4CGPA

Leishmania major n-myristoyltransferase in complex with cofactor
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Diverse Modes of Binding in Structures of Leishmania Major N-Myristoyltransferase with Selective Inhibitors
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 126
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cgpA00
4UFVA 4A2ZA 4CGNA 4C2ZA 4B12A 4A33A 2WUUA 5G21A 4CGOA 5AG7A 4CYPA 5AG4A 4CGMA 5AGEA 4CGPA 2YNEA 5G20A 4C2XA 2WSAA 4CAEA 4UFXA 4A30A 2YNDA 2YNCC 3H5ZA 3IU2A 4B13A 4C7HA 5A27A 3IU1A 4UCMA 4UCPA 4BBHA 4UCNA 4B10A 5AG6A 4CGLA 2YNCA 4CYQA 4CYOA 5G1ZA 4CAFA 4A95A 4C68A 3IWEA 4A32A 4A31A 4B11A 5G22A 4C7IA 4CYNA 4C2YA 5A28A 4B14A 3JTKA 4UFWA 5AG5A
chains in the Genus database with same CATH superfamily
2QJ8A 3KZWA 2EWBA 4MHNA 3H8GA 3IFEA 1BLLE 4NGQA 2XEFA 4JLYA 3SJXA 4P4BA 4CGMA 4HNYB 4IK2A 3PFEA 1VIXA 2OZUA 3H5ZA 3SJEA 1AMPA 4MCQA 4CAWA 2O28A 3W6SA 1MJAA 4QUSA 4UBRA 1MJ9A 4UF4A 4EVYA 1TIQA 4NSQA 2Z10A 2HC9A 3QAHA 3MRUA 4OAEA 2AJ6A 2ZXVA 2QYVA 3CPXA 2CNMA 3BI1A 4KVME 3F5BA 4MCSA 1XEBA 2EBJA 4BD9A 1VHOA 1X10A 2IJZA 5G22A 3KR4A 2EVNA 5JGFA 1M4LA 2DPTA 3I1UA 4KUAA 1OZPA 3EO4A 6CPAA 4OC0A 3NH5A 5HXDA 2CNSA 5E96A 3IJ3A 2PRQA 3FB3A 1VHSA 4JZ0A 3WC6A 5JPHA 1F57A 5K8PA 2WUUA 4RS2A 3VWDA 4MY3A 2OH1A 4PXDA 3PBBA 3GLJA 1CM0A 1FT7A 4GS4A 1KUXA 2JDDA 1Z8TA 4YU9A 4A37A 3CZXA 3FYNA 2PVWA 2OOTA 1QMUA 4AVAA 1YW6A 4KOUA 4J3GA 2POKA 2JBKA 2Q51A 2AFUA 4WWVA 2B5GB 2Q0YA 1XRYA 1V0CA 4ZX9A 4OC2A 2Z11A 2BEIA 3WC5A 4MBUA 1CG2A 1LAPA 2HUZA 1IGBA 1TXRA 1IB1E 2JLMA 2DPSA 3D7HA 3R9FA 2FCKA 3PZJA 4OADA 2PIYA 2ZEPA 2P6GA 4R3LA 4OC3A 3S9MA 4R7MA 2B4DA 4A33A 1IY7A 1HEEA 1XF8A 5AGEA 2YNEA 4MHYA 2YNDA 3D66A 1Z9UA 2P6FA 3LWUA 1Q2CA 4KOTA 3IWGA 1LOKA 3K9TA 1Z8LA 4PPZA 5LRGA 4OMEA 2IL4A 4MFJA 5DWMA 5CBMA 3TOBA 1ZLHA 5LYDA 5C88A 5K8OA 1BO4A 1GYTA 3DNSA 3V8IA 2NSMA 4CAFA 2KCWA 3GY9A 5LYFA 3S9NA 4U5YA 5IB9A 2ZELA 1YQEA 2AFSA 4PXBA 2Z3OA 4AVCA 1NE9A 1UFHA 2F5IA 4X5KA 5AG5A 4OLLA 2F8HA 3KKWA 4KORA 3S6FA 5C82A 1DE4C 1IU8A 4B6ZA 4F8ZA 4EFDA 2PJ8A 5JM6A 2RC4A 5HVFA 2VQYA 2PJBA 4UFXA 4B13A 4XPDC 3B7IA 3DSBA 3T9YA 3NE7A 4NGPA 1LAMA 2VI7A 1OBRA 3IO1A 4B10A 4NF1A 1Y0RA 2PJ9A 2PJ5A 3FEDA 4P4DA 4X3RA 4LUAA 4NGTA 3UY5A 2AFZA 3H4QA 3G3SA 4A38A 1PCAA 1L0CA 4UWJA 2D4PA 1YR0A 2ANPA 3KR5A 2GLFA 1M4GA 3RNZA 4ZY1A 4DUKA 3JUWA 2WZNA 4ZGYB 3S6KA 3IEHA 2A4NA 2JBJA 2FT0A 3W91A 1YGHA 4X8IA 3IWWA 2GU2A 3TTHA 4B5OA 3GUXA 2ZW7A 3HUVA 3I9SA 4R9MA 1VGYA 2Q7SA 3FEEA 2V8VA 3EC4A 4ZX8A 4IUSA 3GYAA 3QAYA 2B3VA 4PK2A 2I79A 2ODFA 3TCVA 2PJ6A 4M6GA 3WC7A 1TKFA 3PB6X 1QSOA 4NXYA 2G0BA 2GE3A 1CPSA 1M4DA 1ELMP 1JWQA 2B4BA 4FD7A 5JH9A 2GANA 2HB6A 1F2OA 3NH8A 1H8LA 4L89A 3B3WA 1XFOA 3WABA 4AVBA 4KLVA 4B11A 2B4DB 2WPWA 2JEWA 2ZPAA 2H5MA 5THWA 4GM5A 5DWNA 1TF9A 3G8WA 4NFRA 5IV0A 3P2FA 4CGPA 3H8FA 4CRYB 3FECA 3D68A 1YLEA 4KOSA 3D8PA 3NFZA 1PYTB 3EY5A 3PGPA 4FD4A 4UEFA 3LD2A 4UEEA 3VWEA 4Z65A 3BLNA 5HVHA 4NJRA 4AG7A 2OB0A 4PSWA 4NCZA 4P6YA 4PK3A 4F0XA 1Q2DA 4MHZA 4CAXA 4CRZB 2V8GA 5LRKA 1ZG7A 4P4IA 3PB4X 2AFXA 2REFA 1Z5RA 1Y7EA 2C27A 4E8OA 3KQXA 1M4IA 1S7NA 2ABZA 2PRBA 4FD6A 1I12A 2Q7BA 1QSMA 1Y9KA 2DF5A 4B14A 4CAVA 3GIUA 1CBXA 3R9GA 3KHXA 3D7FA 4CYPA 3S9LA 2B58A 1RTQA 3B3TA 5HH1A 4JXRA 1IYLA 3B35A 3FVLA 2Q4YA 1UWYA 2WPXA 5HVGA 1Y9WA 4YRHA 5J8CA 3DGVA 4IHMA 2HQYA 3PB9X 4E2AA 3TOAA 3DR6A 1KZFA 3RO0A 3D67A 1CP6A 4MFLA 2Z3PA 1ZG8A 1S5KA 3TO6A 3CXPA 4CS0B 2AFWA 3E0KA 4GXHA 4X2TA 1QSNA 3L2NA 3B2YA 1M1DA 4MHDA 3T8WA 5I0CA 4A94A 4YFJA 2CY2A 1MK4A 2ZOGA 5HMNA 2CIJA 2XEGA 1S7FA 4JYWA 1Z4RA 4H6UA 3MN8A 1J4JA 4R3KA 4M85A 1I21A 2EO8A 1YVKA 4ONWA 2RFHA 4XNHC 4CAEA 1XJOA 3DR8A 2PIZA 3PB8X 4HPSA 4MFQA 4CPAA 4EMEA 3CDXA 1QSTA 2J8MA 4LQGA 4II9A 3MGDA 3V7ZA 5J8FA 2RB7A 1AYEA 2XEIA 2REEA 3H8EA 3HLPA 5J1QA 4BMHA 2J9AA 4CGLA 2AFOA 5F09A 2Q43A 2Y0MA 2ATRA 4BINA 4LQ6A 5BWAB 4MMOA 5D8NA 2PSWA 5LRJA 1WWZA 1WK4A 4CYNA 4R6TA 2C6PA 1TKJA 2P6EA 1DTDA 2ZW4A 3GB0A 4U9ZA 1XBUA 5FVJA 4H2KA 1CP7A 2J8RA 4A2ZA 2BO9A 4R76A 5G21A 4C68A 1VKCA 5AG4A 2PJ0A 4KOWA 3SJGA 2IMOA 1S3ZA 3B3VA 4MI4A 4DNCA 4M6IA 4XNHB 5CPAA 5I4MA 4UEZA 4UCPA 2BL1A 3KQZA 5JQ4A 4O23A 1PU9A 2DXQA 4BBHA 3R96A 2QMLA 3KI9A 3TC8A 4MFKA 1MJBA 3CXSA 2X7BA 4KS9A 3C26A 1I1DA 2QVPA 1RO5A 4R87A 2Z0ZA 2FIWA 4I49A 4K30A 1YSJA 4KZTA 4AXVA 4U9YA 3SXNA 3PBEA 2F7VA 2ZEHA 5ISVA 4UFVA 2ZEMA 2C6CA 4Q7AA 2G3TA 2FVGA 4MRIA 4F9VA 1P0HA 1YREA 1AUGA 4KOVA 5GCNA 2WSAA 3ISXA 4Q36A 2GFQA 3BJ8A 1TKHA 4PV6A 5A27A 1B87A 1Q2YA 2HV2A 4ZI6A 4ZYQA 4H6ZA 4OIDA 3PEIA 3FMCA 5F46A 2GLJA 1CX8A 2ZW6A 3B8GA 2WYRA 1ON0A 4RUHA 5LYLA 3OWCA 2FSRA 3P2HA 3FRMA 3FF3A 2PCUA 3VATA 2XEJA 1LANA 3FH4A 3DLJA 4H89A 2Z3MA 4P4JA 4TNUA 5CNPA 1XE4A 3SXOA 1IICA 1YVOA 2PC1A 3CT9A 4UA3A 1CPXA 1BOBA 2C1CA 4R8FA 4OC1A 3K2KA 1M44A 1Y7RA 3TO7A 3WT4A 1EE3P 3R1KA 4LX9A 4WJBA 4B12A 4CGNA 1FY7A 2CTBA 4E0AA 4MXUA 1Z8WA 4NGSA 2PJ1A 5H86A 1K4JA 1X12A 3RYOA 2ARHA 1QQ9A 4MHPA 5EC4A 4M6HA 4FUUA 4RI1A 4UCMA 3V38A 4JWPA 2BOAA 4UCNA 4HKFA 2AE6A 5IB0A 3LODA 1IIDA 3LMSA 3BI0A 4PXCA 4DYOA 2FS5A 4L8AA 3IIBA 4RN7A 4Q38A 5KTCA 2V8HA 2Q04A 2V77A 1R43A 2Z3NA 2ZENA 3A9LA 4Y49C 3RZAA 3VARA 4DJLA 4HNXB 4A31A 5A28A 7CPAA 3FIXA 1XMTA 1YW4A 2PE3A 3JTKA 2B3UA 4F0YA 5KTAA 1S7KA 2VZYA 1BAVA 3NA6A 2EUIA 3IC1A 2PR8A 3DDDA 4FD5A 2YGWA 1R3NA 2O53A 3JVNA 3FNCA 3D2MA 3R9EA 2EK9A 3S6HA 1ZLIA 1Q7LA 3B3SA 5F48A 2J8NA 2Z3LA 1ARMA 1ZG9A 2PQ8A 4QC6A 3KGQA 2BSWA 3TT2A 4QVTA 3SJFA 2OR4A 1KWMA 5AG6A 4G1PA 2Q4VA 2P0WA 3PRTA 3TO9A 3IGRA 3F0AA 3IWEA 4Y49B 3D7GA 3R95A 1A2ZA 8CPAA 2R7HA 3T90A 1ELLP 4KOYA 2CNTA 4KVXA 2FIAA 2VBQA 3FX6A 2PJ3A 4EWTA 4UIBA 4ZY0A 2O4HA 3ZZIA 3W6XA 3PB7X 1KUVA 5AG7A 3GKRA 1FNOA 1Z8XA 1NSLA 5K8NA 4OIWA 1YX0A 2G9DA 4C7HA 5K8MA 1IOFA 4OKOA 2Q44A 4P44A 2VEZA 1CJWA 2PR1A 2JDCA 5ELYA 3EXNA 4OP4A 5D29A 2ZEOA 1BPMA 1U6MA 2VZZA 2YNCA 4CYOA 4PSXA 4XPKA 5LYIA 3PP9A 3ZJ0A 2QECA 4ORFA 1IOIA 2ZEFA 4PQAA 3D7DA 4MFPA 1LRZA 4JJXA 4C7IA 2PJ4A 3NE8A 4QB9A 2PJ2A 4AG9A 3QNVA 4F9UA 2IQ6A 2D4OA 4K3NA 1HDQA 2OZGA 3N5FA 5F49A 3KHZA 1JQGA 1XIXA 4UFWA 2I3CA 4ONUA 4ZBGA 4A30A 2I00A 4MY0A 2R98A 2DEAA 4TWEA 4IF5A 4KSAA 1PUAA 3TE4A 4B5PB 1YLOA 3KL9A 1HDUA 3BHXA 3CXQA 1SQHA 1S60A 2AFMA 4YWYA 4NGMA 1KUYA 4ZY2A 1NSAA 2Q4ZA 4MFZA 4CYQA 1P4NA 1S7LA 2CF4A 5G1ZA 3WR7A 4AB7A 4W9YA 3QB8A 2C6GA 2K5TA 3RAMA 5EBVA 4OC4A 1LCPA 4HNWB 2CTCA 1YK3A 1ARLA 4P4EA 4UWIA 3JRUA 1IYKA 4JXQA 2JEVA 1LFWA 4MJ8A 5G20A 3PFOA 2PJCA 2ZOFA 2G3AA 2YNCC 3KASA 4NEXA 3B3CA 1TF8A 2GREA 4R57A 4IAVA 4XPLA 3FXTA 4KUBA 3IU1A 4UIAA 3VH9A 2ZEEA 3EFAA 3SI2A 4MCRA 2FXFA 2OU2A 3ISZA 3TFYA 1B6BA 4FBEA 2PJ7A 2QIRA 4P10A 2PVVA 4NGRA 4KSFA 4F6AA 2VL1A 4QBJA 3CPAA 3D2PA 1N71A 2BCOA 1RXTA 3D3SA 2R8VA 4KOXA 4P4FA 3S6GA 2B5GA 1Z2LA 1BPNA 1VHEA 3FJUA 4FAIA 2R1IA 4M3SA 2FL4A 1GHEA 4C2ZA 1NMTA 1Z4EA 4JD6A 4YGOA 5H84A 4CGOA 2VXKA 5KTDA 2GIVA 5DS0A 1F2PA 2NYQA 3SI1A 3BXMA 3SI0A 4C2XA 2ZEGA 3IU2A 4XPDB 3FBUA 4KVOE 3NH4A 2NMTA 4FWUA 4KLWA 1QSRA 2EK8A 5IX3A 4MCPA 3D4UA 1XOVA 3N7ZA 4NJQA 2OZHA 3TX8A 4B5PA 2BUEA 1Y0YA 2V8DA 4OC5A 5EMIA 3RBUA 1YMEA 1XMBA 2FE7A 5F47A 3K9UA 2PJAA 4A39A 1ZO0A 1R57A 4P45A 4A95A 3F8KA 3I3GA 4A32A 3SHPA 4C2YA 2ZEDA 3LACA 2CXAA 2ZW5A 2PDOA 2Z3KA 4NGNA 4PXEA 4KSIA 3BJ7A
chains in the Genus database with same CATH topology
4JLYA 4CGMA 4HNYB 2OZUA 3H5ZA 4CAWA 2O28A 3W6SA 1MJAA 4QUSA 4UBRA 1MJ9A 4EVYA 1TIQA 4NSQA 2Z10A 3QAHA 4OAEA 2AJ6A 2ZXVA 4KVME 2CNMA 3F5BA 1XEBA 5G22A 2EVNA 2DPTA 4KUAA 1OZPA 3EO4A 2CNSA 5E96A 3FB3A 1VHSA 5JPHA 2WUUA 4RS2A 3VWDA 4MY3A 2OH1A 4GS4A 1CM0A 1KUXA 2JDDA 3FYNA 4AVAA 4KOUA 4J3GA 2B5GB 2Q0YA 1V0CA 2Z11A 2BEIA 4MBUA 2DPSA 2HUZA 2JLMA 1IB1E 3R9FA 2FCKA 3PZJA 4OADA 4R3LA 2P6GA 2B4DA 4A33A 1XF8A 5AGEA 2YNEA 2YNDA 1Z9UA 2P6FA 4KOTA 1Q2CA 3IWGA 2IL4A 4MFJA 5DWMA 3TOBA 5C88A 1BO4A 3DNSA 3V8IA 4CAFA 2KCWA 3GY9A 4U5YA 2Z3OA 4AVCA 1NE9A 1UFHA 2F5IA 4X5KA 5AG5A 4OLLA 3S6FA 3KKWA 4KORA 5C82A 2RC4A 2VQYA 4UFXA 4B13A 4XPDC 3DSBA 3T9YA 3NE7A 2VI7A 4B10A 4NF1A 3UY5A 4LUAA 3H4QA 3G3SA 1L0CA 4UWJA 2D4PA 1YR0A 1M4GA 3JUWA 4ZGYB 3S6KA 2A4NA 2FT0A 3W91A 1YGHA 3TTHA 4B5OA 2ZW7A 3I9SA 4R9MA 3EC4A 4IUSA 3GYAA 4PK2A 2B3VA 2I79A 3TCVA 1QSOA 4NXYA 2G0BA 2GE3A 1M4DA 2B4BA 4FD7A 2GANA 4L89A 4B11A 4AVBA 4KLVA 2B4DB 2WPWA 2ZPAA 2H5MA 5DWNA 3G8WA 5IV0A 3P2FA 4CGPA 4CRYB 1YLEA 4KOSA 3D8PA 3EY5A 3PGPA 4FD4A 3LD2A 3VWEA 3BLNA 4AG7A 2OB0A 4PSWA 4NCZA 4PK3A 4F0XA 1Q2DA 4CAXA 4CRZB 2REFA 2C27A 4E8OA 1M4IA 1S7NA 2PRBA 4FD6A 2Q7BA 1I12A 4B14A 1Y9KA 1QSMA 4CAVA 3R9GA 4CYPA 2B58A 5HH1A 4JXRA 1IYLA 2Q4YA 2WPXA 1Y9WA 4YRHA 5J8CA 2HQYA 4E2AA 3TOAA 3DR6A 1KZFA 4MFLA 2Z3PA 1S5KA 3TO6A 3CXPA 4CS0B 3E0KA 1QSNA 1M1DA 4MHDA 5I0CA 4YFJA 2CY2A 1MK4A 5HMNA 1S7FA 1Z4RA 4H6UA 1J4JA 4R3KA 4M85A 1I21A 1YVKA 4XNHC 4CAEA 3DR8A 4MFQA 1QSTA 2J8MA 4II9A 3MGDA 5J8FA 2REEA 4BMHA 4CGLA 2Y0MA 2ATRA 5BWAB 2PSWA 1WWZA 1WK4A 4CYNA 2P6EA 2ZW4A 4U9ZA 5FVJA 2J8RA 4A2ZA 5G21A 1VKCA 5AG4A 4KOWA 1S3ZA 4MI4A 4DNCA 4XNHB 4UCPA 2BL1A 5JQ4A 1PU9A 2DXQA 4BBHA 3R96A 2QMLA 4MFKA 1MJBA 3CXSA 2X7BA 4KS9A 3C26A 1I1DA 1RO5A 4R87A 2Z0ZA 2FIWA 4I49A 4K30A 4KZTA 4U9YA 3SXNA 5ISVA 4UFVA 2G3TA 1P0HA 1YREA 4KOVA 5GCNA 2WSAA 4Q36A 3BJ8A 4PV6A 5A27A 1B87A 1Q2YA 2HV2A 4H6ZA 5F46A 2ZW6A 3B8GA 1ON0A 3OWCA 2FSRA 3P2HA 3FRMA 4H89A 2Z3MA 5CNPA 1XE4A 3SXOA 1IICA 2PC1A 1YVOA 4UA3A 1BOBA 1M44A 1Y7RA 3TO7A 4CGNA 4LX9A 3R1KA 4B12A 1FY7A 4E0AA 5H86A 1K4JA 3RYOA 2ARHA 5EC4A 4RI1A 4UCMA 4JWPA 4UCNA 4HKFA 2AE6A 5IB0A 3LODA 1IIDA 2FS5A 4L8AA 4Q38A 5KTCA 2Q04A 4Y49C 2Z3NA 3A9LA 4HNXB 4A31A 5A28A 3FIXA 1XMTA 3JTKA 2B3UA 4F0YA 5KTAA 1S7KA 2VZYA 2EUIA 2PR8A 3DDDA 4FD5A 2YGWA 3R9EA 3JVNA 3FNCA 3D2MA 3S6HA 5F48A 2J8NA 2Z3LA 2PQ8A 4QC6A 3TT2A 2BSWA 4QVTA 5AG6A 2Q4VA 2P0WA 3TO9A 3IGRA 3F0AA 3IWEA 4Y49B 3R95A 2R7HA 3T90A 4KOYA 2CNTA 4KVXA 2FIAA 2VBQA 3ZZIA 3W6XA 1KUVA 5AG7A 3GKRA 1NSLA 1YX0A 4C7HA 2Q44A 2VEZA 1CJWA 2PR1A 2JDCA 3EXNA 1U6MA 2VZZA 2YNCA 4CYOA 4PSXA 4XPKA 3ZJ0A 3PP9A 2QECA 4ORFA 4MFPA 1LRZA 4JJXA 4C7IA 4AG9A 4QB9A 2D4OA 5F49A 2OZGA 1XIXA 4UFWA 4ZBGA 4A30A 4ONUA 2I00A 4MY0A 2R98A 4IF5A 4KSAA 1PUAA 3TE4A 4B5PB 3CXQA 1SQHA 1S60A 1KUYA 4MFZA 4CYQA 1P4NA 1S7LA 5G1ZA 3WR7A 4AB7A 3QB8A 2K5TA 5EBVA 4HNWB 1YK3A 4UWIA 1IYKA 4JXQA 2JEVA 4MJ8A 5G20A 4NEXA 2G3AA 2YNCC 4R57A 4XPLA 3FXTA 4KUBA 3IU1A 3EFAA 2FXFA 2OU2A 3TFYA 1B6BA 2QIRA 4KSFA 4F6AA 4QBJA 3D2PA 1N71A 1RXTA 3D3SA 2R8VA 4KOXA 3S6GA 2B5GA 2R1IA 4M3SA 2FL4A 1GHEA 4C2ZA 1NMTA 1Z4EA 4JD6A 4YGOA 5H84A 4CGOA 2VXKA 5KTDA 2GIVA 4C2XA 3IU2A 4XPDB 3FBUA 4KVOE 2NMTA 4KLWA 1QSRA 5IX3A 3N7ZA 4B5PA 2OZHA 2BUEA 2FE7A 4A95A 5F47A 3K9UA 4C68A 1ZO0A 1R57A 3F8KA 3I3GA 4A32A 3SHPA 4C2YA 2CXAA 2ZW5A 2PDOA 2Z3KA 3BJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UFV A;  4A2Z A;  4CGN A;  4C2Z A;  4B12 A;  4A33 A;  2WUU A;  5G21 A;  4CGO A;  5AG7 A;  4CYP A;  5AG4 A;  4CGM A;  5AGE A;  4CGP A;  2YNE A;  5G20 A;  4C2X A;  2WSA A;  4CAE A;  4UFX A;  4A30 A;  2YND A;  2YNC C;  3H5Z A;  3IU2 A;  4B13 A;  4C7H A;  5A27 A;  3IU1 A;  4UCM A;  4UCP A;  4BBH A;  4UCN A;  4B10 A;  5AG6 A;  4CGL A;  2YNC A;  4CYQ A;  4CYO A;  5G1Z A;  4CAF A;  4A95 A;  4C68 A;  3IWE A;  4A32 A;  4A31 A;  4B11 A;  5G22 A;  4C7I A;  4CYN A;  4C2Y A;  5A28 A;  4B14 A;  3JTK A;  4UFW A;  5AG5 A; 
#chains in the Genus database with same CATH topology
 2QJ8 A;  3KZW A;  2EWB A;  4MHN A;  3H8G A;  3IFE A;  1BLL E;  4NGQ A;  2XEF A;  4JLY A;  3SJX A;  4P4B A;  4CGM A;  4HNY B;  4IK2 A;  3PFE A;  1VIX A;  2OZU A;  3H5Z A;  3SJE A;  1AMP A;  4MCQ A;  4CAW A;  2O28 A;  3W6S A;  1MJA A;  4QUS A;  4UBR A;  1MJ9 A;  4UF4 A;  4EVY A;  1TIQ A;  4NSQ A;  2Z10 A;  2HC9 A;  3QAH A;  3MRU A;  4OAE A;  2AJ6 A;  2ZXV A;  2QYV A;  3CPX A;  2CNM A;  3BI1 A;  4KVM E;  3F5B A;  4MCS A;  1XEB A;  2EBJ A;  4BD9 A;  1VHO A;  1X10 A;  2IJZ A;  5G22 A;  3KR4 A;  2EVN A;  5JGF A;  1M4L A;  2DPT A;  3I1U A;  4KUA A;  1OZP A;  3EO4 A;  6CPA A;  4OC0 A;  3NH5 A;  5HXD A;  2CNS A;  5E96 A;  3IJ3 A;  2PRQ A;  3FB3 A;  1VHS A;  4JZ0 A;  3WC6 A;  5JPH A;  1F57 A;  5K8P A;  2WUU A;  4RS2 A;  3VWD A;  4MY3 A;  2OH1 A;  4PXD A;  3PBB A;  3GLJ A;  1CM0 A;  1FT7 A;  4GS4 A;  1KUX A;  2JDD A;  1Z8T A;  4YU9 A;  4A37 A;  3CZX A;  3FYN A;  2PVW A;  2OOT A;  1QMU A;  4AVA A;  1YW6 A;  4KOU A;  4J3G A;  2POK A;  2JBK A;  2Q51 A;  2AFU A;  4WWV A;  2B5G B;  2Q0Y A;  1XRY A;  1V0C A;  4ZX9 A;  4OC2 A;  2Z11 A;  2BEI A;  3WC5 A;  4MBU A;  1CG2 A;  1LAP A;  2HUZ A;  1IGB A;  1TXR A;  1IB1 E;  2JLM A;  2DPS A;  3D7H A;  3R9F A;  2FCK A;  3PZJ A;  4OAD A;  2PIY A;  2ZEP A;  2P6G A;  4R3L A;  4OC3 A;  3S9M A;  4R7M A;  2B4D A;  4A33 A;  1IY7 A;  1HEE A;  1XF8 A;  5AGE A;  2YNE A;  4MHY A;  2YND A;  3D66 A;  1Z9U A;  2P6F A;  3LWU A;  1Q2C A;  4KOT A;  3IWG A;  1LOK A;  3K9T A;  1Z8L A;  4PPZ A;  5LRG A;  4OME A;  2IL4 A;  4MFJ A;  5DWM A;  5CBM A;  3TOB A;  1ZLH A;  5LYD A;  5C88 A;  5K8O A;  1BO4 A;  1GYT A;  3DNS A;  3V8I A;  2NSM A;  4CAF A;  2KCW A;  3GY9 A;  5LYF A;  3S9N A;  4U5Y A;  5IB9 A;  2ZEL A;  1YQE A;  2AFS A;  4PXB A;  2Z3O A;  4AVC A;  1NE9 A;  1UFH A;  2F5I A;  4X5K A;  5AG5 A;  4OLL A;  2F8H A;  3KKW A;  4KOR A;  3S6F A;  5C82 A;  1DE4 C;  1IU8 A;  4B6Z A;  4F8Z A;  4EFD A;  2PJ8 A;  5JM6 A;  2RC4 A;  5HVF A;  2VQY A;  2PJB A;  4UFX A;  4B13 A;  4XPD C;  3B7I A;  3DSB A;  3T9Y A;  3NE7 A;  4NGP A;  1LAM A;  2VI7 A;  1OBR A;  3IO1 A;  4B10 A;  4NF1 A;  1Y0R A;  2PJ9 A;  2PJ5 A;  3FED A;  4P4D A;  4X3R A;  4LUA A;  4NGT A;  3UY5 A;  2AFZ A;  3H4Q A;  3G3S A;  4A38 A;  1PCA A;  1L0C A;  4UWJ A;  2D4P A;  1YR0 A;  2ANP A;  3KR5 A;  2GLF A;  1M4G A;  3RNZ A;  4ZY1 A;  4DUK A;  3JUW A;  2WZN A;  4ZGY B;  3S6K A;  3IEH A;  2A4N A;  2JBJ A;  2FT0 A;  3W91 A;  1YGH A;  4X8I A;  3IWW A;  2GU2 A;  3TTH A;  4B5O A;  3GUX A;  2ZW7 A;  3HUV A;  3I9S A;  4R9M A;  1VGY A;  2Q7S A;  3FEE A;  2V8V A;  3EC4 A;  4ZX8 A;  4IUS A;  3GYA A;  3QAY A;  2B3V A;  4PK2 A;  2I79 A;  2ODF A;  3TCV A;  2PJ6 A;  4M6G A;  3WC7 A;  1TKF A;  3PB6 X;  1QSO A;  4NXY A;  2G0B A;  2GE3 A;  1CPS A;  1M4D A;  1ELM P;  1JWQ A;  2B4B A;  4FD7 A;  5JH9 A;  2GAN A;  2HB6 A;  1F2O A;  3NH8 A;  1H8L A;  4L89 A;  3B3W A;  1XFO A;  3WAB A;  4AVB A;  4KLV A;  4B11 A;  2B4D B;  2WPW A;  2JEW A;  2ZPA A;  2H5M A;  5THW A;  4GM5 A;  5DWN A;  1TF9 A;  3G8W A;  4NFR A;  5IV0 A;  3P2F A;  4CGP A;  3H8F A;  4CRY B;  3FEC A;  3D68 A;  1YLE A;  4KOS A;  3D8P A;  3NFZ A;  1PYT B;  3EY5 A;  3PGP A;  4FD4 A;  4UEF A;  3LD2 A;  4UEE A;  3VWE A;  4Z65 A;  3BLN A;  5HVH A;  4NJR A;  4AG7 A;  2OB0 A;  4PSW A;  4NCZ A;  4P6Y A;  4PK3 A;  4F0X A;  1Q2D A;  4MHZ A;  4CAX A;  4CRZ B;  2V8G A;  5LRK A;  1ZG7 A;  4P4I A;  3PB4 X;  2AFX A;  2REF A;  1Z5R A;  1Y7E A;  2C27 A;  4E8O A;  3KQX A;  1M4I A;  1S7N A;  2ABZ A;  2PRB A;  4FD6 A;  1I12 A;  2Q7B A;  1QSM A;  1Y9K A;  2DF5 A;  4B14 A;  4CAV A;  3GIU A;  1CBX A;  3R9G A;  3KHX A;  3D7F A;  4CYP A;  3S9L A;  2B58 A;  1RTQ A;  3B3T A;  5HH1 A;  4JXR A;  1IYL A;  3B35 A;  3FVL A;  2Q4Y A;  1UWY A;  2WPX A;  5HVG A;  1Y9W A;  4YRH A;  5J8C A;  3DGV A;  4IHM A;  2HQY A;  3PB9 X;  4E2A A;  3TOA A;  3DR6 A;  1KZF A;  3RO0 A;  3D67 A;  1CP6 A;  4MFL A;  2Z3P A;  1ZG8 A;  1S5K A;  3TO6 A;  3CXP A;  4CS0 B;  2AFW A;  3E0K A;  4GXH A;  4X2T A;  1QSN A;  3L2N A;  3B2Y A;  1M1D A;  4MHD A;  3T8W A;  5I0C A;  4A94 A;  4YFJ A;  2CY2 A;  1MK4 A;  2ZOG A;  5HMN A;  2CIJ A;  2XEG A;  1S7F A;  4JYW A;  1Z4R A;  4H6U A;  3MN8 A;  1J4J A;  4R3K A;  4M85 A;  1I21 A;  2EO8 A;  1YVK A;  4ONW A;  2RFH A;  4XNH C;  4CAE A;  1XJO A;  3DR8 A;  2PIZ A;  3PB8 X;  4HPS A;  4MFQ A;  4CPA A;  4EME A;  3CDX A;  1QST A;  2J8M A;  4LQG A;  4II9 A;  3MGD A;  3V7Z A;  5J8F A;  2RB7 A;  1AYE A;  2XEI A;  2REE A;  3H8E A;  3HLP A;  5J1Q A;  4BMH A;  2J9A A;  4CGL A;  2AFO A;  5F09 A;  2Q43 A;  2Y0M A;  2ATR A;  4BIN A;  4LQ6 A;  5BWA B;  4MMO A;  5D8N A;  2PSW A;  5LRJ A;  1WWZ A;  1WK4 A;  4CYN A;  4R6T A;  2C6P A;  1TKJ A;  2P6E A;  1DTD A;  2ZW4 A;  3GB0 A;  4U9Z A;  1XBU A;  5FVJ A;  4H2K A;  1CP7 A;  2J8R A;  4A2Z A;  2BO9 A;  4R76 A;  5G21 A;  4C68 A;  1VKC A;  5AG4 A;  2PJ0 A;  4KOW A;  3SJG A;  2IMO A;  1S3Z A;  3B3V A;  4MI4 A;  4DNC A;  4M6I A;  4XNH B;  5CPA A;  5I4M A;  4UEZ A;  4UCP A;  2BL1 A;  3KQZ A;  5JQ4 A;  4O23 A;  1PU9 A;  2DXQ A;  4BBH A;  3R96 A;  2QML A;  3KI9 A;  3TC8 A;  4MFK A;  1MJB A;  3CXS A;  2X7B A;  4KS9 A;  3C26 A;  1I1D A;  2QVP A;  1RO5 A;  4R87 A;  2Z0Z A;  2FIW A;  4I49 A;  4K30 A;  1YSJ A;  4KZT A;  4AXV A;  4U9Y A;  3SXN A;  3PBE A;  2F7V A;  2ZEH A;  5ISV A;  4UFV A;  2ZEM A;  2C6C A;  4Q7A A;  2G3T A;  2FVG A;  4MRI A;  4F9V A;  1P0H A;  1YRE A;  1AUG A;  4KOV A;  5GCN A;  2WSA A;  3ISX A;  4Q36 A;  2GFQ A;  3BJ8 A;  1TKH A;  4PV6 A;  5A27 A;  1B87 A;  1Q2Y A;  2HV2 A;  4ZI6 A;  4ZYQ A;  4H6Z A;  4OID A;  3PEI A;  3FMC A;  5F46 A;  2GLJ A;  1CX8 A;  2ZW6 A;  3B8G A;  2WYR A;  1ON0 A;  4RUH A;  5LYL A;  3OWC A;  2FSR A;  3P2H A;  3FRM A;  3FF3 A;  2PCU A;  3VAT A;  2XEJ A;  1LAN A;  3FH4 A;  3DLJ A;  4H89 A;  2Z3M A;  4P4J A;  4TNU A;  5CNP A;  1XE4 A;  3SXO A;  1IIC A;  1YVO A;  2PC1 A;  3CT9 A;  4UA3 A;  1CPX A;  1BOB A;  2C1C A;  4R8F A;  4OC1 A;  3K2K A;  1M44 A;  1Y7R A;  3TO7 A;  3WT4 A;  1EE3 P;  3R1K A;  4LX9 A;  4WJB A;  4B12 A;  4CGN A;  1FY7 A;  2CTB A;  4E0A A;  4MXU A;  1Z8W A;  4NGS A;  2PJ1 A;  5H86 A;  1K4J A;  1X12 A;  3RYO A;  2ARH A;  1QQ9 A;  4MHP A;  5EC4 A;  4M6H A;  4FUU A;  4RI1 A;  4UCM A;  3V38 A;  4JWP A;  2BOA A;  4UCN A;  4HKF A;  2AE6 A;  5IB0 A;  3LOD A;  1IID A;  3LMS A;  3BI0 A;  4PXC A;  4DYO A;  2FS5 A;  4L8A A;  3IIB A;  4RN7 A;  4Q38 A;  5KTC A;  2V8H A;  2Q04 A;  2V77 A;  1R43 A;  2Z3N A;  2ZEN A;  3A9L A;  4Y49 C;  3RZA A;  3VAR A;  4DJL A;  4HNX B;  4A31 A;  5A28 A;  7CPA A;  3FIX A;  1XMT A;  1YW4 A;  2PE3 A;  3JTK A;  2B3U A;  4F0Y A;  5KTA A;  1S7K A;  2VZY A;  1BAV A;  3NA6 A;  2EUI A;  3IC1 A;  2PR8 A;  3DDD A;  4FD5 A;  2YGW A;  1R3N A;  2O53 A;  3JVN A;  3FNC A;  3D2M A;  3R9E A;  2EK9 A;  3S6H A;  1ZLI A;  1Q7L A;  3B3S A;  5F48 A;  2J8N A;  2Z3L A;  1ARM A;  1ZG9 A;  2PQ8 A;  4QC6 A;  3KGQ A;  2BSW A;  3TT2 A;  4QVT A;  3SJF A;  2OR4 A;  1KWM A;  5AG6 A;  4G1P A;  2Q4V A;  2P0W A;  3PRT A;  3TO9 A;  3IGR A;  3F0A A;  3IWE A;  4Y49 B;  3D7G A;  3R95 A;  1A2Z A;  8CPA A;  2R7H A;  3T90 A;  1ELL P;  4KOY A;  2CNT A;  4KVX A;  2FIA A;  2VBQ A;  3FX6 A;  2PJ3 A;  4EWT A;  4UIB A;  4ZY0 A;  2O4H A;  3ZZI A;  3W6X A;  3PB7 X;  1KUV A;  5AG7 A;  3GKR A;  1FNO A;  1Z8X A;  1NSL A;  5K8N A;  4OIW A;  1YX0 A;  2G9D A;  4C7H A;  5K8M A;  1IOF A;  4OKO A;  2Q44 A;  4P44 A;  2VEZ A;  1CJW A;  2PR1 A;  2JDC A;  5ELY A;  3EXN A;  4OP4 A;  5D29 A;  2ZEO A;  1BPM A;  1U6M A;  2VZZ A;  2YNC A;  4CYO A;  4PSX A;  4XPK A;  5LYI A;  3PP9 A;  3ZJ0 A;  2QEC A;  4ORF A;  1IOI A;  2ZEF A;  4PQA A;  3D7D A;  4MFP A;  1LRZ A;  4JJX A;  4C7I A;  2PJ4 A;  3NE8 A;  4QB9 A;  2PJ2 A;  4AG9 A;  3QNV A;  4F9U A;  2IQ6 A;  2D4O A;  4K3N A;  1HDQ A;  2OZG A;  3N5F A;  5F49 A;  3KHZ A;  1JQG A;  1XIX A;  4UFW A;  2I3C A;  4ONU A;  4ZBG A;  4A30 A;  2I00 A;  4MY0 A;  2R98 A;  2DEA A;  4TWE A;  4IF5 A;  4KSA A;  1PUA A;  3TE4 A;  4B5P B;  1YLO A;  3KL9 A;  1HDU A;  3BHX A;  3CXQ A;  1SQH A;  1S60 A;  2AFM A;  4YWY A;  4NGM A;  1KUY A;  4ZY2 A;  1NSA A;  2Q4Z A;  4MFZ A;  4CYQ A;  1P4N A;  1S7L A;  2CF4 A;  5G1Z A;  3WR7 A;  4AB7 A;  4W9Y A;  3QB8 A;  2C6G A;  2K5T A;  3RAM A;  5EBV A;  4OC4 A;  1LCP A;  4HNW B;  2CTC A;  1YK3 A;  1ARL A;  4P4E A;  4UWI A;  3JRU A;  1IYK A;  4JXQ A;  2JEV A;  1LFW A;  4MJ8 A;  5G20 A;  3PFO A;  2PJC A;  2ZOF A;  2G3A A;  2YNC C;  3KAS A;  4NEX A;  3B3C A;  1TF8 A;  2GRE A;  4R57 A;  4IAV A;  4XPL A;  3FXT A;  4KUB A;  3IU1 A;  4UIA A;  3VH9 A;  2ZEE A;  3EFA A;  3SI2 A;  4MCR A;  2FXF A;  2OU2 A;  3ISZ A;  3TFY A;  1B6B A;  4FBE A;  2PJ7 A;  2QIR A;  4P10 A;  2PVV A;  4NGR A;  4KSF A;  4F6A A;  2VL1 A;  4QBJ A;  3CPA A;  3D2P A;  1N71 A;  2BCO A;  1RXT A;  3D3S A;  2R8V A;  4KOX A;  4P4F A;  3S6G A;  2B5G A;  1Z2L A;  1BPN A;  1VHE A;  3FJU A;  4FAI A;  2R1I A;  4M3S A;  2FL4 A;  1GHE A;  4C2Z A;  1NMT A;  1Z4E A;  4JD6 A;  4YGO A;  5H84 A;  4CGO A;  2VXK A;  5KTD A;  2GIV A;  5DS0 A;  1F2P A;  2NYQ A;  3SI1 A;  3BXM A;  3SI0 A;  4C2X A;  2ZEG A;  3IU2 A;  4XPD B;  3FBU A;  4KVO E;  3NH4 A;  2NMT A;  4FWU A;  4KLW A;  1QSR A;  2EK8 A;  5IX3 A;  4MCP A;  3D4U A;  1XOV A;  3N7Z A;  4NJQ A;  2OZH A;  3TX8 A;  4B5P A;  2BUE A;  1Y0Y A;  2V8D A;  4OC5 A;  5EMI A;  3RBU A;  1YME A;  1XMB A;  2FE7 A;  5F47 A;  3K9U A;  2PJA A;  4A39 A;  1ZO0 A;  1R57 A;  4P45 A;  4A95 A;  3F8K A;  3I3G A;  4A32 A;  3SHP A;  4C2Y A;  2ZED A;  3LAC A;  2CXA A;  2ZW5 A;  2PDO A;  2Z3K A;  4NGN A;  4PXE A;  4KSI A;  3BJ7 A; 
#chains in the Genus database with same CATH homology
 4JLY A;  4CGM A;  4HNY B;  2OZU A;  3H5Z A;  4CAW A;  2O28 A;  3W6S A;  1MJA A;  4QUS A;  4UBR A;  1MJ9 A;  4EVY A;  1TIQ A;  4NSQ A;  2Z10 A;  3QAH A;  4OAE A;  2AJ6 A;  2ZXV A;  4KVM E;  2CNM A;  3F5B A;  1XEB A;  5G22 A;  2EVN A;  2DPT A;  4KUA A;  1OZP A;  3EO4 A;  2CNS A;  5E96 A;  3FB3 A;  1VHS A;  5JPH A;  2WUU A;  4RS2 A;  3VWD A;  4MY3 A;  2OH1 A;  4GS4 A;  1CM0 A;  1KUX A;  2JDD A;  3FYN A;  4AVA A;  4KOU A;  4J3G A;  2B5G B;  2Q0Y A;  1V0C A;  2Z11 A;  2BEI A;  4MBU A;  2DPS A;  2HUZ A;  2JLM A;  1IB1 E;  3R9F A;  2FCK A;  3PZJ A;  4OAD A;  4R3L A;  2P6G A;  2B4D A;  4A33 A;  1XF8 A;  5AGE A;  2YNE A;  2YND A;  1Z9U A;  2P6F A;  4KOT A;  1Q2C A;  3IWG A;  2IL4 A;  4MFJ A;  5DWM A;  3TOB A;  5C88 A;  1BO4 A;  3DNS A;  3V8I A;  4CAF A;  2KCW A;  3GY9 A;  4U5Y A;  2Z3O A;  4AVC A;  1NE9 A;  1UFH A;  2F5I A;  4X5K A;  5AG5 A;  4OLL A;  3S6F A;  3KKW A;  4KOR A;  5C82 A;  2RC4 A;  2VQY A;  4UFX A;  4B13 A;  4XPD C;  3DSB A;  3T9Y A;  3NE7 A;  2VI7 A;  4B10 A;  4NF1 A;  3UY5 A;  4LUA A;  3H4Q A;  3G3S A;  1L0C A;  4UWJ A;  2D4P A;  1YR0 A;  1M4G A;  3JUW A;  4ZGY B;  3S6K A;  2A4N A;  2FT0 A;  3W91 A;  1YGH A;  3TTH A;  4B5O A;  2ZW7 A;  3I9S A;  4R9M A;  3EC4 A;  4IUS A;  3GYA A;  4PK2 A;  2B3V A;  2I79 A;  3TCV A;  1QSO A;  4NXY A;  2G0B A;  2GE3 A;  1M4D A;  2B4B A;  4FD7 A;  2GAN A;  4L89 A;  4B11 A;  4AVB A;  4KLV A;  2B4D B;  2WPW A;  2ZPA A;  2H5M A;  5DWN A;  3G8W A;  5IV0 A;  3P2F A;  4CGP A;  4CRY B;  1YLE A;  4KOS A;  3D8P A;  3EY5 A;  3PGP A;  4FD4 A;  3LD2 A;  3VWE A;  3BLN A;  4AG7 A;  2OB0 A;  4PSW A;  4NCZ A;  4PK3 A;  4F0X A;  1Q2D A;  4CAX A;  4CRZ B;  2REF A;  2C27 A;  4E8O A;  1M4I A;  1S7N A;  2PRB A;  4FD6 A;  2Q7B A;  1I12 A;  4B14 A;  1Y9K A;  1QSM A;  4CAV A;  3R9G A;  4CYP A;  2B58 A;  5HH1 A;  4JXR A;  1IYL A;  2Q4Y A;  2WPX A;  1Y9W A;  4YRH A;  5J8C A;  2HQY A;  4E2A A;  3TOA A;  3DR6 A;  1KZF A;  4MFL A;  2Z3P A;  1S5K A;  3TO6 A;  3CXP A;  4CS0 B;  3E0K A;  1QSN A;  1M1D A;  4MHD A;  5I0C A;  4YFJ A;  2CY2 A;  1MK4 A;  5HMN A;  1S7F A;  1Z4R A;  4H6U A;  1J4J A;  4R3K A;  4M85 A;  1I21 A;  1YVK A;  4XNH C;  4CAE A;  3DR8 A;  4MFQ A;  1QST A;  2J8M A;  4II9 A;  3MGD A;  5J8F A;  2REE A;  4BMH A;  4CGL A;  2Y0M A;  2ATR A;  5BWA B;  2PSW A;  1WWZ A;  1WK4 A;  4CYN A;  2P6E A;  2ZW4 A;  4U9Z A;  5FVJ A;  2J8R A;  4A2Z A;  5G21 A;  1VKC A;  5AG4 A;  4KOW A;  1S3Z A;  4MI4 A;  4DNC A;  4XNH B;  4UCP A;  2BL1 A;  5JQ4 A;  1PU9 A;  2DXQ A;  4BBH A;  3R96 A;  2QML A;  4MFK A;  1MJB A;  3CXS A;  2X7B A;  4KS9 A;  3C26 A;  1I1D A;  1RO5 A;  4R87 A;  2Z0Z A;  2FIW A;  4I49 A;  4K30 A;  4KZT A;  4U9Y A;  3SXN A;  5ISV A;  4UFV A;  2G3T A;  1P0H A;  1YRE A;  4KOV A;  5GCN A;  2WSA A;  4Q36 A;  3BJ8 A;  4PV6 A;  5A27 A;  1B87 A;  1Q2Y A;  2HV2 A;  4H6Z A;  5F46 A;  2ZW6 A;  3B8G A;  1ON0 A;  3OWC A;  2FSR A;  3P2H A;  3FRM A;  4H89 A;  2Z3M A;  5CNP A;  1XE4 A;  3SXO A;  1IIC A;  2PC1 A;  1YVO A;  4UA3 A;  1BOB A;  1M44 A;  1Y7R A;  3TO7 A;  4CGN A;  4LX9 A;  3R1K A;  4B12 A;  1FY7 A;  4E0A A;  5H86 A;  1K4J A;  3RYO A;  2ARH A;  5EC4 A;  4RI1 A;  4UCM A;  4JWP A;  4UCN A;  4HKF A;  2AE6 A;  5IB0 A;  3LOD A;  1IID A;  2FS5 A;  4L8A A;  4Q38 A;  5KTC A;  2Q04 A;  4Y49 C;  2Z3N A;  3A9L A;  4HNX B;  4A31 A;  5A28 A;  3FIX A;  1XMT A;  3JTK A;  2B3U A;  4F0Y A;  5KTA A;  1S7K A;  2VZY A;  2EUI A;  2PR8 A;  3DDD A;  4FD5 A;  2YGW A;  3R9E A;  3JVN A;  3FNC A;  3D2M A;  3S6H A;  5F48 A;  2J8N A;  2Z3L A;  2PQ8 A;  4QC6 A;  3TT2 A;  2BSW A;  4QVT A;  5AG6 A;  2Q4V A;  2P0W A;  3TO9 A;  3IGR A;  3F0A A;  3IWE A;  4Y49 B;  3R95 A;  2R7H A;  3T90 A;  4KOY A;  2CNT A;  4KVX A;  2FIA A;  2VBQ A;  3ZZI A;  3W6X A;  1KUV A;  5AG7 A;  3GKR A;  1NSL A;  1YX0 A;  4C7H A;  2Q44 A;  2VEZ A;  1CJW A;  2PR1 A;  2JDC A;  3EXN A;  1U6M A;  2VZZ A;  2YNC A;  4CYO A;  4PSX A;  4XPK A;  3ZJ0 A;  3PP9 A;  2QEC A;  4ORF A;  4MFP A;  1LRZ A;  4JJX A;  4C7I A;  4AG9 A;  4QB9 A;  2D4O A;  5F49 A;  2OZG A;  1XIX A;  4UFW A;  4ZBG A;  4A30 A;  4ONU A;  2I00 A;  4MY0 A;  2R98 A;  4IF5 A;  4KSA A;  1PUA A;  3TE4 A;  4B5P B;  3CXQ A;  1SQH A;  1S60 A;  1KUY A;  4MFZ A;  4CYQ A;  1P4N A;  1S7L A;  5G1Z A;  3WR7 A;  4AB7 A;  3QB8 A;  2K5T A;  5EBV A;  4HNW B;  1YK3 A;  4UWI A;  1IYK A;  4JXQ A;  2JEV A;  4MJ8 A;  5G20 A;  4NEX A;  2G3A A;  2YNC C;  4R57 A;  4XPL A;  3FXT A;  4KUB A;  3IU1 A;  3EFA A;  2FXF A;  2OU2 A;  3TFY A;  1B6B A;  2QIR A;  4KSF A;  4F6A A;  4QBJ A;  3D2P A;  1N71 A;  1RXT A;  3D3S A;  2R8V A;  4KOX A;  3S6G A;  2B5G A;  2R1I A;  4M3S A;  2FL4 A;  1GHE A;  4C2Z A;  1NMT A;  1Z4E A;  4JD6 A;  4YGO A;  5H84 A;  4CGO A;  2VXK A;  5KTD A;  2GIV A;  4C2X A;  3IU2 A;  4XPD B;  3FBU A;  4KVO E;  2NMT A;  4KLW A;  1QSR A;  5IX3 A;  3N7Z A;  4B5P A;  2OZH A;  2BUE A;  2FE7 A;  4A95 A;  5F47 A;  3K9U A;  4C68 A;  1ZO0 A;  1R57 A;  3F8K A;  3I3G A;  4A32 A;  3SHP A;  4C2Y A;  2CXA A;  2ZW5 A;  2PDO A;  2Z3K A;  3BJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...