4CGPA

Leishmania major n-myristoyltransferase in complex with cofactor
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Diverse Modes of Binding in Structures of Leishmania Major N-Myristoyltransferase with Selective Inhibitors
pubmed doi rcsb
source organism Leishmania major
total genus 126
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cgpA00
4CYPA 4C68A 4UFWA 5G20A 5AG4A 4C2ZA 2WUUA 4C2XA 5AG7A 2YNEA 3IU1A 4BBHA 4A31A 4C7HA 4C2YA 4UCPA 5AG5A 4C7IA 5AG6A 4UFXA 4A30A 4B10A 4CGLA 4CGNA 4B13A 3IWEA 2YNCA 3H5ZA 4UCNA 5G1ZA 4B12A 4A95A 4CYQA 4UCMA 4B14A 4CAFA 4CAEA 2YNCC 3JTKA 4A32A 5G21A 4A2ZA 4A33A 4B11A 2WSAA 4UFVA 4CGOA 2YNDA 4CGMA 3IU2A 4CYOA 5AGEA 4CYNA 5G22A 4CGPA 5A28A 5A27A
chains in the Genus database with same CATH superfamily
4GXHA 5G20A 3PBEA 3CPAA 2XEFA 2K5TA 1ON0A 4OLLA 4ZYQA 3MRUA 1YQEA 4CS0B 4JXQA 3VARA 2J8NA 1XOVA 4KOWA 1NMTA 4NCZA 1BLLE 4DYOA 5E96A 2PJAA 3BXMA 2JDCA 2J9AA 5F48A 3ZZIA 3DR8A 5F47A 5KTCA 2R8VA 4B14A 2VBQA 3SJGA 3PFEA 4KOTA 1XE4A 2PJ6A 2POKA 2ZEHA 3K9TA 3B3VA 5C82A 4R3KA 1U6MA 2ANPA 4U5YA 4YU9A 2F8HA 3IU2A 3D7DA 3P2HA 3D67A 4HKFA 2DEAA 1ZO0A 4K3NA 2ZXVA 2PJ5A 5H86A 1XBUA 2PJ3A 2ZW7A 4P10A 2GFQA 3T90A 1TXRA 2DF5A 5F09A 4MCSA 4UIAA 2CNTA 2PCUA 3TX8A 3W6SA 4DUKA 4OADA 1Q2YA 2IMOA 4C2YA 3RYOA 3EO4A 5HMNA 2F7VA 1GYTA 1HDUA 5K8NA 3LD2A 1Y0YA 1Z4EA 1S3ZA 2BOAA 2FS5A 3CDXA 4WWVA 4AXVA 4ZY0A 3IFEA 1YVOA 4LQ6A 1FT7A 4CAFA 2ZW6A 4RI1A 2AFSA 2ZW5A 3SXOA 1FY7A 4HPSA 4R76A 4UEEA 1CP6A 5JGFA 4AG7A 3L2NA 1BOBA 2FL4A 1M44A 2HB6A 2OOTA 2AJ6A 3EFAA 2C6PA 4JYWA 4OP4A 4EWTA 1XF8A 2EO8A 2RFHA 2REFA 4E8OA 4P4DA 2PRBA 2ZEMA 3OWCA 4XPDC 1IOIA 2B58A 4Q7AA 2G0BA 2QECA 3D2MA 1S7KA 4UEZA 2JBJA 1LFWA 1QSOA 2WPXA 4W9YA 3B3SA 2Q44A 1NE9A 4C7IA 2XEIA 5AG6A 4PXEA 3F8KA 4B13A 2PVVA 5DS0A 4OC0A 4NF1A 3KHXA 1Q2CA 3FEDA 5ELYA 1J4JA 2Z10A 4Y49B 2ZEEA 3I1UA 3F5BA 1L0CA 3DR6A 3KGQA 2ZOGA 1UWYA 1M1DA 2PJ4A 1IICA 2CNMA 3R96A 4M85A 2VQYA 4R9MA 4P45A 3PBBA 5DWMA 4EMEA 1R43A 2Q04A 5J8FA 1CJWA 4CYPA 4AB7A 2ZOFA 1HEEA 3PB6X 5AG7A 3BJ7A 3NE8A 3N5FA 2VZYA 2Z3PA 4B5PB 3R1KA 2OZUA 4PK3A 3GUXA 5JH9A 4GS4A 4A37A 4FD5A 4PV6A 5FVJA 2I3CA 3FRMA 1YW4A 3KASA 4MHPA 4A95A 5HVGA 4MCQA 4MXUA 1R57A 2GE3A 2Q51A 2KCWA 2YNCC 3S6GA 3JTKA 4QC6A 3NH4A 5HH1A 3LACA 4A32A 2AFOA 4O23A 2PR1A 3KQZA 4YGOA 3V8IA 4NGNA 3CPXA 5KTDA 1TF8A 3NFZA 1PUAA 2H5MA 1TKJA 4MJ8A 5HVHA 1YGHA 4CGPA 1TF9A 3D2PA 2VL1A 3R9EA 3TOAA 5LYFA 4JJXA 2B3VA 3KKWA 2G3AA 3PZJA 2PQ8A 2OB0A 4JWPA 2G9DA 2IJZA 2BSWA 3SI1A 4M6IA 3RO0A 4DNCA 5CBMA 4A30A 4OC4A 4CGNA 1YLOA 1YX0A 2QMLA 2PRQA 3B2YA 4QUSA 2AE6A 3IEHA 3EC4A 2GLFA 3IGRA 2PIYA 4NGPA 4KSIA 1S5KA 4FD4A 1UFHA 4LX9A 4U9YA 4UWJA 3FNCA 1NSLA 3GLJA 3K2KA 3DGVA 2C1CA 4KSFA 3D66A 4UIBA 5IV0A 2REEA 1S7NA 1Z8LA 1QSMA 3CXPA 5LYIA 4PSXA 1NSAA 1K4JA 1OBRA 3FIXA 4B5PA 4CYNA 4F0XA 1I21A 2NMTA 2Z11A 4X5KA 2EVNA 4QB9A 3TO9A 4AVCA 4E2AA 1XMBA 5J1QA 3EXNA 4IAVA 3SJEA 3I9SA 2Q7SA 4A31A 1IYLA 4XPLA 3D68A 1F2PA 1M4IA 5K8MA 4L8AA 4M3SA 1YMEA 1DE4C 2ZELA 2ABZA 4KUAA 4P4FA 5LYLA 2OZGA 3ISZA 3CT9A 4XNHC 4HNXB 2PJ0A 2PR8A 1YSJA 3UY5A 4U9ZA 4A33A 2IL4A 3D8PA 4A2ZA 4FAIA 2I00A 3HLPA 2I79A 2GU2A 1Z8XA 2ZEGA 3FJUA 5EBVA 2C6CA 2AFMA 4MHNA 3TO6A 4II9A 1KZFA 3IIBA 3QAYA 2WPWA 2VZZA 3QNVA 5JPHA 4FBEA 1HDQA 2ARHA 1QSTA 1Y9KA 2P6FA 3KZWA 4MI4A 4ZY2A 4ORFA 4OAEA 4R3LA 3H8FA 4YRHA 4UFXA 5EC4A 2HV2A 4KZTA 2FXFA 4MFKA 5CPAA 4PXDA 2AFUA 1TIQA 2R1IA 3IWEA 4A39A 3S6KA 4JLYA 1XEBA 3B3WA 4KOVA 4E0AA 2JDDA 4PXBA 5IB0A 1S7LA 2EWBA 2P0WA 2V8GA 3P2FA 4M6GA 3WC6A 1V0CA 1TKHA 1Z9UA 2QIRA 4UF4A 2P6EA 2P6GA 3IWWA 2XEJA 4FUUA 4BD9A 4BMHA 4MMOA 4YWYA 2GIVA 1BPNA 4KOYA 1VGYA 1ZG8A 2O28A 2VXKA 3S9MA 2PJ7A 5AG4A 3D4UA 3RAMA 2D4OA 1XJOA 4R6TA 2FE7A 1Z8TA 2PJ2A 3DSBA 4UEFA 2Y0MA 2BUEA 2C27A 1B87A 3PEIA 1JWQA 5IX3A 2FVGA 2QJ8A 4MCRA 2OR4A 5DWNA 2EK9A 1PCAA 4F0YA 2FT0A 3PB7X 1XIXA 1Y7RA 4NGSA 3GIUA 2G3TA 2JEWA 5G1ZA 1R3NA 4LUAA 1F57A 4ZX9A 3A9LA 3FMCA 1MJ9A 1XFOA 3VH9A 2GANA 4NSQA 2V77A 1CX8A 3PP9A 4RS2A 1S60A 3KI9A 4H6ZA 3WR7A 4MY0A 4P6YA 3NH8A 3TCVA 2RB7A 1PU9A 2F5IA 2Z3NA 2EK8A 3MN8A 4CYOA 2B3UA 1CM0A 4F9VA 4UA3A 2B4BA 4NFRA 1QQ9A 3FXTA 4CAWA 2QYVA 4KOXA 2HC9A 4XPKA 3IU1A 4GM5A 5LRJA 3QAHA 3RBUA 1M4LA 1IGBA 2DPSA 4OIWA 5LYDA 2Z3KA 3G8WA 1QMUA 3PGPA 2VI7A 4CGLA 1X12A 2JBKA 3H4QA 1QSRA 2EUIA 1CBXA 3PB4X 4B5OA 1XMTA 3IO1A 4UCNA 2B5GB 3S9LA 1KUYA 5F46A 1YW6A 1KWMA 3BI0A 4P4IA 4CPAA 1N71A 1OZPA 3R95A 4PK2A 4CRYB 1LCPA 2XEGA 2A4NA 3KR5A 4MFQA 4ZX8A 4AVBA 2Z0ZA 3GB0A 3GY9A 2J8MA 3WABA 1RO5A 5K8PA 4QBJA 1FNOA 2ZW4A 5A28A 1YR0A 2OU2A 4MFLA 3LWUA 3S6FA 5J8CA 1IY7A 5I4MA 4PXCA 5D29A 4H89A 1ARMA 5I0CA 3T8WA 5CNPA 3BI1A 4Z65A 3MGDA 3DDDA 4ZY1A 2Z3OA 2NYQA 3JVNA 3N7ZA 4H6UA 2Q7BA 7CPAA 3CZXA 1ZG9A 5JM6A 3ZJ0A 1IIDA 2Z3MA 3WT4A 1B6BA 2V8HA 5H84A 4MY3A 2R7HA 4X8IA 4MFPA 3KQXA 3VATA 2DXQA 1GHEA 2O4HA 3SI2A 4R57A 4KORA 2CF4A 3TTHA 4F8ZA 5F49A 1YLEA 2IQ6A 4PSWA 4DJLA 2FCKA 4NGRA 5D8NA 2ZEDA 3FBUA 4C68A 4UFWA 1VHOA 3BJ8A 4Q36A 2PJBA 1AMPA 3V7ZA 4KVXA 2B5GA 2BEIA 3PB8X 1CPSA 4C7HA 2CTCA 1M4DA 3GYAA 2Q0YA 4IHMA 4UCPA 4XPDB 4Y49C 2Q4ZA 4K30A 8CPAA 5GCNA 1IOFA 4CAVA 2CIJA 3FX6A 5C88A 3JRUA 2PJ8A 4UCMA 5K8OA 4P44A 1QSNA 1EE3P 4OC5A 1MJBA 3EY5A 4OC2A 4P4BA 3B35A 3R9FA 1WWZA 2BCOA 2PJ9A 4J3GA 4B11A 4CGOA 1BO4A 3C26A 4MHYA 2PJ1A 4RN7A 2PE3A 4KUBA 5ISVA 2OH1A 3LODA 4LQGA 1Y0RA 2HQYA 3E0KA 4Q38A 3WC7A 2AFXA 3D3SA 3D7GA 4ZGYB 2YNEA 1KUVA 2PDOA 4FWUA 4NJRA 4JXRA 3B3TA 1KUXA 3RZAA 3W6XA 2GLJA 4MFZA 1ZG7A 3D7FA 1F2OA 4G1PA 4EVYA 2JEVA 1AUGA 4EFDA 2AFZA 4MRIA 4OIDA 1LAMA 1JQGA 4UWIA 4OKOA 2ZEFA 4TWEA 3W91A 1AYEA 3DLJA 1A2ZA 4HNWB 2FSRA 3K9UA 2HUZA 1Y7EA 3TC8A 5LRGA 4WJBA 1Z8WA 3CXQA 4M6HA 4PQAA 1CPXA 4C2ZA 1CP7A 1LRZA 3SI0A 3TFYA 1LANA 4KS9A 4IF5A 1YREA 2Q4YA 4A38A 2OZHA 2C6GA 3LMSA 3B7IA 4NGQA 1Z4RA 4ONUA 1VKCA 3TO7A 4CRZB 5BWAB 4KLVA 4QVTA 4B12A 2PSWA 3FYNA 4IUSA 4KOUA 4R8FA 4B6ZA 1Y9WA 3BLNA 1TKFA 3IC1A 2ODFA 2PC1A 1M4GA 3JUWA 3NE7A 3PFOA 3KHZA 4NGTA 4P4EA 2BO9A 2WZNA 2YNDA 4FD7A 1I1DA 2Q43A 5G22A 4KSAA 4F9UA 3S9NA 2AFWA 3KL9A 1S7FA 3H8GA 4KOSA 4PPZA 4C2XA 3IWGA 4JZ0A 2Z3LA 3T9YA 3NA6A 2FIWA 2JLMA 4YFJA 1ELLP 3FEEA 5EMIA 2V8VA 3F0AA 1MJAA 4F6AA 2YNCA 1Z2LA 4CYQA 4MFJA 5LRKA 4UBRA 4NEXA 3VWDA 3S6HA 3B8GA 4CAXA 1SQHA 4NGMA 2O53A 4JD6A 6CPAA 3WC5A 2V8DA 2ZEOA 5AGEA 3B3CA 4XNHB 3TOBA 3BHXA 4R7MA 1BAVA 1ZLHA 1XRYA 2YGWA 2WUUA 4ONWA 4X2TA 3FVLA 4L89A 4BBHA 2R98A 2D4PA 2WYRA 2ATRA 2DPTA 4BINA 1ARLA 1ZLIA 2B4DB 5AG5A 3CXSA 4R87A 4B10A 3SHPA 1VHEA 4P4JA 1MK4A 1Z5RA 2EBJA 1RXTA 3HUVA 1Q7LA 4OMEA 4CAEA 5JQ4A 1WK4A 2CTBA 3SJFA 2VEZA 3R9GA 5G21A 3FB3A 3DNSA 2NSMA 4X3RA 2WSAA 2ZEPA 4KLWA 3H8EA 4UFVA 1PYTB 3SXNA 1VIXA 2J8RA 4CGMA 2CXAA 3PRTA 2ZPAA 1IB1E 1ELMP 2PJCA 5IB9A 3KR4A 3PB9X 4NXYA 1Q2DA 1LAPA 2BL1A 2Q4VA 1BPMA 2X7BA 4KVOE 4KVME 4MHDA 1DTDA 3I3GA 3QB8A 1CG2A 3GKRA 4MHZA 4OC3A 4NJQA 3VWEA 4TNUA 4RUHA 1I12A 4ZBGA 1YK3A 2FIAA 1RTQA 3FECA 4A94A 1IU8A 4FD6A 5THWA 5HXDA 2CY2A 3H5ZA 1IYKA 3NH5A 4I49A 2QVPA 4IK2A 4AG9A 4ZI6A 5HVFA 2GREA 2PVWA 4OC1A 1P0HA 2ZENA 3V38A 5KTAA 1P4NA 3D7HA 4HNYB 4MBUA 2CNSA 3FH4A 1VHSA 1X10A 4H2KA 3TE4A 3RNZA 3ISXA 3FF3A 3G3SA 4AVAA 1H8LA 2B4DA 3IJ3A 2PIZA 2RC4A 4MCPA 3TT2A 1YVKA 1LOKA 3SJXA 5A27A
chains in the Genus database with same CATH topology
5G20A 2K5TA 1ON0A 4OLLA 4CS0B 4JXQA 2J8NA 4KOWA 4NCZA 1NMTA 5E96A 2JDCA 5F48A 3ZZIA 3DR8A 5F47A 5KTCA 2R8VA 4B14A 2VBQA 4KOTA 1XE4A 5C82A 4R3KA 1U6MA 4U5YA 3IU2A 3P2HA 4HKFA 1ZO0A 2ZXVA 5H86A 2ZW7A 3T90A 2CNTA 3W6SA 4OADA 1Q2YA 4C2YA 3RYOA 3EO4A 5HMNA 3LD2A 1Z4EA 2FS5A 1S3ZA 1YVOA 4CAFA 2ZW6A 4RI1A 2ZW5A 3SXOA 1FY7A 4AG7A 1BOBA 2FL4A 1M44A 2AJ6A 3EFAA 1XF8A 4E8OA 2REFA 2PRBA 3OWCA 4XPDC 2B58A 2G0BA 2QECA 3D2MA 1S7KA 1QSOA 2WPXA 2Q44A 1NE9A 4C7IA 5AG6A 3F8KA 4B13A 4NF1A 1Q2CA 1J4JA 2Z10A 4Y49B 3F5BA 1L0CA 3DR6A 1M1DA 1IICA 2CNMA 3R96A 4M85A 2VQYA 4R9MA 5DWMA 2Q04A 5J8FA 1CJWA 4CYPA 4AB7A 5AG7A 3BJ7A 2VZYA 2Z3PA 4B5PB 3R1KA 2OZUA 4PK3A 4GS4A 4FD5A 4PV6A 5FVJA 3FRMA 4A95A 3S6GA 1R57A 2GE3A 2YNCC 2KCWA 3JTKA 4QC6A 4A32A 5HH1A 2PR1A 4YGOA 3V8IA 5KTDA 1PUAA 2H5MA 4MJ8A 1YGHA 4CGPA 3D2PA 3R9EA 3TOAA 4JJXA 2B3VA 3KKWA 2G3AA 3PZJA 2PQ8A 2OB0A 4JWPA 2BSWA 4DNCA 4A30A 4CGNA 1YX0A 2QMLA 4QUSA 2AE6A 3EC4A 3IGRA 1S5KA 4FD4A 1UFHA 4LX9A 4U9YA 4UWJA 3FNCA 1NSLA 4KSFA 5IV0A 2REEA 1S7NA 1QSMA 3CXPA 4B5PA 4PSXA 4CYNA 1K4JA 3FIXA 4F0XA 1I21A 2NMTA 2Z11A 4X5KA 2EVNA 4QB9A 3TO9A 4AVCA 4E2AA 3EXNA 3I9SA 4A31A 1IYLA 4XPLA 1M4IA 4L8AA 4M3SA 4KUAA 2OZGA 4XNHC 4HNXB 2PR8A 4A2ZA 3UY5A 4U9ZA 4A33A 2IL4A 3D8PA 2I00A 2I79A 5EBVA 3TO6A 4II9A 1KZFA 2WPWA 2VZZA 5JPHA 2P6FA 2ARHA 1QSTA 1Y9KA 4MI4A 4ORFA 4OAEA 4R3LA 4YRHA 4UFXA 5EC4A 2HV2A 4KZTA 2FXFA 4MFKA 1TIQA 2R1IA 3IWEA 3S6KA 4JLYA 1XEBA 4KOVA 4E0AA 2JDDA 5IB0A 1S7LA 2P0WA 3P2FA 1V0CA 1Z9UA 2QIRA 2P6EA 2P6GA 4BMHA 2GIVA 4KOYA 2VXKA 2O28A 5AG4A 2D4OA 2FE7A 3DSBA 2Y0MA 2BUEA 2C27A 1B87A 5IX3A 5DWNA 4F0YA 2FT0A 1XIXA 1Y7RA 2G3TA 5G1ZA 4LUAA 3A9LA 1MJ9A 2GANA 4NSQA 3PP9A 4RS2A 1S60A 4H6ZA 3WR7A 4MY0A 3TCVA 1PU9A 2F5IA 2Z3NA 4CYOA 2B3UA 1CM0A 4UA3A 2B4BA 3FXTA 4CAWA 4KOXA 4XPKA 3IU1A 3QAHA 2DPSA 2Z3KA 3G8WA 3PGPA 2VI7A 4CGLA 3H4QA 1QSRA 2EUIA 4B5OA 1XMTA 4UCNA 2B5GB 1KUYA 5F46A 1N71A 1OZPA 3R95A 4PK2A 4CRYB 4MFQA 2A4NA 4AVBA 2Z0ZA 3GY9A 2J8MA 1RO5A 4QBJA 2ZW4A 5A28A 1YR0A 2OU2A 4MFLA 3S6FA 5J8CA 4H89A 5I0CA 5CNPA 3MGDA 3DDDA 2Z3OA 3JVNA 3N7ZA 4H6UA 2Q7BA 3ZJ0A 1IIDA 2Z3MA 1B6BA 5H84A 4MY3A 2R7HA 4MFPA 2DXQA 1GHEA 4R57A 4KORA 3TTHA 5F49A 1YLEA 4PSWA 2FCKA 3FBUA 4C68A 4UFWA 3BJ8A 4Q36A 4KVXA 2B5GA 2BEIA 4C7HA 1M4DA 3GYAA 2Q0YA 4UCPA 4XPDB 4Y49C 4K30A 5GCNA 4CAVA 5C88A 4UCMA 1QSNA 1MJBA 3EY5A 3R9FA 1WWZA 4J3GA 4B11A 4CGOA 1BO4A 3C26A 4KUBA 5ISVA 2OH1A 3LODA 2HQYA 3E0KA 4Q38A 3D3SA 4ZGYB 2YNEA 1KUVA 2PDOA 4JXRA 1KUXA 3W6XA 4MFZA 4EVYA 2JEVA 4UWIA 3W91A 4HNWB 2FSRA 3K9UA 2HUZA 3CXQA 4C2ZA 3TFYA 1LRZA 4KS9A 4IF5A 1YREA 2Q4YA 2OZHA 1Z4RA 4ONUA 1VKCA 3TO7A 4CRZB 5BWAB 4KLVA 4QVTA 4B12A 2PSWA 3FYNA 4IUSA 4KOUA 1Y9WA 3BLNA 2PC1A 1M4GA 3JUWA 3NE7A 2YNDA 4FD7A 1I1DA 5G22A 4KSAA 1S7FA 4KOSA 4C2XA 3IWGA 2Z3LA 3T9YA 2FIWA 2JLMA 4YFJA 4F6AA 3F0AA 1MJAA 2YNCA 4CYQA 4MFJA 4UBRA 4NEXA 3VWDA 3S6HA 3B8GA 4CAXA 1SQHA 4JD6A 5AGEA 3TOBA 4XNHB 2YGWA 2WUUA 4L89A 4BBHA 2R98A 2D4PA 2ATRA 2DPTA 2B4DB 5AG5A 3CXSA 4R87A 4B10A 3SHPA 1MK4A 1RXTA 4CAEA 5JQ4A 1WK4A 2VEZA 3R9GA 5G21A 3FB3A 3DNSA 2WSAA 4KLWA 4UFVA 3SXNA 2J8RA 4CGMA 2CXAA 2ZPAA 1IB1E 4NXYA 1Q2DA 2BL1A 2Q4VA 4KVOE 4MHDA 2X7BA 4KVME 3QB8A 3I3GA 3GKRA 3VWEA 1I12A 4ZBGA 1YK3A 2FIAA 4FD6A 2CY2A 3H5ZA 1IYKA 4I49A 4AG9A 1P0HA 5KTAA 1P4NA 4HNYB 4MBUA 2CNSA 1VHSA 3TE4A 3G3SA 4AVAA 3TT2A 2B4DA 2RC4A 1YVKA 5A27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CYP A;  4C68 A;  4UFW A;  5G20 A;  5AG4 A;  4C2Z A;  2WUU A;  4C2X A;  5AG7 A;  2YNE A;  3IU1 A;  4BBH A;  4A31 A;  4C7H A;  4C2Y A;  4UCP A;  5AG5 A;  4C7I A;  5AG6 A;  4UFX A;  4A30 A;  4B10 A;  4CGL A;  4CGN A;  4B13 A;  3IWE A;  2YNC A;  3H5Z A;  4UCN A;  5G1Z A;  4B12 A;  4A95 A;  4CYQ A;  4UCM A;  4B14 A;  4CAF A;  4CAE A;  2YNC C;  3JTK A;  4A32 A;  5G21 A;  4A2Z A;  4A33 A;  4B11 A;  2WSA A;  4UFV A;  4CGO A;  2YND A;  4CGM A;  3IU2 A;  4CYO A;  5AGE A;  4CYN A;  5G22 A;  4CGP A;  5A28 A;  5A27 A; 
#chains in the Genus database with same CATH topology
 4GXH A;  5G20 A;  3PBE A;  3CPA A;  2XEF A;  2K5T A;  1ON0 A;  4OLL A;  4ZYQ A;  3MRU A;  1YQE A;  4CS0 B;  4JXQ A;  3VAR A;  2J8N A;  1XOV A;  4KOW A;  1NMT A;  4NCZ A;  1BLL E;  4DYO A;  5E96 A;  2PJA A;  3BXM A;  2JDC A;  2J9A A;  5F48 A;  3ZZI A;  3DR8 A;  5F47 A;  5KTC A;  2R8V A;  4B14 A;  2VBQ A;  3SJG A;  3PFE A;  4KOT A;  1XE4 A;  2PJ6 A;  2POK A;  2ZEH A;  3K9T A;  3B3V A;  5C82 A;  4R3K A;  1U6M A;  2ANP A;  4U5Y A;  4YU9 A;  2F8H A;  3IU2 A;  3D7D A;  3P2H A;  3D67 A;  4HKF A;  2DEA A;  1ZO0 A;  4K3N A;  2ZXV A;  2PJ5 A;  5H86 A;  1XBU A;  2PJ3 A;  2ZW7 A;  4P10 A;  2GFQ A;  3T90 A;  1TXR A;  2DF5 A;  5F09 A;  4MCS A;  4UIA A;  2CNT A;  2PCU A;  3TX8 A;  3W6S A;  4DUK A;  4OAD A;  1Q2Y A;  2IMO A;  4C2Y A;  3RYO A;  3EO4 A;  5HMN A;  2F7V A;  1GYT A;  1HDU A;  5K8N A;  3LD2 A;  1Y0Y A;  1Z4E A;  1S3Z A;  2BOA A;  2FS5 A;  3CDX A;  4WWV A;  4AXV A;  4ZY0 A;  3IFE A;  1YVO A;  4LQ6 A;  1FT7 A;  4CAF A;  2ZW6 A;  4RI1 A;  2AFS A;  2ZW5 A;  3SXO A;  1FY7 A;  4HPS A;  4R76 A;  4UEE A;  1CP6 A;  5JGF A;  4AG7 A;  3L2N A;  1BOB A;  2FL4 A;  1M44 A;  2HB6 A;  2OOT A;  2AJ6 A;  3EFA A;  2C6P A;  4JYW A;  4OP4 A;  4EWT A;  1XF8 A;  2EO8 A;  2RFH A;  2REF A;  4E8O A;  4P4D A;  2PRB A;  2ZEM A;  3OWC A;  4XPD C;  1IOI A;  2B58 A;  4Q7A A;  2G0B A;  2QEC A;  3D2M A;  1S7K A;  4UEZ A;  2JBJ A;  1LFW A;  1QSO A;  2WPX A;  4W9Y A;  3B3S A;  2Q44 A;  1NE9 A;  4C7I A;  2XEI A;  5AG6 A;  4PXE A;  3F8K A;  4B13 A;  2PVV A;  5DS0 A;  4OC0 A;  4NF1 A;  3KHX A;  1Q2C A;  3FED A;  5ELY A;  1J4J A;  2Z10 A;  4Y49 B;  2ZEE A;  3I1U A;  3F5B A;  1L0C A;  3DR6 A;  3KGQ A;  2ZOG A;  1UWY A;  1M1D A;  2PJ4 A;  1IIC A;  2CNM A;  3R96 A;  4M85 A;  2VQY A;  4R9M A;  4P45 A;  3PBB A;  5DWM A;  4EME A;  1R43 A;  2Q04 A;  5J8F A;  1CJW A;  4CYP A;  4AB7 A;  2ZOF A;  1HEE A;  3PB6 X;  5AG7 A;  3BJ7 A;  3NE8 A;  3N5F A;  2VZY A;  2Z3P A;  4B5P B;  3R1K A;  2OZU A;  4PK3 A;  3GUX A;  5JH9 A;  4GS4 A;  4A37 A;  4FD5 A;  4PV6 A;  5FVJ A;  2I3C A;  3FRM A;  1YW4 A;  3KAS A;  4MHP A;  4A95 A;  5HVG A;  4MCQ A;  4MXU A;  1R57 A;  2GE3 A;  2Q51 A;  2KCW A;  2YNC C;  3S6G A;  3JTK A;  4QC6 A;  3NH4 A;  5HH1 A;  3LAC A;  4A32 A;  2AFO A;  4O23 A;  2PR1 A;  3KQZ A;  4YGO A;  3V8I A;  4NGN A;  3CPX A;  5KTD A;  1TF8 A;  3NFZ A;  1PUA A;  2H5M A;  1TKJ A;  4MJ8 A;  5HVH A;  1YGH A;  4CGP A;  1TF9 A;  3D2P A;  2VL1 A;  3R9E A;  3TOA A;  5LYF A;  4JJX A;  2B3V A;  3KKW A;  2G3A A;  3PZJ A;  2PQ8 A;  2OB0 A;  4JWP A;  2G9D A;  2IJZ A;  2BSW A;  3SI1 A;  4M6I A;  3RO0 A;  4DNC A;  5CBM A;  4A30 A;  4OC4 A;  4CGN A;  1YLO A;  1YX0 A;  2QML A;  2PRQ A;  3B2Y A;  4QUS A;  2AE6 A;  3IEH A;  3EC4 A;  2GLF A;  3IGR A;  2PIY A;  4NGP A;  4KSI A;  1S5K A;  4FD4 A;  1UFH A;  4LX9 A;  4U9Y A;  4UWJ A;  3FNC A;  1NSL A;  3GLJ A;  3K2K A;  3DGV A;  2C1C A;  4KSF A;  3D66 A;  4UIB A;  5IV0 A;  2REE A;  1S7N A;  1Z8L A;  1QSM A;  3CXP A;  5LYI A;  4PSX A;  1NSA A;  1K4J A;  1OBR A;  3FIX A;  4B5P A;  4CYN A;  4F0X A;  1I21 A;  2NMT A;  2Z11 A;  4X5K A;  2EVN A;  4QB9 A;  3TO9 A;  4AVC A;  4E2A A;  1XMB A;  5J1Q A;  3EXN A;  4IAV A;  3SJE A;  3I9S A;  2Q7S A;  4A31 A;  1IYL A;  4XPL A;  3D68 A;  1F2P A;  1M4I A;  5K8M A;  4L8A A;  4M3S A;  1YME A;  1DE4 C;  2ZEL A;  2ABZ A;  4KUA A;  4P4F A;  5LYL A;  2OZG A;  3ISZ A;  3CT9 A;  4XNH C;  4HNX B;  2PJ0 A;  2PR8 A;  1YSJ A;  3UY5 A;  4U9Z A;  4A33 A;  2IL4 A;  3D8P A;  4A2Z A;  4FAI A;  2I00 A;  3HLP A;  2I79 A;  2GU2 A;  1Z8X A;  2ZEG A;  3FJU A;  5EBV A;  2C6C A;  2AFM A;  4MHN A;  3TO6 A;  4II9 A;  1KZF A;  3IIB A;  3QAY A;  2WPW A;  2VZZ A;  3QNV A;  5JPH A;  4FBE A;  1HDQ A;  2ARH A;  1QST A;  1Y9K A;  2P6F A;  3KZW A;  4MI4 A;  4ZY2 A;  4ORF A;  4OAE A;  4R3L A;  3H8F A;  4YRH A;  4UFX A;  5EC4 A;  2HV2 A;  4KZT A;  2FXF A;  4MFK A;  5CPA A;  4PXD A;  2AFU A;  1TIQ A;  2R1I A;  3IWE A;  4A39 A;  3S6K A;  4JLY A;  1XEB A;  3B3W A;  4KOV A;  4E0A A;  2JDD A;  4PXB A;  5IB0 A;  1S7L A;  2EWB A;  2P0W A;  2V8G A;  3P2F A;  4M6G A;  3WC6 A;  1V0C A;  1TKH A;  1Z9U A;  2QIR A;  4UF4 A;  2P6E A;  2P6G A;  3IWW A;  2XEJ A;  4FUU A;  4BD9 A;  4BMH A;  4MMO A;  4YWY A;  2GIV A;  1BPN A;  4KOY A;  1VGY A;  1ZG8 A;  2O28 A;  2VXK A;  3S9M A;  2PJ7 A;  5AG4 A;  3D4U A;  3RAM A;  2D4O A;  1XJO A;  4R6T A;  2FE7 A;  1Z8T A;  2PJ2 A;  3DSB A;  4UEF A;  2Y0M A;  2BUE A;  2C27 A;  1B87 A;  3PEI A;  1JWQ A;  5IX3 A;  2FVG A;  2QJ8 A;  4MCR A;  2OR4 A;  5DWN A;  2EK9 A;  1PCA A;  4F0Y A;  2FT0 A;  3PB7 X;  1XIX A;  1Y7R A;  4NGS A;  3GIU A;  2G3T A;  2JEW A;  5G1Z A;  1R3N A;  4LUA A;  1F57 A;  4ZX9 A;  3A9L A;  3FMC A;  1MJ9 A;  1XFO A;  3VH9 A;  2GAN A;  4NSQ A;  2V77 A;  1CX8 A;  3PP9 A;  4RS2 A;  1S60 A;  3KI9 A;  4H6Z A;  3WR7 A;  4MY0 A;  4P6Y A;  3NH8 A;  3TCV A;  2RB7 A;  1PU9 A;  2F5I A;  2Z3N A;  2EK8 A;  3MN8 A;  4CYO A;  2B3U A;  1CM0 A;  4F9V A;  4UA3 A;  2B4B A;  4NFR A;  1QQ9 A;  3FXT A;  4CAW A;  2QYV A;  4KOX A;  2HC9 A;  4XPK A;  3IU1 A;  4GM5 A;  5LRJ A;  3QAH A;  3RBU A;  1M4L A;  1IGB A;  2DPS A;  4OIW A;  5LYD A;  2Z3K A;  3G8W A;  1QMU A;  3PGP A;  2VI7 A;  4CGL A;  1X12 A;  2JBK A;  3H4Q A;  1QSR A;  2EUI A;  1CBX A;  3PB4 X;  4B5O A;  1XMT A;  3IO1 A;  4UCN A;  2B5G B;  3S9L A;  1KUY A;  5F46 A;  1YW6 A;  1KWM A;  3BI0 A;  4P4I A;  4CPA A;  1N71 A;  1OZP A;  3R95 A;  4PK2 A;  4CRY B;  1LCP A;  2XEG A;  2A4N A;  3KR5 A;  4MFQ A;  4ZX8 A;  4AVB A;  2Z0Z A;  3GB0 A;  3GY9 A;  2J8M A;  3WAB A;  1RO5 A;  5K8P A;  4QBJ A;  1FNO A;  2ZW4 A;  5A28 A;  1YR0 A;  2OU2 A;  4MFL A;  3LWU A;  3S6F A;  5J8C A;  1IY7 A;  5I4M A;  4PXC A;  5D29 A;  4H89 A;  1ARM A;  5I0C A;  3T8W A;  5CNP A;  3BI1 A;  4Z65 A;  3MGD A;  3DDD A;  4ZY1 A;  2Z3O A;  2NYQ A;  3JVN A;  3N7Z A;  4H6U A;  2Q7B A;  7CPA A;  3CZX A;  1ZG9 A;  5JM6 A;  3ZJ0 A;  1IID A;  2Z3M A;  3WT4 A;  1B6B A;  2V8H A;  5H84 A;  4MY3 A;  2R7H A;  4X8I A;  4MFP A;  3KQX A;  3VAT A;  2DXQ A;  1GHE A;  2O4H A;  3SI2 A;  4R57 A;  4KOR A;  2CF4 A;  3TTH A;  4F8Z A;  5F49 A;  1YLE A;  2IQ6 A;  4PSW A;  4DJL A;  2FCK A;  4NGR A;  5D8N A;  2ZED A;  3FBU A;  4C68 A;  4UFW A;  1VHO A;  3BJ8 A;  4Q36 A;  2PJB A;  1AMP A;  3V7Z A;  4KVX A;  2B5G A;  2BEI A;  3PB8 X;  1CPS A;  4C7H A;  2CTC A;  1M4D A;  3GYA A;  2Q0Y A;  4IHM A;  4UCP A;  4XPD B;  4Y49 C;  2Q4Z A;  4K30 A;  8CPA A;  5GCN A;  1IOF A;  4CAV A;  2CIJ A;  3FX6 A;  5C88 A;  3JRU A;  2PJ8 A;  4UCM A;  5K8O A;  4P44 A;  1QSN A;  1EE3 P;  4OC5 A;  1MJB A;  3EY5 A;  4OC2 A;  4P4B A;  3B35 A;  3R9F A;  1WWZ A;  2BCO A;  2PJ9 A;  4J3G A;  4B11 A;  4CGO A;  1BO4 A;  3C26 A;  4MHY A;  2PJ1 A;  4RN7 A;  2PE3 A;  4KUB A;  5ISV A;  2OH1 A;  3LOD A;  4LQG A;  1Y0R A;  2HQY A;  3E0K A;  4Q38 A;  3WC7 A;  2AFX A;  3D3S A;  3D7G A;  4ZGY B;  2YNE A;  1KUV A;  2PDO A;  4FWU A;  4NJR A;  4JXR A;  3B3T A;  1KUX A;  3RZA A;  3W6X A;  2GLJ A;  4MFZ A;  1ZG7 A;  3D7F A;  1F2O A;  4G1P A;  4EVY A;  2JEV A;  1AUG A;  4EFD A;  2AFZ A;  4MRI A;  4OID A;  1LAM A;  1JQG A;  4UWI A;  4OKO A;  2ZEF A;  4TWE A;  3W91 A;  1AYE A;  3DLJ A;  1A2Z A;  4HNW B;  2FSR A;  3K9U A;  2HUZ A;  1Y7E A;  3TC8 A;  5LRG A;  4WJB A;  1Z8W A;  3CXQ A;  4M6H A;  4PQA A;  1CPX A;  4C2Z A;  1CP7 A;  1LRZ A;  3SI0 A;  3TFY A;  1LAN A;  4KS9 A;  4IF5 A;  1YRE A;  2Q4Y A;  4A38 A;  2OZH A;  2C6G A;  3LMS A;  3B7I A;  4NGQ A;  1Z4R A;  4ONU A;  1VKC A;  3TO7 A;  4CRZ B;  5BWA B;  4KLV A;  4QVT A;  4B12 A;  2PSW A;  3FYN A;  4IUS A;  4KOU A;  4R8F A;  4B6Z A;  1Y9W A;  3BLN A;  1TKF A;  3IC1 A;  2ODF A;  2PC1 A;  1M4G A;  3JUW A;  3NE7 A;  3PFO A;  3KHZ A;  4NGT A;  4P4E A;  2BO9 A;  2WZN A;  2YND A;  4FD7 A;  1I1D A;  2Q43 A;  5G22 A;  4KSA A;  4F9U A;  3S9N A;  2AFW A;  3KL9 A;  1S7F A;  3H8G A;  4KOS A;  4PPZ A;  4C2X A;  3IWG A;  4JZ0 A;  2Z3L A;  3T9Y A;  3NA6 A;  2FIW A;  2JLM A;  4YFJ A;  1ELL P;  3FEE A;  5EMI A;  2V8V A;  3F0A A;  1MJA A;  4F6A A;  2YNC A;  1Z2L A;  4CYQ A;  4MFJ A;  5LRK A;  4UBR A;  4NEX A;  3VWD A;  3S6H A;  3B8G A;  4CAX A;  1SQH A;  4NGM A;  2O53 A;  4JD6 A;  6CPA A;  3WC5 A;  2V8D A;  2ZEO A;  5AGE A;  3B3C A;  4XNH B;  3TOB A;  3BHX A;  4R7M A;  1BAV A;  1ZLH A;  1XRY A;  2YGW A;  2WUU A;  4ONW A;  4X2T A;  3FVL A;  4L89 A;  4BBH A;  2R98 A;  2D4P A;  2WYR A;  2ATR A;  2DPT A;  4BIN A;  1ARL A;  1ZLI A;  2B4D B;  5AG5 A;  3CXS A;  4R87 A;  4B10 A;  3SHP A;  1VHE A;  4P4J A;  1MK4 A;  1Z5R A;  2EBJ A;  1RXT A;  3HUV A;  1Q7L A;  4OME A;  4CAE A;  5JQ4 A;  1WK4 A;  2CTB A;  3SJF A;  2VEZ A;  3R9G A;  5G21 A;  3FB3 A;  3DNS A;  2NSM A;  4X3R A;  2WSA A;  2ZEP A;  4KLW A;  3H8E A;  4UFV A;  1PYT B;  3SXN A;  1VIX A;  2J8R A;  4CGM A;  2CXA A;  3PRT A;  2ZPA A;  1IB1 E;  1ELM P;  2PJC A;  5IB9 A;  3KR4 A;  3PB9 X;  4NXY A;  1Q2D A;  1LAP A;  2BL1 A;  2Q4V A;  1BPM A;  2X7B A;  4KVO E;  4KVM E;  4MHD A;  1DTD A;  3I3G A;  3QB8 A;  1CG2 A;  3GKR A;  4MHZ A;  4OC3 A;  4NJQ A;  3VWE A;  4TNU A;  4RUH A;  1I12 A;  4ZBG A;  1YK3 A;  2FIA A;  1RTQ A;  3FEC A;  4A94 A;  1IU8 A;  4FD6 A;  5THW A;  5HXD A;  2CY2 A;  3H5Z A;  1IYK A;  3NH5 A;  4I49 A;  2QVP A;  4IK2 A;  4AG9 A;  4ZI6 A;  5HVF A;  2GRE A;  2PVW A;  4OC1 A;  1P0H A;  2ZEN A;  3V38 A;  5KTA A;  1P4N A;  3D7H A;  4HNY B;  4MBU A;  2CNS A;  3FH4 A;  1VHS A;  1X10 A;  4H2K A;  3TE4 A;  3RNZ A;  3ISX A;  3FF3 A;  3G3S A;  4AVA A;  1H8L A;  2B4D A;  3IJ3 A;  2PIZ A;  2RC4 A;  4MCP A;  3TT2 A;  1YVK A;  1LOK A;  3SJX A;  5A27 A; 
#chains in the Genus database with same CATH homology
 5G20 A;  2K5T A;  1ON0 A;  4OLL A;  4CS0 B;  4JXQ A;  2J8N A;  4KOW A;  4NCZ A;  1NMT A;  5E96 A;  2JDC A;  5F48 A;  3ZZI A;  3DR8 A;  5F47 A;  5KTC A;  2R8V A;  4B14 A;  2VBQ A;  4KOT A;  1XE4 A;  5C82 A;  4R3K A;  1U6M A;  4U5Y A;  3IU2 A;  3P2H A;  4HKF A;  1ZO0 A;  2ZXV A;  5H86 A;  2ZW7 A;  3T90 A;  2CNT A;  3W6S A;  4OAD A;  1Q2Y A;  4C2Y A;  3RYO A;  3EO4 A;  5HMN A;  3LD2 A;  1Z4E A;  2FS5 A;  1S3Z A;  1YVO A;  4CAF A;  2ZW6 A;  4RI1 A;  2ZW5 A;  3SXO A;  1FY7 A;  4AG7 A;  1BOB A;  2FL4 A;  1M44 A;  2AJ6 A;  3EFA A;  1XF8 A;  4E8O A;  2REF A;  2PRB A;  3OWC A;  4XPD C;  2B58 A;  2G0B A;  2QEC A;  3D2M A;  1S7K A;  1QSO A;  2WPX A;  2Q44 A;  1NE9 A;  4C7I A;  5AG6 A;  3F8K A;  4B13 A;  4NF1 A;  1Q2C A;  1J4J A;  2Z10 A;  4Y49 B;  3F5B A;  1L0C A;  3DR6 A;  1M1D A;  1IIC A;  2CNM A;  3R96 A;  4M85 A;  2VQY A;  4R9M A;  5DWM A;  2Q04 A;  5J8F A;  1CJW A;  4CYP A;  4AB7 A;  5AG7 A;  3BJ7 A;  2VZY A;  2Z3P A;  4B5P B;  3R1K A;  2OZU A;  4PK3 A;  4GS4 A;  4FD5 A;  4PV6 A;  5FVJ A;  3FRM A;  4A95 A;  3S6G A;  1R57 A;  2GE3 A;  2YNC C;  2KCW A;  3JTK A;  4QC6 A;  4A32 A;  5HH1 A;  2PR1 A;  4YGO A;  3V8I A;  5KTD A;  1PUA A;  2H5M A;  4MJ8 A;  1YGH A;  4CGP A;  3D2P A;  3R9E A;  3TOA A;  4JJX A;  2B3V A;  3KKW A;  2G3A A;  3PZJ A;  2PQ8 A;  2OB0 A;  4JWP A;  2BSW A;  4DNC A;  4A30 A;  4CGN A;  1YX0 A;  2QML A;  4QUS A;  2AE6 A;  3EC4 A;  3IGR A;  1S5K A;  4FD4 A;  1UFH A;  4LX9 A;  4U9Y A;  4UWJ A;  3FNC A;  1NSL A;  4KSF A;  5IV0 A;  2REE A;  1S7N A;  1QSM A;  3CXP A;  4B5P A;  4PSX A;  4CYN A;  1K4J A;  3FIX A;  4F0X A;  1I21 A;  2NMT A;  2Z11 A;  4X5K A;  2EVN A;  4QB9 A;  3TO9 A;  4AVC A;  4E2A A;  3EXN A;  3I9S A;  4A31 A;  1IYL A;  4XPL A;  1M4I A;  4L8A A;  4M3S A;  4KUA A;  2OZG A;  4XNH C;  4HNX B;  2PR8 A;  4A2Z A;  3UY5 A;  4U9Z A;  4A33 A;  2IL4 A;  3D8P A;  2I00 A;  2I79 A;  5EBV A;  3TO6 A;  4II9 A;  1KZF A;  2WPW A;  2VZZ A;  5JPH A;  2P6F A;  2ARH A;  1QST A;  1Y9K A;  4MI4 A;  4ORF A;  4OAE A;  4R3L A;  4YRH A;  4UFX A;  5EC4 A;  2HV2 A;  4KZT A;  2FXF A;  4MFK A;  1TIQ A;  2R1I A;  3IWE A;  3S6K A;  4JLY A;  1XEB A;  4KOV A;  4E0A A;  2JDD A;  5IB0 A;  1S7L A;  2P0W A;  3P2F A;  1V0C A;  1Z9U A;  2QIR A;  2P6E A;  2P6G A;  4BMH A;  2GIV A;  4KOY A;  2VXK A;  2O28 A;  5AG4 A;  2D4O A;  2FE7 A;  3DSB A;  2Y0M A;  2BUE A;  2C27 A;  1B87 A;  5IX3 A;  5DWN A;  4F0Y A;  2FT0 A;  1XIX A;  1Y7R A;  2G3T A;  5G1Z A;  4LUA A;  3A9L A;  1MJ9 A;  2GAN A;  4NSQ A;  3PP9 A;  4RS2 A;  1S60 A;  4H6Z A;  3WR7 A;  4MY0 A;  3TCV A;  1PU9 A;  2F5I A;  2Z3N A;  4CYO A;  2B3U A;  1CM0 A;  4UA3 A;  2B4B A;  3FXT A;  4CAW A;  4KOX A;  4XPK A;  3IU1 A;  3QAH A;  2DPS A;  2Z3K A;  3G8W A;  3PGP A;  2VI7 A;  4CGL A;  3H4Q A;  1QSR A;  2EUI A;  4B5O A;  1XMT A;  4UCN A;  2B5G B;  1KUY A;  5F46 A;  1N71 A;  1OZP A;  3R95 A;  4PK2 A;  4CRY B;  4MFQ A;  2A4N A;  4AVB A;  2Z0Z A;  3GY9 A;  2J8M A;  1RO5 A;  4QBJ A;  2ZW4 A;  5A28 A;  1YR0 A;  2OU2 A;  4MFL A;  3S6F A;  5J8C A;  4H89 A;  5I0C A;  5CNP A;  3MGD A;  3DDD A;  2Z3O A;  3JVN A;  3N7Z A;  4H6U A;  2Q7B A;  3ZJ0 A;  1IID A;  2Z3M A;  1B6B A;  5H84 A;  4MY3 A;  2R7H A;  4MFP A;  2DXQ A;  1GHE A;  4R57 A;  4KOR A;  3TTH A;  5F49 A;  1YLE A;  4PSW A;  2FCK A;  3FBU A;  4C68 A;  4UFW A;  3BJ8 A;  4Q36 A;  4KVX A;  2B5G A;  2BEI A;  4C7H A;  1M4D A;  3GYA A;  2Q0Y A;  4UCP A;  4XPD B;  4Y49 C;  4K30 A;  5GCN A;  4CAV A;  5C88 A;  4UCM A;  1QSN A;  1MJB A;  3EY5 A;  3R9F A;  1WWZ A;  4J3G A;  4B11 A;  4CGO A;  1BO4 A;  3C26 A;  4KUB A;  5ISV A;  2OH1 A;  3LOD A;  2HQY A;  3E0K A;  4Q38 A;  3D3S A;  4ZGY B;  2YNE A;  1KUV A;  2PDO A;  4JXR A;  1KUX A;  3W6X A;  4MFZ A;  4EVY A;  2JEV A;  4UWI A;  3W91 A;  4HNW B;  2FSR A;  3K9U A;  2HUZ A;  3CXQ A;  4C2Z A;  3TFY A;  1LRZ A;  4KS9 A;  4IF5 A;  1YRE A;  2Q4Y A;  2OZH A;  1Z4R A;  4ONU A;  1VKC A;  3TO7 A;  4CRZ B;  5BWA B;  4KLV A;  4QVT A;  4B12 A;  2PSW A;  3FYN A;  4IUS A;  4KOU A;  1Y9W A;  3BLN A;  2PC1 A;  1M4G A;  3JUW A;  3NE7 A;  2YND A;  4FD7 A;  1I1D A;  5G22 A;  4KSA A;  1S7F A;  4KOS A;  4C2X A;  3IWG A;  2Z3L A;  3T9Y A;  2FIW A;  2JLM A;  4YFJ A;  4F6A A;  3F0A A;  1MJA A;  2YNC A;  4CYQ A;  4MFJ A;  4UBR A;  4NEX A;  3VWD A;  3S6H A;  3B8G A;  4CAX A;  1SQH A;  4JD6 A;  5AGE A;  3TOB A;  4XNH B;  2YGW A;  2WUU A;  4L89 A;  4BBH A;  2R98 A;  2D4P A;  2ATR A;  2DPT A;  2B4D B;  5AG5 A;  3CXS A;  4R87 A;  4B10 A;  3SHP A;  1MK4 A;  1RXT A;  4CAE A;  5JQ4 A;  1WK4 A;  2VEZ A;  3R9G A;  5G21 A;  3FB3 A;  3DNS A;  2WSA A;  4KLW A;  4UFV A;  3SXN A;  2J8R A;  4CGM A;  2CXA A;  2ZPA A;  1IB1 E;  4NXY A;  1Q2D A;  2BL1 A;  2Q4V A;  4KVO E;  4MHD A;  2X7B A;  4KVM E;  3QB8 A;  3I3G A;  3GKR A;  3VWE A;  1I12 A;  4ZBG A;  1YK3 A;  2FIA A;  4FD6 A;  2CY2 A;  3H5Z A;  1IYK A;  4I49 A;  4AG9 A;  1P0H A;  5KTA A;  1P4N A;  4HNY B;  4MBU A;  2CNS A;  1VHS A;  3TE4 A;  3G3S A;  4AVA A;  3TT2 A;  2B4D A;  2RC4 A;  1YVK A;  5A27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...