2VL1A

Crystal structure of beta-alanine synthase from saccharomyces kluyveri in complex with a gly-gly peptide
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
433
structure length
433
Chain Sequence
b'PLSIASGRLNQTILETGSQFGGVARWGQESHEFGMRRLAGTALDGAMRDWFTNECESLGCKVKVDKIGNMFAVYPGKNGGKPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNYVPNYDVCVVVWFNEEGARFARSCTGSSVWSHDLSLEEAYGLMSVGEDKPESVYDSLKNIGYIGDTPASYKENEIDAHFELHIEQGPILEDENKAIGIVTGVQAYNWQKVTVHGVGAHAGTTPWRLRKDALLMSSKMIVAASEIAQRHNGLFTCGIIDAKPYSVNIIPGEVSFTLDFRHPSDDVLATMLKEAAAEFDRLIKINDGGALSYESETLQVSPAVNFHEVCIECVSRSAFAQFKKDQVRQIWSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPEEIENGFKVLLQAIINYDNYRVIRGHQFPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BETA-ALANINE SYNTHASE
publication title A Recruited Protease is Involved in Catabolism of Pyrimidines.
pubmed doi rcsb
source organism Saccharomyces kluyveri
molecule tags Hydrolase
total genus 162
structure length 433
sequence length 433
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.6: Beta-ureidopropionase.
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vl1A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2vl1A01
5CPAA 4F9UA 3D68A 3S9MA 1LFWA 3HUVA 4ONWA 3MN8A 4R7MA 4OKOA 3SI2A 3WT4A 2BCOA 2ZEHA 4DUKA 4DYOA 3S9NA 3IWWA 2ANPA 3S9LA 3DLJA 2PVVA 3QNVA 3B7IA 1EE3P 1CX8A 2AFWA 1ZG7A 1FNOA 3KQZA 2ZEGA 4MHPA 3D66A 3WABA 1LOKA 3FECA 4B6ZA 4NGNA 1Y7EA 4ZY0A 2OR4A 4NFRA 1ELMP 1GYTA 4OC0A 4P44A 1DE4C 2DEAA 3GB0A 3FVLA 4OC2A 2NYQA 1AMPA 1IY7A 1BPNA 3V38A 1CP7A 1ZG9A 2C1CA 4OIWA 1VGYA 3FEDA 1VHEA 1CPXA 3B3WA 3KQXA 2PJ0A 4GM5A 1VHOA 2PJBA 1LAPA 3KL9A 2Q43A 2RFHA 4W9YA 2ZENA 4KSIA 8CPAA 2F8HA 4NJRA 2QYVA 2ZOFA 2AFMA 1PCAA 4NGMA 1CBXA 2Q4ZA 5HVGA 3PB8X 4MXUA 1XMBA 5K8MA 2IQ6A 3H8GA 3B3TA 3DGVA 3B35A 1YSJA 3KHXA 2V77A 2ZEDA 4MHZA 2IMOA 3D7FA 2ZEMA 4OIDA 4BD9A 5HXDA 3SJEA 4YU9A 2ABZA 5K8OA 1NSAA 3B3VA 5HVHA 4P4IA 4PXBA 1BAVA 3MRUA 5JH9A 2PJ5A 1RTQA 1ARLA 3K9TA 1OBRA 3VATA 2HB6A 4FUUA 3KI9A 4JYWA 4TWEA 4UIAA 3N5FA 4MCSA 3SI0A 4O23A 2GREA 4ZI6A 1TKHA 3VH9A 4P10A 2IJZA 5IB9A 2V8HA 1AYEA 1TF8A 2XEIA 4Q7AA 2AFSA 4X2TA 3PB4X 4H2KA 4A39A 1KWMA 4NGTA 1CP6A 4OMEA 1QQ9A 3B3CA 4MCRA 4P45A 3ISXA 4AXVA 2XEJA 2CTCA 3PB7X 2EK8A 4CPAA 3T8WA 2V8GA 4UF4A 3FJUA 1Z2LA 1JQGA 3KR5A 3BI0A 4F8ZA 4A94A 4MHNA 6CPAA 1LANA 4IAVA 3FH4A 2PJ3A 1CPSA 1F2OA 1XRYA 5F09A 2PJ9A 3FMCA 5LRJA 4NGRA 1ZLHA 2I3CA 1TF9A 4FBEA 5D8NA 1TXRA 3SJGA 5J1QA 4X3RA 4OP4A 2QJ8A 3KGQA 1F2PA 5CBMA 3RZAA 4A38A 2PRQA 4R76A 3BHXA 3D4UA 4P6YA 2JBJA 1YMEA 3RBUA 1Z5RA 5DS0A 1UWYA 3KR4A 3JRUA 4P4DA 2V8DA 1YW4A 3K2KA 1BLLE 3BI1A 1F57A 2ZELA 5K8PA 2PIYA 2C6GA 4MHYA 2ZEPA 2BOAA 3NH5A 2AFUA 1Q7LA 4OC1A 1ELLP 2F7VA 1LCPA 3CT9A 4P4EA 2CTBA 2AFXA 4EWTA 4NGPA 2GU2A 3TC8A 3LWUA 5LRGA 1BPMA 1HEEA 3H8EA 5THWA 4A37A 4PXCA 5HVFA 4EMEA 1HDUA 3CPAA 2PJ6A 3IFEA 5JGFA 3TX8A 3PFOA 4LQGA 4RUHA 3PB9X 1XFOA 1ZLIA 4OC3A 7CPAA 4DJLA 4PQAA 3CPXA 2CIJA 5ELYA 1YW6A 4MRIA 1IGBA 3PEIA 4JZ0A 3IO1A 5LYLA 1H8LA 2PJ2A 1CG2A 4MCPA 3FF3A 3KZWA 4NJQA 2JEWA 4FWUA 2EWBA 2GLJA 3HLPA 1TKJA 4F9VA 2CF4A 2PJCA 4ZY2A 3D7DA 4K3NA 2BO9A 3IC1A 4P4JA 2PVWA 2ZEFA 3FEEA 3ISZA 5LYDA 4TNUA 2G9DA 4PXEA 1Z8LA 5K8NA 2PJ8A 1YLOA 4R6TA 4MMOA 3GUXA 3WC6A 3D67A 4IK2A 2QVPA 3V7ZA 2HC9A 3PBBA 3D7HA 1Y0YA 5LRKA 1PYTB 4FAIA 4ZYQA 2XEGA 2PJAA 4G1PA 4P4FA 3PFEA 2AFZA 3FX6A 3BXMA 3PB6X 3SJFA 1FT7A 2C6PA 4WJBA 2RB7A 1XBUA 4UEFA 2OOTA 2WZNA 3B2YA 3H8FA 3PBEA 2ZEEA 4NGSA 1ZG8A 1VIXA 3SI1A 3GLJA 4YWYA 1TKFA 2ZOGA 1QMUA 2PJ1A 3B3SA 4OC4A 5I4MA 2PE3A 5LYIA 3NFZA 3VARA 2NSMA 3CDXA 3IEHA 4OC5A 4WWVA 1Y0RA 2PJ4A 3D7GA 5LYFA 3I1UA 4Z65A 2EK9A 3NH8A 2ZEOA 3PRTA 1DTDA 5JM6A 4ZY1A 3NA6A 4R8FA 3NH4A 2Q51A 1LAMA 2AFOA 2PCUA 2O53A 4EFDA 4UIBA 3LMSA 2POKA 1M4LA 4MCQA 4P4BA 2VL1A 1XJOA 3L2NA 2GLFA 4PPZA 2FVGA 4ZX9A 2JBKA 3WC5A 3IJ3A 2J9AA 4IHMA 3RAMA 4NGQA 3SJXA 4PXDA 4UEEA 5D29A 1ARMA 2WYRA 4ZX8A 2XEFA 4UEZA 3IIBA 1HDQA 2C6CA 4X8IA 2PIZA 1R43A 2V8VA 1R3NA 2O4HA 3KHZA 3KASA 3WC7A 2PJ7A
chains in the Genus database with same CATH superfamily
2RF2A 2NPIA 2OEKA 4HACA 1N52B 3GCWP 4DUKA 2ZEHA 4F26A 4DYOA 1LXJA 3FGVA 3S6EA 4OZ3A 1QUPA 5ETTA 4M6HA 3EZ5A 2AFWA 3TEGA 2JH3A 3J81Y 4KE5A 2EC2A 3TTHA 3MPYA 4NGNA 1KOHA 3VQSA 1RT3A 4KY3A 2ZEJA 3CDEA 2QMUB 2VODA 4NL5A 2W4DA 3C16A 2C2MB 5DLGA 3E01A 4D3GA 3V38A 2FHOB 1AUDA 5EDWA 5K14B 1RT6A 1IKVB 2J5AA 4OIXA 2PC6A 5H84A 1RQ0A 5ETQA 2PJ0A 1WC1A 2Y0SD 5E7OB 1NJWA 1DFDA 3IU2A 2CPEA 2HYIB 3HMJG 3I56S 4WK1A 3SCKE 1RXOB 1G1XA 1T05A 2AGQA 3TO8A 1HKAA 5F9NA 3EVMA 1XQIA 5D6GA 2B6AA 2Q4ZA 3NGTA 3TJ9A 3UDLA 4UQGA 3NAHA 3U1NA 3DLGA 3D7FA 5IOLA 4ZVPB 2DJWA 2CZ9A 5F0UA 4QYZK 5DWNA 2IYIA 4DLEA 2DGQA 3ILOA 3J80Y 4J90A 2LEPA 5KG0A 3TP2A 3QMQA 3VATA 3AA8A 2W8LA 3AB4B 3IGVA 4MCSA 4RNFA 1S1UB 4WKRA 4DX5A 4Y28C 3FFIA 4UBRA 1PAUB 2XMTA 4DPWA 4MCRA 3DXBA 3CNQP 4FD4A 4K4UA 4HKQA 4MFPA 3B6BA 1TK8A 4NASA 3WDOA 2DR9A 4KBIA 4R25A 1Z2LA 4ECUA 4P2FA 4LFAJ 5LJ5Y 1JLQB 1GQEA 4C11B 5U47A 1XRYA 1FRLA 1RHRB 1LWFB 2ZHAA 2GQ2A 2MTLA 2V2ZA 4J91A 1NHUA 4DR5F 3CMES 3J7YI 4N56A 2YKNB 3CXPA 1YGYA 3EGZA 5A0YA 5HSPA 1DY3A 3M8PA 5F3TA 4R5PB 3KGQA 1VFJA 2CG8A 2AYBA 4CLLA 1S7LA 3TUIC 2V8DA 4KT0C 1MJAA 4PQUB 4WP9A 3T1YJ 4ZP9A 4DFMA 4OX6A 1NSQA 4MHYA 2ILYA 3CXSA 4QUSA 2B9XA 4FXVA 4W90B 2VFRA 2ASDA 3C14A 1B6BA 4RW4B 2IM3A 1CJUA 2QEXS 4P4EA 4WE1B 4QWDA 4NEYA 2XEXA 3L9ZA 3HHLB 1G6BA 1Z9UA 4P72A 1OY9A 2PJ6A 4DV0J 1FDNA 4JI3F 3ISNC 4B17A 3G8WA 5ETVA 1RU2A 2WVFA 2BKNA 4XPLA 1FJEB 4ZJQA 1ICEB 1ROFA 4GVBB 3PZJA 3R5GA 4DV3J 4X65F 3FF3A 4EI2A 1X4AA 1TV6A 3W65A 4DR1J 4EK2A 2OMLA 1KUYA 1C0TB 4RW6A 2E7WA 3W2WA 1RTZA 3M2VA 4NZ6A 2ALYB 2KFYA 3VVUA 4EVYA 2VBYA 3V4IB 3IGNA 3TO9A 2O5DA 5LRKA 1JK9B 1H2TZ 2PFDA 1T0TV 2XSJB 2XMMA 2BE2B 1TUGB 1VBYA 2NQPA 2WB1D 3DNSA 3DI6B 1SIZA 4NMXA 1Q8IA 3M32A 1T02A 2UUWA 1Q53A 4NI2A 2KT5A 5EHHA 2VXKA 3Q8SB 1REGX 5G22A 3IWXA 4NGSA 1LW0A 3RYLA 2PR8A 1IBKF 2MZSA 1TKTA 2KI2A 4U8VA 1CEZA 2W9CA 2M0GB 4KQZA 2HQCA 3LTOA 2DNQA 4GKJJ 4NCAA 2BSWA 3IWGA 5IT4A 1Y00A 4NXMJ 5DDPC 3OTOF 2D3O1 1Q2CA 3RGIA 2VQEF 1FESA 2QO3A 2JDCA 1RBLA 5EBVA 2KL8A 3WC2A 2QGFB 3IR6B 4UIBA 2ZD1A 3DDKA 4B02A 2JHEA 1YJRA 3BGOP 4XPKA 1H2UX 3UNYA 5BYRA 4K2JA 4L75A 4K4ZA 1EKRA 3SCIE 3MECA 4KH0B 3GV7B 2UUBJ 4NGQA 3VWDA 1U6ZA 3AXMA 4F8RA 4O3PA 5CH7B 4QWAA 2AHOB 5HMXA 2UU9F 2H65B 3NOCA 1NM2A 1JLCB 3D68A 3ISND 1FE0A 1LWCA 3ENQA 1NCLA 2AYEA 3CO9A 2XY7A 2EVNA 5B0CA 3RAQA 1WDTA 4K0KF 2JWNA 4MHPA 1LWXA 1RGVA 2E5JA 1U7LA 4ZY0A 5KFCA 3H40A 4C48A 3JB9k 3GR1A 4KSEB 2HBQB 3GSDA 1YLXA 5AXNA 4B3SJ 4ZPWR 3IG1B 3MPVA 3HCXA 4J9SA 3SXLA 1SH0A 3RAXA 4B11A 2XO7A 4OJGA 1DTTB 2R4FA 1OIAA 3BB5A 5L1KA 4ZGYB 1DZ5A 1Q7LB 2KXNB 4X4RA 3FXTA 1UL3A 1XMQF 2Q43A 2RFHA 4Y2IA 3QSYB 2QYVA 4J9RA 1KTVA 1M0SA 2EG1A 2V94A 1Y7PA 1Q5VA 3DOLA 2I5JB 2JOQA 3B82A 1TL3B 4UZCA 1CJKB 5LSLA 4ZPBA 5DQHA 4YU9A 2XC9A 3MUMP 2GO8A 4MHDA 2D69A 3MEDA 1QLNA 2FHJA 2M3DA 5HP1A 1GXUA 4LRBA 2YNFA 3BV8A 3CDBA 3TJ8A 2F40A 5A8WA 2MKKA 4RUBA 2AW0A 2K3KA 3NY0A 4FUUA 3KI9A 1CS4B 4ZI6A 4KYZA 1LFPA 4LIWA 5KG7A 4QR2A 3TE4A 2B4BA 1ZH5A 1S0MA 4J9LA 3O3LA 1XBWA 3OXFA 4CYUB 3MM9B 1VQYA 1VRTA 2DF5A 2HVDA 2CKWA 3LUYA 2F4VF 4ER8A 3L7UA 1GX6A 4ZBGA 4BDPA 3G9CA 3PB7X 4RNHA 5BJRA 5F46A 3I0RA 1N34F 5T14A 1NMEB 1JQGA 4JV0A 4P74A 1DQAA 2JC1A 4F4YA 1O5JA 1D0EA 2X1FA 5F09A 3TZWA 2JZ5A 3LPEA 2QFIA 2KH9A 2FIWA 4TQRA 2BM1A 1KN6A 2H5JB 3DLBA 4P7VA 3DNCA 4X3RA 4LQ6A 4TYAA 3LP0A 3G87A 3MOZA 1SPBP 1NJXA 4OV1A 3I3GA 1SV5A 3G6YA 3HJFA 1U6MA 3NE8A 3JRUA 1Z4RA 4IG3A 1M4DA 2N7YA 1K1SA 5C24A 2KXFA 1TUWA 2NXUA 2QX0A 1IBCB 4DXLA 4DV1F 4CLSA 2HWIA 3MUTP 3KFWX 2E66A 2ZZMA 4BMHA 1HI1A 2RDIA 1K47A 3FCVA 4JI2F 2OO4A 3M8QB 4NLTA 2ZJQQ 1GT8A 1O51A 1HBNA 1IUJA 3KOAA 3NGKA 1ZTTA 2ZH4A 1HPZA 3J7ZT 1NSPA 2CADA 2W01A 3Q89A 1YQEA 4RUHA 3CEDA 2VICA 1TKZB 3R1HA 2XS2A 1K73T 1U8SA 3EVOA 3NCPA 4AVAA 2BABA 2FJXA 5EN1A 2AGPA 4WXWA 2Q1LA 4FWUA 3CC4S 1ZTWA 1RWPB 3RBDA 2RILA 3TAMA 2MQMA 4C8YA 4XDDA 1R8BA 2GVDB 3MMAA 1YGHA 4RO0A 2ZEFA 3B54A 1RT4A 3Q8UA 2D9PA 2MQNA 2F63A 2VFTA 3C16B 5K8NA 3E01B 4UFWA 3AHPA 3CC2S 5HK4A 4IK2A 2H1YA 1RT6B 1P4NA 1SJRA 3CCMS 2E5LF 3NL0A 1BQXA 2G13A 4P4FA 2DKOB 2AFZA 3PB6X 3SJFA 5ETOA 3KUEA 4DMZA 3RW7A 1T05B 3CCQS 2BACA 5ETMA 2FHMA 1QSSA 2XMVA 2EI5A 3NCQA 1CJWA 1R8AA 1X5PA 1HHTP 2RHSB 1HNXJ 2DNMA 1VIXA 5KFJA 4YHHF 3DLGB 2CQIA 3BYRA 1VC5A 4YQWA 4UCMA 5I4MA 3CVKA 4AD6A 1U25A 2G2OA 5KT2A 1W2IA 5IXUA 1EQMA 5KAKA 5FLXU 4YY3J 1UFLA 3WC0A 3I5CA 3T6BA 3FFIB 1S9FA 1RK8A 1P9QC 2Q6CA 3F8KA 4QPTA 2NZCA 1RHJB 1VQ7S 3KG0A 2JBKA 5C2GA 3OHAA 3NMRA 1RWOB 2W7OA 3GJQB 1BQNA 1PU9A 3EJMA 1IQTA 1R57A 2XY6A 2PEHA 3SYZA 2XS5A 1R3NA 2C3UA 2YXLA 2F5IA 3TCVA 1NK7A 4DN0A 4R0EA 4F3MA 2V50A 3R2DJ 2W4PA 4L74A 4RNNA 3S9MA 5C82A 4KPYA 2IHR1 3G3SA 3QIDA 1RBAA 1FNMA 3BLNA 2OTLS 5D4LA 2ZJRQ 2BJ7A 1A0OB 3KQZA 3V8IA 1JKHB 3IR5B 2RJZA 4ZCMA 1H73A 4B6ZA 2HHUA 2PFFB 4P44A 2C2KB 4M8LA 1VISA 2HRTA 1R0AA 3LW5C 3ZZUA 4FXWA 4CYOA 1VDHA 5C25A 4DFPA 2GJ2A 2K1RA 2ROGA 1KKHA 1K4JA 2N3OA 2OIHA 3PY8A 4Y3CA 4BC9A 2CPIA 1V5VA 1SQFA 2G3AA 5AG5A 2Q0YA 1CJUB 4ZJLA 2HNDA 1HNWJ 1IJFB 3OR2A 1N56A 4ELUA 4LR9A 5HVGA 4NCZA 2AF6A 3WX8A 4B3MJ 4C97A 3B35A 1M1GA 1VBXA 4TVAB 2J8RA 5KFZA 4QB9A 2P9GA 2ABZA 1U0SA 1RTHA 2XMJA 4KUAA 5C2CA 3PX4A 1XN9A 3U7JA 1HD1A 2P6GA 2VG5A 1YJNS 1TV6B 4DX8H 4HNYB 4O23A 2CG4A 4KOVA 3G8SA 3UD3P 5HMWA 4RW6B 1H7XA 3W2WB 4BWMA 3M2VB 2GVZA 2Y3YA 4C8OA 1RHKB 4DZ6A 3HSJA 3IBWA 4QWBA 3ZTRA 4QBJA 3SZ2A 4KORA 5HROA 5D0EA 2R1IA 4LVOP 2V2KA 2WB4A 2IMWP 1FERA 1IBMJ 4HNWB 4J9MA 1U1KA 3QB8A 4F8ZA 4O3OA 2ZH7A 4OYMA 4IAVA 3W1YC 2RHQB 1PJ6A 3M32B 4ZN3A 1F2OA 1PBUA 2M7SA 1IM4A 3BM7A 1AB8A 3KJQB 2OU2A 3PX0A 2YWGA 1ACMB 1VK8A 3D0GE 4A48A 5EC4A 1LW0B 2DD8S 2I38A 3HT3A 4UFXA 2W9CB 2IL4A 3MPWA 4OZJA 2HFOA 8AT1B 3U1LA 4ECQA 4B08A 2ZHBA 2CJ9A 2YKOA 1C4AA 2R3VA 4QWCA 1U4BA 1LWEA 3RBUA 2AZ3A 2AV5A 2DGVA 1HNVA 5IC6B 3WIUA 2CDRB 1VHIA 4NLUA 1SKUB 4DF4A 2KB2A 1JIHA 2PEBA 3M8YA 3ZZOA 4LUBA 2KFZA 2J9DA 2ZD1B 4BHQA 4P6QA 1R6YA 3LGNA 2ABYA 1S60A 3QZ8A 3LALA 2FZKB 1TVRA 2IJRA 2HS3A 5F8IA 1DURA 3HX9A 4EMEA 4FNHA 1JLFA 4AQYJ 1IKXA 3PFOA 3A8JA 3V6JA 2CZVC 3A3NB 2QL5B 2CUYA 1SUQA 4MRIA 4JZ0A 4P75A 3DDDA 5IV0A 4QYZJ 5DQIA 3W9JA 2GCFA 2HZCA 4OJHA 5CAAA 3HHLC 1SVDA 2DISA 2YNCC 1CC8A 3AD9C 4P4JA 3QJLA 4IH6A 1S6PA 3FEEA 3ISZA 1MROB 4U95A 2KM8B 3DM2A 3C3LA 2QECA 4IUFA 1Z8LA 1BUXA 4C0HA 2V4QA 4OYIA 2UVWA 4X84A 4KOXA 3D7HA 3OVAA 2FD2A 3GYNA 4ZCIA 3MGJA 1T9TA 2VQFF 5FVJA 3P6YC 4I56A 2XQCA 4IOBA 4FBUA 2VBXA 2AGOA 1D9AA 1E6VA 2CPJA 3C6TB 3MFHA 5L8RC 4FYDA 4IF5A 3K5LA 1M1KT 2OOTA 1SC4B 4TNOA 1GTHA 3DOLB 2RAQA 1S10A 3LH2S 3A13A 2HHWA 5KT6A 2WTFA 3ELHA 4H4MB 5DLFA 3IMQJ 4AL6A 1BWVA 2CQ0A 1N5VA 2DEJA 3NKYA 5CD4A 3DRRA 2R2RA 1S72S 3MEDB 4NLOA 1WI6A 1S57A 2NSMA 4M1KA 3CJ4A 5HP1B 1S59A 2NXCA 5A8WB 4B9LA 4PABA 5JM6A 2FC8A 4ZY1A 2LQBA 3T19A 2NXEA 1LAMA 2COLA 1VRTB 3POTB 5D0GA 5A6PA 4LF1A 3AJ2A 3FRMA 4FPIA 1JXVA 1FJGF 1B64A 3KLFA 3V6DA 3RAMA 5DDQC 3PO4A 2XYGB 1FXLA 3OSPA 3B8GA 3I0RB 2E1RA 2QJ3A 5DGBA 3RB0A 1I94J 3H20A 5CPAA 4HKFA 4K50A 1Q86T 4R7MA 4LF9J 3L7PA 2VIHA 1EETB 5A8RA 4OFZA 4OYZA 2XWXA 3D66A 2JVOA 4JYAF 1S9GA 5F8GA 2APOA 3G96A 3LP0B 1KLNA 1CPZA 3LODA 2FIAA 2FLOA 1ZZNA 4X2BA 3FVLA 2M8DB 1SV5B 4KPCA 4PV6A 4GVLA 1HIYA 2GO9A 1S7NA 2QIFA 3CJ0A 4X4PA 4IG3B 4LRDA 5B7WA 1SJ3P 5C24B 3HKWA 3FEDA 2WZ1A 4ZCKA 1I12A 4PG8A 1RISA 3CSKA 3N0VA 1N5SA 4ZHRA 2XGPA 1K9MT 2OSQA 1LAPA 2ROEA 1FNXH 5G21A 2QG9B 3FB3A 4NWBA 4ILLA 2OZHA 3M7VA 4OADA 2D41A 2ILZA 1F9EB 3PB8X 1JXLA 2LXFA 4LR8A 4K4WA 1HPZB 3DGVA 1FWKA 5KFMA 3S01A 3QIPA 4F2SA 1N33J 2JEIA 2ZEDA 3OW2R 3BPDA 3DU5A 3D8PA 2CQBA 2ZUAA 5HVHA 3RU0A 2KCWA 4USJC 2OUGA 3K9TA 4CAFA 1S1WA 3GYXB 4KOTA 4CYNA 2B56A 1U1RA 2GREA 2HQYA 4M85A 3TAMB 3GIMA 3A3OB 4A8QA 3OPKA 2V8HA 3MMAB 1WC6A 1AYEA 1AUSL 4ECSA 5IV4A 4X2TA 1RT4B 4H6ZA 3GG1A 3FUYA 2QSFA 5L39A 3LOUA 2J8AA 1TL7A 4RUAA 3D1HA 1X4CA 1RAHB 1AA1B 2Z2LA 2BDPA 3MAHA 4OJ1A 3RRKA 2R8KA 2CJQA 4ED7A 2E1CA 2XCAA 2KN4A 2GQQA 2XMKA 5KFDA 1RTIB 4JP8A 5IM0A 4C68A 3PO5A 2HHHF 3M4XA 4DJBA 2G1HA 1DTQA 1S5KA 1JJ4A 4WFXA 4NZ7A 1B3TA 4Y49B 1PYTA 3DLHA 5CXTA 3R27A 4Q38A 3I5BA 3KJNB 2KT2A 3IM9A 4RNMA 3P3DA 3R7BB 2PDOA 3CDWA 4KR0B 4YMEA 1FRXA 2FL4A 3US5A 4C9DA 1H0HB 5KFWA 4DR5J 1S4FA 5B0DA 2G2YA 1UW4A 2FIUA 3CT9A 3BN4A 3M8ZA 3TC8A 1CSJA 2Y9HA 2FJWA 4YB6A 2BJEA 4MH8A 1TKXA 5THWA 2HSEB 4LF6J 1Q81T 4YFUA 3PB9X 2NYIA 7CPAA 1LXNA 4ED2A 2CIJA 2F4FA 3NE7A 4KOWA 5BXIA 3HHNB 3N01A 4XIUA 2FS5A 3EDQB 1CG2A 3SI8A 1S7IA 1S5ZA 2CQHA 3KDNA 2RNEA 2FUG9 1HBUA 2JEWA 2EWBA 3EGVA 4WP8A 1UVIA 4ZY2A 4LJMA 1X0FA 2W7AA 4CAEA 4KHMA 4TNUA 1NK0A 1B70B 3DRYA 3EYZA 1R0AB 5IB0A 2PJ8A 1YLOA 1RE1B 4K4XA 4WXOA 4KJIA 4OI0A 1TELA 5C25B 4MKBA 2MXYA 2B4VA 4R87A 3WX4A 2MKCA 2YH0A 4UOCA 4ZVEA 4G1PA 3RB3A 3OV7A 4B5PB 2B4UA 2KDOA 4KOYA 4A95A 4WKYA 4X65J 2DH8A 3BH7B 3MR2A 3BO2A 3VAFA 2HNDB 4DSEA 2ODFA 1FJCA 3DHXA 3OR2B 4B12A 5E5NA 2UXDJ 3PBEA 2ADBA 3NGRA 3IRWP 4HDHA 3SI1A 3CJ5A 2DO4A 3Q24A 5KFTA 3D3SA 4NLQA 2PJ1A 3AQPA 3UFCX 1AXQA 1NDKA 2JDDA 4DUZJ 2KG1A 1RTHB 4MJKA 2JEGA 2LDYA 4CGPA 1GX5A 3D0IE 1ZA2B 4GMKA 1RT1A 2AEMA 2YKMB 1Y0RA 5BR8F 2EK9A 3FKBA 4LSLA 2MKJA 3MURP 4O4GA 2G9OA 1JLEA 1QJHA 2GVZB 2ASYA 2NREA 1X5OA 2X1GA 3EICA 2VPXB 5KFFA 1NZ8A 4FBTA 4LFAF 1YBUA 2P9EA 2BYCA 4PXDA 1RBOB 4HI1A 5FLXY 3AODA 3N9UC 5F8MA 2AJ1A 1MWQA 4X8IA 4IQXA 1MSWD 2O4HA 3JAMU 1NJYA 2BJ1A 2FVRA 5KT3A 2XLJA 3M9NB 2VQEJ 2AYGA 7FDRA 4C3KA 4ONWA 3RUBL 4ONUA 4PZVA 2ANPA 2PVVA 3IWNC 1HHQA 2E5IA 1KQFB 4KH1B 2C2NA 2E9TA 1U2RA 3PKYA 3KDOA 1Q82T 2ZW5A 2Z58B 2ZNYA 3R2CJ 3FECA 2LP4A 4DCPB 3ILIA 3KKFA 1D09B 3MZIA 4ETXA 2J7KA 4O3QA 2R8IA 1RAGB 1T03A 4DPXA 3OTEA 2JLGA 4WYLA 1FI4A 4EFAC 3GJTB 1IY7A 4HVZA 1BPNA 1NDPA 4ES3A 1HNVB 4OIWA 4F3QA 1HLWA 3QAHA 3TQEA 4AFFA 4OHWA 3MCMA 4EO6A 3R5CA 1HL6A 3PYFA 5KFXA 4NXYA 4BC7A 3EY5A 1M5OC 2Y0BB 3EXNA 3K5PA 4AUKA 2GA7A 3MM5A 3ITHA 1TVRB 4DV0F 1KVJA 5IQQA 4P2XA 4CQ1A 1HQ2A 2VG6B 4NGMA 1NB7A 5LM7E 1SI9A 1RT5A 3D6TB 5E3RA 5E96A 2W1BA 1JLFB 4DV3F 1IKXB 2GC8A 3KLGA 1NSAA 1SUQB 1ZYQA 3MRUA 4PRFA 5SZTA 4CLFA 2V63A 1BOBA 2GANA 4QVTA 2HNYA 4X64F 3GV5B 2RQCA 1R6VA 4RW7A 4U8YA 3PCOB 1S6PB 2GIRA 3D0HE 3DM2B 3DLEA 4NGTA 2JLFA 4W98A 2U2FA 2VFSA 3DDNA 1H3DA 2H5IB 4DS5A 3ISXA 4U7CA 4AXVA 4ZKAA 4YUDA 2IJNA 3IS9A 1XR7A 3OLAA 2KT3A 3TNVA 2Q66A 3LAMA 3CB4A 1OSCA 3FMWA 2DNYA 2AX1A 1UW9A 1A6LA 1Y11A 5HQ8A 3N4WA 1E6VB 1Q7YT 2D1CA 2DK2A 1Z8TA 3HP6A 5CNPA 4OZNA 4GKJF 3P2FA 2DHSA 2KHDA 3V2UC 2F8MA 3FEYB 3EMTA 5F48A 3M6XA 1VHSA 2OELA 2HHVA 3DRRB 2GHWA 2OH1A 2KYZA 1YJVA 2L9NA 3TVYA 2KG0A 4F04B 4RUCA 1J4JA 2JBJA 3PXGa 2Z8QA 4C8KA 3VAMA 3NG8A 1HWKA 3Q8RB 1RB0A 4J7CA 2Z56B 4DL7A 2P5VA 4CLTA 2CFXA 5H9EK 1FWLA 4E2FB 2ZBPA 1X5SA 3LWMA 3P5TL 2UUBF 2B9EA 3X1LB 1NK5A 3ENVA 4QOTA 1IWAA 2F7VA 3CGIA 4WTYA 4NGPA 3KLFB 2B43A 3V6DB 3MAAA 4JB8B 4F0YA 3THTA 4FYVB 1PAEX 1Q8KA 4F4WA 3PVXA 3I31A 1S1TA 1KHVA 2AU0A 3JSMA 1ZLIA 1X4DA 3EX7B 4P2MA 3HVWA 2KRRA 3O5TB 4EZ9A 3TYTA 1NU4A 2B3VA 4DV1J 3MM6A 4B3SF 1Z4EA 1BHNA 1DRZA 4F9VA 3IWEA 1S9GB 2NSCA 2WCXA 3GPAA 1RYRA 4JI6F 5LYDA 2G9DA 4IKAA 4FPRA 4PXEA 4GS4A 5KG1A 3IP0A 5KT5A 2WRMA 2LA4A 2Y8YA 3CJKA 3TX0A 2QVPA 1R0CB 1BO4A 3ULHA 4EEYA 4ZHRB 4FYXB 4JI8J 1GTEA 2DNKA 4ES2A 2DGXA 4JV2A 3CDAA 3MGDA 4H89A 2Z3LA 3QNWB 3R6LB 2LEBA 4WBFA 4X4VA 2KM8C 4X4QA 1EJ7L 4NCGA 2NUHA 4QW9A 1FK9A 2UXBF 1UPMB 2QZ8A 1ZG8A 2B7CB 4CGMA 3QIPB 1FF2A 3GLJA 1C2PA 5GADU 5I42A 2D3OR 3N6LA 4I0WA 3C26A 2RD5C 1T3NA 3W91A 1CJVA 2YNIA 2C2ZB 1F60B 1FA0A 1C0UA 3THPA 3EWGA 2MGZA 1S1WB 1JX4A 1DTDA 3W6XA 4X66J 3NA6A 1GK8A 2OZGA 1VC6A 3HT0A 4CAVA 3CJQA 2HW3A 1Y10A 1VHFA 3N28A 4YHHJ 4J9UE 1TL7B 1R8CA 3ETOA 4RW8B 2FLLA 2WYRA 4OYPA 5E3CA 2XEFA 3IIBA 3QGHA 5CD4H 2D4OA 1TAQA 2V4JB 4XNHC 1A7GE 3DRSA 1HWLA 3TA2A 3HHEA 1XNRJ 5IM0B 4EYIB 2Q44A 4IDKA 3S9LA 1DTQB 4JI7J 3B7IA 5LXRA 2XM3A 3UDCA 3R8YA 2QLWA 1FVQA 2XYPB 5ETPA 3DRPA 1UMJA 3FQLA 3SSRA 1KNZA 5F47A 1AROP 1OPZA 3B8HA 3GIRA 1R8HA 2HZVA 1DE4C 2HWHA 2DEAA 4LX9A 5A8KA 4QWEA 4M5HA 3AOAA 2MKIA 2A6OA 2PMHA 2PMWA 3KTQA 2UZAA 2VV5A 3QJPA 2YKPA 3DLLQ 3B3WA 4C98A 5KFUA 1VHOA 1IXKA 4YB1P 3VGVA 1M44A 2R7VA 4XAKA 3W6SA 1RABB 3PRVA 3KL9A 4IOAQ 4KSIA 1HARA 1VMBA 2ZOFA 2QRRA 1O6XA 2C1EB 3HULA 5K8MA 2DHXA 3H8GA 2XSFA 4WF9Q 3LD2A 3DR8A 2MYFA 4URQU 1FRKA 4LQ9A 3FRZA 1NPKA 3SIPB 2J0WA 5K8OA 2REFA 1I1GA 2NPFA 4NMLA 4N7TA 4PXBA 4I6WA 1BAVA 3UCUP 3N6MA 4B9NA 3F41A 4NEXA 2AJ4A 1H74A 1OBRA 4B3OA 3GIIA 5GMKa 1HBUB 1A9NB 1YVKA 3VH9A 2P6FA 2LEAA 1U0HA 3P8BB 3UY5A 3TUJC 3T5HA 1YZ7A 3QT8A 4DR3J 1PYOB 4HT5A 4GKKJ 4OAEA 4H2KA 9RUBA 2YWKA 5BYSA 3PRBA 3TZZA 4CTAA 1NJIT 4CS0B 3AFGA 4USIA 1TFYA 3EXYA 5C7PA 3IM8A 1LK7A 3Q2TC 2PC1A 1TIQA 1UJ6A 2YX1A 1PC5A 2FHJD 2GW8A 2R7QA 1IKYA 1YI2S 3KG1A 2MQPA 2DGTA 3I96A 3CMAS 1ZETA 1HNXF 4A94A 1LANA 4QZVB 4W92B 2CQ4A 1KR4A 4MIAA 1YWXA 1UKUA 3BDEA 1HWUA 1ZLHA 3H2VE 4L89A 2EKYA 4B3RF 1VRQC 3Q8VA 3KLEB 1TL4A 3D4UA 4YY3F 3D7SB 4CO4A 3KR4A 2CJBA 2Q7SA 1RT1B 1U47A 4CRYB 3KK1A 3MI7X 4UY85 2D9OA 4LSLB 2MKHA 2ZELA 1KQKA 4Y65A 4O4GB 4CGOA 1F6TA 2PD1A 4FYYB 3PDNA 2BEFA 3UPFA 4Y49C 1MMDA 1ELLP 4OYXA 2B58A 4X4UA 4ZPCA 3IN5A 2C2RA 1UVLA 3THVA 3RYOA 1HQEA 2O3DA 2CNMA 1CQMA 1IN0A 3IFEA 5ETNA 4P52A 1I3OB 1BWEA 1XFOA 2F9JA 3N6NA 4ICLA 4G1IA 3OD2A 4LMZA 2C3PA 4JI0F 1YW6A 3KHLA 3O8WA 1IBLF 2R8HA 3PEIA 8RUCA 4NPOA 2EEYA 2BE7D 2NZ4A 3OXGA 2OPRA 2IBKA 3L4BC 1G3OA 1JB0C 2GLJA 1HYSA 4U9YA 5G0RB 3FBFA 3JYTB 5KFYA 4IOCQ 2DXFA 2L08A 3LANA 2WSAA 2GAHC 2OI2A 4QIWD 2EBJA 1T03B 3E0KA 2K8GA 3KHRA 3R1KA 4E0AA 1OQ3A 4JUZA 1HNIA 2YWEA 1KFDA 5A76A 4DV6J 3PBBA 1SIWB 1NKBA 1UVJA 2YPZA 4ED0A 1RHUB 3MOJB 4B3MF 2V0NA 1Y3KA 4J37A 2DT9A 3MM5B 3ITHB 2B4DA 3DKDA 2VFUA 3D1OA 2B8QA 1RT5B 3IR7B 3MF5A 3PW5A 1FCAA 4RW9A 3HXMA 3NWRA 3VQTA 5KFAA 2C2DA 2ZOGA 4LF2A 1M5SA 1LQ9A 1I1DA 1VR6A 1SKWA 3KLGB 3TRGA 1SC6A 4D3HA 5BWAB 2YWFA 3I87A 1RCOB 5CCMA 1YBTA 3DGPA 2VU5A 2VQFJ 4OC5A 3BKFA 3D2MA 2G0IA 3GR0A 4B3TF 4BS2A 2HNYB 2AFOA 3FBEA 1C1BA 1HW8A 4RW7B 2O53A 2B7BB 1UA0A 4DFKA 2VG7A 1RUSA 3DLEB 1IBMF 4HTJA 3W3SA 1FVSA 1QAYA 5AJ3F 5IQ6A 3PR5B 1SC1B 5C42A 3PGPA 2C3YA 3H2UB 2FLPA 3A8KA 1VS3A 4OX7A 3SXOA 4P7TA 2I9SA 3BYPA 3W8GA 2FTRA 2E44A 1TL5A 1RP5A 4A8OA 2DGSA 4IQMA 3E3XA 1X0PA 3AH6A 2FVPA 3JSBA 1LFWA 1TFWA 3IWWA 1RWXB 2M52A 4ZVGA 5BYQA 2QLXA 1ZG7A 2Q4VA 3JAMY 5J2QB 3KG4A 3JTPA 1EAYC 2GGPA 4NFRA 4BBYA 5AE3A 2KTQA 4OYBA 3GB0A 2NYQA 4J3GA 5GAGI 2VBZA 2HGLA 1QAIA 1Y0HA 2AX0A 2RKIA 4N76A 3BN7A 2FJBB 3T6JA 1VHEA 1U02A 4E0DA 5CQGA 1D8ZA 3FNNA 4DQSA 1XEBA 2JEFA 3TR5A 2PJBA 2VFVA 6AT1B 3HD2A 2XMAA 4DL2A 1QSNA 5HQMA 2F8HA 3TUZC 2LXUA 4JWPA 4JYAJ 3MAAB 1YDLA 1FEHA 1XMBA 2FJDB 3MPUB 1RWWB 2ATLA 4K8RA 1S1TB 3PEHA 2VZYA 1TQLA 4DG1A 1YJUA 4F3OA 3NCRA 2HHSA 2QL9B 4P4IA 1TMMA 2QA4G 1SJ1A 1LRZA 3AD8C 2I8EA 4TWEA 2HHTA 1R27B 3PW7A 4ZVHA 5F8LA 3SSQA 3FZBA 4Q7AA 3Q83A 3ZTSA 1W7WA 1YX2A 3TO6A 4JI5J 4ID5A 1KWMA 2ZVSA 1WOOA 4Q2MA 3IAM9 1X31C 4CNYA 4DHVA 3C6UA 3CXCR 4Y34A 3OFEA 3BZQA 3CJKB 4A47A 4DUTA 1NBEB 2DPIA 4KB7A 2E5HA 2M9KA 3LP2A 2FJEB 1RWVB 2DNRA 3OXLA 2CQ2A 2ZM6F 2JNJA 4NCGB 4NGRA 4O44A 1WC0A 4DLGA 4WK3A 3H2LA 1J27A 5A27A 3BQ2A 4QQBA 5I42B 3R3TA 3BHXA 2YNIB 2FPHX 1WEYA 2EXUA 4N8OA 1YR0A 4NLWA 2N3LA 3EE3A 3OWCA 2IA0A 5KFNA 3CCTA 5K8PA 2HHHJ 4QU7A 5KG3A 2E9ZA 3OR1A 3QRRA 5HLFA 5LJ3Y 3AOBA 1LKZA 2UV8A 1M5HA 3GONA 2LXIA 2XS7A 4XPDB 4NZ0A 1I94F 2FCKA 5B0GA 2IRXA 4LF9F 3S8SA 1X12A 1IM6A 3QT6A 5L38A 1WWZA 4LQGA 3DRSB 3CPWR 4J9OA 2HUZA 2BR0A 1S79A 1MG7A 1QSLA 4B9SA 2Z3OA 4KC5A 1S1XB 4IDKB 1H8LA 3RBXA 1FFSB 2CYYA 4AVCA 2QYCA 1YHQS 1NKCA 1QVGR 2ACMA 5KFOA 1KD1T 2BKPA 2J7WA 3DRPB 5KFSA 4AL7A 5M2UA 4P2SA 1ZAXA 5FJ4A 5A8KB 4CGNA 2CY2A 1QE1A 2EFVA 3CD7A 1QAXA 5JQ4A 1FD2A 2M4MA 1N36J 2M70A 2W2NP 2HAFA 1FTRA 2LDIA 1S6OA 1SL2A 1N33F 2VZ9A 4ED5A 2PA8D 2A6MA 4QR0A 4RU9A 1S7HA 4N41A 3T9NA 2C2OB 5J2PA 2Z11A 2ZEEA 3FCWA 1Z1ZA 3EZUA 2OGUA 3R5JB 5L9NA 1QMUA 2R2TA 2W2OP 2J8SA 4DBQA 4LF5J 5LYIA 2RQKA 4AG9A 3S6FA 2BW7A 3SBMA 3HVRA 4PWWA 1IWGA 1RADB 1FWPA 3QT7A 2G0CA 5CYQB 2ZHOA 5D4OA 4MTPA 2X3GA 1U0HB 1YX0A 1LNQA 5LMNJ 3OJUA 5H9EJ 3MMCA 1T9WA 2HMIA 3K2YA 4P4BA 2BQ3A 4FN5A 4IUSA 1KDNA 3GFXA 2BM0A 2P8IA 5C88A 3DFEA 4CTAB 2Z3KA 4TLRA 3TW0A 4E8UA 1X8DA 2XMWA 1XC9A 3QFHA 4OQJA 5M2RA 2FVQA 1TK5A 4DR7J 2PIZA 2YVSA 5KOWA 5EWFA 1S0OA 2J9DE 5BR8J 3AAWB 3O6QA 5CCLA 2V8PA 3MN8A 4Y2KA 3GP9A 1FX2A 5HANA 1KVKA 3VAHA 3G8QA 4TXSA 4NXNF 2IY5B 1GYTA 5F8JA 5HAOA 4ZVOB 1UVMA 1NXIA 4M5DA 1S48A 2BEIA 5J8CA 3EPIA 2RDDA 4RR5A 4L3KA 1OZPA 3KK1B 2H51B 3VAIA 2YNEA 5I3UA 2PIIA 1K1QA 2D3ZA 5IC4B 5EWGA 2HBRB 4CH1A 2YNDA 2IM1A 3TUPA 2DBBA 4W9YA 4AYBD 4I2QA 4LF6F 4C7QA 3BH6B 4USHA 1J5EJ 1ZO0A 1HQEB 3H4BA 3HF5A 1PG5B 2RUSA 3TOAA 3I4PA 4ELVA 2VDIA 5D77A 1FO1A 3NS7B 2AIRB 1T9UA 4K59A 3Q22A 2N7CA 2PI5A 2IMOA 3K8VA 4MHZA 2MZQA 4DWIA 5KOXA 3OL7A 4ED3A 4ICLB 4NCBA 1XMTA 4U5YA 3ZZRA 2J6TA 3HVTA 2MY7A 2OAUA 1JJCB 3RG6A 2OPRB 1PIEA 4UIAA 1TK0A 3QRQA 3V5RA 1WNEA 1HYSB 4ES1A 2JEJA 4E2AA 1X9SA 1J2VA 3TA0A 1W2BR 2MZ1A 3M9OB 1H2VZ 3PHTA 4Z7YA 2D74B 5KFEA 3D6MB 4PSWA 5ISVA 1B0PA 3R7NB 2Y1IA 5IS2A 1QQ9A 1FDBA 1UFWA 1HNIB 5LSOA 1UEKA 3UE2A 2LLZA 1M1HA 5B0FA 1ZM9A 1OYEA 2V34A 4AE5A 2UXDF 3CJRA 3BI0A 1MN7A 2YKQA 2WHOA 3W64A 2FHKA 3V81B 2B4DB 1LOUA 4X64J 1VRUA 2YNGA 2Q4YA 1T95A 4A8KA 4YP3A 4DUZF 2V2QA 2HQ3A 4C8ZA 1UWBA 2I3CA 3GCXP 4RW9B 1KHWA 4FBEA 1REVA 1TXRA 4OJ3A 4FS1A 4YEAA 3JXOA 2OEMA 1QAJA 3RZAA 5H9FK 4R76A 4UY8T 3UI3A 1N0VC 4NF1A 1ULRA 2QLJB 1PILA 1R0BG 1HBOA 1QSOA 4C6AA 3QAUA 1UWYA 4NLGA 4YB7A 3DGPB 5HI7A 4P4DA 4CO2A 2PRBA 5H86A 4HI2A 5AXMA 2XZDB 3FCHA 3PW2A 3HSZA 2QLFB 3BBBA 2VPWB 2OB0A 3NH5A 1C1BB 2EFNA 2PR1A 3H98A 1NB2A 2VG7B 2PSWA 4DPYA 3BR9A 4U67Q 1RLCL 4USKA 2L9DA 3JS9A 1KEKA 3KNAA 5C42B 3NWGA 4URGA 3CCWA 3VAKA 3U1MA 3QWPA 5B0AA 3R9LA 1JJ2R 3ZTQA 1HA1A 1S7FA 5D4PA 3NNCA 1H72C 4IRDA 2RSQA 2DNOA 1FDAA 1KC8T 3BR8A 1MNEA 1F9FA 2I00A 1IGBA 4I67A 1BY9A 1NNDA 3LO3A 1FX4A 1Y9KA 4ANCA 2ZBQA 2Z30B 2JL9A 3BO4A 4ID8A 2OD4A 4ED8A 2CF4A 1XR6A 2ATCB 1HR0J 1AFJA 5KT7A 1V9OA 2CNKB 1Q1KA 3IAS9 2C2EA 3CXQA 2QFJA 4HHUA 1N88A 2KJWA 2A10A 3GZ7A 1RHMB 2MB0B 4X62J 2RKIB 3BSCA 4B14A 4ILMA 1P6TA 1DJ0A 3BKTA 4BCAA 1SCJB 2Z2ZA 3RB4A 1SKRA 3RR7A 4C3MA 3OUYA 2OPSA 5ADZA 4K7QA 3MEGA 1UJ4A 1WTFA 2YKAA 5LT5A 2RT3A 1CC7A 3KUGA 3R5BA 1XMOJ 4CZCA 5KFPA 5HH1A 5K14A 4JI6J 5RUBA 2QL7B 2YQ0A 1WHWA 4MK7A 1FTCA 4F02A 1TKFA 1TL1B 4FDFA 2CNSA 5F9LA 4DG1B 1FRIA 2P6EA 4LVNP 2ZH5A 5G4DA 1CJTA 3G8TA 2RQMA 3NFZA 3VARA 5DGAA 2GIQA 4KSFA 3D1QA 1X10A 2JDJA 1HMVA 1JLBA 2HBYB 3D7GA 3I1UA 1D9DA 2UXCF 4RX6A 2Q3PA 2YGWA 3I55S 3SXNA 2CPDA 4DV5J 1Y4ZB 2PCUA 4EFDA 4KGKA 5EGYA 4LFBJ 2UXBJ 4ID5B 4DV7J 2R7UA 5IV3A 2Z0ZA 3SFGA 1S9EA 2CQPA 3CJ8A 3QGIA 1XWLA 1YG0A 3IJ3A 3C6UB 4B9MA 3CJSA 3UDVA 1F5CA 4UEEA 3OL6A 1Q79A 1Q16B 4DU8A 2HHPA 1APSA 5AGEA 1QSRA 5KFBA 4I2PA 4RJVA 2CAJA 3LP2B 1AFIA 4IH5A 3QNVA 4KFBA 4O44B 1O8BA 3T3FA 2MQ8A 3V6HA 3A3PB 5DZ6A 1YJTA 2ZEGA 4OLPA 4LT6A 1FY7A 3CCES 4KGVB 1Q95G 3H4QA 4LBIA 1LW2A 5CYMA 1U8WA 5HJXA 1U1LA 5GAEU 3IWLA 4C11A 3DDIA 1S99A 5KG2A 2C1CA 1JWWA 1L3TA 4Q36A 5HL7Q 4ZDNA 1U09A 1N5QA 3LGHA 4DX6A 1FKAF 4LIRA 4DSKA 1P0HA 4TY8A 3L95X 3DR6A 4L3NA 5J2MA 5HLFB 3M9MB 2ZENA 3H0PA 2DIUA 4WP3A 4RBUA 4F36A 3QT5A 1NK8A 1Z8XA 4H4OB 3O2IA 2H4WB 2HK2A 3R9GA 2CWXA 2D3UA 4UUXA 1Y9WA 1S3ZA 2JLMA 3OVBA 2YBVA 3LWLA 1RAAB 1N54B 3MD1A 1DQ8A 4CLUA 1AZSA 3JSRA 1WC5A 3B3VA 4FZVA 2PJ5A 2OP5A 4FXDA 2CXEA 1RTQA 4KVME 4M3SA 4DOZA 4JYWA 3DXSX 2WUUA 4OHVA 1N5YA 4M63A 1RXTA 1YK3A 3QYYA 1BQMA 1QUVA 4NEZA 4NA1A 4G6VB 2RF2B 2UUTA 2DEIA 4OX9J 4HACB 4Y6IA 2HFVA 4JI8F 2MZJA 1QE1B 1ZAVA 4OMEA 3CJ3A 2VQYA 3H25A 2M8HA 3HHDA 3D4JA 5CHCB 4OYAA 4DPOA 1KBRA 1RT3B 1KRPA 1RKJA 2K5TA 3PX6A 3FEXB 4ECTA 5J8FA 3O1LA 1PGZA 2MSSA 1X5TA 5J2PB 2HGMA 2ZH3A 2IBOA 4RWWA 5CZVA 2W9BA 2AWZA 4WFNQ 3BQ0A 2JSXA 4Z2XA 4MFBA 4X66F 1WC3A 3UVJA 2GIFA 1RKIA 3IBCB 4HHHA 3BGRA 3GYGA 3UCZP 2HQFA 4YDXA 3UD4P 2B6AB 3OT9A 3FQKA 2O28A 2BVZA 2BE9B 2E1PA 3BI1A 5DG7A 2CVEA 3TARA 2AJFE 3L09A 2IM2A 2LFVA 1M4GA 2UVVA 2FE7A 2DO0A 1RAFB 4OC1A 3MMCB 2CNOB 2HMIB 4J5OA 3QWUA 3ILLA 1LCPA 3I82A 4GC7A 1MMLA 4RPFA 4B3RJ 3AOCA 1XNRF 5IT9U 1WF2A 4XO0A 2YX4A 1GMVA 2CJXB 2YPYA 5JJBA 5KFKA 2ZH6A 4JI7F 2V6AA 5JGFA 3HK2A 2FC9A 3CUNA 2GMJA 3MEEA 2R7OA 1VQ4S 4E98A 3HZGA 2BUEA 2AKWB 1U1QA 2Y1JA 1XE4A 4ETZA 3KZWA 2Q6BA 1FEEA 4XPDC 2RRNA 2DR5A 2IA6A 5FIIA 1UA1A 2WPWA 3NS5A 1RACB 3OTDA 1Q4RA 2DVIA 3R7SB 3JQKA 2RU3A 4ED1A 2XWYA 5GAEI 2ACYA 1YVFA 4M5DB 4DN9A 3PNIA 5CYJA 1JLCA 4NLVA 2Y1RI 3D5MA 3DMJA 5G1ZA 4FF3A 2OFGX 3W5YA 4ZCLA 5DG9A 5I3UB 3WQPA 5A0YB 3CCRS 4JI0J 4G1QA 3M8PB 4ZLJA 1IBLJ 3MFIA 3OTBA 1NK4A 3PZPA 3I9SA 3N79A 2Y0MA 3M30A 2GZOA 3GE9A 5J1PA 2G1DA 1Q5YA 3LF0A 4UT4A 1NLKL 3PP9A 4DR2J 3T1HJ 4DI6A 2ZH9A 1KOOA 2XLIA 1LV5A 2BJ3A 1YJWS 3C14B 3EPGA 3NEKA 3GFYA 4KUBA 3TZXA 2JFKA 3K7RA 3E8OA 3P2HA 2RUGA 3HVTB 3M2RA 4OMFG 3PJXA 3IEHA 4DR3F 4GKKF 1N0UA 3D2WA 2I5JA 3MEKA 3UN5A 2QN6B 4I7FA 3E2EA 1XIQA 3LMSA 4C8NA 1VBZA 5DQGA 5E0OA 2VL1A 5D3GA 2AT1B 4KSAA 1N48A 3DOKA 3DC2A 4RI1A 2LQJA 1H6KX 4U9RA 5D29A 4ENOA 2AEFA 3M1VA 2JRSA 4KKOA 1ON0A 1V5IB 4LQ3A 3PYEA 2B5JA 2I1RA 3QJJA 3I9V9 1FKPA 4B3TJ 3OFHA 3G6XA 4CH0S 1SH3A 4WCEQ 4F67A 1VRUB 2YNGB 1F2HA 4NYOA 4M5NA 3MAQA 1EE3P 1VQ9S 1UWBB 4FVCA 1FNOA 2MDAA 2PO4A 2ASJA 2OZUA 1REVB 3X3UA 4PPDA 4II9A 2B0GA 5AJ3J 2B8PA 3BBFA 3MD3A 2HPUA 2GJFA 2JC0A 5HBMA 3CO0P 2KO1A 4M5LA 2XHWA 3H5ZA 4NI2B 2JVRA 3QQCD 1HBOB 2DY9A 3P96A 3HO1A 1AMPA 1RWMB 4ECXA 2WBMA 2E1MC 2F8EX 2B3TB 1NH7A 4TKTA 1TKTB 2AJQA 3VR1A 3RW6A 4YN3B 3D9BA 2ZOMA 4EMDA 2FQQB 1VKCA 4ECRA 3P4UB 2CQDA 1XR5A 8CPAA 2HVZA 4NJRA 3LGMA 3M2UA 3W61A 3F0NA 1CULA 1ZA1B 3GWCA 1J5OA 3DSBA 2ASLA 5M2PA 2N82B 2GE3A 2B3UA 1RA6A 4KGZB 3JTKA 3TANA 3GYAA 4FP9A 1JNRB 4AXJA 2AJ6A 4QR1A 2MHNA 3EZOA 3K5NA 2UP1A 1EHWA 3MECB 3M8QA 1QSTA 2RRBA 2ZJPQ 4OZLA 4J9PA 2NS1B 3H59A 4F0MA 4Y2CA 2IIHA 3SQGA 4DZDA 1N5TA 3GV8B 5A2QU 1RO5A 3IXQA 4DV6F 2CNLB 3C66A 3R9FA 4ZLPA 5JPHA 1LWCB 1D9FA 1OSDA 1JJHA 4MY0A 1RAOA 4CPAA 4QIVA 3ETMA 1HBMA 1EKSA 1WACA 1NHKL 4I69A 3C8YA 3TT2A 3S7RA 3K5OA 2GVDA 5MAOA 4MHNA 2HURA 3OUYB 2OPSB 3ZXWA 2HQIA 2PJ3A 3MEGB 4KGMA 3GFHA 5HJYA 2AMCB 3HFVA 4ELTA 2LQ9A 2H54B 1V6HA 2GNKA 1L3KA 3HZEA 3Q2SC 3UO0A 5I0CA 5CBMA 4DSFA 4A38A 1CJTB 1HNZJ 4DEZA 3Q0AA 3S1TA 1WDDA 4DV4J 1UJ5A 4A8FA 3K2KA 4DQIA 1HMVB 1JLBB 3ILJA 4CO0A 2OD6A 4USWA 4XK8C 5AE1A 4ZIWA 1P9YA 3S6KA 1F9HA 2ZM6J 3RR8A 4LF4F 3SFUA 4KLVA 1S9EB 2YNFB 3T1AA 2ZVIA 3MUVP 4EWTA 5LSRA 3M6VA 1SB6A 4XNHB 5CA5A 4ANEA 4PXCA 5HVFA 4KAIA 1URNA 3TX8A 4C2ZA 1G7CB 4X4OA 4N8NA 2VA3A 4I2PB 4Q43A 2MKYA 5IFMA 1RSCA 3HSGA 2VJVA 1YTYA 1V3SA 2XB2D 2FZGB 1IR2A 2K06A 4IR1A 2P2CB 4KFBB 1VBKA 2JEVA 5GCNA 2Z57B 2BA9A 4CO5A 5K20B 2FY1A 2P6SA 2HS0A 4RU2A 1OYDA 1W26A 4CLKA 4ZVQB 1TKDA 2DPSA 3PV8A 1U45A 3NNHA 3EM1A 4C0OC 1WF1A 1FE4A 2EPIA 2ZDOA 1U1OA 1LW2B 4A8XA 5CYMB 4EU0A 1RWUA 3BF4A 4FD5A 1ZS6A 2Z0GA 3WC6A 4PAAA 1WTBA 1R31A 4DPTA 5ETSA 3OL8A 2MHEA 4IFYA 2DXQA 1WEXA 1SL0A 4X4NA 4ZVUB 1UAWA 1S0NA 1QTNB 2PJAA 3SV3A 1JKHA 1PC4A 4TY8B 3S6GA 1HWJA 2FY8A 5J2MB 1VYAA 1FT7A 3JTOA 2DCUB 3P5BP 3U27A 4DL4A 3ZC4A 3NGSA 2EWHA 3CC7S 3I9ZA 4EUVA 2DGUA 4YWYA 2MPUA 3Q8QB 4KOUA 1V0CA 3MR5A 1U2FA 2IDLA 2AQ4A 1AZSB 2XCPA 4OC4A 1VJWA 5KTCA 5J1EA 1HBNB 3HD1A 2EW9A 4C2YA 4PK2A 5H9FJ 4JI5F 3T41A 2WONA 4PWDA 5LYFA 5E3AA 1Z4UA 2DRAA 3OHBA 4NA2A 1FT8A 2RDJA 1WJ9A 1N5YB 1FXDA 1URRA 1KS2A 1BQMB 1EP4A 4LFCJ 4ILRA 3OTCA 1T8EA 2HIQA 3GKRA 3ENWA 1IQZA 4QIEA 3A8EA 4PG7A 3C19A 2J9AA 1YIJS 3FIXA 2HG4A 1YITS 4UCNA 2KVIA 4KGXB 3MTJA 1VQ5S 4OI6A 3TOQA 4HEA9 2C27A 3WBZA 4J9QA 3KHZA 4ZIVA 1S97A 4OLLA 1FRMA 1U6FA 3TVKA 4AB7A 5GMEA 3CD6S 3Q86A 1H7WA 3MMJA 4ZN1A 2BCOA 2V9WA 1OO0B 2DH9A 1UZDA 5DDOC 3NLCA 4PG4A 3D2PA 3KMSA 4ECYA 3BO3A 2B51A 1WSRA 2W9BB 2MLXA 4MFBB 2DNNA 3SV4A 4CI0B 4NX9A 3UVJB 2W7PA 3BGRB 4I68A 1ZG9A 2UV8G 4ZP8A 2MZTA 4K4TA 3TFYA 5D0HA 2GV1A 4Q8FA 4ZLNA 3NP5A 1FKOA 2A3JA 4MYUA 3PHEA 4IG0A 5JVHQ 2HVEA 4GM5A 1RLDA 3QGGA 2J9CA 3F0AA 5DO2A 4Q44A 2FXFA 4RKUC 1ZOTA 4NXNJ 4HTIA 4X5KA 3D3CJ 4NA3A 3ENAA 1Y5IB 2HQDA 5T7LA 1SH2A 4DR6F 1RAIB 3SDEA 2V77A 5HXDA 1V3RA 1ELOA 3HPOA 4ZOSA 2FDNA 1OS5A 2AJ2A 1UEUA 2QA2A 3MEEB 2XLKA 4URSA 2BXJA 4P9SA 3W9HA 5JH9A 4YFJA 1BQNB 1RZMA 3RBZA 2UUCJ 2HB6A 3N5FA 3SI0A 4DV2J 2HQGA 1ZBTA 4H54A 1VQ8S 4CRJA 5IB9A 2CPZA 4LF8J 3ZTOA 2XEIA 2AD9A 2AFSA 1N36F 4G65A 2ZW6A 3QSIA 4O3SA 4P73A 1S76D 1MLAA 3DMJB 2Y8WA 4PUOA 2FZCB 4NSQA 3SCLE 3HKZD 4G1QB 3RO0A 5EX0A 4I1TA 1XF8A 1WEZA 4V19X 3T5LA 4OZ1A 3MHYA 4JV1A 1MROA 5F41A 3M30B 1CPSA 4MK9A 3PRDA 2QC3A 5DDRC 4PSXA 4WZMA 3ADAC 4LF5F 2K1RB 4LRAA 1P27B 3SJGA 1WORA 2CQCA 3HVAA 4OP4A 3CCLS 1IIDA 4DPUA 3BGFA 2BV3A 5JUMA 3I4HX 1LEOA 1Z5RA 3M2RB 5LMNF 3C6TA 4LR7A 2ZWPA 1S0VA 1YW4A 3J81j 1NH8A 2P0WA 1TU0B 2DXDA 3AY0A 2C6GA 5E2QA 3OJSA 4H4MA 2H5MA 4I7FB 5JXSA 1QVFR 2EKNA 3WZ0A 2XI2A 3UWTA 5D3GB 4DR7F 4KTQA 3JUWA 3DOKB 2VG5B 2LA6A 3H4DA 4FYWB 3F5BA 4F0HA 4UFVA 4RBVA 2KFNA 1JMTA 1RWKB 3KLHA 4B10A 1X4BA 2B4PA 1NJZA 1X9MA 3M1VB 4KKOB 2XY5A 2RQ4A 3GIUA 3ONQA 2B5JB 1SQHA 1SC3B 1FKPB 4PQAA 3CCSS 1TZ0A 2X1BA 3POTA 3W63A 5IT9Y 1U1NA 4TU7A 5IWAF 3IO1A 1F5AA 4MCPA 5HROB 4CAXA 2REEA 1ZPWX 3TEHB 5LMUJ 4JI4F 4K3NA 3F73A 3RJMB 3ICLA 5HBMB 1D1UA 4MKYA 4GXHA 2R8JA 4R9MA 2ZC3A 3EDRB 4WU3A 3NOGA 1X9WA 5E41A 1R7IA 4MIBA 2FJAB 2QMWA 2L3MA 3J7A1 1EETA 3K59A 2J76E 3VVTA 3BDPA 3RNZA 4A8MP 1J5EF 4AG7A 3NXZA 4WFZA 2LU2A 4EBEA 1CVJA 5D4NA 2HIYA 3T9YA 3PFEA 2OPQA 4DF8A 2DIVA 1LWEB 4DUYF 2ERRA 2YWHA 1DQ9A 4R3KA 3M2UB 3B2YA 2ZW7A 3IGRA 4J9KA 1CULB 4Q45A 1J5OB 4TYBA 4N47A 4U9ZA 4OZ0A 1NUEA 2R8VA 2CPXA 3D28A 5LOQA 3B3SA 2IAJA 2FGCA 3I5AA 2E7VA 3G4SS 4L6V3 1NAQA 1N32J 1TUVA 2ZEOA 3CW2C 3DOMA 5HATA 2XO6A 3PYGA 3SQGB 3CIZA 3GG0A 2ZC4A 2IM0A 4NOHA 1WUUA 5MLCV 1Q8LA 4PG6A 1PKUA 2W2PP 1ZZFA 4M5KA 1YLEA 1F3FA 2FSRA 4L72B 4JI1J 4PKDB 2YX7A 4OHYA 2ZE2A 1DARA 2WOMA 2ZUGA 2C6CA 1R43A 2V8VA 4PYAA 1HBMB 3HDSA 3BBCA 3CIMA 2FT0A 4PCQA 2UXCJ 1WELA 4TLQA 4TY9A 4F9UA 2ZH2A 3WT4A 3S9NA 1CLFA 3DLJA 3H5UA 3W66A 4B5OA 1CBKA 4UW2A 2E7XA 2DRBA 1Q2DA 4HL9A 2WVEA 1X4FA 3P49B 5CABA 1KLMA 2NSBA 2VKRA 1RTIA 2K3IA 5L1JA 1WG1A 3H7HB 1CP7A 2Z3NA 5GMDA 1FDDA 1S4EA 2R7XA 1OPIA 5ITHA 3VWEA 2HBZB 2ZKUA 4H4KA 1M5PC 2XI3A 1RAEB 2H5EA 1F1BB 3KQXA 2OH2A 1IOIA 4OL8A 5H1SV 1WHVA 1X4HA 2ZNZA 2CA9A 2F9DA 2EFOA 2XTJP 1PCAA 1KP6A 4NRUA 4Y2AA 4A8YA 3D6HB 4ECZA 4I64A 1B7FA 3RB6A 2P9CA 3T5KA 3MR6A 1NDCA 3SJEA 4QCLA 3FBCA 3C15A 1TAUA 4DR4F 1HR0F 1S6QA 2WW8A 3ZZZA 2WBRA 2R98A 2CQ1A 2RE1A 1ARLA 2IRYA 2BRKA 2Q04A 1P8GA 2D7SA 2WVBA 2M5YA 4Y2MA 2C3MA 2B9YA 4KZTA 5E33A 1TKHA 4X62F 4P10A 4CO1A 4LF7J 3OBIA 2EO8A 2I79A 1H98A 3BSAA 2H9ZA 1QY7A 1IICA 1OMSA 1YQHA 4S0MA 4F4ZA 4A39A 2DGWA 2I6WA 1XNQF 3GMGA 2PE8A 2IFXA 5A8RB 4AL5A 4HPSA 3PR4A 1ZPVA 1IR0A 2CNNB 3KYLA 4IFYB 5A2QY 1S7KA 3GIKA 1WC4A 1XMOF 4UF4A 4MY3A 3HM9A 2J7UA 3SCJE 1G4CA 2J9EA 1UFKA 2EC0A 4MKVA 3FH4A 1MJ9A 4KHPJ 3FMCA 4NLRA 1CQNA 4L73A 5J1QA 3E51A 3PW0A 1RTJA 5SUHA 1M5VC 3FBUA 1UP1A 1M1DA 4ECVA 4B5PA 3CJTA 4DV5F 2EG2A 4L8AA 5J1EB 3FYNA 1FJ7A 2WSCC 1BD6A 4LFBF 3NMAA 4CM0A 2WONB 4DV7F 4PWDB 1FFWB 2GFFA 1BLLE 3JQMA 3M05A 1K0TA 4EYHB 3IRXA 4TN2A 4F4AA 4OYOA 1EP4B 1Q2YA 3ZZTA 3DLKA 3KUHA 2ZITA 4M94A 4B13A 2VEZA 4CGLA 1S6UA 2CTBA 1GH8A 4ED4A 4A8WA 2Q79A 4KHRA 2E9RX 2HFZA 3ZZYA 1HEEA 1RT7A 2LU1A 2YKMA 3CMQA 2OJ3A 3H5SA 1YRUA 1DAXA 2IVYA 3EGNA 2RS2A 2ZXVA 4IO9Q 4ZVFA 2LYVA 1L3VA 4O0IA 3KK3A 4QU6A 3PG9A 2CXAA 5T41A 2V68A 2A1BA 1SXLA 2HVHA 1WKJA 1NO8A 3HLPA 1TKJA 5AXKA 1XTZA 1HW9A 3IC1A 1JLAA 2B9WA 5E3PA 3MR7A 1QSYA 2H3EB 3MMBA 5CZXA 3R1LA 1I21A 2GX8A 1Y5NB 3D67A 1SJQA 2ARHA 1U26A 3J7AN 1GEHA 1UZHA 4BLGA 1T9YA 5JVGQ 4JV5J 1FKOB 1Y0YA 4IG0B 5E3QA 1PYTB 4FAIA 3FSXA 4AXIA 2BZ2A 2EVZA 4F0XA 3C2PA 4F50A 4BINA 1N4LA 4XTTA 4Z7CA 2NXJA 4A2ZA 1NPRA 1S1VA 4TQSA 1MMNA 3BJ7A 1WHXA 4F25A 5AG7A 4KIAA 2R9LA 5T7LB 2J6SA 3NGDA 3SDEB 2Z3PA 1L0CA 1L5UA 2M2BA 2GS8A 2R2UA 1NK9A 3T9ZA 2QSWA 2VBQA 4LRCA 2C28A 1U49A 2G3TA 3HFKA 1EX8A 2VG6A 3G82A 4OX9F 4X4SA 1TKXB 3TA1A 4A33A 1T9VA 4K5RA 2W9AA 3NH4A 5DG8A 1VQPS 4RLEA 1I5OB 1XJOA 3SMZA 3VZHA 2GLFA 2XBPA 3R95A 4ZX9A 3CULA 1HI0P 1PJ5A 1NZAA 3MCOA 1K8AT 1B0VA 5KFRA 3SJXA 4RBTA 4R57A 4PUOB 3B78A 2H48B 3KHGA 4ZX8A 1KQGB 1PBAA 4C2MA 1WWHA 1MK4A 3NS6A 7AT1B 1MW7A 1VLOA 2B5GA 4YOEA 3ZTPA 2KRBA 3KASA 4PK3A 3NAIA 3RRGA 5F8NA 3FSYA 4CO3A 4WU2A 3BJYA 2R2SA 4P71A 4DU7A 1WOSA 1PO6A 4ZVRB 1GMWD 4ED6A 1VOMA 4O4RA 4QPXA 4DL6A 2RC4A 4DSLA 3I0SA 4KV8A 3P45B 4V1Ak 4F4XA 3W9IA 2DRDA 3RBEA 5HMZA 4B9TA 2F1FA 5GADI 4DQQA 1B99A 3FSIA 2JLEA 2RRAA 2IVMA 4K5SA 4F4KA 1X4GA 2VASA 2FGOA 3L7OA 4LRFA 3KLHB 2UUAJ 2OPPA 1JLEB 3A9LA 2HWTA 3KHXA 2V4RA 4M95A 1B4SA 1LK5A 2E5GA 4C3LA 4BD9A 2D4PA 2BX6A 3NBPA 2HFSA 4UZBA 1YVOA 2ZDPA 4R8UA 1IKWA 2LQ8A 1GNKA 4MK8A 3VCDA 5HMNA 3W2VA 2BJ9A 4FD6A 4CIOA 2XGQA 1BLUA 3G6VA 1QTMA 2KKHA 4BBHA 3Q8PB 5I3PA 3CE8A 4C4WA 3TI0A 2H4YB 1KFSA 2AEJA 1IB1E 1B87A 3ZJ0A 4WWSA 1K0VA 4P45A 2PDAA 3MXHP 2VPYB 3EFAA 2E29A 3FJUA 2VOPA 2WAQD 3KHHA 4HNXB 5KFGA 4YGOA 1RCXB 1RYSA 3HHLD 4DR2F 3T1HF 2OPQB 3UW1A 4Q2LA 1NHVA 4W4MA 1D8YA 2PJ9A 3UR0A 5LRJA 3K0JA 3L3CA 2PT0A 3W62A 2NXNA 4NYZA 3H8YA 1OJ4A 1HQUA 5LXYA 3DHWC 1RT2A 5L1LA 3D3BJ 1F2PA 3R96A 2HZAA 1QM9A 2IAJB 4TU8A 4P6YA 2ATRA 2GIVA 2J0QD 1BC6A 4ZA1A 1ITPA 4A30A 3LP1A 3KLIA 1VI7A 4IRKA 1U1PA 1Y7RA 4EBCA 3DOMB 2ZEPA 2KHCA 1XERA 2DPTA 1GXTA 4MIWA 1YRXA 3W7BA 1UETA 2NUUG 3G2XA 4YRHA 4KO0A 1MWYA 2ZE2B 1HDUA 1YRTA 4Q8EA 2WOMB 4ZPDA 4FNIA 2FYXA 1C1CA 1NMTA 3TVZA 2ADCA 5ETRA 4ZK7M 2VA2A 4DJLA 2HVIA 2B4OA 2HFNA 3MM7A 3G6ES 4MI4A 2FVCA 2YY3A 4HLBA 4CAWA 1KTQA 3FDSA 3GFZA 1X4EA 3MM8A 2DB1A 3ET6A 3IS9B 5F0WA 4Y00A 2LMIA 4RW8A 4LF4J 4NJQA 3LAKA 3UD5A 4X4TA 2W8KA 1WG4A 1I6JA 2CDQA 3OVSA 2V4JA 3TAPA 1I51B 2GFQA 1KLMB 2VH7A 3DYAA 4CRZB 2KYXA 2V9KA 3ZZ0A 1KSPA 4J9NA 4MMOA 5DS7A 5I3QA 2Z2MA 2MJUA 4N77A 2MY8A 2HC9A 1F0XA 2OMOA 4CLZA 1QSMA 4DL0C 2BJDA 1VQMS 3JQJA 4RWXA 4OYWA 2CJAA 3FX6A 4WJBA 2ROPA 4L76A 2GHVC 2EBGA 1SQGA 4UEFA 3R9EA 2YH1A 2OTJS 2WZNA 1OWXA 3KNGA 4M5MA 3RRHA 5IT0A 4U7UK 4CLPA 1FRHA 4QJVA 3M8SA 5KG5A 2L9WA 2ZFHA 1DLOA 2X7IA 3C15B 1AUGA 2KZZA 4OZ5A 3M8RA 2G0BA 1ZM2A 2IDEA 1S6QB 2W24A 2XMUA 4DSIA 2CQ3A 1WG5A 4G3IA 4WWVA 4UUWA 4LSZB 1N8RT 3PRTA 2CJYB 3ZNJ1 2KVQE 3JSMB 4ITSA 2JFDA 2QE5A 1WI8A 4DCOB 2HNZA 4A46A 3RTVA 2VKZG 5JMNA 3ZZPA 4RNOA 5EWEA 5D78A 2EUIA 4R0JA 5AE2A 3A1YG 1F5BA 2QA1A 3MM6B 1JLGA 4CCHA 5EUHA 4IHMA 3M8WA 5J2NA 1VQ6S 2X3DA 2OFHX 1ARMA 4DNCA 1IJEB 2RIJA 4UEZA 2ZBRA 4C8LA 4UOFA 2RVJA 4UWJA 3LACA 2EBEA 5DM6Q 4YB5A 3GQCA 1XIXA 1WHYA 2J8NA 4PG5A 2Z3MA 1HNZF 5IZHA 3IU1A 4O3RA 4K4SA 4WIQA 4DV4F 1L3SA 2BQRA 1CX8A 1MU2A 2DR8A 1YJ9S 4JI3J 3VTIA 2VC0A 4WYWA 2QYGA 3WABA 4HDGA 4DL5A 1EARA 2OR4A 1MN9A 1RTJB 1ELMP 3QLHA 4O3NA 2HRYA 2VDHA 5DM7Q 3PYDA 4YR2A 2BW2A 1H38A 1RTDA 1XJWB 2DNLA 3ZO7A 2XG8A 2WSFC 2DR6A 1FK9B 3HSDA 1GAOA 4ZITA 3A12A 3BPSP 3CWJA 5B0EA 3IRXB 4PEOA 2Y1LB 2DTJA 4EBDA 4CNZA 1XEZA 3Q8YA 3DLKB 1CJVB 3UN3A 3KLEA 1UFHA 1C0UB 2DITA 1IOFA 2PSZA 3SEOA 2MGZB 2GQCA 1K44A 1RT7B 3B3TA 3AD7C 3VALA 1YSJA 5HMYA 2FLNA 4OIDA 2WPXA 2IPOB 3I6PA 5IX3A 4KVOE 4C0BA 2ZBCA 2XNRA 3KK3B 1NDLA 3QAYA 1E6YA 2VI7A 2Z4PA 2EFPA 3GJRB 3DRXA 3BS9A 1IBKJ 3VGSA 2YWWA 1GFWB 4DFJA 4FS2A 2UVUA 2WSEC 3FRYA 1JLAB 1TTHB 1F2GA 2L41A 3BEGB 3CCUS 2YNHA 3PIPQ 3OTOJ 2UVRA 3PB4X 4HH0A 4DR6J 2WK4A 3BGUA 3MDFA 4EO8A 3MMBB 4MT1A 3PJWA 1UEVA 4YS2A 2XEJA 4XPCA 2CTCA 2EK8A 4A31A 4H6UA 3KR5A 5G0RA 3JYTA 3T1YF 2YQ1A 3JTNA 4EZ6A 4JJXA 2NMTA 2W2QP 3UCGA 1ZM4A 3KXDA 1S1VB 2A2CA 2OKQA 3C46A 1U2CA 2K7KA 2UU9J 8ATCB 4DS4A 4NLDA 4LSNA 2MZRA 5DETA 4UOGA 2MEWA 3PEJA 2PQ8A 1Z2ZA 4GO7X 2G2ZA 4QIFA 4DCJB 4LFCF 5DS0A 6FDRA 2A18A 4USVA 4LBPA 4K0KJ 3G82B 2QMXA 5KFQA 4ZP7A 2VZZA 4C7HA 4WFYA 1U48A 2BRLA 3NNAA 3KJFB 2PN6A 2AFUA 2ZW4A 2XHCA 2DXEA 3FNCA 4DR1F 3K58A 3AXKA 2MQQA 1A2ZA 5L9XA 2BANA 3VWSA 4B3OB 2BBEA 4XDCA 3CDUA 2SXLA 5LRGA 2YQ3A 1M4IA 4FD7A 4USTA 1XMQJ 2AP6A 3FZ2A 2B5GB 4ANDA 4NLXA 5KG4A 2PA3A 4AT1B 3QPIA 3CPXA 2HRUA 3WHIA 3MTKA 5ELYA 3QATA 2O66A 3PIOQ 1PYSB 4A4JA 3DU6A 2R7TA 4Y0FA 4Q0BA 2FVSA 1IKYB 1OQ6A 3GJSB 2BO9A 4LUAA 2HEKA 4HYKA 5LL6d 4LBHA 3I0SB 4KV8B 4R6TA 3NRBA 2MKSA 3GUXA 3T90A 2EFQA 3DCAA 3G86A 4MFZA 2P6TA 1YK9A 4ALZA 2KJVA 2PI4A 2DNGA 1JWQA 1N6QA 5AT1B 1FFGB 5KFVA 2ZZTA 4NXMF 3PKMA 4KRWA 4FF1A 4ZYQA 4ZJOA 5J2QA 2XEGA 5IWAJ 2AZ1A 4HH1A 5AG4A 3FC9A 2X1AA 4XPEA 2KU7A 2VC1A 4YR0A 2F4VJ 1BMQB 5B08A 1IVZA 5GVQA 4IO1A 2IC3A 5KTDA 4JI4J 2IYGA 1N34J 2A4NA 4M5IA 3SQOP 1T9XA 2OPPB 3GTYX 4RS2A 2UUCF 3FK4A 4KOSA 1X7VA 3AJDA 4DV2F 3NBPB 2Z2YB 3K17A 2VHGA 4R8UB 4UTGA 4CYPA 1IKWB 4FVMA 1VQKS 2U1AA 2R7WA 2KXHA 1W25A 4LF8F 3UNGC 2AYMA 5FDLA 4DX7A 4Z65A 4UWIA 3NH8A 1L3UA 3W2VB 4I6YA 2VONA 4DUYJ 2HHQA 5B09A 2HGNA 2BMBA 3KJVA 1XK8A 2POKA 1M4LA 4MCQA 3VHQA 3FVYA 5A6WA 3QAEA 3G71S 4U7UD 3WC5A 2CVIA 3D54A 1VLYA 1RHQB 3W5XA 2I2YA 2WW4A 1HDQA 4JD6A 4JI2J 4KVXA 3J81U 4DDFA 1RWNB 1N71A 2F5GA 3KLVA 2PJ7A 4ZLLA 5D8NA 3MCNA 1R8PA 4QW8A 1WD6A 2XNQA 1M90T 3CTRA 2MQOA 2NCKL 4I49A 4DSJA 1SKSA 3M6UA 2QLBB 5K9FA 1HQUB 2MLYA 3PW4A 1Y7EA 1RT2B 2XZTB 4QYRA 2GHPA 2AE6A 1YKWA 2HV2A 4OC2A 1NSLA 3EVWA 3EGWB 2J8MA 3LP1B 3KLIB 2W4CA 2RH3A 2MJNA 1GXLA 4ZPAA 1CPXA 3PTWA 3OFFA 4ZPTR 1U1MA 4NYPA 4O0NA 1RA7A 5KTQA 4B9VA 2DNHA 4USUA 2R8GA 2DHGA 1OY6A 2E5LJ 4WFBQ 5KT4A 3J80U 3V6KA 4KO0B 4MXUA 4ZVTB 2IRUA 2IQ6A 3V4MA 4NLPA 1C1CB 3EC4A 1NRKA 1ZM3A 3QBCA 1FHTA 5LMUF 3BGLA 1Q78A 3MM7B 3QO9A 2X51A 2DPJA 4OHXA 1GMUA 3MM8B 3KK2A 3ET6B 2X7BA 3ZZIA 3KMQA 2K7JA 4IFVA 3VZIA 1KUXA 3KKWA 1SBRA 4JOUA 1PSDA 2MSTA 3K8WA 3FJ2A 3H42A 2OHDA 2HLUA 3LA0A 2IJZA 3GY9A 4MFKA 4CT8A 1TF8A 4KS9A 1VQSA 4HHJA 1VK3A 1Y9OA 3DYAB 2DHHA 2QIRA 3N7ZA 4OI1A 2Q7BA 3W8PA 4YR3A 3B3CA 1NE9A 4C7IA 4F0KA 2EFGA 2VB6A 3VAJA 1S1XA 3W60A 3JSYA 3SSSA 1SJFA 3PACA 4DR4J 2GGPB 3T8WA 4R3LA 2V8GA 1UCNA 2CNTA 2L48A 4B9UA 3B4MA 2DCLA 1CM0A 1Y5LB 2F65A 3HHKA 4RL1A 1UTAA 4EGLA 4MFJA 2DNZA 3R97A 4ERDA 1TF9A 1KQSR 2QT7A 1XNQJ 1N32F 1Z8WA 4JLYA 4BWJA 4JBCA 2QJ8A 3K9UA 1DLOB 2PRQA 4Z37A 5F3ZA 4A8SA 1YMEA 1WSVA 4ZPVR 3QZ7A 5ETKA 1IKVA 1F57A 1FRJA 1B7YB 4PR6A 1VQOS 2PIYA 2J6UA 2R42A 3VAGA 2CPHA 2IJFA 1YJ7A 4JI1F 3LQVA 2ZH1A 1R89A 1TR0A 2HNZB 1WKKA 4UCPA 4KLWA 2QA4S 5EX3A 3R5AA 3OQ2A 1T11A 1NEEA 2AFXA 1JLGB 2R7HA 3LWUA 4FKXA 1BPMA 5J2NB 1EZZB 1S49A 1NKEA 5HN0A 2OEJA 5K5MA 1QDUB 5CYQA 3CPAA 1WKLA 5L46A 1U6BA 3U02A 2CRLA 1Y3JA 2E1AA 2CIMA 4OZ2A 1GMWA 4OI2A 4WFAQ 5LYLA 2NLWA 2PJ2A 3AA9A 2NYHA 1MU2B 1IU8A 3HI9A 4NRTA 1G2EA 2PJCA 1S1UA 3EXCX 5G20A 3A8IA 3K89A 3QLHB 3EO4A 2CPYA 5D15A 5AG6A 4Q5VA 5J1NA 1RTDB 2V2VA 5HQLA 2K2PA 5F8HA 3B4DA 3V7ZA 1BXNA 1KZFA 4RN7A 3H5XA 2G4BA 1XOVA 1MJBA 1SQEA 1AW0A 3BKUA 3UDEA 3I32A 2V67A 2JX2A 1JLQA 2C6PA 1S12A 3BJ8A 3LPYA 3NGUA 2RB7A 2VUGA 1XBUA 1LWFA 5GAGU 2LQ5A 4FKYA 3H8FA 3K57A 2YKNA 1DHMA 4WIIA 2W25A 2LECA 3TZYA 2EK6A 3F56A 1FXRA 4H4KC 3OR1B 3JVNA 4R5PA 4CLYA 1JNZB 2DGOA 2HFUA 2QV6A 4LF7F 4K2XA 1E6YB 3CDXA 2BKOA 2QTWA 3R5DA 3CCJS 4PQUA 3DN9A 4OV6A 3OFGA 3PJ9A 4R8FA 4ZP6A 5FD1A 4HR2A 2MMYA 4M5JA 5C5JA 3FMBA 1VQLS 4MAKA 3GIJA 2YNHB 3MWBA 1T7PA 4RW4A 4C2XA 1RDRA 4I4BA 4RZRA 3L2NA 1BGXT 4WE1A 2R7RA 2BQUA 2CZ4A 3W5ZA 3QGPA 3UR3C 3HHLA 1PUAA 2DHAA 2YNCA 2N4DA 3VGTA 2DR7A 4KHPF 3AJ1A 1BE4A 2XULA 3HJVA 4J9VA 3WR7A 4M6IA 2M88A 1HD0A 3BSOA 4MYTA 5F49A 3WC7A 4ECWA 1EB0A 3TAQA 3HUVA 3BREA 5GAHU 2V5HG 3Q23A 2HKEA 4OKOA 3SI2A 4GVBA 4LSNB 1SJ4P 4CDIA 1NK6A 2A2DA 3OSNA 1IYKA 1LOKA 2LCWA 1HNWF 1C0TA 4OC0A 2KZMA 1VC0A 4JXRA 3TO7A 4GRSA 2C22A 3AT1B 5L1IA 4E8OA 2GMLA 3V81A 3V4IA 1D3WA 3UQSA 3GILA 3D6FB 4QBUA 2MLZA 2BL1A 1VGYA 3H5YA 1P1LA 3CD5A 2VF3A 2VJUA 1WK4A 5DRKA 2XSJA 2BE2A 2W2MP 3DI6A 1VIOA 4TU9A 2NR0A 2BANB 2O67A 2ZPAA 3ZNUA 3QFWA 2HHXA 2BUNA 2J0SD 2AFMA 1DBDA 1CBXA 3K5MA 4FF2A 1HI8A 2I0XA 1Q0NA 1UPPA 3O44A 4MKAA 4JXQA 3TQ1A 1Q8BA 2ZEMA 3BQ1A 4GC6A 2FB0A 2ZWOA 2AJ0A 2FJVA 3EUNA 1C4CA 1EIYB 2CPFA 3HLUA 2XZWA 4MFLA 3M6WA 2J0XA 3FEZA 4U6PA 4F7VA 1X60A 5KFLA 4I6AA 4Q0BB 5KG6A 9ATCB 2ZKTA 4UOHA 1S77D 5DZ7A 3N5BA 4JV5F 1HHSA 4PYDA 2C3OA 4HT7A 3CJ2A 3F44A 3QRPA 1VCTA 1NPPA 1CP6A 3OL9A 1YBAA 5B0BA 2BOPA 5AXLA 1IYLA 2JJ4D 1U24A 3AB2B 1N6QB 5KTAA 3HFZB 4USMA 4MBUA 1RJJA 4F6AA 4CT9A 4YDDB 1HFEL 2CWKA 6FD1A 2ZBIA 2LVWA 1OY8A 6CPAA 2CQGA 1FJGJ 1YZ6A 5HO4A 4ZVSB 5A28A 2IC3B 1RU1A 4NLSA 4M5GA 4F2RA 1AT1B 2DY1A 2A0FB 2WVCA 1UVNA 3FBBA 4NE9C 1T3OA 3IBFB 1KUVA 4MJ8A 1SL1A 3VGUA 1WOPA 7FD1A 3OLBA 3GSIA 1GHEA 4K30A 4QC6A 3PM9A 4I2QB 2GJIA 3GU0A 1KVIA 3WIVA 3IG1A 4AQYF 2OLWA 1WF0A 2C42A 5FDLB 3IA0A 4WTOB 3TOBA 2ZZNA 3A4TA 2QMLA 4IRCA 2DNPA 1M5KC 4FF4A 4UQTA 1DTTA 2BOAA 2ALZA 4WPAA 3KWMA 1UWAA 3KJVB 1TL1A 4IH7A 1Q7LA 2O1PA 3R6GB 4OLOA 3MR3A 2GMHA 4OHZA 4GO5X 2VBWA 2GU2A 2WVDA 3H8EA 1VQNS 2O01C 4A37A 4OI3A 5KFIA 1QD1A 1TL3A 3TWZA 1CJKA 4NLYA 4DQRA 4CWBA 3CF5Q 4OC3A 3H90A 3J7Z5 1TP7A 4CH7A 5GAHI 4ZMMA 2V69A 2HK3A 4WZQA 4ATNA 1VJQA 2HAIA 1CS4A 4OX8A 5EMIA 1RI7A 1PJ7A 3CCVS 2Z10A 4CLWA 3D7DA 4K4YA 2RS8A 1TMJA 4CYUA 2VD3A 4CYQA 3MM9A 2PVWA 3MCSA 3VF0B 2RU9A 4A32A 2RMLA 1UVKA 4DQPA 3VV2B 3MPDA 4UA3A 4IR9A 1IR1A 2R7SA 4V19J 2HLTA 4CM2A 3UN2A 2VPZB 2UUAF 5D8HB 3BXMA 3TJAA 4OI4A 4DL3A 1RAJA 4CP5A 3SHPA 2DYAA 3T5JA 4N5SA 4ORFA 3J7YU 2MQLA 4MFQA 4M6GA 1NSKL 2PGCA 2DH7A 3CD0A 2YTCA 5ETLA 3CCZA 2IVFB 1F3VA 2LKZA 3QO9B 2PE3A 1FD8A 4IYQA 4ZS6A 3KK2B 1B0TA 5DJBA 2VOOA 2PJ4A 1KONA 4H4OA 4IFVB 1JXEA 5DWMA 3S6HA 1T94A 1MWZA 2N4CA 2EK1A 2Q51A 4U96A 3ZFVA 1V3ZA 2OSRA 2F3JA 1HWIA 5D0RA 4PPZA 2HS4A 2FVGA 2XYHB 1YREA 3CZXA 2CJKA 2G0JA 2BJ8A 2PMZD 3AQOA 4PWUA 4C8MA 4LREA 1ZAWA 1P1TA 2GAGC 4AVBA