2EVNA

Nmr solution structures of at1g77540
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
103
structure length
103
Chain Sequence
MATEPPKIVWNEGKRRFETEDHEAFIEYKMRNNGKVMDLVHTYVPSFKRGLGLASHLCVAAFEHASSHSISIIPSCSYVSDTFLPRNPSWKPLIHSEVFKSSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Arabidopsis thaliana At1g77540 Protein, a Minimal Acetyltransferase from the COG2388 Family.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
molecule keywords Protein At1g77540
total genus 22
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14542 Acetyltransf_CG GCN5-related N-acetyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2evnA00
1N71A 2J8RA 2GANA 3DDDA 2VQYA 4NEXA 3LODA 3PP9A 2ZW5A 1B6BA 3EXNA 4KVOE 1IIDA 3R1KA 4QC6A 1SQHA 3GKRA 1K4JA 2I79A 3EO4A 4PSXA 2HV2A 3S6KA 2CNSA 4RI1A 1CJWA 2ZW7A 2B4BA 2BEIA 2CNTA 2X7BA 2JDCA 2KCWA 1Z9UA 3DR8A 2A4NA 2B5GA 1M4IA 1UFHA 3R9EA 2Q04A 3QB8A 1QSRA 1NMTA 5F47A 4MI4A 4KOYA 4JJXA 2GIVA 1KUXA 4QB9A 4AVAA 2Z10A 3K9UA 5IX3A 1S5KA 4DNCA 2G0BA 5JQ4A 1M44A 5KTAA 3FYNA 2AE6A 1IICA 3TO6A 3H4QA 1Z4RA 3DNSA 3EC4A 1Z4EA 4KLVA 2B3UA 4JXQA 2P6GA 1S7FA 2PR1A 4XPKA 3B8GA 3JVNA 2NMTA 3G8WA 3N7ZA 4QUSA 5HMNA 2J8NA 1KZFA 3D8PA 4L89A 3FB3A 3ZJ0A 2Q0YA 1Y9WA 1YVKA 4YFJA 5DWNA 4OAEA 4MY3A 2OZGA 2P6FA 2R1IA 1QSNA 4IUSA 3EFAA 5C88A 2B3VA 3CXQA 2WPWA 2QECA 4R3KA 3DSBA 3W6XA 1KUYA 4EVYA 4LUAA 4ZBGA 4LX9A 4M3SA 3R9GA 5IB0A 4Y49B 2R7HA 4KOWA 3TO9A 3V8IA 3SXNA 2Z11A 2ARHA 5C82A 1PUAA 1Q2YA 3PZJA 3ZZIA 1MJ9A 4JWPA 1NSLA 5E96A 1M4DA 2G3TA 3R96A 2HQYA 2D4PA 3DR6A 4KOTA 3FNCA 5KTCA 4L8AA 2PC1A 2RC4A 4FD5A 1PU9A 2PSWA 3CXPA 4BMHA 1IYLA 4J3GA 1L0CA 5GCNA 4FD7A 4YGOA 4B5OA 2WPXA 4HKFA 4NXYA 4KUAA 1QSMA 2JEVA 4AVCA 3QAHA 2F5IA 4XNHB 4II9A 2FE7A 2FL4A 2K5TA 3W6SA 1M1DA 4AB7A 3G3SA 5KTDA 1U6MA 2B4DB 1V0CA 4KLWA 4F0YA 4XNHC 5EC4A 4U9YA 4QVTA 2CY2A 1J4JA 5F48A 1XIXA 3D3SA 4H6UA 4XPLA 5JPHA 2EUIA 4KOVA 3TOAA 1I12A 3BJ8A 3FBUA 1M4GA 2BUEA 4NSQA 5J8CA 2C27A 4KOSA 2R8VA 4PV6A 1YK3A 4R87A 2R98A 1S3ZA 2J8MA 4AG7A 5F46A 2ZXVA 1I1DA 3R9FA 2ZW6A 1ON0A 3TOBA 5DWMA 1IYKA 3EY5A 3FRMA 4F6AA 1S7NA 3BJ7A 1BO4A 3P2HA 1S7LA 2Q44A 4R9MA 3FIXA 1FY7A 2FSRA 3S6GA 1MK4A 2GE3A 4CS0B 2VZYA 2ZPAA 4KVXA 4B5PB 2PR8A 1YVOA 4HNXB 2FIAA 4IF5A 3RYOA 1YREA 2O28A 4U9ZA 2BSWA 4KOUA 2QMLA 2G3AA 4CRYB 3TCVA 4PK2A 2B5GB 1S7KA 2VI7A 2OB0A 4HNYB 5IV0A 1Y9KA 4FD4A 3C26A 2REFA 1NE9A 1TIQA 5ISVA 3MGDA 3WR7A 1WK4A 2AJ6A 3TFYA 1VKCA 1OZPA 5J8FA 1Q2CA 3NE7A 2JLMA 3S6FA 3TT2A 2FT0A 3T9YA 2ATRA 4MY0A 2Q4VA 2VBQA 1XF8A 4I49A 4R57A 3W91A 4B5PA 3FXTA 2PDOA 4KZTA 4UWIA 2QIRA 3SXOA 2Q4YA 4CAXA 4H89A 2I00A 4MJ8A 4JXRA 2P6EA 4JLYA 2Y0MA 3T90A 2H5MA 4K30A 4E0AA 1B87A 2FIWA 2FXFA 1RXTA 4GS4A 3R95A 1GHEA 4AVBA 2JDDA 4CAWA 2FCKA 3TE4A 4OLLA 5F49A 1KUVA 1IB1E 1QSTA 1XE4A 4UBRA 4UWJA 1CM0A 3VWEA 4CRZB 5CNPA 4KOXA 5HH1A 4RS2A 4Y49C 1LRZA 2OU2A 2HUZA 2VEZA 2D4OA 4JD6A 2Z0ZA 2CNMA 3I3GA 2VXKA 4NCZA 3F8KA 2ZW4A 4UA3A 2DXQA 4NF1A 1YX0A 1MJBA 2OH1A 3CXSA 1YGHA 5H86A 4XPDC 3GY9A 4PSWA 2B58A 4ONUA 1S60A 4MHDA 1P0HA 1P4NA 3UY5A 2PQ8A 4E2AA 4QBJA 2REEA 5EBVA 2VZZA 1R57A 1VHSA 5I0CA 2Q7BA 1BOBA 1Q2DA 2OZUA 1Y7RA 2FS5A 4MBUA 3GYAA 4KUBA 2IL4A 1I21A 4PK3A 2PRBA 3I9SA 1RO5A 1XEBA 3SHPA 1YR0A 4FD6A 3BLNA 3E0KA 2P0WA 4XPDB 4AG9A 5FVJA 4M85A 1WWZA 3S6HA 2BL1A 3IGRA 2B4DA 3F0AA 3KKWA 4H6ZA 4YRHA 4OADA 3VWDA 4CAVA 4X5KA 5H84A 3F5BA 1YLEA 3D2MA 4ORFA 3OWCA 3TTHA 3JUWA 3PGPA 4KORA 2EVNA 3D2PA 3IWGA 4U5YA 3LD2A 4R3LA 2OZHA 4KVME 4E8OA 1XMTA 4HNWB 1QSOA 1MJAA 3P2FA 3TO7A
chains in the Genus database with same CATH superfamily
1F2PA 1N71A 2J8RA 4MCSA 3S9MA 2CIJA 1Z2LA 3B3WA 2GANA 1ZO0A 3DDDA 2VQYA 4CYPA 4MFLA 5A28A 4NEXA 2YNEA 2IQ6A 3LODA 3PP9A 2ZW5A 3NFZA 1B6BA 2IMOA 2QVPA 3EXNA 4KVOE 1XOVA 1IIDA 3R1KA 1XRYA 2FVGA 4QC6A 2XEIA 1SQHA 3GKRA 4WWVA 4PXBA 4M6IA 1K4JA 1TKFA 4KSAA 2I79A 3RNZA 3EO4A 4PSXA 1F57A 2VL1A 4P4DA 1M4LA 4P45A 4DUKA 2HV2A 4LQGA 3A9LA 3S6KA 1XJOA 2DF5A 3FECA 2CNSA 4EFDA 1CBXA 2PVWA 1EE3P 4RI1A 1CJWA 2ZW7A 2B4BA 4RN7A 4IHMA 2BEIA 2CNTA 2X7BA 4P4EA 3KI9A 2JDCA 4G1PA 2KCWA 4NGRA 7CPAA 1Z9UA 3BXMA 3DR8A 4UEZA 2A4NA 4CAEA 2B5GA 4FBEA 5AG4A 2ZEOA 1M4IA 1UFHA 3KHXA 3R9EA 2Q04A 3QB8A 4YU9A 2PJ7A 1NMTA 1QSRA 3FEEA 4NGMA 5F47A 3D7HA 5HVHA 4MI4A 4KOYA 3QAYA 4UF4A 4JJXA 4O23A 2GIVA 1KUXA 2Z3LA 1Q7LA 2V8VA 3IO1A 4CGNA 4YWYA 4QB9A 3WC7A 2Z10A 4JYWA 2XEJA 4AVAA 3IJ3A 4A2ZA 1IU8A 1Z5RA 3BI1A 3K9UA 1LAMA 5IX3A 3H8EA 1S5KA 4BINA 2RFHA 1JQGA 4DNCA 2G0BA 5JQ4A 1M44A 3GLJA 5ELYA 2GLJA 3RZAA 5JGFA 1AMPA 2EO8A 1CPSA 2ZEHA 5KTAA 3TX8A 3FYNA 2AE6A 8CPAA 1IICA 3TO6A 3H4QA 4ZX9A 1Z4RA 3DNSA 3EC4A 1LAPA 4A94A 1Z4EA 2F7VA 4P10A 2Z3MA 2Z3PA 4KLVA 2B3UA 4JXQA 3H8FA 2P6GA 1S7FA 3T8WA 2ODFA 2PR1A 4XPKA 3MN8A 4ONWA 2PJ4A 3B8GA 3D7DA 3JVNA 4A37A 5K8MA 1Z8WA 3K2KA 2YGWA 3B3VA 2NMTA 4PPZA 3WABA 3G8WA 3N7ZA 1ELMP 4QUSA 4C68A 3PB9X 2V8HA 2J9AA 5HMNA 1ARMA 1KZFA 2J8NA 3SI2A 3D8PA 3SJGA 5DS0A 4OC2A 3FJUA 4L89A 2GFQA 3FB3A 4NGNA 4P4FA 4MMOA 3LWUA 3ZJ0A 4C7IA 4C2ZA 2Q0YA 3NE8A 1Y9WA 1YVKA 5AG5A 4YFJA 5DWNA 5G21A 2JBKA 4OAEA 4MY3A 2OZGA 2P6FA 2R1IA 1QSNA 3N5FA 4CYOA 4IUSA 3EFAA 4PQAA 2B3VA 5C88A 5K8OA 3CXQA 4NGQA 2RB7A 2WPWA 4A31A 3PB4X 2QECA 4R3KA 1IGBA 1XBUA 4GXHA 3VARA 2PRQA 3B35A 2ZOFA 3DSBA 3W6XA 3VH9A 1KUYA 4EVYA 4MHYA 4LUAA 2ZEDA 4ZBGA 4P44A 4LX9A 4CYNA 4M3SA 1NSAA 3R9GA 2G9DA 5IB0A 4Y49B 2R7HA 4KOWA 3TO9A 3V8IA 3SXNA 1LCPA 3KR4A 4H2KA 2Z11A 4M6GA 3IEHA 2ARHA 5C82A 1IOIA 1PUAA 2ZEEA 1Z8XA 4CGPA 1PCAA 1Q2YA 3PZJA 3ZZIA 1MJ9A 4Q7AA 4JWPA 3H8GA 3RAMA 3V38A 2XEGA 1NSLA 1ARLA 4OC5A 3PFEA 3SJXA 1BLLE 5E96A 1A2ZA 5JH9A 4WJBA 5JM6A 1Y0YA 1M4DA 5LYDA 1DE4C 3I1UA 1VGYA 2G3TA 5AG7A 3VATA 3R96A 2HQYA 2D4PA 3DR6A 4KOTA 1TKJA 2ZELA 1ELLP 2YNDA 2IJZA 3FNCA 1GYTA 5HVGA 5KTCA 3KZWA 3PB7X 4UEEA 4L8AA 2GU2A 2BOAA 2PC1A 2JEWA 2RC4A 3NH4A 1PU9A 2CTCA 2PSWA 3PBBA 4FD5A 5A27A 3K9TA 3CXPA 4PXDA 4BMHA 1IYLA 4J3GA 1L0CA 4HPSA 4ZY2A 4KSFA 5GCNA 3D67A 1R3NA 4FD7A 4YGOA 4B5OA 2WPXA 4HKFA 4NXYA 4UFVA 4UCMA 4KUAA 4PXCA 1QSMA 2JEVA 4AVCA 4CGOA 4X3RA 2GLFA 3QAHA 4EWTA 2F5IA 3PRTA 4XNHB 3S9NA 4UIBA 5LYIA 4II9A 2FE7A 2FL4A 2K5TA 3W6SA 1M1DA 4AB7A 6CPAA 3G3SA 5KTDA 1U6MA 4CAFA 2B4DB 1ZLHA 1V0CA 4KLWA 4F0YA 4XNHC 5EC4A 4Z65A 1LOKA 4U9YA 2EK9A 4QVTA 3HLPA 2CY2A 3IWEA 1J4JA 5F48A 1XIXA 4B10A 2ZEGA 3D3SA 4H6UA 3DGVA 4XPLA 5I4MA 2XEFA 5JPHA 2EUIA 3FVLA 4KOVA 3TOAA 3WC6A 3WC5A 1I12A 4K3NA 3BJ8A 3FEDA 4P4JA 5HXDA 3FBUA 1M4GA 2BUEA 2CF4A 2PIYA 2ABZA 4NSQA 4B6ZA 5J8CA 5F09A 1KWMA 2C27A 4KOSA 1YLOA 5D29A 2R8VA 4PV6A 4DJLA 1YK3A 4R87A 4OC4A 3FX6A 3H5ZA 5AG6A 2R98A 1S3ZA 2QYVA 2J8MA 2YNCC 4AG7A 1TXRA 2PJ8A 5F46A 4BD9A 2ZXVA 1I1DA 3BI0A 3GB0A 2AFOA 2WSAA 3R9FA 4F9VA 4MHZA 2ZW6A 1YW4A 2HC9A 1ON0A 3TOBA 5DWMA 1IYKA 2ZOGA 3EY5A 4FWUA 4R76A 4X2TA 2NYQA 3FRMA 4F6AA 3KR5A 2ZEMA 2C6PA 1S7NA 3CPXA 3BJ7A 4UCNA 3CPAA 5LRKA 4CPAA 3MRUA 4ZX8A 1BO4A 3P2HA 2O53A 1S7LA 2Q44A 1AUGA 5LRGA 4ZY0A 3QNVA 3D4UA 4R9MA 3FIXA 3BHXA 1FY7A 1CP6A 2FSRA 3S6GA 2NSMA 1H8LA 1MK4A 3IFEA 1ZG8A 2GE3A 4MFZA 4CS0B 4W9YA 2VZYA 2ZPAA 4KVXA 2DEAA 4B5PB 4C2YA 2PR8A 1VHEA 1YVOA 3KHZA 4HNXB 2FIAA 4IF5A 3RYOA 1YREA 2O28A 4U9ZA 2BSWA 4MHPA 4MCPA 4KOUA 2I3CA 2QMLA 1UWYA 4NJRA 3V7ZA 2G3AA 4CRYB 1ZG9A 2Z3NA 4IK2A 3TCVA 1BAVA 4PK2A 2B5GB 4A95A 2F8HA 1S7KA 4OC3A 2VI7A 2OB0A 2ZEFA 4KSIA 3D7GA 4HNYB 2V8DA 2PE3A 5LYFA 5IV0A 4CYQA 4F0XA 1Y9KA 1Z8TA 4FD4A 1FT7A 2ANPA 2C6GA 3C26A 4LQ6A 2REFA 1NE9A 1TIQA 1Y7EA 3GIUA 5K8PA 5ISVA 3MGDA 2CTBA 3WR7A 4R7MA 5J1QA 2PIZA 3IC1A 1WK4A 2AJ6A 3TFYA 3L2NA 1Z8LA 3PBEA 3WT4A 1X10A 5EMIA 4UFWA 1VKCA 1OZPA 2HB6A 5J8FA 1Q2CA 4MRIA 1TKHA 3NE7A 2JLMA 4OIDA 4ZYQA 2Z3KA 3PFOA 3S6FA 4C2XA 3TT2A 2FT0A 3T9YA 5HVFA 2QJ8A 2AFMA 4TNUA 2ATRA 4MY0A 3D7FA 4DYOA 2POKA 1ZG7A 1XF8A 2Q4VA 2VBQA 3JTKA 3PB8X 4I49A 3FXTA 4R57A 3W91A 4B5PA 2PDOA 3KGQA 4KZTA 2ZEPA 4UWIA 4EMEA 2QIRA 3SXOA 2Q4YA 4PXEA 4H89A 3FF3A 4CAXA 2I00A 1QQ9A 4MFPA 3CZXA 4MJ8A 4JXRA 2P6EA 2BO9A 4JLYA 2Z3OA 2Y0MA 1Y0RA 3T90A 4MCRA 4UEFA 2H5MA 4K30A 2EK8A 4E0AA 3CDXA 1B87A 2FIWA 2FXFA 4OIWA 4R8FA 1RXTA 1IY7A 4GS4A 3R95A 3D66A 1GHEA 4AVBA 2JDDA 4NGTA 4CAWA 1TF8A 3SI1A 4FAIA 4ZY1A 3PB6X 2FCKA 4A30A 4M6HA 2Q43A 3PEIA 1RTQA 4NGPA 3TE4A 2PJ6A 4NFRA 4OLLA 5F49A 4MFJA 2V8GA 1KUVA 5AGEA 2Q7SA 3RO0A 1IB1E 1QSTA 5LRJA 1XE4A 3S9LA 3JRUA 3SJEA 4A39A 3B3CA 4UBRA 4UWJA 5LYLA 1HEEA 1CM0A 3IU1A 3VWEA 3ISXA 4CRZB 2BCOA 3NH8A 5CNPA 4C7HA 4KOXA 1VHOA 5HH1A 1OBRA 4RS2A 3TC8A 4RUHA 4Y49C 4OC0A 1CX8A 1LRZA 2OU2A 2PJ0A 2HUZA 1YQEA 1ZLIA 2VEZA 1BPNA 2D4OA 2Q51A 4JD6A 2Z0ZA 3B3TA 1XMBA 2CNMA 4OP4A 4Q36A 2C1CA 2CXAA 2PJ5A 4MXUA 3IWWA 2PJAA 4MHNA 1IOFA 3I3GA 5G22A 2VXKA 1QMUA 3D68A 4OC1A 4AXVA 4NCZA 2PCUA 3F8KA 1DTDA 2ZW4A 3SI0A 4UA3A 4F8ZA 2DXQA 5CBMA 2O4HA 1YX0A 4NF1A 1MJBA 2OH1A 3CT9A 3CXSA 1YSJA 1YGHA 1XFOA 3B3SA 5G1ZA 5H86A 4XPDC 2PJBA 3GY9A 4PSWA 2B58A 3B7IA 4MFQA 4ONUA 1S60A 4MHDA 1P0HA 2Q4ZA 1VIXA 1P4NA 3UY5A 2PQ8A 4E2AA 4QBJA 2REEA 3DLJA 5EBVA 2VZZA 1R57A 1VHSA 3KQXA 5I0CA 3KQZA 4CGMA 2AFUA 4Q38A 4F9UA 2Q7BA 1BOBA 1Q2DA 4B12A 2OZUA 1Y7RA 2FS5A 4B11A 1HDQA 4A38A 4CGLA 5K8NA 3IIBA 1TF9A 4MBUA 2EBJA 5BWAB 2PJ1A 3GYAA 4KUBA 2AFSA 1BPMA 1I21A 2IL4A 2WZNA 3NH5A 2ZENA 2PRBA 2PJ2A 4PK3A 3I9SA 1HDUA 2AFZA 1RO5A 2DPTA 4B13A 4P4IA 1F2OA 1XEBA 5THWA 4X8IA 1LANA 3SHPA 1YR0A 2C6CA 2GREA 4FD6A 5D8NA 1YW6A 2WYRA 3BLNA 3E0KA 2P0WA 4P6YA 5IB9A 2AFWA 4A33A 3SJFA 4XPDB 4AG9A 3LACA 5FVJA 2YNCA 4M85A 3B2YA 4B14A 4OMEA 2AFXA 1PYTB 1WWZA 2PJCA 3KASA 3S6HA 4GM5A 2BL1A 3IGRA 4UCPA 2OR4A 1AYEA 4NGSA 2B4DA 3F0AA 3RBUA 4UFXA 2JBJA 4OKOA 3KKWA 4A32A 1CG2A 4H6ZA 4YRHA 4FUUA 4OADA 3VWDA 3KL9A 4CAVA 1FNOA 2PVVA 4X5KA 4MFKA 4KS9A 2DPSA 5H84A 5G20A 3FMCA 3F5BA 4JZ0A 1YLEA 2OOTA 3D2MA 1CP7A 4ORFA 4TWEA 4NJQA 3OWCA 4ZGYB 3TTHA 1YMEA 4P4BA 3JUWA 3PGPA 4KORA 1X12A 4UIAA 2EVNA 3D2PA 1R43A 3IWGA 4U5YA 1JWQA 3HUVA 1CPXA 3ISZA 3LD2A 2PJ3A 4R3LA 4ZI6A 2OZHA 3LMSA 3GUXA 4KVME 5CPAA 4E8OA 1XMTA 2V77A 4HNWB 4MCQA 1QSOA 2PJ9A 2EWBA 3IU2A 1LFWA 4BBHA 2WUUA 4IAVA 1MJAA 4R6TA 3P2FA 3NA6A 3FH4A 3TO7A
chains in the Genus database with same CATH topology
1N71A 2J8RA 2GANA 1ZO0A 3DDDA 2VQYA 4CYPA 4MFLA 5A28A 4NEXA 2YNEA 3LODA 3PP9A 2ZW5A 1B6BA 3EXNA 4KVOE 1IIDA 3R1KA 4QC6A 1SQHA 3GKRA 1K4JA 4KSAA 2I79A 3EO4A 4PSXA 2HV2A 3A9LA 3S6KA 2CNSA 4RI1A 1CJWA 2ZW7A 2B4BA 2BEIA 2CNTA 2X7BA 2JDCA 2KCWA 1Z9UA 3DR8A 2A4NA 4CAEA 2B5GA 5AG4A 1M4IA 1UFHA 3R9EA 2Q04A 3QB8A 1QSRA 1NMTA 5F47A 4MI4A 4KOYA 4JJXA 2GIVA 1KUXA 2Z3LA 4CGNA 4QB9A 4AVAA 2Z10A 4A2ZA 3K9UA 5IX3A 1S5KA 4DNCA 2G0BA 5JQ4A 1M44A 5KTAA 3FYNA 2AE6A 1IICA 3TO6A 3H4QA 1Z4RA 3DNSA 3EC4A 1Z4EA 2Z3MA 2Z3PA 4KLVA 2B3UA 4JXQA 2P6GA 1S7FA 4CGPA 2PR1A 4XPKA 3B8GA 3JVNA 2YGWA 2NMTA 3G8WA 3N7ZA 4QUSA 4C68A 5HMNA 2J8NA 1KZFA 3D8PA 4L89A 3FB3A 3ZJ0A 4C7IA 4C2ZA 2Q0YA 1Y9WA 1YVKA 5AG5A 4YFJA 5DWNA 5G21A 4OAEA 4MY3A 2OZGA 2P6FA 2R1IA 1QSNA 4CYOA 4IUSA 3EFAA 5C88A 2B3VA 3CXQA 2WPWA 4A31A 2QECA 4R3KA 3DSBA 3W6XA 1KUYA 4EVYA 4LUAA 4ZBGA 4LX9A 4CYNA 4M3SA 3R9GA 5IB0A 4Y49B 2R7HA 4KOWA 3TO9A 3V8IA 3SXNA 2Z11A 2ARHA 5C82A 1PUAA 1Q2YA 3PZJA 3ZZIA 1MJ9A 4JWPA 1NSLA 5E96A 1M4DA 2G3TA 5AG7A 3R96A 2HQYA 2D4PA 3DR6A 4KOTA 2YNDA 3FNCA 5KTCA 4L8AA 2PC1A 2RC4A 4FD5A 1PU9A 2PSWA 5A27A 3CXPA 4BMHA 1IYLA 4J3GA 1L0CA 4KSFA 5GCNA 4FD7A 4YGOA 4B5OA 2WPXA 4HKFA 4NXYA 4UFVA 4UCMA 4KUAA 4CGOA 1QSMA 2JEVA 4AVCA 3QAHA 2F5IA 4XNHB 4II9A 2FE7A 2FL4A 2K5TA 3W6SA 1M1DA 4AB7A 3G3SA 5KTDA 1U6MA 4CAFA 2B4DB 1V0CA 4KLWA 4F0YA 4XNHC 5EC4A 4U9YA 4QVTA 3IWEA 2CY2A 1J4JA 5F48A 1XIXA 4B10A 3D3SA 4H6UA 4XPLA 5JPHA 2EUIA 4KOVA 3TOAA 1I12A 3BJ8A 3FBUA 1M4GA 2BUEA 4NSQA 5J8CA 2C27A 4KOSA 2R8VA 4PV6A 1YK3A 4R87A 3H5ZA 5AG6A 2R98A 1S3ZA 2J8MA 2YNCC 4AG7A 5F46A 2ZXVA 1I1DA 3R9FA 2WSAA 2ZW6A 1ON0A 3TOBA 5DWMA 1IYKA 3EY5A 3FRMA 4F6AA 1S7NA 3BJ7A 4UCNA 1BO4A 3P2HA 1S7LA 2Q44A 4R9MA 3FIXA 1FY7A 2FSRA 3S6GA 1MK4A 2GE3A 4CS0B 4MFZA 2VZYA 2ZPAA 4KVXA 4B5PB 4C2YA 2PR8A 1YVOA 4HNXB 2FIAA 4IF5A 3RYOA 1YREA 2O28A 4U9ZA 2BSWA 4KOUA 2QMLA 2G3AA 4CRYB 2Z3NA 3TCVA 4PK2A 2B5GB 4A95A 1S7KA 2VI7A 2OB0A 4HNYB 5IV0A 4CYQA 1Y9KA 4FD4A 3C26A 2REFA 1NE9A 1TIQA 5ISVA 3MGDA 3WR7A 1WK4A 2AJ6A 3TFYA 4UFWA 1VKCA 1OZPA 5J8FA 1Q2CA 3NE7A 2JLMA 2Z3KA 3S6FA 4C2XA 3TT2A 2FT0A 3T9YA 2ATRA 4MY0A 2Q4VA 2VBQA 1XF8A 4I49A 4R57A 3JTKA 3W91A 4B5PA 3FXTA 4F0XA 2PDOA 4KZTA 4UWIA 2QIRA 3SXOA 2Q4YA 4CAXA 4H89A 2I00A 4MFPA 4MJ8A 4JXRA 2P6EA 4JLYA 2Z3OA 2Y0MA 3T90A 2H5MA 4K30A 4E0AA 1B87A 2FIWA 2FXFA 1RXTA 4GS4A 3R95A 1GHEA 4AVBA 2JDDA 4CAWA 2FCKA 4A30A 3TE4A 4OLLA 5F49A 4MFJA 5AGEA 1KUVA 1IB1E 1QSTA 1XE4A 4UBRA 4UWJA 1CM0A 3IU1A 3VWEA 4CRZB 5CNPA 4C7HA 4KOXA 5HH1A 4RS2A 4Y49C 1LRZA 2OU2A 2HUZA 2VEZA 2D4OA 4JD6A 2Z0ZA 2CNMA 4Q36A 2CXAA 3I3GA 5G22A 2VXKA 4NCZA 3F8KA 2ZW4A 4UA3A 2DXQA 4NF1A 1YX0A 1MJBA 2OH1A 3CXSA 1YGHA 5G1ZA 5H86A 4XPDC 3GY9A 4PSWA 2B58A 4MFQA 4ONUA 1S60A 4MHDA 1P0HA 1P4NA 3UY5A 2PQ8A 4E2AA 4QBJA 2REEA 5EBVA 2VZZA 1R57A 1VHSA 5I0CA 4CGMA 4Q38A 2Q7BA 1BOBA 1Q2DA 4B12A 2OZUA 1Y7RA 2FS5A 4B11A 4CGLA 4MBUA 5BWAB 3GYAA 4KUBA 2IL4A 1I21A 4PK3A 2PRBA 3I9SA 1RO5A 2DPTA 4B13A 1XEBA 3SHPA 1YR0A 4FD6A 3BLNA 3E0KA 2P0WA 4A33A 4XPDB 4AG9A 5FVJA 2YNCA 4M85A 4B14A 1WWZA 3S6HA 2BL1A 3IGRA 4UCPA 2B4DA 3F0AA 4UFXA 3KKWA 4A32A 4H6ZA 4YRHA 4OADA 3VWDA 4CAVA 4X5KA 4MFKA 4KS9A 2DPSA 5H84A 5G20A 3F5BA 1YLEA 3D2MA 4ORFA 4ZGYB 3OWCA 3TTHA 3JUWA 3PGPA 4KORA 2EVNA 3D2PA 3IWGA 4U5YA 3LD2A 4R3LA 2OZHA 4KVME 4E8OA 1XMTA 4HNWB 1QSOA 3IU2A 4BBHA 2WUUA 1MJAA 3P2FA 3TO7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N71 A;  2J8R A;  2GAN A;  3DDD A;  2VQY A;  4NEX A;  3LOD A;  3PP9 A;  2ZW5 A;  1B6B A;  3EXN A;  4KVO E;  1IID A;  3R1K A;  4QC6 A;  1SQH A;  3GKR A;  1K4J A;  2I79 A;  3EO4 A;  4PSX A;  2HV2 A;  3S6K A;  2CNS A;  4RI1 A;  1CJW A;  2ZW7 A;  2B4B A;  2BEI A;  2CNT A;  2X7B A;  2JDC A;  2KCW A;  1Z9U A;  3DR8 A;  2A4N A;  2B5G A;  1M4I A;  1UFH A;  3R9E A;  2Q04 A;  3QB8 A;  1QSR A;  1NMT A;  5F47 A;  4MI4 A;  4KOY A;  4JJX A;  2GIV A;  1KUX A;  4QB9 A;  4AVA A;  2Z10 A;  3K9U A;  5IX3 A;  1S5K A;  4DNC A;  2G0B A;  5JQ4 A;  1M44 A;  5KTA A;  3FYN A;  2AE6 A;  1IIC A;  3TO6 A;  3H4Q A;  1Z4R A;  3DNS A;  3EC4 A;  1Z4E A;  4KLV A;  2B3U A;  4JXQ A;  2P6G A;  1S7F A;  2PR1 A;  4XPK A;  3B8G A;  3JVN A;  2NMT A;  3G8W A;  3N7Z A;  4QUS A;  5HMN A;  2J8N A;  1KZF A;  3D8P A;  4L89 A;  3FB3 A;  3ZJ0 A;  2Q0Y A;  1Y9W A;  1YVK A;  4YFJ A;  5DWN A;  4OAE A;  4MY3 A;  2OZG A;  2P6F A;  2R1I A;  1QSN A;  4IUS A;  3EFA A;  5C88 A;  2B3V A;  3CXQ A;  2WPW A;  2QEC A;  4R3K A;  3DSB A;  3W6X A;  1KUY A;  4EVY A;  4LUA A;  4ZBG A;  4LX9 A;  4M3S A;  3R9G A;  5IB0 A;  4Y49 B;  2R7H A;  4KOW A;  3TO9 A;  3V8I A;  3SXN A;  2Z11 A;  2ARH A;  5C82 A;  1PUA A;  1Q2Y A;  3PZJ A;  3ZZI A;  1MJ9 A;  4JWP A;  1NSL A;  5E96 A;  1M4D A;  2G3T A;  3R96 A;  2HQY A;  2D4P A;  3DR6 A;  4KOT A;  3FNC A;  5KTC A;  4L8A A;  2PC1 A;  2RC4 A;  4FD5 A;  1PU9 A;  2PSW A;  3CXP A;  4BMH A;  1IYL A;  4J3G A;  1L0C A;  5GCN A;  4FD7 A;  4YGO A;  4B5O A;  2WPX A;  4HKF A;  4NXY A;  4KUA A;  1QSM A;  2JEV A;  4AVC A;  3QAH A;  2F5I A;  4XNH B;  4II9 A;  2FE7 A;  2FL4 A;  2K5T A;  3W6S A;  1M1D A;  4AB7 A;  3G3S A;  5KTD A;  1U6M A;  2B4D B;  1V0C A;  4KLW A;  4F0Y A;  4XNH C;  5EC4 A;  4U9Y A;  4QVT A;  2CY2 A;  1J4J A;  5F48 A;  1XIX A;  3D3S A;  4H6U A;  4XPL A;  5JPH A;  2EUI A;  4KOV A;  3TOA A;  1I12 A;  3BJ8 A;  3FBU A;  1M4G A;  2BUE A;  4NSQ A;  5J8C A;  2C27 A;  4KOS A;  2R8V A;  4PV6 A;  1YK3 A;  4R87 A;  2R98 A;  1S3Z A;  2J8M A;  4AG7 A;  5F46 A;  2ZXV A;  1I1D A;  3R9F A;  2ZW6 A;  1ON0 A;  3TOB A;  5DWM A;  1IYK A;  3EY5 A;  3FRM A;  4F6A A;  1S7N A;  3BJ7 A;  1BO4 A;  3P2H A;  1S7L A;  2Q44 A;  4R9M A;  3FIX A;  1FY7 A;  2FSR A;  3S6G A;  1MK4 A;  2GE3 A;  4CS0 B;  2VZY A;  2ZPA A;  4KVX A;  4B5P B;  2PR8 A;  1YVO A;  4HNX B;  2FIA A;  4IF5 A;  3RYO A;  1YRE A;  2O28 A;  4U9Z A;  2BSW A;  4KOU A;  2QML A;  2G3A A;  4CRY B;  3TCV A;  4PK2 A;  2B5G B;  1S7K A;  2VI7 A;  2OB0 A;  4HNY B;  5IV0 A;  1Y9K A;  4FD4 A;  3C26 A;  2REF A;  1NE9 A;  1TIQ A;  5ISV A;  3MGD A;  3WR7 A;  1WK4 A;  2AJ6 A;  3TFY A;  1VKC A;  1OZP A;  5J8F A;  1Q2C A;  3NE7 A;  2JLM A;  3S6F A;  3TT2 A;  2FT0 A;  3T9Y A;  2ATR A;  4MY0 A;  2Q4V A;  2VBQ A;  1XF8 A;  4I49 A;  4R57 A;  3W91 A;  4B5P A;  3FXT A;  2PDO A;  4KZT A;  4UWI A;  2QIR A;  3SXO A;  2Q4Y A;  4CAX A;  4H89 A;  2I00 A;  4MJ8 A;  4JXR A;  2P6E A;  4JLY A;  2Y0M A;  3T90 A;  2H5M A;  4K30 A;  4E0A A;  1B87 A;  2FIW A;  2FXF A;  1RXT A;  4GS4 A;  3R95 A;  1GHE A;  4AVB A;  2JDD A;  4CAW A;  2FCK A;  3TE4 A;  4OLL A;  5F49 A;  1KUV A;  1IB1 E;  1QST A;  1XE4 A;  4UBR A;  4UWJ A;  1CM0 A;  3VWE A;  4CRZ B;  5CNP A;  4KOX A;  5HH1 A;  4RS2 A;  4Y49 C;  1LRZ A;  2OU2 A;  2HUZ A;  2VEZ A;  2D4O A;  4JD6 A;  2Z0Z A;  2CNM A;  3I3G A;  2VXK A;  4NCZ A;  3F8K A;  2ZW4 A;  4UA3 A;  2DXQ A;  4NF1 A;  1YX0 A;  1MJB A;  2OH1 A;  3CXS A;  1YGH A;  5H86 A;  4XPD C;  3GY9 A;  4PSW A;  2B58 A;  4ONU A;  1S60 A;  4MHD A;  1P0H A;  1P4N A;  3UY5 A;  2PQ8 A;  4E2A A;  4QBJ A;  2REE A;  5EBV A;  2VZZ A;  1R57 A;  1VHS A;  5I0C A;  2Q7B A;  1BOB A;  1Q2D A;  2OZU A;  1Y7R A;  2FS5 A;  4MBU A;  3GYA A;  4KUB A;  2IL4 A;  1I21 A;  4PK3 A;  2PRB A;  3I9S A;  1RO5 A;  1XEB A;  3SHP A;  1YR0 A;  4FD6 A;  3BLN A;  3E0K A;  2P0W A;  4XPD B;  4AG9 A;  5FVJ A;  4M85 A;  1WWZ A;  3S6H A;  2BL1 A;  3IGR A;  2B4D A;  3F0A A;  3KKW A;  4H6Z A;  4YRH A;  4OAD A;  3VWD A;  4CAV A;  4X5K A;  5H84 A;  3F5B A;  1YLE A;  3D2M A;  4ORF A;  3OWC A;  3TTH A;  3JUW A;  3PGP A;  4KOR A;  2EVN A;  3D2P A;  3IWG A;  4U5Y A;  3LD2 A;  4R3L A;  2OZH A;  4KVM E;  4E8O A;  1XMT A;  4HNW B;  1QSO A;  1MJA A;  3P2F A;  3TO7 A; 
#chains in the Genus database with same CATH topology
 1F2P A;  1N71 A;  2J8R A;  4MCS A;  3S9M A;  2CIJ A;  1Z2L A;  3B3W A;  2GAN A;  1ZO0 A;  3DDD A;  2VQY A;  4CYP A;  4MFL A;  5A28 A;  4NEX A;  2YNE A;  2IQ6 A;  3LOD A;  3PP9 A;  2ZW5 A;  3NFZ A;  1B6B A;  2IMO A;  2QVP A;  3EXN A;  4KVO E;  1XOV A;  1IID A;  3R1K A;  1XRY A;  2FVG A;  4QC6 A;  2XEI A;  1SQH A;  3GKR A;  4WWV A;  4PXB A;  4M6I A;  1K4J A;  1TKF A;  4KSA A;  2I79 A;  3RNZ A;  3EO4 A;  4PSX A;  1F57 A;  2VL1 A;  4P4D A;  1M4L A;  4P45 A;  4DUK A;  2HV2 A;  4LQG A;  3A9L A;  3S6K A;  1XJO A;  2DF5 A;  3FEC A;  2CNS A;  4EFD A;  1CBX A;  2PVW A;  1EE3 P;  4RI1 A;  1CJW A;  2ZW7 A;  2B4B A;  4RN7 A;  4IHM A;  2BEI A;  2CNT A;  2X7B A;  4P4E A;  3KI9 A;  2JDC A;  4G1P A;  2KCW A;  4NGR A;  7CPA A;  1Z9U A;  3BXM A;  3DR8 A;  4UEZ A;  2A4N A;  4CAE A;  2B5G A;  4FBE A;  5AG4 A;  2ZEO A;  1M4I A;  1UFH A;  3KHX A;  3R9E A;  2Q04 A;  3QB8 A;  4YU9 A;  2PJ7 A;  1NMT A;  1QSR A;  3FEE A;  4NGM A;  5F47 A;  3D7H A;  5HVH A;  4MI4 A;  4KOY A;  3QAY A;  4UF4 A;  4JJX A;  4O23 A;  2GIV A;  1KUX A;  2Z3L A;  1Q7L A;  2V8V A;  3IO1 A;  4CGN A;  4YWY A;  4QB9 A;  3WC7 A;  2Z10 A;  4JYW A;  2XEJ A;  4AVA A;  3IJ3 A;  4A2Z A;  1IU8 A;  1Z5R A;  3BI1 A;  3K9U A;  1LAM A;  5IX3 A;  3H8E A;  1S5K A;  4BIN A;  2RFH A;  1JQG A;  4DNC A;  2G0B A;  5JQ4 A;  1M44 A;  3GLJ A;  5ELY A;  2GLJ A;  3RZA A;  5JGF A;  1AMP A;  2EO8 A;  1CPS A;  2ZEH A;  5KTA A;  3TX8 A;  3FYN A;  2AE6 A;  8CPA A;  1IIC A;  3TO6 A;  3H4Q A;  4ZX9 A;  1Z4R A;  3DNS A;  3EC4 A;  1LAP A;  4A94 A;  1Z4E A;  2F7V A;  4P10 A;  2Z3M A;  2Z3P A;  4KLV A;  2B3U A;  4JXQ A;  3H8F A;  2P6G A;  1S7F A;  3T8W A;  2ODF A;  2PR1 A;  4XPK A;  3MN8 A;  4ONW A;  2PJ4 A;  3B8G A;  3D7D A;  3JVN A;  4A37 A;  5K8M A;  1Z8W A;  3K2K A;  2YGW A;  3B3V A;  2NMT A;  4PPZ A;  3WAB A;  3G8W A;  3N7Z A;  1ELM P;  4QUS A;  4C68 A;  3PB9 X;  2V8H A;  2J9A A;  5HMN A;  1ARM A;  1KZF A;  2J8N A;  3SI2 A;  3D8P A;  3SJG A;  5DS0 A;  4OC2 A;  3FJU A;  4L89 A;  2GFQ A;  3FB3 A;  4NGN A;  4P4F A;  4MMO A;  3LWU A;  3ZJ0 A;  4C7I A;  4C2Z A;  2Q0Y A;  3NE8 A;  1Y9W A;  1YVK A;  5AG5 A;  4YFJ A;  5DWN A;  5G21 A;  2JBK A;  4OAE A;  4MY3 A;  2OZG A;  2P6F A;  2R1I A;  1QSN A;  3N5F A;  4CYO A;  4IUS A;  3EFA A;  4PQA A;  2B3V A;  5C88 A;  5K8O A;  3CXQ A;  4NGQ A;  2RB7 A;  2WPW A;  4A31 A;  3PB4 X;  2QEC A;  4R3K A;  1IGB A;  1XBU A;  4GXH A;  3VAR A;  2PRQ A;  3B35 A;  2ZOF A;  3DSB A;  3W6X A;  3VH9 A;  1KUY A;  4EVY A;  4MHY A;  4LUA A;  2ZED A;  4ZBG A;  4P44 A;  4LX9 A;  4CYN A;  4M3S A;  1NSA A;  3R9G A;  2G9D A;  5IB0 A;  4Y49 B;  2R7H A;  4KOW A;  3TO9 A;  3V8I A;  3SXN A;  1LCP A;  3KR4 A;  4H2K A;  2Z11 A;  4M6G A;  3IEH A;  2ARH A;  5C82 A;  1IOI A;  1PUA A;  2ZEE A;  1Z8X A;  4CGP A;  1PCA A;  1Q2Y A;  3PZJ A;  3ZZI A;  1MJ9 A;  4Q7A A;  4JWP A;  3H8G A;  3RAM A;  3V38 A;  2XEG A;  1NSL A;  1ARL A;  4OC5 A;  3PFE A;  3SJX A;  1BLL E;  5E96 A;  1A2Z A;  5JH9 A;  4WJB A;  5JM6 A;  1Y0Y A;  1M4D A;  5LYD A;  1DE4 C;  3I1U A;  1VGY A;  2G3T A;  5AG7 A;  3VAT A;  3R96 A;  2HQY A;  2D4P A;  3DR6 A;  4KOT A;  1TKJ A;  2ZEL A;  1ELL P;  2YND A;  2IJZ A;  3FNC A;  1GYT A;  5HVG A;  5KTC A;  3KZW A;  3PB7 X;  4UEE A;  4L8A A;  2GU2 A;  2BOA A;  2PC1 A;  2JEW A;  2RC4 A;  3NH4 A;  1PU9 A;  2CTC A;  2PSW A;  3PBB A;  4FD5 A;  5A27 A;  3K9T A;  3CXP A;  4PXD A;  4BMH A;  1IYL A;  4J3G A;  1L0C A;  4HPS A;  4ZY2 A;  4KSF A;  5GCN A;  3D67 A;  1R3N A;  4FD7 A;  4YGO A;  4B5O A;  2WPX A;  4HKF A;  4NXY A;  4UFV A;  4UCM A;  4KUA A;  4PXC A;  1QSM A;  2JEV A;  4AVC A;  4CGO A;  4X3R A;  2GLF A;  3QAH A;  4EWT A;  2F5I A;  3PRT A;  4XNH B;  3S9N A;  4UIB A;  5LYI A;  4II9 A;  2FE7 A;  2FL4 A;  2K5T A;  3W6S A;  1M1D A;  4AB7 A;  6CPA A;  3G3S A;  5KTD A;  1U6M A;  4CAF A;  2B4D B;  1ZLH A;  1V0C A;  4KLW A;  4F0Y A;  4XNH C;  5EC4 A;  4Z65 A;  1LOK A;  4U9Y A;  2EK9 A;  4QVT A;  3HLP A;  2CY2 A;  3IWE A;  1J4J A;  5F48 A;  1XIX A;  4B10 A;  2ZEG A;  3D3S A;  4H6U A;  3DGV A;  4XPL A;  5I4M A;  2XEF A;  5JPH A;  2EUI A;  3FVL A;  4KOV A;  3TOA A;  3WC6 A;  3WC5 A;  1I12 A;  4K3N A;  3BJ8 A;  3FED A;  4P4J A;  5HXD A;  3FBU A;  1M4G A;  2BUE A;  2CF4 A;  2PIY A;  2ABZ A;  4NSQ A;  4B6Z A;  5J8C A;  5F09 A;  1KWM A;  2C27 A;  4KOS A;  1YLO A;  5D29 A;  2R8V A;  4PV6 A;  4DJL A;  1YK3 A;  4R87 A;  4OC4 A;  3FX6 A;  3H5Z A;  5AG6 A;  2R98 A;  1S3Z A;  2QYV A;  2J8M A;  2YNC C;  4AG7 A;  1TXR A;  2PJ8 A;  5F46 A;  4BD9 A;  2ZXV A;  1I1D A;  3BI0 A;  3GB0 A;  2AFO A;  2WSA A;  3R9F A;  4F9V A;  4MHZ A;  2ZW6 A;  1YW4 A;  2HC9 A;  1ON0 A;  3TOB A;  5DWM A;  1IYK A;  2ZOG A;  3EY5 A;  4FWU A;  4R76 A;  4X2T A;  2NYQ A;  3FRM A;  4F6A A;  3KR5 A;  2ZEM A;  2C6P A;  1S7N A;  3CPX A;  3BJ7 A;  4UCN A;  3CPA A;  5LRK A;  4CPA A;  3MRU A;  4ZX8 A;  1BO4 A;  3P2H A;  2O53 A;  1S7L A;  2Q44 A;  1AUG A;  5LRG A;  4ZY0 A;  3QNV A;  3D4U A;  4R9M A;  3FIX A;  3BHX A;  1FY7 A;  1CP6 A;  2FSR A;  3S6G A;  2NSM A;  1H8L A;  1MK4 A;  3IFE A;  1ZG8 A;  2GE3 A;  4MFZ A;  4CS0 B;  4W9Y A;  2VZY A;  2ZPA A;  4KVX A;  2DEA A;  4B5P B;  4C2Y A;  2PR8 A;  1VHE A;  1YVO A;  3KHZ A;  4HNX B;  2FIA A;  4IF5 A;  3RYO A;  1YRE A;  2O28 A;  4U9Z A;  2BSW A;  4MHP A;  4MCP A;  4KOU A;  2I3C A;  2QML A;  1UWY A;  4NJR A;  3V7Z A;  2G3A A;  4CRY B;  1ZG9 A;  2Z3N A;  4IK2 A;  3TCV A;  1BAV A;  4PK2 A;  2B5G B;  4A95 A;  2F8H A;  1S7K A;  4OC3 A;  2VI7 A;  2OB0 A;  2ZEF A;  4KSI A;  3D7G A;  4HNY B;  2V8D A;  2PE3 A;  5LYF A;  5IV0 A;  4CYQ A;  4F0X A;  1Y9K A;  1Z8T A;  4FD4 A;  1FT7 A;  2ANP A;  2C6G A;  3C26 A;  4LQ6 A;  2REF A;  1NE9 A;  1TIQ A;  1Y7E A;  3GIU A;  5K8P A;  5ISV A;  3MGD A;  2CTB A;  3WR7 A;  4R7M A;  5J1Q A;  2PIZ A;  3IC1 A;  1WK4 A;  2AJ6 A;  3TFY A;  3L2N A;  1Z8L A;  3PBE A;  3WT4 A;  1X10 A;  5EMI A;  4UFW A;  1VKC A;  1OZP A;  2HB6 A;  5J8F A;  1Q2C A;  4MRI A;  1TKH A;  3NE7 A;  2JLM A;  4OID A;  4ZYQ A;  2Z3K A;  3PFO A;  3S6F A;  4C2X A;  3TT2 A;  2FT0 A;  3T9Y A;  5HVF A;  2QJ8 A;  2AFM A;  4TNU A;  2ATR A;  4MY0 A;  3D7F A;  4DYO A;  2POK A;  1ZG7 A;  1XF8 A;  2Q4V A;  2VBQ A;  3JTK A;  3PB8 X;  4I49 A;  3FXT A;  4R57 A;  3W91 A;  4B5P A;  2PDO A;  3KGQ A;  4KZT A;  2ZEP A;  4UWI A;  4EME A;  2QIR A;  3SXO A;  2Q4Y A;  4PXE A;  4H89 A;  3FF3 A;  4CAX A;  2I00 A;  1QQ9 A;  4MFP A;  3CZX A;  4MJ8 A;  4JXR A;  2P6E A;  2BO9 A;  4JLY A;  2Z3O A;  2Y0M A;  1Y0R A;  3T90 A;  4MCR A;  4UEF A;  2H5M A;  4K30 A;  2EK8 A;  4E0A A;  3CDX A;  1B87 A;  2FIW A;  2FXF A;  4OIW A;  4R8F A;  1RXT A;  1IY7 A;  4GS4 A;  3R95 A;  3D66 A;  1GHE A;  4AVB A;  2JDD A;  4NGT A;  4CAW A;  1TF8 A;  3SI1 A;  4FAI A;  4ZY1 A;  3PB6 X;  2FCK A;  4A30 A;  4M6H A;  2Q43 A;  3PEI A;  1RTQ A;  4NGP A;  3TE4 A;  2PJ6 A;  4NFR A;  4OLL A;  5F49 A;  4MFJ A;  2V8G A;  1KUV A;  5AGE A;  2Q7S A;  3RO0 A;  1IB1 E;  1QST A;  5LRJ A;  1XE4 A;  3S9L A;  3JRU A;  3SJE A;  4A39 A;  3B3C A;  4UBR A;  4UWJ A;  5LYL A;  1HEE A;  1CM0 A;  3IU1 A;  3VWE A;  3ISX A;  4CRZ B;  2BCO A;  3NH8 A;  5CNP A;  4C7H A;  4KOX A;  1VHO A;  5HH1 A;  1OBR A;  4RS2 A;  3TC8 A;  4RUH A;  4Y49 C;  4OC0 A;  1CX8 A;  1LRZ A;  2OU2 A;  2PJ0 A;  2HUZ A;  1YQE A;  1ZLI A;  2VEZ A;  1BPN A;  2D4O A;  2Q51 A;  4JD6 A;  2Z0Z A;  3B3T A;  1XMB A;  2CNM A;  4OP4 A;  4Q36 A;  2C1C A;  2CXA A;  2PJ5 A;  4MXU A;  3IWW A;  2PJA A;  4MHN A;  1IOF A;  3I3G A;  5G22 A;  2VXK A;  1QMU A;  3D68 A;  4OC1 A;  4AXV A;  4NCZ A;  2PCU A;  3F8K A;  1DTD A;  2ZW4 A;  3SI0 A;  4UA3 A;  4F8Z A;  2DXQ A;  5CBM A;  2O4H A;  1YX0 A;  4NF1 A;  1MJB A;  2OH1 A;  3CT9 A;  3CXS A;  1YSJ A;  1YGH A;  1XFO A;  3B3S A;  5G1Z A;  5H86 A;  4XPD C;  2PJB A;  3GY9 A;  4PSW A;  2B58 A;  3B7I A;  4MFQ A;  4ONU A;  1S60 A;  4MHD A;  1P0H A;  2Q4Z A;  1VIX A;  1P4N A;  3UY5 A;  2PQ8 A;  4E2A A;  4QBJ A;  2REE A;  3DLJ A;  5EBV A;  2VZZ A;  1R57 A;  1VHS A;  3KQX A;  5I0C A;  3KQZ A;  4CGM A;  2AFU A;  4Q38 A;  4F9U A;  2Q7B A;  1BOB A;  1Q2D A;  4B12 A;  2OZU A;  1Y7R A;  2FS5 A;  4B11 A;  1HDQ A;  4A38 A;  4CGL A;  5K8N A;  3IIB A;  1TF9 A;  4MBU A;  2EBJ A;  5BWA B;  2PJ1 A;  3GYA A;  4KUB A;  2AFS A;  1BPM A;  1I21 A;  2IL4 A;  2WZN A;  3NH5 A;  2ZEN A;  2PRB A;  2PJ2 A;  4PK3 A;  3I9S A;  1HDU A;  2AFZ A;  1RO5 A;  2DPT A;  4B13 A;  4P4I A;  1F2O A;  1XEB A;  5THW A;  4X8I A;  1LAN A;  3SHP A;  1YR0 A;  2C6C A;  2GRE A;  4FD6 A;  5D8N A;  1YW6 A;  2WYR A;  3BLN A;  3E0K A;  2P0W A;  4P6Y A;  5IB9 A;  2AFW A;  4A33 A;  3SJF A;  4XPD B;  4AG9 A;  3LAC A;  5FVJ A;  2YNC A;  4M85 A;  3B2Y A;  4B14 A;  4OME A;  2AFX A;  1PYT B;  1WWZ A;  2PJC A;  3KAS A;  3S6H A;  4GM5 A;  2BL1 A;  3IGR A;  4UCP A;  2OR4 A;  1AYE A;  4NGS A;  2B4D A;  3F0A A;  3RBU A;  4UFX A;  2JBJ A;  4OKO A;  3KKW A;  4A32 A;  1CG2 A;  4H6Z A;  4YRH A;  4FUU A;  4OAD A;  3VWD A;  3KL9 A;  4CAV A;  1FNO A;  2PVV A;  4X5K A;  4MFK A;  4KS9 A;  2DPS A;  5H84 A;  5G20 A;  3FMC A;  3F5B A;  4JZ0 A;  1YLE A;  2OOT A;  3D2M A;  1CP7 A;  4ORF A;  4TWE A;  4NJQ A;  3OWC A;  4ZGY B;  3TTH A;  1YME A;  4P4B A;  3JUW A;  3PGP A;  4KOR A;  1X12 A;  4UIA A;  2EVN A;  3D2P A;  1R43 A;  3IWG A;  4U5Y A;  1JWQ A;  3HUV A;  1CPX A;  3ISZ A;  3LD2 A;  2PJ3 A;  4R3L A;  4ZI6 A;  2OZH A;  3LMS A;  3GUX A;  4KVM E;  5CPA A;  4E8O A;  1XMT A;  2V77 A;  4HNW B;  4MCQ A;  1QSO A;  2PJ9 A;  2EWB A;  3IU2 A;  1LFW A;  4BBH A;  2WUU A;  4IAV A;  1MJA A;  4R6T A;  3P2F A;  3NA6 A;  3FH4 A;  3TO7 A; 
#chains in the Genus database with same CATH homology
 1N71 A;  2J8R A;  2GAN A;  1ZO0 A;  3DDD A;  2VQY A;  4CYP A;  4MFL A;  5A28 A;  4NEX A;  2YNE A;  3LOD A;  3PP9 A;  2ZW5 A;  1B6B A;  3EXN A;  4KVO E;  1IID A;  3R1K A;  4QC6 A;  1SQH A;  3GKR A;  1K4J A;  4KSA A;  2I79 A;  3EO4 A;  4PSX A;  2HV2 A;  3A9L A;  3S6K A;  2CNS A;  4RI1 A;  1CJW A;  2ZW7 A;  2B4B A;  2BEI A;  2CNT A;  2X7B A;  2JDC A;  2KCW A;  1Z9U A;  3DR8 A;  2A4N A;  4CAE A;  2B5G A;  5AG4 A;  1M4I A;  1UFH A;  3R9E A;  2Q04 A;  3QB8 A;  1QSR A;  1NMT A;  5F47 A;  4MI4 A;  4KOY A;  4JJX A;  2GIV A;  1KUX A;  2Z3L A;  4CGN A;  4QB9 A;  4AVA A;  2Z10 A;  4A2Z A;  3K9U A;  5IX3 A;  1S5K A;  4DNC A;  2G0B A;  5JQ4 A;  1M44 A;  5KTA A;  3FYN A;  2AE6 A;  1IIC A;  3TO6 A;  3H4Q A;  1Z4R A;  3DNS A;  3EC4 A;  1Z4E A;  2Z3M A;  2Z3P A;  4KLV A;  2B3U A;  4JXQ A;  2P6G A;  1S7F A;  4CGP A;  2PR1 A;  4XPK A;  3B8G A;  3JVN A;  2YGW A;  2NMT A;  3G8W A;  3N7Z A;  4QUS A;  4C68 A;  5HMN A;  2J8N A;  1KZF A;  3D8P A;  4L89 A;  3FB3 A;  3ZJ0 A;  4C7I A;  4C2Z A;  2Q0Y A;  1Y9W A;  1YVK A;  5AG5 A;  4YFJ A;  5DWN A;  5G21 A;  4OAE A;  4MY3 A;  2OZG A;  2P6F A;  2R1I A;  1QSN A;  4CYO A;  4IUS A;  3EFA A;  5C88 A;  2B3V A;  3CXQ A;  2WPW A;  4A31 A;  2QEC A;  4R3K A;  3DSB A;  3W6X A;  1KUY A;  4EVY A;  4LUA A;  4ZBG A;  4LX9 A;  4CYN A;  4M3S A;  3R9G A;  5IB0 A;  4Y49 B;  2R7H A;  4KOW A;  3TO9 A;  3V8I A;  3SXN A;  2Z11 A;  2ARH A;  5C82 A;  1PUA A;  1Q2Y A;  3PZJ A;  3ZZI A;  1MJ9 A;  4JWP A;  1NSL A;  5E96 A;  1M4D A;  2G3T A;  5AG7 A;  3R96 A;  2HQY A;  2D4P A;  3DR6 A;  4KOT A;  2YND A;  3FNC A;  5KTC A;  4L8A A;  2PC1 A;  2RC4 A;  4FD5 A;  1PU9 A;  2PSW A;  5A27 A;  3CXP A;  4BMH A;  1IYL A;  4J3G A;  1L0C A;  4KSF A;  5GCN A;  4FD7 A;  4YGO A;  4B5O A;  2WPX A;  4HKF A;  4NXY A;  4UFV A;  4UCM A;  4KUA A;  4CGO A;  1QSM A;  2JEV A;  4AVC A;  3QAH A;  2F5I A;  4XNH B;  4II9 A;  2FE7 A;  2FL4 A;  2K5T A;  3W6S A;  1M1D A;  4AB7 A;  3G3S A;  5KTD A;  1U6M A;  4CAF A;  2B4D B;  1V0C A;  4KLW A;  4F0Y A;  4XNH C;  5EC4 A;  4U9Y A;  4QVT A;  3IWE A;  2CY2 A;  1J4J A;  5F48 A;  1XIX A;  4B10 A;  3D3S A;  4H6U A;  4XPL A;  5JPH A;  2EUI A;  4KOV A;  3TOA A;  1I12 A;  3BJ8 A;  3FBU A;  1M4G A;  2BUE A;  4NSQ A;  5J8C A;  2C27 A;  4KOS A;  2R8V A;  4PV6 A;  1YK3 A;  4R87 A;  3H5Z A;  5AG6 A;  2R98 A;  1S3Z A;  2J8M A;  2YNC C;  4AG7 A;  5F46 A;  2ZXV A;  1I1D A;  3R9F A;  2WSA A;  2ZW6 A;  1ON0 A;  3TOB A;  5DWM A;  1IYK A;  3EY5 A;  3FRM A;  4F6A A;  1S7N A;  3BJ7 A;  4UCN A;  1BO4 A;  3P2H A;  1S7L A;  2Q44 A;  4R9M A;  3FIX A;  1FY7 A;  2FSR A;  3S6G A;  1MK4 A;  2GE3 A;  4CS0 B;  4MFZ A;  2VZY A;  2ZPA A;  4KVX A;  4B5P B;  4C2Y A;  2PR8 A;  1YVO A;  4HNX B;  2FIA A;  4IF5 A;  3RYO A;  1YRE A;  2O28 A;  4U9Z A;  2BSW A;  4KOU A;  2QML A;  2G3A A;  4CRY B;  2Z3N A;  3TCV A;  4PK2 A;  2B5G B;  4A95 A;  1S7K A;  2VI7 A;  2OB0 A;  4HNY B;  5IV0 A;  4CYQ A;  1Y9K A;  4FD4 A;  3C26 A;  2REF A;  1NE9 A;  1TIQ A;  5ISV A;  3MGD A;  3WR7 A;  1WK4 A;  2AJ6 A;  3TFY A;  4UFW A;  1VKC A;  1OZP A;  5J8F A;  1Q2C A;  3NE7 A;  2JLM A;  2Z3K A;  3S6F A;  4C2X A;  3TT2 A;  2FT0 A;  3T9Y A;  2ATR A;  4MY0 A;  2Q4V A;  2VBQ A;  1XF8 A;  4I49 A;  4R57 A;  3JTK A;  3W91 A;  4B5P A;  3FXT A;  4F0X A;  2PDO A;  4KZT A;  4UWI A;  2QIR A;  3SXO A;  2Q4Y A;  4CAX A;  4H89 A;  2I00 A;  4MFP A;  4MJ8 A;  4JXR A;  2P6E A;  4JLY A;  2Z3O A;  2Y0M A;  3T90 A;  2H5M A;  4K30 A;  4E0A A;  1B87 A;  2FIW A;  2FXF A;  1RXT A;  4GS4 A;  3R95 A;  1GHE A;  4AVB A;  2JDD A;  4CAW A;  2FCK A;  4A30 A;  3TE4 A;  4OLL A;  5F49 A;  4MFJ A;  5AGE A;  1KUV A;  1IB1 E;  1QST A;  1XE4 A;  4UBR A;  4UWJ A;  1CM0 A;  3IU1 A;  3VWE A;  4CRZ B;  5CNP A;  4C7H A;  4KOX A;  5HH1 A;  4RS2 A;  4Y49 C;  1LRZ A;  2OU2 A;  2HUZ A;  2VEZ A;  2D4O A;  4JD6 A;  2Z0Z A;  2CNM A;  4Q36 A;  2CXA A;  3I3G A;  5G22 A;  2VXK A;  4NCZ A;  3F8K A;  2ZW4 A;  4UA3 A;  2DXQ A;  4NF1 A;  1YX0 A;  1MJB A;  2OH1 A;  3CXS A;  1YGH A;  5G1Z A;  5H86 A;  4XPD C;  3GY9 A;  4PSW A;  2B58 A;  4MFQ A;  4ONU A;  1S60 A;  4MHD A;  1P0H A;  1P4N A;  3UY5 A;  2PQ8 A;  4E2A A;  4QBJ A;  2REE A;  5EBV A;  2VZZ A;  1R57 A;  1VHS A;  5I0C A;  4CGM A;  4Q38 A;  2Q7B A;  1BOB A;  1Q2D A;  4B12 A;  2OZU A;  1Y7R A;  2FS5 A;  4B11 A;  4CGL A;  4MBU A;  5BWA B;  3GYA A;  4KUB A;  2IL4 A;  1I21 A;  4PK3 A;  2PRB A;  3I9S A;  1RO5 A;  2DPT A;  4B13 A;  1XEB A;  3SHP A;  1YR0 A;  4FD6 A;  3BLN A;  3E0K A;  2P0W A;  4A33 A;  4XPD B;  4AG9 A;  5FVJ A;  2YNC A;  4M85 A;  4B14 A;  1WWZ A;  3S6H A;  2BL1 A;  3IGR A;  4UCP A;  2B4D A;  3F0A A;  4UFX A;  3KKW A;  4A32 A;  4H6Z A;  4YRH A;  4OAD A;  3VWD A;  4CAV A;  4X5K A;  4MFK A;  4KS9 A;  2DPS A;  5H84 A;  5G20 A;  3F5B A;  1YLE A;  3D2M A;  4ORF A;  4ZGY B;  3OWC A;  3TTH A;  3JUW A;  3PGP A;  4KOR A;  2EVN A;  3D2P A;  3IWG A;  4U5Y A;  3LD2 A;  4R3L A;  2OZH A;  4KVM E;  4E8O A;  1XMT A;  4HNW B;  1QSO A;  3IU2 A;  4BBH A;  2WUU A;  1MJA A;  3P2F A;  3TO7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...