2EVNA

Nmr solution structures of at1g77540
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
103
structure length
103
Chain Sequence
MATEPPKIVWNEGKRRFETEDHEAFIEYKMRNNGKVMDLVHTYVPSFKRGLGLASHLCVAAFEHASSHSISIIPSCSYVSDTFLPRNPSWKPLIHSEVFKSSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Arabidopsis thaliana At1g77540 Protein, a Minimal Acetyltransferase from the COG2388 Family.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
molecule keywords Protein At1g77540
total genus 22
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14542 Acetyltransf_CG GCN5-related N-acetyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2evnA00
4JWPA 2D4OA 2PSWA 2ZPAA 1GHEA 1YLEA 4XNHC 3TE4A 3FBUA 2BSWA 4KOXA 2B5GA 2HUZA 2A4NA 2WPXA 2VXKA 4PK3A 2Q7BA 3FB3A 2QMLA 4Y49B 4QUSA 2GE3A 4UWIA 2JEVA 4KORA 4PK2A 2FL4A 1KUVA 1QSMA 1S7NA 4R87A 2AE6A 1M44A 5HH1A 3BLNA 4IUSA 4FD4A 1YREA 3EXNA 4L8AA 3V8IA 1WWZA 4MBUA 1FY7A 4AVBA 2QECA 2G0BA 2ZW6A 4KUAA 2EUIA 3W6XA 4NEXA 1OZPA 2B3UA 4PV6A 2B5GB 3EC4A 4OAEA 4DNCA 3BJ8A 3DR6A 3MGDA 4UWJA 4MJ8A 2VZZA 2EVNA 5KTAA 1Q2DA 4U9ZA 2KCWA 4KUBA 2PR1A 2B4BA 3TTHA 1KUYA 2C27A 1L0CA 3N7ZA 4H6ZA 4KOWA 1QSNA 2FXFA 2VBQA 1B87A 2FT0A 2QIRA 1M1DA 1N71A 4NF1A 3TCVA 3TO9A 2K5TA 4LUAA 3IGRA 4NXYA 5EBVA 2PDOA 1I1DA 1Z4EA 2PC1A 4E2AA 2FIWA 2Q44A 4QBJA 4GS4A 2G3TA 2O28A 4AB7A 3CXQA 4R9MA 3TOAA 3JVNA 4PSWA 1MJAA 2P6FA 2CNMA 1XEBA 5GCNA 2PRBA 3LD2A 2CY2A 1S5KA 2GANA 4YFJA 3I9SA 4XPDB 3CXPA 2OZGA 3R1KA 4XPDC 4JD6A 1KZFA 1S7LA 5KTCA 2ZW4A 3P2FA 4FD7A 4CRYB 2CNSA 4KOVA 2HQYA 2ATRA 4RI1A 3SHPA 2RC4A 4CAVA 3DDDA 2J8MA 3NE7A 4U5YA 4UA3A 3UY5A 3R96A 2OB0A 1YGHA 3JUWA 4CRZB 2R7HA 1Z4RA 1MJ9A 3W6SA 4BMHA 2ARHA 5E96A 1SQHA 4IF5A 5J8FA 4KVME 2VI7A 2P0WA 1K4JA 2REEA 1S3ZA 4R57A 2Q04A 5C82A 1IB1E 1YVKA 2OZUA 4KOUA 1S7FA 3F8KA 4R3KA 1B6BA 3F5BA 4MY3A 4XNHB 1IYKA 3TT2A 2FCKA 3FRMA 1XMTA 3S6HA 3DNSA 4E0AA 3ZJ0A 4R3LA 4EVYA 5EC4A 4KVXA 4OADA 5C88A 2D4PA 4KOYA 2Q4VA 4B5OA 4PSXA 2Z10A 1QSRA 2Q4YA 3GKRA 4RS2A 4KOSA 4MY0A 1M4DA 1XF8A 3P2HA 1NSLA 4J3GA 1P4NA 4MHDA 2BL1A 2FSRA 4JJXA 1QSTA 2G3AA 3TO6A 3SXOA 1S60A 3E0KA 5IB0A 1KUXA 2JDCA 5JQ4A 4F6AA 3DR8A 4X5KA 5KTDA 1XE4A 2F5IA 2ZW7A 3D8PA 4I49A 1YK3A 3PZJA 4OLLA 1VKCA 3W91A 1R57A 2HV2A 1MK4A 1XIXA 2J8NA 5H86A 1IICA 2FIAA 4B5PA 4KZTA 4CAXA 1NE9A 4HNYB 1BO4A 2OZHA 4MI4A 2JLMA 2Z0ZA 3FYNA 2FE7A 2PQ8A 2H5MA 4E8OA 1NMTA 4QVTA 3D2PA 3FIXA 4AG9A 1Y9KA 4H6UA 3TOBA 2ZXVA 3H4QA 3QAHA 4QB9A 1Y7RA 2VQYA 3KKWA 4KVOE 4YRHA 3B8GA 3R9FA 4II9A 4F0YA 1YR0A 3I3GA 3C26A 2BEIA 3T9YA 2NMTA 1BOBA 5DWMA 1TIQA 4XPKA 5I0CA 2P6EA 3PGPA 2R1IA 4U9YA 3K9UA 1LRZA 1UFHA 2DXQA 3S6KA 4AVCA 2WPWA 4FD5A 4AVAA 2Y0MA 4NSQA 4K30A 5F49A 3TFYA 3FNCA 3T90A 1Z9UA 1Q2YA 3VWDA 1ON0A 5JPHA 3D3SA 3EO4A 1RO5A 3OWCA 1M4IA 2Q0YA 1PU9A 5F46A 2J8RA 3SXNA 3BJ7A 2P6GA 1YX0A 2PR8A 1I12A 1P0HA 4NCZA 2VEZA 1M4GA 4LX9A 1PUAA 5CNPA 5ISVA 2JDDA 2OU2A 5H84A 2Z11A 3G3SA 3R9GA 2B4DB 2CNTA 4QC6A 2FS5A 3RYOA 2X7BA 4B5PB 1MJBA 4H89A 5F47A 3EFAA 3CXSA 3G8WA 4M85A 1RXTA 1IIDA 2B58A 4HNXB 5FVJA 3R95A 3VWEA 1U6MA 3R9EA 5HMNA 1V0CA 4XPLA 2BUEA 2I79A 3WR7A 2R98A 1J4JA 4ZBGA 2GIVA 3F0AA 2REFA 4JXRA 4YGOA 3LODA 2ZW5A 4M3SA 4Y49C 4KOTA 1IYLA 3ZZIA 5J8CA 5DWNA 3DSBA 1CJWA 2OH1A 4JLYA 4ONUA 3FXTA 4CS0B 2B3VA 1CM0A 1Y9WA 4HKFA 4JXQA 2IL4A 5F48A 1S7KA 3GY9A 4ORFA 3S6GA 4KLVA 4CAWA 3TO7A 4FD6A 4UBRA 1Q2CA 2I00A 3D2MA 4HNWB 2VZYA 3GYAA 1I21A 1WK4A 2R8VA 4AG7A 5IV0A 4L89A 3IWGA 3PP9A 1VHSA 3S6FA 2AJ6A 5IX3A 1YVOA 4KLWA 1QSOA 3EY5A 3QB8A 2B4DA
chains in the Genus database with same CATH superfamily
2PIYA 1ZO0A 4JWPA 6CPAA 2D4OA 2PSWA 2ZPAA 1GHEA 4GXHA 4LQGA 5G22A 1YLEA 4XNHC 3TE4A 3FBUA 2BSWA 4CGOA 5LRKA 1JQGA 4KOXA 4PPZA 2B5GA 4B14A 3CZXA 1TKJA 2HUZA 3B2YA 2A4NA 2WPXA 2VXKA 3B35A 3WABA 5JGFA 3H8GA 4PK3A 2Q7BA 3FB3A 3D7FA 2QMLA 4DYOA 4Y49B 4QUSA 2GE3A 2Z3OA 4EMEA 2CTBA 2JEVA 2PJCA 3KL9A 4KORA 4UWIA 4PK2A 1TF9A 1KUVA 2FL4A 3D7HA 1LAMA 1Y0RA 2QYVA 1QSMA 1S7NA 4R87A 1YMEA 3B3CA 2AE6A 4PXEA 1M44A 4UEEA 5HH1A 1R43A 3BLNA 1OBRA 1EE3P 4UIBA 5K8MA 4IUSA 4FD4A 4P45A 1YREA 3RNZA 4B13A 4RUHA 3NE8A 3KASA 3EXNA 4L8AA 2PJ1A 4R7MA 4Q36A 4MHPA 3B3VA 3JTKA 3V8IA 1WWZA 4F9UA 2Q4ZA 1FY7A 4MBUA 4AVBA 3NH5A 3RBUA 3VH9A 1XFOA 2Z3LA 3LACA 3GB0A 2QECA 4CYQA 2C6PA 2G0BA 2ZW6A 4KUAA 2EUIA 2ZEEA 3W6XA 4A31A 4NEXA 1OZPA 2F8HA 2B3UA 2B5GB 3EC4A 3FX6A 4OAEA 4PV6A 1ZG9A 4DNCA 2GU2A 3BJ8A 4A37A 3DR6A 2ZEHA 3MGDA 4UWJA 4MJ8A 2AFMA 3IO1A 4F8ZA 4BD9A 4CGMA 2DF5A 2VZZA 3FMCA 4MCPA 4NGSA 5AG4A 4OMEA 5I4MA 2AFZA 1HDUA 2EVNA 5CPAA 5J1QA 3DGVA 7CPAA 3RO0A 5K8OA 5KTAA 1Z2LA 4OC2A 8CPAA 4ZGYB 1Q2DA 3HUVA 4C2ZA 3D68A 4U9ZA 2KCWA 4KUBA 2PR1A 4NGQA 2B4BA 3TTHA 3I1UA 1KUYA 2C27A 3SJGA 1L0CA 3N7ZA 4H6ZA 4KOWA 4CGPA 1IOIA 3GUXA 1QSNA 2FXFA 4C68A 2VBQA 1B87A 1ZLHA 2FT0A 2QIRA 4JYWA 1M1DA 4MCRA 2AFOA 1N71A 1Z8TA 1VHEA 2IMOA 4NF1A 3TCVA 1JWQA 4C2XA 3TO9A 4JZ0A 2K5TA 4ZX9A 2NYQA 4UEZA 4LUAA 3IGRA 2GLFA 4NXYA 5EBVA 2PDOA 1XMBA 1YQEA 4MCSA 2ZEDA 1I1DA 4CAEA 1Z4EA 2PC1A 1TXRA 2ZEPA 4MCQA 4E2AA 2PE3A 2FIWA 1IOFA 2Z3NA 2Q44A 2POKA 3NH8A 4CYPA 5IV0A 4QBJA 4GS4A 2G3TA 2O28A 3NFZA 3ISXA 4AB7A 4A94A 1H8LA 1LCPA 3CXQA 3FH4A 4R9MA 2PRQA 3FVLA 3TOAA 3JVNA 2GREA 4PSWA 2P6FA 1MJAA 4A2ZA 2ZELA 5K8PA 2CNMA 1XEBA 2AFUA 3CDXA 4MFZA 5GCNA 3IFEA 2CXAA 2PRBA 3LD2A 2CY2A 1S5KA 5JH9A 2RB7A 3IU1A 2GANA 3H8FA 1IY7A 2IQ6A 2NSMA 4YFJA 3I9SA 4XPDB 3CXPA 3FECA 2OZGA 3R1KA 1IGBA 2PVWA 2Z3PA 4KSIA 4P4FA 4BBHA 2RFHA 4XPDC 4JD6A 1KZFA 1PCAA 1S7LA 4ZY2A 5KTCA 2ZW4A 3P2FA 5JM6A 4FD7A 4PXBA 4CRYB 3VATA 4B10A 2CNSA 4TNUA 4KOVA 2HQYA 4UFWA 1QQ9A 2PJ8A 2ATRA 4HPSA 2PJ7A 4RI1A 2ZOFA 1CPXA 3SHPA 2RC4A 4UCPA 4MHNA 4P4IA 4C7IA 1Z8XA 4CAVA 4UCMA 5HVGA 1ZG8A 3DDDA 2J8MA 2PJ4A 3IU2A 3NE7A 4U5YA 4ONWA 4UA3A 4OC5A 3FEEA 3R96A 2OB0A 3UY5A 1YGHA 3JUWA 2VL1A 3VARA 4BINA 4F9VA 1XRYA 2AFXA 3B3TA 4CRZB 2R7HA 1Z4RA 1MJ9A 2YNCA 3KHXA 4OC0A 3W6SA 1BLLE 4BMHA 2ARHA 3FJUA 2JBKA 5E96A 3SJXA 2ZOGA 4UCNA 4EFDA 1SQHA 2O53A 4IF5A 2EK9A 4A39A 5J8FA 4KVME 1TF8A 1DE4C 2VI7A 2P0WA 1K4JA 1XBUA 5D29A 2REEA 4CPAA 1S3ZA 4R57A 2Q04A 1VGYA 3WT4A 4YU9A 5C82A 1IB1E 4OIWA 1YVKA 4NGTA 2WYRA 4NGNA 1YLOA 3H5ZA 2OZUA 4KOUA 4C7HA 4WJBA 4A33A 1ZLIA 1S7FA 2PIZA 2PJ6A 2Q51A 3F8KA 4R3KA 1CP7A 1B6BA 3KI9A 1FT7A 2BO9A 3D7GA 3B3WA 3F5BA 3LWUA 4MY3A 4FUUA 4XNHB 5ELYA 1IYKA 1ARLA 1AYEA 3WC7A 1BAVA 3TT2A 1GYTA 1PYTB 2PJ3A 2FCKA 2ZENA 3FRMA 3T8WA 1XMTA 3B7IA 3S6HA 5D8NA 2XEFA 3D7DA 4B6ZA 1YW6A 4P4BA 3H8EA 3DNSA 4IK2A 3SJFA 4E0AA 2FVGA 2HC9A 3ZJ0A 4CAFA 5THWA 2BCOA 1BPMA 4R3LA 4EVYA 1CPSA 5AG5A 5LYLA 5EC4A 4KVXA 4NJRA 2V8HA 4OADA 4ZY1A 2EWBA 3N5FA 4NGRA 2D4PA 5C88A 4UFVA 4KOYA 2Q4VA 1ZG7A 4PSXA 2Z10A 3SJEA 4B5OA 1QSRA 2Q4YA 2PVVA 1M4LA 3GKRA 3IWEA 3KQXA 4RS2A 4KOSA 4ZX8A 5HXDA 1M4DA 1XF8A 4MY0A 3FF3A 3P2HA 4YWYA 4CYNA 1NSLA 4J3GA 1Z8LA 4OP4A 5EMIA 1P4NA 3BHXA 5HVHA 4MHDA 4M6HA 2BL1A 1F2PA 2FSRA 4JJXA 2PJBA 1QSTA 2C1CA 2QVPA 2G3AA 3TO6A 3DLJA 3SXOA 4F0XA 1ELLP 2GLJA 4Z65A 4M6IA 5G21A 5LYIA 1S60A 3E0KA 1IU8A 3PB7X 5IB0A 1KUXA 1KWMA 4A38A 2JDCA 3CPXA 4ZYQA 3A9LA 3QNVA 4F6AA 1HEEA 5JQ4A 3DR8A 5LYFA 4X5KA 5KTDA 2OR4A 1XE4A 2F5IA 2HB6A 3KR5A 5LYDA 1VHOA 3NH4A 2ZW7A 3D8PA 4I49A 1YK3A 2YNEA 2G9DA 3PZJA 5LRJA 4OLLA 3D4UA 2BOAA 1VKCA 3W91A 4A95A 1CP6A 1LFWA 1ARMA 4MHZA 3IC1A 1R57A 1Y0YA 2HV2A 1MK4A 1XIXA 2J8NA 4ZY0A 2WUUA 4UFXA 5H86A 3PB9X 3MRUA 1IICA 3WC6A 4X3RA 2OOTA 3KGQA 2FIAA 2XEJA 4NGMA 4C2YA 4B5PA 4KZTA 4CAXA 1NE9A 4OC3A 4HNYB 4OKOA 4P4EA 1BO4A 2OZHA 3B3SA 4MI4A 4FWUA 2JLMA 2Z0ZA 2C6GA 3FYNA 3PB4X 1TKHA 2FE7A 2PQ8A 4O23A 4OC1A 3BI0A 2H5MA 3V38A 1NMTA 4E8OA 2CTCA 2PJ0A 4QVTA 1LAPA 5HVFA 3D2PA 3FIXA 3BXMA 3SI2A 3TC8A 1YW4A 4AG9A 1Y9KA 4A30A 4H6UA 2JEWA 2Q43A 4TWEA 3TOBA 2ZXVA 3H4QA 1HDQA 3QAHA 4QB9A 2Z3KA 1Y7RA 2VQYA 3KKWA 4KVOE 4LQ6A 4YRHA 3B8GA 3R9FA 4EWTA 4MFLA 4II9A 4F0YA 1YR0A 2WZNA 3WC5A 1Z8WA 2IJZA 3I3GA 2CIJA 3C26A 2BEIA 4PQAA 3T9YA 2NMTA 1BOBA 1LANA 2I3CA 4NGPA 5DWMA 2F7VA 1TIQA 4XPKA 2XEGA 2ZEFA 1BPNA 4A32A 5I0CA 2P6EA 4RN7A 2ZEOA 3PGPA 4R6TA 4OC4A 3L2NA 1AMPA 2JBJA 2R1IA 4U9YA 2PJ2A 3K9UA 4MFKA 4CYOA 1LRZA 1UFHA 3KHZA 4DUKA 1Y7EA 4P4DA 2DXQA 3PBEA 4P44A 3FEDA 3GLJA 3S6KA 4AVCA 3IIBA 2WPWA 4FD5A 4AVAA 1ELMP 4P10A 2Y0MA 3GIUA 4IAVA 4K30A 4NSQA 1X12A 2EBJA 4UIAA 5F49A 3TFYA 2ZEGA 4P6YA 3BI1A 3K9TA 3RAMA 3FNCA 2AFWA 2DEAA 2Q7SA 1Z9UA 1Q2YA 4R76A 3T90A 3VWDA 1QMUA 1ON0A 2AFSA 5JPHA 5LRGA 4UEFA 3D3SA 4B11A 2YNDA 3EO4A 5A28A 3RZAA 1RO5A 3OWCA 1M4IA 2DPSA 2Q0YA 3IWWA 4Q38A 1PU9A 1UWYA 3PB8X 5F46A 4MRIA 2J8RA 1NSAA 2V8GA 3SXNA 3BJ7A 2P6GA 1YX0A 2PR8A 4MFJA 1I12A 5K8NA 1P0HA 4NCZA 4H2KA 2VEZA 3KR4A 3PRTA 2PCUA 2C6CA 1M4GA 4PXDA 3V7ZA 4LX9A 1PUAA 5CNPA 5ISVA 3TX8A 3CT9A 2DPTA 2JDDA 3IJ3A 2EK8A 2OU2A 3KZWA 3PEIA 5H84A 4FAIA 2Z11A 2Z3MA 4MMOA 1VIXA 2YNCC 3G3SA 2XEIA 3R9GA 2B4DB 2CNTA 4QC6A 4MHYA 2CF4A 2J9AA 4K3NA 5G1ZA 2EO8A 1CX8A 2FS5A 4CGLA 3RYOA 2X7BA 4B5PB 4MFQA 1MJBA 4M6GA 1AUGA 4H89A 5F47A 3EFAA 3K2KA 3MN8A 1TKFA 3CXSA 1YSJA 4IHMA 3G8WA 1CBXA 4CGNA 4M85A 3CPAA 4OIDA 1RXTA 3ISZA 1IIDA 4MXUA 2PJ5A 4KS9A 2B58A 4ZI6A 2ODFA 1LOKA 4HNXB 5FVJA 3R95A 5CBMA 3VWEA 4FBEA 1U6MA 3R9EA 2GFQA 5F09A 3S9MA 2PJ9A 1CG2A 3LMSA 5G20A 4W9YA 4GM5A 5HMNA 2ABZA 2ZEMA 1V0CA 3PFEA 4R8FA 2ANPA 1X10A 4XPLA 4WWVA 5AG7A 1R3NA 2BUEA 2I79A 3WR7A 1DTDA 2R98A 1J4JA 4ZBGA 2V8VA 2GIVA 1Z5RA 3F0AA 2REFA 2PJAA 3PBBA 3JRUA 4JXRA 4YGOA 3LODA 2ZW5A 5DS0A 5BWAB 3D66A 4Q7AA 4NJQA 4M3SA 4B12A 4Y49C 2YGWA 4KOTA 1RTQA 1IYLA 2O4HA 2V77A 4UF4A 3S9NA 1Q7LA 3ZZIA 5J8CA 3IEHA 5DWNA 5IB9A 3DSBA 1CJWA 3NA6A 3D67A 2OH1A 4JLYA 4ONUA 3FXTA 4CS0B 3S9LA 4PXCA 4P4JA 3SI0A 2B3VA 1CM0A 1Y9WA 5AG6A 4HKFA 4JXQA 4AXVA 2IL4A 5F48A 1S7KA 3GY9A 4DJLA 5A27A 1F2OA 4G1PA 3QAYA 4ORFA 3S6GA 4KLVA 4CAWA 3SI1A 1XJOA 3TO7A 4FD6A 4UBRA 1Q2CA 2I00A 3D2MA 2VZYA 3KQZA 3PFOA 4HNWB 2QJ8A 1I21A 1WK4A 2R8VA 2V8DA 3GYAA 4X8IA 5AGEA 4AG7A 4MFPA 1FNOA 4L89A 3IWGA 3PP9A 3HLPA 1VHSA 1A2ZA 4NFRA 4KSAA 3S6FA 2AJ6A 4KSFA 5IX3A 1F57A 1XOVA 4X2TA 1YVOA 2WSAA 4KLWA 1QSOA 3EY5A 3PB6X 3QB8A 2B4DA
chains in the Genus database with same CATH topology
1ZO0A 4JWPA 2D4OA 2PSWA 2ZPAA 1GHEA 5G22A 1YLEA 4XNHC 3TE4A 3FBUA 2BSWA 4CGOA 4KOXA 2B5GA 4B14A 2HUZA 2A4NA 2WPXA 2VXKA 4PK3A 2Q7BA 3FB3A 2QMLA 4Y49B 4QUSA 2GE3A 2Z3OA 4UWIA 2JEVA 4KORA 4PK2A 2FL4A 1KUVA 1QSMA 1S7NA 4R87A 2AE6A 1M44A 5HH1A 3BLNA 4IUSA 4FD4A 4B13A 1YREA 3EXNA 4L8AA 4Q36A 3JTKA 3V8IA 1WWZA 4MBUA 1FY7A 4AVBA 2Z3LA 2QECA 4CYQA 2G0BA 2ZW6A 4KUAA 2EUIA 3W6XA 4A31A 4NEXA 1OZPA 2B3UA 2B5GB 3EC4A 4OAEA 4PV6A 4DNCA 3BJ8A 3DR6A 3MGDA 4UWJA 4MJ8A 4CGMA 2VZZA 5AG4A 2EVNA 5KTAA 4ZGYB 1Q2DA 4C2ZA 4U9ZA 2KCWA 4KUBA 2PR1A 2B4BA 3TTHA 1KUYA 2C27A 1L0CA 3N7ZA 4H6ZA 4KOWA 4CGPA 1QSNA 2FXFA 4C68A 2VBQA 1B87A 2FT0A 2QIRA 1M1DA 1N71A 4NF1A 3TCVA 4C2XA 3TO9A 2K5TA 4LUAA 3IGRA 4NXYA 5EBVA 2PDOA 1I1DA 4CAEA 1Z4EA 2PC1A 4E2AA 2Z3NA 2FIWA 2Q44A 4CYPA 4QBJA 4GS4A 2G3TA 2O28A 4AB7A 3CXQA 4R9MA 3TOAA 3JVNA 4PSWA 4A2ZA 1MJAA 2P6FA 2CNMA 1XEBA 4MFZA 5GCNA 2CXAA 2PRBA 3LD2A 2CY2A 1S5KA 3IU1A 2GANA 4YFJA 3I9SA 4XPDB 3CXPA 2OZGA 3R1KA 2Z3PA 4BBHA 4XPDC 4JD6A 1KZFA 1S7LA 5KTCA 2ZW4A 3P2FA 4FD7A 4CRYB 4B10A 2CNSA 4KOVA 2HQYA 4UFWA 2ATRA 4RI1A 3SHPA 2RC4A 4UCPA 4C7IA 4CAVA 4UCMA 3DDDA 2J8MA 3IU2A 3NE7A 4U5YA 4UA3A 3UY5A 3R96A 2OB0A 1YGHA 3JUWA 4CRZB 2R7HA 1Z4RA 1MJ9A 2YNCA 3W6SA 4BMHA 2ARHA 5E96A 4UCNA 1SQHA 4IF5A 5J8FA 4KVME 2VI7A 2P0WA 1K4JA 2REEA 1S3ZA 4R57A 2Q04A 5C82A 1IB1E 1YVKA 3H5ZA 2OZUA 4KOUA 4C7HA 4A33A 1S7FA 3F8KA 4R3KA 1B6BA 3F5BA 4MY3A 4XNHB 1IYKA 3TT2A 2FCKA 3FRMA 1XMTA 3S6HA 3DNSA 4E0AA 3ZJ0A 4CAFA 4R3LA 4EVYA 5AG5A 5EC4A 4KVXA 4OADA 5C88A 2D4PA 4UFVA 4KOYA 2Q4VA 4B5OA 4PSXA 2Z10A 1QSRA 2Q4YA 3IWEA 3GKRA 4RS2A 4KOSA 1M4DA 1XF8A 4MY0A 3P2HA 4CYNA 1NSLA 4J3GA 1P4NA 4MHDA 2BL1A 2FSRA 4JJXA 1QSTA 2G3AA 3TO6A 3SXOA 4F0XA 5G21A 1S60A 3E0KA 5IB0A 1KUXA 2JDCA 5JQ4A 3A9LA 4F6AA 3DR8A 4X5KA 5KTDA 1XE4A 2F5IA 2ZW7A 3D8PA 4I49A 1YK3A 2YNEA 3PZJA 4OLLA 1VKCA 3W91A 4A95A 1R57A 2HV2A 1MK4A 1XIXA 2J8NA 2WUUA 4UFXA 5H86A 1IICA 2FIAA 4C2YA 4B5PA 4KZTA 4CAXA 1NE9A 4HNYB 1BO4A 2OZHA 4MI4A 2JLMA 2Z0ZA 3FYNA 2FE7A 2PQ8A 2H5MA 4E8OA 1NMTA 4QVTA 3D2PA 3FIXA 4AG9A 1Y9KA 4A30A 4H6UA 3TOBA 2ZXVA 3H4QA 3QAHA 4QB9A 2Z3KA 1Y7RA 2VQYA 3KKWA 4KVOE 4YRHA 3B8GA 3R9FA 4MFLA 4II9A 4F0YA 1YR0A 3I3GA 3C26A 2BEIA 3T9YA 2NMTA 1BOBA 5DWMA 1TIQA 4XPKA 4A32A 5I0CA 2P6EA 3PGPA 2R1IA 4U9YA 3K9UA 4MFKA 4CYOA 1LRZA 1UFHA 2DXQA 3S6KA 4AVCA 2WPWA 4FD5A 4AVAA 2Y0MA 4NSQA 4K30A 5F49A 3TFYA 3FNCA 3T90A 1Z9UA 1Q2YA 3VWDA 1ON0A 5JPHA 3D3SA 4B11A 2YNDA 3EO4A 5A28A 1RO5A 3OWCA 1M4IA 2DPSA 2Q0YA 4Q38A 1PU9A 5F46A 2J8RA 3SXNA 3BJ7A 2P6GA 1YX0A 2PR8A 4MFJA 1I12A 1P0HA 4NCZA 2VEZA 1M4GA 4LX9A 1PUAA 5CNPA 5ISVA 2DPTA 2JDDA 2OU2A 5H84A 2Z11A 2Z3MA 3G3SA 2YNCC 3R9GA 2B4DB 2CNTA 4QC6A 5G1ZA 2FS5A 4CGLA 3RYOA 2X7BA 4B5PB 4MFQA 1MJBA 4H89A 5F47A 3EFAA 3CXSA 3G8WA 4CGNA 4M85A 1RXTA 1IIDA 4KS9A 2B58A 4HNXB 5FVJA 3R95A 3VWEA 1U6MA 3R9EA 5G20A 5HMNA 1V0CA 4XPLA 5AG7A 2BUEA 2I79A 3WR7A 2R98A 1J4JA 4ZBGA 2GIVA 3F0AA 2REFA 4JXRA 4YGOA 3LODA 2ZW5A 5BWAB 4M3SA 4B12A 4Y49C 2YGWA 4KOTA 1IYLA 3ZZIA 5J8CA 5DWNA 3DSBA 1CJWA 2OH1A 4JLYA 4ONUA 3FXTA 4CS0B 2B3VA 1CM0A 1Y9WA 5AG6A 4HKFA 4JXQA 2IL4A 5F48A 1S7KA 3GY9A 5A27A 4ORFA 3S6GA 4KLVA 4CAWA 3TO7A 4FD6A 4UBRA 1Q2CA 2I00A 3D2MA 4HNWB 2VZYA 3GYAA 1I21A 1WK4A 2R8VA 4AG7A 5IV0A 5AGEA 4MFPA 4L89A 3IWGA 3PP9A 1VHSA 4KSAA 3S6FA 2AJ6A 4KSFA 5IX3A 1YVOA 2WSAA 4KLWA 1QSOA 3EY5A 3QB8A 2B4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JWP A;  2D4O A;  2PSW A;  2ZPA A;  1GHE A;  1YLE A;  4XNH C;  3TE4 A;  3FBU A;  2BSW A;  4KOX A;  2B5G A;  2HUZ A;  2A4N A;  2WPX A;  2VXK A;  4PK3 A;  2Q7B A;  3FB3 A;  2QML A;  4Y49 B;  4QUS A;  2GE3 A;  4UWI A;  2JEV A;  4KOR A;  4PK2 A;  2FL4 A;  1KUV A;  1QSM A;  1S7N A;  4R87 A;  2AE6 A;  1M44 A;  5HH1 A;  3BLN A;  4IUS A;  4FD4 A;  1YRE A;  3EXN A;  4L8A A;  3V8I A;  1WWZ A;  4MBU A;  1FY7 A;  4AVB A;  2QEC A;  2G0B A;  2ZW6 A;  4KUA A;  2EUI A;  3W6X A;  4NEX A;  1OZP A;  2B3U A;  4PV6 A;  2B5G B;  3EC4 A;  4OAE A;  4DNC A;  3BJ8 A;  3DR6 A;  3MGD A;  4UWJ A;  4MJ8 A;  2VZZ A;  2EVN A;  5KTA A;  1Q2D A;  4U9Z A;  2KCW A;  4KUB A;  2PR1 A;  2B4B A;  3TTH A;  1KUY A;  2C27 A;  1L0C A;  3N7Z A;  4H6Z A;  4KOW A;  1QSN A;  2FXF A;  2VBQ A;  1B87 A;  2FT0 A;  2QIR A;  1M1D A;  1N71 A;  4NF1 A;  3TCV A;  3TO9 A;  2K5T A;  4LUA A;  3IGR A;  4NXY A;  5EBV A;  2PDO A;  1I1D A;  1Z4E A;  2PC1 A;  4E2A A;  2FIW A;  2Q44 A;  4QBJ A;  4GS4 A;  2G3T A;  2O28 A;  4AB7 A;  3CXQ A;  4R9M A;  3TOA A;  3JVN A;  4PSW A;  1MJA A;  2P6F A;  2CNM A;  1XEB A;  5GCN A;  2PRB A;  3LD2 A;  2CY2 A;  1S5K A;  2GAN A;  4YFJ A;  3I9S A;  4XPD B;  3CXP A;  2OZG A;  3R1K A;  4XPD C;  4JD6 A;  1KZF A;  1S7L A;  5KTC A;  2ZW4 A;  3P2F A;  4FD7 A;  4CRY B;  2CNS A;  4KOV A;  2HQY A;  2ATR A;  4RI1 A;  3SHP A;  2RC4 A;  4CAV A;  3DDD A;  2J8M A;  3NE7 A;  4U5Y A;  4UA3 A;  3UY5 A;  3R96 A;  2OB0 A;  1YGH A;  3JUW A;  4CRZ B;  2R7H A;  1Z4R A;  1MJ9 A;  3W6S A;  4BMH A;  2ARH A;  5E96 A;  1SQH A;  4IF5 A;  5J8F A;  4KVM E;  2VI7 A;  2P0W A;  1K4J A;  2REE A;  1S3Z A;  4R57 A;  2Q04 A;  5C82 A;  1IB1 E;  1YVK A;  2OZU A;  4KOU A;  1S7F A;  3F8K A;  4R3K A;  1B6B A;  3F5B A;  4MY3 A;  4XNH B;  1IYK A;  3TT2 A;  2FCK A;  3FRM A;  1XMT A;  3S6H A;  3DNS A;  4E0A A;  3ZJ0 A;  4R3L A;  4EVY A;  5EC4 A;  4KVX A;  4OAD A;  5C88 A;  2D4P A;  4KOY A;  2Q4V A;  4B5O A;  4PSX A;  2Z10 A;  1QSR A;  2Q4Y A;  3GKR A;  4RS2 A;  4KOS A;  4MY0 A;  1M4D A;  1XF8 A;  3P2H A;  1NSL A;  4J3G A;  1P4N A;  4MHD A;  2BL1 A;  2FSR A;  4JJX A;  1QST A;  2G3A A;  3TO6 A;  3SXO A;  1S60 A;  3E0K A;  5IB0 A;  1KUX A;  2JDC A;  5JQ4 A;  4F6A A;  3DR8 A;  4X5K A;  5KTD A;  1XE4 A;  2F5I A;  2ZW7 A;  3D8P A;  4I49 A;  1YK3 A;  3PZJ A;  4OLL A;  1VKC A;  3W91 A;  1R57 A;  2HV2 A;  1MK4 A;  1XIX A;  2J8N A;  5H86 A;  1IIC A;  2FIA A;  4B5P A;  4KZT A;  4CAX A;  1NE9 A;  4HNY B;  1BO4 A;  2OZH A;  4MI4 A;  2JLM A;  2Z0Z A;  3FYN A;  2FE7 A;  2PQ8 A;  2H5M A;  4E8O A;  1NMT A;  4QVT A;  3D2P A;  3FIX A;  4AG9 A;  1Y9K A;  4H6U A;  3TOB A;  2ZXV A;  3H4Q A;  3QAH A;  4QB9 A;  1Y7R A;  2VQY A;  3KKW A;  4KVO E;  4YRH A;  3B8G A;  3R9F A;  4II9 A;  4F0Y A;  1YR0 A;  3I3G A;  3C26 A;  2BEI A;  3T9Y A;  2NMT A;  1BOB A;  5DWM A;  1TIQ A;  4XPK A;  5I0C A;  2P6E A;  3PGP A;  2R1I A;  4U9Y A;  3K9U A;  1LRZ A;  1UFH A;  2DXQ A;  3S6K A;  4AVC A;  2WPW A;  4FD5 A;  4AVA A;  2Y0M A;  4NSQ A;  4K30 A;  5F49 A;  3TFY A;  3FNC A;  3T90 A;  1Z9U A;  1Q2Y A;  3VWD A;  1ON0 A;  5JPH A;  3D3S A;  3EO4 A;  1RO5 A;  3OWC A;  1M4I A;  2Q0Y A;  1PU9 A;  5F46 A;  2J8R A;  3SXN A;  3BJ7 A;  2P6G A;  1YX0 A;  2PR8 A;  1I12 A;  1P0H A;  4NCZ A;  2VEZ A;  1M4G A;  4LX9 A;  1PUA A;  5CNP A;  5ISV A;  2JDD A;  2OU2 A;  5H84 A;  2Z11 A;  3G3S A;  3R9G A;  2B4D B;  2CNT A;  4QC6 A;  2FS5 A;  3RYO A;  2X7B A;  4B5P B;  1MJB A;  4H89 A;  5F47 A;  3EFA A;  3CXS A;  3G8W A;  4M85 A;  1RXT A;  1IID A;  2B58 A;  4HNX B;  5FVJ A;  3R95 A;  3VWE A;  1U6M A;  3R9E A;  5HMN A;  1V0C A;  4XPL A;  2BUE A;  2I79 A;  3WR7 A;  2R98 A;  1J4J A;  4ZBG A;  2GIV A;  3F0A A;  2REF A;  4JXR A;  4YGO A;  3LOD A;  2ZW5 A;  4M3S A;  4Y49 C;  4KOT A;  1IYL A;  3ZZI A;  5J8C A;  5DWN A;  3DSB A;  1CJW A;  2OH1 A;  4JLY A;  4ONU A;  3FXT A;  4CS0 B;  2B3V A;  1CM0 A;  1Y9W A;  4HKF A;  4JXQ A;  2IL4 A;  5F48 A;  1S7K A;  3GY9 A;  4ORF A;  3S6G A;  4KLV A;  4CAW A;  3TO7 A;  4FD6 A;  4UBR A;  1Q2C A;  2I00 A;  3D2M A;  4HNW B;  2VZY A;  3GYA A;  1I21 A;  1WK4 A;  2R8V A;  4AG7 A;  5IV0 A;  4L89 A;  3IWG A;  3PP9 A;  1VHS A;  3S6F A;  2AJ6 A;  5IX3 A;  1YVO A;  4KLW A;  1QSO A;  3EY5 A;  3QB8 A;  2B4D A; 
#chains in the Genus database with same CATH topology
 2PIY A;  1ZO0 A;  4JWP A;  6CPA A;  2D4O A;  2PSW A;  2ZPA A;  1GHE A;  4GXH A;  4LQG A;  5G22 A;  1YLE A;  4XNH C;  3TE4 A;  3FBU A;  2BSW A;  4CGO A;  5LRK A;  1JQG A;  4KOX A;  4PPZ A;  2B5G A;  4B14 A;  3CZX A;  1TKJ A;  2HUZ A;  3B2Y A;  2A4N A;  2WPX A;  2VXK A;  3B35 A;  3WAB A;  5JGF A;  3H8G A;  4PK3 A;  2Q7B A;  3FB3 A;  3D7F A;  2QML A;  4DYO A;  4Y49 B;  4QUS A;  2GE3 A;  2Z3O A;  4EME A;  2CTB A;  2JEV A;  2PJC A;  3KL9 A;  4KOR A;  4UWI A;  4PK2 A;  1TF9 A;  1KUV A;  2FL4 A;  3D7H A;  1LAM A;  1Y0R A;  2QYV A;  1QSM A;  1S7N A;  4R87 A;  1YME A;  3B3C A;  2AE6 A;  4PXE A;  1M44 A;  4UEE A;  5HH1 A;  1R43 A;  3BLN A;  1OBR A;  1EE3 P;  4UIB A;  5K8M A;  4IUS A;  4FD4 A;  4P45 A;  1YRE A;  3RNZ A;  4B13 A;  4RUH A;  3NE8 A;  3KAS A;  3EXN A;  4L8A A;  2PJ1 A;  4R7M A;  4Q36 A;  4MHP A;  3B3V A;  3JTK A;  3V8I A;  1WWZ A;  4F9U A;  2Q4Z A;  1FY7 A;  4MBU A;  4AVB A;  3NH5 A;  3RBU A;  3VH9 A;  1XFO A;  2Z3L A;  3LAC A;  3GB0 A;  2QEC A;  4CYQ A;  2C6P A;  2G0B A;  2ZW6 A;  4KUA A;  2EUI A;  2ZEE A;  3W6X A;  4A31 A;  4NEX A;  1OZP A;  2F8H A;  2B3U A;  2B5G B;  3EC4 A;  3FX6 A;  4OAE A;  4PV6 A;  1ZG9 A;  4DNC A;  2GU2 A;  3BJ8 A;  4A37 A;  3DR6 A;  2ZEH A;  3MGD A;  4UWJ A;  4MJ8 A;  2AFM A;  3IO1 A;  4F8Z A;  4BD9 A;  4CGM A;  2DF5 A;  2VZZ A;  3FMC A;  4MCP A;  4NGS A;  5AG4 A;  4OME A;  5I4M A;  2AFZ A;  1HDU A;  2EVN A;  5CPA A;  5J1Q A;  3DGV A;  7CPA A;  3RO0 A;  5K8O A;  5KTA A;  1Z2L A;  4OC2 A;  8CPA A;  4ZGY B;  1Q2D A;  3HUV A;  4C2Z A;  3D68 A;  4U9Z A;  2KCW A;  4KUB A;  2PR1 A;  4NGQ A;  2B4B A;  3TTH A;  3I1U A;  1KUY A;  2C27 A;  3SJG A;  1L0C A;  3N7Z A;  4H6Z A;  4KOW A;  4CGP A;  1IOI A;  3GUX A;  1QSN A;  2FXF A;  4C68 A;  2VBQ A;  1B87 A;  1ZLH A;  2FT0 A;  2QIR A;  4JYW A;  1M1D A;  4MCR A;  2AFO A;  1N71 A;  1Z8T A;  1VHE A;  2IMO A;  4NF1 A;  3TCV A;  1JWQ A;  4C2X A;  3TO9 A;  4JZ0 A;  2K5T A;  4ZX9 A;  2NYQ A;  4UEZ A;  4LUA A;  3IGR A;  2GLF A;  4NXY A;  5EBV A;  2PDO A;  1XMB A;  1YQE A;  4MCS A;  2ZED A;  1I1D A;  4CAE A;  1Z4E A;  2PC1 A;  1TXR A;  2ZEP A;  4MCQ A;  4E2A A;  2PE3 A;  2FIW A;  1IOF A;  2Z3N A;  2Q44 A;  2POK A;  3NH8 A;  4CYP A;  5IV0 A;  4QBJ A;  4GS4 A;  2G3T A;  2O28 A;  3NFZ A;  3ISX A;  4AB7 A;  4A94 A;  1H8L A;  1LCP A;  3CXQ A;  3FH4 A;  4R9M A;  2PRQ A;  3FVL A;  3TOA A;  3JVN A;  2GRE A;  4PSW A;  2P6F A;  1MJA A;  4A2Z A;  2ZEL A;  5K8P A;  2CNM A;  1XEB A;  2AFU A;  3CDX A;  4MFZ A;  5GCN A;  3IFE A;  2CXA A;  2PRB A;  3LD2 A;  2CY2 A;  1S5K A;  5JH9 A;  2RB7 A;  3IU1 A;  2GAN A;  3H8F A;  1IY7 A;  2IQ6 A;  2NSM A;  4YFJ A;  3I9S A;  4XPD B;  3CXP A;  3FEC A;  2OZG A;  3R1K A;  1IGB A;  2PVW A;  2Z3P A;  4KSI A;  4P4F A;  4BBH A;  2RFH A;  4XPD C;  4JD6 A;  1KZF A;  1PCA A;  1S7L A;  4ZY2 A;  5KTC A;  2ZW4 A;  3P2F A;  5JM6 A;  4FD7 A;  4PXB A;  4CRY B;  3VAT A;  4B10 A;  2CNS A;  4TNU A;  4KOV A;  2HQY A;  4UFW A;  1QQ9 A;  2PJ8 A;  2ATR A;  4HPS A;  2PJ7 A;  4RI1 A;  2ZOF A;  1CPX A;  3SHP A;  2RC4 A;  4UCP A;  4MHN A;  4P4I A;  4C7I A;  1Z8X A;  4CAV A;  4UCM A;  5HVG A;  1ZG8 A;  3DDD A;  2J8M A;  2PJ4 A;  3IU2 A;  3NE7 A;  4U5Y A;  4ONW A;  4UA3 A;  4OC5 A;  3FEE A;  3R96 A;  2OB0 A;  3UY5 A;  1YGH A;  3JUW A;  2VL1 A;  3VAR A;  4BIN A;  4F9V A;  1XRY A;  2AFX A;  3B3T A;  4CRZ B;  2R7H A;  1Z4R A;  1MJ9 A;  2YNC A;  3KHX A;  4OC0 A;  3W6S A;  1BLL E;  4BMH A;  2ARH A;  3FJU A;  2JBK A;  5E96 A;  3SJX A;  2ZOG A;  4UCN A;  4EFD A;  1SQH A;  2O53 A;  4IF5 A;  2EK9 A;  4A39 A;  5J8F A;  4KVM E;  1TF8 A;  1DE4 C;  2VI7 A;  2P0W A;  1K4J A;  1XBU A;  5D29 A;  2REE A;  4CPA A;  1S3Z A;  4R57 A;  2Q04 A;  1VGY A;  3WT4 A;  4YU9 A;  5C82 A;  1IB1 E;  4OIW A;  1YVK A;  4NGT A;  2WYR A;  4NGN A;  1YLO A;  3H5Z A;  2OZU A;  4KOU A;  4C7H A;  4WJB A;  4A33 A;  1ZLI A;  1S7F A;  2PIZ A;  2PJ6 A;  2Q51 A;  3F8K A;  4R3K A;  1CP7 A;  1B6B A;  3KI9 A;  1FT7 A;  2BO9 A;  3D7G A;  3B3W A;  3F5B A;  3LWU A;  4MY3 A;  4FUU A;  4XNH B;  5ELY A;  1IYK A;  1ARL A;  1AYE A;  3WC7 A;  1BAV A;  3TT2 A;  1GYT A;  1PYT B;  2PJ3 A;  2FCK A;  2ZEN A;  3FRM A;  3T8W A;  1XMT A;  3B7I A;  3S6H A;  5D8N A;  2XEF A;  3D7D A;  4B6Z A;  1YW6 A;  4P4B A;  3H8E A;  3DNS A;  4IK2 A;  3SJF A;  4E0A A;  2FVG A;  2HC9 A;  3ZJ0 A;  4CAF A;  5THW A;  2BCO A;  1BPM A;  4R3L A;  4EVY A;  1CPS A;  5AG5 A;  5LYL A;  5EC4 A;  4KVX A;  4NJR A;  2V8H A;  4OAD A;  4ZY1 A;  2EWB A;  3N5F A;  4NGR A;  2D4P A;  5C88 A;  4UFV A;  4KOY A;  2Q4V A;  1ZG7 A;  4PSX A;  2Z10 A;  3SJE A;  4B5O A;  1QSR A;  2Q4Y A;  2PVV A;  1M4L A;  3GKR A;  3IWE A;  3KQX A;  4RS2 A;  4KOS A;  4ZX8 A;  5HXD A;  1M4D A;  1XF8 A;  4MY0 A;  3FF3 A;  3P2H A;  4YWY A;  4CYN A;  1NSL A;  4J3G A;  1Z8L A;  4OP4 A;  5EMI A;  1P4N A;  3BHX A;  5HVH A;  4MHD A;  4M6H A;  2BL1 A;  1F2P A;  2FSR A;  4JJX A;  2PJB A;  1QST A;  2C1C A;  2QVP A;  2G3A A;  3TO6 A;  3DLJ A;  3SXO A;  4F0X A;  1ELL P;  2GLJ A;  4Z65 A;  4M6I A;  5G21 A;  5LYI A;  1S60 A;  3E0K A;  1IU8 A;  3PB7 X;  5IB0 A;  1KUX A;  1KWM A;  4A38 A;  2JDC A;  3CPX A;  4ZYQ A;  3A9L A;  3QNV A;  4F6A A;  1HEE A;  5JQ4 A;  3DR8 A;  5LYF A;  4X5K A;  5KTD A;  2OR4 A;  1XE4 A;  2F5I A;  2HB6 A;  3KR5 A;  5LYD A;  1VHO A;  3NH4 A;  2ZW7 A;  3D8P A;  4I49 A;  1YK3 A;  2YNE A;  2G9D A;  3PZJ A;  5LRJ A;  4OLL A;  3D4U A;  2BOA A;  1VKC A;  3W91 A;  4A95 A;  1CP6 A;  1LFW A;  1ARM A;  4MHZ A;  3IC1 A;  1R57 A;  1Y0Y A;  2HV2 A;  1MK4 A;  1XIX A;  2J8N A;  4ZY0 A;  2WUU A;  4UFX A;  5H86 A;  3PB9 X;  3MRU A;  1IIC A;  3WC6 A;  4X3R A;  2OOT A;  3KGQ A;  2FIA A;  2XEJ A;  4NGM A;  4C2Y A;  4B5P A;  4KZT A;  4CAX A;  1NE9 A;  4OC3 A;  4HNY B;  4OKO A;  4P4E A;  1BO4 A;  2OZH A;  3B3S A;  4MI4 A;  4FWU A;  2JLM A;  2Z0Z A;  2C6G A;  3FYN A;  3PB4 X;  1TKH A;  2FE7 A;  2PQ8 A;  4O23 A;  4OC1 A;  3BI0 A;  2H5M A;  3V38 A;  1NMT A;  4E8O A;  2CTC A;  2PJ0 A;  4QVT A;  1LAP A;  5HVF A;  3D2P A;  3FIX A;  3BXM A;  3SI2 A;  3TC8 A;  1YW4 A;  4AG9 A;  1Y9K A;  4A30 A;  4H6U A;  2JEW A;  2Q43 A;  4TWE A;  3TOB A;  2ZXV A;  3H4Q A;  1HDQ A;  3QAH A;  4QB9 A;  2Z3K A;  1Y7R A;  2VQY A;  3KKW A;  4KVO E;  4LQ6 A;  4YRH A;  3B8G A;  3R9F A;  4EWT A;  4MFL A;  4II9 A;  4F0Y A;  1YR0 A;  2WZN A;  3WC5 A;  1Z8W A;  2IJZ A;  3I3G A;  2CIJ A;  3C26 A;  2BEI A;  4PQA A;  3T9Y A;  2NMT A;  1BOB A;  1LAN A;  2I3C A;  4NGP A;  5DWM A;  2F7V A;  1TIQ A;  4XPK A;  2XEG A;  2ZEF A;  1BPN A;  4A32 A;  5I0C A;  2P6E A;  4RN7 A;  2ZEO A;  3PGP A;  4R6T A;  4OC4 A;  3L2N A;  1AMP A;  2JBJ A;  2R1I A;  4U9Y A;  2PJ2 A;  3K9U A;  4MFK A;  4CYO A;  1LRZ A;  1UFH A;  3KHZ A;  4DUK A;  1Y7E A;  4P4D A;  2DXQ A;  3PBE A;  4P44 A;  3FED A;  3GLJ A;  3S6K A;  4AVC A;  3IIB A;  2WPW A;  4FD5 A;  4AVA A;  1ELM P;  4P10 A;  2Y0M A;  3GIU A;  4IAV A;  4K30 A;  4NSQ A;  1X12 A;  2EBJ A;  4UIA A;  5F49 A;  3TFY A;  2ZEG A;  4P6Y A;  3BI1 A;  3K9T A;  3RAM A;  3FNC A;  2AFW A;  2DEA A;  2Q7S A;  1Z9U A;  1Q2Y A;  4R76 A;  3T90 A;  3VWD A;  1QMU A;  1ON0 A;  2AFS A;  5JPH A;  5LRG A;  4UEF A;  3D3S A;  4B11 A;  2YND A;  3EO4 A;  5A28 A;  3RZA A;  1RO5 A;  3OWC A;  1M4I A;  2DPS A;  2Q0Y A;  3IWW A;  4Q38 A;  1PU9 A;  1UWY A;  3PB8 X;  5F46 A;  4MRI A;  2J8R A;  1NSA A;  2V8G A;  3SXN A;  3BJ7 A;  2P6G A;  1YX0 A;  2PR8 A;  4MFJ A;  1I12 A;  5K8N A;  1P0H A;  4NCZ A;  4H2K A;  2VEZ A;  3KR4 A;  3PRT A;  2PCU A;  2C6C A;  1M4G A;  4PXD A;  3V7Z A;  4LX9 A;  1PUA A;  5CNP A;  5ISV A;  3TX8 A;  3CT9 A;  2DPT A;  2JDD A;  3IJ3 A;  2EK8 A;  2OU2 A;  3KZW A;  3PEI A;  5H84 A;  4FAI A;  2Z11 A;  2Z3M A;  4MMO A;  1VIX A;  2YNC C;  3G3S A;  2XEI A;  3R9G A;  2B4D B;  2CNT A;  4QC6 A;  4MHY A;  2CF4 A;  2J9A A;  4K3N A;  5G1Z A;  2EO8 A;  1CX8 A;  2FS5 A;  4CGL A;  3RYO A;  2X7B A;  4B5P B;  4MFQ A;  1MJB A;  4M6G A;  1AUG A;  4H89 A;  5F47 A;  3EFA A;  3K2K A;  3MN8 A;  1TKF A;  3CXS A;  1YSJ A;  4IHM A;  3G8W A;  1CBX A;  4CGN A;  4M85 A;  3CPA A;  4OID A;  1RXT A;  3ISZ A;  1IID A;  4MXU A;  2PJ5 A;  4KS9 A;  2B58 A;  4ZI6 A;  2ODF A;  1LOK A;  4HNX B;  5FVJ A;  3R95 A;  5CBM A;  3VWE A;  4FBE A;  1U6M A;  3R9E A;  2GFQ A;  5F09 A;  3S9M A;  2PJ9 A;  1CG2 A;  3LMS A;  5G20 A;  4W9Y A;  4GM5 A;  5HMN A;  2ABZ A;  2ZEM A;  1V0C A;  3PFE A;  4R8F A;  2ANP A;  1X10 A;  4XPL A;  4WWV A;  5AG7 A;  1R3N A;  2BUE A;  2I79 A;  3WR7 A;  1DTD A;  2R98 A;  1J4J A;  4ZBG A;  2V8V A;  2GIV A;  1Z5R A;  3F0A A;  2REF A;  2PJA A;  3PBB A;  3JRU A;  4JXR A;  4YGO A;  3LOD A;  2ZW5 A;  5DS0 A;  5BWA B;  3D66 A;  4Q7A A;  4NJQ A;  4M3S A;  4B12 A;  4Y49 C;  2YGW A;  4KOT A;  1RTQ A;  1IYL A;  2O4H A;  2V77 A;  4UF4 A;  3S9N A;  1Q7L A;  3ZZI A;  5J8C A;  3IEH A;  5DWN A;  5IB9 A;  3DSB A;  1CJW A;  3NA6 A;  3D67 A;  2OH1 A;  4JLY A;  4ONU A;  3FXT A;  4CS0 B;  3S9L A;  4PXC A;  4P4J A;  3SI0 A;  2B3V A;  1CM0 A;  1Y9W A;  5AG6 A;  4HKF A;  4JXQ A;  4AXV A;  2IL4 A;  5F48 A;  1S7K A;  3GY9 A;  4DJL A;  5A27 A;  1F2O A;  4G1P A;  3QAY A;  4ORF A;  3S6G A;  4KLV A;  4CAW A;  3SI1 A;  1XJO A;  3TO7 A;  4FD6 A;  4UBR A;  1Q2C A;  2I00 A;  3D2M A;  2VZY A;  3KQZ A;  3PFO A;  4HNW B;  2QJ8 A;  1I21 A;  1WK4 A;  2R8V A;  2V8D A;  3GYA A;  4X8I A;  5AGE A;  4AG7 A;  4MFP A;  1FNO A;  4L89 A;  3IWG A;  3PP9 A;  3HLP A;  1VHS A;  1A2Z A;  4NFR A;  4KSA A;  3S6F A;  2AJ6 A;  4KSF A;  5IX3 A;  1F57 A;  1XOV A;  4X2T A;  1YVO A;  2WSA A;  4KLW A;  1QSO A;  3EY5 A;  3PB6 X;  3QB8 A;  2B4D A; 
#chains in the Genus database with same CATH homology
 1ZO0 A;  4JWP A;  2D4O A;  2PSW A;  2ZPA A;  1GHE A;  5G22 A;  1YLE A;  4XNH C;  3TE4 A;  3FBU A;  2BSW A;  4CGO A;  4KOX A;  2B5G A;  4B14 A;  2HUZ A;  2A4N A;  2WPX A;  2VXK A;  4PK3 A;  2Q7B A;  3FB3 A;  2QML A;  4Y49 B;  4QUS A;  2GE3 A;  2Z3O A;  4UWI A;  2JEV A;  4KOR A;  4PK2 A;  2FL4 A;  1KUV A;  1QSM A;  1S7N A;  4R87 A;  2AE6 A;  1M44 A;  5HH1 A;  3BLN A;  4IUS A;  4FD4 A;  4B13 A;  1YRE A;  3EXN A;  4L8A A;  4Q36 A;  3JTK A;  3V8I A;  1WWZ A;  4MBU A;  1FY7 A;  4AVB A;  2Z3L A;  2QEC A;  4CYQ A;  2G0B A;  2ZW6 A;  4KUA A;  2EUI A;  3W6X A;  4A31 A;  4NEX A;  1OZP A;  2B3U A;  2B5G B;  3EC4 A;  4OAE A;  4PV6 A;  4DNC A;  3BJ8 A;  3DR6 A;  3MGD A;  4UWJ A;  4MJ8 A;  4CGM A;  2VZZ A;  5AG4 A;  2EVN A;  5KTA A;  4ZGY B;  1Q2D A;  4C2Z A;  4U9Z A;  2KCW A;  4KUB A;  2PR1 A;  2B4B A;  3TTH A;  1KUY A;  2C27 A;  1L0C A;  3N7Z A;  4H6Z A;  4KOW A;  4CGP A;  1QSN A;  2FXF A;  4C68 A;  2VBQ A;  1B87 A;  2FT0 A;  2QIR A;  1M1D A;  1N71 A;  4NF1 A;  3TCV A;  4C2X A;  3TO9 A;  2K5T A;  4LUA A;  3IGR A;  4NXY A;  5EBV A;  2PDO A;  1I1D A;  4CAE A;  1Z4E A;  2PC1 A;  4E2A A;  2Z3N A;  2FIW A;  2Q44 A;  4CYP A;  4QBJ A;  4GS4 A;  2G3T A;  2O28 A;  4AB7 A;  3CXQ A;  4R9M A;  3TOA A;  3JVN A;  4PSW A;  4A2Z A;  1MJA A;  2P6F A;  2CNM A;  1XEB A;  4MFZ A;  5GCN A;  2CXA A;  2PRB A;  3LD2 A;  2CY2 A;  1S5K A;  3IU1 A;  2GAN A;  4YFJ A;  3I9S A;  4XPD B;  3CXP A;  2OZG A;  3R1K A;  2Z3P A;  4BBH A;  4XPD C;  4JD6 A;  1KZF A;  1S7L A;  5KTC A;  2ZW4 A;  3P2F A;  4FD7 A;  4CRY B;  4B10 A;  2CNS A;  4KOV A;  2HQY A;  4UFW A;  2ATR A;  4RI1 A;  3SHP A;  2RC4 A;  4UCP A;  4C7I A;  4CAV A;  4UCM A;  3DDD A;  2J8M A;  3IU2 A;  3NE7 A;  4U5Y A;  4UA3 A;  3UY5 A;  3R96 A;  2OB0 A;  1YGH A;  3JUW A;  4CRZ B;  2R7H A;  1Z4R A;  1MJ9 A;  2YNC A;  3W6S A;  4BMH A;  2ARH A;  5E96 A;  4UCN A;  1SQH A;  4IF5 A;  5J8F A;  4KVM E;  2VI7 A;  2P0W A;  1K4J A;  2REE A;  1S3Z A;  4R57 A;  2Q04 A;  5C82 A;  1IB1 E;  1YVK A;  3H5Z A;  2OZU A;  4KOU A;  4C7H A;  4A33 A;  1S7F A;  3F8K A;  4R3K A;  1B6B A;  3F5B A;  4MY3 A;  4XNH B;  1IYK A;  3TT2 A;  2FCK A;  3FRM A;  1XMT A;  3S6H A;  3DNS A;  4E0A A;  3ZJ0 A;  4CAF A;  4R3L A;  4EVY A;  5AG5 A;  5EC4 A;  4KVX A;  4OAD A;  5C88 A;  2D4P A;  4UFV A;  4KOY A;  2Q4V A;  4B5O A;  4PSX A;  2Z10 A;  1QSR A;  2Q4Y A;  3IWE A;  3GKR A;  4RS2 A;  4KOS A;  1M4D A;  1XF8 A;  4MY0 A;  3P2H A;  4CYN A;  1NSL A;  4J3G A;  1P4N A;  4MHD A;  2BL1 A;  2FSR A;  4JJX A;  1QST A;  2G3A A;  3TO6 A;  3SXO A;  4F0X A;  5G21 A;  1S60 A;  3E0K A;  5IB0 A;  1KUX A;  2JDC A;  5JQ4 A;  3A9L A;  4F6A A;  3DR8 A;  4X5K A;  5KTD A;  1XE4 A;  2F5I A;  2ZW7 A;  3D8P A;  4I49 A;  1YK3 A;  2YNE A;  3PZJ A;  4OLL A;  1VKC A;  3W91 A;  4A95 A;  1R57 A;  2HV2 A;  1MK4 A;  1XIX A;  2J8N A;  2WUU A;  4UFX A;  5H86 A;  1IIC A;  2FIA A;  4C2Y A;  4B5P A;  4KZT A;  4CAX A;  1NE9 A;  4HNY B;  1BO4 A;  2OZH A;  4MI4 A;  2JLM A;  2Z0Z A;  3FYN A;  2FE7 A;  2PQ8 A;  2H5M A;  4E8O A;  1NMT A;  4QVT A;  3D2P A;  3FIX A;  4AG9 A;  1Y9K A;  4A30 A;  4H6U A;  3TOB A;  2ZXV A;  3H4Q A;  3QAH A;  4QB9 A;  2Z3K A;  1Y7R A;  2VQY A;  3KKW A;  4KVO E;  4YRH A;  3B8G A;  3R9F A;  4MFL A;  4II9 A;  4F0Y A;  1YR0 A;  3I3G A;  3C26 A;  2BEI A;  3T9Y A;  2NMT A;  1BOB A;  5DWM A;  1TIQ A;  4XPK A;  4A32 A;  5I0C A;  2P6E A;  3PGP A;  2R1I A;  4U9Y A;  3K9U A;  4MFK A;  4CYO A;  1LRZ A;  1UFH A;  2DXQ A;  3S6K A;  4AVC A;  2WPW A;  4FD5 A;  4AVA A;  2Y0M A;  4NSQ A;  4K30 A;  5F49 A;  3TFY A;  3FNC A;  3T90 A;  1Z9U A;  1Q2Y A;  3VWD A;  1ON0 A;  5JPH A;  3D3S A;  4B11 A;  2YND A;  3EO4 A;  5A28 A;  1RO5 A;  3OWC A;  1M4I A;  2DPS A;  2Q0Y A;  4Q38 A;  1PU9 A;  5F46 A;  2J8R A;  3SXN A;  3BJ7 A;  2P6G A;  1YX0 A;  2PR8 A;  4MFJ A;  1I12 A;  1P0H A;  4NCZ A;  2VEZ A;  1M4G A;  4LX9 A;  1PUA A;  5CNP A;  5ISV A;  2DPT A;  2JDD A;  2OU2 A;  5H84 A;  2Z11 A;  2Z3M A;  3G3S A;  2YNC C;  3R9G A;  2B4D B;  2CNT A;  4QC6 A;  5G1Z A;  2FS5 A;  4CGL A;  3RYO A;  2X7B A;  4B5P B;  4MFQ A;  1MJB A;  4H89 A;  5F47 A;  3EFA A;  3CXS A;  3G8W A;  4CGN A;  4M85 A;  1RXT A;  1IID A;  4KS9 A;  2B58 A;  4HNX B;  5FVJ A;  3R95 A;  3VWE A;  1U6M A;  3R9E A;  5G20 A;  5HMN A;  1V0C A;  4XPL A;  5AG7 A;  2BUE A;  2I79 A;  3WR7 A;  2R98 A;  1J4J A;  4ZBG A;  2GIV A;  3F0A A;  2REF A;  4JXR A;  4YGO A;  3LOD A;  2ZW5 A;  5BWA B;  4M3S A;  4B12 A;  4Y49 C;  2YGW A;  4KOT A;  1IYL A;  3ZZI A;  5J8C A;  5DWN A;  3DSB A;  1CJW A;  2OH1 A;  4JLY A;  4ONU A;  3FXT A;  4CS0 B;  2B3V A;  1CM0 A;  1Y9W A;  5AG6 A;  4HKF A;  4JXQ A;  2IL4 A;  5F48 A;  1S7K A;  3GY9 A;  5A27 A;  4ORF A;  3S6G A;  4KLV A;  4CAW A;  3TO7 A;  4FD6 A;  4UBR A;  1Q2C A;  2I00 A;  3D2M A;  4HNW B;  2VZY A;  3GYA A;  1I21 A;  1WK4 A;  2R8V A;  4AG7 A;  5IV0 A;  5AGE A;  4MFP A;  4L89 A;  3IWG A;  3PP9 A;  1VHS A;  4KSA A;  3S6F A;  2AJ6 A;  4KSF A;  5IX3 A;  1YVO A;  2WSA A;  4KLW A;  1QSO A;  3EY5 A;  3QB8 A;  2B4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...