4CGPA

Leishmania major n-myristoyltransferase in complex with cofactor
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Diverse Modes of Binding in Structures of Leishmania Major N-Myristoyltransferase with Selective Inhibitors
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 126
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cgpA00
4B11A 3IWEA 3JTKA 4C7IA 5AG5A 4CAEA 4CYPA 5G1ZA 4C2XA 4CAFA 5AGEA 4CGPA 4UCNA 4CGLA 4BBHA 2WSAA 4C68A 5A27A 4UCMA 4CGNA 4A32A 4B10A 5AG4A 4CGOA 4C2ZA 5A28A 4UCPA 4A33A 3IU2A 4A95A 4CGMA 4A2ZA 2YNCC 4C7HA 4B13A 4B14A 3H5ZA 2YNCA 4UFXA 5AG6A 2WUUA 4A30A 4CYQA 5G22A 3IU1A 4UFVA 2YNDA 4CYNA 4C2YA 4UFWA 5G20A 4A31A 4B12A 2YNEA 5G21A 5AG7A 4CYOA
chains in the Genus database with same CATH superfamily
1IICA 3JTKA 2V8DA 4FD5A 3LACA 1KWMA 1YSJA 2IJZA 1BLLE 1IYLA 1XMTA 5AGEA 1S5KA 4KOSA 4NGSA 4OIDA 3B3VA 2B5GB 3PB8X 3F8KA 2PE3A 4KVOE 1TXRA 1VKCA 4W9YA 2PJ9A 1XE4A 4FD4A 2CTBA 4CAVA 3C26A 4TNUA 4YWYA 3S9LA 1YW4A 3IWWA 2REFA 3B3TA 4PXEA 3RAMA 2XEFA 2PC1A 1IU8A 3IU1A 1BPMA 2EWBA 1QSOA 2EVNA 1IB1E 3B35A 3JUWA 4JWPA 4Y49B 4ZGYB 4DJLA 1IY7A 5H84A 1KZFA 4HNWB 4AXVA 1YQEA 4FWUA 4MFZA 5AG5A 4Z65A 2P6FA 2C27A 4XNHB 2VEZA 5C82A 3KHXA 1Y9WA 3QAYA 4NJQA 3KQXA 4PPZA 4UBRA 4UA3A 3G8WA 1P0HA 1Z4RA 3JVNA 3KL9A 4GM5A 4XPKA 2Q44A 4HPSA 2C6GA 5F49A 2BL1A 1YREA 2KCWA 1PCAA 1Y0YA 2XEJA 3R96A 1QQ9A 4O23A 5LYDA 1ZLIA 4DYOA 4MCSA 3D4UA 5D8NA 4R7MA 1UFHA 4UEEA 1N71A 2Z3MA 3CPXA 4KOWA 4YRHA 1TF9A 4E8OA 4HKFA 3NA6A 2PJ6A 3VARA 5I4MA 5AG7A 5JM6A 3CXPA 3RZAA 4TWEA 1PU9A 2PJ0A 1HDQA 4NGQA 4RS2A 3IIBA 2FL4A 4M6IA 2QMLA 1CM0A 3B2YA 4MI4A 2WSAA 1SQHA 3QB8A 1M4DA 3KR4A 2AFZA 4MCPA 4A33A 2I00A 4LUAA 1BOBA 3ISXA 4MHZA 4KZTA 2V8GA 4X3RA 3FNCA 1OBRA 2ZW4A 3BI0A 5KTAA 2REEA 1MJBA 4H6ZA 5EC4A 1LOKA 4NF1A 4FAIA 2GLFA 2FVGA 2ZW5A 3CZXA 4LQGA 3RBUA 2AFOA 3D7DA 4A31A 4KOVA 3WT4A 4PK2A 2FCKA 5LRKA 5BWAB 1CP6A 3D8PA 2BEIA 4KSAA 2GREA 5D29A 5DS0A 2OOTA 4CPAA 3W6XA 2ANPA 1VHOA 3R1KA 2ZELA 5IX3A 4UCNA 2CTCA 2V8VA 1ZG7A 5C88A 3S6HA 2OZUA 5LRGA 4MRIA 5AG4A 1ZLHA 4HNXB 1YMEA 4UCPA 2PJ5A 1GYTA 2X7BA 2PIZA 2B4BA 4JD6A 1I21A 1WK4A 4A2ZA 1YK3A 1S60A 4B14A 2IMOA 3FEEA 3FX6A 2B4DA 1A2ZA 2D4PA 4OAEA 3QAHA 2JDCA 2OZGA 4KSIA 4MHYA 4PK3A 1KUYA 1QSTA 2Q4VA 2C6CA 5CNPA 2WYRA 4PSXA 3SI0A 3HLPA 3B7IA 1FT7A 4WWVA 5ELYA 2WPWA 5J1QA 4MY3A 4UWIA 4B11A 2PJ1A 2Q51A 3PZJA 2I3CA 4UEFA 3TTHA 3IC1A 4CS0B 1F2OA 4F8ZA 3ISZA 2ZOFA 4NGTA 5I0CA 1YW6A 1M4LA 2ZEMA 4IK2A 4MHDA 4M6GA 5A28A 4NXYA 3IU2A 4Q38A 4IAVA 1MJ9A 2XEGA 4R57A 1Z8LA 5LYIA 2PCUA 3S6GA 2GU2A 5H86A 2H5MA 3V8IA 4B6ZA 3GYAA 2CXAA 4NJRA 1WWZA 2R98A 3D2PA 1LAPA 1BAVA 1RTQA 2WZNA 3IWEA 1HEEA 4IF5A 1MJAA 2ARHA 1HDUA 3SJXA 4H6UA 1M4GA 2HV2A 1QSRA 1CX8A 2PSWA 5IB0A 4ZBGA 3R9EA 4CGOA 1FY7A 1XOVA 3IGRA 3S9NA 1S7FA 1YVOA 3D7HA 4P10A 2YNCC 3SXNA 1DE4C 2Q04A 4GXHA 3FRMA 1YR0A 3H8EA 1TIQA 3IWGA 4DUKA 1RXTA 3BLNA 4M85A 2PJAA 2PR1A 2EK9A 5DWMA 4UF4A 4BMHA 3V38A 2J8NA 4ZX8A 1X12A 4C2YA 1NSLA 2GIVA 2PJ2A 2B5GA 3OWCA 4IUSA 3W6SA 4MJ8A 4E0AA 3DLJA 3K9TA 3GB0A 2ATRA 2PRQA 1CPXA 2Z0ZA 2JBKA 4XPLA 3SJGA 3FJUA 2VZYA 2AFUA 1GHEA 1R3NA 3L2NA 1S7NA 1ZG9A 3FVLA 2B3UA 2AE6A 3MGDA 3N5FA 4CGPA 3K9UA 1AUGA 3TCVA 2BCOA 1Q2CA 2AFWA 4AVCA 3H8FA 7CPAA 3K2KA 2ZENA 5JH9A 4ORFA 3KGQA 4PXDA 5J8FA 4R76A 3SXOA 2PQ8A 1DTDA 4KOUA 4R87A 4ZY0A 4BINA 5J8CA 4CRYB 1ELLP 2EK8A 1YX0A 4AVAA 5G22A 3B3CA 4U5YA 2DF5A 4YU9A 5IB9A 5KTDA 1YGHA 1V0CA 1ZO0A 2IQ6A 5EBVA 2BSWA 2VL1A 1Y7RA 4OC2A 5F46A 4GS4A 2Q4YA 4PXBA 3TC8A 4B5PB 4F0XA 2QIRA 3H8GA 2BUEA 1CBXA 4X5KA 1VHSA 4MHPA 2NMTA 3LWUA 1TKHA 5CPAA 1PYTB 2EUIA 4NGNA 3WC7A 3P2FA 1M4IA 2R8VA 4F6AA 3PFOA 1EE3P 3RO0A 4MFQA 4F9VA 1KUXA 3UY5A 2P6EA 3FBUA 1XBUA 2ZW6A 4JJXA 4ZYQA 5LYLA 4AG9A 2HB6A 1K4JA 1QMUA 4CGMA 4B5PA 1FNOA 2ZEEA 3FH4A 4JZ0A 2HQYA 2R7HA 4KOXA 4YFJA 3B3SA 1P4NA 4KUBA 4EFDA 4P4EA 4HNYB 4QB9A 2YNDA 4UWJA 4A37A 2DEAA 5F48A 4LQ6A 2RC4A 2FIWA 4B12A 3GLJA 1XRYA 4J3GA 4X2TA 3TFYA 4CYOA 4ZI6A 4C7IA 2FSRA 2HC9A 2JEWA 4OADA 4LX9A 1ZG8A 3PRTA 3WR7A 2GANA 1NMTA 4BBHA 4EMEA 4F0YA 5HVFA 1ON0A 2I79A 4ZX9A 3B3WA 2PVWA 1UWYA 2PJBA 1L0CA 4H89A 1Z8TA 3NE7A 4R3KA 1I1DA 3BJ8A 2JBJA 4P4JA 2FIAA 4MMOA 2Z10A 1XMBA 3VWDA 4CAXA 2Y0MA 4U9ZA 4BD9A 3I9SA 1YLOA 3D2MA 5F09A 4M6HA 5HVGA 2CIJA 5LRJA 3KHZA 5HMNA 2QYVA 2Z11A 4KS9A 2NYQA 4XPDC 1LANA 4DNCA 2YNEA 3NE8A 2VXKA 2G3AA 2PJ3A 4FD6A 4OC4A 2CNSA 4KVME 2EBJA 4OC1A 3FXTA 2WPXA 3GIUA 4FBEA 1M44A 3IFEA 1OZPA 1S7KA 5E96A 3I3GA 4OKOA 3TO9A 2Z3NA 3W91A 4C2ZA 1U6MA 1S3ZA 5THWA 3TX8A 3F5BA 3RYOA 3SI2A 1PUAA 4C7HA 1IYKA 4OMEA 3TOBA 1IOFA 3D3SA 5K8NA 4R3LA 2AFMA 2B58A 2G0BA 4CYQA 2IL4A 3KI9A 4KLWA 4A39A 4KORA 3LODA 4NGMA 1IGBA 4P4DA 2PDOA 5JGFA 1XF8A 4YGOA 2OH1A 1Z8WA 1MK4A 1AYEA 4H2KA 2FT0A 1XJOA 2RFHA 3D66A 3G3SA 4NGPA 2P0WA 3PGPA 1TKJA 2VBQA 2O4HA 3MN8A 2Q0YA 4MFPA 3BXMA 2YGWA 4KSFA 3I1UA 2V77A 3PP9A 4Y49C 4XPDB 4EWTA 2J8RA 3DGVA 4A95A 4ZY1A 2GFQA 2Q7SA 4AVBA 1CJWA 1QSNA 3NFZA 4XNHC 4UFXA 3VWEA 3H4QA 5HXDA 4QUSA 4KOYA 3KASA 4QBJA 3BJ7A 1JWQA 3EC4A 3FB3A 2Z3KA 3IO1A 4FUUA 3R95A 3RNZA 4CYNA 5G20A 2AFXA 1AMPA 1B87A 1VIXA 4C68A 2GLJA 3DNSA 3T90A 4I49A 5GCNA 3DR6A 4CRZB 2EO8A 3FMCA 2VI7A 4NCZA 3VH9A 4P6YA 4ONUA 4JXRA 4KUAA 4AB7A 2ZEFA 4G1PA 4UIAA 2JLMA 4RI1A 3T9YA 5FVJA 3CDXA 3SJEA 4OC3A 4OP4A 1R43A 2QJ8A 4QVTA 1ELMP 3S6KA 2PVVA 1BPNA 4EVYA 4K3NA 3PB6X 3CPAA 4OC0A 4RN7A 3TT2A 1IOIA 5K8MA 5K8PA 3CT9A 3S9MA 3T8WA 4WJBA 4A38A 1J4JA 3KZWA 1LCPA 2PJ8A 2Z3OA 4OC5A 2PJCA 1YLEA 1Q2YA 2Q43A 3VATA 3CXSA 3S6FA 4ZY2A 3FF3A 3V7ZA 4CAEA 1F57A 1TKFA 5G1ZA 2ZEOA 2PIYA 2PJ7A 3SI1A 1QSMA 4C2XA 3LD2A 3SHPA 2XEIA 3KR5A 3PFEA 2D4OA 4E2AA 4JLYA 4M3SA 3PBBA 3ZZIA 4A32A 4IHMA 2Z3PA 2DXQA 2GE3A 1NE9A 5ISVA 1Q2DA 2AFSA 4PQAA 3BHXA 1F2PA 2CNMA 2YNCA 4A30A 1CP7A 2ODFA 3R9FA 2DPSA 3DDDA 2P6GA 1VHEA 4KVXA 4NFRA 4UFVA 4OLLA 4A94A 3QNVA 5JPHA 2ZXVA 5HH1A 3KKWA 1XFOA 2OR4A 4II9A 3CXQA 2FS5A 4FD7A 3D68A 1VGYA 2C6PA 4F9UA 2CY2A 3TO6A 2ABZA 2BO9A 4CYPA 1H8LA 2ZW7A 3FECA 5KTCA 2CNTA 3NH4A 2J9AA 4JYWA 4MFJA 3JRUA 4MCRA 5IV0A 5K8OA 5A27A 3FIXA 3MRUA 4P4BA 2JEVA 4CGNA 6CPAA 3PEIA 4B10A 4KLVA 1Y7EA 2PRBA 4MFKA 1CG2A 1XEBA 4CAWA 2G9DA 5JQ4A 3R9GA 3GKRA 1I12A 3H5ZA 4B13A 3IEHA 2AJ6A 4PV6A 4MFLA 1X10A 2WUUA 1NSAA 3TE4A 2B3VA 1Z4EA 2ZEGA 1CPSA 2VQYA 5HVHA 3FEDA 1LRZA 4P4FA 1R57A 1Y0RA 3GY9A 4X8IA 3ZJ0A 2QECA 4B5OA 5G21A 2NSMA 2OU2A 3P2HA 4NGRA 2B4DB 3EFAA 1Z8XA 4L89A 2JDDA 4U9YA 5CBMA 4Q36A 4P45A 5EMIA 4PXCA 1B6BA 1Z2LA 2PJ4A 3TOAA 2O53A 3WC5A 3TO7A 4UIBA 3LMSA 2C1CA 4QC6A 3PB4X 2K5TA 3F0AA 4NEXA 4PSWA 3DSBA 1Y9KA 3PB9X 1LAMA 4ONWA 3EO4A 5DWNA 3D67A 3KQZA 1LFWA 4UEZA 1M1DA 3WC6A 2HUZA 5AG6A 3FYNA 1Z9UA 4MBUA 2V8HA 2ZEHA 4R9MA 4R6TA 2Z3LA 2J8MA 5F47A 3DR8A 2CF4A 2FXFA 3N7ZA 4Q7AA 2OZHA 2DPTA 4OIWA 1ARLA 2A4NA 4P4IA 3WABA 1S7LA 2OB0A 2F5IA 2RB7A 4JXQA 4P44A 4CAFA 2PR8A 1BO4A 3D7GA 3EY5A 2Q4ZA 3E0KA 1JQGA 2Q7BA 3B8GA 4CGLA 4AG7A 4MY0A 1XIXA 1KUVA 4UCMA 1Z5RA 2BOAA 1ARMA 1YVKA 4L8AA 3SJFA 3NH5A 2VZZA 4R8FA 2F7VA 8CPAA 3PB7X 1Q7LA 2ZPAA 3A9LA 2F8HA 4NSQA 2ZEPA 4RUHA 3EXNA 5LYFA 3HUVA 3NH8A 4MXUA 3IJ3A 2G3TA 2ZOGA 3BI1A 3D7FA 1IIDA 1TF8A 2POKA 2R1IA 2ZEDA 2O28A 2FE7A 3GUXA 3PBEA 4K30A 4UFWA 4MCQA 4MHNA 4KOTA 2QVPA 1RO5A
chains in the Genus database with same CATH topology
1IICA 3JTKA 4FD5A 5HH1A 1IYLA 5AGEA 1XMTA 1S5KA 4KOSA 2B5GB 3F8KA 4KVOE 1VKCA 1XE4A 4FD4A 4CAVA 3C26A 2REFA 2PC1A 3IU1A 1QSOA 2EVNA 1IB1E 4JWPA 3JUWA 4Y49B 4ZGYB 5H84A 1KZFA 4HNWB 4MFZA 5AG5A 2P6FA 2C27A 4XNHB 2VEZA 5C82A 1Y9WA 4UBRA 4UA3A 3G8WA 1P0HA 1Z4RA 3JVNA 4XPKA 2Q44A 5F49A 2BL1A 1YREA 2KCWA 3R96A 1UFHA 1N71A 2Z3MA 4YRHA 4KOWA 4E8OA 4HKFA 5AG7A 3CXPA 1PU9A 4RS2A 2FL4A 2QMLA 1CM0A 4MI4A 2WSAA 1SQHA 3QB8A 1M4DA 4A33A 2I00A 4LUAA 1BOBA 4KZTA 3FNCA 2ZW4A 5KTAA 2REEA 1MJBA 4H6ZA 5EC4A 4NF1A 2ZW5A 4A31A 4KOVA 4PK2A 2FCKA 5BWAB 3D8PA 2BEIA 4KSAA 3W6XA 3R1KA 5IX3A 4UCNA 5C88A 3S6HA 2OZUA 5AG4A 4HNXB 4UCPA 2X7BA 4JD6A 2B4BA 1I21A 1WK4A 4A2ZA 1YK3A 1S60A 4B14A 2B4DA 2D4PA 4OAEA 3QAHA 2JDCA 2OZGA 4PK3A 1KUYA 1QSTA 2Q4VA 5CNPA 4PSXA 2WPWA 4MY3A 4UWIA 4B11A 3PZJA 3TTHA 4CS0B 5I0CA 4MHDA 5A28A 4NXYA 3IU2A 4Q38A 1MJ9A 4R57A 3S6GA 5H86A 2H5MA 3V8IA 3GYAA 2CXAA 1WWZA 2R98A 3D2PA 3IWEA 4IF5A 1MJAA 2ARHA 4H6UA 1M4GA 2HV2A 1QSRA 2PSWA 5IB0A 4ZBGA 3R9EA 4CGOA 1FY7A 3IGRA 1S7FA 1YVOA 2YNCC 3SXNA 2Q04A 3FRMA 1YR0A 3IWGA 1TIQA 1RXTA 3BLNA 4M85A 2PR1A 5DWMA 4BMHA 2J8NA 4C2YA 1NSLA 2GIVA 3OWCA 2B5GA 4IUSA 4E0AA 3W6SA 4MJ8A 2ATRA 2Z0ZA 4XPLA 2VZYA 1GHEA 1S7NA 2B3UA 2AE6A 3MGDA 4CGPA 3K9UA 3TCVA 1Q2CA 4AVCA 4ORFA 5J8FA 3SXOA 2PQ8A 4KOUA 4R87A 5J8CA 4CRYB 4AVAA 1YX0A 5G22A 4U5YA 5KTDA 1YGHA 1V0CA 1ZO0A 5EBVA 2BSWA 1Y7RA 5F46A 4GS4A 2Q4YA 4B5PB 4F0XA 2QIRA 2BUEA 4X5KA 1VHSA 2NMTA 2EUIA 3P2FA 1M4IA 2R8VA 4F6AA 4MFQA 1KUXA 3UY5A 2P6EA 3FBUA 2ZW6A 4JJXA 4AG9A 1K4JA 4CGMA 4B5PA 2HQYA 2R7HA 4KOXA 4YFJA 1P4NA 4KUBA 4HNYB 4QB9A 2YNDA 4UWJA 5F48A 2RC4A 2FIWA 4B12A 3TFYA 4J3GA 4CYOA 4C7IA 2FSRA 4OADA 4LX9A 3WR7A 2GANA 1NMTA 4BBHA 4F0YA 1ON0A 2I79A 4H89A 1L0CA 3NE7A 4R3KA 1I1DA 3BJ8A 2FIAA 2Z10A 4CAXA 3VWDA 2Y0MA 4U9ZA 3I9SA 3D2MA 5HMNA 2Z11A 4KS9A 4XPDC 4DNCA 2YNEA 2VXKA 2G3AA 4FD6A 2CNSA 4KVME 3FXTA 2WPXA 1M44A 1OZPA 1S7KA 5E96A 3I3GA 3TO9A 2Z3NA 3W91A 4C2ZA 1U6MA 1S3ZA 3F5BA 3RYOA 1PUAA 4C7HA 1IYKA 3TOBA 3D3SA 4R3LA 2B58A 2G0BA 4CYQA 2IL4A 4KLWA 4KORA 3LODA 2PDOA 1XF8A 4YGOA 2OH1A 1MK4A 2FT0A 3G3SA 2P0WA 3PGPA 2VBQA 2Q0YA 4MFPA 2YGWA 4KSFA 3PP9A 4Y49C 4XPDB 2J8RA 4A95A 4AVBA 1CJWA 1QSNA 4XNHC 4UFXA 3VWEA 3H4QA 4QUSA 4KOYA 4QBJA 3BJ7A 3EC4A 3FB3A 2Z3KA 3R95A 4CYNA 5G20A 1B87A 4C68A 3DNSA 3T90A 4I49A 5GCNA 3DR6A 4CRZB 2VI7A 4NCZA 4ONUA 4JXRA 4KUAA 4AB7A 2JLMA 4RI1A 3T9YA 5FVJA 4QVTA 3S6KA 4EVYA 3TT2A 1J4JA 2Z3OA 1YLEA 1Q2YA 3CXSA 3S6FA 4CAEA 5G1ZA 4C2XA 1QSMA 3LD2A 3SHPA 4E2AA 2D4OA 4JLYA 4M3SA 3ZZIA 4A32A 2Z3PA 2DXQA 2GE3A 1NE9A 5ISVA 1Q2DA 2CNMA 2YNCA 4A30A 3R9FA 2DPSA 3DDDA 2P6GA 4KVXA 4UFVA 4OLLA 5JPHA 2ZXVA 3KKWA 4II9A 3CXQA 2FS5A 4FD7A 2CY2A 3TO6A 4CYPA 2ZW7A 5KTCA 2CNTA 4MFJA 5IV0A 5A27A 3FIXA 2JEVA 4CGNA 4B10A 4KLVA 2PRBA 4MFKA 1XEBA 4CAWA 5JQ4A 3R9GA 3GKRA 1I12A 3H5ZA 4B13A 2AJ6A 4PV6A 4MFLA 2WUUA 3TE4A 2B3VA 1Z4EA 2VQYA 1LRZA 1R57A 3GY9A 3ZJ0A 2QECA 4B5OA 5G21A 2OU2A 3P2HA 2B4DB 3EFAA 4L89A 2JDDA 4U9YA 4Q36A 3TOAA 1B6BA 3TO7A 4QC6A 2K5TA 3F0AA 4NEXA 4PSWA 3DSBA 1Y9KA 3EO4A 5DWNA 1M1DA 2HUZA 5AG6A 3FYNA 1Z9UA 4MBUA 4R9MA 2Z3LA 2J8MA 5F47A 3DR8A 2FXFA 3N7ZA 2OZHA 2DPTA 2A4NA 1S7LA 2OB0A 4JXQA 2F5IA 4CAFA 2PR8A 1BO4A 3EY5A 2Q7BA 3E0KA 3B8GA 4CGLA 4MY0A 1XIXA 1KUVA 4UCMA 1YVKA 4L8AA 2VZZA 2ZPAA 3A9LA 4NSQA 3EXNA 2G3TA 1IIDA 2R1IA 4K30A 2O28A 2FE7A 4UFWA 4AG7A 4KOTA 1RO5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B11 A;  3IWE A;  3JTK A;  4C7I A;  5AG5 A;  4CAE A;  4CYP A;  5G1Z A;  4C2X A;  4CAF A;  5AGE A;  4CGP A;  4UCN A;  4CGL A;  4BBH A;  2WSA A;  4C68 A;  5A27 A;  4UCM A;  4CGN A;  4A32 A;  4B10 A;  5AG4 A;  4CGO A;  4C2Z A;  5A28 A;  4UCP A;  4A33 A;  3IU2 A;  4A95 A;  4CGM A;  4A2Z A;  2YNC C;  4C7H A;  4B13 A;  4B14 A;  3H5Z A;  2YNC A;  4UFX A;  5AG6 A;  2WUU A;  4A30 A;  4CYQ A;  5G22 A;  3IU1 A;  4UFV A;  2YND A;  4CYN A;  4C2Y A;  4UFW A;  5G20 A;  4A31 A;  4B12 A;  2YNE A;  5G21 A;  5AG7 A;  4CYO A; 
#chains in the Genus database with same CATH topology
 1IIC A;  3JTK A;  2V8D A;  4FD5 A;  3LAC A;  1KWM A;  1YSJ A;  2IJZ A;  1BLL E;  1IYL A;  1XMT A;  5AGE A;  1S5K A;  4KOS A;  4NGS A;  4OID A;  3B3V A;  2B5G B;  3PB8 X;  3F8K A;  2PE3 A;  4KVO E;  1TXR A;  1VKC A;  4W9Y A;  2PJ9 A;  1XE4 A;  4FD4 A;  2CTB A;  4CAV A;  3C26 A;  4TNU A;  4YWY A;  3S9L A;  1YW4 A;  3IWW A;  2REF A;  3B3T A;  4PXE A;  3RAM A;  2XEF A;  2PC1 A;  1IU8 A;  3IU1 A;  1BPM A;  2EWB A;  1QSO A;  2EVN A;  1IB1 E;  3B35 A;  3JUW A;  4JWP A;  4Y49 B;  4ZGY B;  4DJL A;  1IY7 A;  5H84 A;  1KZF A;  4HNW B;  4AXV A;  1YQE A;  4FWU A;  4MFZ A;  5AG5 A;  4Z65 A;  2P6F A;  2C27 A;  4XNH B;  2VEZ A;  5C82 A;  3KHX A;  1Y9W A;  3QAY A;  4NJQ A;  3KQX A;  4PPZ A;  4UBR A;  4UA3 A;  3G8W A;  1P0H A;  1Z4R A;  3JVN A;  3KL9 A;  4GM5 A;  4XPK A;  2Q44 A;  4HPS A;  2C6G A;  5F49 A;  2BL1 A;  1YRE A;  2KCW A;  1PCA A;  1Y0Y A;  2XEJ A;  3R96 A;  1QQ9 A;  4O23 A;  5LYD A;  1ZLI A;  4DYO A;  4MCS A;  3D4U A;  5D8N A;  4R7M A;  1UFH A;  4UEE A;  1N71 A;  2Z3M A;  3CPX A;  4KOW A;  4YRH A;  1TF9 A;  4E8O A;  4HKF A;  3NA6 A;  2PJ6 A;  3VAR A;  5I4M A;  5AG7 A;  5JM6 A;  3CXP A;  3RZA A;  4TWE A;  1PU9 A;  2PJ0 A;  1HDQ A;  4NGQ A;  4RS2 A;  3IIB A;  2FL4 A;  4M6I A;  2QML A;  1CM0 A;  3B2Y A;  4MI4 A;  2WSA A;  1SQH A;  3QB8 A;  1M4D A;  3KR4 A;  2AFZ A;  4MCP A;  4A33 A;  2I00 A;  4LUA A;  1BOB A;  3ISX A;  4MHZ A;  4KZT A;  2V8G A;  4X3R A;  3FNC A;  1OBR A;  2ZW4 A;  3BI0 A;  5KTA A;  2REE A;  1MJB A;  4H6Z A;  5EC4 A;  1LOK A;  4NF1 A;  4FAI A;  2GLF A;  2FVG A;  2ZW5 A;  3CZX A;  4LQG A;  3RBU A;  2AFO A;  3D7D A;  4A31 A;  4KOV A;  3WT4 A;  4PK2 A;  2FCK A;  5LRK A;  5BWA B;  1CP6 A;  3D8P A;  2BEI A;  4KSA A;  2GRE A;  5D29 A;  5DS0 A;  2OOT A;  4CPA A;  3W6X A;  2ANP A;  1VHO A;  3R1K A;  2ZEL A;  5IX3 A;  4UCN A;  2CTC A;  2V8V A;  1ZG7 A;  5C88 A;  3S6H A;  2OZU A;  5LRG A;  4MRI A;  5AG4 A;  1ZLH A;  4HNX B;  1YME A;  4UCP A;  2PJ5 A;  1GYT A;  2X7B A;  2PIZ A;  2B4B A;  4JD6 A;  1I21 A;  1WK4 A;  4A2Z A;  1YK3 A;  1S60 A;  4B14 A;  2IMO A;  3FEE A;  3FX6 A;  2B4D A;  1A2Z A;  2D4P A;  4OAE A;  3QAH A;  2JDC A;  2OZG A;  4KSI A;  4MHY A;  4PK3 A;  1KUY A;  1QST A;  2Q4V A;  2C6C A;  5CNP A;  2WYR A;  4PSX A;  3SI0 A;  3HLP A;  3B7I A;  1FT7 A;  4WWV A;  5ELY A;  2WPW A;  5J1Q A;  4MY3 A;  4UWI A;  4B11 A;  2PJ1 A;  2Q51 A;  3PZJ A;  2I3C A;  4UEF A;  3TTH A;  3IC1 A;  4CS0 B;  1F2O A;  4F8Z A;  3ISZ A;  2ZOF A;  4NGT A;  5I0C A;  1YW6 A;  1M4L A;  2ZEM A;  4IK2 A;  4MHD A;  4M6G A;  5A28 A;  4NXY A;  3IU2 A;  4Q38 A;  4IAV A;  1MJ9 A;  2XEG A;  4R57 A;  1Z8L A;  5LYI A;  2PCU A;  3S6G A;  2GU2 A;  5H86 A;  2H5M A;  3V8I A;  4B6Z A;  3GYA A;  2CXA A;  4NJR A;  1WWZ A;  2R98 A;  3D2P A;  1LAP A;  1BAV A;  1RTQ A;  2WZN A;  3IWE A;  1HEE A;  4IF5 A;  1MJA A;  2ARH A;  1HDU A;  3SJX A;  4H6U A;  1M4G A;  2HV2 A;  1QSR A;  1CX8 A;  2PSW A;  5IB0 A;  4ZBG A;  3R9E A;  4CGO A;  1FY7 A;  1XOV A;  3IGR A;  3S9N A;  1S7F A;  1YVO A;  3D7H A;  4P10 A;  2YNC C;  3SXN A;  1DE4 C;  2Q04 A;  4GXH A;  3FRM A;  1YR0 A;  3H8E A;  1TIQ A;  3IWG A;  4DUK A;  1RXT A;  3BLN A;  4M85 A;  2PJA A;  2PR1 A;  2EK9 A;  5DWM A;  4UF4 A;  4BMH A;  3V38 A;  2J8N A;  4ZX8 A;  1X12 A;  4C2Y A;  1NSL A;  2GIV A;  2PJ2 A;  2B5G A;  3OWC A;  4IUS A;  3W6S A;  4MJ8 A;  4E0A A;  3DLJ A;  3K9T A;  3GB0 A;  2ATR A;  2PRQ A;  1CPX A;  2Z0Z A;  2JBK A;  4XPL A;  3SJG A;  3FJU A;  2VZY A;  2AFU A;  1GHE A;  1R3N A;  3L2N A;  1S7N A;  1ZG9 A;  3FVL A;  2B3U A;  2AE6 A;  3MGD A;  3N5F A;  4CGP A;  3K9U A;  1AUG A;  3TCV A;  2BCO A;  1Q2C A;  2AFW A;  4AVC A;  3H8F A;  7CPA A;  3K2K A;  2ZEN A;  5JH9 A;  4ORF A;  3KGQ A;  4PXD A;  5J8F A;  4R76 A;  3SXO A;  2PQ8 A;  1DTD A;  4KOU A;  4R87 A;  4ZY0 A;  4BIN A;  5J8C A;  4CRY B;  1ELL P;  2EK8 A;  1YX0 A;  4AVA A;  5G22 A;  3B3C A;  4U5Y A;  2DF5 A;  4YU9 A;  5IB9 A;  5KTD A;  1YGH A;  1V0C A;  1ZO0 A;  2IQ6 A;  5EBV A;  2BSW A;  2VL1 A;  1Y7R A;  4OC2 A;  5F46 A;  4GS4 A;  2Q4Y A;  4PXB A;  3TC8 A;  4B5P B;  4F0X A;  2QIR A;  3H8G A;  2BUE A;  1CBX A;  4X5K A;  1VHS A;  4MHP A;  2NMT A;  3LWU A;  1TKH A;  5CPA A;  1PYT B;  2EUI A;  4NGN A;  3WC7 A;  3P2F A;  1M4I A;  2R8V A;  4F6A A;  3PFO A;  1EE3 P;  3RO0 A;  4MFQ A;  4F9V A;  1KUX A;  3UY5 A;  2P6E A;  3FBU A;  1XBU A;  2ZW6 A;  4JJX A;  4ZYQ A;  5LYL A;  4AG9 A;  2HB6 A;  1K4J A;  1QMU A;  4CGM A;  4B5P A;  1FNO A;  2ZEE A;  3FH4 A;  4JZ0 A;  2HQY A;  2R7H A;  4KOX A;  4YFJ A;  3B3S A;  1P4N A;  4KUB A;  4EFD A;  4P4E A;  4HNY B;  4QB9 A;  2YND A;  4UWJ A;  4A37 A;  2DEA A;  5F48 A;  4LQ6 A;  2RC4 A;  2FIW A;  4B12 A;  3GLJ A;  1XRY A;  4J3G A;  4X2T A;  3TFY A;  4CYO A;  4ZI6 A;  4C7I A;  2FSR A;  2HC9 A;  2JEW A;  4OAD A;  4LX9 A;  1ZG8 A;  3PRT A;  3WR7 A;  2GAN A;  1NMT A;  4BBH A;  4EME A;  4F0Y A;  5HVF A;  1ON0 A;  2I79 A;  4ZX9 A;  3B3W A;  2PVW A;  1UWY A;  2PJB A;  1L0C A;  4H89 A;  1Z8T A;  3NE7 A;  4R3K A;  1I1D A;  3BJ8 A;  2JBJ A;  4P4J A;  2FIA A;  4MMO A;  2Z10 A;  1XMB A;  3VWD A;  4CAX A;  2Y0M A;  4U9Z A;  4BD9 A;  3I9S A;  1YLO A;  3D2M A;  5F09 A;  4M6H A;  5HVG A;  2CIJ A;  5LRJ A;  3KHZ A;  5HMN A;  2QYV A;  2Z11 A;  4KS9 A;  2NYQ A;  4XPD C;  1LAN A;  4DNC A;  2YNE A;  3NE8 A;  2VXK A;  2G3A A;  2PJ3 A;  4FD6 A;  4OC4 A;  2CNS A;  4KVM E;  2EBJ A;  4OC1 A;  3FXT A;  2WPX A;  3GIU A;  4FBE A;  1M44 A;  3IFE A;  1OZP A;  1S7K A;  5E96 A;  3I3G A;  4OKO A;  3TO9 A;  2Z3N A;  3W91 A;  4C2Z A;  1U6M A;  1S3Z A;  5THW A;  3TX8 A;  3F5B A;  3RYO A;  3SI2 A;  1PUA A;  4C7H A;  1IYK A;  4OME A;  3TOB A;  1IOF A;  3D3S A;  5K8N A;  4R3L A;  2AFM A;  2B58 A;  2G0B A;  4CYQ A;  2IL4 A;  3KI9 A;  4KLW A;  4A39 A;  4KOR A;  3LOD A;  4NGM A;  1IGB A;  4P4D A;  2PDO A;  5JGF A;  1XF8 A;  4YGO A;  2OH1 A;  1Z8W A;  1MK4 A;  1AYE A;  4H2K A;  2FT0 A;  1XJO A;  2RFH A;  3D66 A;  3G3S A;  4NGP A;  2P0W A;  3PGP A;  1TKJ A;  2VBQ A;  2O4H A;  3MN8 A;  2Q0Y A;  4MFP A;  3BXM A;  2YGW A;  4KSF A;  3I1U A;  2V77 A;  3PP9 A;  4Y49 C;  4XPD B;  4EWT A;  2J8R A;  3DGV A;  4A95 A;  4ZY1 A;  2GFQ A;  2Q7S A;  4AVB A;  1CJW A;  1QSN A;  3NFZ A;  4XNH C;  4UFX A;  3VWE A;  3H4Q A;  5HXD A;  4QUS A;  4KOY A;  3KAS A;  4QBJ A;  3BJ7 A;  1JWQ A;  3EC4 A;  3FB3 A;  2Z3K A;  3IO1 A;  4FUU A;  3R95 A;  3RNZ A;  4CYN A;  5G20 A;  2AFX A;  1AMP A;  1B87 A;  1VIX A;  4C68 A;  2GLJ A;  3DNS A;  3T90 A;  4I49 A;  5GCN A;  3DR6 A;  4CRZ B;  2EO8 A;  3FMC A;  2VI7 A;  4NCZ A;  3VH9 A;  4P6Y A;  4ONU A;  4JXR A;  4KUA A;  4AB7 A;  2ZEF A;  4G1P A;  4UIA A;  2JLM A;  4RI1 A;  3T9Y A;  5FVJ A;  3CDX A;  3SJE A;  4OC3 A;  4OP4 A;  1R43 A;  2QJ8 A;  4QVT A;  1ELM P;  3S6K A;  2PVV A;  1BPN A;  4EVY A;  4K3N A;  3PB6 X;  3CPA A;  4OC0 A;  4RN7 A;  3TT2 A;  1IOI A;  5K8M A;  5K8P A;  3CT9 A;  3S9M A;  3T8W A;  4WJB A;  4A38 A;  1J4J A;  3KZW A;  1LCP A;  2PJ8 A;  2Z3O A;  4OC5 A;  2PJC A;  1YLE A;  1Q2Y A;  2Q43 A;  3VAT A;  3CXS A;  3S6F A;  4ZY2 A;  3FF3 A;  3V7Z A;  4CAE A;  1F57 A;  1TKF A;  5G1Z A;  2ZEO A;  2PIY A;  2PJ7 A;  3SI1 A;  1QSM A;  4C2X A;  3LD2 A;  3SHP A;  2XEI A;  3KR5 A;  3PFE A;  2D4O A;  4E2A A;  4JLY A;  4M3S A;  3PBB A;  3ZZI A;  4A32 A;  4IHM A;  2Z3P A;  2DXQ A;  2GE3 A;  1NE9 A;  5ISV A;  1Q2D A;  2AFS A;  4PQA A;  3BHX A;  1F2P A;  2CNM A;  2YNC A;  4A30 A;  1CP7 A;  2ODF A;  3R9F A;  2DPS A;  3DDD A;  2P6G A;  1VHE A;  4KVX A;  4NFR A;  4UFV A;  4OLL A;  4A94 A;  3QNV A;  5JPH A;  2ZXV A;  5HH1 A;  3KKW A;  1XFO A;  2OR4 A;  4II9 A;  3CXQ A;  2FS5 A;  4FD7 A;  3D68 A;  1VGY A;  2C6P A;  4F9U A;  2CY2 A;  3TO6 A;  2ABZ A;  2BO9 A;  4CYP A;  1H8L A;  2ZW7 A;  3FEC A;  5KTC A;  2CNT A;  3NH4 A;  2J9A A;  4JYW A;  4MFJ A;  3JRU A;  4MCR A;  5IV0 A;  5K8O A;  5A27 A;  3FIX A;  3MRU A;  4P4B A;  2JEV A;  4CGN A;  6CPA A;  3PEI A;  4B10 A;  4KLV A;  1Y7E A;  2PRB A;  4MFK A;  1CG2 A;  1XEB A;  4CAW A;  2G9D A;  5JQ4 A;  3R9G A;  3GKR A;  1I12 A;  3H5Z A;  4B13 A;  3IEH A;  2AJ6 A;  4PV6 A;  4MFL A;  1X10 A;  2WUU A;  1NSA A;  3TE4 A;  2B3V A;  1Z4E A;  2ZEG A;  1CPS A;  2VQY A;  5HVH A;  3FED A;  1LRZ A;  4P4F A;  1R57 A;  1Y0R A;  3GY9 A;  4X8I A;  3ZJ0 A;  2QEC A;  4B5O A;  5G21 A;  2NSM A;  2OU2 A;  3P2H A;  4NGR A;  2B4D B;  3EFA A;  1Z8X A;  4L89 A;  2JDD A;  4U9Y A;  5CBM A;  4Q36 A;  4P45 A;  5EMI A;  4PXC A;  1B6B A;  1Z2L A;  2PJ4 A;  3TOA A;  2O53 A;  3WC5 A;  3TO7 A;  4UIB A;  3LMS A;  2C1C A;  4QC6 A;  3PB4 X;  2K5T A;  3F0A A;  4NEX A;  4PSW A;  3DSB A;  1Y9K A;  3PB9 X;  1LAM A;  4ONW A;  3EO4 A;  5DWN A;  3D67 A;  3KQZ A;  1LFW A;  4UEZ A;  1M1D A;  3WC6 A;  2HUZ A;  5AG6 A;  3FYN A;  1Z9U A;  4MBU A;  2V8H A;  2ZEH A;  4R9M A;  4R6T A;  2Z3L A;  2J8M A;  5F47 A;  3DR8 A;  2CF4 A;  2FXF A;  3N7Z A;  4Q7A A;  2OZH A;  2DPT A;  4OIW A;  1ARL A;  2A4N A;  4P4I A;  3WAB A;  1S7L A;  2OB0 A;  2F5I A;  2RB7 A;  4JXQ A;  4P44 A;  4CAF A;  2PR8 A;  1BO4 A;  3D7G A;  3EY5 A;  2Q4Z A;  3E0K A;  1JQG A;  2Q7B A;  3B8G A;  4CGL A;  4AG7 A;  4MY0 A;  1XIX A;  1KUV A;  4UCM A;  1Z5R A;  2BOA A;  1ARM A;  1YVK A;  4L8A A;  3SJF A;  3NH5 A;  2VZZ A;  4R8F A;  2F7V A;  8CPA A;  3PB7 X;  1Q7L A;  2ZPA A;  3A9L A;  2F8H A;  4NSQ A;  2ZEP A;  4RUH A;  3EXN A;  5LYF A;  3HUV A;  3NH8 A;  4MXU A;  3IJ3 A;  2G3T A;  2ZOG A;  3BI1 A;  3D7F A;  1IID A;  1TF8 A;  2POK A;  2R1I A;  2ZED A;  2O28 A;  2FE7 A;  3GUX A;  3PBE A;  4K30 A;  4UFW A;  4MCQ A;  4MHN A;  4KOT A;  2QVP A;  1RO5 A; 
#chains in the Genus database with same CATH homology
 1IIC A;  3JTK A;  4FD5 A;  5HH1 A;  1IYL A;  5AGE A;  1XMT A;  1S5K A;  4KOS A;  2B5G B;  3F8K A;  4KVO E;  1VKC A;  1XE4 A;  4FD4 A;  4CAV A;  3C26 A;  2REF A;  2PC1 A;  3IU1 A;  1QSO A;  2EVN A;  1IB1 E;  4JWP A;  3JUW A;  4Y49 B;  4ZGY B;  5H84 A;  1KZF A;  4HNW B;  4MFZ A;  5AG5 A;  2P6F A;  2C27 A;  4XNH B;  2VEZ A;  5C82 A;  1Y9W A;  4UBR A;  4UA3 A;  3G8W A;  1P0H A;  1Z4R A;  3JVN A;  4XPK A;  2Q44 A;  5F49 A;  2BL1 A;  1YRE A;  2KCW A;  3R96 A;  1UFH A;  1N71 A;  2Z3M A;  4YRH A;  4KOW A;  4E8O A;  4HKF A;  5AG7 A;  3CXP A;  1PU9 A;  4RS2 A;  2FL4 A;  2QML A;  1CM0 A;  4MI4 A;  2WSA A;  1SQH A;  3QB8 A;  1M4D A;  4A33 A;  2I00 A;  4LUA A;  1BOB A;  4KZT A;  3FNC A;  2ZW4 A;  5KTA A;  2REE A;  1MJB A;  4H6Z A;  5EC4 A;  4NF1 A;  2ZW5 A;  4A31 A;  4KOV A;  4PK2 A;  2FCK A;  5BWA B;  3D8P A;  2BEI A;  4KSA A;  3W6X A;  3R1K A;  5IX3 A;  4UCN A;  5C88 A;  3S6H A;  2OZU A;  5AG4 A;  4HNX B;  4UCP A;  2X7B A;  4JD6 A;  2B4B A;  1I21 A;  1WK4 A;  4A2Z A;  1YK3 A;  1S60 A;  4B14 A;  2B4D A;  2D4P A;  4OAE A;  3QAH A;  2JDC A;  2OZG A;  4PK3 A;  1KUY A;  1QST A;  2Q4V A;  5CNP A;  4PSX A;  2WPW A;  4MY3 A;  4UWI A;  4B11 A;  3PZJ A;  3TTH A;  4CS0 B;  5I0C A;  4MHD A;  5A28 A;  4NXY A;  3IU2 A;  4Q38 A;  1MJ9 A;  4R57 A;  3S6G A;  5H86 A;  2H5M A;  3V8I A;  3GYA A;  2CXA A;  1WWZ A;  2R98 A;  3D2P A;  3IWE A;  4IF5 A;  1MJA A;  2ARH A;  4H6U A;  1M4G A;  2HV2 A;  1QSR A;  2PSW A;  5IB0 A;  4ZBG A;  3R9E A;  4CGO A;  1FY7 A;  3IGR A;  1S7F A;  1YVO A;  2YNC C;  3SXN A;  2Q04 A;  3FRM A;  1YR0 A;  3IWG A;  1TIQ A;  1RXT A;  3BLN A;  4M85 A;  2PR1 A;  5DWM A;  4BMH A;  2J8N A;  4C2Y A;  1NSL A;  2GIV A;  3OWC A;  2B5G A;  4IUS A;  4E0A A;  3W6S A;  4MJ8 A;  2ATR A;  2Z0Z A;  4XPL A;  2VZY A;  1GHE A;  1S7N A;  2B3U A;  2AE6 A;  3MGD A;  4CGP A;  3K9U A;  3TCV A;  1Q2C A;  4AVC A;  4ORF A;  5J8F A;  3SXO A;  2PQ8 A;  4KOU A;  4R87 A;  5J8C A;  4CRY B;  4AVA A;  1YX0 A;  5G22 A;  4U5Y A;  5KTD A;  1YGH A;  1V0C A;  1ZO0 A;  5EBV A;  2BSW A;  1Y7R A;  5F46 A;  4GS4 A;  2Q4Y A;  4B5P B;  4F0X A;  2QIR A;  2BUE A;  4X5K A;  1VHS A;  2NMT A;  2EUI A;  3P2F A;  1M4I A;  2R8V A;  4F6A A;  4MFQ A;  1KUX A;  3UY5 A;  2P6E A;  3FBU A;  2ZW6 A;  4JJX A;  4AG9 A;  1K4J A;  4CGM A;  4B5P A;  2HQY A;  2R7H A;  4KOX A;  4YFJ A;  1P4N A;  4KUB A;  4HNY B;  4QB9 A;  2YND A;  4UWJ A;  5F48 A;  2RC4 A;  2FIW A;  4B12 A;  3TFY A;  4J3G A;  4CYO A;  4C7I A;  2FSR A;  4OAD A;  4LX9 A;  3WR7 A;  2GAN A;  1NMT A;  4BBH A;  4F0Y A;  1ON0 A;  2I79 A;  4H89 A;  1L0C A;  3NE7 A;  4R3K A;  1I1D A;  3BJ8 A;  2FIA A;  2Z10 A;  4CAX A;  3VWD A;  2Y0M A;  4U9Z A;  3I9S A;  3D2M A;  5HMN A;  2Z11 A;  4KS9 A;  4XPD C;  4DNC A;  2YNE A;  2VXK A;  2G3A A;  4FD6 A;  2CNS A;  4KVM E;  3FXT A;  2WPX A;  1M44 A;  1OZP A;  1S7K A;  5E96 A;  3I3G A;  3TO9 A;  2Z3N A;  3W91 A;  4C2Z A;  1U6M A;  1S3Z A;  3F5B A;  3RYO A;  1PUA A;  4C7H A;  1IYK A;  3TOB A;  3D3S A;  4R3L A;  2B58 A;  2G0B A;  4CYQ A;  2IL4 A;  4KLW A;  4KOR A;  3LOD A;  2PDO A;  1XF8 A;  4YGO A;  2OH1 A;  1MK4 A;  2FT0 A;  3G3S A;  2P0W A;  3PGP A;  2VBQ A;  2Q0Y A;  4MFP A;  2YGW A;  4KSF A;  3PP9 A;  4Y49 C;  4XPD B;  2J8R A;  4A95 A;  4AVB A;  1CJW A;  1QSN A;  4XNH C;  4UFX A;  3VWE A;  3H4Q A;  4QUS A;  4KOY A;  4QBJ A;  3BJ7 A;  3EC4 A;  3FB3 A;  2Z3K A;  3R95 A;  4CYN A;  5G20 A;  1B87 A;  4C68 A;  3DNS A;  3T90 A;  4I49 A;  5GCN A;  3DR6 A;  4CRZ B;  2VI7 A;  4NCZ A;  4ONU A;  4JXR A;  4KUA A;  4AB7 A;  2JLM A;  4RI1 A;  3T9Y A;  5FVJ A;  4QVT A;  3S6K A;  4EVY A;  3TT2 A;  1J4J A;  2Z3O A;  1YLE A;  1Q2Y A;  3CXS A;  3S6F A;  4CAE A;  5G1Z A;  4C2X A;  1QSM A;  3LD2 A;  3SHP A;  4E2A A;  2D4O A;  4JLY A;  4M3S A;  3ZZI A;  4A32 A;  2Z3P A;  2DXQ A;  2GE3 A;  1NE9 A;  5ISV A;  1Q2D A;  2CNM A;  2YNC A;  4A30 A;  3R9F A;  2DPS A;  3DDD A;  2P6G A;  4KVX A;  4UFV A;  4OLL A;  5JPH A;  2ZXV A;  3KKW A;  4II9 A;  3CXQ A;  2FS5 A;  4FD7 A;  2CY2 A;  3TO6 A;  4CYP A;  2ZW7 A;  5KTC A;  2CNT A;  4MFJ A;  5IV0 A;  5A27 A;  3FIX A;  2JEV A;  4CGN A;  4B10 A;  4KLV A;  2PRB A;  4MFK A;  1XEB A;  4CAW A;  5JQ4 A;  3R9G A;  3GKR A;  1I12 A;  3H5Z A;  4B13 A;  2AJ6 A;  4PV6 A;  4MFL A;  2WUU A;  3TE4 A;  2B3V A;  1Z4E A;  2VQY A;  1LRZ A;  1R57 A;  3GY9 A;  3ZJ0 A;  2QEC A;  4B5O A;  5G21 A;  2OU2 A;  3P2H A;  2B4D B;  3EFA A;  4L89 A;  2JDD A;  4U9Y A;  4Q36 A;  3TOA A;  1B6B A;  3TO7 A;  4QC6 A;  2K5T A;  3F0A A;  4NEX A;  4PSW A;  3DSB A;  1Y9K A;  3EO4 A;  5DWN A;  1M1D A;  2HUZ A;  5AG6 A;  3FYN A;  1Z9U A;  4MBU A;  4R9M A;  2Z3L A;  2J8M A;  5F47 A;  3DR8 A;  2FXF A;  3N7Z A;  2OZH A;  2DPT A;  2A4N A;  1S7L A;  2OB0 A;  4JXQ A;  2F5I A;  4CAF A;  2PR8 A;  1BO4 A;  3EY5 A;  2Q7B A;  3E0K A;  3B8G A;  4CGL A;  4MY0 A;  1XIX A;  1KUV A;  4UCM A;  1YVK A;  4L8A A;  2VZZ A;  2ZPA A;  3A9L A;  4NSQ A;  3EXN A;  2G3T A;  1IID A;  2R1I A;  4K30 A;  2O28 A;  2FE7 A;  4UFW A;  4AG7 A;  4KOT A;  1RO5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...