4CGPA

Leishmania major n-myristoyltransferase in complex with cofactor
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diverse Modes of Binding in Structures of Leishmania Major N-Myristoyltransferase with Selective Inhibitors
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
total genus 126
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cgpA00
4UCNA 4A33A 4A95A 4B13A 4B12A 4B10A 5AG7A 4CGNA 4UFXA 5G20A 5G21A 4CYPA 4UFVA 2YNCC 5AGEA 4A31A 4CAEA 4CAFA 4CGOA 3IU1A 2WUUA 3IU2A 4CYQA 3JTKA 4A30A 3H5ZA 5AG5A 4UCPA 4C7IA 4CGLA 2YNCA 4B11A 2YNEA 5AG6A 2WSAA 4C2YA 4C2ZA 2YNDA 5A27A 3IWEA 4CGPA 4CYOA 4UCMA 4BBHA 4C68A 4A2ZA 5G1ZA 4B14A 4C7HA 4CYNA 5AG4A 5G22A 4C2XA 4CGMA 5A28A 4UFWA 4A32A
chains in the Genus database with same CATH superfamily
1QSTA 4PPZA 3TCVA 5DS0A 4XNHB 1IGBA 3SJEA 1ARMA 3SJGA 1BPNA 1ELMP 3K2KA 5G21A 1Q2CA 2PJCA 3KHZA 4JYWA 4MFKA 3H8FA 2Q0YA 5DWNA 4OIWA 4FD7A 2PJ3A 3JRUA 3R9FA 4FAIA 1YLOA 4XPLA 2JDDA 3EO4A 4JJXA 3D7DA 5F46A 3B3SA 4P10A 4IF5A 2DPSA 1X10A 2DF5A 3PGPA 4RI1A 4ZX8A 3WC7A 3SXOA 1DTDA 2PVWA 2VBQA 5LYDA 1IOIA 3I1UA 1M4IA 2KCWA 1Z8TA 4CGPA 1Y0RA 3CDXA 3LWUA 4IHMA 2BEIA 2CTCA 2K5TA 3PP9A 4MHNA 4OC2A 4EFDA 1AMPA 4YWYA 4X8IA 2PSWA 2Q04A 3G3SA 4KOVA 4KOTA 4F0YA 3S9NA 2CTBA 3OWCA 4FUUA 3S6FA 3W91A 2ZEOA 1S7LA 2Q43A 2ATRA 4A39A 1XFOA 4CGNA 3BI1A 3RAMA 1ZG9A 2FXFA 3QNVA 4KOYA 4UFXA 4YRHA 4ZBGA 4OP4A 4ZY1A 2A4NA 3WC6A 4HNXB 3IU1A 5JH9A 4IUSA 4M3SA 1P0HA 3L2NA 3JTKA 3V38A 4QC6A 1VHEA 2WZNA 3S6HA 3PFEA 2V77A 2PC1A 2VEZA 3NH8A 1HDUA 1I21A 4NGQA 1VGYA 1Z2LA 2GANA 1YX0A 4ZYQA 3B3WA 2PIYA 1VHOA 4AVCA 3RBUA 5G22A 2AFMA 4DJLA 3RNZA 5ELYA 2B58A 3B2YA 2CIJA 1WWZA 4ONUA 4A95A 4X3RA 2XEIA 3B35A 3PB4X 2ZPAA 2R7HA 1R57A 1XJOA 2Q44A 2NYQA 4PXEA 2HB6A 3NFZA 1ELLP 2O53A 1LAMA 1Y7EA 2ZEHA 4MY3A 1F2OA 5CNPA 4F0XA 4A30A 3VARA 3BJ8A 5F47A 1IIDA 1Z4RA 4B11A 4MHZA 1CP7A 1MK4A 2ZW7A 2OR4A 2GU2A 2ZENA 4B5OA 2QVPA 3IWEA 4ONWA 3D4UA 3I3GA 3PBEA 4A37A 4ZY2A 5AG4A 3P2HA 4R87A 1S3ZA 3UY5A 2QECA 3FB3A 3RZAA 1Y7RA 2PJBA 2JDCA 1M4LA 5AG7A 3ISXA 5KTAA 4MFZA 4MFPA 1YSJA 3FBUA 1IB1E 3H8EA 4R9MA 3GKRA 4MFLA 1YMEA 4CS0B 3IO1A 2EWBA 1IICA 4Y49B 3FNCA 1QQ9A 3NH4A 1XOVA 4ZX9A 1HEEA 3K9UA 3F5BA 4YU9A 4P4JA 4RS2A 4X5KA 1M4DA 2NMTA 1OBRA 3N7ZA 4NJQA 4CYOA 4UCMA 4OC0A 3F8KA 4JWPA 3FIXA 4U5YA 1EE3P 3E0KA 2J9AA 4A2ZA 3TT2A 3HLPA 4C7HA 2JEVA 4QBJA 4NFRA 3H4QA 3LMSA 4HNWB 1VHSA 5LYLA 1TKJA 4QVTA 2J8MA 3QAHA 3SHPA 1Z8LA 5K8OA 2ZW5A 1KUVA 3C26A 1I1DA 4G1PA 4NGRA 4KORA 1XE4A 3EXNA 2OZGA 2Z10A 4KOUA 2BL1A 2BOAA 2EK8A 1R43A 4FD5A 4HKFA 4NGTA 3TX8A 4CAEA 4P4IA 4FD4A 6CPAA 3KR4A 4E8OA 1KZFA 1ZLIA 2HUZA 3SI0A 4NJRA 4PXDA 4UEEA 1YR0A 2OB0A 4C2YA 2B4BA 2HC9A 1CG2A 2R1IA 5DWMA 3SI1A 5CPAA 4C68A 3D7HA 4WJBA 1YLEA 5HVHA 2AJ6A 1MJAA 2Z0ZA 1KUXA 4P6YA 4TWEA 3H8GA 2PQ8A 2WYRA 4KOWA 4PSXA 1PUAA 2AFZA 4H89A 3ZJ0A 2F8HA 1YW6A 2FIWA 2YGWA 2PCUA 4ZI6A 2EO8A 5H84A 4GS4A 2EUIA 5HH1A 3PB7X 4CYQA 5I0CA 1JQGA 4K3NA 2JBKA 4OMEA 4PQAA 4Z65A 1XF8A 5C82A 2V8DA 5I4MA 5IV0A 2YNEA 1DE4C 3R9GA 3FF3A 3CXQA 3PRTA 2ZEEA 4WWVA 1SQHA 4KVXA 5ISVA 3IEHA 3BJ7A 3FEEA 4IK2A 3G8WA 1MJ9A 1IYKA 1UFHA 2RC4A 4U9ZA 3N5FA 2Z3NA 2Y0MA 3R1KA 4A33A 3FYNA 2Q7BA 4CAWA 4PXCA 3QB8A 1BPMA 1KUYA 1LAPA 4F9VA 5IB9A 2V8HA 2FT0A 4UFVA 2D4PA 2C1CA 2BUEA 1Y0YA 2PE3A 2GE3A 3GUXA 1BLLE 1FT7A 1GHEA 2BO9A 3A9LA 3KI9A 4OC3A 4CGLA 4DYOA 1YQEA 1IYLA 3FVLA 2VQYA 2PJ1A 1TKFA 3K9TA 3S6KA 3QAYA 1TF9A 2CF4A 4XPKA 4PV6A 4OC1A 4TNUA 4QUSA 5E96A 2P6FA 5C88A 4KVOE 2G0BA 4Y49C 3ISZA 3WT4A 1BOBA 1XMTA 4L8AA 4E2AA 1M4GA 3KKWA 4PXBA 5FVJA 2PJ8A 3VWEA 4AG9A 3DR8A 1Q2DA 2X7BA 1ZLHA 4JD6A 2P0WA 3IWWA 2FS5A 3KQXA 3LACA 4PSWA 5EMIA 1UWYA 4X2TA 2ARHA 2ZEDA 4F9UA 3NH5A 5LYFA 3D2PA 4J3GA 3R9EA 4UEFA 2C27A 2ABZA 2PDOA 4NGMA 3H5ZA 4P4DA 1FNOA 4R3KA 5AG6A 2JLMA 2P6GA 2PRBA 2CY2A 2ZEFA 2I3CA 2ZELA 3KASA 2ODFA 1M1DA 3BHXA 1JWQA 1M44A 3FJUA 3VWDA 1ZO0A 2PJAA 2Z3PA 2QYVA 2AFUA 5IX3A 3TO6A 1CBXA 4AG7A 3B7IA 2C6GA 4MCPA 3D2MA 3IGRA 4EWTA 4LX9A 4R57A 4UFWA 4YFJA 2Z3OA 2PVVA 4GM5A 2Q4YA 3TFYA 4IAVA 4O23A 5LRGA 2FIAA 4M85A 1I12A 2Z3LA 4HNYB 2V8GA 4K30A 3T9YA 4CGOA 1AUGA 3TOBA 4BMHA 3B3CA 3EY5A 3MN8A 4CAFA 4AVBA 4EMEA 2XEGA 3IU2A 3KHXA 3ZZIA 2EBJA 3GIUA 3S9MA 2AFXA 3PZJA 3IWGA 4C7IA 4UCPA 4W9YA 2Z3MA 2XEFA 4NCZA 3BXMA 3CXSA 3P2FA 2BSWA 3PB8X 2VZYA 2ZOFA 2YNDA 1TXRA 4KZTA 2PJ7A 5H86A 3SJXA 5D8NA 4CRYB 2PJ5A 1PU9A 2Q51A 3FX6A 1B6BA 5G1ZA 4CAVA 4A38A 1Z9UA 2VZZA 1R3NA 1ZG7A 3GYAA 4ZY0A 2REFA 4B12A 5KTDA 1CX8A 4GXHA 2NSMA 8CPAA 7CPAA 3T8WA 3IJ3A 4H2KA 3LODA 4MBUA 4OC5A 4OC4A 4CRZB 2FCKA 2ZEGA 3D8PA 4F8ZA 4MRIA 2DPTA 4OADA 1MJBA 3KQZA 4KOXA 2BCOA 2VL1A 3BI0A 3D67A 1XRYA 3EFAA 4M6GA 5K8MA 3F0AA 4ZGYB 1K4JA 4CAXA 1CP6A 4KSFA 4H6ZA 1QSNA 3FH4A 5LRJA 2G3TA 4KUAA 2CNMA 2EK9A 4DNCA 1J4JA 1S5KA 3KL9A 2B5GB 3W6SA 2OZUA 4CYNA 3FMCA 5F49A 3NE7A 3B8GA 1ARLA 5HXDA 1WK4A 1RO5A 1YGHA 2FL4A 3GY9A 4CGMA 1BO4A 4A32A 4BINA 4KUBA 4R6TA 1HDQA 4PK2A 4UA3A 4UF4A 5K8PA 2AE6A 2OOTA 2CXAA 2WPWA 1PCAA 3DSBA 4CYPA 1Q2YA 1XBUA 2YNCC 5F09A 5JPHA 3TTHA 2POKA 1CM0A 2ANPA 2XEJA 2PJ9A 5IB0A 5JGFA 3RYOA 4AB7A 3CT9A 5AG5A 4Q38A 4MXUA 4MCSA 4PK3A 4QB9A 3D3SA 2G9DA 3FXTA 1S7FA 4C2ZA 2B3UA 2F5IA 4BBHA 3W6XA 5KTCA 4E0AA 1RXTA 5JQ4A 4MFJA 2PJ2A 2J8NA 4XPDB 5J8FA 1XMBA 1YK3A 1NMTA 4KVME 3WABA 3D66A 4B13A 2PJ6A 3R95A 1A2ZA 4UWIA 3PFOA 3SJFA 4JXQA 2GFQA 2ZOGA 2REEA 4XNHC 5F48A 3IFEA 1LOKA 2OU2A 4LQGA 4MCRA 2WPXA 1GYTA 4KSIA 1TIQA 4UEZA 2GIVA 3FRMA 2R98A 1X12A 1ZG8A 4HPSA 4II9A 2IQ6A 4KLWA 2C6PA 2DXQA 2YNCA 2F7VA 2GLJA 2IL4A 4YGOA 1QSMA 2GREA 2WSAA 3T90A 2PJ4A 4M6HA 3PB9X 4P4EA 3SXNA 2D4OA 2Z3KA 4OLLA 3LD2A 1QMUA 4MMOA 4UIBA 1NSLA 5LRKA 4KSAA 3JUWA 2FE7A 3GB0A 4CPAA 2DEAA 3MRUA 4MHDA 3TO7A 2OH1A 2B4DA 2G3AA 2PRQA 4P44A 1XEBA 1Y9WA 2O28A 4NGSA 1CPXA 2PR8A 4UWJA 3S6GA 3FECA 1OZPA 4A31A 5AGEA 5CBMA 4KLVA 4NF1A 2IJZA 2QMLA 4MCQA 2O4HA 3KZWA 4XPDC 1YVKA 2ZEPA 1Z5RA 5HVGA 2RFHA 2JEWA 4OIDA 4I49A 1KWMA 2AFSA 4AXVA 2GLFA 4P45A 2B5GA 3TE4A 3SI2A 4F6AA 2ZEMA 4FWUA 5A27A 4P4BA 1Q7LA 1XIXA 1IOFA 2HV2A 3DNSA 4B6ZA 4JLYA 4Q36A 4A94A 4B5PA 4NXYA 4MI4A 1LANA 5EC4A 4KS9A 1U6MA 2PR1A 2CNSA 3PBBA 4BD9A 2PJ0A 3B3VA 4MFQA 4R8FA 1VIXA 3VATA 1S60A 2HQYA 2EVNA 5EBVA 4FBEA 3JVNA 2VXKA 3CZXA 5J8CA 5K8NA 3V7ZA 2I00A 2WUUA 1TF8A 4KOSA 1IU8A 1S7KA 3MGDA 2Q4VA 3DDDA 3IIBA 1Z8WA 3DLJA 5THWA 3RO0A 1H8LA 1CPSA 1NE9A 1P4NA 3S9LA 3R96A 3DGVA 1B87A 3BLNA 3V8IA 5JM6A 2IMOA 2RB7A 1QSOA 1YREA 2AFOA 2C6CA 4P4FA 1QSRA 5GCNA 3D7GA 4U9YA 1PYTB 1VKCA 2Q7SA 3VH9A 4C2XA 3NE8A 4FD6A 4B10A 2OZHA 4JXRA 4UIAA 4Q7AA 1S7NA 5BWAB 4R76A 1LCPA 3HUVA 4H6UA 4MJ8A 2AFWA 4M6IA 4NEXA 2B4DB 2V8VA 4JZ0A 1RTQA 2VI7A 1L0CA 2I79A 1N71A 3FEDA 3TC8A 2CNTA 1Z4EA 2B3VA 2Q4ZA 3D7FA 3TO9A 5J1QA 1TKHA 4NGNA 4OAEA 2FVGA 1V0CA 2PIZA 4R7MA 3TOAA 5LYIA 1CJWA 4B14A 1FY7A 3KR5A 2J8RA 2ZXVA 2Z11A 4UCNA 3CXPA 1YVOA 3EC4A 1ON0A 2QJ8A 1Y9KA 1AYEA 3IC1A 3GLJA 5G20A 3PEIA 2ZW4A 2JBJA 1F57A 4RN7A 4LUAA 1F2PA 3NA6A 2ZW6A 5HVFA 3WR7A 2P6EA 1BAVA 2QIRA 4NSQA 4AVAA 1Z8XA 1LRZA 4DUKA 2FSRA 3KGQA 4RUHA 4R3LA 5HMNA 4EVYA 2H5MA 1NSAA 3B3TA 4MHPA 4B5PB 3DR6A 4UBRA 1LFWA 3CPAA 3PB6X 3WC5A 1IY7A 2R8VA 4OKOA 1YW4A 4L89A 4ORFA 3I9SA 4NGPA 5D29A 3D68A 3CPXA 4MHYA 4MY0A 5A28A 4LQ6A
chains in the Genus database with same CATH topology
1QSTA 3TCVA 4XNHB 5G21A 1Q2CA 4MFKA 5DWNA 2Q0YA 4FD7A 3R9FA 4XPLA 2JDDA 3EO4A 4JJXA 5F46A 4IF5A 2DPSA 3PGPA 4RI1A 3SXOA 2VBQA 1M4IA 2KCWA 4CGPA 3W6XA 2BEIA 2K5TA 3PP9A 4KOVA 2PSWA 2Q04A 3G3SA 4KOTA 4F0YA 3S6FA 3OWCA 3W91A 1S7LA 2ATRA 4CGNA 2FXFA 4KOYA 4UFXA 4YRHA 4ZBGA 2A4NA 4HNXB 3IU1A 4IUSA 4M3SA 1P0HA 3JTKA 4QC6A 3S6HA 2PC1A 2VEZA 1I21A 2GANA 1YX0A 4AVCA 5G22A 2B58A 1WWZA 4ONUA 4A95A 2ZPAA 2R7HA 1R57A 2Q44A 5CNPA 4MY3A 4F0XA 4A30A 3BJ8A 5F47A 1IIDA 1Z4RA 4B11A 1MK4A 2ZW7A 4B5OA 3IWEA 3I3GA 5AG4A 3P2HA 4R87A 1S3ZA 3UY5A 2QECA 3FB3A 1Y7RA 2JDCA 5AG7A 5KTAA 4MFZA 4MFPA 3FBUA 1IB1E 4R9MA 3GKRA 4MFLA 4CS0B 1IICA 4Y49B 3FNCA 3K9UA 3F5BA 4RS2A 4X5KA 1M4DA 2NMTA 5IX3A 3N7ZA 4CYOA 4UCMA 4U5YA 3F8KA 4JWPA 3FIXA 4A2ZA 3E0KA 3TT2A 4C7HA 2JEVA 4QBJA 3H4QA 4HNWB 1VHSA 4QVTA 2J8MA 3QAHA 3SHPA 2ZW5A 1KUVA 3C26A 1I1DA 4KORA 1XE4A 3EXNA 2OZGA 2Z10A 4KOUA 2BL1A 4CAEA 4FD5A 4HKFA 4FD4A 4E8OA 1KZFA 2HUZA 1YR0A 2OB0A 4C2YA 2B4BA 2R1IA 5DWMA 4C68A 1YLEA 2AJ6A 1MJAA 2Z0ZA 1KUXA 2PQ8A 4KOWA 4PSXA 1PUAA 4H89A 3ZJ0A 2FIWA 2YGWA 5H84A 4GS4A 2EUIA 5HH1A 4CYQA 5I0CA 5IV0A 5C82A 1XF8A 2YNEA 3R9GA 3CXQA 1SQHA 4KVXA 5ISVA 3BJ7A 3G8WA 1UFHA 1MJ9A 1IYKA 2RC4A 4U9ZA 3R1KA 2Z3NA 2Y0MA 3R95A 4A33A 3FYNA 2Q7BA 4CAWA 3QB8A 1KUYA 2FT0A 4UFVA 2D4PA 2BUEA 2GE3A 1GHEA 3A9LA 4CGLA 1IYLA 2VQYA 3S6KA 4XPKA 4PV6A 4QUSA 5E96A 2P6FA 5C88A 4KVOE 2G0BA 4Y49C 1XMTA 1BOBA 4L8AA 4E2AA 1M4GA 3KKWA 5FVJA 3VWEA 4AG9A 3DR8A 1Q2DA 2X7BA 4JD6A 2P0WA 2FS5A 4PSWA 2ARHA 3D2PA 4J3GA 3R9EA 2C27A 2PDOA 3H5ZA 4R3KA 5AG6A 2JLMA 2P6GA 2PRBA 2CY2A 1M1DA 3VWDA 1M44A 1ZO0A 2Z3PA 3TO6A 4AG7A 3D2MA 3IGRA 4LX9A 4R57A 4UFWA 4YFJA 2Z3OA 2Q4YA 3TFYA 2FIAA 4M85A 1I12A 2Z3LA 4HNYB 4K30A 3T9YA 4CGOA 3TOBA 4CAFA 4BMHA 3EY5A 4AVBA 3IU2A 3ZZIA 3PZJA 3IWGA 4C7IA 4UCPA 2Z3MA 4NCZA 3CXSA 3P2FA 2BSWA 2VZYA 2YNDA 4KZTA 5H86A 4CRYB 1PU9A 5G1ZA 1B6BA 4CAVA 1Z9UA 2VZZA 3GYAA 2REFA 4B12A 5KTDA 4MBUA 3LODA 4CRZB 2FCKA 3D8PA 2DPTA 4OADA 1MJBA 4KOXA 3EFAA 3F0AA 4ZGYB 1K4JA 4CAXA 4KSFA 4H6ZA 1QSNA 2G3TA 4KUAA 2CNMA 4DNCA 1J4JA 1S5KA 3W6SA 2B5GB 2OZUA 4CYNA 5F49A 3NE7A 3B8GA 1WK4A 1RO5A 1YGHA 2FL4A 3GY9A 4CGMA 1BO4A 4A32A 4KUBA 4PK2A 4UA3A 2AE6A 2CXAA 2WPWA 3DSBA 4CYPA 1Q2YA 2YNCC 5JPHA 3TTHA 1CM0A 5IB0A 3RYOA 4AB7A 5AG5A 4Q38A 4PK3A 4QB9A 3D3SA 4C2ZA 3FXTA 1S7FA 2B3UA 2F5IA 4BBHA 5KTCA 4E0AA 1RXTA 5JQ4A 4MFJA 2J8NA 4XPDB 5J8FA 1YK3A 1NMTA 4KVME 4B13A 4UWIA 4JXQA 4XNHC 2REEA 5F48A 2OU2A 2WPXA 1TIQA 2GIVA 3FRMA 2R98A 4II9A 4KLWA 2DXQA 2YNCA 2IL4A 4YGOA 3T90A 1QSMA 2WSAA 3SXNA 2D4OA 2Z3KA 4OLLA 3LD2A 1NSLA 4KSAA 3JUWA 2FE7A 4MHDA 3TO7A 2OH1A 2B4DA 2G3AA 1XEBA 1Y9WA 2O28A 2PR8A 4UWJA 3S6GA 1OZPA 4A31A 5AGEA 4KLVA 4NF1A 2QMLA 4XPDC 1YVKA 4I49A 2B5GA 3TE4A 4F6AA 5A27A 1XIXA 2HV2A 3DNSA 4JLYA 4Q36A 4B5PA 4NXYA 4MI4A 5EC4A 4KS9A 1U6MA 2PR1A 2CNSA 4MFQA 1S60A 2HQYA 2EVNA 5EBVA 5J8CA 3JVNA 2VXKA 2I00A 2WUUA 4KOSA 1S7KA 3MGDA 2Q4VA 3DDDA 1P4NA 1NE9A 3R96A 1B87A 3BLNA 3V8IA 1QSOA 1YREA 5GCNA 1QSRA 4C2XA 4U9YA 1VKCA 4FD6A 4B10A 2OZHA 4JXRA 1S7NA 5BWAB 4H6UA 4MJ8A 4NEXA 2B4DB 2VI7A 1L0CA 2I79A 1N71A 2CNTA 1Z4EA 2B3VA 3TO9A 4OAEA 1V0CA 3TOAA 4B14A 1CJWA 1FY7A 2J8RA 2ZXVA 2Z11A 4UCNA 3CXPA 1YVOA 3EC4A 1ON0A 1Y9KA 5G20A 2ZW4A 4LUAA 2ZW6A 3WR7A 2P6EA 4AVAA 2QIRA 4NSQA 1LRZA 2FSRA 4R3LA 5HMNA 4EVYA 2H5MA 4B5PB 3DR6A 4UBRA 2R8VA 4ORFA 4L89A 3I9SA 4MY0A 5A28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UCN A;  4A33 A;  4A95 A;  4B13 A;  4B12 A;  4B10 A;  5AG7 A;  4CGN A;  4UFX A;  5G20 A;  5G21 A;  4CYP A;  4UFV A;  2YNC C;  5AGE A;  4A31 A;  4CAE A;  4CAF A;  4CGO A;  3IU1 A;  2WUU A;  3IU2 A;  4CYQ A;  3JTK A;  4A30 A;  3H5Z A;  5AG5 A;  4UCP A;  4C7I A;  4CGL A;  2YNC A;  4B11 A;  2YNE A;  5AG6 A;  2WSA A;  4C2Y A;  4C2Z A;  2YND A;  5A27 A;  3IWE A;  4CGP A;  4CYO A;  4UCM A;  4BBH A;  4C68 A;  4A2Z A;  5G1Z A;  4B14 A;  4C7H A;  4CYN A;  5AG4 A;  5G22 A;  4C2X A;  4CGM A;  5A28 A;  4UFW A;  4A32 A; 
#chains in the Genus database with same CATH topology
 1QST A;  4PPZ A;  3TCV A;  5DS0 A;  4XNH B;  1IGB A;  3SJE A;  1ARM A;  3SJG A;  1BPN A;  1ELM P;  3K2K A;  5G21 A;  1Q2C A;  2PJC A;  3KHZ A;  4JYW A;  4MFK A;  3H8F A;  2Q0Y A;  5DWN A;  4OIW A;  4FD7 A;  2PJ3 A;  3JRU A;  3R9F A;  4FAI A;  1YLO A;  4XPL A;  2JDD A;  3EO4 A;  4JJX A;  3D7D A;  5F46 A;  3B3S A;  4P10 A;  4IF5 A;  2DPS A;  1X10 A;  2DF5 A;  3PGP A;  4RI1 A;  4ZX8 A;  3WC7 A;  3SXO A;  1DTD A;  2PVW A;  2VBQ A;  5LYD A;  1IOI A;  3I1U A;  1M4I A;  2KCW A;  1Z8T A;  4CGP A;  1Y0R A;  3CDX A;  3LWU A;  4IHM A;  2BEI A;  2CTC A;  2K5T A;  3PP9 A;  4MHN A;  4OC2 A;  4EFD A;  1AMP A;  4YWY A;  4X8I A;  2PSW A;  2Q04 A;  3G3S A;  4KOV A;  4KOT A;  4F0Y A;  3S9N A;  2CTB A;  3OWC A;  4FUU A;  3S6F A;  3W91 A;  2ZEO A;  1S7L A;  2Q43 A;  2ATR A;  4A39 A;  1XFO A;  4CGN A;  3BI1 A;  3RAM A;  1ZG9 A;  2FXF A;  3QNV A;  4KOY A;  4UFX A;  4YRH A;  4ZBG A;  4OP4 A;  4ZY1 A;  2A4N A;  3WC6 A;  4HNX B;  3IU1 A;  5JH9 A;  4IUS A;  4M3S A;  1P0H A;  3L2N A;  3JTK A;  3V38 A;  4QC6 A;  1VHE A;  2WZN A;  3S6H A;  3PFE A;  2V77 A;  2PC1 A;  2VEZ A;  3NH8 A;  1HDU A;  1I21 A;  4NGQ A;  1VGY A;  1Z2L A;  2GAN A;  1YX0 A;  4ZYQ A;  3B3W A;  2PIY A;  1VHO A;  4AVC A;  3RBU A;  5G22 A;  2AFM A;  4DJL A;  3RNZ A;  5ELY A;  2B58 A;  3B2Y A;  2CIJ A;  1WWZ A;  4ONU A;  4A95 A;  4X3R A;  2XEI A;  3B35 A;  3PB4 X;  2ZPA A;  2R7H A;  1R57 A;  1XJO A;  2Q44 A;  2NYQ A;  4PXE A;  2HB6 A;  3NFZ A;  1ELL P;  2O53 A;  1LAM A;  1Y7E A;  2ZEH A;  4MY3 A;  1F2O A;  5CNP A;  4F0X A;  4A30 A;  3VAR A;  3BJ8 A;  5F47 A;  1IID A;  1Z4R A;  4B11 A;  4MHZ A;  1CP7 A;  1MK4 A;  2ZW7 A;  2OR4 A;  2GU2 A;  2ZEN A;  4B5O A;  2QVP A;  3IWE A;  4ONW A;  3D4U A;  3I3G A;  3PBE A;  4A37 A;  4ZY2 A;  5AG4 A;  3P2H A;  4R87 A;  1S3Z A;  3UY5 A;  2QEC A;  3FB3 A;  3RZA A;  1Y7R A;  2PJB A;  2JDC A;  1M4L A;  5AG7 A;  3ISX A;  5KTA A;  4MFZ A;  4MFP A;  1YSJ A;  3FBU A;  1IB1 E;  3H8E A;  4R9M A;  3GKR A;  4MFL A;  1YME A;  4CS0 B;  3IO1 A;  2EWB A;  1IIC A;  4Y49 B;  3FNC A;  1QQ9 A;  3NH4 A;  1XOV A;  4ZX9 A;  1HEE A;  3K9U A;  3F5B A;  4YU9 A;  4P4J A;  4RS2 A;  4X5K A;  1M4D A;  2NMT A;  1OBR A;  3N7Z A;  4NJQ A;  4CYO A;  4UCM A;  4OC0 A;  3F8K A;  4JWP A;  3FIX A;  4U5Y A;  1EE3 P;  3E0K A;  2J9A A;  4A2Z A;  3TT2 A;  3HLP A;  4C7H A;  2JEV A;  4QBJ A;  4NFR A;  3H4Q A;  3LMS A;  4HNW B;  1VHS A;  5LYL A;  1TKJ A;  4QVT A;  2J8M A;  3QAH A;  3SHP A;  1Z8L A;  5K8O A;  2ZW5 A;  1KUV A;  3C26 A;  1I1D A;  4G1P A;  4NGR A;  4KOR A;  1XE4 A;  3EXN A;  2OZG A;  2Z10 A;  4KOU A;  2BL1 A;  2BOA A;  2EK8 A;  1R43 A;  4FD5 A;  4HKF A;  4NGT A;  3TX8 A;  4CAE A;  4P4I A;  4FD4 A;  6CPA A;  3KR4 A;  4E8O A;  1KZF A;  1ZLI A;  2HUZ A;  3SI0 A;  4NJR A;  4PXD A;  4UEE A;  1YR0 A;  2OB0 A;  4C2Y A;  2B4B A;  2HC9 A;  1CG2 A;  2R1I A;  5DWM A;  3SI1 A;  5CPA A;  4C68 A;  3D7H A;  4WJB A;  1YLE A;  5HVH A;  2AJ6 A;  1MJA A;  2Z0Z A;  1KUX A;  4P6Y A;  4TWE A;  3H8G A;  2PQ8 A;  2WYR A;  4KOW A;  4PSX A;  1PUA A;  2AFZ A;  4H89 A;  3ZJ0 A;  2F8H A;  1YW6 A;  2FIW A;  2YGW A;  2PCU A;  4ZI6 A;  2EO8 A;  5H84 A;  4GS4 A;  2EUI A;  5HH1 A;  3PB7 X;  4CYQ A;  5I0C A;  1JQG A;  4K3N A;  2JBK A;  4OME A;  4PQA A;  4Z65 A;  1XF8 A;  5C82 A;  2V8D A;  5I4M A;  5IV0 A;  2YNE A;  1DE4 C;  3R9G A;  3FF3 A;  3CXQ A;  3PRT A;  2ZEE A;  4WWV A;  1SQH A;  4KVX A;  5ISV A;  3IEH A;  3BJ7 A;  3FEE A;  4IK2 A;  3G8W A;  1MJ9 A;  1IYK A;  1UFH A;  2RC4 A;  4U9Z A;  3N5F A;  2Z3N A;  2Y0M A;  3R1K A;  4A33 A;  3FYN A;  2Q7B A;  4CAW A;  4PXC A;  3QB8 A;  1BPM A;  1KUY A;  1LAP A;  4F9V A;  5IB9 A;  2V8H A;  2FT0 A;  4UFV A;  2D4P A;  2C1C A;  2BUE A;  1Y0Y A;  2PE3 A;  2GE3 A;  3GUX A;  1BLL E;  1FT7 A;  1GHE A;  2BO9 A;  3A9L A;  3KI9 A;  4OC3 A;  4CGL A;  4DYO A;  1YQE A;  1IYL A;  3FVL A;  2VQY A;  2PJ1 A;  1TKF A;  3K9T A;  3S6K A;  3QAY A;  1TF9 A;  2CF4 A;  4XPK A;  4PV6 A;  4OC1 A;  4TNU A;  4QUS A;  5E96 A;  2P6F A;  5C88 A;  4KVO E;  2G0B A;  4Y49 C;  3ISZ A;  3WT4 A;  1BOB A;  1XMT A;  4L8A A;  4E2A A;  1M4G A;  3KKW A;  4PXB A;  5FVJ A;  2PJ8 A;  3VWE A;  4AG9 A;  3DR8 A;  1Q2D A;  2X7B A;  1ZLH A;  4JD6 A;  2P0W A;  3IWW A;  2FS5 A;  3KQX A;  3LAC A;  4PSW A;  5EMI A;  1UWY A;  4X2T A;  2ARH A;  2ZED A;  4F9U A;  3NH5 A;  5LYF A;  3D2P A;  4J3G A;  3R9E A;  4UEF A;  2C27 A;  2ABZ A;  2PDO A;  4NGM A;  3H5Z A;  4P4D A;  1FNO A;  4R3K A;  5AG6 A;  2JLM A;  2P6G A;  2PRB A;  2CY2 A;  2ZEF A;  2I3C A;  2ZEL A;  3KAS A;  2ODF A;  1M1D A;  3BHX A;  1JWQ A;  1M44 A;  3FJU A;  3VWD A;  1ZO0 A;  2PJA A;  2Z3P A;  2QYV A;  2AFU A;  5IX3 A;  3TO6 A;  1CBX A;  4AG7 A;  3B7I A;  2C6G A;  4MCP A;  3D2M A;  3IGR A;  4EWT A;  4LX9 A;  4R57 A;  4UFW A;  4YFJ A;  2Z3O A;  2PVV A;  4GM5 A;  2Q4Y A;  3TFY A;  4IAV A;  4O23 A;  5LRG A;  2FIA A;  4M85 A;  1I12 A;  2Z3L A;  4HNY B;  2V8G A;  4K30 A;  3T9Y A;  4CGO A;  1AUG A;  3TOB A;  4BMH A;  3B3C A;  3EY5 A;  3MN8 A;  4CAF A;  4AVB A;  4EME A;  2XEG A;  3IU2 A;  3KHX A;  3ZZI A;  2EBJ A;  3GIU A;  3S9M A;  2AFX A;  3PZJ A;  3IWG A;  4C7I A;  4UCP A;  4W9Y A;  2Z3M A;  2XEF A;  4NCZ A;  3BXM A;  3CXS A;  3P2F A;  2BSW A;  3PB8 X;  2VZY A;  2ZOF A;  2YND A;  1TXR A;  4KZT A;  2PJ7 A;  5H86 A;  3SJX A;  5D8N A;  4CRY B;  2PJ5 A;  1PU9 A;  2Q51 A;  3FX6 A;  1B6B A;  5G1Z A;  4CAV A;  4A38 A;  1Z9U A;  2VZZ A;  1R3N A;  1ZG7 A;  3GYA A;  4ZY0 A;  2REF A;  4B12 A;  5KTD A;  1CX8 A;  4GXH A;  2NSM A;  8CPA A;  7CPA A;  3T8W A;  3IJ3 A;  4H2K A;  3LOD A;  4MBU A;  4OC5 A;  4OC4 A;  4CRZ B;  2FCK A;  2ZEG A;  3D8P A;  4F8Z A;  4MRI A;  2DPT A;  4OAD A;  1MJB A;  3KQZ A;  4KOX A;  2BCO A;  2VL1 A;  3BI0 A;  3D67 A;  1XRY A;  3EFA A;  4M6G A;  5K8M A;  3F0A A;  4ZGY B;  1K4J A;  4CAX A;  1CP6 A;  4KSF A;  4H6Z A;  1QSN A;  3FH4 A;  5LRJ A;  2G3T A;  4KUA A;  2CNM A;  2EK9 A;  4DNC A;  1J4J A;  1S5K A;  3KL9 A;  2B5G B;  3W6S A;  2OZU A;  4CYN A;  3FMC A;  5F49 A;  3NE7 A;  3B8G A;  1ARL A;  5HXD A;  1WK4 A;  1RO5 A;  1YGH A;  2FL4 A;  3GY9 A;  4CGM A;  1BO4 A;  4A32 A;  4BIN A;  4KUB A;  4R6T A;  1HDQ A;  4PK2 A;  4UA3 A;  4UF4 A;  5K8P A;  2AE6 A;  2OOT A;  2CXA A;  2WPW A;  1PCA A;  3DSB A;  4CYP A;  1Q2Y A;  1XBU A;  2YNC C;  5F09 A;  5JPH A;  3TTH A;  2POK A;  1CM0 A;  2ANP A;  2XEJ A;  2PJ9 A;  5IB0 A;  5JGF A;  3RYO A;  4AB7 A;  3CT9 A;  5AG5 A;  4Q38 A;  4MXU A;  4MCS A;  4PK3 A;  4QB9 A;  3D3S A;  2G9D A;  3FXT A;  1S7F A;  4C2Z A;  2B3U A;  2F5I A;  4BBH A;  3W6X A;  5KTC A;  4E0A A;  1RXT A;  5JQ4 A;  4MFJ A;  2PJ2 A;  2J8N A;  4XPD B;  5J8F A;  1XMB A;  1YK3 A;  1NMT A;  4KVM E;  3WAB A;  3D66 A;  4B13 A;  2PJ6 A;  3R95 A;  1A2Z A;  4UWI A;  3PFO A;  3SJF A;  4JXQ A;  2GFQ A;  2ZOG A;  2REE A;  4XNH C;  5F48 A;  3IFE A;  1LOK A;  2OU2 A;  4LQG A;  4MCR A;  2WPX A;  1GYT A;  4KSI A;  1TIQ A;  4UEZ A;  2GIV A;  3FRM A;  2R98 A;  1X12 A;  1ZG8 A;  4HPS A;  4II9 A;  2IQ6 A;  4KLW A;  2C6P A;  2DXQ A;  2YNC A;  2F7V A;  2GLJ A;  2IL4 A;  4YGO A;  1QSM A;  2GRE A;  2WSA A;  3T90 A;  2PJ4 A;  4M6H A;  3PB9 X;  4P4E A;  3SXN A;  2D4O A;  2Z3K A;  4OLL A;  3LD2 A;  1QMU A;  4MMO A;  4UIB A;  1NSL A;  5LRK A;  4KSA A;  3JUW A;  2FE7 A;  3GB0 A;  4CPA A;  2DEA A;  3MRU A;  4MHD A;  3TO7 A;  2OH1 A;  2B4D A;  2G3A A;  2PRQ A;  4P44 A;  1XEB A;  1Y9W A;  2O28 A;  4NGS A;  1CPX A;  2PR8 A;  4UWJ A;  3S6G A;  3FEC A;  1OZP A;  4A31 A;  5AGE A;  5CBM A;  4KLV A;  4NF1 A;  2IJZ A;  2QML A;  4MCQ A;  2O4H A;  3KZW A;  4XPD C;  1YVK A;  2ZEP A;  1Z5R A;  5HVG A;  2RFH A;  2JEW A;  4OID A;  4I49 A;  1KWM A;  2AFS A;  4AXV A;  2GLF A;  4P45 A;  2B5G A;  3TE4 A;  3SI2 A;  4F6A A;  2ZEM A;  4FWU A;  5A27 A;  4P4B A;  1Q7L A;  1XIX A;  1IOF A;  2HV2 A;  3DNS A;  4B6Z A;  4JLY A;  4Q36 A;  4A94 A;  4B5P A;  4NXY A;  4MI4 A;  1LAN A;  5EC4 A;  4KS9 A;  1U6M A;  2PR1 A;  2CNS A;  3PBB A;  4BD9 A;  2PJ0 A;  3B3V A;  4MFQ A;  4R8F A;  1VIX A;  3VAT A;  1S60 A;  2HQY A;  2EVN A;  5EBV A;  4FBE A;  3JVN A;  2VXK A;  3CZX A;  5J8C A;  5K8N A;  3V7Z A;  2I00 A;  2WUU A;  1TF8 A;  4KOS A;  1IU8 A;  1S7K A;  3MGD A;  2Q4V A;  3DDD A;  3IIB A;  1Z8W A;  3DLJ A;  5THW A;  3RO0 A;  1H8L A;  1CPS A;  1NE9 A;  1P4N A;  3S9L A;  3R96 A;  3DGV A;  1B87 A;  3BLN A;  3V8I A;  5JM6 A;  2IMO A;  2RB7 A;  1QSO A;  1YRE A;  2AFO A;  2C6C A;  4P4F A;  1QSR A;  5GCN A;  3D7G A;  4U9Y A;  1PYT B;  1VKC A;  2Q7S A;  3VH9 A;  4C2X A;  3NE8 A;  4FD6 A;  4B10 A;  2OZH A;  4JXR A;  4UIA A;  4Q7A A;  1S7N A;  5BWA B;  4R76 A;  1LCP A;  3HUV A;  4H6U A;  4MJ8 A;  2AFW A;  4M6I A;  4NEX A;  2B4D B;  2V8V A;  4JZ0 A;  1RTQ A;  2VI7 A;  1L0C A;  2I79 A;  1N71 A;  3FED A;  3TC8 A;  2CNT A;  1Z4E A;  2B3V A;  2Q4Z A;  3D7F A;  3TO9 A;  5J1Q A;  1TKH A;  4NGN A;  4OAE A;  2FVG A;  1V0C A;  2PIZ A;  4R7M A;  3TOA A;  5LYI A;  1CJW A;  4B14 A;  1FY7 A;  3KR5 A;  2J8R A;  2ZXV A;  2Z11 A;  4UCN A;  3CXP A;  1YVO A;  3EC4 A;  1ON0 A;  2QJ8 A;  1Y9K A;  1AYE A;  3IC1 A;  3GLJ A;  5G20 A;  3PEI A;  2ZW4 A;  2JBJ A;  1F57 A;  4RN7 A;  4LUA A;  1F2P A;  3NA6 A;  2ZW6 A;  5HVF A;  3WR7 A;  2P6E A;  1BAV A;  2QIR A;  4NSQ A;  4AVA A;  1Z8X A;  1LRZ A;  4DUK A;  2FSR A;  3KGQ A;  4RUH A;  4R3L A;  5HMN A;  4EVY A;  2H5M A;  1NSA A;  3B3T A;  4MHP A;  4B5P B;  3DR6 A;  4UBR A;  1LFW A;  3CPA A;  3PB6 X;  3WC5 A;  1IY7 A;  2R8V A;  4OKO A;  1YW4 A;  4L89 A;  4ORF A;  3I9S A;  4NGP A;  5D29 A;  3D68 A;  3CPX A;  4MHY A;  4MY0 A;  5A28 A;  4LQ6 A; 
#chains in the Genus database with same CATH homology
 1QST A;  3TCV A;  4XNH B;  5G21 A;  1Q2C A;  4MFK A;  5DWN A;  2Q0Y A;  4FD7 A;  3R9F A;  4XPL A;  2JDD A;  3EO4 A;  4JJX A;  5F46 A;  4IF5 A;  2DPS A;  3PGP A;  4RI1 A;  3SXO A;  2VBQ A;  1M4I A;  2KCW A;  4CGP A;  3W6X A;  2BEI A;  2K5T A;  3PP9 A;  4KOV A;  2PSW A;  2Q04 A;  3G3S A;  4KOT A;  4F0Y A;  3S6F A;  3OWC A;  3W91 A;  1S7L A;  2ATR A;  4CGN A;  2FXF A;  4KOY A;  4UFX A;  4YRH A;  4ZBG A;  2A4N A;  4HNX B;  3IU1 A;  4IUS A;  4M3S A;  1P0H A;  3JTK A;  4QC6 A;  3S6H A;  2PC1 A;  2VEZ A;  1I21 A;  2GAN A;  1YX0 A;  4AVC A;  5G22 A;  2B58 A;  1WWZ A;  4ONU A;  4A95 A;  2ZPA A;  2R7H A;  1R57 A;  2Q44 A;  5CNP A;  4MY3 A;  4F0X A;  4A30 A;  3BJ8 A;  5F47 A;  1IID A;  1Z4R A;  4B11 A;  1MK4 A;  2ZW7 A;  4B5O A;  3IWE A;  3I3G A;  5AG4 A;  3P2H A;  4R87 A;  1S3Z A;  3UY5 A;  2QEC A;  3FB3 A;  1Y7R A;  2JDC A;  5AG7 A;  5KTA A;  4MFZ A;  4MFP A;  3FBU A;  1IB1 E;  4R9M A;  3GKR A;  4MFL A;  4CS0 B;  1IIC A;  4Y49 B;  3FNC A;  3K9U A;  3F5B A;  4RS2 A;  4X5K A;  1M4D A;  2NMT A;  5IX3 A;  3N7Z A;  4CYO A;  4UCM A;  4U5Y A;  3F8K A;  4JWP A;  3FIX A;  4A2Z A;  3E0K A;  3TT2 A;  4C7H A;  2JEV A;  4QBJ A;  3H4Q A;  4HNW B;  1VHS A;  4QVT A;  2J8M A;  3QAH A;  3SHP A;  2ZW5 A;  1KUV A;  3C26 A;  1I1D A;  4KOR A;  1XE4 A;  3EXN A;  2OZG A;  2Z10 A;  4KOU A;  2BL1 A;  4CAE A;  4FD5 A;  4HKF A;  4FD4 A;  4E8O A;  1KZF A;  2HUZ A;  1YR0 A;  2OB0 A;  4C2Y A;  2B4B A;  2R1I A;  5DWM A;  4C68 A;  1YLE A;  2AJ6 A;  1MJA A;  2Z0Z A;  1KUX A;  2PQ8 A;  4KOW A;  4PSX A;  1PUA A;  4H89 A;  3ZJ0 A;  2FIW A;  2YGW A;  5H84 A;  4GS4 A;  2EUI A;  5HH1 A;  4CYQ A;  5I0C A;  5IV0 A;  5C82 A;  1XF8 A;  2YNE A;  3R9G A;  3CXQ A;  1SQH A;  4KVX A;  5ISV A;  3BJ7 A;  3G8W A;  1UFH A;  1MJ9 A;  1IYK A;  2RC4 A;  4U9Z A;  3R1K A;  2Z3N A;  2Y0M A;  3R95 A;  4A33 A;  3FYN A;  2Q7B A;  4CAW A;  3QB8 A;  1KUY A;  2FT0 A;  4UFV A;  2D4P A;  2BUE A;  2GE3 A;  1GHE A;  3A9L A;  4CGL A;  1IYL A;  2VQY A;  3S6K A;  4XPK A;  4PV6 A;  4QUS A;  5E96 A;  2P6F A;  5C88 A;  4KVO E;  2G0B A;  4Y49 C;  1XMT A;  1BOB A;  4L8A A;  4E2A A;  1M4G A;  3KKW A;  5FVJ A;  3VWE A;  4AG9 A;  3DR8 A;  1Q2D A;  2X7B A;  4JD6 A;  2P0W A;  2FS5 A;  4PSW A;  2ARH A;  3D2P A;  4J3G A;  3R9E A;  2C27 A;  2PDO A;  3H5Z A;  4R3K A;  5AG6 A;  2JLM A;  2P6G A;  2PRB A;  2CY2 A;  1M1D A;  3VWD A;  1M44 A;  1ZO0 A;  2Z3P A;  3TO6 A;  4AG7 A;  3D2M A;  3IGR A;  4LX9 A;  4R57 A;  4UFW A;  4YFJ A;  2Z3O A;  2Q4Y A;  3TFY A;  2FIA A;  4M85 A;  1I12 A;  2Z3L A;  4HNY B;  4K30 A;  3T9Y A;  4CGO A;  3TOB A;  4CAF A;  4BMH A;  3EY5 A;  4AVB A;  3IU2 A;  3ZZI A;  3PZJ A;  3IWG A;  4C7I A;  4UCP A;  2Z3M A;  4NCZ A;  3CXS A;  3P2F A;  2BSW A;  2VZY A;  2YND A;  4KZT A;  5H86 A;  4CRY B;  1PU9 A;  5G1Z A;  1B6B A;  4CAV A;  1Z9U A;  2VZZ A;  3GYA A;  2REF A;  4B12 A;  5KTD A;  4MBU A;  3LOD A;  4CRZ B;  2FCK A;  3D8P A;  2DPT A;  4OAD A;  1MJB A;  4KOX A;  3EFA A;  3F0A A;  4ZGY B;  1K4J A;  4CAX A;  4KSF A;  4H6Z A;  1QSN A;  2G3T A;  4KUA A;  2CNM A;  4DNC A;  1J4J A;  1S5K A;  3W6S A;  2B5G B;  2OZU A;  4CYN A;  5F49 A;  3NE7 A;  3B8G A;  1WK4 A;  1RO5 A;  1YGH A;  2FL4 A;  3GY9 A;  4CGM A;  1BO4 A;  4A32 A;  4KUB A;  4PK2 A;  4UA3 A;  2AE6 A;  2CXA A;  2WPW A;  3DSB A;  4CYP A;  1Q2Y A;  2YNC C;  5JPH A;  3TTH A;  1CM0 A;  5IB0 A;  3RYO A;  4AB7 A;  5AG5 A;  4Q38 A;  4PK3 A;  4QB9 A;  3D3S A;  4C2Z A;  3FXT A;  1S7F A;  2B3U A;  2F5I A;  4BBH A;  5KTC A;  4E0A A;  1RXT A;  5JQ4 A;  4MFJ A;  2J8N A;  4XPD B;  5J8F A;  1YK3 A;  1NMT A;  4KVM E;  4B13 A;  4UWI A;  4JXQ A;  4XNH C;  2REE A;  5F48 A;  2OU2 A;  2WPX A;  1TIQ A;  2GIV A;  3FRM A;  2R98 A;  4II9 A;  4KLW A;  2DXQ A;  2YNC A;  2IL4 A;  4YGO A;  3T90 A;  1QSM A;  2WSA A;  3SXN A;  2D4O A;  2Z3K A;  4OLL A;  3LD2 A;  1NSL A;  4KSA A;  3JUW A;  2FE7 A;  4MHD A;  3TO7 A;  2OH1 A;  2B4D A;  2G3A A;  1XEB A;  1Y9W A;  2O28 A;  2PR8 A;  4UWJ A;  3S6G A;  1OZP A;  4A31 A;  5AGE A;  4KLV A;  4NF1 A;  2QML A;  4XPD C;  1YVK A;  4I49 A;  2B5G A;  3TE4 A;  4F6A A;  5A27 A;  1XIX A;  2HV2 A;  3DNS A;  4JLY A;  4Q36 A;  4B5P A;  4NXY A;  4MI4 A;  5EC4 A;  4KS9 A;  1U6M A;  2PR1 A;  2CNS A;  4MFQ A;  1S60 A;  2HQY A;  2EVN A;  5EBV A;  5J8C A;  3JVN A;  2VXK A;  2I00 A;  2WUU A;  4KOS A;  1S7K A;  3MGD A;  2Q4V A;  3DDD A;  1P4N A;  1NE9 A;  3R96 A;  1B87 A;  3BLN A;  3V8I A;  1QSO A;  1YRE A;  5GCN A;  1QSR A;  4C2X A;  4U9Y A;  1VKC A;  4FD6 A;  4B10 A;  2OZH A;  4JXR A;  1S7N A;  5BWA B;  4H6U A;  4MJ8 A;  4NEX A;  2B4D B;  2VI7 A;  1L0C A;  2I79 A;  1N71 A;  2CNT A;  1Z4E A;  2B3V A;  3TO9 A;  4OAE A;  1V0C A;  3TOA A;  4B14 A;  1CJW A;  1FY7 A;  2J8R A;  2ZXV A;  2Z11 A;  4UCN A;  3CXP A;  1YVO A;  3EC4 A;  1ON0 A;  1Y9K A;  5G20 A;  2ZW4 A;  4LUA A;  2ZW6 A;  3WR7 A;  2P6E A;  4AVA A;  2QIR A;  4NSQ A;  1LRZ A;  2FSR A;  4R3L A;  5HMN A;  4EVY A;  2H5M A;  4B5P B;  3DR6 A;  4UBR A;  2R8V A;  4ORF A;  4L89 A;  3I9S A;  4MY0 A;  5A28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...