4CGPA

Leishmania major n-myristoyltransferase in complex with cofactor
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diverse Modes of Binding in Structures of Leishmania Major N-Myristoyltransferase with Selective Inhibitors
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
total genus 126
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cgpA00
4UFVA 4C7HA 2YNCC 5G22A 4B14A 4A33A 4BBHA 5AG5A 4UCPA 4A32A 2YNCA 4C7IA 5AG6A 4CAFA 4CAEA 3IWEA 4A30A 4UCMA 2YNDA 4B10A 4B12A 4CGPA 3H5ZA 4CYOA 4CYPA 4CGMA 5A27A 4C2YA 5AG7A 3IU1A 5AG4A 4CGOA 5A28A 3JTKA 4CYQA 4C2ZA 5G1ZA 4A95A 2WSAA 5G21A 4A31A 3IU2A 5AGEA 4CGLA 4UFXA 4C2XA 4CGNA 4CYNA 2WUUA 5G20A 4UCNA 4A2ZA 4UFWA 4B13A 4C68A 2YNEA 4B11A
chains in the Genus database with same CATH superfamily
4MCSA 1PU9A 3SI0A 1R57A 2PRBA 3RYOA 4UWIA 1M4LA 2PJBA 4OIWA 3JUWA 2C6GA 4A37A 4NGSA 4A39A 4NCZA 3S9LA 4OMEA 3IGRA 3IU1A 1HEEA 4FWUA 4B5OA 4RN7A 3L2NA 2ZEFA 3ZJ0A 3VWDA 4MHDA 1WK4A 1XOVA 4CYQA 4Z65A 1R3NA 4U9YA 3G3SA 4U9ZA 3W6SA 4MFPA 4I49A 4HNWB 4MFQA 4P4FA 2JLMA 4FBEA 2D4PA 2PR8A 4OC5A 1XMBA 4JXQA 2OZGA 4OKOA 3WABA 2BL1A 3H8EA 3LD2A 3W6XA 4ONWA 4UFWA 1IOFA 1MJ9A 2AFMA 1IOIA 4CGMA 4KUBA 3MRUA 2Q44A 2PDOA 4A38A 4B14A 1Q7LA 2BSWA 1AUGA 3EXNA 3B3WA 5AG5A 1XMTA 5F46A 1ZG9A 3SJFA 3F8KA 2ZW7A 3VARA 2Z3LA 4A30A 1MJAA 1UFHA 5AG7A 5F48A 4CAWA 3BJ7A 2ZW6A 1YVOA 1YGHA 3B35A 3BLNA 1IU8A 2CY2A 2CTBA 5J8CA 5IB0A 1X12A 4UIBA 4NGNA 1P0HA 2QMLA 5G21A 4QUSA 3S9MA 1CG2A 2ZEEA 1QSTA 4UEFA 2GLJA 4XNHB 3B3TA 2PJ1A 5CPAA 3F5BA 1AMPA 3TT2A 5I0CA 2ZEHA 2CTCA 4NGPA 2P6GA 4KOTA 5IB9A 4HNYB 1KWMA 5K8NA 2FS5A 3R96A 3NE7A 2Z3OA 4R87A 4R57A 4QBJA 3RO0A 2FXFA 4UCPA 1FY7A 3OWCA 4MHPA 2XEFA 5JGFA 3B8GA 3KGQA 1YW4A 1DE4C 2NSMA 4H6UA 3FMCA 4MHNA 2PRQA 3CT9A 4TNUA 4CGOA 4MCQA 3PRTA 2PIYA 5GCNA 1Q2YA 3JRUA 5G1ZA 1CBXA 1BOBA 2Q43A 4PXDA 1BPMA 2RC4A 4P6YA 4A31A 5C82A 3RZAA 4OAEA 1SQHA 2B3UA 1AYEA 3A9LA 3B3CA 4P44A 2OU2A 1I12A 1TIQA 2Z3MA 3FEEA 2Y0MA 4EWTA 1IIDA 5G20A 4KOSA 3EC4A 1QSNA 2EK9A 4M3SA 1RTQA 1XIXA 2ODFA 3KHXA 5J1QA 4P4DA 1BO4A 4MFLA 1XE4A 2V77A 1QSRA 4KVOE 5K8MA 5EBVA 1YVKA 1ELLP 4CRZB 4EMEA 1CPXA 3D67A 3H5ZA 4FD7A 2PE3A 4ZBGA 3SJXA 4ONUA 2CXAA 3PB6X 2VZYA 3LODA 2GU2A 2GANA 2REEA 2X7BA 2PJ3A 4HNXB 3PZJA 3IU2A 4MY3A 1VKCA 4NGMA 2QVPA 3S6GA 1EE3P 4MCRA 4P4JA 3SJEA 4CGNA 4KUAA 4R76A 4TWEA 2B5GB 1YLOA 3FXTA 2CF4A 4P4EA 3D66A 4WWVA 3T8WA 4UCNA 1NSLA 4JD6A 5F09A 2Q04A 2R1IA 1YQEA 5DS0A 1Y9WA 4R6TA 3VH9A 2Q7BA 1QQ9A 1M4GA 3FNCA 3H4QA 4WJBA 5DWMA 2XEGA 1H8LA 2JBKA 2GREA 2FL4A 4XPKA 5A27A 4C2YA 1GYTA 3TC8A 3R9FA 2OH1A 1GHEA 3TTHA 1LANA 1TF9A 2AFOA 3WR7A 4YFJA 4ZY0A 3D7DA 3ISXA 3D8PA 2AFUA 4FUUA 1ARMA 1S7KA 3CXPA 1KUYA 3NE8A 4QB9A 2BOAA 4OC3A 3JVNA 3WC5A 5K8PA 2WPXA 5D8NA 3S9NA 4KVME 3NH4A 2KCWA 4CPAA 4IAVA 1VHEA 2OZHA 2V8DA 4KOVA 4M6IA 4UEEA 4FD6A 4BMHA 4CYNA 2D4OA 5DWNA 2IMOA 1F57A 4OC2A 2Z10A 3KKWA 2FE7A 2VXKA 4UFVA 5IV0A 2POKA 3TO9A 3N5FA 2CNSA 2ZW5A 1TF8A 4CAXA 1CX8A 2ANPA 2B58A 1PCAA 4B10A 3IWWA 4MMOA 3ZZIA 3TOBA 3GLJA 1JQGA 3FX6A 2G0BA 4OADA 5IX3A 3PB4X 2EBJA 3EFAA 4LUAA 5JQ4A 2AFZA 1IICA 2GFQA 1X10A 2PQ8A 2R98A 2GIVA 3SI1A 4A95A 1Z8LA 3PB9X 4LX9A 4E8OA 2OB0A 2OR4A 1XF8A 5JM6A 4W9YA 2ZEOA 3D7FA 3HLPA 2V8HA 3D7HA 3D2MA 2ZEPA 3KL9A 2Z3PA 1YX0A 2ZELA 3R1KA 4NGTA 2PJ6A 4IHMA 4UEZA 4XPLA 3VATA 3DNSA 4OC4A 2Q4VA 1S7NA 1Z8XA 3N7ZA 4CYOA 8CPAA 2G3AA 4MFJA 4CGPA 3WC6A 3FB3A 1YLEA 4YU9A 4AVCA 4DJLA 2Q4YA 1ZG7A 4MFZA 2O4HA 4H2KA 1BLLE 3LACA 4NFRA 4CS0B 4ZY2A 2PJ5A 1ZLHA 5LYDA 3MN8A 3QB8A 3GUXA 3SHPA 5KTAA 1Q2DA 4F9VA 1JWQA 2QJ8A 2XEJA 4P4BA 3IEHA 3KHZA 4AVBA 2CIJA 3I9SA 2ARHA 5EC4A 2O53A 2R8VA 2PC1A 4MRIA 1Z5RA 4G1PA 1CP6A 2P6FA 1FT7A 3R95A 4KOUA 2IQ6A 4C7HA 1Z8WA 2QECA 4MI4A 3LWUA 1Z2LA 4M6GA 2GE3A 2J8MA 2I79A 2AFWA 2YNCA 3B2YA 2Z11A 3PGPA 4KSIA 5EMIA 3RBUA 2OOTA 3R9GA 4Y49B 3CXSA 5F49A 2AFXA 3W91A 2AE6A 3WC7A 2RB7A 2YGWA 1TKJA 2F7VA 2PJ7A 3H8FA 2QIRA 4MJ8A 1YK3A 2PJ0A 4UWJA 2WYRA 2B5GA 2FCKA 2J9AA 3FBUA 4RS2A 4ZY1A 5ELYA 2DF5A 3B7IA 2EVNA 1YR0A 3GYAA 5CBMA 3FVLA 5LRGA 5HMNA 3NA6A 4NGQA 1XBUA 5E96A 3RAMA 3NFZA 5FVJA 3FJUA 3F0AA 4QVTA 4B5PB 1LFWA 2PJ2A 3BI1A 4ZX9A 2A4NA 1Z4EA 4CYPA 1QSMA 3G8WA 4NJRA 4P4IA 3D4UA 4MHZA 3DR8A 4JLYA 5F47A 5THWA 1MK4A 2Q51A 2PVWA 4FD4A 2DXQA 4MHYA 2PJCA 1TKFA 3LMSA 3TO6A 4AVAA 4NXYA 1IY7A 1PUAA 1WWZA 1U6MA 1Y7EA 2JEVA 1KZFA 4YRHA 2NYQA 4YGOA 4L89A 4UF4A 1M44A 3TE4A 1M4IA 3HUVA 1M1DA 2C27A 1LCPA 4QC6A 3S6KA 4KOXA 1N71A 2J8NA 2Q7SA 2I3CA 3K9UA 4AG7A 3E0KA 1KUVA 3PBBA 4JJXA 5G22A 2PR1A 4X3RA 4R7MA 1YMEA 1ELMP 3WT4A 1Y0YA 4AG9A 1A2ZA 4P10A 2JEWA 3GKRA 3GIUA 5AG4A 2PSWA 2HC9A 2XEIA 4CAVA 3FF3A 4M85A 1I1DA 2WPWA 4KLWA 4F8ZA 3FECA 1NSAA 1Y9KA 2WZNA 4JYWA 4ZYQA 1IYKA 1CJWA 3BXMA 3QAHA 4H89A 3GY9A 4IUSA 4HPSA 4DUKA 4E2AA 4BD9A 4KSAA 3B3SA 4UA3A 4UFXA 4C2XA 2HUZA 1L0CA 3IFEA 4KORA 5KTDA 1S60A 4MBUA 5I4MA 1Y7RA 4A94A 1K4JA 3DGVA 3QNVA 4GS4A 3CPAA 3KQZA 1J4JA 2G3TA 2O28A 4Y49C 3NH5A 1HDUA 3FH4A 4UCMA 1HDQA 4R9MA 1BPNA 1S7FA 2C6CA 2P6EA 3DSBA 2Z3NA 1R43A 2HQYA 2FSRA 4IF5A 3JTKA 1S3ZA 1IB1E 3I1UA 3D3SA 1VIXA 2WSAA 3IWGA 3P2FA 1LAMA 4L8AA 4OP4A 1OZPA 4U5YA 3GB0A 4F9UA 2PJAA 2ZPAA 4PSXA 1YREA 4NGRA 5C88A 5HVHA 4FD5A 2DEAA 4PK2A 4B13A 2VI7A 1XEBA 2F8HA 2HV2A 3FIXA 3PBEA 4A33A 2DPSA 4GM5A 5AG6A 3BHXA 1QSOA 4CAEA 2JDCA 1CP7A 3D68A 5LRKA 5H86A 4AB7A 3S6FA 2PIZA 5LYFA 4JZ0A 3PB8X 5ISVA 1IGBA 2EWBA 1FNOA 3K9TA 2RFHA 3IO1A 3PEIA 3QAYA 4E0AA 3V38A 3PFEA 1LAPA 2PJ9A 2ZOFA 3V7ZA 4AXVA 1Y0RA 2ZENA 5LYIA 1KUXA 3FRMA 4P45A 2G9DA 2J8RA 3D7GA 4MXUA 5K8OA 5AGEA 3I3GA 4GXHA 3T9YA 1V0CA 5BWAB 2FT0A 1VHOA 3D2PA 2BO9A 4XPDC 4H6ZA 4J3GA 4PQAA 4C2ZA 4PSWA 2K5TA 3BI0A 2NMTA 2YNCC 3DR6A 3TX8A 4BBHA 4OIDA 1XFOA 1UWYA 2PCUA 4KLVA 2C1CA 2R7HA 3NH8A 1B6BA 4KS9A 5LRJA 4FAIA 2YNDA 3RNZA 1Q2CA 1TXRA 2ZW4A 4B6ZA 3KI9A 1QMUA 4LQGA 4R3KA 2V8VA 1TKHA 2ZEGA 3TOAA 4MFKA 5A28A 5HVGA 2OZUA 1P4NA 4KOWA 4NSQA 4UBRA 3CXQA 2H5MA 3T90A 4DNCA 4EVYA 4RUHA 2AFSA 1XRYA 2Z0ZA 2B4DB 1Z9UA 4II9A 3C26A 1S5KA 2IJZA 3EY5A 3KZWA 4PV6A 4PXEA 2ZXVA 4M6HA 4PXBA 1RO5A 4A2ZA 4PK3A 3P2HA 4NJQA 2QYVA 4C68A 3VWEA 1CPSA 2Q0YA 4B5PA 2ZEDA 2VQYA 3TO7A 2VZZA 4Q38A 4C7IA 5KTCA 4OC1A 3IWEA 4K3NA 4B12A 4DYOA 3MGDA 2B4DA 2BEIA 4PPZA 1CM0A 4KVXA 4KOYA 3K2KA 3IC1A 4ZX8A 2B4BA 2P0WA 2FIAA 2CNTA 2ZOGA 4OLLA 3TFYA 1LRZA 4ORFA 1F2OA 2REFA 3KR5A 1OBRA 1VGYA 4K30A 2Z3KA 4NF1A 4HKFA 4MCPA 1NMTA 4CRYB 5JH9A 1ZLIA 1LOKA 3DLJA 2JDDA 2AJ6A 2EO8A 2EUIA 2WUUA 4EFDA 2B3VA 1S7LA 4F0YA 5LYLA 2ZEMA 1MJBA 3IIBA 2YNEA 4NEXA 2GLFA 3PB7X 2FVGA 2V8GA 2IL4A 4A32A 4ZGYB 5HVFA 3SXNA 3V8IA 2VBQA 1B87A 2EK8A 5HXDA 5H84A 2BCOA 1F2PA 5JPHA 3KR4A 2VL1A 2DPTA 3H8GA 3S6HA 4YWYA 4ZI6A 4Q36A 2JBJA 2ABZA 3EO4A 3KASA 4Q7AA 1BAVA 1ARLA 1Z4RA 2BUEA 1RXTA 2FIWA 3ISZA 3SJGA 1ZO0A 2CNMA 3FYNA 2PJ8A 4BINA 4CGLA 3PFOA 4XPDB 1IYLA 4X8IA 1I21A 1PYTB 4F0XA 1VHSA 2PJ4A 4X2TA 4RI1A 4XNHC 2I00A 4CAFA 4F6AA 1ON0A 1YW6A 4B11A 4IK2A 3CZXA 3KQXA 4JWPA 3B3VA 4O23A 4R8FA 4UIAA 1XJOA 3SI2A 4R3LA 5CNPA 7CPAA 4JXRA 5HH1A 1NE9A 3R9EA 3CPXA 3PP9A 3IJ3A 2VEZA 1Z8TA 3SXOA 3FEDA 4KZTA 3CDXA 4KSFA 4LQ6A 5J8FA 1YSJA 5D29A 3DDDA 3BJ8A 4MY0A 2HB6A 1DTDA 2F5IA 1M4DA 4X5KA 6CPAA 2C6PA 2Q4ZA 3UY5A 2PVVA 4OC0A 3TCVA 1ZG8A 4PXCA 2ATRA
chains in the Genus database with same CATH topology
1PU9A 1R57A 2PRBA 3RYOA 4UWIA 3JUWA 4NCZA 3IGRA 3IU1A 4B5OA 3ZJ0A 3VWDA 4MHDA 1WK4A 4CYQA 4U9YA 3G3SA 4U9ZA 3W6SA 4MFPA 4I49A 4HNWB 4MFQA 2JLMA 2D4PA 2PR8A 4JXQA 2OZGA 2BL1A 3LD2A 3W6XA 4UFWA 4CGMA 1MJ9A 4KUBA 2Q44A 2PDOA 4B14A 2BSWA 3EXNA 5AG5A 1XMTA 5F46A 3F8KA 2ZW7A 4A30A 2Z3LA 1MJAA 1UFHA 5AG7A 5F48A 4CAWA 3BJ7A 2ZW6A 1YVOA 1YGHA 3BLNA 2CY2A 5J8CA 5IB0A 1P0HA 2QMLA 5G21A 4QUSA 1QSTA 4XNHB 3TT2A 3F5BA 5I0CA 2P6GA 4KOTA 4HNYB 2FS5A 3R96A 3NE7A 2Z3OA 4R87A 4R57A 4QBJA 2FXFA 4UCPA 1FY7A 3OWCA 3B8GA 4H6UA 4CGOA 5GCNA 1Q2YA 5G1ZA 1BOBA 4A31A 2RC4A 5C82A 4OAEA 1SQHA 2B3UA 3A9LA 2OU2A 1I12A 1TIQA 2Z3MA 2Y0MA 1IIDA 5G20A 4KOSA 3EC4A 1QSNA 4M3SA 1XIXA 1BO4A 4MFLA 1XE4A 4KVOE 1QSRA 5EBVA 1YVKA 4CRZB 4FD7A 3H5ZA 4ZBGA 4ONUA 2CXAA 2VZYA 3LODA 2GANA 2REEA 2X7BA 4HNXB 3PZJA 3IU2A 4MY3A 1VKCA 3S6GA 4CGNA 4KUAA 2B5GB 3FXTA 4UCNA 1NSLA 4JD6A 2Q04A 2R1IA 1Y9WA 2Q7BA 1M4GA 3FNCA 3H4QA 5DWMA 5A27A 2FL4A 4XPKA 4C2YA 3R9FA 2OH1A 1GHEA 3TTHA 3WR7A 4YFJA 3D8PA 4QB9A 4AG7A 1S7KA 3CXPA 1KUYA 3JVNA 2WPXA 4KVME 2KCWA 2OZHA 4CYNA 4KOVA 4FD6A 4BMHA 2D4OA 5DWNA 2Z10A 3KKWA 2FE7A 2VXKA 4UFVA 5IV0A 3TO9A 2CNSA 2ZW5A 4CAXA 2B58A 4B10A 3ZZIA 3TOBA 2G0BA 4OADA 5IX3A 4LUAA 3EFAA 5JQ4A 1IICA 2PQ8A 2R98A 2GIVA 4A95A 4LX9A 4E8OA 2OB0A 1XF8A 3D2MA 2Z3PA 1YX0A 3R1KA 4XPLA 3DNSA 2Q4VA 1S7NA 3N7ZA 4CYOA 2G3AA 4MFJA 4CGPA 3FB3A 1YLEA 4AVCA 2Q4YA 4MFZA 4CS0B 3QB8A 3SHPA 5KTAA 1Q2DA 4AVBA 3I9SA 2ARHA 5EC4A 2R8VA 2PC1A 2P6FA 3R95A 4KOUA 4C7HA 2QECA 4MI4A 2GE3A 2J8MA 2I79A 2YNCA 3PGPA 2Z11A 3R9GA 4Y49B 3CXSA 5F49A 3W91A 2AE6A 2YGWA 2QIRA 4MJ8A 1YK3A 4UWJA 2B5GA 2FCKA 3FBUA 4RS2A 2EVNA 1YR0A 3GYAA 5HMNA 5E96A 5FVJA 3F0AA 4QVTA 4B5PB 2A4NA 1Z4EA 4CYPA 1QSMA 3G8WA 3DR8A 4JLYA 5F47A 1MK4A 4FD4A 2DXQA 3TO6A 4AVAA 4NXYA 1PUAA 1WWZA 1U6MA 2JEVA 1KZFA 4YRHA 4YGOA 4L89A 1M44A 3TE4A 1M4IA 1M1DA 2C27A 4QC6A 3S6KA 4KOXA 1N71A 2J8NA 3K9UA 3E0KA 1KUVA 4JJXA 5G22A 2PR1A 4AG9A 3GKRA 5AG4A 2PSWA 4CAVA 4M85A 1I1DA 2WPWA 4KLWA 1Y9KA 1IYKA 1CJWA 3QAHA 4IUSA 4H89A 3GY9A 4E2AA 4KSAA 4UA3A 4UFXA 4C2XA 2HUZA 1L0CA 4KORA 5KTDA 1S60A 4MBUA 1Y7RA 1K4JA 4GS4A 1J4JA 2G3TA 2O28A 4Y49C 4UCMA 4R9MA 1S7FA 2P6EA 3DSBA 2Z3NA 2HQYA 2FSRA 4IF5A 3JTKA 1S3ZA 1IB1E 3D3SA 2WSAA 3IWGA 3P2FA 4L8AA 1OZPA 4U5YA 2ZPAA 4PSXA 1YREA 5C88A 4FD5A 4PK2A 4B13A 2VI7A 1XEBA 2HV2A 3FIXA 4A33A 2DPSA 5AG6A 4CAEA 1QSOA 2JDCA 5H86A 4AB7A 3S6FA 5ISVA 4E0AA 1KUXA 3FRMA 2J8RA 5AGEA 3I3GA 3T9YA 1V0CA 5BWAB 2FT0A 3D2PA 4XPDC 4H6ZA 4J3GA 4C2ZA 4PSWA 2K5TA 2NMTA 2YNCC 3DR6A 4BBHA 4KS9A 4KLVA 2R7HA 1B6BA 2YNDA 1Q2CA 2ZW4A 4R3KA 3TOAA 4MFKA 5A28A 2OZUA 1P4NA 4KOWA 4NSQA 4UBRA 3CXQA 2H5MA 3T90A 4DNCA 4EVYA 2Z0ZA 2B4DB 1Z9UA 4II9A 3C26A 1S5KA 3EY5A 4PV6A 2ZXVA 4A2ZA 1RO5A 4PK3A 3P2HA 4C68A 3VWEA 4B5PA 2Q0YA 2VQYA 3TO7A 2VZZA 4Q38A 4C7IA 5KTCA 3IWEA 4B12A 3MGDA 2B4DA 2BEIA 1CM0A 4KVXA 4KOYA 2B4BA 2P0WA 2FIAA 2CNTA 4OLLA 3TFYA 1LRZA 4ORFA 2REFA 4K30A 2Z3KA 4NF1A 4HKFA 1NMTA 4CRYB 2JDDA 2AJ6A 2EUIA 2WUUA 4F0YA 2B3VA 1S7LA 1MJBA 2YNEA 4NEXA 4A32A 2IL4A 4ZGYB 3SXNA 3V8IA 2VBQA 1B87A 5H84A 5JPHA 2DPTA 3S6HA 4Q36A 3EO4A 1Z4RA 2BUEA 1RXTA 2FIWA 1ZO0A 2CNMA 3FYNA 4CGLA 4XPDB 1IYLA 1I21A 4F0XA 1VHSA 4XNHC 4RI1A 2I00A 4CAFA 4F6AA 1ON0A 4B11A 4JWPA 4R3LA 5CNPA 4JXRA 5HH1A 1NE9A 3R9EA 3PP9A 2VEZA 3SXOA 4KZTA 4KSFA 5J8FA 3DDDA 3BJ8A 4MY0A 2F5IA 1M4DA 4X5KA 3UY5A 3TCVA 2ATRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UFV A;  4C7H A;  2YNC C;  5G22 A;  4B14 A;  4A33 A;  4BBH A;  5AG5 A;  4UCP A;  4A32 A;  2YNC A;  4C7I A;  5AG6 A;  4CAF A;  4CAE A;  3IWE A;  4A30 A;  4UCM A;  2YND A;  4B10 A;  4B12 A;  4CGP A;  3H5Z A;  4CYO A;  4CYP A;  4CGM A;  5A27 A;  4C2Y A;  5AG7 A;  3IU1 A;  5AG4 A;  4CGO A;  5A28 A;  3JTK A;  4CYQ A;  4C2Z A;  5G1Z A;  4A95 A;  2WSA A;  5G21 A;  4A31 A;  3IU2 A;  5AGE A;  4CGL A;  4UFX A;  4C2X A;  4CGN A;  4CYN A;  2WUU A;  5G20 A;  4UCN A;  4A2Z A;  4UFW A;  4B13 A;  4C68 A;  2YNE A;  4B11 A; 
#chains in the Genus database with same CATH topology
 4MCS A;  1PU9 A;  3SI0 A;  1R57 A;  2PRB A;  3RYO A;  4UWI A;  1M4L A;  2PJB A;  4OIW A;  3JUW A;  2C6G A;  4A37 A;  4NGS A;  4A39 A;  4NCZ A;  3S9L A;  4OME A;  3IGR A;  3IU1 A;  1HEE A;  4FWU A;  4B5O A;  4RN7 A;  3L2N A;  2ZEF A;  3ZJ0 A;  3VWD A;  4MHD A;  1WK4 A;  1XOV A;  4CYQ A;  4Z65 A;  1R3N A;  4U9Y A;  3G3S A;  4U9Z A;  3W6S A;  4MFP A;  4I49 A;  4HNW B;  4MFQ A;  4P4F A;  2JLM A;  4FBE A;  2D4P A;  2PR8 A;  4OC5 A;  1XMB A;  4JXQ A;  2OZG A;  4OKO A;  3WAB A;  2BL1 A;  3H8E A;  3LD2 A;  3W6X A;  4ONW A;  4UFW A;  1IOF A;  1MJ9 A;  2AFM A;  1IOI A;  4CGM A;  4KUB A;  3MRU A;  2Q44 A;  2PDO A;  4A38 A;  4B14 A;  1Q7L A;  2BSW A;  1AUG A;  3EXN A;  3B3W A;  5AG5 A;  1XMT A;  5F46 A;  1ZG9 A;  3SJF A;  3F8K A;  2ZW7 A;  3VAR A;  2Z3L A;  4A30 A;  1MJA A;  1UFH A;  5AG7 A;  5F48 A;  4CAW A;  3BJ7 A;  2ZW6 A;  1YVO A;  1YGH A;  3B35 A;  3BLN A;  1IU8 A;  2CY2 A;  2CTB A;  5J8C A;  5IB0 A;  1X12 A;  4UIB A;  4NGN A;  1P0H A;  2QML A;  5G21 A;  4QUS A;  3S9M A;  1CG2 A;  2ZEE A;  1QST A;  4UEF A;  2GLJ A;  4XNH B;  3B3T A;  2PJ1 A;  5CPA A;  3F5B A;  1AMP A;  3TT2 A;  5I0C A;  2ZEH A;  2CTC A;  4NGP A;  2P6G A;  4KOT A;  5IB9 A;  4HNY B;  1KWM A;  5K8N A;  2FS5 A;  3R96 A;  3NE7 A;  2Z3O A;  4R87 A;  4R57 A;  4QBJ A;  3RO0 A;  2FXF A;  4UCP A;  1FY7 A;  3OWC A;  4MHP A;  2XEF A;  5JGF A;  3B8G A;  3KGQ A;  1YW4 A;  1DE4 C;  2NSM A;  4H6U A;  3FMC A;  4MHN A;  2PRQ A;  3CT9 A;  4TNU A;  4CGO A;  4MCQ A;  3PRT A;  2PIY A;  5GCN A;  1Q2Y A;  3JRU A;  5G1Z A;  1CBX A;  1BOB A;  2Q43 A;  4PXD A;  1BPM A;  2RC4 A;  4P6Y A;  4A31 A;  5C82 A;  3RZA A;  4OAE A;  1SQH A;  2B3U A;  1AYE A;  3A9L A;  3B3C A;  4P44 A;  2OU2 A;  1I12 A;  1TIQ A;  2Z3M A;  3FEE A;  2Y0M A;  4EWT A;  1IID A;  5G20 A;  4KOS A;  3EC4 A;  1QSN A;  2EK9 A;  4M3S A;  1RTQ A;  1XIX A;  2ODF A;  3KHX A;  5J1Q A;  4P4D A;  1BO4 A;  4MFL A;  1XE4 A;  2V77 A;  1QSR A;  4KVO E;  5K8M A;  5EBV A;  1YVK A;  1ELL P;  4CRZ B;  4EME A;  1CPX A;  3D67 A;  3H5Z A;  4FD7 A;  2PE3 A;  4ZBG A;  3SJX A;  4ONU A;  2CXA A;  3PB6 X;  2VZY A;  3LOD A;  2GU2 A;  2GAN A;  2REE A;  2X7B A;  2PJ3 A;  4HNX B;  3PZJ A;  3IU2 A;  4MY3 A;  1VKC A;  4NGM A;  2QVP A;  3S6G A;  1EE3 P;  4MCR A;  4P4J A;  3SJE A;  4CGN A;  4KUA A;  4R76 A;  4TWE A;  2B5G B;  1YLO A;  3FXT A;  2CF4 A;  4P4E A;  3D66 A;  4WWV A;  3T8W A;  4UCN A;  1NSL A;  4JD6 A;  5F09 A;  2Q04 A;  2R1I A;  1YQE A;  5DS0 A;  1Y9W A;  4R6T A;  3VH9 A;  2Q7B A;  1QQ9 A;  1M4G A;  3FNC A;  3H4Q A;  4WJB A;  5DWM A;  2XEG A;  1H8L A;  2JBK A;  2GRE A;  2FL4 A;  4XPK A;  5A27 A;  4C2Y A;  1GYT A;  3TC8 A;  3R9F A;  2OH1 A;  1GHE A;  3TTH A;  1LAN A;  1TF9 A;  2AFO A;  3WR7 A;  4YFJ A;  4ZY0 A;  3D7D A;  3ISX A;  3D8P A;  2AFU A;  4FUU A;  1ARM A;  1S7K A;  3CXP A;  1KUY A;  3NE8 A;  4QB9 A;  2BOA A;  4OC3 A;  3JVN A;  3WC5 A;  5K8P A;  2WPX A;  5D8N A;  3S9N A;  4KVM E;  3NH4 A;  2KCW A;  4CPA A;  4IAV A;  1VHE A;  2OZH A;  2V8D A;  4KOV A;  4M6I A;  4UEE A;  4FD6 A;  4BMH A;  4CYN A;  2D4O A;  5DWN A;  2IMO A;  1F57 A;  4OC2 A;  2Z10 A;  3KKW A;  2FE7 A;  2VXK A;  4UFV A;  5IV0 A;  2POK A;  3TO9 A;  3N5F A;  2CNS A;  2ZW5 A;  1TF8 A;  4CAX A;  1CX8 A;  2ANP A;  2B58 A;  1PCA A;  4B10 A;  3IWW A;  4MMO A;  3ZZI A;  3TOB A;  3GLJ A;  1JQG A;  3FX6 A;  2G0B A;  4OAD A;  5IX3 A;  3PB4 X;  2EBJ A;  3EFA A;  4LUA A;  5JQ4 A;  2AFZ A;  1IIC A;  2GFQ A;  1X10 A;  2PQ8 A;  2R98 A;  2GIV A;  3SI1 A;  4A95 A;  1Z8L A;  3PB9 X;  4LX9 A;  4E8O A;  2OB0 A;  2OR4 A;  1XF8 A;  5JM6 A;  4W9Y A;  2ZEO A;  3D7F A;  3HLP A;  2V8H A;  3D7H A;  3D2M A;  2ZEP A;  3KL9 A;  2Z3P A;  1YX0 A;  2ZEL A;  3R1K A;  4NGT A;  2PJ6 A;  4IHM A;  4UEZ A;  4XPL A;  3VAT A;  3DNS A;  4OC4 A;  2Q4V A;  1S7N A;  1Z8X A;  3N7Z A;  4CYO A;  8CPA A;  2G3A A;  4MFJ A;  4CGP A;  3WC6 A;  3FB3 A;  1YLE A;  4YU9 A;  4AVC A;  4DJL A;  2Q4Y A;  1ZG7 A;  4MFZ A;  2O4H A;  4H2K A;  1BLL E;  3LAC A;  4NFR A;  4CS0 B;  4ZY2 A;  2PJ5 A;  1ZLH A;  5LYD A;  3MN8 A;  3QB8 A;  3GUX A;  3SHP A;  5KTA A;  1Q2D A;  4F9V A;  1JWQ A;  2QJ8 A;  2XEJ A;  4P4B A;  3IEH A;  3KHZ A;  4AVB A;  2CIJ A;  3I9S A;  2ARH A;  5EC4 A;  2O53 A;  2R8V A;  2PC1 A;  4MRI A;  1Z5R A;  4G1P A;  1CP6 A;  2P6F A;  1FT7 A;  3R95 A;  4KOU A;  2IQ6 A;  4C7H A;  1Z8W A;  2QEC A;  4MI4 A;  3LWU A;  1Z2L A;  4M6G A;  2GE3 A;  2J8M A;  2I79 A;  2AFW A;  2YNC A;  3B2Y A;  2Z11 A;  3PGP A;  4KSI A;  5EMI A;  3RBU A;  2OOT A;  3R9G A;  4Y49 B;  3CXS A;  5F49 A;  2AFX A;  3W91 A;  2AE6 A;  3WC7 A;  2RB7 A;  2YGW A;  1TKJ A;  2F7V A;  2PJ7 A;  3H8F A;  2QIR A;  4MJ8 A;  1YK3 A;  2PJ0 A;  4UWJ A;  2WYR A;  2B5G A;  2FCK A;  2J9A A;  3FBU A;  4RS2 A;  4ZY1 A;  5ELY A;  2DF5 A;  3B7I A;  2EVN A;  1YR0 A;  3GYA A;  5CBM A;  3FVL A;  5LRG A;  5HMN A;  3NA6 A;  4NGQ A;  1XBU A;  5E96 A;  3RAM A;  3NFZ A;  5FVJ A;  3FJU A;  3F0A A;  4QVT A;  4B5P B;  1LFW A;  2PJ2 A;  3BI1 A;  4ZX9 A;  2A4N A;  1Z4E A;  4CYP A;  1QSM A;  3G8W A;  4NJR A;  4P4I A;  3D4U A;  4MHZ A;  3DR8 A;  4JLY A;  5F47 A;  5THW A;  1MK4 A;  2Q51 A;  2PVW A;  4FD4 A;  2DXQ A;  4MHY A;  2PJC A;  1TKF A;  3LMS A;  3TO6 A;  4AVA A;  4NXY A;  1IY7 A;  1PUA A;  1WWZ A;  1U6M A;  1Y7E A;  2JEV A;  1KZF A;  4YRH A;  2NYQ A;  4YGO A;  4L89 A;  4UF4 A;  1M44 A;  3TE4 A;  1M4I A;  3HUV A;  1M1D A;  2C27 A;  1LCP A;  4QC6 A;  3S6K A;  4KOX A;  1N71 A;  2J8N A;  2Q7S A;  2I3C A;  3K9U A;  4AG7 A;  3E0K A;  1KUV A;  3PBB A;  4JJX A;  5G22 A;  2PR1 A;  4X3R A;  4R7M A;  1YME A;  1ELM P;  3WT4 A;  1Y0Y A;  4AG9 A;  1A2Z A;  4P10 A;  2JEW A;  3GKR A;  3GIU A;  5AG4 A;  2PSW A;  2HC9 A;  2XEI A;  4CAV A;  3FF3 A;  4M85 A;  1I1D A;  2WPW A;  4KLW A;  4F8Z A;  3FEC A;  1NSA A;  1Y9K A;  2WZN A;  4JYW A;  4ZYQ A;  1IYK A;  1CJW A;  3BXM A;  3QAH A;  4H89 A;  3GY9 A;  4IUS A;  4HPS A;  4DUK A;  4E2A A;  4BD9 A;  4KSA A;  3B3S A;  4UA3 A;  4UFX A;  4C2X A;  2HUZ A;  1L0C A;  3IFE A;  4KOR A;  5KTD A;  1S60 A;  4MBU A;  5I4M A;  1Y7R A;  4A94 A;  1K4J A;  3DGV A;  3QNV A;  4GS4 A;  3CPA A;  3KQZ A;  1J4J A;  2G3T A;  2O28 A;  4Y49 C;  3NH5 A;  1HDU A;  3FH4 A;  4UCM A;  1HDQ A;  4R9M A;  1BPN A;  1S7F A;  2C6C A;  2P6E A;  3DSB A;  2Z3N A;  1R43 A;  2HQY A;  2FSR A;  4IF5 A;  3JTK A;  1S3Z A;  1IB1 E;  3I1U A;  3D3S A;  1VIX A;  2WSA A;  3IWG A;  3P2F A;  1LAM A;  4L8A A;  4OP4 A;  1OZP A;  4U5Y A;  3GB0 A;  4F9U A;  2PJA A;  2ZPA A;  4PSX A;  1YRE A;  4NGR A;  5C88 A;  5HVH A;  4FD5 A;  2DEA A;  4PK2 A;  4B13 A;  2VI7 A;  1XEB A;  2F8H A;  2HV2 A;  3FIX A;  3PBE A;  4A33 A;  2DPS A;  4GM5 A;  5AG6 A;  3BHX A;  1QSO A;  4CAE A;  2JDC A;  1CP7 A;  3D68 A;  5LRK A;  5H86 A;  4AB7 A;  3S6F A;  2PIZ A;  5LYF A;  4JZ0 A;  3PB8 X;  5ISV A;  1IGB A;  2EWB A;  1FNO A;  3K9T A;  2RFH A;  3IO1 A;  3PEI A;  3QAY A;  4E0A A;  3V38 A;  3PFE A;  1LAP A;  2PJ9 A;  2ZOF A;  3V7Z A;  4AXV A;  1Y0R A;  2ZEN A;  5LYI A;  1KUX A;  3FRM A;  4P45 A;  2G9D A;  2J8R A;  3D7G A;  4MXU A;  5K8O A;  5AGE A;  3I3G A;  4GXH A;  3T9Y A;  1V0C A;  5BWA B;  2FT0 A;  1VHO A;  3D2P A;  2BO9 A;  4XPD C;  4H6Z A;  4J3G A;  4PQA A;  4C2Z A;  4PSW A;  2K5T A;  3BI0 A;  2NMT A;  2YNC C;  3DR6 A;  3TX8 A;  4BBH A;  4OID A;  1XFO A;  1UWY A;  2PCU A;  4KLV A;  2C1C A;  2R7H A;  3NH8 A;  1B6B A;  4KS9 A;  5LRJ A;  4FAI A;  2YND A;  3RNZ A;  1Q2C A;  1TXR A;  2ZW4 A;  4B6Z A;  3KI9 A;  1QMU A;  4LQG A;  4R3K A;  2V8V A;  1TKH A;  2ZEG A;  3TOA A;  4MFK A;  5A28 A;  5HVG A;  2OZU A;  1P4N A;  4KOW A;  4NSQ A;  4UBR A;  3CXQ A;  2H5M A;  3T90 A;  4DNC A;  4EVY A;  4RUH A;  2AFS A;  1XRY A;  2Z0Z A;  2B4D B;  1Z9U A;  4II9 A;  3C26 A;  1S5K A;  2IJZ A;  3EY5 A;  3KZW A;  4PV6 A;  4PXE A;  2ZXV A;  4M6H A;  4PXB A;  1RO5 A;  4A2Z A;  4PK3 A;  3P2H A;  4NJQ A;  2QYV A;  4C68 A;  3VWE A;  1CPS A;  2Q0Y A;  4B5P A;  2ZED A;  2VQY A;  3TO7 A;  2VZZ A;  4Q38 A;  4C7I A;  5KTC A;  4OC1 A;  3IWE A;  4K3N A;  4B12 A;  4DYO A;  3MGD A;  2B4D A;  2BEI A;  4PPZ A;  1CM0 A;  4KVX A;  4KOY A;  3K2K A;  3IC1 A;  4ZX8 A;  2B4B A;  2P0W A;  2FIA A;  2CNT A;  2ZOG A;  4OLL A;  3TFY A;  1LRZ A;  4ORF A;  1F2O A;  2REF A;  3KR5 A;  1OBR A;  1VGY A;  4K30 A;  2Z3K A;  4NF1 A;  4HKF A;  4MCP A;  1NMT A;  4CRY B;  5JH9 A;  1ZLI A;  1LOK A;  3DLJ A;  2JDD A;  2AJ6 A;  2EO8 A;  2EUI A;  2WUU A;  4EFD A;  2B3V A;  1S7L A;  4F0Y A;  5LYL A;  2ZEM A;  1MJB A;  3IIB A;  2YNE A;  4NEX A;  2GLF A;  3PB7 X;  2FVG A;  2V8G A;  2IL4 A;  4A32 A;  4ZGY B;  5HVF A;  3SXN A;  3V8I A;  2VBQ A;  1B87 A;  2EK8 A;  5HXD A;  5H84 A;  2BCO A;  1F2P A;  5JPH A;  3KR4 A;  2VL1 A;  2DPT A;  3H8G A;  3S6H A;  4YWY A;  4ZI6 A;  4Q36 A;  2JBJ A;  2ABZ A;  3EO4 A;  3KAS A;  4Q7A A;  1BAV A;  1ARL A;  1Z4R A;  2BUE A;  1RXT A;  2FIW A;  3ISZ A;  3SJG A;  1ZO0 A;  2CNM A;  3FYN A;  2PJ8 A;  4BIN A;  4CGL A;  3PFO A;  4XPD B;  1IYL A;  4X8I A;  1I21 A;  1PYT B;  4F0X A;  1VHS A;  2PJ4 A;  4X2T A;  4RI1 A;  4XNH C;  2I00 A;  4CAF A;  4F6A A;  1ON0 A;  1YW6 A;  4B11 A;  4IK2 A;  3CZX A;  3KQX A;  4JWP A;  3B3V A;  4O23 A;  4R8F A;  4UIA A;  1XJO A;  3SI2 A;  4R3L A;  5CNP A;  7CPA A;  4JXR A;  5HH1 A;  1NE9 A;  3R9E A;  3CPX A;  3PP9 A;  3IJ3 A;  2VEZ A;  1Z8T A;  3SXO A;  3FED A;  4KZT A;  3CDX A;  4KSF A;  4LQ6 A;  5J8F A;  1YSJ A;  5D29 A;  3DDD A;  3BJ8 A;  4MY0 A;  2HB6 A;  1DTD A;  2F5I A;  1M4D A;  4X5K A;  6CPA A;  2C6P A;  2Q4Z A;  3UY5 A;  2PVV A;  4OC0 A;  3TCV A;  1ZG8 A;  4PXC A;  2ATR A; 
#chains in the Genus database with same CATH homology
 1PU9 A;  1R57 A;  2PRB A;  3RYO A;  4UWI A;  3JUW A;  4NCZ A;  3IGR A;  3IU1 A;  4B5O A;  3ZJ0 A;  3VWD A;  4MHD A;  1WK4 A;  4CYQ A;  4U9Y A;  3G3S A;  4U9Z A;  3W6S A;  4MFP A;  4I49 A;  4HNW B;  4MFQ A;  2JLM A;  2D4P A;  2PR8 A;  4JXQ A;  2OZG A;  2BL1 A;  3LD2 A;  3W6X A;  4UFW A;  4CGM A;  1MJ9 A;  4KUB A;  2Q44 A;  2PDO A;  4B14 A;  2BSW A;  3EXN A;  5AG5 A;  1XMT A;  5F46 A;  3F8K A;  2ZW7 A;  4A30 A;  2Z3L A;  1MJA A;  1UFH A;  5AG7 A;  5F48 A;  4CAW A;  3BJ7 A;  2ZW6 A;  1YVO A;  1YGH A;  3BLN A;  2CY2 A;  5J8C A;  5IB0 A;  1P0H A;  2QML A;  5G21 A;  4QUS A;  1QST A;  4XNH B;  3TT2 A;  3F5B A;  5I0C A;  2P6G A;  4KOT A;  4HNY B;  2FS5 A;  3R96 A;  3NE7 A;  2Z3O A;  4R87 A;  4R57 A;  4QBJ A;  2FXF A;  4UCP A;  1FY7 A;  3OWC A;  3B8G A;  4H6U A;  4CGO A;  5GCN A;  1Q2Y A;  5G1Z A;  1BOB A;  4A31 A;  2RC4 A;  5C82 A;  4OAE A;  1SQH A;  2B3U A;  3A9L A;  2OU2 A;  1I12 A;  1TIQ A;  2Z3M A;  2Y0M A;  1IID A;  5G20 A;  4KOS A;  3EC4 A;  1QSN A;  4M3S A;  1XIX A;  1BO4 A;  4MFL A;  1XE4 A;  4KVO E;  1QSR A;  5EBV A;  1YVK A;  4CRZ B;  4FD7 A;  3H5Z A;  4ZBG A;  4ONU A;  2CXA A;  2VZY A;  3LOD A;  2GAN A;  2REE A;  2X7B A;  4HNX B;  3PZJ A;  3IU2 A;  4MY3 A;  1VKC A;  3S6G A;  4CGN A;  4KUA A;  2B5G B;  3FXT A;  4UCN A;  1NSL A;  4JD6 A;  2Q04 A;  2R1I A;  1Y9W A;  2Q7B A;  1M4G A;  3FNC A;  3H4Q A;  5DWM A;  5A27 A;  2FL4 A;  4XPK A;  4C2Y A;  3R9F A;  2OH1 A;  1GHE A;  3TTH A;  3WR7 A;  4YFJ A;  3D8P A;  4QB9 A;  4AG7 A;  1S7K A;  3CXP A;  1KUY A;  3JVN A;  2WPX A;  4KVM E;  2KCW A;  2OZH A;  4CYN A;  4KOV A;  4FD6 A;  4BMH A;  2D4O A;  5DWN A;  2Z10 A;  3KKW A;  2FE7 A;  2VXK A;  4UFV A;  5IV0 A;  3TO9 A;  2CNS A;  2ZW5 A;  4CAX A;  2B58 A;  4B10 A;  3ZZI A;  3TOB A;  2G0B A;  4OAD A;  5IX3 A;  4LUA A;  3EFA A;  5JQ4 A;  1IIC A;  2PQ8 A;  2R98 A;  2GIV A;  4A95 A;  4LX9 A;  4E8O A;  2OB0 A;  1XF8 A;  3D2M A;  2Z3P A;  1YX0 A;  3R1K A;  4XPL A;  3DNS A;  2Q4V A;  1S7N A;  3N7Z A;  4CYO A;  2G3A A;  4MFJ A;  4CGP A;  3FB3 A;  1YLE A;  4AVC A;  2Q4Y A;  4MFZ A;  4CS0 B;  3QB8 A;  3SHP A;  5KTA A;  1Q2D A;  4AVB A;  3I9S A;  2ARH A;  5EC4 A;  2R8V A;  2PC1 A;  2P6F A;  3R95 A;  4KOU A;  4C7H A;  2QEC A;  4MI4 A;  2GE3 A;  2J8M A;  2I79 A;  2YNC A;  3PGP A;  2Z11 A;  3R9G A;  4Y49 B;  3CXS A;  5F49 A;  3W91 A;  2AE6 A;  2YGW A;  2QIR A;  4MJ8 A;  1YK3 A;  4UWJ A;  2B5G A;  2FCK A;  3FBU A;  4RS2 A;  2EVN A;  1YR0 A;  3GYA A;  5HMN A;  5E96 A;  5FVJ A;  3F0A A;  4QVT A;  4B5P B;  2A4N A;  1Z4E A;  4CYP A;  1QSM A;  3G8W A;  3DR8 A;  4JLY A;  5F47 A;  1MK4 A;  4FD4 A;  2DXQ A;  3TO6 A;  4AVA A;  4NXY A;  1PUA A;  1WWZ A;  1U6M A;  2JEV A;  1KZF A;  4YRH A;  4YGO A;  4L89 A;  1M44 A;  3TE4 A;  1M4I A;  1M1D A;  2C27 A;  4QC6 A;  3S6K A;  4KOX A;  1N71 A;  2J8N A;  3K9U A;  3E0K A;  1KUV A;  4JJX A;  5G22 A;  2PR1 A;  4AG9 A;  3GKR A;  5AG4 A;  2PSW A;  4CAV A;  4M85 A;  1I1D A;  2WPW A;  4KLW A;  1Y9K A;  1IYK A;  1CJW A;  3QAH A;  4IUS A;  4H89 A;  3GY9 A;  4E2A A;  4KSA A;  4UA3 A;  4UFX A;  4C2X A;  2HUZ A;  1L0C A;  4KOR A;  5KTD A;  1S60 A;  4MBU A;  1Y7R A;  1K4J A;  4GS4 A;  1J4J A;  2G3T A;  2O28 A;  4Y49 C;  4UCM A;  4R9M A;  1S7F A;  2P6E A;  3DSB A;  2Z3N A;  2HQY A;  2FSR A;  4IF5 A;  3JTK A;  1S3Z A;  1IB1 E;  3D3S A;  2WSA A;  3IWG A;  3P2F A;  4L8A A;  1OZP A;  4U5Y A;  2ZPA A;  4PSX A;  1YRE A;  5C88 A;  4FD5 A;  4PK2 A;  4B13 A;  2VI7 A;  1XEB A;  2HV2 A;  3FIX A;  4A33 A;  2DPS A;  5AG6 A;  4CAE A;  1QSO A;  2JDC A;  5H86 A;  4AB7 A;  3S6F A;  5ISV A;  4E0A A;  1KUX A;  3FRM A;  2J8R A;  5AGE A;  3I3G A;  3T9Y A;  1V0C A;  5BWA B;  2FT0 A;  3D2P A;  4XPD C;  4H6Z A;  4J3G A;  4C2Z A;  4PSW A;  2K5T A;  2NMT A;  2YNC C;  3DR6 A;  4BBH A;  4KS9 A;  4KLV A;  2R7H A;  1B6B A;  2YND A;  1Q2C A;  2ZW4 A;  4R3K A;  3TOA A;  4MFK A;  5A28 A;  2OZU A;  1P4N A;  4KOW A;  4NSQ A;  4UBR A;  3CXQ A;  2H5M A;  3T90 A;  4DNC A;  4EVY A;  2Z0Z A;  2B4D B;  1Z9U A;  4II9 A;  3C26 A;  1S5K A;  3EY5 A;  4PV6 A;  2ZXV A;  4A2Z A;  1RO5 A;  4PK3 A;  3P2H A;  4C68 A;  3VWE A;  4B5P A;  2Q0Y A;  2VQY A;  3TO7 A;  2VZZ A;  4Q38 A;  4C7I A;  5KTC A;  3IWE A;  4B12 A;  3MGD A;  2B4D A;  2BEI A;  1CM0 A;  4KVX A;  4KOY A;  2B4B A;  2P0W A;  2FIA A;  2CNT A;  4OLL A;  3TFY A;  1LRZ A;  4ORF A;  2REF A;  4K30 A;  2Z3K A;  4NF1 A;  4HKF A;  1NMT A;  4CRY B;  2JDD A;  2AJ6 A;  2EUI A;  2WUU A;  4F0Y A;  2B3V A;  1S7L A;  1MJB A;  2YNE A;  4NEX A;  4A32 A;  2IL4 A;  4ZGY B;  3SXN A;  3V8I A;  2VBQ A;  1B87 A;  5H84 A;  5JPH A;  2DPT A;  3S6H A;  4Q36 A;  3EO4 A;  1Z4R A;  2BUE A;  1RXT A;  2FIW A;  1ZO0 A;  2CNM A;  3FYN A;  4CGL A;  4XPD B;  1IYL A;  1I21 A;  4F0X A;  1VHS A;  4XNH C;  4RI1 A;  2I00 A;  4CAF A;  4F6A A;  1ON0 A;  4B11 A;  4JWP A;  4R3L A;  5CNP A;  4JXR A;  5HH1 A;  1NE9 A;  3R9E A;  3PP9 A;  2VEZ A;  3SXO A;  4KZT A;  4KSF A;  5J8F A;  3DDD A;  3BJ8 A;  4MY0 A;  2F5I A;  1M4D A;  4X5K A;  3UY5 A;  3TCV A;  2ATR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...