2VL1A

Crystal structure of beta-alanine synthase from saccharomyces kluyveri in complex with a gly-gly peptide
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
433
structure length
433
Chain Sequence
PLSIASGRLNQTILETGSQFGGVARWGQESHEFGMRRLAGTALDGAMRDWFTNECESLGCKVKVDKIGNMFAVYPGKNGGKPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNYVPNYDVCVVVWFNEEGARFARSCTGSSVWSHDLSLEEAYGLMSVGEDKPESVYDSLKNIGYIGDTPASYKENEIDAHFELHIEQGPILEDENKAIGIVTGVQAYNWQKVTVHGVGAHAGTTPWRLRKDALLMSSKMIVAASEIAQRHNGLFTCGIIDAKPYSVNIIPGEVSFTLDFRHPSDDVLATMLKEAAAEFDRLIKINDGGALSYESETLQVSPAVNFHEVCIECVSRSAFAQFKKDQVRQIWSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPEEIENGFKVLLQAIINYDNYRVIRGHQFPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BETA-ALANINE SYNTHASE
publication title A Recruited Protease is Involved in Catabolism of Pyrimidines.
pubmed doi rcsb
source organism Saccharomyces kluyveri
molecule tags Hydrolase
total genus 162
structure length 433
sequence length 433
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.6: Beta-ureidopropionase.
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vl1A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2vl1A01
2AFMA 2PJ3A 1LOKA 4PPZA 4FUUA 2J9AA 3NH8A 3WT4A 1TKHA 2OR4A 4A39A 3KI9A 3IIBA 3B3WA 3SJEA 5JM6A 2JBJA 2QYVA 4P4JA 4B6ZA 4NGQA 3IFEA 2ABZA 3KQXA 2PVVA 4H2KA 3VARA 1Y0RA 2IQ6A 3D66A 2CF4A 5K8MA 1DE4C 3H8EA 2PJ5A 3B7IA 5LRKA 4IK2A 5JH9A 3ISXA 1H8LA 4NJQA 5LYLA 1F2OA 2ZEDA 3FX6A 2NYQA 3TC8A 4PXDA 4OC2A 3D7FA 3SJGA 3GB0A 5I4MA 2ZEPA 3HLPA 2V8GA 4UEZA 3PRTA 1XJOA 4R7MA 4A37A 3I1UA 3NA6A 3D7GA 2XEJA 4UEFA 4GM5A 1YW6A 2DEAA 2GU2A 2XEFA 4X3RA 3B3SA 3DGVA 1R3NA 4MCPA 4PXEA 3PB7X 3KR5A 7CPAA 4TWEA 5JGFA 1YW4A 4R6TA 2PJ0A 3BHXA 4WJBA 5LYIA 4NFRA 1QQ9A 2ZEHA 5DS0A 4P4EA 4PQAA 5CBMA 2F7VA 4MCQA 2BO9A 3FECA 3KQZA 4DUKA 1HDQA 1XBUA 4TNUA 1CBXA 4IHMA 4MCRA 3PB4X 3KHZA 4OC0A 4LQGA 3PB9X 2CTBA 2EWBA 2AFWA 3S9NA 2RB7A 5LYDA 4ZY1A 1GYTA 3IJ3A 2FVGA 4A94A 4NJRA 1IY7A 5F09A 4ZY0A 3RAMA 4P45A 1CP7A 3WC7A 1CX8A 3KHXA 3FJUA 1EE3P 2PE3A 2HC9A 1PCAA 4BD9A 4OIWA 2PRQA 1CPSA 1M4LA 4JZ0A 4P44A 1ZG8A 1VHOA 1Z2LA 5D29A 3K9TA 2PCUA 3PFEA 3FEDA 3DLJA 8CPAA 4UF4A 2VL1A 2RFHA 2AFUA 5D8NA 1RTQA 3NH5A 2QVPA 2PIZA 4EMEA 5HVHA 2CIJA 3CT9A 1CG2A 2QJ8A 3JRUA 1ZLHA 4KSIA 4UEEA 2F8HA 3LWUA 1AYEA 1QMUA 3S9LA 3T8WA 3SI0A 2ZEGA 2C6GA 1DTDA 1LAMA 4MHZA 3KL9A 2POKA 4X2TA 3N5FA 2Q51A 3CPXA 4WWVA 4MRIA 1Z8LA 4OKOA 2V8HA 4OC4A 3GUXA 5K8OA 3PEIA 1FT7A 3BI1A 1BAVA 3KZWA 4Q7AA 1VHEA 4O23A 2ZENA 4P4DA 1BPNA 2PVWA 3NH4A 4P10A 1ZG9A 1NSAA 3D67A 2ZOFA 2Q4ZA 2PJBA 2EK8A 3CPAA 5J1QA 3K2KA 4OIDA 1ELLP 3IC1A 4DYOA 3SI2A 2C1CA 3CDXA 4P6YA 3PBEA 1HEEA 2WZNA 2PJ4A 5THWA 1KWMA 1XFOA 3KGQA 3RBUA 3GLJA 3H8GA 5HXDA 1F2PA 4FAIA 3PFOA 3H8FA 1CPXA 4ZYQA 2IJZA 2O53A 2ZEMA 1Y0YA 3SI1A 3ISZA 1AMPA 2IMOA 4MXUA 3VH9A 1TKJA 1ARLA 4EFDA 3MN8A 1TKFA 4FWUA 2ZEOA 1XMBA 1CP6A 3PB8X 3MRUA 3FVLA 3B3TA 2WYRA 4IAVA 3D4UA 1ZG7A 2ZEEA 4NGSA 5HVFA 4ONWA 3B35A 5K8PA 2ZEFA 1BLLE 4NGMA 1ARMA 2AFSA 2V77A 4CPAA 4P4IA 4MHPA 4G1PA 1HDUA 3NFZA 1F57A 4ZI6A 3QNVA 4MHNA 4OC3A 4RUHA 1Y7EA 4ZY2A 1VGYA 2GLFA 4NGTA 5CPAA 2PJCA 4OC1A 4MCSA 1ZLIA 3IWWA 1ELMP 4A38A 2C6PA 2CTCA 2ZOGA 2JBKA 4MHYA 4PXBA 4W9YA 2PJ6A 2OOTA 3SJFA 1Q7LA 2GREA 2PJ7A 1LFWA 4ZX9A 1LANA 3FEEA 3S9MA 1BPMA 1TF9A 2NSMA 4OC5A 2XEGA 2AFOA 4DJLA 5ELYA 5K8NA 3BI0A 4P4FA 1TXRA 3IEHA 3V7ZA 3D7HA 2BCOA 3WC6A 4JYWA 4EWTA 4NGRA 1JQGA 3WC5A 5HVGA 4R76A 3B2YA 2XEIA 3VATA 1R43A 4P4BA 3PBBA 3HUVA 1YLOA 2G9DA 4OP4A 4MMOA 4UIAA 1Z5RA 1UWYA 2ANPA 4AXVA 4YU9A 2GLJA 4FBEA 5LRJA 4X8IA 2AFXA 4K3NA 1PYTB 2EK9A 3B3VA 3KASA 4NGPA 1OBRA 2PJ2A 3D7DA 1LCPA 4F8ZA 2V8VA 2JEWA 3FF3A 5IB9A 2PJ8A 2I3CA 3WABA 4R8FA 2O4HA 1FNOA 4UIBA 3RZAA 3FH4A 6CPAA 2PJ1A 3BXMA 3IO1A 2PJAA 4ZX8A 4OMEA 2PIYA 4Z65A 2PJ9A 3D68A 3KR4A 1VIXA 2V8DA 3PB6X 1IGBA 1YMEA 2BOAA 3V38A 2ZELA 3TX8A 2AFZA 4NGNA 1TF8A 2Q43A 3LMSA 5LYFA 1LAPA 3B3CA 3FMCA 4F9VA 3L2NA 4PXCA 2HB6A 4F9UA 3SJXA 2C6CA 4YWYA 5LRGA 1YSJA 1XRYA
chains in the Genus database with same CATH superfamily
2YNCA 5FLXU 4PSWA 2GA7A 4TYBA 1S1UA 1YR0A 3AD9C 3CD0A 1QDUB 4F7VA 4DFKA 5E2QA 1FDDA 4A39A 2F65A 3CULA 2ZXVA 1CULB 4GRSA 4Y00A 1FE4A 2FPHX 2HAIA 1CJKB 1SQFA 5H9FK 2JEIA 1J5OA 1RHQB 3K17A 2R8HA 2PEBA 4WU2A 4NXNJ 3TCVA 1HBUB 2EC0A 1FFSB 3PM9A 1HMVB 2V4RA 3R7BB 2DEAA 4X3RA 5EWGA 4AE5A 3DRSA 3LP0B 2MY8A 2XZWA 4EZ9A 3CCVS 1RHKB 5IB0A 3QAEA 1UVLA 1LWCB 5LYIA 2ZBIA 5DS0A 2W8LA 2GIVA 3MM5A 2JOQA 1MLAA 3G8SA 3MM9A 5DG9A 3KQZA 2K5TA 4EK2A 4TNUA 2DRBA 4CCHA 2EPIA 3CJ4A 2I8EA 1QSNA 4XNHC 1XC9A 1RACB 4OLLA 2ASJA 4UA3A 5LYDA 3F73A 3E2EA 2D3O1 2WONB 3D5MA 1NHKL 2JJ4D 3OTDA 1XR7A 4USJC 3J81U 3W60A 2FHOB 3TUZC 2QLWA 4KLVA 1Z2LA 3E0KA 3ITHB 4EBDA 3DGPB 4C11B 3IRWP 4ED3A 1X0FA 2E5LJ 2AFUA 4YB1P 3NGUA 5C42B 1BQXA 5M2UA 3NH5A 2D4PA 5HVHA 3MPDA 4DX6A 3P3DA 3Q2TC 1UFLA 5DDRC 5GAEU 2GVZB 4X2BA 1HNXJ 2EWHA 3KL9A 3TJAA 1UEUA 1XNRF 2YNDA 3ZZTA 1S6PB 3KHRA 2IDEA 3DOLB 5J2MB 3M1VA 4OZJA 1IYKA 5IT9U 1ZA2B 1KC8T 2A4NA 5HQLA 4IDKA 1KZFA 2XLJA 2MEWA 3EVMA 4ZIVA 1PU9A 3N6NA 3B82A 4LFAF 2RJZA 2ROGA 4ED4A 1K0VA 1GMWD 3NAIA 1NK7A 3G9CA 2R7SA 1TL1B 1T9UA 1GHEA 2GJ2A 1U2RA 3CJTA 3OR1A 3DC2A 2F4FA 3PBEA 2WZNA 4ES2A 2XMVA 4WP9A 2P9EA 3NGDA 1FTRA 4CYOA 2Y1IA 3MMCA 4C8YA 4YB6A 4N41A 2V9KA 4ANCA 2G13A 4Q38A 4UWIA 2QIFA 2ARHA 5F46A 3PYDA 2R7UA 4TNOA 4IFVB 1OZPA 2CJ9A 1B7YB 3AD8C 4WBFA 4D3GA 1NZAA 3B3TA 3D3SA 1KVJA 1Z4RA 2K1RB 2OI2A 5K8PA 1QVFR 2LEAA 2ZW5A 4B3MF 3H7HB 1QTMA 1RBLA 3QNVA 2ZNYA 5CYQA 4WKYA 3MURP 2W1BA 5ETVA 3T19A 4OZ1A 2GLFA 4N77A 4ZHRB 3GJRB 3UCUP 4JI6F 5IQ6A 5KFQA 3R5BA 3MXHP 1OY8A 2YNHB 1HBOB 1BOBA 3KK3B 2GE3A 4H54A 3QBCA 2Z3MA 3BGRB 1ICEB 3BJYA 4QIGA 1RXTA 2OD4A 1KUVA 2ZFHA 4KHPJ 4Q0BB 4OC5A 5C2CA 2NS1B 1T9TA 3WC6A 3O2IA 3IU1A 4WXOA 3Q23A 3A8EA 2PSZA 3D3CJ 2DK2A 4U7CA 4FF3A 3VATA 1DTTA 1X0PA 2DGUA 4DCPB 2Q44A 3J80U 2DCUB 5KFAA 2G9DA 4ID5B 1QSRA 3IXQA 4DZ6A 2J8RA 2XMJA 1LW0B 5KTQA 3QLHA 3HXMA 3NOCA 4F67A 4YFJA 5GADI 2A0FB 4NLDA 4DQRA 1DURA 3ETOA 4DR7F 3TA1A 3VGVA 1EQMA 1NJYA 2O4HA 4UIBA 2PD1A 1NK5A 1SC4B 2PJ1A 4ECQA 4LF1A 4I2PB 2ZHOA 3TEGA 4K2XA 3P2FA 2FHJA 2Q7SA 1IKXA 2HHPA 1FKOB 2BW7A 2IRUA 3V38A 3EVOA 2CWKA 5AE3A 2GFQA 1A6LA 4B9NA 1T02A 1H2VZ 2Q1LA 1PBUA 2RS8A 2AD9A 1KSPA 1YSJA 2V9WA 4ANEA 4CLSA 3DU6A 4Z2XA 1SH2A 2IFXA 3D1OA 4N56A 5HP1A 1LOKA 2NXJA 4UUXA 2QFIA 4LF7F 4WIQA 3H90A 4DF8A 4RI1A 4DV5J 4ECTA 4NLPA 4DQSA 4YOEA 1U1NA 3D0IE 2V69A 2PVVA 5L9XA 4HVZA 2JLFA 4LQ9A 1NAQA 5F0UA 4NLYA 4CNYA 3QIDA 5EN1A 1RWVB 2WSCC 1TV6B 4MTPA 4M85A 4ONUA 2Z57B 2BJ8A 4N7TA 2CQ4A 3PEHA 4PXDA 3TZXA 1Y0HA 3CJ3A 3AJ2A 3KHLA 5KFRA 3HDSA 4U8VA 3FRZA 2H9ZA 4KZTA 2BZ2A 2PE8A 3PJXA 3GY9A 1N5VA 4CO5A 2W7AA 3G4SS 3GFZA 2MKSA 1HBUA 2ZEHA 4R0EA 3TWZA 4P52A 4Y2CA 4B5PA 1REVB 2BO9A 4DUKA 1ZO0A 1XBUA 2MLYA 2AGQA 2R8GA 4LFBF 3D8PA 1S99A 1YVFA 3CXPA 1ZM4A 4F26A 1XF8A 3PRBA 3A12A 3JSYA 3Q8PB 3MFIA 3FJUA 1X9SA 3HP6A 3W9IA 2XCPA 1YZ6A 1HA1A 1TTHB 1LW2A 4C4WA 2ASLA 3C6UB 3QT5A 3MOZA 2BBEA 4TVAB 4PCQA 1GFWB 4KOUA 2V0NA 4WFZA 2KXFA 2GQQA 3W66A 3DLHA 4IO9Q 1VMBA 1VKCA 5F8GA 2PMHA 3CCLS 4ZPBA 4CDIA 4OL8A 2QVPA 4C8OA 1N5YA 4E0AA 3RR8A 4GKJJ 2H5MA 1AROP 3TTHA 4Q8FA 2KM8B 2CQHA 1CJUA 3QSYB 2AMCB 2C2KB 4C11A 3KNGA 3SCKE 2DO0A 3KLHB 2CIMA 3AT1B 1Q2DA 2LVWA 3Q2SC 2N82B 1Q8BA 3PEIA 4CGNA 2W25A 4RWWA 1BAVA 2UUAJ 1WHWA 2JVRA 4YFUA 5DWMA 2FVPA 4QU6A 2ODFA 2R3VA 2DR7A 1S6PA 1NSPA 5J2MA 4FXWA 2EFPA 3IC1A 4DYOA 2UUCJ 4E8OA 4P6YA 3TQ1A 3DLLQ 4A8WA 5KFYA 1FFGB 1B0VA 4R9MA 3AH6A 2MGZA 4OI3A 2PJ4A 4P2FA 2UU9F 5BYRA 4CI0B 2GFFA 4IOAQ 1BQMA 2HVEA 5HO4A 2FCKA 2MKKA 3IWNC 1S5KA 3AQOA 2ZEMA 1NDLA 1YK9A 1K1SA 4X62F 1PYTA 3FZ2A 1TKDA 2AGOA 4RN7A 1T03A 4FNIA 3KKWA 3PB8X 3MRUA 3SDEB 5LJ5Y 3D4UA 4NXYA 1ZM2A 5K5MA 2C42A 4PQUA 2ACMA 3H4BA 4R8UA 2GVDA 4ZVGA 5HQ8A 4IO1A 1ULRA 4P75A 2E9TA 1BWEA 4L75A 1JLCB 1HR0F 3QFHA 4OC1A 1IN0A 4F8RA 4LSLA 4U8YA 2ATCB 2Q4YA 3FIXA 5FVJA 2MQMA 5T7LB 2XY5A 1IQTA 3RYOA 3QIPA 2LKZA 1S1TB 2OOTA 3SJFA 1U02A 2BJEA 1L3KA 4O4GA 3BDPA 2GNKA 3CC2S 1S1VA 1TL5A 1N33F 4Q2LA 4H6ZA 3I9ZA 1AZSB 4HYKA 2YNHA 4CH1A 5KT5A 1Q5YA 2BJ1A 1DTQA 4HI1A 2VOPA 1Y5LB 1KVIA 4F50A 5C5JA 4HH1A 3R1KA 4ECSA 3GIMA 2BE2A 3W2WA 1BY9A 3GFYA 3RB4A 3M2VA 3S8SA 5A0YA 4C7HA 2DTJA 3UN2A 3JTKA 1XNQJ 3WZ0A 3DMJB 2M70A 3NCQA 4Y34A 2YKAA 1N5SA 4G3IA 1LCPA 4B08A 1RYSA 1V0CA 4NCGB 2K3KA 3S7RA 4ID5A 2I3CA 5DGAA 1LW0A 2VODA 1U1OA 2SXLA 1VK8A 2ZNZA 1VRTB 3GV7B 3JQKA 2DH8A 2M0GB 3LACA 2AFZA 1TP7A 1KS2A 1P6TA 2HGNA 1LXJA 3MPVA 1RWOB 4KR0B 1VBXA 4KV8A 2J0QD 1S9EB 3RW7A 1DRZA 4DR6J 3EGNA 3HMJG 3QAYA 3UNYA 3EM1A 5HK4A 3V4IA 4J9NA 2E7WA 1M0SA 2KN4A 1NEEA 2J9CA 3W62A 2ZDOA 3M8QA 1WC3A 5ETSA 4X64J 4L6V3 2QMXA 1TU0B 3G6YA 4Z37A 4ELVA 4DR4J 1VYAA 3L7UA 1N56A 4XIUA 4JI7J 3W6XA 1IBMJ 2FJAB 4IFYA 1Y0RA 4CYUB 5K8MA 1P27B 1ZM3A 1RT7B 2FVCA 4USWA 2N4DA 4Z7YA 3CJKB 4O3QA 3KXDA 2O28A 2ZEDA 1WG1A 1WSVA 3Q8YA 3VF0B 1T05B 3HLPA 5J2PB 1XN9A 4II9A 2CNSA 5ISVA 3IGVA 3MZIA 2ACYA 9ATCB 1RBOB 1JLBA 1XK8A 3P6YC 4YMEA 3BKFA 5KFXA 2BEFA 2VQEF 5KFGA 3B3SA 2W2NP 1F9EB 2JEFA 1TL7B 1TV6A 1PJ6A 2YWFA 1R0CB 3DOKB 3CNQP 4H4MA 2CZ4A 2YNFA 1DLOB 4Q2MA 1BUXA 3CCWA 4IHMA 5F8HA 1V9OA 3HSGA 4HNYB 2XMMA 1OWXA 3DU5A 1IKWA 4DV0J 5F09A 4I6WA 3G3SA 3BPSP 2KYZA 3UI3A 4IQXA 1REVA 2GO8A 1YG0A 4OJ1A 2MSSA 4U67Q 2XEXA 1HQUB 2CNLB 2N7CA 1HFEL 3I0RB 4U9ZA 5A27A 3R95A 2WCXA 3PHEA 3K9TA 1WF0A 1M5VC 1FDNA 3D3BJ 2D41A 2HSEB 1VC0A 2N3OA 4FD4A 3L95X 5KFFA 3C6UA 4BC7A 3TJ8A 3LWUA 3BO3A 3SI0A 3SV4A 5IM0B 2CA9A 1S7NA 4RW7A 4ZPCA 4TYAA 2A10A 4QWEA 4I7FA 5K8OA 1NSQA 5DM6Q 5EHHA 2KXHA 2QL9B 1F5AA 3M8PA 3ZC4A 1VC6A 1RWUA 4PYAA 4USMA 3VHQA 1RAHB 1N34J 2OEJA 3W9JA 5GAHU 4ZVPB 2YWKA 4DX8H 3GJQB 1FVSA 4OHWA 5J1QA 1TR0A 1K4JA 2K06A 1AXQA 7FD1A 1JLEA 5THWA 3C14A 4TQSA 2KFZA 4LR8A 2IMWP 3GE9A 4DL3A 2VUGA 1F2PA 4RUAA 1EJ7L 3TOQA 1CPXA 4ZYQA 2GGPB 4CRJA 2ZBPA 4HNWB 2MHNA 3B54A 1AW0A 3P8BB 1RT1B 2B5GB 4OJHA 4NLOA 3UD5A 1B0TA 4KVME 2X1AA 3DLGA 3FRYA 1Y7PA 4TY9A 3OLAA 4B9UA 2YKOA 1HNIA 1TUVA 5KOXA 2AFSA 2V77A 2EKNA 4DR3J 2DRAA 1F57A 3PV8A 3V6DA 4RUHA 2R7TA 2ZUGA 4C2YA 1C1BB 3ENWA 2OZHA 2PJCA 3FEYB 3TARA 2W01A 1OQ3A 4G1IA 3R97A 3K89A 2YKQA 2JBKA 1OQ6A 2E9ZA 2DIUA 4KBIA 4ECXA 1XMQJ 1QY7A 1K9MT 2FIWA 4DUYF 3WQPA 3B8GA 2RUSA 2C3PA 1UEVA 1FRJA 3V7ZA 4FVCA 4O3OA 1VQLS 4MKAA 4IG3A 1N0UA 2QFJA 3HVRA 2J9DA 4CYPA 1RWKB 2QA1A 3UDLA 1VFJA 4R76A 3VR1A 4W92B 3HVTB 4L73A 1UVJA 4C0OC 3SYZA 3L09A 3J7ZT 4OP4A 3KK2A 3JSRA 2KZZA 4LVOP 4AXVA 1IJFB 3T1HF 4X8IA 3FMBA 4ZCKA 2HNZB 1WG5A 4AT1B 1S4FA 5GAHI 2PJ2A 2G4BA 4NMXA 4F0HA 3BO4A 5IXUA 3O5TB 2RT3A 5KFDA 2BDPA 3WABA 1U0HB 4RBVA 2LA4A 4Y2AA 3J7A1 1APSA 5B0AA 1TUGB 3EDQB 3LA0A 3DMJA 1KR4A 1Y9OA 2V4JB 5KFVA 3RB6A 4KOYA 3LO3A 2C2NA 1BC6A 3W5YA 3ADAC 4YB5A 4NCGA 1IGBA 1QE1A 1R0BG 5L1LA 4DR2J 5J8CA 2Z4PA 2VG5B 2ZEJA 2BACA 4PZVA 3LMSA 2J8SA 2DNPA 3ZTPA 2KDOA 2DPSA 1RXOB 1FRKA 2BUNA 3PJ9A 3GMGA 2ZD1A 5D15A 3HHLD 2PJ3A 3JQJA 3KHHA 4IOCQ 1C2PA 3M6WA 1VLOA 1SC6A 4ZN1A 2LFVA 1WEZA 2UXCJ 3NLCA 2FIAA 1EP4B 2Y0SD 3I87A 2KTQA 1IB1E 4EI2A 3B3WA 3LAMA 2ZM6J 3HZGA 4CM2A 1B4SA 3SSRA 3SHPA 4LF6J 4RLEA 2LQ8A 4ZIWA 4ZBGA 3FDSA 4FF4A 1H8LA 2UP1A 1Y7RA 3N28A 1Y11A 1CJVA 2A2DA 4DV7J 2BQUA 4B3TF 5I4MA 2FT0A 3FSXA 3DXBA 2WSAA 3OTCA 4KGZB 3EC4A 3NCPA 2YX4A 1PGZA 1QJHA 3NA6A 4UEFA 6AT1B 5AXNA 4TU7A 2GANA 1YW6A 1RT7A 3KMSA 4NLSA 2AJ4A 1UZHA 4PXEA 4O0NA 1MN7A 4ECZA 5FLXY 3Q83A 4R6TA 4CRZB 2DBBA 5D3GB 5K14B 5IV3A 1Q53A 1ZPVA 4LF4J 1B7FA 3IBFB 1S1WA 4M63A 1QSTA 4P73A 1VISA 2OGUA 2DGSA 1VIOA 4RW4B 4JV0A 3H2LA 5AXMA 5KFKA 1JNZB 4K4UA 1WC1A 3QJPA 2ALYB 5KG3A 4M5GA 2R7WA 2PC6A 2I79A 2EVNA 2F40A 1RADB 1T8EA 4WFNQ 3T5HA 1UKUA 3Q8SB 4HNXB 4QC6A 3KLFA 4P45A 4LQ6A 1FF2A 1BLUA 1YGHA 4K4XA 4MY0A 1WC5A 3KUGA 3QT8A 3JQMA 2IC3B 3AOCA 3LODA 4P44A 1VHOA 2WRMA 3J7YU 3BEGB 3DOMB 4PK3A 2DKOB 2W4DA 3MECB 3I56S 1ZZNA 1UVMA 4GVBB 2OP5A 3FBUA 5D8NA 1T95A 1IM6A 1HNZJ 2F1FA 2DY9A 3MGDA 2B8QA 2B9WA 5J1EB 3I0RA 4FPRA 2RILA 3T5LA 5KG1A 1LAMA 1TL3B 1KVKA 3IGRA 1U1KA 1FKAF 1S1XB 3E51A 4E2AA 4OC4A 2HLTA 2KYXA 4FBTA 4HL9A 4DR1J 4LUBA 4O23A 1W26A 2DHXA 5IC6B 1IU8A 3IR6B 1NU4A 4DL6A 2VB6A 3EGVA 2ZH9A 5HAOA 5G22A 3MD1A 1JMTA 4B14A 5GAGU 5J2QB 3CPAA 3SMZA 5IOLA 1F3FA 2IAJB 4M5NA 4B11A 2WTFA 4ZMMA 4OYBA 3RBUA 2HVDA 1FNMA 2VA3A 1E6VB 2C1EB 2ZZMA 1B87A 2OLWA 2FHKA 3NCRA 4MXUA 3D6TB 1S7KA 1WC0A 4NXMJ 4ER8A 3GP9A 4NZ7A 3CE8A 3R1LA 3TQEA 2OIHA 4IAVA 4H4OB 3ZTRA 4P72A 2HVHA 2Z0ZA 4WXWA 3OW2R 4JI8J 4CS0B 4LVNP 3TZYA 1HDUA 3NFZA 4NPOA 3U1LA 1Y7EA 2BANB 5CPAA 2B5GA 3HKZD 3LQVA 2CQGA 5A8RA 3SZ2A 4WK1A 3V6KA 1Z4UA 3S01A 2RDIA 4A8SA 4F6AA 2DEIA 1Z4EA 4OYOA 1BD6A 1ZPWX 1LANA 2ATRA 2VC0A 4OYMA 3THVA 3GILA 2ZKTA 4LRCA 3I55S 1YJNS 3FBBA 3D7HA 4J9OA 3LUYA 3NGTA 1R57A 4KO0B 4O3RA 1FWKA 1HNVB 4DSKA 4A4JA 3H5XA 4YRHA 2R8JA 4WWSA 4ELTA 3JTPA 4YU9A 8RUCA 3QB8A 2HFNA 3S6KA 4QVTA 2FIUA 3WDOA 1Q86T 3IG1B 5GAGI 1LOUA 1VRUA 2ZWPA 3CCTA 1JJ4A 3FNCA 3M4XA 2IYIA 1CS4A 2EG2A 3LP1A 1E6YA 1X10A 4F3MA 3S1TA 4DN0A 3Q8RB 4BMHA 2HUZA 2HNZA 1FE0A 3BH7B 3OFEA 1VRQC 1B64A 2JWNA 4J91A 4X4TA 4F02A 2XGQA 2WUUA 4EO6A 2DR9A 1SPBP 3TX8A 2QA4G 3GR0A 3J80Y 1X60A 4PXCA 4XK8C 1RT3B 4YWYA 3K9UA 1M5OC 2OB0A 4XPDC 3T1YJ 1VQ8S 1U6BA 3CVKA 2GW8A 5DDPC 2M4MA 1MG7A 3WR7A 2MQOA 2B0GA 3R96A 1P9YA 3BM7A 3RB3A 2MSTA 4B9LA 1HW9A 1G1XA 2WOMB 4P71A 2UV8G 1S9FA 2PI4A 2MKCA 4LFCF 3HO1A 1TMJA 3F0NA 3MR2A 3D1HA 1XR5A 4NE9C 2M3DA 4IK2A 2I9SA 3QRRA 4LSZB 5LYLA 1U1RA 5D0RA 4ZPVR 4ECWA 5EMIA 1NXIA 1XTZA 4A48A 3J81j 1F9HA 4M94A 3CW2C 2OO4A 2VKRA 4EO8A 3A13A 1FO1A 2XEJA 4QR2A 3NE7A 3NWRA 2QA2A 3BYRA 1Q2YA 4MJ8A 1R3NA 3EMTA 2J8AA 4LF8F 1YW4A 2QL7B 4JI3J 1UW4A 2HNYB 4YHHJ 3FECA 3D7SB 4XNHB 2FJVA 2XLKA 3NL0A 3OFGA 1HI1A 1SUQA 1BE4A 2YTCA 3AQPA 1GYTA 3IWLA 4JOUA 2FVGA 1IBLJ 3R27A 3VAFA 2X51A 3W5ZA 3RAMA 3BSAA 1IBKJ 4I2QA 1YJWS 3DRRB 2VH7A 5A8KB 1CPSA 4MKBA 3M8RA 2QE5A 2EFOA 2P6FA 4MT1A 4QPXA 3C2PA 4DV5F 4AG9A 5FIIA 1KKHA 1TELA 2MJNA 1OSCA 2WB4A 2GAHC 4OFZA 4OX9J 4EMEA 2VICA 4ECVA 4F4XA 1CG2A 4K4ZA 4U7UK 3FCWA 1QMUA 2M8HA 3OTOJ 2C6GA 1DTDA 1ITPA 2QL5B 2AZ1A 3D6FB 1CSJA 5DM7Q 3DOMA 3GCXP 4DXLA 5J2NB 2FY1A 4B5OA 2XHWA 1UCNA 1YGYA 2YKNB 3DLEA 4ECYA 3GUXA 4CNZA 3BI1A 1RP5A 5MLCV 2MQLA 2ZENA 5J1EA 4BWMA 2XTJP 2JDCA 3FSYA 1TL3A 2EC2A 2ZH5A 5KAKA 2IJRA 3KDOA 1SBRA 1ELLP 2WBMA 5A8WB 4M5DB 1QTNB 5DQGA 5LMUF 2YKPA 1URNA 4WE1B 1Q5VA 1IUJA 3M9OB 4MFLA 4N8OA 3OV7A 2VFUA 4NEYA 4UY8T 5J2QA 5KFLA 2FQQB 1U47A 2P9GA 2QEXS 2OPPA 3H8FA 5A28A 3MM6B 2O53A 4CIOA 4DV2J 1AFIA 3GV5B 2HFUA 8ATCB 1F2GA 1M4DA 2MZJA 3FVLA 4KYZA 2BE9B 2CJBA 4RNMA 3CSKA 2C2EA 2BJ3A 5DGBA 3CXQA 4WZMA 3T9ZA 1UEKA 4AXIA 4DPXA 3KK1B 1PJ5A 1MJ9A 1BWVA 1GXLA 4J9VA 2WW4A 3HD2A 1UJ6A 2OPRB 4A30A 2HHXA 1IR0A 2R4FA 4B13A 4CO2A 3S6FA 4M8LA 4A38A 3MI7X 1DZ5A 2B6AB 4IOBA 4A32A 4DUTA 3AB4B 4BS2A 1UA1A 2PJ7A 4CQ1A 3WX4A 1H98A 2RRAA 3I96A 3K59A 3AXKA 4L76A 2UUAF 3KNAA 1RTJB 2BJDA 1X9WA 4P4FA 1RQ0A 3HVAA 4HHUA 4KKOB 1X4DA 2E7VA 4JWPA 3TJ9A 1X5OA 1T0TV 3NBPB 4R5PB 1P4NA 1T94A 2YX7A 3QZ7A 2PC1A 4JJXA 2KU7A 4JI1J 1UVNA 2XZDB 4WZQA 1UPMB 4WP8A 2VPYB 2YH0A 3OSNA 3CC4S 4F8ZA 4B9MA 4PUOB 4WCEQ 3KOAA 1WKLA 1QD1A 3OSPA 3R2DJ 2HQCA 1NUEA 4DLGA 2HKEA 6CPAA 2MKHA 5AGEA 3I0SA 3MD3A 4UZCA 2PIYA 3KUHA 2GQCA 3GU0A 3MEDB 4LBPA 3OVSA 4USVA 2FSRA 4NGNA 2F5GA 2AX1A 2Z3PA 3TR5A 1RAGB 5L1IA 2HB6A 1S7IA 3RAQA 4MIBA 3KLIA 1H7WA 1SQGA 2HHTA 4ES3A 3MM8A 4ZJQA 3K5MA 3MEGB 4RBTA 3W6SA 3V5RA 3Q8UA 3K5NA 2H4WB 3NH8A 2W9BA 5KG0A 4USKA 3CDEA 4ECRA 2YQ0A 2EKYA 3AA8A 1YVOA 1C0UB 2QYVA 3IFEA 1RK8A 3AOBA 1RE1B 3UQSA 3ILIA 4TY8A 4M6GA 2QLXA 1I94J 3GPAA 2CQCA 2PFFB 3IRXB 1OPZA 2EG1A 3K8WA 1ZZFA 4OV1A 1KOOA 1U24A 1MNEA 1HWIA 3TC8A 1HWKA 3GB0A 1CJTA 4KTQA 3FQKA 1HBMB 2CRLA 3OJSA 1K47A 2OEMA 3CUNA 4QIEA 4CLFA 2XEFA 4KOVA 2B4DA 2YNIB 3BJ7A 2HBZB 2KKHA 4RW6B 4WJBA 3WIUA 1KLMB 1ZS6A 2OPSB 3FEZA 4YR3A 3RRKA 2R7RA 2HHWA 1NJZA 5ETQA 4C0BA 4MCQA 2VBWA 4YGOA 2GJFA 3CDWA 3SXLA 2XY6A 3SIPB 4MCRA 1XMOJ 4DCOB 4LQGA 1FD8A 1SQHA 2GZOA 2GS8A 2MQPA 3UCZP 1JLFA 1OY6A 3PDNA 4URGA 3UD4P 2AJQA 2LDIA 4ZY1A 2G9OA 1OPIA 1PBAA 4M5JA 4DSIA 3IM8A 1RI7A 4OYPA 3WC7A 2V6AA 3X1LB 1QUVA 4L3KA 3PEJA 1PCAA 1WOSA 2EBJA 3BQ1A 4BINA 2BRLA 4USUA 2J6SA 1I1DA 1I51B 2DXFA 5D77A 1JJ2R 3JS9A 1AFJA 3FEDA 2M7SA 2CPFA 2VONA 4HHJA 1O5JA 2N7YA 3ULHA 2OZUA 2DNQA 2YKMA 4RPFA 5FD1A 4JI7F 2PIZA 3DRRA 4O4RA 4DPTA 5IV0A 1Y00A 2MB0B 4KSIA 4HT5A 4F2SA 3VWEA 1KD1T 3AD7C 3R6GB 2R1IA 1G2EA 3DDKA 2ZC3A 4WF9Q 4XDCA 5A2QU 3KHGA 1SC3B 2RRBA 4X4SA 2NUUG 1ZAVA 4N76A 3D2PA 1EARA 2XQCA 4KSAA 4AL6A 5KFIA 2O66A 3F8KA 4J9RA 1RAOA 1A2ZA 2FC9A 2ZKUA 1MSWD 3TFYA 4JI2J 3FBEA 2MLZA 1M5PC 4UFXA 1F9FA 5CNPA 3HHLB 5F8NA 1FDAA 2ZWOA 4YUDA 5C25A 2DGQA 3BR8A 3A3NB 1S6UA 1XFOA 1NMEB 2BA9A 4CT8A 2D9OA 2DNKA 2I5JB 1VQPS 1N6QA 2IJZA 1Q8LA 2VQYA 3ISZA 3GWCA 3CD6S 3SI8A 4M5DA 4F25A 2CDRB 3M6XA 4J9PA 3MFHA 4QZVB 3ZTSA 2RIJA 2D3ZA 4QWDA 2DGOA 1ZG7A 2AYGA 3SSQA 1YJ7A 2HGLA 3TVZA 2ZEFA 2V50A 4EYHB 4M5HA 1Y5IB 3W8PA 1FK9A 4KQZA 1CC7A 1RU1A 1RTDA 3HJVA 4R0JA 3UPFA 1YTYA 2F4VJ 2E5JA 1PUAA 5JQ4A 1X4FA 1YRXA 2YNGA 3OPKA 2DNNA 3QYYA 3NS6A 1NDKA 3FXTA 4MHYA 5AG6A 2X7IA 1D9AA 3KK1A 2KVQE 3OHAA 1NLKL 3CO9A 4RX6A 1SC1B 2BL1A 5AJ3F 1U0SA 2NSMA 3MR7A 1D09B 2MZ1A 2ZJRQ 4DJLA 1PC5A 4ENOA 3LAKA 2BCOA 4B3SJ 4DDFA 1N34F 4P9SA 2KRRA 4URSA 4J37A 2HFZA 4I49A 5HVGA 1T3OA 4D3HA 2XEIA 3KLEB 2NZCA 3GV8B 3POTB 5KFTA 2WBRA 4CT9A 4B12A 1I21A 4HPSA 2XWXA 4F2RA 2K7JA 2GLJA 5F9NA 3G8WA 4G1QB 2QX0A 3QWPA 2E29A 4KKOA 4CO3A 3VQSA 4IG0A 3W9HA 5BXIA 4RKUC 3MOJB 3NBPA 1M5SA 1VDHA 2EI5A 2HFSA 1Q82T 1UFKA 2Q6CA 1HPZB 3OL7A 4WP3A 2QYGA 4K4WA 2NPIA 3DLKA 3ET6A 2Z3KA 3TA0A 2VBQA 2KFYA 3RZAA 2Q4VA 3PIOQ 5HROA 2CVIA 1IXKA 5HMYA 2BABA 1W2IA 4I4BA 1U49A 5LSRA 3GR1A 2R8KA 1JLGB 2I6WA 3JVNA 4DR3F 4PUOA 2AIRB 4B3OB 3TOAA 3DR8A 2DHHA 3FMWA 1LV5A 2FXFA 3BSOA 3GYNA 3NNAA 3QGGA 4F0XA 4FKXA 1XOVA 3T9YA 1T9VA 3L2NA 4MIAA 3BBBA 1HWUA 1HWJA 4ED0A 2VV5A 2RVJA 4OJGA 3QGPA 1JXLA 1XMQF 1TKTB 2C2OB 4E2FB 4ZCLA 2AFMA 4BHQA 1QAXA 3TANA 1GMUA 5I42A 1SKWA 5L38A 2W9CA 5EWFA 2VFSA 2RH3A 1W25A 4LJMA 3CXCR 4RWXA 1JLAA 4H6UA 3KI9A 4Q5VA 5IC4B 1FKPA 3UO0A 4LBIA 3IIBA 4ZN3A 2HW3A 1RTZA 3SJEA 4OADA 4MFKA 4P4JA 4NGQA 1IKVA 1SJ4P 3OLBA 3PVXA 1RT6B 4K0KJ 1TIQA 3FCVA 3I31A 3AHPA 1KOHA 4DG1B 5E3QA 2IRXA 5F41A 3AOAA 2B51A 4MY3A 1WHVA 1N36F 5EX0A 2O01C 2NYQA 3B6BA 1J4JA 2PRBA 1S5ZA 4ILRA 2D1CA 3UDVA 3GTYX 5FDLB 4GO7X 1CJWA 3CCSS 5IT0A 5AG7A 3NNCA 4RUBA 2QG9B 1DARA 3FFIA 5DQIA 5CQGA 3MWBA 4RNOA 1O6XA 1X4AA 1B99A 4IH7A 5EUHA 3SFUA 2I38A 3HULA 2HYIB 1DJ0A 3T6BA 1RHJB 1NHVA 3KHZA 3MTJA 1WNEA 1OJ4A 2U1AA 1ON0A 2XSFA 2ZVSA 2F63A 3G87A 4HH0A 3CJRA 4RZRA 5GCNA 5ADZA 5DQHA 5F0WA 1HYSB 5IV4A 2OMOA 4ZY0A 1Z8WA 3PKMA 3NKYA 1SL2A 4C6AA 4OI6A 2PDOA 1EE3P 1PAEX 2KT5A 2OTLS 4PG7A 3R7NB 2CVEA 2I1RA 3O3LA 3DNSA 1GXUA 2IA6A 2AJ0A 2CPJA 1U7LA 2V2KA 3K0JA 5KT4A 1ZM9A 1P1TA 4CAEA 3DI6B 1RAIB 3IA0A 1D0EA 5L8RC 3UFCX 1NK8A 3G2XA 4MHZA 4AD6A 4C2ZA 3I9V9 3R8YA 2MQQA 5CYMA 1KONA 4DSJA 2H1YA 1VC5A 4YR2A 4X66J 2JRSA 4IRDA 4DI6A 2HQIA 1EKRA 2GC8A 4RW8B 4DBQA 1AUSL 3MAAA 2RUGA 5E33A 5MAOA 4LFAJ 5HBMA 3LTOA 2DNLA 4LF4F 4Y49C 1S9GA 1RT5A 5A76A 1IOIA 3BO2A 4OI0A 5DO2A 2M8DB 2LECA 3CCQS 3GCWP 1WKJA 4EGLA 2Q66A 4CO4A 5C24B 3PACA 5G0RB 3GLJA 4MKVA 4DR5F 2W9AA 5HXDA 3GG0A 3PFOA 4DF4A 2Q7BA 3M2RB 3K5PA 4UZBA 4ED5A 5G1ZA 4EFDA 5KT2A 2DO4A 2AT1B 2NCKL 1XMBA 1CM0A 4L89A 4FBUA 2RSQA 1BQNB 4UOFA 2L9WA 1RTHB 4DSFA 2OFGX 2UUWA 4DCJB 1H73A 1H7XA 4ZVFA 1F5CA 3AFGA 1FX2A 1M5HA 5LL6d 3TAMB 4F4WA 2CPXA 3GZ7A 3NXZA 3GYGA 2A6OA 4J90A 3JYTA 1FJEB 2FHJD 2AJFE 1NJIT 2CTCA 3K57A 4DL4A 3VAMA 1JKHB 3FUYA 4WK3A 3MCMA 3MM7B 1RLCL 2GREA 4DV6J 1SJ1A 2HFOA 1WDTA 5D6GA 3CC7S 4A8MP 1NK0A 4NI2A 2YWEA 4Y0FA 5ETPA 5DLFA 4C8ZA 4OAEA 5I3UB 4P7VA 1DBDA 2AP6A 3IU2A 2AF6A 2BJ7A 1AA1B 4CO1A 5G21A 4I64A 2E5IA 1A7GE 1RDRA 5BR8J 4OZNA 1WF1A 3IP0A 1NPRA 1NSLA 1YREA 2KCWA 2K3IA 3H40A 4R87A 3PO5A 3ZNJ1 1RHRB 1H0HB 2B43A 4QBUA 3HVWA 2H4YB 1R8HA 2OH1A 3CJ0A 2RHQB 2D4OA 1FRHA 2DXQA 3D7DA 2V8VA 2ILZA 2JEWA 5HJYA 3C6TA 2OUGA 5I3QA 2Z2LA 5JVGQ 2NQPA 4FP9A 2GMJA 5CHCB 1WWHA 3DYAB 1SJ3P 2X3GA 4UCNA 2BM0A 1YQEA 3W91A 2OU2A 3CZXA 1REGX 4K4SA 4Z65A 2LXIA 2PJ9A 3KR4A 4Q45A 3M7VA 4K4YA 2XSJB 4YDXA 2VZYA 2LP4A 1Q7LB 1FI4A 2Q43A 4LX9A 4LR7A 3T6JA 4BBYA 5L1KA 3CD7A 4MIWA 4W4MA 5F3TA 3Q86A 3MMBB 5HMNA 4KGVB 4B3OA 4TLQA 5HN0A 3VZHA 3TAPA 3WT4A 2MZTA 4EYIB 5ITHA 3CO0P 2CZVC 4N47A 4LF7J 1YBAA 4O44A 1FEEA 2R42A 3DXSX 4FZVA 5JM6A 4JYAF 2DNYA 2HZAA 3EUNA 2ABZA 1HHQA 1RT2B 1TL4A 5JJBA 4ED6A 2ZJQQ 5B0EA 4C68A 2UXDF 2ZE2B 3FRMA 2LU1A 2OEKA 1L3VA 3U27A 2Z2MA 5F8LA 2HWTA 1RA6A 3MR6A 2HRTA 3VGSA 4Z7CA 3PRTA 4C2XA 1XJOA 5GMDA 1XE4A 4C8MA 4A37A 2CFXA 3VVTA 1R6VA 3TVYA 5HLFA 3DGVA 3AAWB 4RU2A 3GSIA 1PIEA 2EVZA 1HKAA 3C66A 3KR5A 3SCIE 2KHCA 3CCJS 3M32B 3BHXA 4C3KA 3ZTQA 4MFQA 2DPTA 1X7VA 4TU8A 1WOPA 3QJLA 1WDDA 4Y65A 3UE2A 4YY3F 3PB4X 2RF2B 3TAQA 1URRA 3QO9B 2VZZA 4QIFA 4Q36A 4DNCA 4LFBJ 2Z56B 1LWFB 1CBKA 2VDIA 4QQBA 5ETNA 1RUSA 4NLVA 1LWEA 1VLYA 3VTIA 1KQSR 1V5VA 2R98A 1HQEB 2LDYA 2UVVA 3OUYA 2VG7A 3BBCA 2HMIA 3NWGA 2B4UA 2HHHJ 3N5BA 4PWUA 3K5OA 2WHOA 4RU9A 1JLQB 3P5TL 4IH5A 1IKYB 2YWHA 3CJ5A 4G6VB 1GX6A 1TKZB 1TKXA 4WFBQ 2NXCA 4B02A 1K1QA 3WBZA 3I5AA 5CCMA 4PG5A 2HBYB 3OQ2A 3N0VA 1NK4A 3MHYA 2QJ8A 3LW5C 1F2HA 1SKSA 3MEEB 4PR6A 3RBZA 5B08A 3NMRA 1HI8A 2CQ2A 1FESA 3MAHA 4FXVA 3LPYA 1RAFB 4GKKF 1S4EA 3DI6A 2F3JA 5U47A 2V8HA 3W2VB 3OBIA 1R0AA 2CPDA 2IJNA 4W90B 4IR1A 4Q7AA 1FXLA 3BKTA 1HNWF 3TP2A 5GAEI 3CPWR 2AQ4A 5ETOA 4JI5J 3GJSB 4I68A 1FNXH 1K73T 1S12A 4JI3F 2PJBA 2ERRA 3MUVP 2HQYA 2B4BA 2FLNA 2NXNA 4YHHF 2J0SD 1TVRA 1O51A 4UBRA 4J9SA 2ROEA 3I6PA 5HI7A 3E01B 4PABA 5HL7Q 1NPKA 3G71S 2HHUA 4KH0B 2UUBF 3C15B 2NSBA 4GMKA 1YHQS 1TMMA 3FNNA 2BKPA 3EFAA 3SQGA 1UMJA 1X4CA 1D8ZA 4CAVA 3LP2A 2CNNB 1M4IA 1NH7A 1S6QB 2HVZA 2PR1A 2WYRA 2RU3A 3QRQA 4X62J 4A8FA 4HACA 5LMNJ 3B35A 3V4MA 2OPQB 4NA2A 1SV5A 1SQEA 2HS3A 3ZJ0A 2FS5A 4K5SA 3EX7B 1RWNB 2AE6A 2QV6A 2CPZA 4OX9F 2V5HG 1H6KX 1YRTA 4U5YA 5L46A 3NNHA 4JLYA 1SXLA 2VC1A 3ZNUA 4IQMA 3OTOF 3IWWA 2D3UA 3DLBA 1HR0J 1FXRA 4LSNB 1KQKA 3M6UA 1Y9KA 3TNVA 1QLNA 4FXDA 4PWDA 4PXBA 3BF4A 4W9YA 2GHWA 3EXYA 2OKQA 2AU0A 4HKFA 1LFWA 3RG6A 4ZX9A 1BPMA 4BC9A 3THPA 3CCRS 1B70B 2J8MA 3BDEA 4KUBA 4CGOA 1N33J 3HT0A 4EBCA 1FTCA 1I1GA 2CY2A 1JKHA 4ZDNA 3M8YA 3T90A 4OLPA 2ZUAA 2R7HA 2BX6A 4CLLA 3MAQA 1YLOA 2QMLA 1YI2S 2DPIA 3WIVA 4MMOA 4F4ZA 5KT6A 2O3DA 1CULA 4UOHA 4R3LA 1Q4RA 1IICA 4K3NA 3G82B 3W65A 1CJKA 3FBCA 3NY0A 3GIKA 3KYLA 2Y1LB 2EFGA 1L0CA 2ZW4A 4QW8A 4ILMA 1K0TA 4DV2F 2ADCA 1EETB 1TFWA 4QYZK 2DD8S 4Y28C 1YIJS 3OL8A 3H20A 4QYRA 4NLTA 3D54A 1HMVA 4ZVOB 4IRKA 1VJWA 2BVZA 4FD7A 1YJUA 5IX3A 4X4RA 2P0WA 3LP0A 4R25A 2XWYA 4OI1A 1IYLA 2PA3A 2FLPA 1LWCA 2ZBQA 4OYAA 2EUIA 4X65F 3M30B 3BPDA 3HJFA 3EZOA 5A6PA 1MW7A 4XPDB 5H9EK 2RDDA 3RBEA 1UTAA 4FUUA 3R9LA 2DNZA 2WONA 2J9AA 3Q22A 3H25A 9RUBA 3MR3A 4DL7A 2DNHA 5EC4A 2B9EA 1WTFA 4B6ZA 1WC6A 4KOXA 3ITHA 4UT4A 3DGPA 3H2UB 2X3DA 2PJ5A 5LRKA 5C42A 2X1BA 2MKYA 3BSCA 2Q6BA 3KFWX 2ZEPA 4EU0A 1FA0A 2R7QA 1VHIA 1HBNB 2GVZA 2F9DA 4Y6IA 3IGNA 2PEHA 5ETKA 3DOLA 3OFHA 1U48A 3DM2B 4MCPA 1UWBB 3PB7X 3H98A 1RISA 4KC5A 2PJ0A 1RWXB 2ALZA 5CXTA 4NLGA 1WACA 1PKUA 3HHLC 4PQAA 5GMKa 2FE7A 2J8NA 1XWLA 4XPLA 2J6TA 4YN3B 2XULA 2QLFB 3G96A 3UVJB 4FYYB 2CQ0A 1NDPA 3LH2S 1TL1A 4JB8B 1MMDA 4YS2A 5HMXA 1VHSA 2QTWA 2EWBA 3LWLA 2AFWA 4TLRA 2HHQA 4A33A 2MDAA 1F6TA 2IM3A 4DSLA 1GTHA 1EB0A 1GT8A 1N48A 1IM4A 3FK4A 5KFEA 2RE1A 1NSKL 2CPEA 4DV4J 1NPPA 2KJWA 2C3YA 5B0GA 4AVBA 3DRXA 3DRYA 2DGXA 2HS4A 3Q0AA 1IWAA 4UWJA 4ZVHA 4QR0A 2PCUA 1LWFA 4IFVA 3O6QA 3OJUA 2BUEA 1J5OB 3IWGA 5FJ4A 1RTIB 2XMKA 1CLFA 5DRKA 5ETMA 5EX3A 4N5SA 2HS0A 2CIJA 6FD1A 4C8KA 1ZTTA 2CXAA 2CUYA 2K1RA 1ZBTA 3VQTA 1Q79A 2BEIA 1S0MA 4NLQA 2JDJA 3S6EA 4P2SA 1Q8KA 3CB4A 2J7WA 2POKA 1S10A 4MHDA 3PYFA 1ELOA 3IWXA 3DRSB 5DDOC 1N32J 4ZHRA 1KQGB 3BGUA 2A3JA 3VALA 3KJQB 3TUJC 2WPXA 4NF1A 1X31C 4A47A 5CD4H 3C26A 4DUZF 1HBOA 3KK3A 3VAHA 3MM5B 4X4QA 3MM9B 1NHUA 2DB1A 3BGRA 2FVRA 5BYQA 5KFSA 4Q0BA 5G4DA 4EEYA 3BN7A 3BN4A 2G0IA 4IR9A 2VD3A 5C82A 3QPIA 3ZZRA 5AXKA 4KFBB 4CAXA 2FC8A 2AHOB 1KDNA 1M1HA 2JX2A 3N7ZA 1GQEA 1HLWA 2JEJA 3T41A 3P49B 4LMZA 4HLBA 3HPOA 1C4AA 2P2CB 3VAGA 2FUG9 1Q0NA 1YBTA 1Z1ZA 1B3TA 2D74B 2ZEOA 3CMQA 2MMYA 4JXRA 5ETLA 2VHGA 4FPIA 4KJIA 3S6GA 3EYZA 2DR8A 1BLLE 5F47A 2NREA 4C97A 1OS5A 5BJRA 1QSMA 4FVMA 4ELUA 3ILLA 1GTEA 4MHPA 2C22A 4G65A 4OC3A 1P8GA 1WEYA 4ZY2A 4WTOB 4WYLA 4I2PA 3M1VB 4K4VA 3NS7B 3TUPA 1WI6A 4IDKB 2MZSA 1FKOA 5KFCA 4JV5J 4KH1B 4USIA 3VAJA 2VJUA 4XPEA 2FJEB 3BV8A 3HSJA 3LALA 3OR1B 4MYUA 2CQBA 4PWWA 5ELYA 5B0FA 1TXRA 3L4BC 4P7TA 1C1CB 2E1CA 2GQ2A 4HT7A 3TO7A 1G7CB 2FJBB 4NYPA 1FD2A 4NL5A 1VQMS 5F8IA 3THTA 3ZZZA 1YJRA 3MMCB 2KZMA 5BYSA 3FKBA 2AYEA 1OY9A 4R57A 4A46A 5M2RA 4FKYA 2ANPA 1LXNA 4FBEA 1QM9A 3HHNB 1YVKA 2HHSA 4TN2A 4LF9F 4P2XA 2FGOA 3T1HJ 2V4QA 2FHMA 2RNEA 2MXYA 3H2VE 2XLIA 3PIPQ 5IB9A 3UN3A 3D4JA 2W2MP 2R2TA 1M1KT 1VQKS 4H4KA 1YJ9S 1YITS 4EFAC 4ETXA 1FJCA 5KTCA 2J0WA 1Y3JA 2DY1A 2RQCA 4EBEA 2KI2A 4BCAA 3WC2A 1UL3A 4MFJA 3NS5A 1YBUA 4OHVA 1ROFA 2RAQA 2BQRA 2HNDB 3BREA 4LREA 2CNTA 4M5KA 1FJGF 4UW2A 3SJXA 5LRGA 2V34A 4A8XA 3FBFA 4RO0A 4NZ0A 1FERA 3G8TA 4UCMA 3VWDA 1I5OB 4QU7A 1DTTB 2YQ1A 3P96A 1WJ9A 4GS4A 4B3SF 4CO0A 3PZJA 2C3OA 2KB2A 4WKRA 2Y9HA 3QLHB 4YP3A 4F0YA 4KGXB 1PILA 1YJVA 1RHUB 4RL1A 3UW1A 2Z2YB 2YBVA 4LIRA 3US5A 3ILJA 5D0HA 2YY3A 4B3RF 4KUAA 4OC2A 1EIYB 2GIRA 2MZRA 2V8GA 2ZW7A 1NMTA 1I3OB 2PGCA 4V19X 2YWGA 2D69A 4OV6A 1UFWA 3KLHA 2IM0A 2M2BA 1IKXB 1MMNA 1TZ0A 1VJQA 2DNOA 3KG4A 1TAUA 2ZDPA 1N88A 2ZITA 3I4HX 3LWMA 2XYPB 2QLBB 5J1PA 2G0JA 3DDIA 4IYQA 3UD3P 2HWIA 3KTQA 4KRWA 2CTBA 2Z11A 5T41A 3ZXWA 2LQ9A 3JTNA 2JFKA 2D9PA 2J7KA 1K44A 2IM1A 4CRYB 4EUVA 5K9FA 4A8YA 5J8FA 4OIWA 3UVJA 2EK6A 4OI2A 1NJXA 2IBKA 2Z30B 2YWWA 3R2CJ 2XBPA 3W5XA 4GC6A 1X4EA 2B4PA 2DNMA 4I0WA 4C8LA 2VL1A 1YJTA 2OD6A 2RHSB 3GIRA 1RU2A 3SDEA 3CT9A 1MMLA 4F3QA 2W24A 2P5VA 3N9UC 4K0KF 1D9FA 4EVYA 1U6FA 5HH1A 1YK3A 3CDUA 4ITSA 3CPXA 3N6LA 1RTIA 1JLCA 3Q8QB 1S7FA 4K2JA 3ISND 4C8NA 2KL8A 1N71A 4HR2A 4B5PB 3LD2A 5T7LA 4CGLA 1OMSA 3BSNA 4MFPA 1S76D 1ZG9A 2CKWA 1S1TA 3U7JA 4NMLA 4NA3A 2JH3A 2P9CA 4AFFA 4X4UA 2LEBA 3SI2A 4KPYA 1AZSA 5B09A 4ZP8A 4AVCA 4NA1A 1F60B 3UWTA 1QAJA 1SI9A 2CDQA 1LW2B 3VZIA 2FLOA 3H8GA 4J5OA 5IWAF 5M2PA 3BKUA 5IS2A 2JLEA 5DG8A 5EDWA 3SI1A 2RQ4A 4F04B 4ALZA 2O67A 1TKJA 5KT7A 4KFBA 2F8MA 3QNWB 3GG1A 1N5YB 2REEA 2P6TA 2A6MA 2QMUB 2G3TA 3WC0A 4AB7A 1WHXA 2OZGA 2MJUA 1CJUB 3DN9A 3H5UA 3VVUA 2MKJA 4J3GA 2VZ9A 4ZI6A 4MHNA 1ZYQA 3D9BA 4LIWA 2PT0A 3NAHA 1ZLIA 4I1TA 1VRTA 3KLVA 3M6VA 3BGLA 4X5KA 2QSFA 5AE1A 4OQJA 2E9RX 1PO6A 1HHTP 2G0BA 1SIWB 4KSFA 4UY85 4X66F 1S9EA 2VQFF 2EFNA 3PY8A 3BI0A 2E1PA 2FTRA 1H38A 1WWZA 2E44A 2MGZB 4WU3A 4J7CA 3PX0A 4IF5A 4CLZA 3CWJA 5GADU 2K7KA 1BQMB 3G6XA 5E7OB 1RAAB 4ED7A 2F9JA 4FS1A 1N5QA 2QMWA 3HK2A 2IHR1 1DFDA 2KH9A 2JHEA 4UIAA 1Q7YT 3KG1A 2DITA 2B3TB 3U1NA 1C1CA 2EFQA 1PG5B 2AFXA 3W1YC 1M90T 1PYTB 1T03B 1KUYA 4CYUA 2HK2A 2OSQA 4O3SA 3CJKA 1Q8IA 5CCLA 4PQUB 4R8UB 5DZ6A 2GVDB 2VFRA 2CQ1A 4ED8A 4WFXA 1T05A 5J2PA 1FNOA 5I0CA 3A3OB 3IR7B 4MK7A 1NK9A 3VCDA 1CC8A 3MMAB 3HT3A 3EXCX 3KMQA 4Q44A 1DAXA 1MU2B 4NEZA 4LSLB 4NRUA 1TL7A 3CMES 5LXYA 2WSEC 3DOKA 3QIPB 4KB7A 2UV8A 1DLOA 3PR5B 4AQYJ 4O4GB 5H1SV 4DV3F 1LAPA 1S1VB 4PG4A 4NLWA 3BGFA 4OI4A 4ZCIA 1GK8A 1DTQB 4DV6F 5G20A 1NCLA 4CLKA 2J76E 2BE2B 2IY5B 4CLTA 2AJ6A 3PW7A 3W2WB 4ZKAA 4X84A 1X5SA 2HNDA 2B8PA 3M2VB 3QAHA 1PAUB 4K5RA 1QAYA 1HQUA 1OO0B 3GFXA 2R7VA 5A0YB 2HFVA 2J6UA 4C0HA 2XMUA 1CVJA 5BR8F 5F8JA 4NXNF 4UOGA 2H65B 3UR0A 3H8EA 4KVXA 3X3UA 5JUMA 4LFCJ 2QT7A 4CTAB 2ASDA 1U6MA 5ETTA 3SJGA 3GSDA 2VASA 3UDCA 3J81Y 4UEZA 1S0VA 5LM7E 3TYTA 2WZ1A 2KXNB 1LWXA 3I1UA 5IM0A 3D7GA 4GM5A 4MAKA 3LPEA 4MI4A 3T3FA 4ZPWR 5EBVA 2RD5C 1KUXA 4TWEA 4NCZA 1VQYA 1T7PA 2F5IA 3BQ2A 1IOFA 4LF8J 2F7VA 1M44A 4KV8B 3M8SA 4UTGA 1W7WA 4ICLB 4MH8A 3V4IB 2BV3A 4ZPDA 2QECA 4WIIA 1NKBA 3M8QB 4ZPAA 2RB7A 2B7CB 4J9UE 3OWCA 3V6JA 4HTIA 2G2ZA 5IT9Y 3RBDA 4YQWA 1VQSA 3PNIA 2OELA 4L8AA 3VGUA 4OYXA 4V19J 4CLUA 3M2UB 4LQ3A 3F44A 3OR2B 4KE5A 2QIRA 1M4LA 1R6YA 2A1BA 2E5LF 4IFYB 2GGPA 2DH7A 3FC9A 3P2HA 2RFHA 1VBYA 1RT1A 4QW9A 3MR5A 2RKIB 4ZLLA 3FQLA 1RO5A 1HNXF 3J7YI 3U1MA 1WELA 1JLBB 3RW6A 3N5FA 3PZPA 2I2YA 4JI4J 5KTAA 2JZ5A 1C1BA 2XMWA 2R9LA 2D7SA 2L9DA 3VV2B 2DR5A 2AEJA 3NRBA 1VHEA 4H4MB 5CH7B 2YNFB 2PVWA 4DFJA 3NH4A 2IM2A 4X4VA 1NSAA 4Y49B 1Y4ZB 3PX6A 3RB0A 1KTQA 2HURA 4YDDB 2B4OA 1HW8A 2J7UA 4BLGA 2MKIA 3W3SA 1M4GA 2P6EA 2FZGB 2HZVA 1IKWB 1HEEA 4L72B 3DCAA 4X4NA 2NR0A 2MYFA 3IAM9 5LMUJ 1KWMA 1WKKA 3K5LA 2QSWA 5EWEA 2EEYA 2HAFA 3HVTA 2QJ3A 1X4GA 4J9LA 5H9FJ 4Y3CA 4OYZA 1ACMB 3V2UC 1FEHA 2CJKA 1QSYA 2XB2D 4Y2IA 3MN8A 1U6ZA 5SUHA 4J9QA 2HHHF 5KFNA 3FJ2A 4O3PA 4C9DA 1R27B 3MCNA 2E7XA 3ZZYA 3RJMB 4IRCA 4NGSA 4ZVTB 2GMHA 3KLGB 1WSRA 1KTVA 1VQ4S 3PRVA 4CWBA 3PHTA 1U0HA 1KBRA 1J5EJ 4HDHA 3EY5A 2X7BA 3L7PA 1VGYA 5GVQA 2CNMA 4RW7B 2HQ3A 2ZH2A 2Z58B 4I7FB 5D0GA 4A8QA 2P6GA 1NJWA 2V4JA 4QOTA 4AYBD 1NO8A 3DSBA 4FF1A 1XEZA 3RYLA 3M8PB 3GFHA 2UVUA 4KHPF 2XCAA 2B7BB 3EZ5A 3QQCD 2L41A 3R9FA 4KLWA 1T9XA 1GMWA 2VG5A 2A2CA 2OTJS 4XAKA 4CAWA 2ILYA 1Q78A 4YEAA 1SH3A 2B3VA 4QR1A 3P4UB 4ZLNA 4AXJA 3FYNA 4JI5F 2RC4A 1JLEB 3ENQA 3C14B 6FDRA 1HD1A 1EP4A 1BGXT 4C3LA 2DEJA 2UXBJ 4DS4A 3TO8A 3FGVA 1OBRA 4DFMA 3DLGB 3OTEA 1XERA 2W8KA 1HNIB 3N79A 2HEKA 1RB0A 2XZTB 2PJ8A 1S0NA 2HBRB 1UPPA 2FLLA 3V6DB 3BXMA 5IFMA 3QSIA 3DRPB 1SJQA 5LMNF 1GAOA 2DH9A 4FYVB 4OMEA 4DHVA 4JI0J 3GYAA 2ZPAA 5D3GA 5K14A 3EJMA 2ZELA 2G1HA 5DETA 2DF5A 2Y0MA 1RAJA 2YNCC 1PYOB 2JVOA 1NE9A 4RW4A 3B3CA 3MMAA 4B10A 1Q16B 5KG7A 2W7OA 1MU2A 3NOGA 2WK4A 4IG3B 2BYCA 4DL0C 4FD6A 4ZS6A 4PPZA 4ED2A 1JJCB 3CEDA 2MZQA 4QIWD 3GIJA 3UDEA 4ZOSA 3QT7A 1FT8A 1MWQA 1V5IB 1U1LA 3KK2B 5KOWA 1V3ZA 2GHPA 2IC3A 2QZ8A 3MPUB 2XMTA 3GKRA 1YQHA 3KQXA 3KUEA 4DQIA 1XEBA 3EWGA 1DHMA 4ECUA 2HG4A 4M3SA 3MECA 3FVYA 4GVBA 2WVCA 3AA9A 3ISXA 3EVWA 3PTWA 4KVOE 2B58A 3PO4A 1L5UA 2AGPA 1HIYA 3I9SA 3MUMP 1R7IA 1X8DA 4QWAA 1FWPA 4F4AA 1FDBA 1S1XA 4CM0A 4CTAA 2XNRA 2VBZA 4TQRA 1QE1B 5KFWA 2DXDA 4P4EA 3D2MA 3F5BA 4CH7A 3LGNA 3KJFB 4MJKA 2WAQD 1YLXA 3ENVA 2GCFA 3CDAA 1NZ8A 2HVIA 1PC4A 4AL7A 2ZD1B 4DJBA 3H42A 3MCOA 2IAJA 1IY7A 1G3OA 3ZZPA 2AEFA 3LF0A 4WYWA 3A8IA 2EO8A 2WW8A 4ICLA 2PRQA 1G6BA 1L3SA 1E6VA 3TOBA 3J7AN 4DPYA 4ZVEA 3V8IA 2RMLA 2PI5A 3HKWA 4NWBA 4DN9A 2DRDA 2ROPA 2Y0BB 8CPAA 2UVWA 4C7QA 7FDRA 4LF5J 4GKJF 1WC4A 2U2FA 3TEHB 1S3ZA 4E8UA 4H4OA 3RRGA 1CJVB 3O44A 1FRLA 3M2UA 2UZAA 3OR2A 3PW4A 4EMDA 2FYXA 4X2TA 5DLGA 2OMLA 2V2ZA 4PRFA 2KO1A 2Q51A 2ZH8A 2M88A 2BANA 2Z8QA 4LRBA 4KOSA 1IVZA 3EGWB 1P0HA 1VQ7S 2VIHA 3UN5A 1S72S 2IA0A 3BQ0A 3UR3C 1H3DA 2RKIA 4NYOA 3ZZUA 2X1FA 2ZH6A 4KOWA 3GYXB 5HJXA 1LFPA 1RWMB 4DLEA 1S1WB 4U6PA 2CADA 3HHEA 3EPIA 3CF5Q 1U1PA 2J0XA 2FJDB 4HHHA 2UUCF 4V1Ak 4RR5A 3GJTB 3TUIC 4FN5A 4FYWB 5F9LA 4ZVRB 4U95A 4B9TA 5KFOA 2Y1JA 4OZ0A 1VOMA 3SCLE 3BGOP 5GMEA 3KLFB 4RW9B 2KHDA 2LXFA 2VDHA 1FWLA 2ZHAA 4KO0A 4Y2MA 1CQNA 1HNVA 1D9DA 5C2GA 2DYAA 1IQZA 5DWNA 1H2TZ 4A2ZA 3MGJA 2IMOA 4RBUA 3BYPA 3F41A 4DV4F 3JAMU 1L3UA 1VI7A 3A8KA 1O0PA 3IG1A 1WEXA 2APOA 5KG6A 2CAJA 4ONWA 3OD2A 5EGYA 3FSIA 1R8CA 1OYEA 3A4TA 2DHAA 2IYGA 2MLXA 3WX8A 2YNEA 2E5GA 4XO0A 4MK9A 3D1QA 4KAIA 4QYZJ 3K8VA 1ZA1B 4KHMA 3M9NB 1ELMP 4E98A 3A1YG 3HFVA 3KLGA 2R7OA 1N32F 5AG5A 2EXUA 3NGKA 3NMAA 3EXNA 2AEMA 3BBFA 1LQ9A 2WB1D 1XBWA 1RT3A 5LXRA 4AVAA 5AJ3J 4F4KA 4NGRA 2NXUA 2HLUA 3N6MA 2BXJA 4UQGA 3T9NA 5H9EJ 4LUAA 2C2MB 2VPZB 4P4BA 3PBBA 1Z9UA 3ZZOA 3HUVA 3OFFA 4TXSA 2LU2A 2VU5A 1N4LA 1XNQF 3L9ZA 2WOMA 2G2YA 3C3LA 5AT1B 2BKNA 4MK8A 4ZITA 3H0PA 4PYDA 4OIXA 3FF3A 2NSCA 3FEXB 1FFWB 2QC3A 1UVIA 4OZLA 2XS2A 3UNGC 2AW0A 4X4OA 3AXMA 4U96A 1YZ7A 2HWHA 2B5JB 1BO4A 1OYDA 1R8PA 3R9EA 2JEGA 2AZ3A 2Z3NA 3CXSA 5E3AA 4KOTA 3L3CA 1C0TB 2M5YA 3LANA 3IO1A 4FF2A 1VQNS 2Z3LA 4P74A 5LJ3Y 1FRXA 2QRRA 5A8RB 4ZX8A 1Y10A 3NGSA 3QAUA 1S57A 2V8DA 3CDBA 3QJJA 3PB6X 1KN6A 1RWPB 1RLDA 4LT6A 2R2SA 2HNYA 4WFAQ 4DR6F 3W61A 2GIQA 3FCHA 2OSRA 2LEPA 2XO6A 3SQOP 3DRPA 4MFZA 1KQFB 4F9UA 2LXUA 4NYZA 3OXGA 2C6CA 1GEHA 4JV5F 1WG4A 2HPUA 4HDGA 2PFDA 1AT1B 4ZGYB 4KPCA 4HEA9 1U09A 4X64F 5C88A 1NB7A 1BXNA 3OTBA 1UWAA 4AUKA 1T3NA 3PKYA 2J9EA 4DR4F 2JLMA 1KRPA 3MDFA 1IBMF 3UY5A 5BWAB 2ZZNA 2AYBA 2LQJA 3PCOB 2V68A 2VFVA 3VAKA 3JSMB 5A8KA 2VI7A 3R5GA 3RR7A 4M6HA 3A3PB 3D66A 2IQ6A 1DE4C 4FNHA 4HKQA 3SV3A 4DSEA 3AJDA 4UUWA 4TKTA 4NJQA 1VRUB 4K8RA 3KG0A 4GVLA 3R1HA 4ERDA 2IVYA 1CS4B 3LP1B 1N36J 1E6YB 3EE3A 3RNZA 3BLNA 2COLA 1NH8A 3G86A 4F36A 4Y2KA 2GU2A 1X5TA 5J2NA 4QPTA 3TO6A 2CPIA 3R7SB 2YKNA 5JGFA 4P2MA 3EPGA 5D4PA 2VEZA 4DZDA 4NFRA 4O0IA 5CBMA 1HDQA 1PJ7A 3D0HE 4KGMA 4RNNA 2PR8A 1Y5NB 4DV0F 2WVFA 1XIQA 5KFMA 3CCUS 5HQMA 5A8WA 4IUSA 2GJIA 1QSLA 3SCJE 4WE1A 5CYJA 3D0GE 2WPWA 3U02A 2C27A 2I0XA 5HSPA 1UETA 2ZBRA 5F49A 2E1RA 2Y8YA 4JZ0A 4P6QA 2PQ8A 3MM6A 5D29A 2ABYA 4OZ5A 5L9NA 3DLJA 4UF4A 2XI3A 1JX4A 1IR1A 1T11A 4HI2A 3Q24A 5DG7A 1PSDA 3QWUA 4KT0C 2ZH1A 1IWGA 2HQFA 5JMNA 5CABA 2PDAA 3TA2A 3S9LA 3T8WA 2E1AA 2ZEGA 2Q3PA 5KFBA 3QATA 3F56A 2OPRA 4KGKA 1DQ8A 1Z8LA 3RU0A 1D1UA 4FD5A 3HCXA 2DIVA 4L3NA 4S0MA 1SCJB 4ZLJA 4NSQA 1WHYA 2B6AA 4P4DA 1QSOA 4P10A 4CGPA 5E96A 4OX7A 2YX1A 2CYYA 1M5KC 1FCAA 3R5JB 3H4DA 3HSZA 4I69A 1SUQB 1LRZA 3K2KA 2I00A 1RTJA 3M9MB 3QGIA 3C8YA 3EZUA 1Z8TA 3CIZA 5KFHA 4I2QB 3RRHA 2H51B 3TX0A 1SL0A 2OJ3A 1Y9WA 2HV2A 1EKSA 1XQIA 4R5PA 3RAXA 2IDLA 4IUFA 5H86A 4OX6A 2HRYA 3PW5A 4DR5J 2XG8A 1UW9A 4C2MA 1ZOTA 5LSLA 2ZW6A 1CP6A 4RS2A 4RW9A 4PKDB 1RJJA 1S97A 1HARA 4ZP9A 5KFPA 5HVFA 2CJQA 4DV1J 4AL5A 2PN6A 1F3VA 2JLGA 2L9NA 1WORA 3IBCB 4CPAA 4G1PA 2Z3OA 5D4OA 3BH6B 1JIHA 2IRYA 2Z0GA 1QSSA 3ICLA 3DLEB 1GMVA 2B9XA 3CJQA 2G0CA 4URQU 2N3LA 5KTDA 3MEDA 2JFDA 2ZOGA 2GIFA 1U2FA 2OFHX 3E3XA 3N4WA 1S79A 1RA7A 4OYWA 2GHVC 4PAAA 1G4CA 4DPOA 1TAQA 2YPYA 5F8MA 1HQ2A 2VG6B 4C98A 1VQ5S 5D8HB 5CA5A 3MEGA 2Q79A 4ZVUB 2J5AA 3H4QA 1RABB 3CGIA 1R43A 2LA6A 5HMWA 2OPPB 1GNKA 4WPAA 2V2QA 1C0UA 4K30A 1P9QC 2NYIA 4FYXB 2EK1A 5ETRA 2CWXA 3EO4A 1LKZA 5J1NA 3VAIA 2EK9A 2V94A 4OHXA 3JB9k 1Z2ZA 2E1MC 4YR0A 1YKWA 2DNRA 3IRXA 2V2VA 3ENAA 4GO5X 2BR0A 4NCAA 2HIYA 4YB7A 2XI2A 3PYGA 1HBMA 5CAAA 3FH4A 2DJWA 3MF5A 1KFSA 5LOQA 3BZQA 3K2YA 2YNIA 4A8KA 1U25A 4KSEB 4LRDA 4DR2F 4E0DA 1KFDA 2CG8A 3D68A 4IH6A 1ZAWA 4A8OA 3QZ8A 1EQ0A 4RW6A 1KLMA 2OPSA 4JXQA 2VA2A 2IIHA 2PA8D 2B5JA 1JNRB 2HK3A 5JVHQ 2WVEA 5LYFA 1X5PA 1C0TA 2ADBA 4KORA 2W4PA 3IAS9 2DCLA 3NE8A 1SJFA 2N4CA 1WTBA 4DOZA 5C7PA 2VF3A 4OJ3A 3G8QA 3CCZA 2GAGC 3I32A 1KHVA 2UXCF 5DDQC 4QBJA 3HFZB 5B0BA 1I6JA 1EHWA 4ZVSB 4PEOA 2ZOMA 2Z2ZA 1R31A 2OR4A 4NCBA 2VBXA 2ZM6F 3MPYA 2FDNA 1FJ7A 2H54B 4UCPA 4LF6F 1HD0A 2FZKB 5B0DA 4NEXA 2XGPA 1O8BA 2VXKA 1UJ4A 4JYAJ 1VQOS 4DV7F 3OXFA 1XNRJ 1PYSB 5F3ZA 1LK5A 5D78A 2UXDJ 3D7FA 4XPKA 3JSMA 2Y3YA 3R5DA 3JXOA 1WF2A 3TRGA 2BMBA 1S0OA 4H4KC 1D8YA 3I0SB 1RCOB 1RYRA 1ZAXA 3AJ1A 2JNJA 3V6HA 4QWCA 5KG2A 5KFZA 7CPAA 3A8JA 4CZCA 4JD6A 3HX9A 4ORFA 1QQ9A 4C7IA 2R8IA 4MBUA 1RT4B 3HSDA 3DR6A 3K58A 5KFUA 4F0MA 3KLIB 3PB9X 4YY3J 4W98A 3HHLA 1IR2A 3KWMA 3M8ZA 3MM8B 3S9NA 1MN9A 1R89A 4AQYF 2W9BB 1R8AA 1CX8A 3KHXA 2HC9A 4ZJOA 3TZWA 3N01A 2DGTA 1UZDA 3H5YA 3B4MA 3CMAS 2EBGA 2I5JA 4TY8B 3CTRA 2B4VA 2G2OA 3BB5A 2EFVA 4QB9A 1RGVA 4NLRA 1HNZF 4B3MJ 1RTQA 2LYVA 3IMQJ 1JXVA 4B9SA 3C16B 2LMIA 2ZHBA 1S7LA 1CJTB 4JI6J 1ZLHA 4UEEA 2NLWA 2F8HA 2P8IA 3GQCA 4AG7A 2W4CA 3DNCA 1EX8A 4CLYA 1CEZA 1U1QA 2KM8C 2B4DB 1X12A 4MFBB 3OL9A 4DR1F 1P1LA 3QFWA 1NRKA 5KG4A 2RDJA 1UJ5A 4L74A 4GKKJ 1SJRA 2DGVA 2CQPA 1NM2A 1A0OB 2ZH4A 3GIUA 1RSCA 3RBXA 4DX7A 4OZ2A 1HNWJ 3D67A 3PG9A 4CYQA 1JLFB 1BHNA 3TI0A 2XS7A 3ELHA 2C1CA 3CJ2A 2JC1A 3WHIA 3R9GA 2XNQA 5KG5A 1Q1KA 4EZ6A 1WUUA 4XDDA 5HMZA 1X9MA 4DQQA 2XHCA 3KLEA 3POTA 1SH0A 2ZJPQ 4NXMF 3FZBA 1RZMA 3I5CA 4DR7J 1AMPA 3CJSA 3VH9A 2UUBJ 4G1QA 1TKFA 4FWUA 4CGMA 4IKAA 1U1MA 2YKMB 2GX8A 4LR9A 5E41A 4MKYA 4CLPA 1U8WA 3ZFVA 2CPHA 2H5EA 1AUDA 3KJNB 4JI8F 4UQTA 4M5LA 2XYGB 3B78A 1ARMA 1I12A 2BM1A 2JC0A 1HPZA 2BSWA 3ILOA 2KT2A 4P4IA 3PR4A 3LOUA 3KJVB 2G3AA 3PP9A 2HGMA 1VBZA 4NGTA 2P6SA 5L1JA 4MCSA 1S59A 4N8NA 1OSDA 1JLGA 4QUSA 2VPXB 2C6PA 3JSBA 4ZVQB 1R8BA 1U26A 1HHSA 4JI4F 4RNFA 2PJ6A 1EZZB 2AYMA 4TU9A 4QIVA 2MHEA 3S9MA 1TF9A 2MY7A 2AFOA 3TZZA 2KFNA 4BBHA 5D4NA 5K8NA 4JBCA 3IEHA 5C25B 3DFEA 2BKOA 4ED1A 4J9MA 4CLWA 1TKTA 1GH8A 3WC5A 4FS2A 3AB2B 4JUZA 3NGRA 2NMTA 1S6OA 2HQDA 4XPCA 4NZ6A 4JP8A 3HZEA 1N6QB 5D0EA 2LCWA 1UWYA 1RHMB 2DHGA 2B9YA 1KLNA 5KT3A 2VG6A 1MJAA 3EGZA 5SZTA 3KASA 2G1DA 1RT6A 1AUGA 1XJWB 4NGPA 3MPWA 4DG1A 1FHTA 3DDNA 3TVKA 2QN6B 4QJVA 1JXEA 1FK9B 2EBEA 1UFHA 1RTDB 2CNKB 5FDLA 2JSXA 1NB2A 5A6WA 1VHFA 2QLJB 2YNGB 5DZ7A 2PIIA 2W7PA 1GX5A 2BW2A 4ZJLA 3M05A 1J5EF 1U4BA 3OHBA 4OX8A 2DGWA 1VR6A 1TF8A 3QMQA 1Y3KA 1VQ6S 4OHYA 5E3CA 5LT5A 1VQ9S 4X65J 2AKWB 4DMZA 3T1YF 1VBKA 2NXEA 4WTYA 2ATLA 1UAWA 1HYSA 4C3MA 1X4BA 1FY7A 4USTA 2VJVA 1TKHA 5AE2A 3C46A 4OLOA 1UP1A 1FRMA 1C4CA 4PG8A 2FD2A 2MTLA 3BJ8A 3H5SA 2JBJA 3BR9A 2Y1RI 1LNQA 1N0VC 4IG0B 4DPWA 5H84A 3C19A 2CF4A 3EICA 3ZO7A 4DL5A 3SXOA 2AV5A 2LLZA 1T9WA 3B7IA 5JH9A 4BDPA 1RCXB 2UXBF 3A9LA 1UA0A 5RUBA 4OYIA 2ZC4A 3VGTA 1SKUB 3DLKB 3ET6B 3CCMS 4M5MA 4DU7A 2C2DA 2FVSA 4R7MA 2L3MA 2Z10A 3Q8VA 5KFJA 2H5IB 5HROB 1NBEB 1YDLA 2YQ3A 1ZTWA 4U7UD 1YWXA 4M95A 2V63A 2OH2A 3R3TA 1JB0C 1VS3A 3DDDA 1W2BR 1FVQA 3T5JA 3K7RA 1EAYC 4RW8A 2VFTA 3I3GA 1WD6A 4M6IA 2W2OP 1CBXA 4JI0F 2UU9J 2YVSA 3NEKA 1IBLF 4PK2A 2LQ5A 1IBCB 1RWWB 2FGCA 1IBKF 1SB6A 2XO7A 3IJ3A 4U9YA 2MPUA 3NG8A 5I42B 2W9CB 2JDDA 2IBOA 1CP7A 3B4DA 3DHXA 1JLAB 2PE3A 2QA4S 3I4PA 1RT4A 5C24A 1S77D 4I67A 1FKPB 4KS9A 5G0RA 2OAUA 1ZG8A 1IKVB 5E0OA 2JEVA 4CH0S 3CJ8A 3M2RA 3PFEA 1ZETA 1MWYA 1UVKA 5F48A 5JPHA 5AXLA 2O1PA 1BQNA 1X4HA 5E5NA 1F5BA 2C2RA 4DWIA 2F8EX 2FVQA 3JRUA 4ANDA 2DISA 4XTTA 4OHZA 1AYEA 8AT1B 1RTHA 2FJWA 5DS7A 3O8WA 3L7OA 1LEOA 1B6BA 1VK3A 4RNHA 1N8RT 3TAMA 4U9RA 4WWVA 4MRIA 4JV2A 4OKOA 3FFIB 5L39A 1DQAA 5HANA 1FT7A 3KZWA 3C16A 3PRDA 2XYHB 2Y8WA 4DEZA 4R3KA 4DUZJ 1NNDA 1MROB 3MM7A 2BQ3A 2CJAA 4LBHA 1OIAA 2ZOFA 2PMWA 4KHRA 4MFBA 2Q4ZA 2GV1A 2EK8A 1HWLA 1F0XA 3T5KA 5I3UA 3CDXA 4ETZA 1GXTA 2CPYA 2PMZD 4GC7A 1XIXA 2IVFB 3D6MB 3OL6A 3TW0A 3F0AA 3KGQA 4C48A 2RQMA 3HI9A 2KG0A 4FAIA 3HHKA 4RJVA 1Y0YA 2IL4A 3R5CA 2KG1A 3D2WA 4NRTA 4K4TA 7AT1B 1V3SA 4F4YA 3W7BA 1TQLA 4J9KA 4ZLPA 5CZVA 2ZEEA 5E3RA 3V81B 3RO0A 2HZCA 3MTKA 1QVGR 4NGMA 1LK7A 3ISNC 4LF5F 2ZH3A 1Q95G 3MUTP 4A31A 3IS9B 5AG4A 4RUCA 1HI0P 3CCES 2B56A 3DYAA 5CYMB 2AX0A 3KKFA 4M1KA 1BMQB 3IWEA 2CQIA 1RBAA 3PXGa 3J7Z5 1CPZA 3M8WA 2VPWB 1A9NB 5CZXA 3H5ZA 2CNOB 3W63A 1QAIA 4CAFA 3O1LA 2XSJA 1XR6A 1IJEB 1Q7LA 4DFPA 3MAAB 3KJVA 4DL2A 3G6ES 2DVIA 3FEEA 3RTVA 5HBMB 1NK6A 1TK8A 1AB8A 3JAMY 1S9GB 1RT5B 2VKZG 4K59A 3MMBA 3P5BP 4JYWA 3DKDA 4X4PA 3OVAA 1QUPA 2BE7D 1JK9B 1H74A 4O3NA 3G6VA 3MEKA 1VCTA 3HF5A 4NOHA 4JI1F 3PJWA 2M9KA 1WK4A 2C28A 2CJXB 2AJ1A 3ZTOA 2DT9A 3GONA 2DR6A 1XMTA 1Z5RA 2Q04A 2V8PA 4A95A 5HATA 5LRJA 2WSFC 5B0CA 1WOOA 1RT2A 2W2PP 4ZCMA 5DJBA 2ZE2A 2KJVA 4PG6A 2VQEJ 4LF9J 2MQ8A 2UUTA 2RRNA 1B0PA 5IZHA 5K20B 1M1DA 1YLEA 1JWWA 3H8YA 3PW2A 3BS9A 1DY3A 5E3PA 3TE4A 2JL9A 1CQMA 2E5HA 3JYTB 3HHDA 3IN5A 1NKCA 2J9DE 2C2ZB 3AODA 2ZZTA 1VIXA 3I82A 5JXSA 1YMEA 2BOAA 3M32A 3NP5A 4LRAA 1S1UB 2REFA 4BWJA 2XY7A 3ZZIA 4NI2B 2HQGA 2CQDA 3IM9A 3FMCA 3OT9A 4ZA1A 3HM9A 2RF2A 2YXLA 1D3WA 2L08A 2RU9A 2R8VA 3QO9A 1XRYA 2RS2A 1MJBA 1FJGJ 2IJFA 1ZH5A 3OVBA 2UVRA 1HQEA 2FB0A 2L48A 4KY3A 4UFVA 1KEKA 4HTJA 1FXDA 1I94F 3UCGA 1JLQA 3TO9A 4H2KA 3VARA 1IKYA 1TKZA 4ID8A 2FJXA 1MWZA 2H5JB 1F2OA 4NLUA 3C6TB 3B8HA 1YX0A 1TUWA 3FX6A 2E66A 2CQ3A 3SXNA 1L3TA 3S6HA 2H48B 3AY0A 2NPFA 3EDRB 2XMAA 3MEEA 4B3RJ 1NKEA 4CP5A 1U45A 1S48A 2X1GA 1RKJA 1KNZA 3SSSA 4B17A 2VOOA 3W2VA 2M52A 4KIAA 4NASA 1U2CA 4NX9A 3PW0A 1XMOF 1S60A 2A18A 3JTOA 2WVDA 4Q43A 3JUWA 1U8SA 2C3UA 4OC0A 2Q0YA 2D3OR 2GMLA 5A2QY 3CIMA 1JWQA 4A94A 4NJRA 3SFGA 4ATNA 4DPUA 3E01A 2K8GA 1N5TA 4K7QA 4BD9A 4O44B 4JV1A 4K50A 3TT2A 3PGPA 2R7XA 3C15A 2ZBCA 2K2PA 2FY8A 2QGFB 1Q81T 4ZP7A 1J27A 3KDNA 3DHWC 2PO4A 1S6QA 2DHSA 1Z8XA 2CXEA 3FB3A 1TK0A 2CG4A 4PPDA 5B7WA 1F1BB 4DQPA 2OPQA 2BJ9A 3MCSA 2OHDA 5T14A 2B3UA 4ES1A 3SEOA 5HLFB 1N52B 4I6AA 4QCLA 5IT4A 1T9YA 5IQQA 4OZ3A 2R2RA 4DUYJ 3PYEA 1SL1A 4JI2F 3W8GA 4LSNA 3ZZ0A 3HLUA 1BPNA 2FL4A 2XS5A 3IBWA 2HIQA 2IVMA 1IIDA 3CD5A 2YGWA 4OIDA 2NUHA 2AWZA 3D28A 1V6HA 2YPZA 2CJYB 3HFKA 3ONQA 3LGMA 1LWEB 3LGHA 2C3MA 1YRUA 4GXHA 3OUYB 2VG7B 1MROA 2HMIB 3MMJA 4Q8EA 3D6HB 4WFYA 4ZPTR 1H72C 3T1AA 2MQNA 4UOCA 1JJHA 2BOPA 1SVDA 5IWAJ 1TKXB 2KT3A 5CYQB 4OMFG 2HBQB 1ARLA 3G82A 4DU8A 4UFWA 4B9VA 4LRFA 2DXEA 1K8AT 3RUBL 2NYHA 1RKIA 2XC9A 3H59A 4FDFA 1EETA 3R6LB 1J2VA 1WI8A 1KHWA 2F4VF 1TK5A 1TFYA 3GIIA 4F3OA 1R0AB 3SBMA 4M5IA 4LF2A 3V81A 2IPOB 2BRKA 2LQBA 5D4LA 3HD1A 3IS9A 3QGHA 5CD4A 3M30A 1N54B 4NLXA 1DQ9A 3QRPA 2QYCA 1RAEB 3VWSA 1FX4A 2XEGA 1H2UX 3R5AA 4F0KA 3RGIA 1TVRB 3P45B 2NZ4A 2V67A 2KVIA 4EWTA 2VQFJ 1JQGA 4I6YA 1MK4A 3PX4A 3B2YA 1SIZA 2ZH7A 2ZVIA 2FZCB 3Q89A 2H3EB 2O5DA 3I5BA 3SQGB 4DX5A 2DNGA 3LP2B 4FYDA 2VBYA 2YH1A 4B3TJ 3B3VA 4DS5A 3ETMA 1M1GA 1FRIA 1YX2A 2HRUA 4HACB 2KRBA 2QO3A 4ZK7M 2R2UA 1SV5B 2AJ2A 1Q2CA 4USHA 1S49A 4MYTA 4QWBA 3W64A 4R8FA 4H89A 2PSWA 1HBNA 4DV1F 2PJAA 3OXLA 3E8OA 2RQKA 3DM2A 3IR5B 1UWBA 4CYNA 1NDCA 2DPJA 1S7HA 5HP1B 2WVBA 4PWDB 1HL6A 4ILLA 1SKRA 1V3RA 2W2QP 2XM3A 4ZP6A 2ASYA 5I3PA 4PSXA 4PV6A 4I56A 1KP6A