2EVNA

Nmr solution structures of at1g77540
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
103
structure length
103
Chain Sequence
MATEPPKIVWNEGKRRFETEDHEAFIEYKMRNNGKVMDLVHTYVPSFKRGLGLASHLCVAAFEHASSHSISIIPSCSYVSDTFLPRNPSWKPLIHSEVFKSSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Protein At1g77540
publication title Structure of Arabidopsis thaliana At1g77540 Protein, a Minimal Acetyltransferase from the COG2388 Family.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 22
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14542 Acetyltransf_CG GCN5-related N-acetyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2evnA00
4KORA 3I9SA 2F5IA 1XEBA 1I21A 2FL4A 5H84A 4XPDC 1Y9KA 1YREA 1WWZA 4PV6A 5HMNA 1I1DA 1UFHA 1VKCA 3IGRA 1Q2DA 4JXQA 3V8IA 5H86A 1S7FA 1MJ9A 3SXNA 3BJ8A 4AVAA 2JDDA 4AG9A 1KUYA 1S7KA 5J8CA 4UA3A 4E8OA 3VWEA 2FE7A 3R9GA 3CXSA 4KOVA 5JQ4A 5KTCA 1U6MA 1IYKA 2VI7A 4E0AA 2B3VA 3EC4A 1XIXA 3W6SA 1B87A 4NEXA 4R3KA 2CNMA 4L89A 4R87A 4XNHC 4EVYA 2EVNA 2Z10A 3OWCA 2OZHA 3R1KA 1CM0A 2J8MA 2ZW6A 4KOSA 3S6KA 4AB7A 3R96A 3TO6A 2P6FA 5C82A 1MK4A 2PDOA 2BEIA 2AE6A 2PSWA 3T9YA 3SXOA 1LRZA 4CRYB 2PR8A 2B3UA 3QAHA 1P0HA 1Z9UA 4MY0A 3ZZIA 1NSLA 3JUWA 3R95A 1M1DA 3GKRA 1NE9A 4M3SA 2G0BA 1N71A 2IL4A 1RXTA 1B6BA 1V0CA 3N7ZA 4NCZA 1PUAA 2FCKA 2GANA 2K5TA 3H4QA 4H89A 5IB0A 3DR8A 4H6UA 4QBJA 4E2AA 2PC1A 1QSMA 3PZJA 4NSQA 3F0AA 2FSRA 1K4JA 4J3GA 3WR7A 3W91A 3TO9A 3FB3A 3R9EA 3C26A 3K9UA 4HNYB 3PGPA 3GYAA 2VXKA 5EC4A 2OB0A 3D3SA 2D4PA 4Y49C 5C88A 4LX9A 3NE7A 4PK3A 5CNPA 2FT0A 4CAXA 2HUZA 4R9MA 3BLNA 3EY5A 4R57A 4B5OA 3G3SA 2GIVA 3E0KA 4KLVA 1S3ZA 1Z4RA 3PP9A 1IICA 2OH1A 3S6HA 3S6GA 4AVBA 2EUIA 4KUBA 4OAEA 4KUAA 4KZTA 4QUSA 5F47A 3TOBA 2OU2A 1Y7RA 3B8GA 1Y9WA 3EFAA 4AVCA 2B58A 2Y0MA 2WPXA 2A4NA 3VWDA 2NMTA 1IB1E 4KVXA 3FRMA 4MHDA 3ZJ0A 2PQ8A 3LODA 4KVOE 4FD7A 4MI4A 1YR0A 1M4DA 5GCNA 1QSNA 3R9FA 1FY7A 1TIQA 2P6GA 3I3GA 3TO7A 3IWGA 3D8PA 4F0YA 3DR6A 3TFYA 2Q4YA 2D4OA 2VBQA 4M85A 4RI1A 3T90A 4X5KA 1M4GA 2H5MA 2VEZA 4IUSA 2OZGA 2OZUA 4AG7A 4QB9A 3FIXA 4LUAA 1IIDA 2ZW5A 1M44A 1S5KA 2ZXVA 2RC4A 4HNXB 3FBUA 1I12A 2Q7BA 2B5GB 3EXNA 5ISVA 2ZPAA 3TOAA 2VZZA 2J8NA 2B5GA 1PU9A 1ON0A 4YFJA 5J8FA 1YX0A 4HKFA 1XF8A 3UY5A 1GHEA 1M4IA 2JLMA 4MBUA 4KOYA 4YRHA 4CAVA 1P4NA 2WPWA 4XNHB 4QVTA 3DSBA 3KKWA 4KOUA 4I49A 1Q2CA 3W6XA 4JD6A 5IV0A 1NMTA 5FVJA 3P2HA 2CNSA 5JPHA 3FNCA 2ARHA 3LD2A 4XPLA 5KTDA 1VHSA 3DNSA 2CY2A 3CXPA 2J8RA 2I00A 2Q04A 2JDCA 2B4DB 4HNWB 1KUVA 2HV2A 1XMTA 4JLYA 2C27A 2B4DA 2BL1A 2KCWA 4B5PB 1YGHA 5HH1A 4JXRA 5IX3A 5E96A 5F48A 3DDDA 4KVME 2Q44A 4CAWA 3D2PA 4CS0B 4B5PA 2QMLA 1QSRA 3P2FA 3CXQA 4ONUA 4KOXA 4F6AA 2R1IA 4GS4A 2CNTA 4UBRA 1S7NA 1S7LA 2R7HA 3TE4A 1SQHA 1KUXA 4YGOA 2BUEA 3MGDA 2FIWA 4KOWA 1RO5A 4U5YA 4UWJA 2FIAA 4Y49B 2PR1A 2REFA 3D2MA 1YVKA 2I79A 5F49A 2ATRA 4PK2A 2Z11A 4L8AA 2ZW4A 4RS2A 1YVOA 3GY9A 2QIRA 2AJ6A 4XPDB 1L0CA 2R8VA 1S60A 2FS5A 5EBVA 1WK4A 2Q0YA 3G8WA 5DWMA 1BOBA 3TCVA 3FYNA 1CJWA 2HQYA 3SHPA 1MJAA 4NF1A 4KOTA 1J4JA 2JEVA 3RYOA 1QSOA 1YLEA 4JWPA 2O28A 4KLWA 2FXFA 4ZBGA 4K30A 4U9ZA 1R57A 2R98A 2P6EA 1Q2YA 2P0WA 2QECA 1XE4A 4MJ8A 2BSWA 4OLLA 1IYLA 4II9A 5KTAA 4OADA 2G3AA 4IF5A 1MJBA 1QSTA 2B4BA 4FD6A 4JJXA 3JVNA 5DWNA 4DNCA 2Q4VA 4QC6A 2GE3A 1KZFA 4FD5A 5I0CA 2ZW7A 1YK3A 3EO4A 3QB8A 1BO4A 2G3TA 4CRZB 4U9YA 4BMHA 2VQYA 1OZPA 2Z0ZA 3F8KA 4UWIA 3TTHA 2VZYA 4PSWA 3TT2A 5F46A 4PSXA 2X7BA 2PRBA 4H6ZA 3F5BA 4XPKA 4MY3A 4FD4A 1Z4EA 3BJ7A 4R3LA 2REEA 3S6FA 4NXYA 4ORFA 2DXQA 3FXTA
chains in the Genus database with same CATH superfamily
1X10A 3PB6X 4KORA 3I9SA 3PBBA 3D7DA 4NGSA 2F5IA 4CGLA 3KL9A 1XEBA 2EBJA 2Q51A 1VHOA 4MCQA 4FUUA 1I21A 2FL4A 5H84A 4XPDC 3MN8A 1H8LA 4UIAA 5JH9A 4UEFA 2ZEMA 5HVHA 2CIJA 1Y9KA 1YREA 3SI0A 1WWZA 4PV6A 4NJRA 2DPSA 5HMNA 1I1DA 1UFHA 1VKCA 3IGRA 1YLOA 2ZEHA 1UWYA 1Q2DA 4JXQA 3V8IA 5H86A 1S7FA 1MJ9A 1VGYA 2Z3KA 3SXNA 3BJ8A 4PPZA 3D67A 4AVAA 1XRYA 2PJBA 3S9MA 2JDDA 3KR5A 4AG9A 4PXBA 4F9VA 2C6CA 3FEDA 1KUYA 1F57A 2C6PA 1BAVA 1S7KA 2OOTA 5J8CA 2YNDA 4UA3A 4E8OA 2DF5A 3IWEA 3PBEA 5BWAB 2RFHA 3VWEA 2FE7A 3R9GA 4MHYA 3WT4A 3CXSA 4KOVA 5JQ4A 5KTCA 1U6MA 1IYKA 2VI7A 2ZELA 2Z3LA 1FT7A 4P4JA 2PIZA 5IB9A 4E0AA 2B3VA 4A31A 3EC4A 1XIXA 3W6SA 4CGMA 5AG4A 1B87A 1IY7A 4C7IA 2YNEA 1TKJA 4NGTA 4NEXA 3N5FA 4MFQA 1CBXA 4R3KA 2CNMA 3KZWA 3H8FA 3D7GA 2ANPA 4L89A 4R87A 4XNHC 4NGPA 3H8EA 4YU9A 2EVNA 2Z10A 3OWCA 1YQEA 2OZHA 4EVYA 4P44A 5HVGA 1NSAA 3IEHA 3R1KA 1CM0A 2AFXA 2J8MA 2ZW6A 3KR4A 2IQ6A 4KOSA 4IHMA 4P4EA 4CYPA 3S6KA 4A33A 3IC1A 3R96A 3TO6A 3WC6A 3NA6A 2P6FA 4AB7A 5C82A 2EWBA 1XJOA 1MK4A 2PDOA 4MFKA 2BEIA 2Z3OA 4X3RA 2AE6A 2PSWA 3T9YA 3SXOA 1LRZA 4CRYB 2PR8A 1Z8LA 2B3UA 4B14A 3D4UA 3QAHA 5HVFA 1Z5RA 2XEJA 3KASA 3GB0A 1P0HA 1JWQA 1Z9UA 2ZENA 4MY0A 3ZZIA 3CDXA 1NSLA 2V8VA 3JUWA 2HB6A 3R95A 4C2YA 3IFEA 1M1DA 3GKRA 1ARMA 4OC5A 1NE9A 4M3SA 3IJ3A 2G0BA 5JGFA 2ZOFA 1N71A 2IL4A 4P4BA 1RXTA 1B6BA 1V0CA 5JM6A 3FJUA 5ELYA 4A39A 1HDQA 3N7ZA 4LQ6A 4NCZA 4YWYA 1LAMA 2C1CA 1PUAA 2Q4ZA 1LANA 4TNUA 4NGQA 2FCKA 3KI9A 4CAEA 2GANA 3SI1A 2K5TA 4MRIA 3H4QA 4CYOA 4H89A 5IB0A 2AFZA 3FVLA 4A32A 3DR8A 1Z2LA 4H6UA 4QBJA 4ZI6A 4NGMA 4E2AA 2PC1A 1QSMA 2VL1A 3PZJA 4JZ0A 1XBUA 4NSQA 3F0AA 3PFEA 3KGQA 1LOKA 1K4JA 2FSRA 4J3GA 4MFLA 1TXRA 5K8OA 3WR7A 3IU1A 3W91A 4C2ZA 4UFVA 3SJFA 4X8IA 3HLPA 3TO9A 3FB3A 4CAFA 3R9EA 4CGPA 3C26A 4OC3A 3K9UA 4HNYB 2JBKA 3PGPA 3GYAA 1ZLHA 2ABZA 2VXKA 5EC4A 2OB0A 1A2ZA 3D3SA 2V8DA 2D4PA 3D68A 4OP4A 4Y49C 4ZX9A 1AUGA 1DTDA 2IMOA 2GLJA 1CP6A 4LX9A 5C88A 2XEFA 3IU2A 3JTKA 3I1UA 3NE7A 2Q7SA 1YW4A 2PVVA 4PK3A 4MFJA 1R43A 4PXCA 3BXMA 5CNPA 2AFMA 2FT0A 2WSAA 5J1QA 4CAXA 2BCOA 2HUZA 2ZEFA 4R9MA 2PJ8A 3BLNA 5D29A 1CX8A 3EY5A 1LFWA 4B12A 4R57A 4KSIA 4B5OA 1BLLE 3G3SA 4UF4A 2GIVA 3E0KA 4KLVA 4F9UA 5F09A 3KQZA 3FECA 1S3ZA 1Z4RA 2JEWA 3PP9A 1IICA 2OH1A 2PJ2A 3LACA 3VARA 5I4MA 3S6HA 2PE3A 3S6GA 4K3NA 1CG2A 1Y7EA 2YNCA 3B3TA 1Z8WA 4AVBA 2EUIA 3CZXA 4MHPA 4KUBA 4W9YA 3IIBA 2PJ7A 4KUAA 3DLJA 4KZTA 4MFPA 4MMOA 4NGRA 4OAEA 4QUSA 2BOAA 2OU2A 5F47A 1Y7RA 5THWA 3TOBA 4EMEA 1Q7LA 3B8GA 1Y9WA 3EFAA 4CYNA 4AVCA 2B58A 2Y0MA 2WPXA 3DGVA 4B11A 4P4FA 1IGBA 3ISZA 3RZAA 3H8GA 2AFWA 2A4NA 3VWDA 4KSAA 2NMTA 2V8HA 1IB1E 3CPAA 5G1ZA 1TKHA 3B3VA 4KVXA 2ZEEA 3FRMA 4MHDA 3ZJ0A 2PQ8A 4M6HA 4CGOA 3FMCA 3LODA 8CPAA 4KVOE 1CPSA 2PCUA 3BHXA 3H5ZA 4FD7A 4MI4A 1ZO0A 2Z3NA 3PB8X 1YR0A 4R76A 4ZX8A 3PB9X 4ZY2A 3VATA 1M4DA 5GCNA 1QSNA 4A38A 4A94A 2JBJA 4GXHA 2C6GA 3B3SA 1DE4C 3CT9A 3R9FA 2QYVA 1FY7A 4UEEA 4R6TA 1TIQA 1Z8XA 3JRUA 5EMIA 4F0XA 2P6GA 4B10A 2PJ5A 1EE3P 2ZEOA 3I3GA 3TO7A 3IWGA 3D8PA 4F0YA 2G9DA 1ZG7A 2PJ9A 2PJ6A 3DR6A 5K8MA 3ISXA 3TFYA 2Q4YA 3FEEA 2D4OA 4HPSA 2VBQA 4M85A 3WABA 4RI1A 3T90A 4X5KA 1IU8A 1M4GA 2H5MA 4CPAA 5AG7A 5G20A 2AFOA 2VEZA 4IUSA 2OZGA 4RUHA 2OZUA 4AG7A 4QB9A 3FIXA 4LUAA 1IIDA 4NJQA 2ZW5A 2O53A 1M44A 1S5KA 3QNVA 2CXAA 2PJAA 2ZXVA 2RC4A 1VIXA 4HNXB 3FBUA 4PQAA 4R7MA 1I12A 2Q7BA 2B5GB 2O4HA 3B2YA 3EXNA 1F2OA 5ISVA 1BPMA 2ZPAA 1QMUA 3TOAA 2VZZA 2XEGA 2PRQA 2J8NA 3TC8A 1TF9A 2B5GA 1PU9A 1ON0A 5CPAA 4YFJA 1YW6A 5J8FA 5LRJA 2QVPA 1F2PA 1YX0A 5LRKA 3KQXA 4HKFA 2GU2A 1XF8A 3LMSA 4IK2A 3UY5A 4FAIA 1GHEA 3NH4A 1M4IA 2JLMA 3D66A 4MBUA 4KOYA 4C2XA 3B3CA 4YRHA 4A37A 1PCAA 4CAVA 3WC5A 1P4NA 2WPWA 3B3WA 4XNHB 4QVTA 3DSBA 4B6ZA 3KKWA 4UCNA 4WWVA 2WYRA 4F8ZA 4OC0A 4KOUA 4I49A 1Q2CA 2EK8A 3W6XA 1LAPA 4JD6A 5IV0A 3L2NA 1NMTA 4G1PA 5AGEA 5FVJA 2Z3PA 3PB4X 3P2HA 3V7ZA 2CNSA 4CYQA 3FNCA 2ARHA 3GUXA 3LD2A 4XPLA 5JPHA 5KTDA 4BD9A 1VHSA 1TF8A 3B7IA 3DNSA 4ONWA 2QJ8A 2CY2A 7CPAA 3CXPA 1X12A 4UEZA 2CTCA 4EWTA 2J8RA 4EFDA 2I00A 5LYLA 2CF4A 2Q04A 4RN7A 2JDCA 3SJGA 5DS0A 2B4DB 2PIYA 2WZNA 4HNWB 2ZEDA 1KUVA 2HV2A 4A30A 1XMTA 4DJLA 3NE8A 2C27A 4JLYA 3FF3A 1CP7A 2B4DA 2BL1A 3K2KA 1OBRA 1ZG8A 4MCPA 3RNZA 2KCWA 4B5PB 1YGHA 5HH1A 4JXRA 5IX3A 2DPTA 5E96A 3T8WA 5F48A 3DDDA 4KVME 2Q44A 4CAWA 4TWEA 5AG6A 2BO9A 3D2PA 2IJZA 4OC4A 4GM5A 4CS0B 4B5PA 2GFQA 3D7FA 1YMEA 2QMLA 5K8PA 4B13A 1IOIA 1QSRA 4PXEA 4Z65A 1TKFA 1RTQA 3P2FA 3CXQA 4P4DA 4ONUA 5A28A 4KOXA 4F6AA 2DEAA 2R1IA 4GS4A 2PJ1A 3PB7X 3NH5A 3TX8A 2CNTA 4MCSA 4UBRA 1S7NA 3PRTA 5LYFA 1IOFA 4BINA 6CPAA 1S7LA 2R7HA 4KSFA 3TE4A 4NFRA 1Y0RA 1SQHA 5HXDA 1KUXA 4YGOA 2BUEA 3MGDA 2FIWA 4M6GA 2F8HA 4KOWA 1RO5A 4U5YA 3QAYA 1XOVA 2FIAA 4UWJA 4Y49B 2PR1A 4OKOA 1BPNA 2REFA 3D2MA 1YVKA 2I79A 5F49A 2PJ3A 3K9TA 2ATRA 4MFZA 4Q36A 4PK2A 2Z11A 4L8AA 4ZY1A 2ZW4A 4OC2A 4RS2A 2PVWA 1YVOA 3GY9A 2QIRA 2AJ6A 2XEIA 4AXVA 2ZOGA 3RO0A 3A9LA 4XPDB 3SJEA 1L0CA 2R8VA 4A2ZA 1S60A 1Y0YA 4IAVA 4P10A 5A27A 2FS5A 5EBVA 1Z8TA 4OC1A 4A95A 4P45A 3VH9A 1WK4A 2Q0YA 1ELLP 3G8WA 5DWMA 1BOBA 4ZYQA 4Q38A 1YSJA 3GLJA 3TCVA 3FYNA 4UIBA 1CJWA 2HQYA 4O23A 3SHPA 1MJAA 4NF1A 3CPXA 5LYIA 1FNOA 2RB7A 1PYTB 1J4JA 2JEVA 2AFUA 1QSOA 1GYTA 4KOTA 3RYOA 4UCMA 4DUKA 1YLEA 4JWPA 2O28A 4R8FA 4KLWA 1QQ9A 2FXFA 3IO1A 4UFXA 5K8NA 4JYWA 4M6IA 3S9NA 2YGWA 2AFSA 4MXUA 3WC7A 3V38A 3SJXA 1M4LA 3IWWA 2HC9A 4ZBGA 4ZY0A 4OIDA 4K30A 4U9ZA 5D8NA 1R57A 4C7HA 4FBEA 4OMEA 5CBMA 2R98A 1KWMA 2P6EA 1CPXA 1Q2YA 1XMBA 2EK9A 2F7VA 2P0WA 4MCRA 5G22A 1XFOA 2QECA 4MHZA 3FX6A 3FH4A 2NYQA 1XE4A 4MJ8A 1LCPA 2BSWA 3LWUA 4OIWA 5G21A 4OLLA 1IYLA 4DYOA 3BI0A 5KTAA 4II9A 2J9AA 1VHEA 4Q7AA 5LRGA 3SI2A 4ZGYB 4OADA 2G3AA 2ZEGA 4IF5A 3PFOA 1MJBA 4FWUA 1QSTA 2B4BA 4FD6A 2ZEPA 4JJXA 3JVNA 3NFZA 3RAMA 5DWNA 2WUUA 1AMPA 4DNCA 2Q4VA 1HDUA 3NH8A 4QC6A 2GLFA 2GE3A 1JQGA 1KZFA 2FVGA 2YNCC 4FD5A 5I0CA 3D7HA 1AYEA 3HUVA 2ZW7A 4X2TA 4NGNA 2I3CA 1YK3A 3EO4A 2PJ0A 3QB8A 2ODFA 3GIUA 1BO4A 3KHXA 2G3TA 4CRZB 4U9YA 3B35A 4BMHA 3MRUA 1ZG9A 2GREA 1OZPA 2VQYA 1ELMP 4MHNA 4WJBA 4BBHA 4UCPA 4CGNA 3S9LA 2CTBA 2V77A 4PXDA 4P4IA 3KHZA 2Z0ZA 1ARLA 4KS9A 2OR4A 4P6YA 2V8GA 2Z3MA 3F8KA 4UWIA 5LYDA 3TTHA 2VZYA 2NSMA 4PSWA 3TT2A 1HEEA 2EO8A 1R3NA 5F46A 4H2KA 4PSXA 2X7BA 2PRBA 4H6ZA 1ZLIA 3F5BA 4LQGA 4XPKA 4MY3A 4FD4A 1Z4EA 4C68A 3BJ7A 3PEIA 4R3LA 3BI1A 2PJCA 2Q43A 2REEA 5AG5A 2PJ4A 2POKA 3RBUA 3S6FA 4NXYA 4ORFA 2DXQA 4UFWA 3FXTA
chains in the Genus database with same CATH topology
4KORA 3I9SA 2F5IA 4CGLA 1XEBA 1I21A 2FL4A 5H84A 4XPDC 1Y9KA 1YREA 1WWZA 4PV6A 2DPSA 5HMNA 1I1DA 1UFHA 1VKCA 3IGRA 1Q2DA 4JXQA 3V8IA 5H86A 1S7FA 1MJ9A 2Z3KA 3SXNA 3BJ8A 4AVAA 2JDDA 4AG9A 1KUYA 1S7KA 5J8CA 2YNDA 4UA3A 4E8OA 3IWEA 5BWAB 3VWEA 2FE7A 3R9GA 3CXSA 4KOVA 5JQ4A 5KTCA 1U6MA 1IYKA 2VI7A 2Z3LA 4E0AA 2B3VA 4A31A 3EC4A 1XIXA 3W6SA 4CGMA 5AG4A 1B87A 4C7IA 2YNEA 4NEXA 4MFQA 4R3KA 2CNMA 4L89A 4R87A 4XNHC 4EVYA 2EVNA 2Z10A 3OWCA 2OZHA 3R1KA 1CM0A 2J8MA 2ZW6A 4KOSA 4CYPA 3S6KA 4A33A 4AB7A 3R96A 3TO6A 2P6FA 5C82A 1MK4A 2PDOA 4MFKA 2BEIA 2Z3OA 2AE6A 2PSWA 3T9YA 3SXOA 1LRZA 4CRYB 2PR8A 2B3UA 3QAHA 1P0HA 1Z9UA 4MY0A 3ZZIA 1NSLA 3JUWA 4C2YA 3R95A 1M1DA 3GKRA 1NE9A 4M3SA 2G0BA 1N71A 2IL4A 1RXTA 1B6BA 1V0CA 3N7ZA 4NCZA 1PUAA 2FCKA 4CAEA 2GANA 2K5TA 3H4QA 4CYOA 4H89A 5IB0A 4A32A 3DR8A 4H6UA 4QBJA 4E2AA 2PC1A 1QSMA 3PZJA 4NSQA 3F0AA 4MFLA 2FSRA 1K4JA 4J3GA 3WR7A 3IU1A 3W91A 4C2ZA 4UFVA 3TO9A 3FB3A 4CAFA 3R9EA 4CGPA 3C26A 3K9UA 4HNYB 3PGPA 3GYAA 2VXKA 5EC4A 2OB0A 3D3SA 2D4PA 4Y49C 5C88A 4LX9A 3IU2A 3JTKA 3NE7A 4PK3A 4MFJA 5CNPA 2FT0A 2WSAA 4CAXA 2HUZA 4R9MA 3BLNA 3EY5A 4B12A 4R57A 4B5OA 3G3SA 2GIVA 3E0KA 4KLVA 1S3ZA 1Z4RA 3PP9A 1IICA 2OH1A 3S6HA 3S6GA 2YNCA 4AVBA 2EUIA 4KUBA 4OAEA 4KUAA 4KZTA 4MFPA 4QUSA 5F47A 3TOBA 2OU2A 1Y7RA 3B8GA 1Y9WA 3EFAA 4CYNA 4AVCA 2B58A 2Y0MA 2WPXA 4B11A 2A4NA 3VWDA 4KSAA 2NMTA 1IB1E 5G1ZA 4KVXA 3FRMA 4MHDA 3ZJ0A 2PQ8A 4CGOA 3LODA 4KVOE 3H5ZA 4FD7A 4MI4A 1ZO0A 2Z3NA 1YR0A 1M4DA 5GCNA 1QSNA 3R9FA 1FY7A 1TIQA 4F0XA 2P6GA 4B10A 3I3GA 3TO7A 3IWGA 3D8PA 4F0YA 3DR6A 3TFYA 2Q4YA 2D4OA 2VBQA 4M85A 4RI1A 3T90A 4X5KA 1M4GA 2H5MA 5AG7A 5G20A 2VEZA 4IUSA 2OZGA 2OZUA 4AG7A 4QB9A 3FIXA 4LUAA 1IIDA 2ZW5A 1M44A 1S5KA 2CXAA 2ZXVA 2RC4A 4HNXB 3FBUA 1I12A 2Q7BA 2B5GB 3EXNA 5ISVA 2ZPAA 3TOAA 2VZZA 2J8NA 2B5GA 1PU9A 1ON0A 4YFJA 5J8FA 1YX0A 4HKFA 1XF8A 3UY5A 1GHEA 1M4IA 2JLMA 4MBUA 4KOYA 4C2XA 4YRHA 4CAVA 1P4NA 2WPWA 4XNHB 4QVTA 3DSBA 3KKWA 4UCNA 4KOUA 4I49A 1Q2CA 3W6XA 4JD6A 5IV0A 1NMTA 5AGEA 5FVJA 2Z3PA 3P2HA 2CNSA 4CYQA 3FNCA 2ARHA 5JPHA 3LD2A 4XPLA 5KTDA 1VHSA 3DNSA 2CY2A 3CXPA 2J8RA 2I00A 2Q04A 2JDCA 2B4DB 4HNWB 1KUVA 2HV2A 4A30A 1XMTA 4JLYA 2C27A 2B4DA 2BL1A 2KCWA 4B5PB 1YGHA 5HH1A 4JXRA 5IX3A 2DPTA 5E96A 5F48A 3DDDA 4KVME 2Q44A 4CAWA 5AG6A 3D2PA 4CS0B 4B5PA 2QMLA 4B13A 1QSRA 3P2FA 3CXQA 4ONUA 5A28A 4KOXA 4F6AA 2R1IA 4GS4A 2CNTA 4UBRA 1S7NA 1S7LA 2R7HA 4KSFA 3TE4A 1SQHA 1KUXA 4YGOA 2BUEA 3MGDA 2FIWA 4KOWA 1RO5A 4U5YA 4UWJA 2FIAA 4Y49B 2PR1A 2REFA 3D2MA 1YVKA 2I79A 5F49A 2ATRA 4MFZA 4Q36A 4PK2A 2Z11A 4L8AA 2ZW4A 4RS2A 1YVOA 3GY9A 2QIRA 2AJ6A 3A9LA 4XPDB 1L0CA 2R8VA 4A2ZA 1S60A 5A27A 2FS5A 5EBVA 4A95A 1WK4A 2Q0YA 3G8WA 5DWMA 1BOBA 4Q38A 3TCVA 3FYNA 1CJWA 2HQYA 3SHPA 1MJAA 4NF1A 4KOTA 1J4JA 2JEVA 3RYOA 1QSOA 4UCMA 1YLEA 4JWPA 2O28A 4KLWA 2FXFA 4UFXA 2YGWA 4ZBGA 4K30A 4U9ZA 1R57A 4C7HA 2R98A 2P6EA 1Q2YA 2P0WA 5G22A 2QECA 4B14A 5G21A 1XE4A 4MJ8A 2BSWA 4OLLA 1IYLA 4II9A 5KTAA 4ZGYB 4OADA 2G3AA 4IF5A 1MJBA 1QSTA 2B4BA 4FD6A 4JJXA 3JVNA 5DWNA 2WUUA 4DNCA 2Q4VA 4QC6A 2GE3A 1KZFA 2YNCC 4FD5A 5I0CA 2ZW7A 1YK3A 3EO4A 3QB8A 1BO4A 2G3TA 4CRZB 4U9YA 4BMHA 2VQYA 1OZPA 4BBHA 4UCPA 4CGNA 2Z0ZA 4KS9A 2Z3MA 3F8KA 4UWIA 3TTHA 2VZYA 4PSWA 3TT2A 5F46A 4PSXA 2X7BA 2PRBA 4H6ZA 3F5BA 4XPKA 4C68A 4MY3A 4FD4A 1Z4EA 3BJ7A 4R3LA 2REEA 5AG5A 3S6FA 4NXYA 4ORFA 2DXQA 4UFWA 3FXTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KOR A;  3I9S A;  2F5I A;  1XEB A;  1I21 A;  2FL4 A;  5H84 A;  4XPD C;  1Y9K A;  1YRE A;  1WWZ A;  4PV6 A;  5HMN A;  1I1D A;  1UFH A;  1VKC A;  3IGR A;  1Q2D A;  4JXQ A;  3V8I A;  5H86 A;  1S7F A;  1MJ9 A;  3SXN A;  3BJ8 A;  4AVA A;  2JDD A;  4AG9 A;  1KUY A;  1S7K A;  5J8C A;  4UA3 A;  4E8O A;  3VWE A;  2FE7 A;  3R9G A;  3CXS A;  4KOV A;  5JQ4 A;  5KTC A;  1U6M A;  1IYK A;  2VI7 A;  4E0A A;  2B3V A;  3EC4 A;  1XIX A;  3W6S A;  1B87 A;  4NEX A;  4R3K A;  2CNM A;  4L89 A;  4R87 A;  4XNH C;  4EVY A;  2EVN A;  2Z10 A;  3OWC A;  2OZH A;  3R1K A;  1CM0 A;  2J8M A;  2ZW6 A;  4KOS A;  3S6K A;  4AB7 A;  3R96 A;  3TO6 A;  2P6F A;  5C82 A;  1MK4 A;  2PDO A;  2BEI A;  2AE6 A;  2PSW A;  3T9Y A;  3SXO A;  1LRZ A;  4CRY B;  2PR8 A;  2B3U A;  3QAH A;  1P0H A;  1Z9U A;  4MY0 A;  3ZZI A;  1NSL A;  3JUW A;  3R95 A;  1M1D A;  3GKR A;  1NE9 A;  4M3S A;  2G0B A;  1N71 A;  2IL4 A;  1RXT A;  1B6B A;  1V0C A;  3N7Z A;  4NCZ A;  1PUA A;  2FCK A;  2GAN A;  2K5T A;  3H4Q A;  4H89 A;  5IB0 A;  3DR8 A;  4H6U A;  4QBJ A;  4E2A A;  2PC1 A;  1QSM A;  3PZJ A;  4NSQ A;  3F0A A;  2FSR A;  1K4J A;  4J3G A;  3WR7 A;  3W91 A;  3TO9 A;  3FB3 A;  3R9E A;  3C26 A;  3K9U A;  4HNY B;  3PGP A;  3GYA A;  2VXK A;  5EC4 A;  2OB0 A;  3D3S A;  2D4P A;  4Y49 C;  5C88 A;  4LX9 A;  3NE7 A;  4PK3 A;  5CNP A;  2FT0 A;  4CAX A;  2HUZ A;  4R9M A;  3BLN A;  3EY5 A;  4R57 A;  4B5O A;  3G3S A;  2GIV A;  3E0K A;  4KLV A;  1S3Z A;  1Z4R A;  3PP9 A;  1IIC A;  2OH1 A;  3S6H A;  3S6G A;  4AVB A;  2EUI A;  4KUB A;  4OAE A;  4KUA A;  4KZT A;  4QUS A;  5F47 A;  3TOB A;  2OU2 A;  1Y7R A;  3B8G A;  1Y9W A;  3EFA A;  4AVC A;  2B58 A;  2Y0M A;  2WPX A;  2A4N A;  3VWD A;  2NMT A;  1IB1 E;  4KVX A;  3FRM A;  4MHD A;  3ZJ0 A;  2PQ8 A;  3LOD A;  4KVO E;  4FD7 A;  4MI4 A;  1YR0 A;  1M4D A;  5GCN A;  1QSN A;  3R9F A;  1FY7 A;  1TIQ A;  2P6G A;  3I3G A;  3TO7 A;  3IWG A;  3D8P A;  4F0Y A;  3DR6 A;  3TFY A;  2Q4Y A;  2D4O A;  2VBQ A;  4M85 A;  4RI1 A;  3T90 A;  4X5K A;  1M4G A;  2H5M A;  2VEZ A;  4IUS A;  2OZG A;  2OZU A;  4AG7 A;  4QB9 A;  3FIX A;  4LUA A;  1IID A;  2ZW5 A;  1M44 A;  1S5K A;  2ZXV A;  2RC4 A;  4HNX B;  3FBU A;  1I12 A;  2Q7B A;  2B5G B;  3EXN A;  5ISV A;  2ZPA A;  3TOA A;  2VZZ A;  2J8N A;  2B5G A;  1PU9 A;  1ON0 A;  4YFJ A;  5J8F A;  1YX0 A;  4HKF A;  1XF8 A;  3UY5 A;  1GHE A;  1M4I A;  2JLM A;  4MBU A;  4KOY A;  4YRH A;  4CAV A;  1P4N A;  2WPW A;  4XNH B;  4QVT A;  3DSB A;  3KKW A;  4KOU A;  4I49 A;  1Q2C A;  3W6X A;  4JD6 A;  5IV0 A;  1NMT A;  5FVJ A;  3P2H A;  2CNS A;  5JPH A;  3FNC A;  2ARH A;  3LD2 A;  4XPL A;  5KTD A;  1VHS A;  3DNS A;  2CY2 A;  3CXP A;  2J8R A;  2I00 A;  2Q04 A;  2JDC A;  2B4D B;  4HNW B;  1KUV A;  2HV2 A;  1XMT A;  4JLY A;  2C27 A;  2B4D A;  2BL1 A;  2KCW A;  4B5P B;  1YGH A;  5HH1 A;  4JXR A;  5IX3 A;  5E96 A;  5F48 A;  3DDD A;  4KVM E;  2Q44 A;  4CAW A;  3D2P A;  4CS0 B;  4B5P A;  2QML A;  1QSR A;  3P2F A;  3CXQ A;  4ONU A;  4KOX A;  4F6A A;  2R1I A;  4GS4 A;  2CNT A;  4UBR A;  1S7N A;  1S7L A;  2R7H A;  3TE4 A;  1SQH A;  1KUX A;  4YGO A;  2BUE A;  3MGD A;  2FIW A;  4KOW A;  1RO5 A;  4U5Y A;  4UWJ A;  2FIA A;  4Y49 B;  2PR1 A;  2REF A;  3D2M A;  1YVK A;  2I79 A;  5F49 A;  2ATR A;  4PK2 A;  2Z11 A;  4L8A A;  2ZW4 A;  4RS2 A;  1YVO A;  3GY9 A;  2QIR A;  2AJ6 A;  4XPD B;  1L0C A;  2R8V A;  1S60 A;  2FS5 A;  5EBV A;  1WK4 A;  2Q0Y A;  3G8W A;  5DWM A;  1BOB A;  3TCV A;  3FYN A;  1CJW A;  2HQY A;  3SHP A;  1MJA A;  4NF1 A;  4KOT A;  1J4J A;  2JEV A;  3RYO A;  1QSO A;  1YLE A;  4JWP A;  2O28 A;  4KLW A;  2FXF A;  4ZBG A;  4K30 A;  4U9Z A;  1R57 A;  2R98 A;  2P6E A;  1Q2Y A;  2P0W A;  2QEC A;  1XE4 A;  4MJ8 A;  2BSW A;  4OLL A;  1IYL A;  4II9 A;  5KTA A;  4OAD A;  2G3A A;  4IF5 A;  1MJB A;  1QST A;  2B4B A;  4FD6 A;  4JJX A;  3JVN A;  5DWN A;  4DNC A;  2Q4V A;  4QC6 A;  2GE3 A;  1KZF A;  4FD5 A;  5I0C A;  2ZW7 A;  1YK3 A;  3EO4 A;  3QB8 A;  1BO4 A;  2G3T A;  4CRZ B;  4U9Y A;  4BMH A;  2VQY A;  1OZP A;  2Z0Z A;  3F8K A;  4UWI A;  3TTH A;  2VZY A;  4PSW A;  3TT2 A;  5F46 A;  4PSX A;  2X7B A;  2PRB A;  4H6Z A;  3F5B A;  4XPK A;  4MY3 A;  4FD4 A;  1Z4E A;  3BJ7 A;  4R3L A;  2REE A;  3S6F A;  4NXY A;  4ORF A;  2DXQ A;  3FXT A; 
#chains in the Genus database with same CATH topology
 1X10 A;  3PB6 X;  4KOR A;  3I9S A;  3PBB A;  3D7D A;  4NGS A;  2F5I A;  4CGL A;  3KL9 A;  1XEB A;  2EBJ A;  2Q51 A;  1VHO A;  4MCQ A;  4FUU A;  1I21 A;  2FL4 A;  5H84 A;  4XPD C;  3MN8 A;  1H8L A;  4UIA A;  5JH9 A;  4UEF A;  2ZEM A;  5HVH A;  2CIJ A;  1Y9K A;  1YRE A;  3SI0 A;  1WWZ A;  4PV6 A;  4NJR A;  2DPS A;  5HMN A;  1I1D A;  1UFH A;  1VKC A;  3IGR A;  1YLO A;  2ZEH A;  1UWY A;  1Q2D A;  4JXQ A;  3V8I A;  5H86 A;  1S7F A;  1MJ9 A;  1VGY A;  2Z3K A;  3SXN A;  3BJ8 A;  4PPZ A;  3D67 A;  4AVA A;  1XRY A;  2PJB A;  3S9M A;  2JDD A;  3KR5 A;  4AG9 A;  4PXB A;  4F9V A;  2C6C A;  3FED A;  1KUY A;  1F57 A;  2C6P A;  1BAV A;  1S7K A;  2OOT A;  5J8C A;  2YND A;  4UA3 A;  4E8O A;  2DF5 A;  3IWE A;  3PBE A;  5BWA B;  2RFH A;  3VWE A;  2FE7 A;  3R9G A;  4MHY A;  3WT4 A;  3CXS A;  4KOV A;  5JQ4 A;  5KTC A;  1U6M A;  1IYK A;  2VI7 A;  2ZEL A;  2Z3L A;  1FT7 A;  4P4J A;  2PIZ A;  5IB9 A;  4E0A A;  2B3V A;  4A31 A;  3EC4 A;  1XIX A;  3W6S A;  4CGM A;  5AG4 A;  1B87 A;  1IY7 A;  4C7I A;  2YNE A;  1TKJ A;  4NGT A;  4NEX A;  3N5F A;  4MFQ A;  1CBX A;  4R3K A;  2CNM A;  3KZW A;  3H8F A;  3D7G A;  2ANP A;  4L89 A;  4R87 A;  4XNH C;  4NGP A;  3H8E A;  4YU9 A;  2EVN A;  2Z10 A;  3OWC A;  1YQE A;  2OZH A;  4EVY A;  4P44 A;  5HVG A;  1NSA A;  3IEH A;  3R1K A;  1CM0 A;  2AFX A;  2J8M A;  2ZW6 A;  3KR4 A;  2IQ6 A;  4KOS A;  4IHM A;  4P4E A;  4CYP A;  3S6K A;  4A33 A;  3IC1 A;  3R96 A;  3TO6 A;  3WC6 A;  3NA6 A;  2P6F A;  4AB7 A;  5C82 A;  2EWB A;  1XJO A;  1MK4 A;  2PDO A;  4MFK A;  2BEI A;  2Z3O A;  4X3R A;  2AE6 A;  2PSW A;  3T9Y A;  3SXO A;  1LRZ A;  4CRY B;  2PR8 A;  1Z8L A;  2B3U A;  4B14 A;  3D4U A;  3QAH A;  5HVF A;  1Z5R A;  2XEJ A;  3KAS A;  3GB0 A;  1P0H A;  1JWQ A;  1Z9U A;  2ZEN A;  4MY0 A;  3ZZI A;  3CDX A;  1NSL A;  2V8V A;  3JUW A;  2HB6 A;  3R95 A;  4C2Y A;  3IFE A;  1M1D A;  3GKR A;  1ARM A;  4OC5 A;  1NE9 A;  4M3S A;  3IJ3 A;  2G0B A;  5JGF A;  2ZOF A;  1N71 A;  2IL4 A;  4P4B A;  1RXT A;  1B6B A;  1V0C A;  5JM6 A;  3FJU A;  5ELY A;  4A39 A;  1HDQ A;  3N7Z A;  4LQ6 A;  4NCZ A;  4YWY A;  1LAM A;  2C1C A;  1PUA A;  2Q4Z A;  1LAN A;  4TNU A;  4NGQ A;  2FCK A;  3KI9 A;  4CAE A;  2GAN A;  3SI1 A;  2K5T A;  4MRI A;  3H4Q A;  4CYO A;  4H89 A;  5IB0 A;  2AFZ A;  3FVL A;  4A32 A;  3DR8 A;  1Z2L A;  4H6U A;  4QBJ A;  4ZI6 A;  4NGM A;  4E2A A;  2PC1 A;  1QSM A;  2VL1 A;  3PZJ A;  4JZ0 A;  1XBU A;  4NSQ A;  3F0A A;  3PFE A;  3KGQ A;  1LOK A;  1K4J A;  2FSR A;  4J3G A;  4MFL A;  1TXR A;  5K8O A;  3WR7 A;  3IU1 A;  3W91 A;  4C2Z A;  4UFV A;  3SJF A;  4X8I A;  3HLP A;  3TO9 A;  3FB3 A;  4CAF A;  3R9E A;  4CGP A;  3C26 A;  4OC3 A;  3K9U A;  4HNY B;  2JBK A;  3PGP A;  3GYA A;  1ZLH A;  2ABZ A;  2VXK A;  5EC4 A;  2OB0 A;  1A2Z A;  3D3S A;  2V8D A;  2D4P A;  3D68 A;  4OP4 A;  4Y49 C;  4ZX9 A;  1AUG A;  1DTD A;  2IMO A;  2GLJ A;  1CP6 A;  4LX9 A;  5C88 A;  2XEF A;  3IU2 A;  3JTK A;  3I1U A;  3NE7 A;  2Q7S A;  1YW4 A;  2PVV A;  4PK3 A;  4MFJ A;  1R43 A;  4PXC A;  3BXM A;  5CNP A;  2AFM A;  2FT0 A;  2WSA A;  5J1Q A;  4CAX A;  2BCO A;  2HUZ A;  2ZEF A;  4R9M A;  2PJ8 A;  3BLN A;  5D29 A;  1CX8 A;  3EY5 A;  1LFW A;  4B12 A;  4R57 A;  4KSI A;  4B5O A;  1BLL E;  3G3S A;  4UF4 A;  2GIV A;  3E0K A;  4KLV A;  4F9U A;  5F09 A;  3KQZ A;  3FEC A;  1S3Z A;  1Z4R A;  2JEW A;  3PP9 A;  1IIC A;  2OH1 A;  2PJ2 A;  3LAC A;  3VAR A;  5I4M A;  3S6H A;  2PE3 A;  3S6G A;  4K3N A;  1CG2 A;  1Y7E A;  2YNC A;  3B3T A;  1Z8W A;  4AVB A;  2EUI A;  3CZX A;  4MHP A;  4KUB A;  4W9Y A;  3IIB A;  2PJ7 A;  4KUA A;  3DLJ A;  4KZT A;  4MFP A;  4MMO A;  4NGR A;  4OAE A;  4QUS A;  2BOA A;  2OU2 A;  5F47 A;  1Y7R A;  5THW A;  3TOB A;  4EME A;  1Q7L A;  3B8G A;  1Y9W A;  3EFA A;  4CYN A;  4AVC A;  2B58 A;  2Y0M A;  2WPX A;  3DGV A;  4B11 A;  4P4F A;  1IGB A;  3ISZ A;  3RZA A;  3H8G A;  2AFW A;  2A4N A;  3VWD A;  4KSA A;  2NMT A;  2V8H A;  1IB1 E;  3CPA A;  5G1Z A;  1TKH A;  3B3V A;  4KVX A;  2ZEE A;  3FRM A;  4MHD A;  3ZJ0 A;  2PQ8 A;  4M6H A;  4CGO A;  3FMC A;  3LOD A;  8CPA A;  4KVO E;  1CPS A;  2PCU A;  3BHX A;  3H5Z A;  4FD7 A;  4MI4 A;  1ZO0 A;  2Z3N A;  3PB8 X;  1YR0 A;  4R76 A;  4ZX8 A;  3PB9 X;  4ZY2 A;  3VAT A;  1M4D A;  5GCN A;  1QSN A;  4A38 A;  4A94 A;  2JBJ A;  4GXH A;  2C6G A;  3B3S A;  1DE4 C;  3CT9 A;  3R9F A;  2QYV A;  1FY7 A;  4UEE A;  4R6T A;  1TIQ A;  1Z8X A;  3JRU A;  5EMI A;  4F0X A;  2P6G A;  4B10 A;  2PJ5 A;  1EE3 P;  2ZEO A;  3I3G A;  3TO7 A;  3IWG A;  3D8P A;  4F0Y A;  2G9D A;  1ZG7 A;  2PJ9 A;  2PJ6 A;  3DR6 A;  5K8M A;  3ISX A;  3TFY A;  2Q4Y A;  3FEE A;  2D4O A;  4HPS A;  2VBQ A;  4M85 A;  3WAB A;  4RI1 A;  3T90 A;  4X5K A;  1IU8 A;  1M4G A;  2H5M A;  4CPA A;  5AG7 A;  5G20 A;  2AFO A;  2VEZ A;  4IUS A;  2OZG A;  4RUH A;  2OZU A;  4AG7 A;  4QB9 A;  3FIX A;  4LUA A;  1IID A;  4NJQ A;  2ZW5 A;  2O53 A;  1M44 A;  1S5K A;  3QNV A;  2CXA A;  2PJA A;  2ZXV A;  2RC4 A;  1VIX A;  4HNX B;  3FBU A;  4PQA A;  4R7M A;  1I12 A;  2Q7B A;  2B5G B;  2O4H A;  3B2Y A;  3EXN A;  1F2O A;  5ISV A;  1BPM A;  2ZPA A;  1QMU A;  3TOA A;  2VZZ A;  2XEG A;  2PRQ A;  2J8N A;  3TC8 A;  1TF9 A;  2B5G A;  1PU9 A;  1ON0 A;  5CPA A;  4YFJ A;  1YW6 A;  5J8F A;  5LRJ A;  2QVP A;  1F2P A;  1YX0 A;  5LRK A;  3KQX A;  4HKF A;  2GU2 A;  1XF8 A;  3LMS A;  4IK2 A;  3UY5 A;  4FAI A;  1GHE A;  3NH4 A;  1M4I A;  2JLM A;  3D66 A;  4MBU A;  4KOY A;  4C2X A;  3B3C A;  4YRH A;  4A37 A;  1PCA A;  4CAV A;  3WC5 A;  1P4N A;  2WPW A;  3B3W A;  4XNH B;  4QVT A;  3DSB A;  4B6Z A;  3KKW A;  4UCN A;  4WWV A;  2WYR A;  4F8Z A;  4OC0 A;  4KOU A;  4I49 A;  1Q2C A;  2EK8 A;  3W6X A;  1LAP A;  4JD6 A;  5IV0 A;  3L2N A;  1NMT A;  4G1P A;  5AGE A;  5FVJ A;  2Z3P A;  3PB4 X;  3P2H A;  3V7Z A;  2CNS A;  4CYQ A;  3FNC A;  2ARH A;  3GUX A;  3LD2 A;  4XPL A;  5JPH A;  5KTD A;  4BD9 A;  1VHS A;  1TF8 A;  3B7I A;  3DNS A;  4ONW A;  2QJ8 A;  2CY2 A;  7CPA A;  3CXP A;  1X12 A;  4UEZ A;  2CTC A;  4EWT A;  2J8R A;  4EFD A;  2I00 A;  5LYL A;  2CF4 A;  2Q04 A;  4RN7 A;  2JDC A;  3SJG A;  5DS0 A;  2B4D B;  2PIY A;  2WZN A;  4HNW B;  2ZED A;  1KUV A;  2HV2 A;  4A30 A;  1XMT A;  4DJL A;  3NE8 A;  2C27 A;  4JLY A;  3FF3 A;  1CP7 A;  2B4D A;  2BL1 A;  3K2K A;  1OBR A;  1ZG8 A;  4MCP A;  3RNZ A;  2KCW A;  4B5P B;  1YGH A;  5HH1 A;  4JXR A;  5IX3 A;  2DPT A;  5E96 A;  3T8W A;  5F48 A;  3DDD A;  4KVM E;  2Q44 A;  4CAW A;  4TWE A;  5AG6 A;  2BO9 A;  3D2P A;  2IJZ A;  4OC4 A;  4GM5 A;  4CS0 B;  4B5P A;  2GFQ A;  3D7F A;  1YME A;  2QML A;  5K8P A;  4B13 A;  1IOI A;  1QSR A;  4PXE A;  4Z65 A;  1TKF A;  1RTQ A;  3P2F A;  3CXQ A;  4P4D A;  4ONU A;  5A28 A;  4KOX A;  4F6A A;  2DEA A;  2R1I A;  4GS4 A;  2PJ1 A;  3PB7 X;  3NH5 A;  3TX8 A;  2CNT A;  4MCS A;  4UBR A;  1S7N A;  3PRT A;  5LYF A;  1IOF A;  4BIN A;  6CPA A;  1S7L A;  2R7H A;  4KSF A;  3TE4 A;  4NFR A;  1Y0R A;  1SQH A;  5HXD A;  1KUX A;  4YGO A;  2BUE A;  3MGD A;  2FIW A;  4M6G A;  2F8H A;  4KOW A;  1RO5 A;  4U5Y A;  3QAY A;  1XOV A;  2FIA A;  4UWJ A;  4Y49 B;  2PR1 A;  4OKO A;  1BPN A;  2REF A;  3D2M A;  1YVK A;  2I79 A;  5F49 A;  2PJ3 A;  3K9T A;  2ATR A;  4MFZ A;  4Q36 A;  4PK2 A;  2Z11 A;  4L8A A;  4ZY1 A;  2ZW4 A;  4OC2 A;  4RS2 A;  2PVW A;  1YVO A;  3GY9 A;  2QIR A;  2AJ6 A;  2XEI A;  4AXV A;  2ZOG A;  3RO0 A;  3A9L A;  4XPD B;  3SJE A;  1L0C A;  2R8V A;  4A2Z A;  1S60 A;  1Y0Y A;  4IAV A;  4P10 A;  5A27 A;  2FS5 A;  5EBV A;  1Z8T A;  4OC1 A;  4A95 A;  4P45 A;  3VH9 A;  1WK4 A;  2Q0Y A;  1ELL P;  3G8W A;  5DWM A;  1BOB A;  4ZYQ A;  4Q38 A;  1YSJ A;  3GLJ A;  3TCV A;  3FYN A;  4UIB A;  1CJW A;  2HQY A;  4O23 A;  3SHP A;  1MJA A;  4NF1 A;  3CPX A;  5LYI A;  1FNO A;  2RB7 A;  1PYT B;  1J4J A;  2JEV A;  2AFU A;  1QSO A;  1GYT A;  4KOT A;  3RYO A;  4UCM A;  4DUK A;  1YLE A;  4JWP A;  2O28 A;  4R8F A;  4KLW A;  1QQ9 A;  2FXF A;  3IO1 A;  4UFX A;  5K8N A;  4JYW A;  4M6I A;  3S9N A;  2YGW A;  2AFS A;  4MXU A;  3WC7 A;  3V38 A;  3SJX A;  1M4L A;  3IWW A;  2HC9 A;  4ZBG A;  4ZY0 A;  4OID A;  4K30 A;  4U9Z A;  5D8N A;  1R57 A;  4C7H A;  4FBE A;  4OME A;  5CBM A;  2R98 A;  1KWM A;  2P6E A;  1CPX A;  1Q2Y A;  1XMB A;  2EK9 A;  2F7V A;  2P0W A;  4MCR A;  5G22 A;  1XFO A;  2QEC A;  4MHZ A;  3FX6 A;  3FH4 A;  2NYQ A;  1XE4 A;  4MJ8 A;  1LCP A;  2BSW A;  3LWU A;  4OIW A;  5G21 A;  4OLL A;  1IYL A;  4DYO A;  3BI0 A;  5KTA A;  4II9 A;  2J9A A;  1VHE A;  4Q7A A;  5LRG A;  3SI2 A;  4ZGY B;  4OAD A;  2G3A A;  2ZEG A;  4IF5 A;  3PFO A;  1MJB A;  4FWU A;  1QST A;  2B4B A;  4FD6 A;  2ZEP A;  4JJX A;  3JVN A;  3NFZ A;  3RAM A;  5DWN A;  2WUU A;  1AMP A;  4DNC A;  2Q4V A;  1HDU A;  3NH8 A;  4QC6 A;  2GLF A;  2GE3 A;  1JQG A;  1KZF A;  2FVG A;  2YNC C;  4FD5 A;  5I0C A;  3D7H A;  1AYE A;  3HUV A;  2ZW7 A;  4X2T A;  4NGN A;  2I3C A;  1YK3 A;  3EO4 A;  2PJ0 A;  3QB8 A;  2ODF A;  3GIU A;  1BO4 A;  3KHX A;  2G3T A;  4CRZ B;  4U9Y A;  3B35 A;  4BMH A;  3MRU A;  1ZG9 A;  2GRE A;  1OZP A;  2VQY A;  1ELM P;  4MHN A;  4WJB A;  4BBH A;  4UCP A;  4CGN A;  3S9L A;  2CTB A;  2V77 A;  4PXD A;  4P4I A;  3KHZ A;  2Z0Z A;  1ARL A;  4KS9 A;  2OR4 A;  4P6Y A;  2V8G A;  2Z3M A;  3F8K A;  4UWI A;  5LYD A;  3TTH A;  2VZY A;  2NSM A;  4PSW A;  3TT2 A;  1HEE A;  2EO8 A;  1R3N A;  5F46 A;  4H2K A;  4PSX A;  2X7B A;  2PRB A;  4H6Z A;  1ZLI A;  3F5B A;  4LQG A;  4XPK A;  4MY3 A;  4FD4 A;  1Z4E A;  4C68 A;  3BJ7 A;  3PEI A;  4R3L A;  3BI1 A;  2PJC A;  2Q43 A;  2REE A;  5AG5 A;  2PJ4 A;  2POK A;  3RBU A;  3S6F A;  4NXY A;  4ORF A;  2DXQ A;  4UFW A;  3FXT A; 
#chains in the Genus database with same CATH homology
 4KOR A;  3I9S A;  2F5I A;  4CGL A;  1XEB A;  1I21 A;  2FL4 A;  5H84 A;  4XPD C;  1Y9K A;  1YRE A;  1WWZ A;  4PV6 A;  2DPS A;  5HMN A;  1I1D A;  1UFH A;  1VKC A;  3IGR A;  1Q2D A;  4JXQ A;  3V8I A;  5H86 A;  1S7F A;  1MJ9 A;  2Z3K A;  3SXN A;  3BJ8 A;  4AVA A;  2JDD A;  4AG9 A;  1KUY A;  1S7K A;  5J8C A;  2YND A;  4UA3 A;  4E8O A;  3IWE A;  5BWA B;  3VWE A;  2FE7 A;  3R9G A;  3CXS A;  4KOV A;  5JQ4 A;  5KTC A;  1U6M A;  1IYK A;  2VI7 A;  2Z3L A;  4E0A A;  2B3V A;  4A31 A;  3EC4 A;  1XIX A;  3W6S A;  4CGM A;  5AG4 A;  1B87 A;  4C7I A;  2YNE A;  4NEX A;  4MFQ A;  4R3K A;  2CNM A;  4L89 A;  4R87 A;  4XNH C;  4EVY A;  2EVN A;  2Z10 A;  3OWC A;  2OZH A;  3R1K A;  1CM0 A;  2J8M A;  2ZW6 A;  4KOS A;  4CYP A;  3S6K A;  4A33 A;  4AB7 A;  3R96 A;  3TO6 A;  2P6F A;  5C82 A;  1MK4 A;  2PDO A;  4MFK A;  2BEI A;  2Z3O A;  2AE6 A;  2PSW A;  3T9Y A;  3SXO A;  1LRZ A;  4CRY B;  2PR8 A;  2B3U A;  3QAH A;  1P0H A;  1Z9U A;  4MY0 A;  3ZZI A;  1NSL A;  3JUW A;  4C2Y A;  3R95 A;  1M1D A;  3GKR A;  1NE9 A;  4M3S A;  2G0B A;  1N71 A;  2IL4 A;  1RXT A;  1B6B A;  1V0C A;  3N7Z A;  4NCZ A;  1PUA A;  2FCK A;  4CAE A;  2GAN A;  2K5T A;  3H4Q A;  4CYO A;  4H89 A;  5IB0 A;  4A32 A;  3DR8 A;  4H6U A;  4QBJ A;  4E2A A;  2PC1 A;  1QSM A;  3PZJ A;  4NSQ A;  3F0A A;  4MFL A;  2FSR A;  1K4J A;  4J3G A;  3WR7 A;  3IU1 A;  3W91 A;  4C2Z A;  4UFV A;  3TO9 A;  3FB3 A;  4CAF A;  3R9E A;  4CGP A;  3C26 A;  3K9U A;  4HNY B;  3PGP A;  3GYA A;  2VXK A;  5EC4 A;  2OB0 A;  3D3S A;  2D4P A;  4Y49 C;  5C88 A;  4LX9 A;  3IU2 A;  3JTK A;  3NE7 A;  4PK3 A;  4MFJ A;  5CNP A;  2FT0 A;  2WSA A;  4CAX A;  2HUZ A;  4R9M A;  3BLN A;  3EY5 A;  4B12 A;  4R57 A;  4B5O A;  3G3S A;  2GIV A;  3E0K A;  4KLV A;  1S3Z A;  1Z4R A;  3PP9 A;  1IIC A;  2OH1 A;  3S6H A;  3S6G A;  2YNC A;  4AVB A;  2EUI A;  4KUB A;  4OAE A;  4KUA A;  4KZT A;  4MFP A;  4QUS A;  5F47 A;  3TOB A;  2OU2 A;  1Y7R A;  3B8G A;  1Y9W A;  3EFA A;  4CYN A;  4AVC A;  2B58 A;  2Y0M A;  2WPX A;  4B11 A;  2A4N A;  3VWD A;  4KSA A;  2NMT A;  1IB1 E;  5G1Z A;  4KVX A;  3FRM A;  4MHD A;  3ZJ0 A;  2PQ8 A;  4CGO A;  3LOD A;  4KVO E;  3H5Z A;  4FD7 A;  4MI4 A;  1ZO0 A;  2Z3N A;  1YR0 A;  1M4D A;  5GCN A;  1QSN A;  3R9F A;  1FY7 A;  1TIQ A;  4F0X A;  2P6G A;  4B10 A;  3I3G A;  3TO7 A;  3IWG A;  3D8P A;  4F0Y A;  3DR6 A;  3TFY A;  2Q4Y A;  2D4O A;  2VBQ A;  4M85 A;  4RI1 A;  3T90 A;  4X5K A;  1M4G A;  2H5M A;  5AG7 A;  5G20 A;  2VEZ A;  4IUS A;  2OZG A;  2OZU A;  4AG7 A;  4QB9 A;  3FIX A;  4LUA A;  1IID A;  2ZW5 A;  1M44 A;  1S5K A;  2CXA A;  2ZXV A;  2RC4 A;  4HNX B;  3FBU A;  1I12 A;  2Q7B A;  2B5G B;  3EXN A;  5ISV A;  2ZPA A;  3TOA A;  2VZZ A;  2J8N A;  2B5G A;  1PU9 A;  1ON0 A;  4YFJ A;  5J8F A;  1YX0 A;  4HKF A;  1XF8 A;  3UY5 A;  1GHE A;  1M4I A;  2JLM A;  4MBU A;  4KOY A;  4C2X A;  4YRH A;  4CAV A;  1P4N A;  2WPW A;  4XNH B;  4QVT A;  3DSB A;  3KKW A;  4UCN A;  4KOU A;  4I49 A;  1Q2C A;  3W6X A;  4JD6 A;  5IV0 A;  1NMT A;  5AGE A;  5FVJ A;  2Z3P A;  3P2H A;  2CNS A;  4CYQ A;  3FNC A;  2ARH A;  5JPH A;  3LD2 A;  4XPL A;  5KTD A;  1VHS A;  3DNS A;  2CY2 A;  3CXP A;  2J8R A;  2I00 A;  2Q04 A;  2JDC A;  2B4D B;  4HNW B;  1KUV A;  2HV2 A;  4A30 A;  1XMT A;  4JLY A;  2C27 A;  2B4D A;  2BL1 A;  2KCW A;  4B5P B;  1YGH A;  5HH1 A;  4JXR A;  5IX3 A;  2DPT A;  5E96 A;  5F48 A;  3DDD A;  4KVM E;  2Q44 A;  4CAW A;  5AG6 A;  3D2P A;  4CS0 B;  4B5P A;  2QML A;  4B13 A;  1QSR A;  3P2F A;  3CXQ A;  4ONU A;  5A28 A;  4KOX A;  4F6A A;  2R1I A;  4GS4 A;  2CNT A;  4UBR A;  1S7N A;  1S7L A;  2R7H A;  4KSF A;  3TE4 A;  1SQH A;  1KUX A;  4YGO A;  2BUE A;  3MGD A;  2FIW A;  4KOW A;  1RO5 A;  4U5Y A;  4UWJ A;  2FIA A;  4Y49 B;  2PR1 A;  2REF A;  3D2M A;  1YVK A;  2I79 A;  5F49 A;  2ATR A;  4MFZ A;  4Q36 A;  4PK2 A;  2Z11 A;  4L8A A;  2ZW4 A;  4RS2 A;  1YVO A;  3GY9 A;  2QIR A;  2AJ6 A;  3A9L A;  4XPD B;  1L0C A;  2R8V A;  4A2Z A;  1S60 A;  5A27 A;  2FS5 A;  5EBV A;  4A95 A;  1WK4 A;  2Q0Y A;  3G8W A;  5DWM A;  1BOB A;  4Q38 A;  3TCV A;  3FYN A;  1CJW A;  2HQY A;  3SHP A;  1MJA A;  4NF1 A;  4KOT A;  1J4J A;  2JEV A;  3RYO A;  1QSO A;  4UCM A;  1YLE A;  4JWP A;  2O28 A;  4KLW A;  2FXF A;  4UFX A;  2YGW A;  4ZBG A;  4K30 A;  4U9Z A;  1R57 A;  4C7H A;  2R98 A;  2P6E A;  1Q2Y A;  2P0W A;  5G22 A;  2QEC A;  4B14 A;  5G21 A;  1XE4 A;  4MJ8 A;  2BSW A;  4OLL A;  1IYL A;  4II9 A;  5KTA A;  4ZGY B;  4OAD A;  2G3A A;  4IF5 A;  1MJB A;  1QST A;  2B4B A;  4FD6 A;  4JJX A;  3JVN A;  5DWN A;  2WUU A;  4DNC A;  2Q4V A;  4QC6 A;  2GE3 A;  1KZF A;  2YNC C;  4FD5 A;  5I0C A;  2ZW7 A;  1YK3 A;  3EO4 A;  3QB8 A;  1BO4 A;  2G3T A;  4CRZ B;  4U9Y A;  4BMH A;  2VQY A;  1OZP A;  4BBH A;  4UCP A;  4CGN A;  2Z0Z A;  4KS9 A;  2Z3M A;  3F8K A;  4UWI A;  3TTH A;  2VZY A;  4PSW A;  3TT2 A;  5F46 A;  4PSX A;  2X7B A;  2PRB A;  4H6Z A;  3F5B A;  4XPK A;  4C68 A;  4MY3 A;  4FD4 A;  1Z4E A;  3BJ7 A;  4R3L A;  2REE A;  5AG5 A;  3S6F A;  4NXY A;  4ORF A;  2DXQ A;  4UFW A;  3FXT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...