 5J2NA 2R8KA 4X4NA 4CT9A 5H86A 4WK3A 3OWCA 1ZZNA 4NCGB 4ED7A 2NXEA 1VRUA 4A8FA 1VRTB 3W60A 2P6FA 4B3MJ 3R9GA 5KT6A 2YWFA 1F60B 1NJWA 4ECRA 4QIGA 1HHQA 3IO1A 4DPYA 4ZN3A 1IJEB 2ALYB 1EX8A 2FPHX 2JBJA 1LWEB 2B6AB 3GJTB 2JX2A 2HV2A 4YR0A 3RB4A 4CYUB 4J90A 4YDXA 3GFZA 4MFBA 1RUSA 2W8KA 2WW8A 4UOGA 1RK8A 3CPXA 5ISVA 1YRTA 4KKOA 3CD6S 2KRRA 1IBKF 1GNKA 2MY7A 4ZJLA 2CQ1A 1WHXA 3NY0A 3GFYA 4KC5A 2NLWA 1YGHA 1NPRA 1L3VA 4NMLA 3IRWP 2LCWA 1EKRA 2D7SA 3A3OB 4CLLA 3M9MB 3K5MA 5EHHA 3MEDA 4ZCLA 3RBZA 3KJVA 1D0EA 2ZJQQ 5CYMB 1FEEA 4FXVA 2OZUA 1Q2YA 3P4UB 1JLEB 1KD1T 2QECA 3TA2A 2ZZTA 2EFQA 4OZNA 2EC2A 2AFUA 1BHNA 1RWVB 1LOKA 1N0VC 5G0RB 1Z5RA 4K50A 1VIOA 3AXMA 4FF1A 1GMUA 2AE6A 2H65B 1S6PA 2Z2ZA 4LF5J 2LLZA 1WSRA 2IC3B 3NOCA 1Q2DA 4FXDA 3MUTP 2I8EA 3DYAA 3NE7A 3CCZA 3PW7A 1WUUA 5RUBA 1FCAA 4A8SA 5KFDA 1GX5A 2E1CA 2ZM6J 2LEPA 4RL1A 3OLAA 4QIVA 1IXKA 1XMTA 3IAS9 5A2QU 3OTOJ 1D3WA 3NCQA 7FD1A 3DLLQ 4J9OA 2CG8A 4HDGA 3S9NA 1V6HA 3DHXA 2ADBA 1XR6A 1DTQA 1ZM4A 1QE1B 4NXMF 1S4FA 1KLMA 4J9VA 2XNQA 4O23A 3OL8A 2FTRA 1EARA 3KLGA 1T03B 4A8XA 3GJSB 4YS2A 3ZTPA 1RAOA 1R3NA 3NMAA 3CO9A 3THVA 1SJRA 3NGDA 4UZCA 1ZA1B 4OYPA 2SXLA 2KI2A 1MMDA 2VOPA 3JRUA 3V6HA 4DL0C 4B3SJ 5GMKa 1WHWA 1FNMA 1JLQA 2ZH5A 2RF2B 3C8YA 3OW2R 4DQIA 1NK6A 3RUBL 4U7UD 2QJ3A 3DLEA 2MB0B 3DLKA 4NEXA 2HRTA 3IMQJ 4M94A 1KVIA 1NZ8A 3AA8A 5F8NA 4OMEA 1HWLA 4CAEA 4O0NA 1RT4A 3QT7A 3UY5A 1UVKA 2VOOA 1U0SA 5F09A 3TAMB 4ZI6A 1K1SA 3LUYA 2G13A 2WZNA 2FHJD 3FMWA 2DY9A 4LFAF 3ICLA 4C8NA 4IFYA 4LFCF 3VGTA 4U8YA 3B4MA 2P8IA 4ECSA 1PKUA 3VGUA 4R6TA 1BQNB 3QRRA 1FVSA 1UVLA 4PXBA 4WK1A 1SJ4P 1EAYC 4F2SA 1IBKJ 3PV8A 3D0HE 2B5JB 3S6HA 4DV6J 3HHNB 2I9SA 2FC9A 2ZC3A 1WI8A 1IWGA 2F8EX 3KK3B 2Z57B 4ETZA 2V4JB 4MFZA 5CCMA 2V5HG 2C3MA 9ATCB 3BB5A 1U6BA 1QSLA 5G0RA 2QIRA 2DH9A 1TKHA 4YB7A 2ZH2A 3GU0A 4J3GA 4P73A 2J6SA 2XEIA 3H5SA 2OPSA 4MXUA 2YWHA 2UV8G 4X4SA 4I69A 3VZIA 4CO1A 2WHOA 1ZO0A 3TO7A 4I2QB 5E3QA 2KXFA 3NGUA 1D9DA 1RT3A 3BJYA 4DV2J 1N4LA 4LJMA 2EC0A 1TP7A 2VG5A 2PJCA 5GAHI 1IKVA 3BHXA 4KE5A 3MD1A 1S1VA 3OTDA 1Q8IA 3NLCA 3HMJG 4RW9B 3QFWA 1IBCB 2VFVA 3SFGA 4R3KA 1T9TA 2RRNA 5CAAA 3UDCA 2VG7B 2DGQA 2HWIA 3JS9A 1RDRA 1QSSA 2CQ2A 3GFHA 3J7YI 2P6TA 3GWCA 5KG5A 5C2GA 5J2PB 2L3MA 4DCOB 3RNZA 2AEMA 2BJ8A 3FBEA 5D6GA 2EFNA 2C6GA 3HLPA 3TCVA 3QRQA 2XO6A 1WTBA 1H2TZ 3QB8A 3IWXA 4V19X 3CPAA 5J1PA 2R9LA 1NJZA 3F8KA 3OR1A 2H5MA 3CJ8A 1D1UA 3BJ7A 3V4IA 4FF2A 1N5YA 3PYEA 3LWLA 1S7FA 4YDDB 4EZ6A 4H4OB 4IRCA 1XNRF 3ELHA 1JLEA 4JV0A 3VALA 3SQOP 1FXDA 2ZUAA 3W5ZA 1X5PA 1FHTA 2GREA 3TC8A 5GMEA 4AL5A 2QYCA 4DR2F 4OAEA 5HQMA 5E5NA 2IM0A 1RT1A 4ANDA 6FDRA 4RUHA 3H5YA 5LYLA 4A38A 2GIQA 3SIPB 4MIBA 1M5KC 3D7DA 1OQ3A 5J2PA 4RNOA 4DQSA 2E66A 2WUUA 4X62J 4FF4A 2KFZA 2CPHA 4K4WA 7CPAA 1TK5A 4BWJA 5G21A 2PRQA 2R8IA 3SI8A 2KZZA 3VCDA 5I3QA 3C3LA 1AFIA 2C2OB 3I9SA 3H5XA 6FD1A 3ZZRA 2JEFA 5SZTA 3SXOA 1K73T 1P0HA 2GCFA 2Z11A 1DTDA 2ZHBA 2DBBA 2XY6A 2C2NA 4DQRA 5I42A 3SJEA 3CPWR 1HDUA 2GIFA 2RSQA 5F47A 4OYIA 2AHOB 4P4IA 3VQTA 3FDSA 4F4WA 3PYFA 3BN7A 4R5PB 5HMNA 2D3UA 1JWWA 3P5BP 1Z2ZA 1MSWD 2V2VA 1FX4A 1Y3JA 4DSJA 1TKDA 2HMIA 2AJQA 2ZEJA 4WU3A 3FK4A 5C82A 3W64A 3VAIA 2OPPA 3J7YU 1U24A 4DR6J 1NDCA 2BM0A 1MN7A 5B0AA 3KYLA 4JBCA 4KOWA 4TY8B 2DXQA 1H6KX 1RT6A 4IK2A 3ENAA 2MQPA 1VYAA 4RI1A 4L73A 2CDQA 2ZW4A 3HVWA 4PCQA 5A6PA 3G6VA 1HMVB 1RWOB 4LFAJ 3IR6B 5U47A 4ZJOA 1HBUA 2E5GA 1CQMA 4OIWA 3S01A 3EZUA 4MHDA 1RADB 4FS2A 1U26A 1PC4A 1D9FA 2B4UA 1HL6A 2YNHB 3EFAA 3C2PA 2E9RX 2MXYA 3AD8C 3SXLA 4HNWB 3MF5A 2R7XA 3NE8A 1QSOA 1CJVA 1UFKA 1RU2A 4ID5A 3DLEB 5KG7A 1VIXA 3QJPA 4IOAQ 3ZTRA 4OYOA 2YX7A 4USJC 4C3KA 1UVJA 1YLXA 1HBNA 4PR6A 4KLVA 3GIMA 4F3OA 1Q2CA 2FHOB 1HKAA 1FXLA 2NR0A 2CQBA 4ZLNA 2C6CA 3PACA 2K2PA 2RNEA